3FTGA

Crystal structure of h2db in complex with np366-n3a variant peptide from influenza
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
275
structure length
247
Chain Sequence
GPHSMRYFETAVSRPGLEEPRYISVGYVDNKEFVRFDSDAENPRYEPRAPWMEQEGPEYWERETQKAKGQEQWFRVSLRNLLGYYNQSAGGSHTLQQMSGCDLGSDWRLLRGYLQFAYEGRDYIALNEDLKTWTAADMAAQITRRKWEQSGAAEHYKAYLEGECVEWLHRYLKNGNATLLRTDSPKAHVTRCWALGFYPADITLTWQLELVETRPAGDGTFQKWASQNYTCRVYHEGLPEPLTLRWE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
publication title Protective efficacy of cross-reactive CD8+ T cells recognising mutant viral epitopes depends on peptide-MHC-I structural interactions and T cell activation threshold.
pubmed doi rcsb
source organism Mus musculus
total genus 59
structure length 247
sequence length 275
ec nomenclature
pdb deposition date 2009-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ftgA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3ftgA01
5CD5C 4UTBH 5D93C 5HYEA 4NQCB 4R90H 3T4YB 4XTRD 4UOJA 3MGTB 3UP1A 1U3HC 1J86A 1HILA 2BNQB 2CDEA 3HE6D 3IJHA 1E27B 32C2A 1M7IA 5A2LH 3RWHA 4D0CA 1QQDA 3S88H 3FQUB 4NPYA 2GK0B 3OR6A 1KJ3H 4F3FB 1JJUA 5E1HB 1RIHH 2VZUA 3EUUA 3FFCA 3O4LB 3O6ML 4XMLH 4X6CB 4Z0XB 2P8PA 1KENH 3V7MA 4YQXH 1DDHA 3GMRB 4WO4D 4KZDL 2D03L 2APXA 2RCSH 5KVGH 3MMEB 1FSKB 3DV4B 5EZJB 1D5MB 2YC1B 4P23C 5D2NE 2X4OB 5KS9F 5ACLA 5ERWB 4P59H 2CKBB 4AEIL 3WLWC 2OL3H 5CS7A 5T3ZD 1U3HD 1ZKAA 3TIEA 1DTUA 3S34L 1A7RH 4NFCA 5JPNB 1ZGLB 4LVHC 1KXQE 3P4OB 2IBBA 1DBAL 3BPCA 3O2DL 1NC4D 4P2RB 2X4NB 3FQRB 1YN7B 1KB5H 5HGBA 3REVB 1F11A 2PTTA 2E8YA 3FCTB 2C4FT 2DBJA 2JIXA 3OX8B 5TE4L 4IRZL 1JHTB 4XCFL 1H3UA 1J0YA 2ZJSH 1N0LA 1QBML 3M45A 2A9NH 3QDJB 4RA0C 3VRIA 2H2PD 2Y06L 3LKQB 4P23D 5KOMC 5F9WB 1BFOB 5DZNA 1D9KD 3CLEL 1F4XH 5A2IH 4PJ8D 4WENB 5KW9L 4RX4A 2GHWB 3IFPA 3OAYH 4JR9L 3B9KB 4G43B 4MXWL 4PRAA 4UT9H 5CP3A 4NQVB 5AYUL 4F2MA 3ULVC 1L7IH 3X3GL 5MENB 1QNZH 3VXRD 1GHFL 4IOFD 3NACL 3G08A 1BFVL 1VGKA 2H3NB 4KROB 4K94L 4N9GA 1S7XA 1ZHKB 4YHLH 4OZFG 1MLBA 3CUPA 4XHQA 3WFCL 1QHOA 1L7TH 4FXLA 3GGWB 4BKLB 5JLZA 3MJ9L 5C09B 2JCCA 4N0CC 3DIFA 5HI5C 1S5IL 4JKPH 1TVBB 1SEBB 3CK0L 5HJ3B 4JHAH 2FRGP 1KIRA 5TQ2L 2V2WB 3CMGA 1RK0B 3WDHA 4JFDB 1ADQA 3QDAA 4ONFH 5T3ZL 1F90H 3LD8C 2PYED 3O3AB 3QDGB 4U33A 4MDJA 1DQDL 2LE9A 3RNKB 5DK2B 1CFNB 1PJ9A 3G5YB 3JTTB 3U48A 4FMFA 2R23B 4RGMB 4LMQI 4M61B 4N0CD 4KK8C 2IBGA 2KUTA 2OTWB 3BP6A 4U6TA 1N5YH 5JQ6L 3WHXB 4ZAKD 3QIUB 3TNMA 1FGNH 3QEQB 1C5DA 3QDMD 1WTLA 1A1NB 4JFEB 1PX4A 4WRLA 4YWGL 3C09C 2EDJA 2DICA 3L7EB 4OKVB 5FIEA 1HH9A 3B5HA 5LQBH 1JF1A 3WIHH 2HRPL 4KAQH 4JKWA 4GJTB 5IW6B 1FLRH 4P46C 1W0WA 1HI6B 2YKLH 1EHAA 4Z7UF 4TVPE 3FB8A 4JG0H 4I3RL 5D2LE 5F6IC 1IMHC 1VKXB 5L2JB 5B39G 1E0OB 3CMOH 3KJ6H 1X5XA 4UV4L 3CXDH 4GBXB 5C0BE 3LS5L 4RMWA 1XF3B 2DM4A 5L0QB 1KLUB 2J88H 4PRPA 2X1QA 1YPZE 5CJOH 1LP9B 3Q5YA 5HDQH 5DHVH 4OLYL 2VLKA 5BV7B 4LBEA 1JPFB 3IDIA 4KHTH 5IB4B 2Y72A 1A9EB 2ICWB 3QUZD 3SDCA 2VLRB 4XP5H 1FO0H 4G9FA 1RIUL 3IRZA 4XGZA 4ODWA 3QRGL 4W6YB 4M6MH 3X11B 1F45A 1MREL 4QGYA 2PW1B 4NQDD 3OWEA 3KHOA 3GSNL 5DUBA 4ZD3H 3BPOB 2VLLA 5EUKB 3OKOA 4O02L 3GK8H 5IFAL 1G6RH 4J1UA 2P24A 1K8DA 1R5WA 4OFDA 5IMLB 2NY6D 5T1MA 2Z91A 3IETB 1FNSL 3LB6C 2FD6L 5GRYA 1UB6B 4GAJH 3V6ZB 3HI5H 2YRZA 2FEDD 4Q9CA 3L6FA 2EH8L 2ITCB 4RGND 5LXGL 1KIUA 3C5JB 3KPLA 1P1ZB 3RPKA 5JHDA 1QBLH 2VDPL 2FX8L 3CFDB 2OXHA 3QISA 4OLVH 3LPFA 2V5RA 2DYPD 4LCWB 1FAIH 4O2FB 2DM3A 5EC1A 2GQHA 5J8OA 3LKPB 4MQ7A 3GJFH 3D25A 2BERA 5C08D 1A6UH 1MCOH 3B43A 4HIHA 2ZCHL 3BW9A 5EZOH 4DQOH 1P84J 4YPGA 1LDPH 2Z93B 5IF0B 3E2HA 1EMTH 2XTJE 3O8XC 1FHGA 1VADB 5ISZA 1Y6MR 3STLA 2Q3AA 2DBLH 1EK3A 1WCBB 1JGLL 1CZ8H 4KI5E 5FHAH 1LK3H 3DX7B 1BQHB 2AS5M 2E27H 2FIKB 1OAYH 3H9HA 2GW5A 3HRPA 4GMTL 4ZODA 1HYSD 3MGOA 4XVTL 2COQA 1U8IB 4UT6H 3RVTD 4FRWA 3MOBL 2AKRB 5J12B 4FQQB 4MJ5A 4HFUH 4HC1A 2NXZD 4UDTB 3JWDL 1ZA3A 4HZLB 1MCFA 1EAPA 3LQZB 4HX1A 5DR5L 3WUWB 4G6KH 3WXWL 2I27N 4MMZC 3BGMA 5CJQH 1WFTA 2A6KB 3IXTA 5AZEL 3BX7C 5DJ8B 3OZ9L 3TBWB 2VZVA 2AW2A 2ADIA 4JQIL 5T1DH 3MNWB 3MUJA 1FIGL 3QCTL 5CGMA 1XR9A 4F9PA 4ZS7H 4OCLC 4ZO7A 4HF5L 5BRZE 3PGDB 2SEBB 1Q9WB 3FOMB 4QTHA 3CX5K 4HQQL 3U30C 5DUPL 1NCDL 4X80H 5HVHB 3TO4B 1JGVH 3BH8A 4GKNA 5IBLC 4H1LA 4RZCB 1OL0A 2DQCL 3GMQA 4JKKA 1I8LA 5DEFA 2MHAA 4ZUSA 4LKCA 4GKZB 4YHIA 5DJZA 3MUY1 4JPKL 4R0LB 2Y9RT 3S9DB 2LV4A 1DBML 4OGAD 1ZVYA 5FGRA 4L29B 4ZS6D 2P5WB 2HP4A 2BNUB 4NQSB 43C9B 2I26N 3QXDA 2GY7B 5E4EC 3N1GC 2Z92A 2W07A 5DURD 3T65B 2JB6B 4R7DB 5TFSL 3ARPA 1DN0A 1LVEA 5KAQG 1EERB 1KGCE 1ODAA 3JBG7 4I2XE 4QWWD 2WV3A 3DUUA 5DYOA 1AR1C 1G1CA 5A40E 2C1PB 2XOTA 5BS0A 3GMPA 2FJHA 4QRRB 3DBXA 4JHWH 1K3IA 4X99A 5DEZA 5FK9B 4QHNA 1HDMA 5ADOL 3LKOA 2I9TA 4G8GB 2CDGA 5CAYB 1KIPB 1ORSB 3QUKA 4F37F 4NOBA 2VR4A 5I73B 2J8HA 4L9LC 1P5VA 2GYSA 3RY5A 2Y6SC 2VDLH 2Z31C 1NAMH 4H20L 5FOBB 3RL2A 3MLYH 3PV6B 1R24B 2HLAA 3IFOB 4I0KA 4PJEE 3U7YH 3MLTB 1DQLH 1A0QH 4K7PX 3R8QA 2R2HA 1YECH 4WFFE 3F7VA 4IOSD 1JBJA 5JDSB 2HFGH 1R3HB 1UM5L 3R1GL 3RTQC 3QQ4B 4LIQE 4BSWA 2CIIB 4UNTA 1N64L 3SE9H 4HS6B 1IBGL 4KKAD 1HHJB 1GOHA 3B9VA 4MA1B 4EZMA 3VFVB 3QT2A 2OL3B 1AI1H 4QHKJ 3VXSA 1HCFX 4NWUH 4FOMA 1BOGB 4WEUD 4Q0XL 3V79C 1Y6NR 3NCCB 3QQ9C 1CD1A 5IKCB 1CDYA 2VIRA 4UBDD 2DLFH 5D70H 2APVA 3PQYA 5JR1L 4RWYH 4MVBA 1T0NA 5F7DA 1KB5B 3ROOB 2Z31D 4LSVL 1A64A 3IAQA 5KSAA 2EEBA 4JFOB 3VFUA 4F58L 4XWOC 3VFPA 2PXYA 1G0YR 3KPMB 1N6UA 4Q9QH 3ZHDA 3CFIC 5EU7E 2MNUA 3BIKB 3GI8L 3VD3A 4LPVA 1AFVH 3WUZA 4Z7WA 4IS6A 1E4WH 3SDAA 2A83B 1CXIA 1NLBL 2XZCL 1U8MB 4LVEA 4NCDA 4LEXH 1IEBA 1UQSA 5I71B 5TE7H 3U1SH 4W70A 1T6WA 1JMZA 1CLYL 2WQRA 4JN2B 4BH7B 1QSEE 1YN6B 4QXUL 2EICA 5DXWA 1ZVHA 3GSXB 3MV8E 1U8QB 1IGYA 4JPVH 5CEXA 4X6DA 2DQGL 3C8DA 3G5VA 3K8LA 3U6RB 3MACH 1RIVH 4GAYB 1XF2B 1U36A 3D2UD 4JRYB 4OI7A 1HQ4B 4MNQA 4NO3A 1RUAH 2W0FB 2OMBA 2BCKA 3RVUC 5E00B 5JNYB 1AJ7H 5I1EL 4JM2F 1TLKA 4HZAA 3SKJH 5HDLA 5D1QD 2X09A 3L5IA 4TSCH 2NY0C 4LSSH 4NRXB 2Y5TA 2B1HH 4PJ5E 3MRDA 5JOFA 3ZYIA 3KS0J 5FO7A 3L95A 5I1JH 1I9IH 4C83B 3T0EA 1ZA6B 3MNVB 4U0RC 4HWBA 1A3LH 3KNBB 4G8FA 4XNQA 3MRCA 5GGTL 4U1HB 5J3HD 1FNGB 1ZTXH 4KQ3H 4NDMB 1U6AH 4YIQB 1N59A 4FQPA 1INEL 4YXHL 3SDXB 2DMBA 4HKZB 2AK4E 4I77L 3UC0H 4XCYB 4AEHH 5IVZA 4P5TA 2DN7A 2DIBA 1QRND 3BEWB 2IMMA 2VL5A 3EDEA 5DMJB 5F9DC 5F89B 5GZOC 1IAKB 5GGUB 3F6LA 3B2UD 5DMKB 4ZTOH 1OY3B 3G6DL 3DVNB 1DBBL 1JK8A 3RU8L 2VRAA 5D6CB 5T1KD 2QQKL 4GAGH 1I1RA 4M7ZC 4RWHA 3TJHD 4A6YH 5SWSD 2HJKB 5I0ZA 3DTXB 3SBWA 2R69H 3CFCL 4U2ZA 5IVXA 1CR9H 3OKYA 1JV5B 1XIWA 1LMKA 4X9IA 5DVNA 5ENWB 5DHVB 4K9EC 4FA8A 1T2QH 4YBLB 2IPTH 5C6WH 3AREA 5EPMB 4UILL 1CYGA 1QLRB 4CJ1A 1FJ1B 3ME0A 4QTIH 3LMJL 1FO0B 4NHUE 3BKCH 4ACPA 1BJ1H 3BVNA 5FA4B 1MRFL 4LKXB 1F4YH 2HJFB 2KKQA 4KJYA 4L4VB 3D3VE 4YUEH 1GGUA 5EC2B 4NQEA 5K9QI 1G6RB 1OF2B 3Q1SL 3O2DA 4XCCH 1I8KA 4NQCE 2X4TB 3OKMA 4U1KB 1I7RB 1I4FB 2EXYC 4LVOB 4QHLB 3VXOB 3EOTL 1YEJL 3EFFB 1HIML 1CG9B 1Q72L 3C5ZD 4Z7QF 5F3BB 1CXHA 5ESAA 4ZFOL 2BNQE 4F7PA 3EHBD 2BNRB 2NYYC 4HUMB 5MEOB 4G7VH 5DJCB 4ZOBA 4LDEB 3LKNB 4X6CE 4KKNA 4TN9A 1A6TB 4RBPK 1PQZB 3GJFB 3L3DA 1MCEA 3ZDZF 4ETQB 5KVMC 5DQDH 5SWZD 4L8BA 1IEAB 3A67H 3MO1B 5IHUL 2BRQA 3FO1B 3QFJD 4X4YA 5EUOA 3EOBA 1DUYA 3MV11 4LHJB 3VGDA 5ID0A 4L3EB 1TETH 2ZSVB 3SDCC 1NDMA 5DJ6B 3BDBA 3S96B 2XV6B 4E41B 1IKFL 3MJ9A 4HJGA 5DA4A 4P5KA 2VLME 4P2RE 2W59A 3MCKA 5CCKH 5SWQB 4WTZA 3VU2A 3TBVA 4CVUA 4R4FL 1D7FA 4YZFF 2CMRL 4XP6H 4HS8L 1T1WB 1S7VB 4HK0A 4FQXA 5DI8A 3PHQB 4WY7L 2JB5L 3ESUF 3QDJE 2IANE 1I1FA 1RZGA 3UBXI 3QJHA 4NBXB 4ZPVB 1Z9OA 5DMGC 3VE0A 3QIWB 1MVFA 3L3GB 4HT1L 2IH3A 1HKLH 3WE6B 1IFHL 1FVCB 1V05A 4AYFA 2O5YH 5FKPA 3QUMH 1U93B 2DM2A 3PP3K 3T0AA 3VH8B 2C3VB 3VFNB 2V7NB 3WFDH 4NQUA 3P4NB 12E8H 1YY8A 4NZUL 4PJAB 1A14H 2UV3A 3TN0D 35C8L 4KY1L 3KYKH 1CL7I 4R9HA 2R2BA 2FYYA 5CWSA 1NFDF 1NC2D 5C09E 3ULSA 2ZUQC 5DMGD 4JRXD 3BDYH 4JFFB 2Q76A 4KTEL 3E2HC 4NO0B 1K5NB 5IR1B 1MFBH 1OPGL 3HPJB 4HCRH 4RGOL 3SJVA 5EBGA 3S8WA 4MWFA 4AM0A 5C07B 1LEKB 4HIEB 4JFDE 2ADGA 2ZCKH 5C0AB 2HWZL 4N0UA 4ZG1A 3HNVH 1TITA 2YD7A 5HI4C 2WZPD 1OM3L 2BSTB 4KJPC 3MRQB 3QQ3A 1OAQL 2P45B 4FFVD 3MV7D 1ZT7B 4WTWA 1I1AB 4FFEX 4GG8A 4JREC 2YUZA 4M43L 1IGIL 2XKNB 3SGJA 5FV2A 1R3LB 3W39A 3T2NL 4N5EA 4X98B 4U7KA 2WBJB 2D2OA 3GSNA 1W72A 3C60D 4NRYA 4WW1B 4JO1H 2D4DA 1IT9H 3B9AA 3QEQE 5GISH 4XNUL 4O2CA 3GSRA 3VRJB 5CKGA 3WD5H 1AQDB 1P7HL 1BF8A 5LVEA 2ZCLH 4F9PC 4MCZB 5DJDA 1OTSC 2MSPA 1NAMB 3Q0HA 5HPOA 3FTGA 4B5EA 1JWMA 4KJWD 3VRLF 3GJEA 1E4JA 5C71A 1IM3B 3UJIH 1FVEB 1CDHA 2EXWC 1OT1A 4BQ8A 1I8LC 4EN3D 4PJDB 4PB0L 5FA3A 5F88A 5JDJA 1LP9E 4HLZG 1EO8H 2CRIA 5E9DD 4Q2ZA 3P9WB 4WI4A 2VLRE 1KULA 3RVWD 4Q6YA 3W9DB 4WI8A 3V52L 4V1DD 2J6EH 3LDBB 1KCVL 1RZFL 4PRIA 3SQBA 3GSQB 1N8ZA 4K2UH 2HJLA 3GHBH 3WN5B 2OJZL 4JM4H 1AD0B 4J8RA 1S5HB 3G6JA 1H5BA 1M71A 1YJDC 2RBLA 1YEIL 4Y4HD 3UTPD 5HVGB 2WINB 3IDNB 3REWA 3CVHH 3EO1B 1JGEA 1LDSA 3TO2B 3WNKA 5BJTB 4RMSA 1ZS8A 4ZFGL 1RD6A 4PV8B 2FSEB 3A6CL 4NC1C 2NMSA 4P2CG 1GGTA 3OSKA 2JELL 4QRPA 3CH1A 1OGAD 1NPUA 4PR5B 4BSVB 4NBYB 2HVJB 3T0DA 1BIHA 2AQ2A 5D1ZA 2DL2A 4PG2A 4L4TA 4RMRA 1MY7A 3O0RH 1N3NB 1FFRA 1RMFH 1DEEA 1WEJL 2MQ0A 4AIZA 1NAKL 5C0FA 3UXFA 1MLCA 3RBGA 5JOPD 4NUJB 3L9RA 2FO4A 4LHUD 1RK1B 2BXYA 2MJWA 4J4PD 4MVBC 5ADPL 4TUKL 2F54B 4NT6A 5AD0A 3JVGA 1N5AA 5FKAB 5HYQA 3IKCA 2AK1L 5KSAC 1F3JB 2AP2A 1KT2A 2OXGA 1JYNA 1A6PA 2PXYC 4PRBA 2XQYG 1WWBX 1I7TA 1TZHA 3BFOA 4PJHE 2DM7A 2BHYA 2VITA 4TOYL 3HR6A 5DJAB 2PCPB 5EG6C 3SDAC 1Q9KA 4MXVF 4R7NB 4KKBD 5I17B 3P4MA 4PGBA 4FXGA 3ULUD 2FBJH 2R1WA 2HT3D 3TT3L 3HAEA 3KYMA 4EXPX 1Q0YH 2I24N 2A6IB 5F9OL 3GMOB 5I1KL 3DGGB 2ED7A 5TDNB 4KRNA 3UTSD 1KJVB 3TZVD 4KRPD 5HHVH 5TH2A 4FZ8H 2BJML 2GFBB 4M7JH 5DJ2B 4X7TB 3KR3H 4A6YB 3BMWA 4WUKH 3U79A 3L3HB 3QPQC 3ES6A 1NJ9A 5IFHL 3SO5A 3OKEB 4IHOB 3BPNC 3KPTA 2ZUWA 4M7KH 5JA9A 4JAMB 3R06B 5TDOB 2P5WE 5CSZA 3FRPG 4XAWH 1OP5H 1TJIH 4U05A 3PWUB 1MCWW 3VWKD 2Y07L 4XMKL 3ARSA 5FCUL 3F65A 2Y7QA 3WKMH 2A1WL 1HSAB 1UM4H 4LLUA 3T0EC 1EVUA 1UZ6E 2XFXB 2BC4A 2IAMD 5I1GL 3I85A 1R6VA 3UTQA 5DQJB 5IB2B 4WCYH 1CL7L 1UACH 4IMKA 1SQ2N 4OM0L 2ESVE 1JNLL 4NQXB 1E6JL 2NY4C 4TQEH 2CKNA 4G8GE 1NGWA 2VISA 4P5TC 1A7PL 2NX5A 1RFDL 4HDIB 1S3KH 4OGXH 1EDQA 3ARDD 4X6EB 4PP1D 5FF6B 3D85D 4OFVA 1SYVA 1EFXA 1MUJB 4JN1H 5KOVC 1T6VN 2C1OA 3NN8A 1QSFE 4MJIB 2GTZB 4Y19D 1PLGH 4EOWL 4EI6B 1N6QH 4OIBA 1ED3B 4JFPB 5IV2B 1U58A 4TRPL 2FLRT 1RHHB 3ULUL 3DYOA 5I15H 4KVNH 4OJFL 3DX9A 1BWMA 3SBWC 4MD5B 4LSPL 1RU9H 1XIWC 1EX0A 2DKUA 4JZOB 1MHCA 4ALAH 3SDDB 3S4SG 4NKMB 1OB1B 3AREC 5ID1B 4HWNA 2P8LB 4Z7VA 5JW5B 1LO0H 4KK5D 2NY1D 4TSBH 4PJBF 3RPIA 1CDUA 4FTVB 4ZPTA 5IM7A 4ZOAA 1U8PA 5DJ0A 5DMIL 3V0AC 4K8RL 3PWNA 4WWID 3NZ8A 3PGCB 4JZJA 3I2CH 2X4PA 3NIFE 3S35H 2VR9A 3FL7A 5F1IB 1AO7B 5L6YL 1C08B 4GXVL 4WI3A 1T4KB 5DD5H 4KI1A 3HC4H 1HSBB 5GGTA 1QBAA 3ULVF 4TSAH 2QQQA 2GAZB 4OV5B 3MLSL 1NCTA 1XGYL 3BP7A 5EZIL 3ARUA 2VDRH 5LCVH 3KPSD 1DBJL 1UB5A 3OKNB 4MSWA 2EIZB 2Q8AH 3F12B 3S6CA 4PBVC 2HN7B 1DQJA 1AQKL 2AAVA 3VFWA 2VLJB 3VW3L 3JTSB 4GG6B 5ANMB 4JRYE 1CBVL 5E6IA 3OAZK 3ECBB 5MHSE 3NCYP 2CLRB 5J13B 1MCPL 1IKNA 1TDQA 3QA3B 4MLIA 4MHHG 5GGVY 1WIPA 3OMZA 2EYSB 4JHZA 1II4E 5E2WL 4YXLH 4Z5RB 2DKMA 1HEZA 3QUXD 3QUYB 3NGBB 4K7PL 3UJTH 5BQ7B 4ZQKA 1OQOA 4HHAB 1H8OA 2YPKB 3GIZH 3HC0B 4PJHF 1AXTH 1TQCC 3VWJA 1BX2B 4FQXC 1HYRC 5T1LB 3RVXC 3RDTD 3SDXE 3F6IA 5CZXD 3CZFB 2OQJA 1H3GA 3NFSL 3GIVA 4E5XB 5J56B 3R4DA 1T7ZA 1BIIB 3FRUB 3VGFA 4UU9B 3CDFA 2J8OA 1BLNB 1YDPB 5DRWB 3MV9B 2GJZA 5T5FL 2IADB 2Z8WC 3IAPA 2HTLD 5HYFA 4OZFA 3L3JA 3HZKB 2H45A 2XZQL 1VENA 3CSYB 5A2JH 3RZCB 4M7LL 4ZFOA 2DQTH 3I6KA 4UIMA 5I8OH 5IW1B 3D69A 4LLWA 5F3HB 2QKIA 4LARH 2DDQH 4XH2A 3C6SA 2XZAL 1T89A 4BYHA 3MRRB 4OCRH 2P5ED 5E1AB 3ZL4L 2VC2H 3TYGL 5GHWH 1FGVL 2AJSL 5HHOA 5DC9B 2A74A 1JPTH 4Y4FD 1MFCH 3QR2A 4PGZA 2MPAL 4L4VE 1BQLL 3GRWH 1V5JA 2YD5A 4WV1B 3VGAC 1UH3A 1CD9B 1XGUA 3KXFB 2H9GB 1CDJA 3RHWK 3RUGF 3CVHB 5D5MB 2WANA 3OHXB 3SGJC 3EZ8A 1MCJA 4N5EC 1A5FH 4TUJA 5GGVH 4PLJD 1KCSH 1IGJB 4CVXA 2ICEA 1T1ZB 3HLAB 3X13B 1NGZB 1RSFA 3PWLB 3AB0B 1ZLUK 2BNRE 2IQAA 3M1BB 3C6LC 3FFCE 3MRNA 3EYFB 1N26A 4JFXA 2GCYA 2WWKO 3QI9A 5EOQL 1CLCA 1DBKL 1G7HB 2CGRH 1E6OL 2H6PB 2LVCA 4G9DB 3FT3A 5J57B 5K59E 4MNGE 1KEGH 2RGSA 1FL6A 5IHZB 2ZOKB 1BREA 2YSSB 3EZJB 4KDWA 1CI5A 1TJHH 15C8H 3UJJH 3P30L 1CN4A 5C0RL 1TCRB 3H0TB 4L3EE 1MWAL 4JJ5A 1U95B 4E41E 4YHOL 5FDWB 1HE7A 1Q1JL 2R4SH 2V2TA 3C6LD 5B4MC 1WTGT 1JUFA 5D93B 5CD3B 4WO4B 5ACMA 3RVVD 2QLVB 1T22B 2EYRA 5I19H 1JL8A 1EUTA 2VAJA 5H2BB 4HMCA 1H5BC 2QTEA 3LKRB 4AMKL 1KPUA 2H1PH 1MHEA 1RULH 3FB6B 3MJ7B 1XGQA 2VDML 2R9HD 1U3HB 3D0LB 4NSKA 1AKJA 2HG5A 1Q9LA 1QFUL 2IG2H 5JTWA 3H8NA 1S9VA 4OD1H 3ZYZA 5EO1B 3U7AA 4HUUB 1NC4B 3WDIA 5TE6H 3MLUL 3TH3T 4TVPL 1W0VB 3JWDC 4OQTH 4DJMA 3MRIA 5FYJU 2CK0H 3AXLA 5INDA 4DCQB 4PJAE 1TPXC 1RZJL 3SGEI 4GW1A 1C12B 1D6VH 5LWYH 3O2VL 3M8OH 4G6AC 4P23B 3C2AH 4PG2C 3CU1A 1QEWB 2JCCE 5FYJE 1D9KB 3H7BA 1J8HA 4PJ8B 5DK0A 4NZTL 1EXUB 2BY2A 4LLDB 4P57B 1MJJA 3BD4A 3QIBA 3BPLC 2D7TH 3VXRB 1AGEA 5F96L 4XI5C 1MCWM 2I9LA 4C56A 1IJ9A 2X2YA 3J7HA 3HE7A 5C07E 4JDVA 4QYOA 4DGYL 5HYSB 4Y8AA 5CEZH 4KVCH 1J87A 3JVGC 5CGTA 3EJZD 3BZFB 4ODUB 5JW4Q 4FMKA 1RUKL 1WITA 5ETUB 5GSRB 1T7YA 1XZ0B 1DVFD 4YK4C 3BKYH 3E6HB 3I50H 1KJMA 1V3KA 5FECB 5EBWB 5E99H 4KKLD 5F7EH 3X12B 4NFBA 2PW2B 4D9QE 3GM0A 4OCYL 3HR5A 3BSZL 4HUKB 1BBJA 4NJAH 4HIJA 5GRUL 5ITFB 2B2XH 4OZGF 2PO6D 2F53D 4MB5A 4Y5VA 1NGQL 3DSNA 5C6TH 4K3HA 1DLFH 3VFGL 2W0LA 1U3ZA 2UWEE 1G9ML 4WJ5B 2FX7L 4IDLA 3FONB 3GZKA 1MVUB 3GSVB 3AS0A 4XNYL 3VD9A 4GW5A 2UUDK 1CD0A 4X9BA 3EO9H 4OLZH 3V6OE 5IFJA 4ZAKB 1KC5H 3P9MB 1OAKH 1MFEL 5KSUA 3S36H 1YEKL 1X5HA 3PL6A 3DGCR 5HHPB 2DTMH 2GT9B 3QDMB 4HPOH 4RQQA 5ILTL 4PJDE 1GC1L 4CGTA 4KK6C 4QT5B 1B0GB 3G5ZA 3LS4H 3SCMA 3WNOA 4I4WA 3KPQB 3RL1B 2FJGA 3WLBA 4J3VA 5A3ID 5MI0B 3LD8B 4HXBL 5IROA 5J4MA 3OR7B 3MYJB 3RKDC 2VMFA 2ENYA 4PJ9D 3ZLQC 1EGJA 4ISVA 2WLZA 1VHPA 3BH9A 3U4BH 3FB5B 4YGVB 3BZEA 5I30L 2FO1A 1S9WA 2B39A 1UJTA 3FN9A 5F93C 4U1NA 1YY9D 4TTDC 4IMKC 3QUZB 5LAXB 2CUIA 3HPLA 5CP3H 1O0VA 2YD8A 4U1LB 3U0TB 3BUYA 4H5SB 1UKTA 4ENED 4JEGB 3SGKA 4NQDB 4P46B 1WQVT 5D1XD 3CFJB 2Q6WB 4LLYA 5IBTH 5D7JA 1GYAA 1QPPA 2B20A 4M1CD 4RISH 4H26B 5TQ0L 5KVEL 1Q94B 1HXYA 2NY6B 4M48H 5I18H 5I8CB 5EWIL 1HH6A 3WBDA 5C0DB 1MRDH 3IJYA 1Z5LB 4K9EH 4RGNB 5F8QC 1FRGH 1HOCB 4HG4J 3BHBB 2N1KA 4DN3H 1QVOB 5HDOA 4ODVL 2EDQA 5CZVH 5E8DL 4ZUVA 5B22A 2CIKB 5BCAA 2CJUL 4JKLA 3GMMA 2CH8A 2DYPB 4MDIB 2O26U 3WJLA 4RAUB 5EO0A 4Z76A 5D9SA 2F54E 4Z95L 2C7UB 1G7MA 4O51A 1VACB 3WNPA 4GH7B 5JW3H 1YNLH 5C08B 5E24E 1U8JB 3UZVB 4JZJC 4L8CB 1KBGL 4QRTA 1T1XA 2DLEA 5C0CD 1JPGB 4ZO8A 3QEHA 2MTPA 3BP5A 5HHME 4O9HH 1QLFA 3V4VL 3X14A 3T0VA 3VFRB 1LWRA 4Y89A 4RMUA 1OWWA 2DKSA 2NY5L 4U6YA 4P4KD 4PY7B 4D0BB 4MCYB 5IMMA 1J7VR 5DD6A 4LF3B 2HVKB 3KPRD 1KF9B 2EKJA 4XZUB 1LNUB 1Z0NA 5DVMA 1T7XA 4ZFFB 1FE8H 1SVCP 4LIQL 4YFDB 3QNXA 4WHTB 4AH2A 5ACZB 4LK4A 1NGYB 3Q6FB 1GIGL 2NR6D 2YZ1A 3IFLH 5CUSL 2JCCF 4OUUA 5F7KC 5D7IB 3ZE2E 1G7JB 2Y36L 4YHZL 4FZEH 3FT2A 3UZEA 3DYMA 2QQNL 2AJZB 5E6IC 5C0EA 4EI5A 5E5RB 4UQ2B 4R2GD 3QJFB 1IKNC 4DOHB 3TFKA 4HBCL 2OTUB 3C8KB 3FQNB 1SVZA 5JHLL 1OAUL 4N0YL 2EZ0C 4FS0A 1DLHB 4YDJB 4XCNA 5HD8D 4JO4L 3P2TA 3D39A 2B1AL 4MLSA 2ARJQ 3BXNB 2R15A 3LVEA 4K3DL 4YHPB 4X0KA 3EJYD 5J9PA 3VWJC 3LRHA 2YXFA 5I9QC 3DOSA 1YQVH 3D6GA 4WFGD 1D6EA 1JHLH 5BOZG 1HHIB 3CH8A 5CZKA 1EJOL 1KCUH 4YNYB 4NP4H 5DURB 2ZPKL 7FABH 1I9JH 4CADB 1BAFL 5KSBB 2OBGA 5IGXL 2R39A 5F72S 2A38A 4R8WL 5KG9A 2EYTB 1I9RL 1F4WL 4MJIE 1U8NA 3FN0H 3UTTB 1A3RH 4MNHA 2ATPA 2XNAB 3IAGC 3TEUA 1DFBH 43CAA 4M93C 1S7RA 4PJ7A 4TULH 3ZKND 4WW2A 4M6NL 2L7UA 1X7QB 1DSFH 1Q0XL 4NNPL 2XN9A 2NNAB 4Z7NF 1Y18A 1H9VA 1KN4H 1T89C 3BJLA 1URLA 3N85L 3MUHL 3UDWA 1KPVA 5B8CB 5GPRA 2KL6A 5IB3A 2BP3A 4ZUWB 2NW3B 5D7LD 2W9EL 3SE4A 5KBNC 2WNGA 3STBA 5I75C 3WCYA 2VDQH 3VXUD 3CC5A 4U6VH 3AS1A 2A6DB 4GXUN 2BK8A 1UFUA 1YMMA 2ICWI 5CP7A 1FL5B 4ONHA 4FQ1L 3O4LD 4M9PA 1P4BH 3T1FB 2BSRB 4FXKA 3HNSL 2ILLA 5IIEA 1RJLA 3SPVA 2WLYA 3T4AB 5IESL 2J4WL 4KUZL 1WAAE 5IB1B 5D6DA 1TVHB 2GSGA 1B4JL 3P3YA 1MIEL 4L9LB 4XXDA 2DQHL 2Z31B 3CDGA 3ARFA 1A6VL 1F58H 5DS8A 2XG4A 2ZOLB 4U3XA 5GS1A 2HFFA 3QI9C 3TCLA 5C1MB 3DECA 3LIZL 3V7AE 5DWUH 4B7IA 2VOTA 4RBPH 3KWWB 2HLFD 4NNYA 1A7OH 1MCLA 3O6LH 2VLJE 4L5FH 1A9BB 2P47B 5ANME 4GG6E 4OLWH 2Z8RA 1ONQA 2X4QA 1YC8A 5D2NA 3MRLA 4N8VB 1MQKH 4MA3B 5LGJA 2VL4A 1J1PH 3MREB 2ZKHH 3O41A 4JKMA 5C8JA 3HB3D 1CIUA 5T5NF 4Z7OF 4KHXH 2AXGA 2YD1A 4LASL 4P9HH 1QZ1A 2BDNL 4LFHG 3D2UB 1G1YA 1A4JB 5MEND 4GRWE 4M3JA 4KROD 5JIHA 2EC8A 3EOAA 4OGYH 4Y8DC 4ODHL 2VXQL 5D1QB 5L88L 1N7MH 4CRPA 4JDTH 2NCMA 2CDEB 1XFPA 3IJHB 1ZEAL 3KLAB 1PZ5B 1NMBL 4D0CB 3PXJA 4S0SD 4YDLB 3PP3H 3DRTA 4HPYH 3V95A 3MV9E 5JO5B 3NABH 4ODTL 4PTTA 5GGQL 2JK5A 3HRZA 3QNYA 3BKJL 2LU4A 1H15B 1NCUA 4JJHA 2CKBL 4YDVB 3IDXH 1MF2L 4U1GC 1K4CA 1ORQB 2AJUL 4LPTA 3VJ6A 2VZ3A 4U1MA 1IC7L 3QDGD 5C0JA 1LE5A 2C3XA 4MD4B 2F5AL 1IGFH 1QRNB 4GQ9H 3QIBC 2XA8H 1D5IH 2VQ1A 4G6JL 3M07A 5CHNB 5E6YA 1MFAH 1MHHA 4ONGH 3HE7C 2YD2A 3DUSA 4OT1L 4FQHB 4FNLL 4JFED 5CIPA 5T1KB 2JIXB 1J05A 3ZE0F 4XC1L 4G5ZL 5SWSB 5IT2H 4LDLB 1A6WH 3EYUH 3VRIB 1MWAA 4L8SB 4KJQC 3KXFE 5D5ME 2HKFH 1BM3L 1ZMYA 1JRHL 2DMKA 4W4NA 1NCAH 1OGTB 4GBXD 4QNPE 3QEGH 4QOKE 4F2MB 1IC5H 1KJ2A 4Y5VC 1MI5D 3G08B 1CXLA 5E8PA 4N9GB 5DRXB 5K9OA 3D9AL 5IEHB 4TPRH 1MLBB 2FGZA 3TH2T 5F6HJ 5H35A 1F13A 1G7QB 5JLZB 4S2SA 4AIXA 3NIDF 5D2LA 3DIFB 2BOCA 3MNZB 3RAJH 5EU6E 3PE9A 4HIXL 1MCDA 1A1MB 5C0BA 1GAFH 3PL6C 3C5ZB 1RZ7L 2PF6A 2X5PA 3VD4A 2HKHH 4Z0BL 3DMMA 5E03A 1YPZA 3TA3A 3SCMC 2EDKA 3DLQR 3QNZA 4Y1AD 1BJMA 3EO0B 3N1QC 4H0GA 4JDZA 3KLHD 1BZ9A 4L9DA 3V0WH 5HTSA 2IALB 3BIBX 3DXAE 4HWBH 4XBEL 5IROC 1NDGB 4GAFB 4YE4H 2JTDA 1ZVSA 2NXYC 5SWZB 3RWCB 4CVZB 1H3PL 4Z7WF 4LCWD 4HUWA 3QFJB 1PG7X 5T3ZE 5KZCD 2EDRA 3KAAA 3W0WD 3MROB 2X6MA 1B6DA 4EBQL 5J6HB 4V2BA 4KGLA 3E3QE 1AIFB 1WWCA 3VFSA 3SGKC 3IDJA 5HPMB 5IQ7H 4X6DF 4OBSA 2AEQL 5D7JC 1IGTB 3MUGA 4HV8B 3VH8G 4I48A 1RJYB 1T3FB 2VAAA 4OZIB 1IAOA 2ZP0T 3PIQA 3VDAA 3DROA 3O6MH 5BV7L 1RJCA 1PKQE 5KSVB 2VLKB 3SO3B 1HWGB 2E7CA 2OSLB 3IDIB 2VH5H 3QPXH 5I1IL 2OK0L 4X5WB 4NKIL 1FH5L 3SDCB 4MS8A 3SJVE 4NN6C 3G5XA 3VXRE 4AEIH 4LLAA 2FB4L 2CK2A 3WJLC 2PTVA 3S34H 1MHPL 4JY5L 2A2QT 1VB9A 4J1UB 2IGFH 2P24B 4DN4H 5D72H 5T1MB 2J8UB 1ZLSL 1NC2B 3NFPA 1TCMA 3TO4D 4XP4H 2VZTA 2XI9A 3ILPB 4LRNH 4XCFH 2ERJC 2VB5A 1Z6JT 1JIBA 2Y06H 4OD2B 3S37X 2DJSA 3PWVA 1DQQB 3CLEH 2Q1EA 3OF6A 1AGBA 1T5XB 2AJ3A 4C4KO 5KW9H 5EC1B 4ZXBD 2PYEE 3MV7B 4JR9H 1CLZL 3O3EA 4MQ7B 2A6JA 2XWJA 3QWRA 5BRZA 3K74B 5TPWH 1FG2B 2XPGB 5IMKA 5GGRA 5DSCB 5EBLA 4HWZA 1K6QL 4NGHH 5EU5B 4HIHB 3U82B 1E4KA 6FABL 1BFVH 2DQIL 2ZUQB 5IVXF 1H3WM 3O6FA 4YPGB 3ROLB 3C60B 4Y4KA 5GJSH 3CCHA 3QDME 2DOCA 3O9WA 4LNRB 4EI5C 4ERSL 2VWEC 4NOFA 1IAIM 5FUOL 1NFIA 4YEFA 3MJ9H 3DURB 2HTKC 4QRRD 3FRPA 4ZFZA 3GSOA 1RZ8A 1XGTA 3CLFL 4R96A 3H42H 4PREB 1R5VA 5TQ2H 3H9SD 4JREB 1ZT4A 5LBSH 1FYTA 5L8KB 2O5ZH 4GW4A 3CFBA 2B7DT 4YHMH 1ZA3B 1EAPB 1T5WA 5DK3A 4EN3B 4YDKL 3CVIH 1INDH 4I2XA 2WSKA 3ZSSA 1T2JA 1JF5A 3RGVA 3BAEH 3T2OA 2BOBB 3IXTB 4U1IA 4Y16D 1DQDH 1C1EL 4FQIL 5E9DB 4EI5D 4K8RC 3GUTA 4MJ6B 3EYOA 1J5OL 3INUL 2AI0L 1IVLA 4PJGE 4X7CC 4V1DB 1S7WB 2BVQA 2EO9A 3W9EA 1TZGL 2ARJA 3DO7B 3OXRB 5CILH 2GSIA 1N0XH 4QHUB 4QTHB 1NCBH 4NQDE 5DJYA 5INCA 5TF0A 3LCYA 2ZUXA 2IPKA 2R4RL 3FMGL 2G9HA 4YWGH 3PWJA 4Y4HB 1J9CT 3C2SA 1QFWM 4K3JH 4Z78A 5I76A 3U9PL 3MRFB 1U2HA 5D7KD 1QO3A 2HRPH 1ACZA 3GMQB 5DEFB 1FNLA 4PJEA 2MHAB 4LKCB 4PUBL 4YHIB 5SV3A 2XA3A 2I5YL 4M62L 4WW2C 5FYKD 3E1F1 1S9YA 4FQ2H 5FUCC 4BSJA 4XPFL 5BZWA 4RGNE 4WI7A 1EAJA 3S4SA 1UWEH 1FCGA 4HWUA 3LS5H 5HHXL 3UDWC 4Y2DA 2D0HA 3IVKA 4QRSA 5EOCJ 2X4UA 4OLYH 2FECI 1HINH 1W2KT 2EH7H 1OGAB 2H8PA 3WNLA 2EDLA 2ZUYA 3KYOA 3UBXB 3GBNH 2R0KH 3SE4C 2Z9TA 5SX5K 4R90L 4MA7H 4N90D 2YZ8A 1ROWA 5ALBH 5C08E 1QACA 3QRGH 3ARQA 5T5NG 1J18A 1R3IH 1MREH 4XRCA 2YEZA 3L5WA 1U2CA 1W72H 1HDMB 3OV6A 3LKOB 4O02H 3ARBA 4YBQC 4LHUB 5HYJD 4WI5A 1BGXL 3S88L 3QUKB 5TGBB 5D6DC 1RIHL 4XMLL 1FIEA 1B0WA 3QXWA 3PDOA 1TENA 4F37K 3THMH 1IM9A 3ARFC 3MPCA 4YQXL 4WNQA 5KVGL 5GS0C 3FB7B 1UGNA 4PRHD 4GRMA 3MV8A 5GS1C 1UWXK 4MXQA 2P43B 1CICA 4P59L 2NPLX 3MLVL 4UNUA 4NN5B 3AS3A 5GIRA 1A7RL 5HGHA 4KMQA 1FZMB 4XP1H 3SKMA 3VG9C 3OAZH 2VUOA 1Q8MA 1CD1B 5D2NC 2VIRB 3RWIA 4YHYC 5E7BA 3PQYB 1KB5L 5DRZB 4PGDA 4X4XA 2OZ4H 3EDDA 4LCUA 4NRZB 1G9NH 1EEUA 1FVDA 3U46B 3VGBA 5KSAB 3VFUB 2W92A 2IBZY 4LHQB 3VFPB 5I8KH 3UTSB 4LMQE 3TZVB 4QLRA 2ZJSL 1C16A 1JGLH 2A9NL 4OF3A 5C9JB 1YEEL 3DX6B 4S0TD 3AU1B 1F4XL 3SE8L 4XVTH 5LKNA 2OR8A 1T04A 4JO3H 4BZ1H 1RJZA 3NCFB 4QCIB 3WXVH 4GFTB 5E95B 4DFIA 1MH5B 4UT9L 1A6AB 2MCG1 1F6AA 3I75B 4MAYD 1EHXA 1QNZL 3JWDH 4QY8B 2AK4A 1X5JA 5BOPA 3TVMD 3VWKB 2V9RA 1ACYH 4OFYA 4DGIH 4YHLL 3MFFB 5AZEH 3WEXB 1IGCH 5CEXB 3OZ9H 3G5VB 1L7TL 5KSBE 1FIGH 2IAMB 2IPUG 3QRFM 4JKPL 4HF5H 2GKIA 2L7JA 3GSWB 4APQA 1MCQA 1KYOJ 3DARA 2C5DC 1NCDH 1YNTB 4W6WB 2NY2C 4UTAH 1EVTC 2Y5TB 5IHLB 3D85B 4ONFL 1ZV5A 1F90L 4RFEA 1K4DA 2CRYA 5FFLA 1HHHA 3Q48A 4PPTA 1DBMH 3RX8A 2XQYK 1FAKT 3ARZA 3G6JF 4NHUA 3OJDA 1AXSA 3AMLA 4G8FB 4XNQB 1S7TB 3MRCB 3VXPB 4OIIH 4G8EA 5MP6H 1WBXA 4YBHA 5J6GB 3KJ4C 4IRSD 1N5YL 3D3VA 1XGRB 5TFSH 1N59B 2IH1B 5K9KB 3NH7L 5EORL 3EYQD 4OB5H 2XQBL 3UO1H 5KANI 2NY4B 4NQCA 3UYPA 4P2OD 4P5TB 3T4YA 4R97B 1UH4A 3WIHL 5KN5A 5MEQB 5FHBL 4CN1A 3ZDYF 3IXAB 3HA0A 3CSPA 1K85A 2BRRL 1FLRL 5DDHB 2E3VA 2YKLL 3AMKA 1ZLUH 4JG0L 2BNQA 5F8RC 1JK8B 1E27A 3CMOL 3KJ6L 1LK2A 1I85A 1NSNL 4RDQF 3BD3A 3CXDL 3JWNC 2VXTH 4I0PD 3JV6A 1BVKB 1QUNA 5D96C 4QHMA 4R4BA 4PJXB 4X6CA 3E6FA 4K3EH 5CJOL 3KPNB 1LO3H 3EGSA 4OF0A 1SJHA 1XIWB 3GMRA 4KHTL 3V7AG 3HUJB 1I8MB 3DV4A 4XP5L 3RBSA 5EZJA 3P9LB 3MC0A 3BN9D 1FO0L 2YC1A 1RZJC 2X4OA 5ERWA 2CKBA 1UM5H 4M6ML 4M4RA 4I0CC 3OKLB 4N0RA 5DHYA 3TA3C 3ZO0A 5JW4R 3BVNB 5J11C 1IC4H 4JQVA 4ZD3L 1FYHB 4FQCH 3GK8L 1G6RL 3QXAA 4JHBA 1NMAH 2KPNA 4YHKH 4P2RA 2X4NA 1YN7A 2N56A 1UH2A 4Y5XB 1L9NA 4H88H 3FCTA 4FP8H 1A7NH 4GAJL 4NCC1 2HMID 3HI5L 1YA5A 1JVKA 4HW6A 4F58H 5J1SC 4LU5L 3SKOB 1JHTA 4TNVF 1LD9A 3L5XL 4UAOC 1QBLL 1T83A 4EXKA 3QDJA 2IANA 3LKQA 2XZZA 3KPOA 4TNWF 5ESAB 2QSQA 1K8IA 4OLVL 1AD9B 1AGFA 1PD6A 1BFOA 3QUXB 4LEOB 1EBPA 2XWBB 4JFFD 5DZOA 2L0DA 4Y88A 1NLBH 1BD2D 4WEBH 2R29H 3B9KA 4K7FA 1PGRB 2NY3C 2VDNH 1A6UL 1T7VA 4J3UA 3V5DB 5EZOL 4DQOL 2H3NA 5C0AD 3J8F7 2WK2A 3MOAL 1T0MB 1LDPL 1ZHKA 1EMTL 4YXKH 1UEYA 3RDTB 5EUOB 2DBLL 1NLDL 1JNHB 3HNTH 1CZ8L 3SHSA 2BY3A 5C09A 1LK3L 1QRNE 1NDMB 2E27L 4MS8C 4PY8J 1UENA 5GJTH 1TVBA 1SEBA 4P5KB 2XTJC 5HJ3A 3LKSB 4WHCA 1RQ5A 1ZHLA 1Z2KA 4UT6L 2YBRA 2V2WA 1RK0A 4KI5C 4HFUL 1YUHB 4JFDA 4HIIA 4NM8H 1GC1C 4BUGA 1TQCB 1FC1A 4BFIB 5ICZA 5SWSE 5CJQL 3WKNA 5DUML 2BFVL 1I1FB 1RZGB 2YD4A 3L3KB 3RNKA 5T1DL 5DK2A 1ND0B 1CFNA 3JTTA 3P0GB 2P5EB 2R23A 5DO2C 4M61A 4ZS7L 2OTWA 4KV5E 3I3BA 3IDYC 2FBOJ 3WHXA 3QIUA 3P77B 3PP4L 5F9JA 3QEQA 1GGCH 4JM2D 2YD3A 4Y4FB 2IFFL 1YY8B 1A1NA 4X80L 4YGAB 1JGVL 4HAGA 2EE9A 2PR4H 5ESVB 4OKVA 5FYJL 2YA2A 4BFGA 1SJEB 2R2BB 4HKXA 1B2WH 1HI6A 5T33L 2VQUA 1E4KC 1VKXA 1AR2A 3G6DH 3RI5F 3O6FC 5L2JA 3UAJC 2V5SA 2Q76B 1G7PA 4Y4KC 4XMPH 2DQJL 2QQKH 1XF3A 3O9WC 2PNDA 2OLDA 4Z7VF 1UKSA 4UUJB 1LP9A 3I6LD 2WY3A 4N0UB 4YJZL 1TQBC 2H2SD 5EDXA 1A9EA 2VLRA 3QQ3B 3MRPB 1CGUA 4G8IA 2BSSB 3QXUA 4YO0A 1CXEA 3LMJH 2PW1A 5SWZE 4JHWL 3VMPA 1MRFH 5H37G 4LPWA 5EUKA 3QFJE 1MPAH 1W72B 5IMLA 3RGVC 4J23A 5GZNC 1KLGB 4O2CB 3GSRB 3Q1SH 3IETA 1AGDB 1UB6A 2VDLL 3V6ZA 1NAML 3C6LB 2ITCA 3EOTH 3MLYL 4OI8A 4PJCB 1YEJH 2GY5A 1P1ZA 1WFNA 3QWOA 4OZFH 5B21A 3U7YL 4EKXA 3GSUB 1DQLL 1Q72H 3UTZA 1I1CA 3FTGB 4WDIA 1JWMB 3CFDA 5CJ8A 4YAQA 1CE1L 2CLZB 2HFGL 5KVDH 4G7YH 1KV3A 3SE9L 2NY5C 4F7EB 4OZIE 4O2FA 1ZHBB 1AI1L 1F6LL 3LKPA 4QO1A 4NWUL 4IDJH 5FA3B 3BQUA 2OR9H 3T0BA 5GZND 5D70L 4RWYL 3IKKA 2EIEA 4K71B 4DTGH 2V7HA 3SQOL 4H8WH 2AJXL 2JF1A 2Z93A 5IF0A 4Z6AT 4C56E 4Y2DC 4PRIB 4OAWB 1CFQB 2HJLB 4LVNB 1WCBA 3FQWA 5HSFA 1KCGC 4IOIB 1WCQA 1H5BB 1M71B 1AFVL 3ARYA 2FIKA 5IVOA 3MTRA 2D4FA 1ES0B 4CKVX 1E4WL 4KZEH 2G60H 3WSQH 2J8UE 4XT1C 1U8IA 4F80A 4LEXL 1JGEB 3LPGA 4XHJD 2AKRA 3NAAH 4JRXE 5EU7C 5TE7L 3U1SL 1Z3GH 3IGAA 4R4FH 1CVRA 2CMRH 1WC7B 4PJHA 1UVQB 3ARBC 2WWKT 3LQZA 2EKSB 3WUWA 4PB9H 2MMXA 5GGSY 4EJ1C 4AJ0A 4JPVL 1T66C 3TBWA 4OF6A 2Y5EA 4HT1H 3MACL 1TPXB 3MNWA 5JQHC 1WWWX 3CH1B 2WM0A 3STZB 3T2QA 2YMXH 3Q5TA 4YEEA 3MV7E 2HA1A 1PG7L 3PGDA 1DVFB 2SEBA 5EFIB 1RUAL 1Q9WA 3FOMA 4MXQC 4L4TB 1G0DA 1X5GA 1CICC 1AJ7L 2MWCA 3SKJL 1DEEB 2P49B 4TSCL 2R0ZH 4AIZB 5E2VH 3ILQD 2BVOA 4LSSL 5FEBA 5C0FB 4CNIB 2B1HL 35C8H 4RZCA 5JA8B 3BPLB 2F53B 4KY1H 2NLJB 2DWDA 5I1JL 1I9IL 1ETZB 4L3CB 3V6FB 4EVNB 5AD0B 5HYQB 4L29A 1MJUH 2P5WA 1A3LL 1KOAA 2GJJA 4XCEA 2O93L 2BNUA 4NQSA 1OPGH 1QSED 1ZTXL 4RGOH 3T0XA 3VFOB 1DE4B 4KQ3L 4YK4B 3T65A 2JB6A 1U6AL 1TZHB 3F58H 3W11D 4IJ3C 4F7TA 2VITB 5JORB 4J3OC 3VI4F 3UC0L 1CDCA 4AEHL 1OM3H 1B9ZA 1U8LB 4FG6C 3RFZC 4GQPH 1IQWH 4BJLA 3R0MA 4POUB 5E9DE 1E28B 1IGIH 3P4MB 4PGBB 3PHOB 3RY4A 4D9LH 2R1WB 2ESVA 1JWSA 4ZTOL 4V1DE 4G8GA 1YMHB 1KIPA 1ORSA 4LOUC 4PJ5D 1M7DA 4XNUH 2DWEB 2GUOB 4KK9D 4PJ9B 4HKBB 1RI8A 4U7SA 3UTPE 4XPTH 3WO3B 2R69L 2B5IC 4FTVD 4FN0A 1QSFA 1CR9L 3T09A 5FUZH 1R24A 5CBAA 1T2QL 4APQC 3V9FA 2Z0BA 3GFUA 2AERT 5JDSA 1R3HA 3QQ4A 1AO7D 1EEYB 2CIIA 3BKCL 1XGPB 2A0LD 4HH9B 4HS6A 1S7UA 1HHJA 5CSZB 3KYAA 3BE1H 5D1XB 4V3DB 1FORL 5EOCL 1YZZA 1BOGA 2XWTA 4YUEL 4JFHD 4LOUD 4OFYD 5IKCA 2Y7QB 2ED9A 1A1OB 4ZUUB 3ZE1E 1QFHA 1OGAE 1L8JA 3LSOB 4XCCL 1X4XA 1KB5A 3ROOA 5B3JF 3UTQB 4JFOA 3ZKMD 3KPMA 3PG2A 3LRSA 2OJZH 3JZ7A 3BIKA 2BVTA 1MELA 3I3EA 1IEHA 3N50A 3NZHH 5JOPE 1NGWB 2W38A 4G7VL 1S8DB 2A83A 1U8MA 1J0JA 4NZJA 4WI6A 1JTOA 4JY4A 1IAIL 5JUEH 3QDHA 1CLOH 3OPZH 4XP9L 3ZHKA 1WBYA 4HKJA 4JN2A 5HGDB 4ZFGH 4I5BA 1I85C 1U8OA 2QADC 3GSXA 3A67L 1U8QA 5C0CB 2N4IA 1GGIH 3LEVL 2J1KA 2Y23A 3GDBA 3MLXH 5F9AC 3U6RA 4Q9RL 1HXMB 4GAYA 4DKFH 4D8PB 1TETL 1MHCB 4JRYA 1HQ4A 1F3RB 4P4KB 2VJXA 4Z8FH 2W0FA 4URTB 2EDTA 5CCKL 4XB7A 5EULV 2Q86B 3ULUE 3KPRB 5I1CL 3BGFC 1D3CA 4P9MH 4ZPTB 2YRLA 5HY9A 1KIQA 4JQVC 5AUMB 1QYGH 3NCYS 1OP5K 2MOVA 4XP6L 4PDCE 3PWNB 3BZ4B 5EIVA 1WLHA 3UTSE 2LAGB 1EGJH 1H8NA 2VDOH 2M1KA 4C83A 4I18B 4GLRH 5ADPH 1YEDB 4TUKH 3OKKB 1PYWB 3TYFB 1WFUA 3ALWA 2FR4A 1ZA6A 1KB9J 3MNVA 1HKLL 2AK1H 3AGVA 1CF8H 4PJIB 5HHNB 3RZCD 2O5YL 4B0MM 2E6QA 3K81A 4EIZC 2XKUA 1T83C 4NDMA 1QHPA 4YIQA 5MERA 4F33A 3WFDL 3SDXA 1SBBA 1NCWL 4HKZA 4IBLT 2Z8SA 3BWUC 5JIKA 4KMTL 5L2KD 4XCYA 1A14L 3K2MC 5CGYC 2NZ9D 1RY7B 4O58L 1UB5B 3B9KC 4ZMAT 1SEQL 3KYKL 1U8HA 1MCSA 2OP4H 3B2VH 5F89A 3WIHA 1IAKA 5GGUA 4QGTA 4LQ1A 3DVNA 5C0ND 3IFNL 5FO8A 5D6CA 1JTTA 1K3ZA 3AC0A 1MFBL 1EIBA 4HCRL 3BIAX 5JXED 3L1OH 2HJKA 3DTXA 1G0XA 3QBTB 4ELMB 3QH3A 2AABH 2ZCKL 1JV5A 3TBYB 2YUVA 3HNVL 5ENWA 4BELD 4F15B 5KAQF 4ZOEA 5EPMA 1QLRA 2AV7A 4Y19E 2CDFB 4E0RA 5FA4A 1YMME 4LKXA 1RURH 5TF1H 3RIFF 4L4VA 2Y07H 4XMKH 4JO1L 5I1LB 2E6JA 5EC2A 3HG1D 5GISL 1IT9L 2A73B 2YD6A 1OF2A 1X5KA 2YPLD 3WD5L 3P0YH 1JWUB 1UXSB 4JPWL 3BRDA 4RGMC 2CO7B 5I1GH 2ZCLL 1I7RA 1I4FA 4MX7A 4EDXB 4M1DL 4QHLA 3VXOA 3W2DH 2NY7H 4OCSH 2ADFH 3QIUC 2QSCH 1IZJA 3BT2L 3EFFA 1CG9A 5D7LB 5F3BA 5B38B 1E6JH 3L3JB 4OZFB 3VXUB 2X9YA 2FHBA 5LGHH 2BNRA 3HCVB 3DYPA 3UJIL 5D71H 1VERA 4L8DA 4M93B 3I6KB 2RB8A 3NIGF 1NGXA 1PSKH 5DJCA 2QKIB 1WT5A 4PJXE 5CD5D 1A6TA 4EIGB 1JCKA 4MNGA 1EO8L 1FZOB 1PQZA 4EOWH 3WDJA 3HUJE 4MAUL 1IEAA 3MO1A 4D3CH 3ARGA 4XPGH 5L0QC 1BHGA 3FO1A 4OJFH 4XNXH 5HHOB 2GJ6D 1A02N 1NL0H 4K2UL 3GHBL 2A74B 4HG4K 2QR0B 3KPSE 5BV7C 5I75B 4L3EA 4LPXA 3TJEH 2ZSVA 1P2CB 4E41A 1NBQA 4HFWA 4WUUD 5BVJB 3CVHL 3MSPA 1QR1A 5SWQA 3HS0B 5FYKH 5J1TC 3PWPD 1KCRH 2L4OA 5I1DB 1WF5A 1DEDA 1T20A 1P53A 4M5ZH 3WLWD 2AGJH 4HGWB 4JG1L 4WGWB 5I8EB 2LVEA 4GXVH 1CFVH 3QIWA 4LLVB 3L3GA 3WE6A 1TXKA 1FVCA 3MRNB 3G9VA 4JFXB 1KCLA 1U93A 3QI9B 5B39B 3OJMB 3VH8A 2C3VA 4BK4A 4EUPG 5E2UH 2V7NA 3GMNB 2WWMC 1XGYH 3MLWL 3P4NA 4PRDA 1PBYA 1R3KB 3O0RL 2G75B 1BPVA 4PJAA 4PJFE 3QHTC 4HSQA 4FABL 1U92B 3TT1H 3QHZH 3BQUC 4DWHA 3CDCA 1AQKH 3VW3H 2WBKA 1QG3A 1CBVH 4JJ5B 1NANH 1KXVC 2R2EB 1M6OB 4NO0A 2DJ4A 3CU7A 1AHWA 2XICA 3HPJA 1XF5B 3H9ZA 3UROR 1LGVA 5GRVK 3ULVD 1TIUA 5C07A 4HIEA 5E2WH 3KS0H 1MHEB 2X89D 3CDYA 5BMFH 2EE2A 2YS4A 1XGQB 4GMSH 2BSTA 3MRQA 4OLXH 1ZT7A 1I1AA 3TPUE 1AKJB 2HG5B 4YFLF 1Q9LB 4IM8A 5J12C 2OX5A 2XKNA 5HI5D 2FBJL 1OSZB 1R3LA 2P5EE 2V5YA 3TBSA 2WBJA 2I60H 2Z35A 3MRIB 5GS0H 4BQ6A 3AXLB 4PS4H 1OTTC 5HHVL 4FZ8L 1QLEH 1AGCB 2AEWA 1AXIB 1AQDA 1D5XB 4M1GH 4M7JL 4DUWA 1AC6A 1C5CH 3ESVF 4ORZC 4PV9B 1QOKA 4U1GB 3KR3L 2UWEA 2X70A 3DETC 3C8HA 4WUKL 4UIKL 4CMHC 4PJ7F 1NFKA 4MCZA 4Q97A 1EO5A 4WW2F 5T5FH 3H7BB 5BXFB 3LQAL 2ZG1A 5DK0B 1UJ3B 4M7KL 5HVHC 1WK0A 1B6UA 4Z9KB 2VXVH 3QG6A 3VG0H 3V6OA 1MJJB 4KK8D 2XYCA 3QIBB 5GGSB 4JFYB 1TJIL 1FQ9C 1AGEB 1CGSH 1MI5B 4PJDA 3HE7B 2W60B 4QYOB 4QXTA 1ZWIB 2UVFA 3WKML 2OR7A 1U91B 1P4IH 2Z4QB 1P9MA 1BBDL 5DJXB 1GXEA 4M8VA 1OAXL 3RWFB 1CFTA 3ZL4H 5HGGS 3TYGH 5DFTA 2R56H 1M05B 4P46D 3SN6N 2AJSH 3GSQA 4WCYL 1BQSA 1UACL 3WN5A 4XPBH 5C86A 1AD0A 1V3JA 4A2LA 2R0LH 2ITDB 3HR5B 1BBJB 4QRUB 4OGXL 4HIJB 1P7QD 5DGQA 1JZ4A 3MRMB 3QEUB 4U3HA 4Y1AB 4Y5VB 3RP1A 3TO2A 1X5YA 5BJTA 5ELIA 1DQTA 5BO1L 4UZGA 3BEVB 1ZANH 4HGMA 1PLGL 4PJCE 4M7LT 1MCHA 5I73C 3FKUS 4XVUC 1KNOB 4LSQH 3VFMA 5KZCB 1FFPA 4NHCH 1RU9L 5KSUB 3W0WB 3PL6B 4BSVA 2HVJA 4RQQB 4ALAL 5ITBH 4XNZB 5JPMA 4MGXA 3TV3H 5FXCH 4U2YA 3LB6D 4I4WB 5EBMA 2D3VA 1N3NA 4NKDA 4TSBL 2E8ZA 3AUVA 2FX9H 3MXVH 3CXHK 3DI3B 4G80B 1GZQA 4ZTPH 5BVPL 1RK1A 3I2CL 3QQNA 5T3XD 2NXYB 4ISVB 5SX5H 2F54A 4R26H 3BZEB 5FKAA 1C5BL 1Q1JH 1XF4B 4GRLC 1F3JA 5DD5L 3ZTJG 2DS4A 2ZG3A 4BM7A 4O2EB 5DD0H 4HULB 4MB3A 4TSAL 4QXGH 4AG4H 4UQ3B 5HHMA 1EZVY 5DJAA 1KJ2H 2PCPA 2VDRL 5LCVL 2OI9A 3O8XD 3Q3GB 5KJRH 1HQRB 4LLYB 4R7NA 2Q8AL 3TNNB 5I71C 2ZUTA 1IQDA 5I17A 5F71A 1HXYB 4X6FB 1DCLA 2W65B 2RFXB 4NZDA 4NKOB 2MQ3A 4TVPH 2A6IA 1HH6B 1UWXH 3GMOA 4GRLD 3DGGA 2DLGA 5TDNA 4N9OB 4HLZH 3EYVA 3MBEC 4MJ2A 2GFBA 4YXLL 3O2VH 5KS9B 3RWDA 1V7ML 1LO5B 3L3HA 2F53E 1JN6B 2E9BA 4C58B 3LOWA 1VSCA 1FG9C 3ELAT 3UJTL 5ICYB 1EEZA 3OKEA 4IHOA 4ZXBB 4Z76B 2DI9A 4JFZL 1LO2H 4JAMA 1G7MB 5HGAB 5GSVB 5TDOA 3LHPL 1MAML 1AXTL 3V4PH 2JJTA 2ZSWB 5F96H 1FYTE 2FZ3B 3PWUA 1BFSA 5K9QG 4ZUTB 4N5UA 2PETA 3MBXH 5IBLD 5DC4B 3MBED 2ERJB 3UTTD 4L4JA 3LN5A 1KUMA 1I3RB 1RUKH 1W8NA 5DQJA 3VXMD 5IB2A 5IMMB 3H3BC 2E7LE 1UA6H 4NQXA 3F7YB 3TIDB 3H9SB 4XXCA 1PDKA 5GRUH 5IBUB 4X6EA 5FF6A 1O5DT 5I8OL 5HHQB 1BF2A 5D2LF 1GPOH 2X9WA 3QXTA 1KEMH 4HBQA 4LARL 4TUOB 2WIIB 2DDQL 2DIAA 4MJIA 2GTZA 1I75A 4OZHE 1T0PB 4Y16B 4EI6A 1ED3A 4EI5B 4JFPA 5IV2A 1AR1D 4OCRL 5I2IA 4HLJA 1RHHA 1YPZF 2VC2L 4P0DA 5GHWL 3HZMB 1JI1A 3O11A 4WTXA 4MD5A 1I1YA 4I9WD 5IB5A 4XCNB 4JZOA 4QF1B 3SGDH 3HMXH 1JNJA 3RWJB 3SDDA 4YBLC 4NKMA 3GRWL 1JZ5A 4IRJA 2P8LA 5F7YC 5JW5A 3U9UB 2Y6SD 4QXWA 1FNAA 1GL4B 5L7XH 5J9PB 1FBIL 5HI3C 5JZ7C 1A5FL 2GITB 4Q9BA 5GGVL 3R8BB 3UBXG 3UEZA 3D0VA 1KCSL 3PGCA 4WWKA 5DFVC 1JGUH 2LTQB 3DRQB 5E94A 1J0ZA 3OB0K 4C4KT 3QB7C 2ARWA 3RTQD 5F1IA 4XBPA 1C08A 2C3GA 3WIFB 4LVOC 1T4KA 2X40A 1CT8B 3QQ9D 1WAAA 4MQTB 3CFEB 4NFDA 2CGRL 2GAZA 4OV5A 4HUVA 4LCIL 5KG9B 1I7ZB 4OCNC 3E8UH 1X6NA 4MNHB 5HDBE 2CD0A 3BP4A 43CAB 1TJHL 1S7RB 4XWOD 1OQXA 3BUTA 4Z7UB 2LU7A 5C0CE 5CEZD 3OKNA 2EIZA 4JFQA 15C8L 3F12A 4KXZH 1WT5C 3UJJL 5TQ0H 2W9DL 2XN9B 4K23H 5HYJB 4KWUA 5E6ZA 2F58H 4JCLA 4AT6B 2VLJA 3S5LG 3JTSA 2CXKA 5ANMA 4GG6A 2PYFB 1JHKH 4FQJL 1JFQL 4KUCF 2EC9U 3ARGC 2R4SL 4PBXA 1NMCB 3UCRA 3B5GA 3KPRE 3QA3A 5IB3B 4KI5F 3FQTA 5I19L 4PRHB 3DSFL 3CC5B 2P1YA 2EIDA 4JZNB 2H1PL 2BVUA 3QUYA 1TJGH 3QULA 3RX7A 4ONHB 3FFCD 1PY9A 5BQ7A 2V5TA 3P73A 5C7XH 5I1AB 1RUML 5BW7A 3OXSA 2W0PA 2IG2L 4OD1L 2JLLA 3U4AA 4MQXC 2BVPB 2VTFA 5IIEB 2YPKA 1I7UA 3SPVB 5IUSA 2FWOB 5TE6L 3RVUD 3FQXA 1KBGH 2B4CL 2GSGB 5T1LA 1ERNA 4UB0H 4B7LA 2WUCH 4OQTL 4N68A 2CK0L 4XXDB 3RGHA 2NY0D 1OCWL 2VXSL 4H0HB 3CZFA 3QIWC 4Y5YB 5L9DH 3B3IB 1ZHNB 4E5XA 2HT4C 2D7OA 1QD0A 1BIIA 1D6VL 1KTDA 5FGCB 3M8OL 4ETYA 5KVFH 3TCLB 3B9DA 4UU9A 5IOPB 1YDPA 3MV9A 2QL1A 2IADA 1KG0A 8FABB 3HZKA 2JIXD 4JGJA 4D2NA 1ONQB 3CSYA 1HN1A 2KBGA 4O4YH 5JW4M 4WFGE 1PEZA 2YUWA 3MRLB 2D7TL 4P2QE 4MAYB 1GIGH 1FFQA 5F3HA 3FZUC 5CUSH 1MFDH 1FPTH 3TVMB 2F5BH 4ELME 2QSTA 4YHZH 5CEZL 4BK5A 5I6XB 5D8JH 4RX4D 2QQNH 2OTPA 4EQ3A 2AXGB 4BQBA 3MRRA 3MRGA 1AHWC 1GGBL 5E1AA 1U8KB 4D94A 5GZOD 3BKYL 3C9NB 3NVQA 3H3KA 5F7EL 2YD9A 4S1SH 3IB4A 4WV1A 1I1AC 2O5XL 2B2XL 4U6HA 3KXFA 5F1NB 3UYRH 4K3DH 3CVHA 5D5MA 5C6TL 3OHXA 1DLFL 1MCBA 5IQ9B 4D0DB 3DRTB 2WBJC 3ZDXE 2GTWA 3BGAA 1IGJA 1T1ZA 3HLAA 3X13A 5D7LE 4QOKA 1NGZA 4YC2B 4PTTB 3TWCH 1VFAB 3VXUE 1ZSDB 1OSPH 1A4KB 5J89A 3BRGC 1SYSB 3M1BA 4IRSB 4OLZL 2V6HA 4YR6B 1UM6L 4LPCA 4PJEF 1OHQA 3O4LE 4NC2B 4YLQT 3EYFA 2X4RA 3MA7A 5JIIA 4U1MB 4HPOL 4RCAA 5C0JB 4LSUH 3T3ME 3HHRB 3IF1A 1G7HA 4P2OB 3CFKB 3LS4L 3NCJH 3V6OC 2EXYD 5M7QA 2CUMA 3MYZA 5EU6A 4LCYB 2UZIH 3AS2A 4LSRL 4XPHH 4FQLH 4ELKA 1MHHB 1Q0XH 3HE6A 4ZSOB 2XY1A 2NYYD 3QAZC 5EN2A 3JWOC 1P9MC 3G9AB 2D7PA 4I0PB 3N85H 1FV1B 3U4BL 1S78C 5BZDB 5FO9B 5F21B 3DXAA 5F7HA 5CD3A 4WO4A 1KTRL 1D5ZA 4X8JB 3WN5C 4Y2OA 2W9EH 5ESQA 4S1DC 2YWZA 5H2BA 3VDBA 3LKRA 2Q20A 1NBYB 2AEPH 3FB6A 3V2AR 3HMWH 2E9WA 4PRPD 2QQLL 3EYSL 1L6XA 3D0LA 1KJ2B 4KQ4H 5IBTL 2VLKD 5HVWA 4DVRH 4RISL 1YC7A 4B41A 3MZTA 5EO1A 3SDCD 5DFWH 1NC4A 3DV6B 3VXNB 5I18L 3E3QA 4NUGH 4G9FD 3HFML 5HDBF 4RMTA 5H35B 1B4JH 1W0VA 5D96B 5MENE 1MIEH 1F8TH 3QZWB 1MRDL 4OTXH 4S2SB 2EDXA 4HJ0C 1DANT 5D2LB 4K9EL 1NUGA 5EZLB 2BOCB 3MR9B 1A6VH 3S7GA 3U0WH 1NBVH 1F3DJ 5DRNB 4BH8A 1B4RA 5C0BB 4DN3L 1C12A 3LIZH 1IGML 1QEWA 1XMWA 1PKQA 5AG9A 2W9LA 1D9KA 3TA3B 3K2UL 4PJ8A 1BD2B 4JB9H 3IDGB 3RWGA 1EXUA 4LLDA 4JDZB 2EDDA 5JHDD 1YNLL 1M4KA 4IIQA 3VXRA 5EOTA 1ZVSB 3PF2A 4M8QA 3GB7B 3RZWA 3QDGE 3O6KH 3BZFA 5FYLD 5ECJE 4ODUA 2BDNH 3KDMB 5ETUA 3PNWB 1XZ0A 3VXQB 4M4PA 5JOEA 3GI9L 3E6HA 1MQ8A 4OFKA 4I3GA 3X12A 1R5IB 1OTUC 5I74B 2CRMA 2VXQH 1FE8L 2OI9C 5L88H 3TGXA 4UINH 5ISZD 5C2BL 4JFEE 5ITFA 4CJ0A 3IFLL 1ZEAH 1Y6KR 1B88A 3O4OC 3WS6A 4M5YH 5HI4D 2PYEA 3BKMH 3GHEH 5SX4H 4FZEL 2WUBL 4WJ5A 3LN4B 5LGKA 4KJPD 1MVUA 3GSVA 4CU8A 3MRHB 3CIQA 2RR3A 3BKJH 3VD7A 4F7CB 4ZAKA 3P9MA 2AJUH 2XTJB 3G5XB 1QKZH 1KYOK 5HHMD 4JM2B 1S7SB 1IC7H 2GT9A 3QDMA 3RIAF 1MI5E 4W4OA 2YA0A 1A21A 2YN5A 1YEGH 1YYLL 4ZDHB 3OKDB 4QT5A 1B0GA 2IBZX 2YPVH 7CGTA 3KPQA 1OWRM 1RUQL 3NOIA 4ZYKB 4QRQA 3IDUA 3H9YA 2JJTC 3TH4T 1OTSD 4UDUB 1OD7A 1YQVL 4OT1H 3OR7A 5DZLA 1JHLL 2CLVB 4Q58C 1GJIA 1DL7H 2EXWD 4XC1H 3FB5A 4YGVA 1FNHA 3P4LA 2VE6B 1A47A 4XBGB 2RHEA 4Y1AE 3QUZA 1AGBB 2FATH 1JRHH 4IMLA 4PJGA 4WHDA 2AXFB 3V5HB 2A6JB 1SM3H 3FN0L 4XXCC 1A3RL 3U0TA 5BRZB 4J2XA 4H5SA 4RNRA 1DFBL 5FM4A 2J5LB 5EBLB 3IDMB 4HWZB 4NQDA 4RAVB 4X6CF 2Q6WA 4LCWE 4FFYH 5TDPB 1FN4B 3C5SB 1R3JB 4R6UA 1KN4L 3W0WE 3OG4B 3CCHB 3UPRA 4J3SA 5I8CA 3GNML 1A22B 4GXUM 4NBZB 1L0YA 2R0WH 3U36A 4OM1H 5C0DA 3U83A 4ODBD 5BS0D 4C59B 1Z5LA 1XGTB 4DZ8B 1HOCA 4R96B 2HAZA 4OZ4B 3BHBA 1QVOA 2HRLA 1AE6L 1R5VB 2VDQL 4R4NC 4U6VL 1CU4H 2DQEH 3SDDC 4Z0BH 5I1HH 4OD3H 4IRJC 4Q6IB 4RFOL 3VI3E 4GKOA 2DYPA 4MDIA 4L1HA 1P4BL 1SY6H 4RAUA 4XC3H 4RFNC 5CINL 5DT1L 1FNFA 2C7UA 1RV6X 1VACA 3K4DA 4I2XB 3V5KB 1T1YB 2VQTA 5C08A 3RX5A 1U8JA 2P7TA 4WWKC 3GUTB 4L8CA 1H3TA 5FB8B 3KGRA 3L7FB 2BVQB 2EEDA 3VXSD 1F58L 2GSIB 3LH2H 5DJYB 1JYVA 4NJ9H 1EV2E 4BZ2H 3WL9B 2FJFB 2IPKB 3CX2A 3PQYD 4PY7A 2G9HB 4V3EB 4MCYA 4G6MH 4MVBD 5DWUL 4EBQH 5I76B 4Z78B 4LF3A 1WJ3A 4OLEA 1S7QB 3JXAA 4L5FL 1LNUA 4XVSH 1UXWA 4OLWL 5KSAD 4ZFFA 5C9KA 4JPIB 1E4XH 2PXYD 2BMKB 1S9YB 3NCBB 4WHTA 5ACZA 1IILE 3Q6FA 2PKDA 5BZWB 4LPYA 4HK3N 1F5WA 4LP4A 3S4SB 2HT2C 2ZKHL 3RWEB 1G7JA 1H0DB 3SDAD 5KS9E 2B0SH 3NPZB 4Y2DB 3FJTA 5BV7H 2AJZA 1J1XL 4P9HL 3QJFA 1K2DB 3FN3A 4NO2A 1KLFA 4P5MB 3KYOB 3GKWH 2OK0H 1FH5H 4GO6B 4AQOA 3FQNA 4LP5A 1KELL 1DLHA 4YDJA 3WJJA 3HI1B 1HZHH 1MAKA 4OGYL 3QUYC 5EO9B 5K9JL 3FO9B 5J06A 1N7ML 4JDTL 5ABDE 5BW7C 1MHPH 3BXNA 3GRWA 3VGEA 3BI9X 4YHPA 2C4FU 3MCLL 2H32A 4MNQD 1XR8B 3QPQD 5GS2D 4OLUH 1TFHA 1CD8A 4QRRE 4HPYL 3D18B 4LLMB 3NABL 3AROA 3PDOB 4X6BB 4W6XB 1RUPH 3ULVH 4LCCB 3G6AB 4WNQB 1QSEB 4WU7B 4YNYA 2DQUH 3H9SE 3IDXL 3MV8B 4J6RH 2WAHA 2VDKL 5JMOC 3T0ED 5KSBA 4XNMB 4KKCC 4WFHD 5GIRB 3MJ8B 3U2SB 1IGFL 2EYTA 4UT7L 1ZT1B 4LAQH 2XNAA 4GQ9L 5CBEB 2QEJA 3O3DB 4P3DA 3RWIB 1TTFA 1NFDB 2XA8L 1D5IL 1UC6A 3FHAA 1LP9F 4DEPB 6FABH 1MFAL 4ONGL 4X4XB 4LCUB 2NNAA 3NPSB 2NY4D 2LFGA 4PJ5B 4P5TD 5FYKU 1DUZA 2VSDA 4ERSH 1HNGA 4AK1A 5B8CA 5IT2L 1C16B 4UI2A 3EYUL 3B83A 5D7KE 3WFZA 1T03H 4LGRB 4NZRH 4ZUWA 3GMLA 2NW3A 1FZKA 5IJVB 1NCAL 5FYKE 2X9XA 4JO2L 2A6DA 1ZGLM 4XPAL 3QEGL 4WV1C 1Y0LB 3NA9L 1F6AB 1LO4H 1RVFL 3RNQB 2DIJA 3O3BB 4HUXA 4NNXB 2AK4B 3T1FA 2BSRA 4YDKH 1XIWD 4NYLB 3SDYH 1MRCL 2DQFB 3ARXA 3T4AA 4TPRL 4OBRA 3ARED 5IB1A 1A7QL 3QUMB 2MCPH 3INUH 2AI0H 4N90E 4YDIH 1MIMH 4FFWC 4OQTA 2K7PA 3BJ91 3BISA 3RAJL 5IWLA 1GAFL 1GZPA 4Z7UE 2Q7NA 4APQB 2HKHL 2X4SB 4NQED 3LAFA 1NGPL 1ZAGA 2UYLB 5HYJE 3PXHA 2ATKA 5J7CC 1FZJA 4XTRC 1A9BA 3LN9A 2Y4SA 2EECA 4K94C 1FDLL 5EU4B 4RFEB 1K4DB 4M62H 4U6XA 3V0WL 1OARH 1UYWH 4HWBL 4N8VA 3HE6C 4MA3A 4NHUB 4PRHE 1DR9A 2DD8H 3HZYA 1S9KC 5HHXH 3B6SA 4AZ8A 3D3VB 3MRJA 4KRLB 4PGEB 4WO4C 4YHNB 1D5BB 3D2UA 1A4JA 4NKQB 4DKEH 2OCFD 2FLBT 4Z77B 5KN5B 3FOLB 5EU6D 2WW8A 1VEMA 3B9EA 5D1QA 5IQ7L 5M94B 1OOAA 3H7LA 3ZT6A 1I8IA 5T3XH 3KLAA 1PZ5A 1LK2B 1ZLVH 4EUPA 5E4IA 2QADB 1BGXH 3E3QC 5DTFA 5FGCE 3JV6B 4ORGA 4QHMB 4R4BB 1EHLH 1SBSH 3E6FB 5JO5A 2CO6B 3DXAD 3V0VB 4X5XA 4A2MA 3EGSB 2F15A 4FHBD 1NQBA 1SJHB 4JY6B 2VH5L 3QPXL 2AV1B 1H15A 4YDVA 4FQXD 3VXTB 2H2PC 1ORQA 4MA8H 1HK6A 2HFEB 1GOFA 2DQDL 3BGFB 1RHFA 3MLVH 4PTUB 4KH2A 5DHYB 1D9KC 3RVXD 2NTFB 1XCTA 1IL1B 4PJ8C 2K7QA 2Q7YA 3HI6L 4MD4A 4PLKC 5L2KB 3QO0B 4HS3A 4JE4B 1QRNA 2H26B 3P0VH 3LQAC 3QXAB 5C0IB 2IGFL 4DN4L 5D72L 3FFDA 4IIQC 4IOFC 3MQIA 5CHNA 1N4XH 2GI7A 1MNUH 4FQHA 1G84A 4XP4L 3N1MC 5T1KA 1UZ6F 3TBTA 5C0GB 4LRNL 1HHGB 1LD9B 3TJHA 2DLIA 5SWSA 3EDFA 2BY1A 2IANB 3KPOB 4L8SA 1YEEH 4TNVK 1AY1L 2F74B 1K8IB 2OYPA 1AGFB 4Q74A 3UPAA 3QFDB 4YX2L 3SE8H 4PLKD 4TNWK 3F62A 4WHYG 2FCBA 4UOW1 1MCCA 2YHGA 5CMAB 1OGTA 1F42A 5TPWL 4K7FB 3SJVD 3L5HA 4NGHL 3ZKXB 2NW2B 1A2YB 4OCXL 3WS6C 1NEUA 4AIOA 5DRXA 1LEIB 5B38G 5IEHA 3HG1B 5GJSL 5JXAH 2K3TA 2YPLB 4DAGL 1G7QA 1JPSH 3R0NA 1QP1A 1CTNA 2G2RB 2KH2B 2HFTA 3MNZA 4N5ED 4ZAKC 4BA8A 3H42L 1A1MA 5CLTA 1QA9B 3C5ZA 1ZHLB 3B5TA 4W4OC 2YBRB 3NCMA 1OW0A 4ZSOE 5LBSL 4HIIB 4XWGH 1WIOA 2O5ZL 2VZ1A 4MZ3A 4YHML 3CVIL 3EO0A 1INDL 5ICZB 5MI0C 2IALA 3BAEL 1L0XA 1NDGA 3NIFF 2VKXA 1BQUA 5SWZA 3RWCA 4ODSL 4CVZA 3C08L 1TZIB 3QFJA 3MA9H 5EIIB 5CILL 2GJ6B 1N0XL 3AY4A 5F9JB 1NCBL 3MROA 3NH7H 5EORH 1DP0A 2XQBH 5EA0H 5LJYH 3QUZC 1ULVA 3L3OB 1FFOA 1JPST 1NUNB 3ZHLA 5J6HA 4K3JL 4WUUB 2ADJA 1JGDB 1X4ZA 1AIFA 3P11H 5FHBH 3SKUD 5B4MD 4PRID 2BRRH 4HKXB 1G7IB 5GQBA 5HPMA 3PWPB 2LU3A 3MFGB 4FQ2L 3WV0A 1IGTA 2I07B 2R8SL 4HV8A 4KDVA 5E5MA 3DX8A 1NSNH 1RJYA 1I3UA 1G7PB 1T3FA 1UWEL 2NY6C 3ET9F 1P6AB 5D1ZC 4OZIA 3RI5K 1JNNH 2XXCB 2BVEA 1X5AA 3S3SA 4H25B 2ICWJ 5KSVA 4JFFE 4R3SB 2FEDC 5GRZA 1HINL 4LVHB 2EH7L 4RGNC 2OSLA 1BD2E 3I6GB 4X5WA 3GBNL 2R0KL 1IZKA 4MA7L 4U1SA 1NEZB 4E42B 1TVDA 4P3CH 4HWEH 4G8IB 5ALBL 4YO0B 5ALCH 2VXUH 4PJBB 1R3IL 4J12A 1OP3H 3SOBH 1F6FB 5C0AE 3SKNB 4QRPD 1W72L 3TN0A 1YEHH 2VABB 3WFHA 4G6AD 1KN2H 2J8UA 5D1ZD 3V8OA 1YQ2A 3S97C 2X1OA 5DF0A 1NC2A 4L4TD 5EU3B 1VGEH 2V9TA 4JRXA 3SDXF 1KB9K 1J10A 4JANA 3ILPA 1WBZB 2KDGA 3THML 5AZ2H 4LU5H 4NN7C 3L5XH 3QWOB 1G6VK 4P4RA 3UTZB 5H94A 4WDIB 4OD2A 3OAUH 4XI5D 4YAQB 3TM6A 3VMNA 1DQQA 3OBAA 1HYSC 1T5XA 3LV3A 3ZKSD 4U1JB 3MV7A 3JUYA 3RVTC 1U3YA 4XP1L 1FG2A 2XPGA 3Q2CA 4HJJH 5AWNH 5DSCA 3BQUB 4UOW0 5IVNA 2P8MB 5EU5A 2NXZC 5F7LB 2V7HB 3K3QA 2OZ4L 5H8DA 1CGYA 3MOAH 1G9NL 3ROLA 1B0RB 3C60A 1XH3B 1YYML 3WMSA 3O45B 3BWAA 3EJJX 5I8KL 4LNRA 5FM5M 1J8KA 1NLDH 1YNKH 4N1EA 3FQWB 4N1CA 1VPOL 2M8XA 3LEYH 3DURA 3I9GH 4PP2A 1KTLB 4PREA 2V2XA 3WJJC 2OM5A 5GRJL 4JO3L 4BZ1L 3HC3H 5IG7A 4PLNC 5E2TL 3WXVL 4D9RD 3IGAB 4LSTL 4PJHB 3L3IB 3WS3B 3W5MA 1GH7A 5I16B 4EN3A 2AJVL 1WZ1H 3I6LE 5DUMH 2BFVH 1ACYL 4DGIL 2BOBA 1IGCL 4OGAC 3C09B 4KK6D 2ORBH 5E9DA 1XT5A 2A9ML 4MJ6A 3EW3B 4ZS6C 5FAAA 3SEPA 5F1OB 4V1DA 1S7WA 4J3XA 4CMHB 3DO7A 3OXRA 3VFTB 4QHUA 3PP4H 5F6IB 2IFFH 5K59F 2KQNA 1I3VA 3RKDD 3QO1B 4UTAL 2BVOB 4Y4HA 4QWWC 5FYJH 2PUQT 1P7QB 3MRFA 1ITCA 3HZVA 1OVZA 3PJSB 2DWDB 3WFBL 1SMAA 5T33H 4LLQB 4TTDD 4KMLB 1CK0H 4HD9A 4BQ9A 1WIUA 3GO1L 5IK3B 4XCEB 5SV4A 1ADQH 2NX5D 2DQJH 4OIIL 2NQCA 5MP6L 2X41A 3DVFA 2DB8A 5CJXA 5B8CC 1EFXD 2HH0H 4OB5L 1OGAA 4F7TB 2QHRH 1PG7W 3UO1L 1CE6B 1P4LB 1J1OH 3UBXA 4ODXA 1BQHG 5E56A 5DQ9B 3KVQA 1PKOA 2CSPA 3IT8D 3MRBB 3OB0H 1Q9OB 4S11A 3RUGB 4KKAC 1QSVA 2ESVB 2JJVA 1JWSB 3I84A 4NM4H 4LQFL 4LHUA 1UADC 4UBDC 4Z7QE 3WUWG 5TGBA 1M7DB 1OAZL 1ZLWK 2VXTL 4CUCA 1A6ZB 4J4PA 3DI2B 4K3EL 3N1FC 2UVEA 4CW1B 4PJAF 1LO3L 2B4CC 1QSFB 5CEYB 3QCVL 5IWLC 3FB7A 5CBAB 3FO2B 3MLZH 3QG7H 1INQB 4MD0B 2VN4A 4RIRB 2G5BA 1CE1H 3S5LA 1VEOA 3MRKA 3ZDZE 5E70A 1S7UB 1H3XA 5D7SH 3VCLA 3O8XB 1IC4L 4PRNB 1BZ7A 4FQCL 1FZMA 4G6FB