3FTGA

Crystal structure of h2db in complex with np366-n3a variant peptide from influenza
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
275
structure length
247
Chain Sequence
GPHSMRYFETAVSRPGLEEPRYISVGYVDNKEFVRFDSDAENPRYEPRAPWMEQEGPEYWERETQKAKGQEQWFRVSLRNLLGYYNQSAGGSHTLQQMSGCDLGSDWRLLRGYLQFAYEGRDYIALNEDLKTWTAADMAAQITRRKWEQSGAAEHYKAYLEGECVEWLHRYLKNGNATLLRTDSPKAHVTRCWALGFYPADITLTWQLELVETRPAGDGTFQKWASQNYTCRVYHEGLPEPLTLRWE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Protective efficacy of cross-reactive CD8+ T cells recognising mutant viral epitopes depends on peptide-MHC-I structural interactions and T cell activation threshold.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
total genus 59
structure length 247
sequence length 275
ec nomenclature
pdb deposition date 2009-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ftgA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3ftgA01
5LWYH 3EOBA 3K8LA 5D7JA 5IVXF 5TH2A 2LTQB 3TBVB 1KLGA 1Z9SA 3ULVF 5ISZE 1R5WB 1NEUA 5F1NA 1G9MH 5D1ZB 1F11B 5E4IA 3FB7B 3HNVH 4PRPA 3BD3A 5J1SC 1BGXH 1INQB 4U49A 1J1OL 2R56L 3H8NA 5IV2A 3SY0A 5T1LB 1T20B 2R1WA 4MNHA 4N0CA 1RZJL 4HJ0C 1T21A 1PSKH 3KS0J 1U8NA 3O11B 1MFEL 3QEQE 1PG7H 4FZEH 4KROC 1S9VB 3KPTA 3GSXA 3HCVA 3GSUB 2OZ4H 3BPNB 1U8PB 1Q9LA 4Z7WB 1EAPB 3ZHLA 1BF8A 1U2CA 4G8EA 3ZE0F 3LKRB 3DVNA 1JF5A 4TSBH 5D96C 1QSZA 3L7EB 1T04A 3SE8L 4J4PA 3CMOH 4G9DB 4O2CB 1IM3B 1GGUA 1SJEA 1NCBL 1BJ8A 3RWFA 1O5DT 3FAWA 4R3SB 4HGWA 2XTJB 1JHLL 4WW2C 5FO8A 3TNMB 2BVOB 5HHMA 1MCSA 4KTYA 4KXZI 4OCSH 5ICXA 4K7FB 2VN4A 1EAPA 5CJ8A 4JFOB 4TRPH 5DURD 3T4YA 1BZ7A 2BY2A 3CH8A 3CH1A 1JGDA 1XGPB 3P4OA 1R0AL 1FNEA 2ZPKL 1HHGA 5IMOB 2AEIT 4XCCH 4G9FA 3OJ2C 3FO0L 3H2WA 3QUYC 3RPIA 1GOFA 2XWJB 4WU5A 1MQ8A 4QXTB 4OZFB 2JE8A 4CMHB 5IB1A 4HCRL 4BZ1H 3SDAD 1I85A 1T5XB 3WUWG 12E8L 2IQAA 3WJLA 5EU7C 5FO8B 3D9AL 2EYTB 2FECI 3CZJA 5HDQH 1TLKA 5IB3A 1F3DH 1YN6B 2V5MA 2ORBH 5DS8A 3BPOB 3WFCL 3HR5A 4G5ZL 1R24A 3MRNA 4TSBL 4KZEH 3PP4H 4G7YH 3PWUA 4MHHI 3ZKSD 5CP3H 3TESA 4S1SH 2OZ4L 4ODHL 1G0DA 2RIKA 4YH6A 5J6GA 3G6AB 4P2YA 1ZHLB 4G8GA 4GFTB 3PV6B 2R23A 4R8WL 4QRRA 1NSNH 5ID1A 5C2BH 2YD7A 4RMQA 3WIIL 2HFGL 5DD3H 3P4NA 3TBYA 4Y5XB 3DGGB 4JEGB 4S0TD 1RUAL 3EFDL 3SDXA 4WWID 1JK8B 1KG0B 3TVMA 3WIIH 4D0DB 4K8RH 5BV7H 4PJ8D 5EUOA 4ZUSB 2LAGB 2BOBB 3MJ7B 3GJFK 4YFLF 3I2CH 2FX8L 2OXHA 4QT5B 4KV5F 2XQYK 4E41B 5K9JL 2DICA 4WCYL 5DGRA 4KDVA 1QRKA 4XPHH 4U1KA 5GRJL 5SX4H 2N4IA 2GTZB 3BOVA 2E7LC 5JOEA 5IBLC 4ELKA 4ODHH 2FJGB 2UVEA 1K2DB 1OTTD 3O6FB 4HIJA 3UJJH 5KVGH 1W8OA 3X3FH 2V2TB 1MCEA 4KZEL 3KPNB 2Q3AA 4JKKA 5DRXA 3V6OE 4WFED 1L4IA 2VO5A 2H8PA 4MAUL 2G75A 1ZHBA 5T3XE 5BJTA 1E4WL 2OL3H 3PHSA 1N6VA 4P2RE 4IIQA 2UV3A 4OD1H 4WENB 4WGVB 12E8H 5MI0B 4PJEE 3QDHA 5H37H 32C2B 4PJXA 3DXAE 3O9WD 4XC3L 3TPUA 3T77B 5K9QG 4Q9RH 2OX5A 5F7FA 3FO0H 3QI9D 2VH5H 2BOCA 3LRSB 2WINB 5D1QC 3O3DB 4XCCL 4LSVL 4F33A 1CLYH 1R0AH 2WMPA 3VWJB 2N1KA 4NKDA 3EDJA 3QI9B 1N0LA 3NCCB 4NJAL 5IF0A 2VTFA 3WUWA 3LQZB 4GW1B 2R1XB 3MMEB 2ZG2A 4OFKA 4PBWD 1J5OL 5JLZB 2DL9A 5KS9B 3LZFH 1VSCA 3FONB 5T5FH 2EH8H 1CFNA 1A4KA 1YEHL 3VFOB 3P73B 2SEBA 3SKMA 3WBDA 1U8KA 2A9ML 2C7UB 5C1MB 2EE2A 5DD0L 3LD8C 1FSKB 1B2WL 1E4JA 3WNPA 1YMHB 4X7DC 1PW3A 4XP5H 4DFHA 4NQDE 4WUUB 4HUNB 1CGTA 1MCBA 4OZFH 5HHME 4Y4HC 1NL0L 4MQ7A 4GRWB 2VOTA 2F5AL 3S36L 2P42B 1QFUL 4HG4K 1QBML 4R96A 1TQBB 5C08B 3UTTE 4EN3D 1YPZF 2D31B 3ARGA 4DUWA 2W9DL 4HHAA 3TF7A 2ZJSL 2D03H 3HLAB 3CSPA 4RMSA 3SKNA 3MV7B 4NM4H 5AZEH 1GC1H 1T66C 4LCUA 1EJOH 1IAKB 5I1CH 1I8MB 2MCG1 3SJVD 2X89D 4NC0B 3PHOA 3SJVA 2NTFA 3VG9C 1DLHA 1ODAA 5H35A 3CU1A 4ORZC 5F9WB 5JIHA 4L3CB 4NKOB 5E03A 3VXSD 4Y19A 2EDWA 5EOTA 1VENA 1DBJL 1P7HL 3CDGB 1FORH 4LVHC 4TVPH 1YY8B 3ZKQD 2L4OA 5IHUH 5LKNA 5EIVA 4FQPA 4UUJB 4LBEA 4NQCD 4JVWA 2X9YA 3KXFB 5ERWA 1PFCA 2ED8A 2JTDA 1FZJB 2VAAA 3VGDA 4IRJA 1U9KA 3C5JA 1B4JL 2GAZB 3PHOB 3U0WL 1VGKB 3O2DL 3BKYH 4MJIB 3O8XA 3ZKND 3EO1B 3N50A 3TJHD 2EIZA 4QKXB 4Z7UE 1QFWH 3P2TA 4ZUVA 4I5BB 1NAML 4JLRA 2AJZA 1I8LA 3HZKA 2DQEL 3OTTA 2B0SH 4DZBB 3FFCA 2V9QA 3OB0H 4QHMB 4RCAA 3WFBL 5L6YH 1WWAX 4YX2H 4FZ8L 5E8DH 3OAZK 1EBAA 3FT4A 1TZIB 3GIZL 4ETQB 2BRQA 3FQNA 4LEOA 1X5KA 3UEZA 1FZOB 3V5KA 5I1GL 1RJCA 1GGTA 4F15C 3H7BB 4LLYB 3HLAA 2VQ1B 4UINL 5EPMB 3OAUL 1J05B 2AXGA 4CW1B 5C0DB 1IAKA 1YNTA 1IQWH 3BDYL 3T1FB 5F89B 2HJLB 2HFFA 3QFDB 4I0PB 4WEBH 1GHFL 2I07B 1BOYA 1YEKL 1E0OB 2EDNA 3SGJC 5BO1H 4K3JH 1CCZA 4RFNB 2VDQH 1WITA 2HT4C 4UAOC 4E41E 4HJGA 1XF3A 1HYSC 2XT1B 4DCQA 3O4OB 1DVFC 4GG6B 4PJCE 5E5MB 4HK3N 5TJWK 4JRXA 4YR6A 2BMKA 3O3AA 1TJHH 4NQXB 1S3KL 4Q7DA 3BESR 1MCDA 5DUML 3VFTB 3T0ED 3UDWC 1MJUL 2A77H 4BSVB 4JQXC 2QR0A 3VW3L 3CU7A 4XVUD 5I1GH 4X0KB 4KKBD 5ERWB 3QJFA 4Q2ZA 3X14B 3HS0A 2YEZB 3SHSA 1WFOA 5GISL 1CTOA 2BDNL 2ESVA 4H20H 3TBTA 1LE5B 2DQEH 2WWKT 1J1XH 4PJ7F 3LEYH 5DMIL 3DV4A 5E08L 1JMXA 1NKRA 3FB8A 1GSMA 2PNDA 4HUXB 4M4RA 4MA3A 4Y4FC 1KB9J 4AIOA 1VEPA 1XGTA 5AAWA 2M1KA 3GK8H 3DLQR 2DQHH 5CINH 4BM7A 5FUZH 3DURB 5HYJD 3S8WA 5IESL 3IFOB 3MOQA 3QUXA 5FGBA 1G7MB 2Q7YA 2X4PB 1AD9A 5F1SA 3VXRB 5SWQA 1MUJA 3AM8A 3I3DA 4JFHD 5GHWH 4D2NA 1JGUL 2BSTA 3IRZA 2FLRT 3HCVB 4HJJH 4TTGA 4MA3B 3IETA 3PWNA 2Y5EA 1I3RB 2P8LB 3MFFB 2IAND 1KIRB 4F58L 5ETUB 3JWDL 3V6OA 2YKLL 4XWGL 4EQ2A 3L7EA 3VE0A 1Q9OA 3LKPB 2A83A 5E8NB 4MA7H 4X7CC 1SVZA 2O5ZL 2ADGB 5MEQB 2AEQL 3MRFA 3OXRB 5BOZG 1OAQL 4XMLL 1H3VA 1IAMA 1QA9A 2EYTA 5HGAB 1HHIA 1IC5L 5HGBB 1D9KA 2VZSA 2G5BA 2Q3ZA 4YWGH 4ZSOE 3TBTB 4XP9H 4MJ4A 1KJMA 1KUMA 3EYSH 1RI8A 4HUVA 1IJ9A 4M7LL 3HB3D 3QUZC 5KN5B 5LJYH 5GGSA 4WW1B 4GMTL 2NYYD 4FQQB 4NIKB 1BZ7B 5TE7H 2ADFL 3LKNA 5JXAH 4QXGL 2VLLA 2VDNL 2P5EA 3NAAL 5ESVB 5FUCC 4MJ5B 3G6AA 1MPAH 1NC2D 1MWAH 5EBLB 3JTSB 3UYPA 1ZA6B 2I25N 1N4XL 2CJUL 2R0ZL 3K0WA 4LLWB 3O3UN 3VFGH 2ARJA 2BVQB 5HGBA 4OF8A 1FGNL 4JO3H 3ORJA 1QSVA 1UXWA 3EYVA 1P5UA 1C1EL 4HC1A 4MD5A 4JFDD 3CFEA 4EN3C 1GYAA 4ZUSA 2AJXH 4I3SH 3RTQB 1FFRA 4J1UA 4G6MH 3IB4A 5CSZB 1QSFD 2VC2L 4ZPTB 5HBBA 3DVNB 4ZPVA 1A6WH 5IB2B 2Z92B 2O93L 4JY4A 4YBHA 4XNYL 1N5AB 5D7IA 4U6YA 4OTXH 3IF1A 1RZGB 3EOBB 4HK0A 2FDBP 4NQSA 3P4OB 5D2LB 4JKWA 2W07A 3FFDB 4UBDD 3UO1L 2CRYA 4XMKL 4S0SD 3FTGA 3OR6A 4KVCL 4G8GB 4EDWH 5IW6A 3WNNA 2CUHA 3D85A 5JO5B 2P46B 1SHMA 3HI1B 4HS3B 2P43B 5SWZD 4PJ5B 3NFPB 5ID1B 1EMTH 3BKJH 1M1SA 3GHBH 1FLTX 1UM4H 5DR5H 4EKXA 3HI6H 4HMDA 4L5FL 3UPRB 1CICB 1M05B 2EDJA 1U8MB 4KJPD 3S9DB 5MEOB 4R4NC 3KWWA 3U6RB 5GS2H 5FA4B 4HKXA 4HIEA 3MGAA 3QDJD 3PP3H 1P7QD 3QCTH 5IW3A 2AJUH 3TWCL 3MR9B 2W0LA 1JF6A 1Q0XH 3B9AA 5F3HB 3JTSA 3VXSA 2IAMC 5BS0E 1ZT4B 3CVIH 2J8UE 1NAKL 4MB4A 4V1DB 3ULSB 1Q72H 3VCLB 1WEJH 1JHTA 3QUYD 4Y89A 5EBGA 4Y1AE 5L9DH 4PJ8A 1XCTA 3BZFA 4Y5XC 4JO3L 2Q7NA 1A14H 5EZLB 4BK4A 4MJ2A 1A64A 4XVJL 3ULVH 3MJ8B 1MCPL 4K3HA 3PL6A 5T1DL 3L1OL 5CS7A 5E94B 4NO0B 5J3HC 1MF2L 2BOBA 2H2PC 3BXNA 2DTMH 4GW5B 5KSAB 1RZGA 1FG9C 1A7RL 3SDDD 2CIIA 4KJQC 2OTWB 2L0DA 4G7YL 4L8DB 5ADPH 4IS6B 4ONGL 3OG4B 3MUGA 2XA8H 1LO0H 4M7LH 2DBLL 4FFYH 1JGEA 1I4FB 3TV3H 3RVUC 4AJ0A 1NPUA 1AI1H 1HEZB 5EZOH 4KK9D 4ONGH 3HC4L 1JZ4A 5L0QB 4WV1C 1X5JA 3GSQB 1FV1A 2Y72A 1KOAA 5GGUB 1OAUL 4QRPD 2EXWD 5EWIL 4WTZG 3MJ7A 5DT1H 3IKCA 2CGRL 4PGCB 1OGAB 5EUOE 4UOJA 2ZUUA 4MD4B 1UACH 4NFDA 3NACH 2PXYA 3RGVD 3B43A 1FH5L 43C9A 1AIFA 3LN4A 4FQ2H 3DO7A 1IILE 4RGNE 2F58L 2MOVA 3EOYG 3HC0A 5D7LD 2BXZA 3TCLB 5A2FA 4HG4J 2F53D 4P9MH 1R5IB 5EB9A 2QADC 3RDTA 3BN9C 3B9DA 3RTQD 1U95A 1MREH 3VDAA 1MEXH 5IIEB 1J1PL 1QBBA 3FHQA 2FGZA 3JXAA 5BVPH 2HLAA 4JDTH 2DLTA 3HTLX 4MQ7B 3T0EE 3ZKMC 4YDKL 4G42A 5J11C 3IXTA 3CFDB 3QZWB 4QCIA 3MMEA 4JZJB 2BX5A 2FB4L 3PL6B 4J6RH 1JTOA 3G5YB 1EPFA 1MQKH 4BH8B 3D39E 5D6DC 2R69L 5HYJB 1IAOA 3LN4B 5C9KA 4LVNC 2ATKB 3WKNA 2BOCB 3LRSA 4NZRH 2OTWA 4Y88A 4L1DA 3OPZH 3H3PH 2CLVB 5HVHB 2LVCA 1KSRA 5F9JB 3FB5B 5I73C 1RZKC 3LKSA 1A7OH 4NHUB 4KVCH 2F54E 4WUUA 2ZG1A 4DUVA 5CJOL 4MMZC 1J10A 2LABA 1XIWC 2ZNXA 3STBA 5EOTB 4TVPE 5DHXB 4NO3B 1A4KB 1EXUB 1AJ7L 2AW2A 1WBXB 3MBEB 3QUZA 2YWZA 2WQ8A 5GGTA 1RU9L 3MV7A 4E41D 3QUMB 3WLWC 4NQCE 2K1MA 4D94A 1RZIA 1BVLA 3MLRL 5C0ND 3Q5YA 3B3IB 4X8XA 4U6XA 5E2JA 3S35L 1VFAB 2E6PA 4JAMB 1W0WA 4ZUWA 3GBMH 4ZOCA 1R3KA 1UH3A 2NYYC 4LSPH 4M9OA 3HRZB 4WEBL 4WRLA 5I15H 3WNLA 3ARQA 5AEAA 5DJ2B 4QXGH 5I66A 2DQTL 1F97A 4U4BA 5IBUB 2OP4L 3FONA 4ZSOA 5F7UA 1XEDA 4UNVA 4JZOB 1U2HA 3QDME 3OX8B 2QKIB 3V7MA 4CVZA 2Q6WB 4KC3B 1S7XA 5TFSH 2E3VA 2AXGB 4I2XE 3PGCB 3SJVE 3U4EA 1TTFA 4CNIA 1ADQL 5A40E 3F7VA 1KPRA 4PG9A 1EAJA 1FBIH 2HFEB 1B9ZA 4NGHL 4UT6L 1Z0NA 4JN1L 4DKAA 2HRLA 3HRZA 3QO1A 1JWSB 2FO4A 1N5YL 3R06A 2O5YH 5F6HJ 1H3UA 2V9RA 3QUYB 2YPLD 4F58H 5JLZA 3OZ9L 2B1HL 3VFTA 4IOIB 4OZIB 2IAMD 2ZUQC 4L1HA 4CVXB 4NFCA 2MNUA 1HIMH 5HY9A 3OL2A 3EDFA 3GSVA 4QRQA 4RGNB 4W6YB 3ZTNL 5J13C 1G0YR 2FB4H 3Q3GA 1NGYA 1CLZH 5IBTL 4CJ0A 1QO3B 5H37G 3LKOB 1BIHA 1H5BB 1U3JA 5D5MB 2VZ1A 4GRMB 1NGQH 4PRHE 1NFKA 1CDJA 3UJTL 5ESQB 3D85D 3UZEA 3RRQA 4NDMB 1X3DA 2HRPL 1FFNB 1RUMH 4PV9A 3MRQB 1DSFH 1F00I 3MGTB 2B7DT 3BH9B 4O2EA 5DZNA 4D3CL 4JRXB 1TQCC 5IEKA 5D7IE 5HYJE 3RL1A 3WXWH 3DXAD 2XQYG 3OXSB 3EDKA 4YDIL 2I27N 3OAYK 2ZSVA 3MLZL 4OFIA 3T4AA 3U9PH 3UTQB 4PD4J 2R4SH 1FG2A 3I75B 4DAGH 3VXMA 2X4QB 3IYLW 2YUWA 4GRMA 1NL0H 4LPUA 4LSQL 2WM0A 4FXGA 1YMMB 2BJML 5JPNA 5FF6B 3R8BB 1RIHH 3HS0B 4L3EE 1KN4L 4JRYA 2XYCA 5DRWA 4HZAA 4Z5RA 3S6CA 4JFFA 3SGEH 5IROA 1DQLH 2BSTB 1JWSA 2FO4B 3MOAH 5J3HD 2QQNH 2A77L 1HQRB 1YC7A 3RZWA 4XNZC 3D0LB 1HYSD 2BNQA 2HVJB 1AFVL 2EKSA 2IH1B 5D7JB 4IIQC 1TVHA 2Y6SD 1FO0A 1L7TL 3ZYZA 1W0VB 5CP7A 1TZGL 1TJGH 5F1NB 5J9PB 1JN6A 3ECBA 3RVVC 4F80A 1H5BC 4O02L 3HG1B 4JPWL 2CR6A 5IUSA 4AG4L 5L2KD 2YD3A 1F4WH 3B2UD 1FNAA 3LN5B 2GAZA 5LCVH 4P5KB 4PGDB 4FFVD 1RV6X 1NCWL 1OB1A 3LS4H 2BHUA 4MDIB 5TQ0L 1NBVH 3VGBA 5F1KC 3DYPA 1MHHA 3CVIL 3MGOA 4O5LL 1BJ1H 5F44A 4MLIA 1FBIL 5I8OH 5T3XD 3U7AA 1IE5A 1DQJA 3RA7L 1DE4B 1FO0L 3JV6B 4WFEE 2P8LA 3LRHA 4X98B 2AJVH 4XWOD 5K9KB 2HN7B 1NAMH 3HB3C 4PGZA 1F6LL 5F89A 2NZ9D 3P0VL 2XA8L 2IAMB 3DSNA 3BGAA 5DRZB 1X6LA 1MVUB 2DWDA 4XNXH 4U7MA 3QHTC 1MNUH 2VQTA 1UM6L 2YN5A 2VZOA 5IHZB 3AS0A 1DR9A 3WL9B 4DKEL 1I3RA 3UO1H 1BM3L 5HHVL 3T0WA 2X4UB 5BQ7B 3RNQA 3D39D 1U8IB 3JVGA 5HI5C 2EZ0D 1FORL 1MCPH 2Q86B 3C6LB 4X9BA 3MR9A 1FO0B 2MFNA 4ZOAA 3BQUD 4YHZH 4XPBH 5HTSA 2ZCKH 4POUB 3QBTB 1JN6B 4HC1L 4YHIB 1BQUA 4JG0H 4L29B 5HHXL 1T89C 1YEDB 4M5ZH 3P0YL 2F54D 4KTEL 4JY6A 4PGDA 4U1MA 3GGWA 4HC1H 4H25A 4R8WH 2DBJA 2VWEC 3NZHH 4R7NB 1Z3GH 1FGNH 4Y4KA 3HZMA 1EK3A 5D93B 4KMTH 4DOHE 3T2PA 2Z0BA 5B38G 1IKFH 4NQDB 2QTEA 1FCGA 1KN2L 1RY7B 4M1GL 4PJ5D 4LVEA 3WLWD 2JJSA 4J3XA 4ODSH 3TBVA 3CSYA 1JZ8A 5DVMA 2A83B 1T7YA 4LLQA 3ILQC 1ZKAA 3QNYA 3DMMA 3LB6C 5MERB 3T3ME 5K9KA 2VXVH 4KI5F 5HGAA 1FNGB 4MLSA 5J8OA 5FYKL 2GSGA 2AK4E 3ULSA 1S7SA 4RBPH 1QPXA 2A74B 3RWCB 5B21A 2W0KA 4GAJH 5HHQB 3QXDB 3L6FA 3D39B 2IALB 4F7MB 3O6FD 3RWGA 4OTXL 1J1PH 3O6LH 4O00A 2MMXA 4OKDA 4MA7L 5ITFB 1CLOH 2XXMB 5E99H 4LU5H 4YPGA 2FCBA 3MRDA 5BVPL 4C59B 4CUCA 5JNYB 2NXZC 1MEXL 4GRWF 4ZYKA 4ZFOL 2NY6C 4F37F 1M4KA 4TNVK 1C1EH 3IFPA 4MJ6A 4NYLA 3R1GH 4P2RB 5AG8A 3RUGF 2EC8A 1FGVL 3BKCL 3BYTA 1QEWB 2F8VA 4N0RA 3PL6D 1YYLH 2QQKH 4FQHA 3HPJB 4ODTL 1U93A 4XH2A 1JK8A 1KG0A 4R26L 3NPZB 3TVMB 3V5HA 2EIDA 4AL8L 3WLBA 2UWEB 1IGCH 3P77B 1E4WH 2OL3L 3VXRE 4OB5H 2QV2A 3HE7A 1FZKB 2AQ3A 1P4BL 4AL8H 5IKCA 4HUWA 4XP9L 3RWHB 3M17B 4KJPC 2DI8A 2FEDD 4PJFA 1IFHH 3WO4B 1JHTB 1MFEH 4FZEL 4R4ND 1MHEB 5F6IB 4PJ9D 5GRUH 3LEYL 1Q9WB 1IKFL 4HS6A 1ZLVH 3X12A 5JXED 4FABH 4Y1AD 3EYFB 3PWLA 5T1MA 4P9HC 2CO7B 4G9FD 5D7KD 2B4CL 4UB0L 3KYMA 5JIIA 2DQDL 4M02A 1S9KC 3P4MB 2V2WA 1LK3L 1OSZB 3NFNA 1DLFL 2OK0L 2R0LL 5GZNC 2HVKA 3C5ZA 1XGPA 2M8XA 3B9KA 2QADD 5HHXH 1OP3H 3VFOA 5L8JB 3OKDB 4LU5L 4PJAA 4DW2L 3VD3A 4IS6A 1F4HA 1Q72L 1U3ZA 4XXCC 3IDGB 1WBYA 4WNQB 1C5BH 2DF3A 2E7MA 1S7VB 1WIOA 4CN6A 4PJGA 4JAMA 2AXFB 1BVZA 4IRSB 4NBXB 4NSKB 4XAKD 4PY7A 4DKEH 1N0XH 1TVDA 1EZVY 2A6JA 2XWTB 2D7PA 1XF4A 4MX7A 4NKIL 5SWSA 1GHFH 4IRZL 5DMGC 3K2UH 1OSZA 1CXEA 4GJTB 3A0OA 1S78D 4H88L 4L5FH 3QG7H 5D8JH 3QNZA 5IFAH 3OZ9H 1FIGL 4GAGL 3TC9A 1MVFA 3F7YB 2D9CA 4QOKE 1J9CT 2NZ9C 5HYJA 1RUPL 3V4VH 4X6DF 4Y4FD 3PIQA 3MJ9A 3K81A 2DWEB 2H41A 4FZ8H 1T0NA 4YDVA 5KVEH 2HKFL 2G60H 4KY1L 2YZ1A 2FZ3B 5M95B 3C2AL 3EFFA 5IOPA 2WSKA 4BZ1L 2N7AA 1O7VA 1TFHA 1MLCA 2E6JA 1RJZB 4JZJA 2GFBB 1ZOXA 5TDOB 4U2ZA 2W9EH 4AT6A 1S9XA 3MJ8A 3R4DA 5EBMB 4JM2A 4P2OC 1TTUA 4X6FB 3VFPB 2X42A 4KKLC 1ZSDA 5E94A 3IJYB 1S9WB 1BF2A 5DEGA 3LOWA 1CS6A 3MNWB 5B38A 1H3XA 2Q6WA 5I1JH 1J0ZA 4LARL 2F9BT 3VFGL 1RJLB 2YD6A 4K3DH 2RGSA 5I30H 1KT2A 1DP0A 2EDBA 1S7VA 5F1IB 2XWBB 2BZDA 5KG9B 5B22A 3HG1D 4UQ3B 1P4LA 3AC0A 3OR7B 1AD0B 5I1EH 5DJ8A 5I16A 5E9DD 1C16B 1G7JB 3MRQA 1G84A 2D7MA 3G5ZB 5C0BA 4KK8D 4N5EA 1NC4D 4YWGL 1C5DB 4AEHL 2Y36H 1RZ7H 5C86A 2VQUA 5DJ2A 5H8DA 1LEGB 5FUOH 5TE4H 3BD4A 1AGBA 5C0IB 1DANT 1BFVL 5EZIL 2GITB 4KMQA 5CBEA 4ODTH 1MF2H 1EGJH 5ALCH 4DN4L 3ULVE 3UBXI 4AK1A 4KHXL 2YPVL 4I0CC 5JW3L 1I7UB 3RBSA 4HJ0D 1A6VL 3B4NA 5D7LB 3VXUB 5BRZA 5A3ID 1LD9B 1PX4A 4S1DD 3RP1A 1E28B 4YJZL 4R6UA 4C4KT 1ZTXH 1OL0A 3RWEA 3B9EA 4AG4H 2GFBA 5JW4N 5GSVB 1ZVSA 5E4EC 4GRWH 4U1NB 3CNKA 2NY6D 1UYWH 1EFXD 5D1QB 5KS9E 1ZS8A 5IESH 1F5WA 5C0CE 3OJMB 2GITA 3IVKB 3I6KA 2DJSA 4KHTH 2AXHA 2EH8L 4Y5YB 4EIZC 5HI3C 3VDCA 1LK2B 4JDTL 2PTTB 1U8QB 1KPVA 4O4YH 5A3IC 2C1PA 3VXUA 4LIQH 1MREL 4HXAL 1A1MA 4MVBA 4EIGB 2IANB 1AGFB 3RWIB 3HZYB 3CFKB 1JHKH 3DX8A 1V8HA 1R3KB 3P30L 1NCDL 3MLUH 3DHMA 3SE4A 2HKHH 1CLYL 5CMAB 1YQ2A 2H2SC 4QEGA 4LLVA 1DBBL 2VL4A 1QFWI 1OTUC 1RVFL 1NBZB 4DN4H 5F7MC 4U1LA 2HT2D 5J1AB 1A6TB 1S8DB 3QEHB 5EFIA 4PJ9C 3WN5A 5TE4L 2DQCL 2UZXB 4QXWA 1FC2D 5IJVB 3L3GA 1CDBA 4LOUC 1I8MA 3BYYA 3LKQB 2CSPA 1CE6A 3UBXG 3MV8A 2H9GA 4PLOB 2EXYC 4EDXA 5IVXB 3GIVA 1DCLA 4LMQE 1GOHA 4IRSD 4G8IA 1T1WA 4XX1G 1WSST 2X05A 5DJZA 4OCYL 5JPMB 4G7VH 3PDOB 4LSPL 4OGYH 2JIXB 1CD1B 3MV11 5DI8A 4FNLL 3S35H 3RY4A 4EXKA 5K9OB 4UDTA 1L6ZA 4I9WD 2X1XR 3MLVL 3OXSA 3J7HA 3B2UC 1BM3H 1G9NC 1BQLH 1BFTA 2IGFH 3U46B 5CZXD 1TCRA 3WS3A 1HI6A 3GSVB 4NZJA 5FDWB 4GMTH 1YEDA 2APXA 4XNUH 3STLB 2GUOA 3CX5K 2UYLB 3LEXA 5GGTH 3G6DL 4ODVL 3SDDA 1GIGL 1KJMB 1S78C 5FO9B 1DUYA 1UADC 1VEOA 4QOKB 1DZBA 3M8OH 2CLRB 2C4FT 5CJOH 1J0HA 2AK1L 3AU1A 1I8KB 3L3HB 4FQXC 4G8EB 1TZIA 3E0GA 3FT4B 4XWOC 3HN3A 4R7DB 2E6QA 5E9DE 1W0VA 3REWA 1DUZB 4LLQB 4LPYA 3QEHA 2EXWC 4U0QB 4BK5A 1A6PA 4FA8A 1HHHA 4P49A 5F1OB 1T03H 4U1GB 5DR5L 5C0GB 1RZ8A 1P1ZB 5KVGL 4RAHA 2HG5B 4KRPD 1KJ2L 3QDMB 4G5ZH 3LH2H 4PB9L 5I8EA 4NKIH 3GIVB 4QRSA 3CIQA 1IEBB 4XCFL 4MQTB 2J7LA 4HCRA 4XMKH 5E00A 3W5MA 1T7ZA 3RTQA 4L8CA 3ZO0A 3CH1B 2DTSA 3ULUF 2CKNA 3MGTA 2WUCH 5EU6D 3KJ4B 3VFMA 5J6HB 1UZ8B 3GMOB 1C08B 3RNQB 3CSBA 4NUGL 5FB8A 1KTDB 1WVZA 4ZYKB 5H2BB 2NY4B 4OT1L 2ZUVA 3KJ6L 2F54A 5BZDA 2OK0H 3E2HA 4K2UL 4OLEA 4S2SB 3BH8B 1NSNL 4CMMB 4PV8B 4OZGF 5JO5A 3FAXA 5F9DC 1JNLH 3QUXB 4PJGE 1OM3L 1NDMA 1LDPH 3L9RA 5FKAB 3TO2A 4D9LH 3C60A 3ABZA 1UH4A 1CDUA 3MBED 2VB5A 3I3EA 4P2QA 4R2GD 5GRUL 2YOCA 3Q48A 2DLFL 2ZSWB 2DDQH 3HC4H 3SDCC 5DZLA 2VDNH 1M6OA 4Y4KB 1RZKH 4O9HH 3VGHA 2CD0A 2JLLA 2UWEA 3K46A 3MRPA 3GB7B 1NANH 2HH0H 4R0LC 4ONFL 1BQHA 1LO0L 4X6DB 1TIUA 4U0RC 1QR4A 4X98A 1WC7A 3RPIB 3IDXL 5FFLA 4S1DC 1HHHB 1S3KH 5GJTH 4ENED 3QFJE 5CIPH 4Z0XB 2WLZA 5TPWL 3AM8C 3UJTH 2OTUB 3GNMH 4LLAA 1S7UA 3BZFB 5HI4D 3RVWD 4HX1A 3MNVB 4X6EB 4LRIA 4F7TA 3UZQA 5J56B 1ZMYA 4YPJA 5BO1L 5C0NC 2UY6A 3R1GL 4Z7WA 4YGVB 4XH2B 2BNRE 5ANME 5HGGS 4ZD3L 4BKLB 2V5RA 5E2WH 2Z31B 2PCPB 5DJ0B 1J5OH 1X5GA 4K55A 4KAQH 4PTUB 1KCSH 5DHYA 1BD2B 1QVOB 4HLZH 4L4TA 4NJAH 4K07A 2DM3A 2JJTA 4WI8A 3NACL 1RPQA 5CEZE 1FL3A 2Q8BH 4POZC 1U58B 1I1AD 2FWOB 3WE6A 4HW6A 3SKUD 4GG6F 5CEXA 5DT1L 3TBWB 4IDLA 1F11A 2LVEA 2H1PL 4JVUA 4QY8A 5HI4C 3DUUB 2ENSA 3RVWC 4QTHB 5E4EB 3CFJA 2HT3D 3WFBH 4PRBB 3AB0B 1MWAB 4LKCA 3TJHA 1ED3B 3ULUE 3VI4F 3X3GL 4JFZH 1KJ2H 4X7TA 2HT2C 2EYRA 3U79A 3T0BA 4OGAC 3TZVA 3UPCA 2YPLA 5I71B 4HFUL 1T03L 3TZVD 5D8JL 3NBNA 1FNEB 2PYEE 4UIKL 4TOYL 5EG6C 3TFKC 4WO4D 4MXQC 4HFUH 4XPHL 5IT2H 2ZOLB 1KB5H 3QIBA 3W0WB 3CC5A 3OV6A 5FYJE 3SDDC 1OARH 3EFFB 5IOPB 3VRIB 4AENB 1JGEB 1MRCH 5IWLC 2A74A 3RJQB 1MHEA 4RNRB 2R1XA 4PY7B 2Y06H 4BFIA 4MVBD 2IALA 2VDPH 4A6YL 5T1MB 3RZCD 4QRUA 1ETZA 2DAVA 4P5TA 5DDHA 4C83B 3UTTB 3WJLC 2Z4QA 3JV0A 4TNWF 1F2XK 2IBZX 4U1JB 1CFNB 2R0KL 3QIUC 2QADB 1A1NB 1DQDL 2CJUH 2YSSB 3QHFL 1C12A 3M17A 4O58H 1OWRM 1VACB 2MSPA 2ZJSH 1U58A 3WE6B 2C26A 4HLZG 5GRWA 5DC0A 2VLRD 4KKAD 5I19H 2YXFA 1JGVH 3MLSL 3IDMB 1V3MA 4P4KB 4JKPH 3JTCA 1DEDA 1MI5A 3EKCA 4PJEA 3QISA 1EUUA 4QXUL 2W9LA 5FGCE 2YK1L 3MNZA 2QQLH 1ZWIA 3B9KB 2DQCH 1CICD 3UDWA 3X3GH 3UYRL 1L7IL 1YNKL 4CMHC 2Z8SA 4I1NB 1RZKL 3IAGC 1JFQL 4J12A 4P4RB 2ZWLT 1AC0A 1MY7A 4G80B 3PV7A 4L8DA 1GCFA 3VWKD 4X99A 1L0YA 3AGVA 2GHWB 5E2TH 2P47B 4LCIH 1I4FA 1ZT7B 3JWDH 5F7EH 3SQOL 3TH3T 1BX2B 4YHYB 3K74B 4F3FA 3DROB 3RY5A 4W4OA 1MCWW 4WTXA 3P9MB 3RWDB 1CI5A 4P9ML 3EO0A 3MV7D 3P4NB 4HXAH 4XVSH 4PJBF 5DEFA 2EEDA 3BRDA 3LPWA 5LCVL 4BSJA 4DQOH 3JWOH 1IC1A 2Q76B 3DMMC 3O6ML 4GOSA 3BMWA 4WFFD 3RQ3A 1MPAL 1FDLH 1PLGH 2GCYB 4GUPB 3NVQA 3TPUB 4DKFH 2CGRH 4X6FA 3BXNB 1S7QB 5CBEB 4NOBA 1P5VA 1AFVH 3PNWB 3Q2CA 5B38B 1IAII 2D0HA 4ZUUA 3QI9A 2OMBA 2XQBH 4HPYH 3V4PL 1LD9A 2VYRE 2DBLH 4ZXBD 5FYLD 1G9EA 1CK0L 3K1DA 5JW3H 4HF5L 2AEPL 3W81A 3LAFA 5JHDA 1BOGB 4ORGA 2P5ED 5AWNH 2P24B 1BQHG 4LHUG 1DEEA 2DN7A 5GRJH 5GGRY 1A7BA 4O58L 2NPLX 4KMTL 2YUVA 5IB5A 1LE9B 3BZ4A 2CK0L 3BGMB 3ZDXF 1JPGA 2FX8H 3PNWA 1MELA 3HC0B 4OKVA 5LWYL 2W60B 1Q9KB 4ETYA 4KKLD 3EFDH 3Q1SL 1ZLWK 1C16A 1G7JA 4PJFE 5DFVD 1U3HB 4PRPD 4CVUA 1ES0B 1E27A 2BC4B 4KRLB 2AJ3B 3BO8B 3VG9B 3MRKA 4GLRH 3FFCB 5L2KE 4F9PC 5JW5A 5F88B 5IJKA 5KSAD 3GRWL 3OKEA 1OP5K 3BH9A 4HHAB 4NN7B 4NO3A 1QSFA 4L4JA 2WLYA 4OZ4A 3VFPA 1E6JL 1I9IL 1S9YB 1IQWL 4IBLT 3SKMB 1LQSR 3MA9L 5DHVB 2D7NA 1H0DB 3L3GB 4PJDE 4GW4B 3REVB 5M7QA 3IU3B 3C5JB 4V1DD 2RAMA 1N5YH 4RAUB 4GKZA 4U3CA 4Z7VE 4N68A 1AXTH 4PJBA 2AVGA 1FL6B 2DQFA 4IMKA 5J0BA 4HPOL 2HKFH 1FNHA 4OIBA 1JFQH 2MPAL 1FO0H 1I3UA 2VDLH 3GSWA 4YR6B 3ARED 3MTRA 4GS7C 1DEEB 1JPSH 3BUYB 5KS9A 1S9XB 2GJ6A 5TFSL 2R2HA 1AGCB 2P7TA 5K33A 4DTGH 1BWMA 4X9HA 43CAB 1CFSB 2FR4A 1I9IH 4PD4K 4IMKC 2H32H 5I2IA 3E3QC 5T3ZH 2YEZA 4JDZA 2OI9B 2VLMD 4X4ZA 2YZ8A 5CGYC 5GRZA 4H26B 1VESA 4P4KC 5J13B 4X4XB 1KCVH 3R06B 5ID0A 4JFFB 1KBGL 4WI4A 4GXVL 2QJDA 4MQXD 3FQNB 4LEOB 3WCYA 4DCQB 5CZXC 1EX0A 3FB6A 2C3VA 3MRGB 3GRWH 3D3VE 3HUJA 4J3UA 4OI8A 1C5DA 3GMLA 4PJEF 3RGVB 4NQXA 1YYMH 4YHML 5L0QC 3TPUE 2E8ZA 4PLNC 3DURA 5E8OB 3KPLB 4Y2DA 3ERYA 1EEZB 1G1CA 3UJIL 1VGKA 2WWMD 4EBQL 5J89A 1BAFL 1F6FB 3L5JA 2YC1A 1MCRA 5I8EB 1I7RB 2WP3T 4MVBC 3SJVB 2MJWA 1J18A 1AGFA 3MUHL 5HDBF 1F8TL 1HZHH 2QHLA 1QQDA 4LOUD 4K7PY 1JNLL 3C5ZC 1M7DA 4OFYD 2Z91B 2IWGA 5ITBH 1BFVH 2YKLH 3KLAB 3RIAF 2X09A 1CG9B 1WQVT 5IHLB 1U0QA 3UP1A 4EEEA 4JO2L 3MFFA 3SDXF 3UTZA 2VAJA 4KJQD 4HT1L 4R4BB 1AGCA 1B2WH 4P5TC 4HJJL 1MJJB 4A6YA 3G04A 3QEQB 5FKPA 2GSIA 1AR2A 5GGQH 3TN0C 3I3BA 1MQKL 2BCKB 4IOSD 5GZND 4WTWA 2AEWA 1IEAB 1RZ8B 5F9OL 3TN0B 1DBAH 1EIBA 5FF6A 5E1HB 1KBGH 3SY0B 3RNKA 4MJIA 5K59F 3NZ8B 2ICWI 5D6CB 3KXFD 3S5LA 4OLWL 3V52H 3LH2L 4KJWD 1WCQA 5D6DA 4NBYB 1PGRB 3WL9A 3BHBA 1FFQA 4RFEB 4PBXA 4OF7A 5E2TL 4N90E 1T7WA 1FVEB 5DJXB 1DDHB 3VDBA 4Z6AT 1BMGA 4HLJA 1N6UA 3SDYH 3RTQC 3GMPB 4S11A 5DC4B 4YHYC 1Z6JT 5E6IB 5GS0D 4PJ5A 2IJ0C 4JFQA 2MPAH 3ILPB 3K3QA 4KUCD 1OLLA 2ESVB 4KJWC 4BQ8A 2YK1H 4X5LA 3UJIH 4U1IA 5ESAB 4XPAL 1FAIH 3DWTA 4W81A 1GXEA 3DMMD 4YFDB 3S3SA 3TV3L 2AK4D 5JMOC 3UTSE 3Q6FA 1BP3B 5IMMB 4X5WA 3VG0H 4C56D 3PDGA 4JKPL 2C4XA 1M6OB 2X7LA 3MA9H 3JV6A 4R97C 2DLFH 2V7NA 1TJHL 4WFFE 1XR8A 1HWHB 1A8JH 2N56A 4Y19D 4Q6IA 4D9LL 5DJDA 3BT2H 3I85A 4C55A 3HG1A 5J11B 1XH3A 1SJEB 2PKDA 3L7FB 3LB6D 2OJEB 4KI5C 5CJQL 4LLWA 5F70A 2OTUA 3O45A 4GKNB 3S5LB 1KC5H 1W8NA 1WEJL 3PQYD 3WO3B 1ITBB 1TQCB 2F53E 2I60L 4GS7B 2RB8A 1UCTA 5I74C 2GK2A 3LKNB 5BRZE 2YD5A 5JHDD 3PJSA 2DIJA 4L4TD 2XY1A 2Q86A 4LASH 5J4MA 1S7TB 5JUEL 5D7IB 2Y5TB 2EE9A 3CPLA 1NUDA 5FYJD 2VDKH 2PW2B 3RBGA 4TUKL 5A1AA 2ADGA 5MEQA 2EIEA 3ZE1E 3STZA 4J2XA 3V4VL 5E24E 2FH6A 3QZWG 4OGAD 1HHIB 4QRRB 5F9AC 2XG5A 3DVGB 4O51A 1JHKL 1KGCD 1CE1H 4MDJA 3WFDL 3DRQA 3KNBB 2EDLA 3WFHB 5B8CC 2PO6A 1FIGH 1YEIL 4GAGH 4F9PA 3P0VH 4GAYA 3QG7L 4QHKI 3T2QA 4HPYL 2JJWA 3MV9D 5JHDE 5BRZD 4HEME 4FG6D 3PJSB 4P57A 3DTXA 3U0TB 3DBXA 1G7LA 1K4CA 5T1KA 4XX1E 2CPCA 3EYOA 1I9RL 2L7UA 4HWZA 4NRYA 1MCFA 2VLRE 5FM5M 4KFZC 1DQML 4TUJA 3MBXH 4OZHA 5KBNC 4MNGB 3CUPA 1FGVH 3BKCH 3IDNA 3PDDA 3S5LG 2GSGB 1CF8H 3BH8A 1U8HB 5C09E 1NBVL 1KJ2A 3V95A 3TNMA 1UB6A 4LRIC 3S37H 2KL6A 4Z76B 2OL3B 2FD6L 1ZEAH 2FYYA 3K4ZA 4MQSB 1I8LC 2ERJC 4I13B 2FX7L 5HVHC 1WAAE 3FFCD 4C56E 2ICWA 4X6CB 5B3JF 1MWAL 2D03L 1U8LA 2R8SH 2JB5L 4NC1C 1KEMH 5KSVB 5CEZL 3O6LL 5ICZA 1EEUA 1QBMH 3TNNB 2Y5TA 3CPLB 1NJ9A 2VITB 1RZ7L 4M8QA 1VACA 3GJFA 3AMLA 5GJTL 4QRRD 1J0IA 8FABB 4O2FB 1GGBH 5JOPE 1WBZA 1PBYA 4UOW1 2ITDA 1T0MB 1S7UB 1HEZA 4H1LA 1HINL 3WMSA 5DEFB 2IH3A 2XIDA 3KLHC 5I30L 2OSLA 1SM3L 4ODSL 1YEHH 3A67H 4AT6B 4DKFL 1MLBB 3F58L 1CZ8H 3VWKC 5D5MF 3PF2A 3DI3B 3U0TA 2PCPA 5D2LE 5DJ0A 5JORB 5E70A 2B1AL 1IAOB 1JL8A 1NCDH 3P30H 4K2UH 4BQBA 2KBGA 2E9IA 3C08L 1MFBH 4ODUB 1T7VA 3KJ6H 2RHEA 3O6KH 5ICYB 1NCCH 4E5XB 5BXFB 5HYFA 5C08E 1ZV5A 2CDEB 3ALPA 3PWVB 3VXOA 1MCJA 1RUML 1TVBA 4G3YH 3V0AC 4EOWL 4F7PA 3JZ7A 3RHWF 3TIDA 5EU6E 4O4YL 5HDOA 5KANI 1ZHKB 1E4XL 1YPZB 2YD8A 3CSGA 3IXAB 4LKCB 3SCMB 4YDJB 3QHZH 3QCVL 3LRGA 4Z7QE 2WIMA 1DQMH 4R96B 3JUZA 1C7SA 2HTLD 4ODWB 1KB5L 1JTTA 3OF6D 4KXZH 3MLXL 4RMRA 43C9B 4NOFA 2XRAL 1YECL 4TUOA 4PP2B 4XZUB 1ZTXL 5MEOA 5LGHL 4ZXBA 3GHBL 4JANA 1D5ZA 4NM8L 1EHNA 1I7UA 4N1EA 3UBXA 5CKAA 2I9TB 4TULH 5C0CB 5HHOA 1J8HB 4EDWL 4UT6H 3TVMC 2E7CA 2GYSA 4PJHB 1KYOJ 2GJZA 2HMID 1T5WB 3HC3L 5GISH 4H1LB 2YR3A 5GGUA 4UIMB 1JV5A 3DRTA 3BIKA 3ZYIA 3G5YA 4XP4L 5JHDB 5BJTB 2F19L 5ELIA 4GH7B 5DZOA 3M8OL 2VC2H 4LHJB 1BIIA 4JZOA 5LGKA 5M94B 2IANE 1PKOA 3MREB 3VH8G 5CD5C 1R3LB 3LDBB 1G7QA 1INEL 3BN3B 1LK3H 2R2EB 1H0DA 3BEWB 1PVHA 3FT2B 5DD5L 3S96B 1MRCL 2B4CH 4UB0H 2DMBA 4P59H 3VRLE 1CYGA 2BRRL 4KPHL 3LIZH 4YNYA 1F4WL 1A4JA 4K3DL 3CLFL 1T2XA 4LPTA 4H8WL 1UB5B 4PG2A 3EGSA 5HDLA 5TDOA 1BFSA 4N8CL 3BIKB 1HYRC 4UAOB 1T89A 1X5AA 1FE8L 4BFEA 1L7TH 5GS1A 5EBMA 1K85A 1ZVSB 1QLFB 4AM0A 1BIIB 3MBEA 3MV9E 2YA0A 4RAVA 1LHZA 1FRGL 4UT9L 1KLFA 1ZAGA 5GSRA 3G6JE 4GXUN 2JCCB 3NIFF 2X89A 5F7DA 1YDPA 3MYZA 1T4KB 3DO7B 4GT7A 1LK2A 4X99B 1KN4H 3ZDYE 2BNRA 4AIXA 1QO3A 1IQDA 1N8ZB 4ZAKD 1OAKL 4WGWB 1UXSA 4FG6C 1SMOA 4UV4L 5ESQA 1AR1C 3MLZH 5CLTA 5IMKB 3RGHA 4FTVB 3HZYA 4CU7A 2OJZH 4NRXB 1UT9A 3ET9F 5GIRA 2RFXB 3TYFB 5B39A 1Z0MA 5D9SA 4PJCF 3SKNB 2MQCA 3QEGL 1GZPB 4OCWL 4JB9L 3O41A 1JGUH 4J23A 3ZKNC 2VLKE 3SEPA 3W39B 2R2EA 4P4KD 3X14A 1TZGH 1KT2B 4MQXC 1AQDB 2A0LC 3S96A 1OP3K 2NW2B 4IM8A 1F4YL 1ES0A 1C5BL 5TPWH 4OZGB 4XGZB 1GGCL 4BUHA 3MGOB 3BAEL 4GRLD 1TPXC 4PB9H 5LVEA 2W59A 4E9LA 3I9GH 4N8VG 4RFEA 3OGCA 4GMSH 5HYSB 1MH5A 4H0GA 2ZUSA 2C3VB 1JNNL 4FFEX 4O9HL 1KCUH 1NUGA 5JIKA 1A3RH 3OX8A 2X40A 3L3JB 4QRQB 4GRWE 4D9RD 2X1OA 3BQUB 4XTRC 2ERJB 4F8QA 1FCCA 4H20L 4YHNA 1ORSB 1CR9H 2IAMA 1WGOA 2C1OB 4K3EL 4CKVX 1YA5A 3F6LA 2XNAB 2BHYA 2CDGA 4XBEL 1EGJL 3NZHL 3SDAA 4QO1A 4PJBB 4TN9A 1UJTA 5GXBB 5CILH 3MRMB 5C0AA 3T0AA 4MD0B 3DX6B 4MXWL 2X4UA 1KLUA 4JCLA 3DO3A 1RZFH 3BUYA 5DMKB 2C9AA 5CLWA 1DQJB 3CFIC 1JFMA 4RA0C 4PRAB 3N85H 4IEFB 4LCCB 4TYUA 2APVA 5I15L 2QSQA 4ZNEE 5EIQA 4LHUD 2KQNA 1KXVC 3G5XA 4KK6C 2VDQL 3N0PB 4XCFH 1I7RA 2NY4D 2VXTH 4P5MB 4IJ3C 1J8HD 1N7MH 3D0VB 1ZA3B 1NFDB 3FQUB 4CDHA 2GJJA 1KPRB 1X5LA 4PR5A 3ZSTA 1FFNA 1OAYL 1YEGL 4PV9B 3OBAA 3QQ3B 1U8PA 3SBWC 3UTTD 4ODBD 3RUGE 4JFYA 5FCUH 5FM4A 1JPTH 3ARZA 3TA3A 2MKWA 3TWCH 4MB3A 4U7KA 3MX0A 1GC1C 2EYSA 3MRCB 3KR3H 1X7QB 4P2QD 1M71A 4PJHE 1MAMH 1CDGA 2BCKA 3FHAA 3DMMB 4KY1H 3NIGE 4TSCH 4G8FA 1CICC 3MFGB 1FL5B 2VZ3A 1RIUH 3G6DH 1BLNA 3TJEL 1A7OL 4GKSA 4P5TD 1D3CA 2ZKHH 4JY6B 3JTTB 3VMPA 4JFQB 3OPZL 4CL7A 5C07B 2HWZL 2Y9RT 3C60B 1N3NB 2AGJL 3L5IA 5GZOC 4I8DA 3DV4B 2HJKB 3WHE0 1JGVL 4ZOBA 1RFDH 2IBGA 3TIEA 4LIQL 3VGEA 4LVHB 3PABA 3GSOB 4R2GC 1KN2H 4ZS7L 5DK2B 3QDJB 4HDIB 1W72H 4Y16D 3MRPB 1M71B 4P48A 3QHFH 2ID5A 1BEYH 3NIFE 4R4BA 3QIWD 3OKOA 1A6WL 3KPRB 1FJ1A 3H9HA 1TDQA 1TJIH 3TBWA 5J9PA 5HGHA 4G9DA 1UYWL 3R8QA 2PETA 5EO9A 1KJ2B 3I50L 1DQLL 2VDPL 4YXLL 3RWFB 4JFEA 3RNKB 1FVCA 2Q7YB 2DQDH 1QKZH 4MCYB 4MDIA 3RPKA 4X7TB 2BVOA 5ACZB 1NGPL 3SKOA 4FN0A 5MP6H 3F12B 2J8UB 4V1DE 5I1DA 1WWWX 5FECB 2R4RH 3WXWL 3A67L 3U36A 1K5NA 1P4IL 1FVDB 5FGCB 2A38A 1H8NA 5HGHB 3PGFH 4Y4KC 2BVPB 4JHAL 5HYQB 5LGJA 3PP4L 3PV6A 3D3VB 5C0GA 1IFHL 2PW2A 5EOQH 5AUMA 3SGKC 1ZT1A 1D7FA 4LCYA 4KK8C 4R3SA 2AJVL 1IC5H 3WFHA 1NFIB 1UVQA 3HZVB 2BERA 2VLKB 35C8H 4M3JA 2NY5C 1N3NA 2VUOA 3SQBA 1XF2B 2EEAA 4KHTL 5CEZH 3RA7H 3L3OA 3EHBC 1NC2B 5DQ9B 2ARWA 3MODL 4UBDC 3U82B 3A6BH 2Q8AL 3SGDH 5I1JL 4JFOA 3BHBB 1UCBL 2IADA 1MFDH 1WAAF 2ATPA 4YDLC 1PYWA 3SOBH 5TH2B 2B1HH 4KAQL 3DXAB 3QSKB 4X83A 5TQ0H 4WO4C 4JPKL 2HAZA 5DMYA 4FTVD 3QIBB 3QXAA 3JV4A 1IGIL 3W0WA 4L29A 2L7JA 1B0GB 1UENA 4OF6A 2J2ZA 3ZYJA 2PO6B 3FCTB 4JPWH 2VH5L 4B7LA 1JRHH 3IKKA 1LO2H 5I6XB 3TH2T 4JHWL 5GGVY 4GKNA 4LCIL 1UACL 5CHNB 3GNML 2G9HA 3ELAT 3EDDA 2FHCA 4I18A 2LTQC 3QPXH 4YAQB 1J0YA 5EZLA 2GY7B 5F6HI 1ACYH 4AEEA 3MNZB 4L4VE 5EZIH 1R3IH 4OD1L 5KN5A 1IC4H 2W0FA 4KQ3L 1NMBH 3F5WB 4X5WB 4G8GD 5C8JB 4YE4L 1OT1A 4NQSB 5I8KL 3DYMA 1CL7I 3T0EB 3W11C 4FFYL 2FLBT 1OF2B 2B2XH 5EOQL 1T0NB 2V6HA 4QY8B 2AJYH 4LVNB 2IMNA 5J6GB 4ODXA 3K2UL 4XNQA 4M7JL 3VXRD 5D93C 2GJZB 5C09D 1YC8A 2E9JA 3EO0B 4JFXA 1Q9WA 5F8QC 2C3HA 2QQQA 1V7ML 3NFSL 2X9WA 1BGXL 5JTWA 1GGIL 1EEQA 1LO4H 4E0RA 5CP3A 4PGJA 2X5PA 4LF3B 3FO2A 3LY6A 4BH8A 4RWYL 3DYOA 2EDTA 4ZTOL 5KVFH 2ADJA 3FOLB 2MHAB 3U30B 2XG4A 2H26A 2I60H 3NPSC 5C2UB 2WUCL 1TENA 3FFDA 2R0LH 1VEMA 4Z7OF 4JG0L 3CVHH 3QULA 2OZ4A 5CJQH 2DYPA 1JWMB 4HH9B 5FO7B 3DVGA 4O51B 5CBAB 3FL7A 3WFEH 3SE9H 4LMQI 1XF5B 1YNLH 3Q6GH 4N0UE 3V6ZB 1SY6A 2NXYD 4KUZL 5I18L 3TZVB 2IFFH 4LVOC 3ARDD 1ZHNB 2R2BB 1P2CB 3MYJA 4M93B 4D9QE 1F3RB 4M6OH 1C12B 2GCYA 3MRDB 4GUPA 2ADIB 4YBQD 3O81A 3D6GA 2OR8A 5IM7B 3TA3C 3TPKA 5DJAA 4JN1H 3EJZD 4KQ3H 2EDEA 5KW9L 1VA9A 4PJIA 4P3DA 5SX5H 4OZHB 2HMIC 3RVTC 3PIQB 3QPXL 2BVEA 1YYLL 2QQKL 4PY8J 5F8RC 3B6SB 1VFAA 4NC1E 3RDTD 1MFAL 3C8DA 4YDVB 2H1PH 1QG3A 4RNRA 1J8HA 2OR7A 1QD0A 1BD2D 3U0PB 3HE6D 1ZLSL 4ZXBC 3QG6A 3BKYL 4QRTA 1UH2A 1IGIH 5C9JB 2ZPKH 2Q8BL 4IDJL 1P2CA 3MYJB 3LVEA 1YJDC 1QSEA 3UAJD 5L8KB 3TA3D 2A6KA 2VXUH 3KPPB 4XVTH 3RAJL 1XR9B 2AK4B 3MLVH 4HGMA 5IHUL 5KSAA 2XPGB 3VI3E 2ICES 5C0BE 2MWCA 1S7RB 1QR1B 3KXFE 5EU5A 4OZHE 3BEWA 4XP6H 4G7VL 3VXSE 1BVLB 1E4KA 4GRLB 4PG9B 3TBSB 1ITCA 1AY1H 4EN3A 3ZE2E 2XWBA 3O2WL 1F4XH 4QHMA 2XTJD 4N8PA 2BC4A 4QRTB 4WUUD 1T1ZA 4ETQA 3GSQA 2V5SA 1QFPA 1MH5B 2YN3A 3KLSA 4DZ8B 4LDLB 1A7RH 5KSAC 5IQ9B 2UZIL 4WY7L 1MRDH 2XI9A 1P84J 1T83C 2D0GA 3C09B 4X7FC 1XR9A 2AK4A 2XZQH 4Z0BH 3SPVA 3MQIA 3L1OH 5E8PB 5E1AB 3U9UB 4PREB 3S88H 3D1MC 4ODUA 2XOTA 5KG9A 4HUUB 5FXCH 4ELKB 1J87A 1QLEH 4LSDA 1A14L 2A6DB 2IG2H 1IQDB 3MLWL 3O6FA 1YEFL 3I6GB 4POYA 4G6FD 2BMKB 4KI5D 4L4VA 5DRXB 4P9HH 5CUSL 5DMKA 3NCYP 1MJUH 3QNXA 1NGQL 1VFBB 5D2NA 2WBJC 3QFJA 5DUMH 4R0LA 5GIRB 3GI9H 2IPKA 3NCFB 3WJJC 5K93A 1ZS8B 4H8WC 4IRJD 1PY4A 1GZPA 3SGDI 2FJFA 1T1XA 3EIFA 4HKBA 4KUCF 3PXJA 2XPGA 5B8CA 1RJLA 4GRLC 4YO0B 5CGMA 4NNXB 4KH2A 2APBA 5I2IB 4BZ2H 1JYXA 1E28A 2H6PA 4G8IB 3FB5A 3E6HA 1NDGB 3BSZL 4XCYA 2Z9TA 4LCWA 3I6GA 1CIDA 2A73A 3PWJB 4LSVH 3QYCA 3UC0L 2X44D 1AH1A 4WEMB 4PJ7A 5H94A 1YY9C 1XGTB 2P8MA 3MZGB 2DLGA 1KFAL 3GKZA 4HMCA 1TVHB 4LSSH 1NAMA 3IFNL 2C4FU 1S7XB 3NH7L 3MRLB 1FLRL 4MA1C 1WJ3A 3ZE0E 2HT3C 1FSKC 1YDPB 1HQ4A 2AJSL 5I8OL 1AXTL 2OQJA 2V5YA 2J6EA 3HI5H 4PRHD 3RWIA 3DOSA 1RMFH 5ENWA 3QPQC 4ZFOB 2A73B 2Y7QB 5EC1B 3MSPA 4Z7NF 3E6FA 1DBKH 2YRLA 4WUUE 5BZWB 1CGXA 2UY7A 4Y19B 4M7ZC 4MWFA 1VFUA 5GSVA 3C5ZD 1H8OA 3FB8B 3VH8B 3GJFH 5AYUL 1AQKL 2FJHA 1KIRA 3G6JB 5JIPA 4WCYH 4JQVA 4JPIA 1NAMB 2NCMA 3IVKA 1A3LL 2NY1D 2Z8WC 3T65B 3ULVL 4N0FA 1DBJH 2MKLC 4EUPG 5JXAL 3LIZL 4X6DE 3E2HB 4WHDA 1MJJA 1CE6B 5DD5H 3VXME 5JMRA 5L9DL 3L5WB 1LEKA 1FVCB 1UZ6E 4Q2ZB 5C7XL 4KWUA 3EYSL 1O0VA 3HMXL 3RZCC 3HNTH 3C2AH 3QO0B 2JIXA 5D1ZC 1CD0A 3RIFK 5I1HH 2EO9A 4FQIL 3I02B 1F45A 1MJ8L 4QGTA 3T8XB 3RGVA 5H94B 2E7BA 4U1HA 4HSQA 3V5KB 5IGXH 4XWGH 4RSVA 4FOMA 1QTYT 1SYVB 4I18C 4UUJA 5FDYA 3HI6L 2HKHL 4Y5VB 1CK0H 1CGYA 2R15A 4WI2A 1HHKA 3VXMB 1CFSA 4PRPB 3V2AR 3D69B 4LPVA 5EORH 1JCKA 5DYOB 2CMRH 4EDXB 2CDFB 2XNAA 5DD6B 3G9AB 4GO6B 1T20A 4FHBD 5DRNB 3CX2A 3BUTA 4X4ME 3D9AH 3V8CA 3HZKB 3PHQA 3DX8B 4JRYD 1RAMA 5IB2A 3RI5F 2Z31D 2KKQA 3MXVL 4X7EC 2IADB 4G43A 5EC2B 1S7TA 4G6ML 2CRMA 5E6YA 3EJZC 1HIML 4UNTA 1NUNB 1G7PA 5KAQG 2F5BH 4Y5VA 1CXHA 1NCNA 4XP1L 5GRYA 3BJLA 3VJ6A 1NC4A 4YZFF 5EZJB 1EHLH 1FNGA 1W2KT 3L5HA 1IEBA 1GOGA 1JUFB 4NO0D 1X4ZA 2LU7A 4I3GA 4GBXA 1GZQA 5LBSL 1JHLH 4HJGB 2YPLB 1UVQB 4B53A 5B4MD 5EZOL 1CQYA 2NR6D 1DN2A 3TGXA 5F7KC 3CMOL 3BWUC 1NC2A 3QUKA 3QH3B 1A5FH 1IGTA 4NFBA 1B0RA 5DK0A 5JW4R 2HVJA 2QL1A 4MXVF 4AEHH 4FQCH 3JWDC 5E95B 4PRAA 4DGVH 2BY0A 3LN9A 2GSIB 3HE6A 2BNUB 2NY2B 1KULA 4C56B 4KROB 2UVFA 5EUKB 4LKXA 1PY9A 2OXGA 1PSKL 1CLCA 3PWPA 5FYJU 1OB1B 3ZTNH 5F9WC 2LU4A 1X5XA 1R3HA 2VLJA 4IRJC 4K7FA 4FXKB 4N5EC 4U1JA 2XKSA 5DVKA 3O3BB 3ZLQC 3TLRA 5HPOA 5I9QB 4OUUB 2F54B 4L4TB 3H9HB 1NAKH 1PYWB 5ISZB 3B83A 4RFOL 1X4XA 4H1LH 4O2FA 1MFAH 5AZ2L 5A2JH 4K23L 1OVZA 3ARBD 5BOPA 2DMKA 1QBLL 3QCUL 1XCTB 3WDJA 5EN2B 3BPLB 5KW9H 4QRPE 4TULL 5D7JD 1CXFA 2AI0L 2HP4A 4P5TB 1MCOH 3HPJA 4JJHA 2BVTA 3S4SB 4FQQA 4Q9BA 4OSUH 3LQAH 1AGDB 5I1DB 3QEQD 5SWZE 5C0EA 1REIA 3TO4D 1HCFX 3FOLA 1G9MC 1YPZE 4N90D 3MLXH 2NY2C 1FFOB 2WBJA 4LNRB 4XCNA 3STZB 5DJ6B 2VITA 1A6ZA 4PP1C 4PRBA 3BKMH 1TETH 1KCGC 3ZDXE 4XBGB 1Z3GL 1Y0LB 3QHZL 2PTVA 2Q20A 1ZHKA 3VRIA 4YAQA 5CWSB 4YHKH 3L6FB 5DHVH 4KTEH 2D7TH 3CFEB 4LGSB 4PYHA 1MIEH 2D4DA 4K94L 5CSBA 1ZHBB 2R29L 1G7LB 4HS8H 1EUTA 2OR9H 1MHPL 4J3VA 3VRJA 3SKOB 4XPBL 3NIGF 3KLHD 1EJOL 1MFBL 3C87A 8CGTA 4YHOH 1BFOB 5JORA 3WIFA 4ZFFA 3IT8D 3CSYB 1TZHB 5ESVA 3BP4A 4MNGA 5HHNA 3GMRA 3RWJA 5DTFB 4M4PA 3HE7C 4NQCB 2Y07H 4P3WA 2BVPA 2VUYA 5BS0A 4P2RA 4HKJA 3HI1A 4HS3A 1HINH 4Q97A 2AI0H 4F7PB 1BBDL 3FB7A 3V0WH 3IDMA 1NCBH 1Q1JL 3BDYH 1JZ7A 4ZFZA 3KNBA 3DRQB 3BIAX 2AJYL 3WUWB 4NZRL 2Q1EA 4X8JA 4Y1AA 3I6LD 4M1DL 5IV2B 2VIRA 3LD8B 4L8BA 1JZ3A 1HXMB 3BP5A 1YEJL 4ONFH 5LXGH 2HH0L 2R69H 3IU4L 1L8JA 1WBXA 1DFBH 3TT3H 2H26B 4ZPVB 3BZ4B 1A9BB 4XHJC 4XMLH 4PTUA 1S5HA 3RWHA 4YXKH 1VDGA 5FCSH 1R6VA 4JJ5A 4ZOEA 1UWGL 3CC5B 3MUZ1 3DXAA 1WZMA 4M5YH 2O61A 1IMHC 1JRHL 1OM3H 4N8VB 1WBZB 1P4LB 1E4KC 3UBXB 2AABL 3RIFF 5LG1A 3O2DH 3GJEB 5ADOH 2FD6H 3I84A 3OKNA 5LQBH 3EYFA 3PWLB 4RBPK 4QF1A 4I77H 4PJHA 4PRNA 5DLMH 2VR4A 2CIKA 4TRPL 1ZHNA 3VD5A 1AO7E 1A2YB 3W9EA 1V3KA 3CFDA 1HSBA 5TDNB 3FO2B 3ZKMD 3D2UD 3INUL 5I1IL 3LHPL 3MJ9L 4WV1B 1AP2B 5DUPL 2FHFA 4OZIE 2JCCA 4RQQA 1EZVX 3IJHB 4OV5B 3IDGA 1KCRL 2PR4L 4LHUB 2F53A 1BX2A 1A3QA 1P9MC 4MS8D 2W60A 4FMKA 4JG1L 2RCSL 4QHKJ 5JDSA 2H6PB 3SE8H 4XXDB 3AXLB 3B3IA 5D5ME 2XN9E 4M61A 1LNUA 1U3HA 4BQCA 5I1CL 1GJIA 5HD8D 2CIKB 2CRIA 2ZCHL 3LKSB 5C3TA 4QRPB 4H5SA 4LSQH 5EIIA 5F88A 1CL7H 1GPOL 5EO1A 4KK5D 2R4SL 3RDTC 2VN7A 2YPKB 5GRVK 4PS4H 1O7SA 2EO1A 4HIIB 2LV4A 2P24A 2A6KB 2MCPH 5I17B 1QSEE 2D31A 3WKML 3QUZD 2HYMA 2HFTA 4RQQB 5JZ7C 5TQ2L 1G0XA 2I26N 5F7LB 1HQ4B 2QSCH 2PTTA 1BAFH 4N0CD 3LKOA 4ODVH 3TH4T 5EU4B 2OI9A 1OP9A 2DQIH 1TQBC 2NW2A 4RAUA 1TITA 4XNUL 3GJEA 1UFUA 5IVNA 2VERN 1FNFA 1E27B 2G5RA 3QCTL 2P5WB 2BSSB 3ZSSA 4ZNEA 2X4NB 3ZDYF 3MZTA 1RUKL 3TBYB 1ZANL 4K9EL 1T66D 1U6AH 4OLZH 3V7AE 2JJSC 5CSGA 3DARA 3H9SD 1A6AB 1F3JB 1G6RA 1P7KB 3SO3C 4OZIA 1JPGB 3KPPA 1DVFB 4P2OB 3MNWA 1HKLH 1D5BA 1XIWA 2HWZH 4FQXB 2OM5A 2YC1B 3BPOC 1D5IH 2CLVA 1HDMB 2RR3A 3WIHH 2VWEE 2K7PA 4JRWA 1QQDB 4XPAH 3TJEH 3BQUC 5TDPB 3F7VB 1W72B 4MD0A 1RIUL 4Y16A 3HMXH 1ADQH 3RKDD 1I8IA 5HYIA 1OAXH 3RX5A 1RJYA 2EKSB 3D48R 4WO4A 3SDYL 1FYHB 1T83A 5I17A 4QGYA 4ONHA 5IEKB 4MAUH 4K8RC 5BV7C 5FCUL 1XGUB 1N59A 4O5LH 5B39G 5E1AA 5C0JA 2PYFB 3ARSA 1WISA 3WHXB 3UJJL 1BBJA 1NCWH 4PLJC 2FIKB 1BZ9A 2E8YA 1KB9K 4XCYB 3V52L 1NGZA 4KKCD 3H9ZA 4OLWH 4Y8AA 4PRDA 4Y16B 3FN9A 5JQHC 4NRZB 3IS0X 4KRPB 5C0FB 2VLRA 1X5HA 2P5WA 5F9OH 5IF0B 3GHEL 1Z9OA 2VLKD 5FYJH 1AO7B 3OAYH 1KELL 1G6RH 3KPOB 3S4SG 1X7QA 1LEGA 1Y18A 1EXUA 4JN2A 4PJFF 1RHHB 3KPQA 1NC4B 1ZE3C 1MAKA 4CVZB 3E8UL 3GMNA 2DS4A 3Q1SH 2EDOA 2VNCA 5F97E 1BZ9B 2OBGA 2BK8A 5GGRB 4PGEA 5JXEA 4ZUVB 3UC0H 1LEKB 3L5WA 2CK0H 4CJ1A 5IB4A 3KG5A 4PJ8C 1DLHB 2JJTC 4L3EB 5F6IC 4DAGL 1ROWA 5ALBL 1NANI 5DVOA 1DUYB 2YHGA 3WDIA 3M1BB 4FQLH 3QUML 1AXSB 1AO7A 2PTUA 3HNVL 2W9DH 1ONQB 2JELH 1ULVA 4OCRL 1QFUH 4JDVA 3VFMB 5J6HA 2Y36L 1T1YA 3THMH 5SWZA 1DUZA 2EEBA 4OZ4B 5D72H 3BDXA 3KVQA 1YNTB 5IK3B 4KKNA 5T3XH 1QA9B 3VXMD 5I1EL 3LS5L 3QIWB 5D72L 1SEQH 1LILA 4Z78A 3QDMA 2B20A 1A22B 1T21B 1YEFH 4HCRH 2YA1A 4U1IB 1IKNC 4LARH 5ESAA 2X4PA 4YK4C 3O6MH 3VGAC 2P5WE 3ULVD 2KQMA 3GBNL 3T1WA 2WV3A 4RGNC 1H3GA 5FYKD 5TQ2H 1DANU 1HKFA 1D9KD 3GBLA 5FECA 4DTGL 1U8IA 3V4UH 5CIPB 4E42A 5D1ZD 4YQXL 2GJ6B 4XPFH 1X5IA 4NWUL 4X7SL 4GBXD 3KPRE 4U6TA 1MRDL 1G7PB 4WU7B 3OHXA 5I74B 4ZFGH 4QOKD 2HJLA 4Z7UB 4KJYB 1IGMH 4RMVA 4HX1B 4NWTL 3D39A 3O45B 1WFNA 1FFPA 4MAYA 1MCCA 1BJ1J 4QNPE 1NMAH 4WHCA 5JZ7D 1QFWL 1S9VA 1U8OA 3BP7B 3AY4A 4QHUB 3N1FC 3ARWA 1IM9B 1KLUB 4RGOH 4ZO8A 4I2XB 5IHZA 1GGYA 5K9OA 3FQRB 4LPWA 2OP4H 1SEBB 3C8KA 2X4RB 1FL3B 4JPIB 4BSVA 2AS5M 3GMPA 4PJDF 1I3GH 1LDSA 3UAJC 5HYQA 4TVPL 3D69A 4XVJH 1ZA6A 3T4AB 2GW5A 5ADOL 3MV8E 4TSAH 5JDJA 3IRPX 2EE3A 3Q0HA 2JF1A 1G9ML 3QJHA 3P9LA 3MLRH 1DJSA 1RUAH 3QQNA 2AV1B 3BGFC 3I2CL 3GGWB 2CKBL 2W0PA 1K6QL 5BW7C 1MCLA 1UC6A 3KLDA 4K9EC 2A9NL 5ACMA 5EDXA 4ZO7A 3F8UB 4DOHB 3L3OB 5E5MA 2AJUL 3L95A 5ITFA 2V7NB 4G43B 4J8RA 4HWEL 1C08A 2J88L 1JZ5A 4PRIB 3GIZH 3OJDA 3IU4H 3ARBA 3MXWH 4K71B 4YX2L 4PTTA 3X17A 3FRPA 1YEJH 2BNUA 1OW0A 5MHSE 1XAUA 1OARL 4LNVA 4XCNB 5KZCB 4DN3H 4A6YB 3L7FA 3ROOA 4UNUA 1VFOA 4YGAB 3PWPB 5KANG 1CD8A 1LP9E 4ZQKA 3DUUA 1IM3A 3RX7A 5D2NE 4YXHH 4DVBB 4ISVA 2RQ8A 5JOPD 3N1MC 3BPLC 1P6FA 3HUJF 3NFPA 5MEND 5D6CA 2VSDA 2XQBL 4F15B 1P4BH 3SDXB 3IAPA 4K8RD 2VL5A 2VLJE 1CGUA 2HJKA 3H3KA 3QWRD 4XP5L 5C70A 3JBG7 4OB5L 2ILLA 5ICXB 2Z4QB 1IGCL 1CT8B 1U3HC 1RURH 5C09A 2WBKA 4V2CB 5DD1H 5I76B 4EJ1C 4G6AD 3G6JF 4H0IA 3AAZB 4JCMA 5GS1C 4JGUA 1PEWA 1FDLL 1OT2A 4WFGE 4ZO6A 2NY0C 3RY6A 4E5XA 5T5FL 4HUMB 3DX7A 3Q5TA 3DIFB 5CD3B 3BX7C 1L9NA 4FFZL 5GGVH 1CDYA 3OSKA 3QWQB 25C8H 3KPNA 2ZUYA 1BHGA 3F7RA 3VCLA 3FT3A 4XBGA 5MEPB 2H8PB 4ERSL 5SX5K 4UTAH 4Z76A 3C08H 4GLRI 4BFBD 3GSUA 4U1GC 4AZ8A 4OJFL 4JPVL 5GGSB 1DQQA 4TUOB 5D7LE 1A7PH 5HGDA 4DWHA 3NAAH 4JQVC 1SM3H 5KS9F 1MCOL 2ADFH 1T04B 1OAUH 1JP5A 4HV8B 1RZJC 1FZKA 3TFKA 3BGFB 4KKCC 1WIPA 1NJ9B 4M6ML 3BP4B 1V3JA 5DWUH 1NBYA 4M61B 3TO4C 4OAWA 3JWNC 1A6UL 1K2DA 2DI7A 3MRFB 1RULH 1LP9B 4ZS6D 4H5SB 1Q0YL 5EIIB 3RVXD 1A02N 4GAYB 4AYFA 1PG7L 4HKZB 4Y5XA 1IAIH 5FIEA 3V6ZA 3GSNL 3KYMB 2LAAA 4WWKA 1NGXA 4BKLA 4WI5A 3WSQH 1J11A 2XZAL 3HNSL 4WV1A 1OGAA 3ZE1F 3BWAA 1I7TA 3NABH 4JR9H 3NTCH 4NZTH 3LZFL 4L4TE 1N5AA 1N2RB 1BD2A 4QHLA 1WCBB 4OV5A 2ZOKA 4OD2A 1DBML 1WUNT 2H2SD 2VLLB 4NZTL 3TYGH 2PXYC 1YMHA 4KK9C 3MPCA 1I1YA 5ANMB 3BD5A 4OQ1A 4M5ZL 2NTSP 3AMKA 3LSOA 5TF1H 2XZCH 4NP4H 4RGND 3FCTA 2X4TA 5IB3B 4DGIH 2A6IA 2F8OA 1OTTC 3K8MA 1HE7A 4FFVC 3HR5B 4XRCA 3ALWA 4MCZA 1U93B 3FRUB 3VD7A 2XACC 1L9MA 5CZVL 1A7NH 3WLBB 5HHVH 4PJ5E 5KSVA 1E4XI 1KV3A 4PIRF 1AP2A 2AXJA 4A2MA 4XZUA 4G8GE 4RMUA 5DTFA 4Q74A 1KTLB 3RI5K 4YEEA 8FABA 1OCWH 2D3VA 4XMPL 3WFCH 4ACPA 2ED9A 2AJ3A 3BO8A 1OLZA 2ORBL 4EI5A 1MIML 4UV7L 5JOFB 4UOW0 4BFIB 2BSSA 6FABH 4X6CE 3ZKXB 4YXLH 1MLCB 4JM2D 4FFZH 1YY8A 3D18A 2WP3O 3IJSA 2ESVD 1AE6L 4XNYH 3FN0H 4NN6C 3EOTL 4HBCH 3H0TA 3E2HC 2Z35B 4P4RA 2ADJB 3NA4A 4PJAF 4PB0L 5DJAB 3H9YA 2AJXL 4I3SL 5DHVA 4LAQH 5DD1L 4I48B 3ARGC 4X5XA 5D7IF 2MQ0A 5DD3L 5GS2D 3AUVA 1RURL 4MSWA 3QA3B 3IU3A 4M8QB 3MUGB 3D3VD 1SY6L 9CGTA 3KGRA 4TQEH 4HIJB 3NOIA 5KOMC 2DIBA 1BQLL 5CJXC 1HN1A 3BT2L 3IXAA 5EORL 2UWEF 3QI9C 4YNYB 3K7UA 4WHYH 4FNLH 1NGWB 1YQVH 1TPXB 4YXHL 3EGSB 3GMQA 1NBZA 5E5UB 3U83A 4F7EB 5CEYB 2R2HB 3GKWL 5D2NB 2VQ1A 1LEIB 5ILTL 4RZCA 2H32B 3WN5B 2VMFA 3C5ZB 5CZKA 4BH7B 1KEGH 4OGXL 4NO2A 1I9JL 2J3SA 2Y4SA 3KAAA 3IDYB 3HHRB 5HDQL 1JTPA 4L3ED 4LP4A 3L3KA 3DUSA 1J12A 3O2VH 4MA1B 1OAYH 1TVBB 4PG2C 3ISWA 3MCLL 5DUBB 3BE1H 4K71C 1RVFH 1P6AB 3C6SA 1ND0A 1EDQA 1XT5A 4G42B 3O4LB 3AS2A 1QLFA 1U92B 4AM0B 4UDTB 1QSFE 4M1CC 4M93C 1Z5LA 2V2XA 3T65A 1CGWA 2GY5A 1XIWB 4WUKL 1DSFL 3N1QC 3QNZB 4U6VH 3DV6A 5C07D 2M26A 4EXPX 5EPMA 2QEJA 1T4KA 2DRUA 4TPRL 5DSCB 4LRNL 3O41B 5GPRA 5IMLB 3UPAA 3BZEB 2OI9C 4FQCL 1BZQK 1EBPA 2APFA 2H9GB 2P5WD 2YXMA 3MLTA 3ZDZE 2WINA 2PYFA 3WXVL 4UQ3A 3SDAC 1KENH 1YUHA 1A5FL 4WW2A 1T3FB 2CLRA 5C07E 4Z95L 3EHBD 4H26A 2VR5A 4NWTH 1LO5B 3NGBB 3L5XL 5HPMB 2EDXA 4G6AC 3V0VB 3QFJB 2NY5H 3S37X 1F3JA 1ZGLB 5GQBA 3LEVH 4OF0A 3VWKB 1KJVA 1FZOA 2PN5A 3U30C 2VABB 4BSWB 4G6KH 3K4AA 2HLFD 3QUZB 1A6VH 6CGTA 2BXYA 3BGMA 5EU6B 1QFOA 1JPST 1NFDF 2AK1H 3BSZH 2F5AH 3S36H 4P5MA 4HUUA 4MA8H 3E6HB 3C5SB 3L3KB 1AD9B 3VXRA 3SDDB 4U6XB 3MXVH 5D70L 5I16B 1D6VL 4M43L 1YJDL 3QO0A 5GS0L 4KMLB 5CCKH 2AV7B 1OPGL 5DJZB 4JO1L 3ZZ1A 3QIUA 3SE3A 2VDOL 2FATH 2A9MH 4U1NA 4LGPB 5L88H 3UZVB 4LRNH 2HLFC 3S34H 5I9QC 1OGTB 2DQTH 1RUQL 3PWPE 3UTZB 1KTRL 5CUSH 3MRIB 1OSPH 4LCCC 2FR4B 3G04B 5CJBA 5J06A 2V9TA 3B5TA 2HG5A 2CDGB 4D0CA 1BBJB 1WZ1H 4JDZB 1I1CA 3W82A 2EIZB 2OJZL 1IEAA 1JGLL 3BP6A 3CLEH 3QUMH 3BE1L 4NHCH 1GZQB 1IBGL 4RFNC 1FFPB 4MAYB 1LE5A 3S88L 2VISA 4P2RD 2VE6B 5L2JB 5JR1H 4JE4B 4OBSA 5JA9A 5BQ7A 1FYTE 3HNTL 2NQCA 3EZ8A 1IGTB 2O5XL 2EH7L 3DJ9A 2CUIA 3RVVD 1B3JA 4U6HB 4PTTB 3C6LA 2NNAA 2VDLL 5H2BA 1RIVL 5EO0B 4ZUTA 2W65B 4HIXH 4KZDL 4UT9H 1CGSL 2RJMA 4CW1A 1K4DB 4Z8FH 2R0WH 4OLYH 5EUKA 1KELH 1AHWB 4WU7A 4EI6A 3MLUL 1RUPH 3NIDE 1J8KA 2WW8A 3O3EB 3SN6N 3GFUA 1H5BA 4XVUC 4W68A 3P9LB 1OY3B 1VADA 2X70B 4FP8L 5I1KL 5JPMA 3DX6A 4XHQA 4H88H 4J1UB 3FQXB 4BA8A 2E7LE 4DZBA 5DQ9A 1DBKL 3RAJH 4XNMB 3B8SA 4Y5YC 1HILA 1KPUB 3MRGA 1JNHA 4YBQC 1QVOA 3BPCB 2J8UA 3G6JA 4UTBL 4LLVB 3UYOD 4WEUD 1EO7A 5L88L 5DK0B 5F96H 2QBWA 3BMVA 2BVUA 4JRYE 4P2OD 5IBLD 1BD2E 4X0KA 2VXQH 3D2UA 3VFVA 1UWEH 3ZKXC 3VXQA 3CFJB 1UKSA 1WV7T 1EEZA 3ARUA 3IFNH 5DD6A 3OXRA 4F7CA 4JO4L 2V7HA 4TVPD 2XKNA 2JB6B 5DJYA 5CHNA 1EA9C 1NDMB 1K9TA 3VXTB 2J5LB 2XY2A 1XGYL 5T3ZE 4XI5D 2YD2A 1YZZA 1DQQB 1ZVHA 4Y4HD 3TA3B 1AXSA 3U1SH 1H3PL 3GMMA 1BQSA 2BHZA 3U7WL 3ZL4H 4V3EB 1CXKA 4HIEB 3RU8H 3C9NB 4PRIA 4XBPB 4HQQH 1A21A 3VJ6B 2W65A 5T33L 5I8CB 4P23B 5FOBA 3RKPA 3WFEL 3MJ6A 1HHKB 2EKJA 4NYLB 5F7NC 3D85B 3QIWA 2YWYA 1U91B 2I9LA 3CDCA 1YN6A 2Y1VA 4J3TA 5HHOE 4XPGL 5DRNA 1QACA 3D0VA 4Z9KB 5KAQF 1QYGL 4AH2B 1EGJA 1NGXB 2AKRB 4HD9A 4X6CA 3CD4A 3VRJB 1JE6A 5FK9A 3TYGL 1I1FB 2X7LB 15C8H 2OYPA 1F02I 2FIRT 5CSZA 4R90L 1UZ8A 5T1DH 3C9NA 4X9IA 5B3JE 1GGIH 3REWB 3NABL 4NRYB 3IF1B 1INDH 3UROR 2D0FA 1CZ8L 4PDCE 1UM5L 5EZJA 1UG9A 4NO5A 4U1MB 3ILPA 2PO6D 3PE9A 4PJEB 4QTIL 1CL7L 3C2SA 4YK4B 1EJ6A 5E2UH 2XKNB 1PJ9A 4ELMB 4DEPC 1A6UH 2DMCA 5HHMD 4XC3H 4Q9RL 4Y4HB 5HJ3B 5FK9B 4HWUA 5IMMA 2BSRB 5I76A 2VXSL 3UYRH 4C57C 2UZYB 2OCFD 5GJSL 3PWUB 1EEYA 5IVOA 1C5CL 1IC4L 3D87B 4P3CL 4QHLB 3BEVB 2WIIB 1WC7B 2C3WA 4NKMA 1YQVL 5LGJB 3FOMA 4HWNA 5F7YC 2JK5B 4NN5C 2NY7H 1Q9OB 5I1IH 5INDA 3SDCB 4P4KA 2FBJL 4JZNA 5BMFH 4UTAL 1IAIM 5C0AD 3HPLB 1JWMA 4Q9CA 3MLSH 1SY6H 5EN2A 2KPNA 4V1DA 4ELMA 1TMCA 4Q0XH 1KIUA 3T3PE 5GGVL 4Z7WF 4PGBA 4YGVA 5ACZA 4FQJL 3HZMB 4MHHG 4NPYA 1GAFH 4PJDB 5K9JH 2ZSWA 1UWEL 3EOTH 2Z35A 1LO3L 4C83A 1HHGB 5IMOA 4UU9B 3NCJH 1GL4B 1AE6H 4RMTA 4KRMB 3BWAB 2GEEA 4MGXA 4MNQA 2ZCLL 1KB5B 3CK0L 4LSTH 2CRZA 2DQJL 4OM1L 3CUPB 3IDNB 4N9GA 5ISZA 4ZNCD 4O2CA 2HFGH 1MIMH 5FHAH 2YRPA 3KPSB 3CXDH 4JFXB 1T2QL 3CXHJ 1UB6B 1L0QA 4S10A 3TEUA 3T2NH 3E3QA 4XC1H 5L2KB 3BZDA 1BBDH 4NPYB 2GT9B 4F7MA 1OTUD 1ORQA 1QRNA 1UJ3B 3U4AA 1NBQA 5TE7L 1TNMA 1MNUL 1I7ZB 4UU9A 3T4YB 5TDNA 3EYQD 2UWEE 4I3RL 4RISH 2Z93B 4FQXD 1TXKA 1CFQA 4S1QH 3C09C 4HWBA 5DHYB 1EEYB 1G7QB 4JQXA 5JUEH 3T0EA 4XPTL 1X6NA 1QP1A 4M6NH 2VDRH 3MACH 3WD5H 3GJFB 3CVHB 2WBJB 4LNRA 3VXPB 2O26U 4M7KH 5IB1B 4LHUA 4RDQG 3KPSA 4DGIL 4N5UA 4OAWB 2ICEB 3RDTB 5DMGD 4NHUA 2AEQH 2D7TL 5DJCB 3O4LD 3B6SA 4XRCB 2HTLC 5IVZB 3LQAC 4L4VB 2IH3B 3BRFA 3ULUH 5HHQA 4D8PB 7FABL 5HD8C 3UXFA 4N1HB 3ARGB 2E27H 2YUZA 3A6CL 1CD9B 3T0EC 3CX5J 4KTDH 1KCSL 4NNYB 3X11A 3QEUA 4RAVB 1UWXH 2YMXH 3V5HB 1WZLA 3VGFA 5E2WL 4Y7MA 1L6XA 5E8PA 3SE3C 3TM6A 3TVMD 2JCCF 2O61B 1KB5A 1AXIB 3V6FA 1EO8L 4NNPL 1HH6B 1NDGA 3T0XA 4ODXB 4XNQB 3NPSB 5GS0H 2ITDB 2J8HA 3RWEB 5JQ6H 4RRPA 3BN9D 1KGCE 2VXVL 1IC7H 3P11L 1FHGA 3IKCB 5TGBB 4Z7NE 3ARPA 2D2OA 5D9SB 2J4WH 4WI9A 4NZUL 2IPKB 1LVEA 1QNZH 3PQYB 4CADB 5E08H 3WV0A 4Y4FB 2VKWA 1T1XB 3LEVL 3OF6A 4HKBB 4MSWB 1F3DJ 4MYWB 2Q87A 4WNQA 4NHCL 5BXFA 2VZVA 4PREA 3L5XH 3JUYA 3IDUA 4YDIH 5ENWB 5C0CA 4PJFB 1I75A 5EA0L 1NMCC 5ID0B 4JHZA 3ZHDA 2A6IB 2ZUTA