1NAMH

Murine alloreactive scfv tcr-peptide-mhc class i molecule complex
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
275
structure length
275
Chain Sequence
GPHSLRYFVTAVSRPGLGEPRYMEVGYVDDTEFVRFDSDAENPRYEPRARWMEQEGPEYWERETQKAKGNEQSFRVDLRTLLGYYNQSKGGSHTIQVISGCEVGSDGRLLRGYQQYAYDGCDYIALNEDLKTWTAADMAALITKHKWEQAGEAERLRAYLEGTCVEWLRRYLKNGNATLLRTDSPKAHVTHHSRPEDKVTLRCWALGFYPADITLTWQLNGEELIQDMELVETRPAGDGTFQKWASVVVPLGKEQYYTCHVYHQGLPEPLTLRWE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords BM3.3 T Cell Receptor alpha-Chain
publication title CDR3 loop flexibility contributes to the degeneracy of TCR recognition
pubmed doi rcsb
source organism Mus musculus
total genus 65
structure length 275
sequence length 275
ec nomenclature
pdb deposition date 2002-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1namH02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1namH01
3NFNB 2A9MH 3FQWA 1WFTA 4BKLA 1W0YT 3MRLA 1BOYA 3SOBH 4YGVA 4H0GA 4OAWB 5DC0A 3WFCH 4EI5C 3GI9H 2Z93B 1ZMYA 3BT2H 5CCKL 2ITDB 3U7AA 4F9LA 1EO8L 4HWUA 1QVOA 2K7PA 3C8DA 4P46D 3ULUH 3LZFL 1U58B 3BPLB 2A6IB 5C7XL 4HULB 4JRXA 4X6FB 5IJVB 2FGWH 3D39E 4KQ4L 4NKDA 4M1DL 2Y1VA 4IDJH 1JRHH 2DJ4A 2ARJB 3T3MF 4DUVA 1T22B 3FB6B 1NGXB 4DK6A 1R3LB 3M1BB 3L5IA 3UCRA 4H8WL 1N8ZB 3OKKB 5BV7H 1RQ5A 4GW5B 1PQZB 3KVQA 5E56A 3OJ2C 2EKSB 1U8QA 1QD0A 2AJXH 1IGFL 4PJ9A 3RBGA 3S36X 2Y7QB 2JJSA 4XXDB 4LLMB 5C3TA 3W9EA 5KSAA 3W11D 1GAFH 4RWYH 3OX8B 4I9WE 3ARBA 3HNVH 3A6BL 1IT9H 1QRNE 4NWUL 4LCYB 5HHQB 5EOCL 5DMJB 2QHRL 3T3PE 1YJDH 3GMOA 1RFDL 3KPLA 1MAML 5E8EA 3X11B 1B6DA 4P4KA 3PGFH 1E0OB 3CZJA 5JXAL 5IB1B 3FOMA 1RUAH 4JPKL 3EW3B 2FHFA 3JWOC 3VFUB 5HPMB 1IC7H 2WZPD 4GG8B 5D4QA 1OAYL 4JDZA 4GS7C 1OHQA 4C56D 3FQNB 1TCRA 1UA6H 4NQCE 1UM6L 4NRYA 2ATKB 5AWNL 1P7KA 1IM9A 4FXKB 2XY2A 1NDGA 2X1WL 1AH1A 4G6KH 5I18H 1OGAA 2B7DT 4KVNH 4PG9B 2Z92A 3PWPB 1G7MA 3MREA 1G7LB 5DS8B 4G9DA 4L8CA 3ILQC 1YEIH 4B41A 2P5EA 3PXJA 4QHMA 2OX5A 4PJIE 1YYMH 4TUKL 2L4OA 3ULUF 2ICES 1LP9B 4JFEE 5IVNA 2HJFB 2E27H 4NO0D 3SDDC 3GMMA 5E2WH 4OIIH 4OSUH 1HHIB 4RMUA 4V3EB 4XCNA 3IU4H 1Q9LA 2X9YA 4IRZH 2EYTA 3EYOA 5T3XE 5EO9B 5D5ME 3DVNB 2BVQA 2G5RA 5JHLL 5LGJB 2HVKA 2C7UA 4YHLL 3HE6D 3QFJD 2BVEA 4QNPF 3ZYIA 2DDQH 1VERA 1AP2B 1BFOA 1I1YA 3RVXC 1T5WA 3WHE0 5SX5H 1NEZB 1NL0H 1QLRA 2L7UA 4WO4C 3GSQB 4ZXBD 2E6JA 1MF2H 1LWRA 4B50A 3MZGB 4K23H 3U9UB 1R5IA 1HI6B 3G9AB 1VACB 2OTWB 3KJ6L 5KS9B 4L5FH 5D7LE 3FO0L 4R90H 2XFXA 4LRIA 4LLWB 1L9NA 5E4IA 5A43C 1H15A 4B0MM 4PP2A 4RGNC 5H37H 2QQKL 1OPGL 5F7WC 1T0NB 1F2QA 3NCEB 1HDMA 4AIOA 5T3ZH 4JAMA 4R4ND 2AXJA 3Q6GL 1T4KA 5D70L 1FV1A 1WK0A 1S3KH 2P8PA 2R15A 4RZCA 5B39G 4QHUA 5EORH 1MH5B 2A6JA 4XWOD 5T5FH 4O5LL 2EDRA 5DRWA 1WCBA 5IROA 1K4DA 2UWEE 5BVPL 2XTLA 4KV5E 3JSSA 4UUJA 2DQJL 2NX5D 4U7SA 3GSNH 3Q5YA 3VH8B 4QRUB 1JHTA 2MHAA 4RA3A 4HGMA 4TVPL 1OP9A 4O2EB 4CU7A 4M7LT 4W68A 4AL8H 2PW2B 3T0BA 3HC3L 3MRPB 2AQ1A 2P47B 5I8OH 4M9PA 1I1CA 2X4NB 3G5YB 1IQWH 1A8JH 1U8PB 3QO1B 5ALBH 2E7MA 2VLLB 1SY6A 3VRIA 4MWFA 5D96B 4XP6L 1CDGA 4MDIA 5L8KB 4P2QB 2J6EA 1FC1A 3HZKB 2H32H 2R0WL 5CZKA 2FX9L 5KOVC 4N0CC 4MXQD 1K8DB 2BNQD 4J8RB 4Z7VE 2C3VB 5KOMC 4UILL 5D7IE 4P57B 1IC1A 2AEQH 4LQFL 4YXLL 2M26A 1CR9L 2YUVA 4PG2A 3LQAL 2HG5A 4NN7C 4X4XB 4QRRA 1P2CB 1N59B 1CVRA 2R23B 3IDJB 5E1HB 4KI5F 3GSXA 4NKQB 3TJHD 5ITFB 4HPOL 1HHGA 2D7TL 3OJDB 4EXKA 2IJ0C 4MLIA 1CFTB 4M7ZB 4X5XA 3VWKC 4QOKB 3H2WA 3FB5A 1NUFA 4YZFF 4Y19E 1CGSH 4KROC 4FQLL 4OZ4B 5EOQH 5D1ZD 4Y5XB 3MLZL 4S1QH 1SM3H 2X1OA 3ARGC 1BFSA 4HF5L 5FDYA 3O6KL 4LVOB 3CX5J 4K3GA 5CJXC 1CFQA 3BISA 1C16A 3SQBA 4TUJA 5IKCB 5IG7A 4LDEB 1KYOJ 3V0VB 5JZ7C 1INEH 4G5ZH 2DTML 3MYJA 5D7SL 4G59A 5EO1A 4XPTL 3B5TA 1WTGT 2IBZY 5MP6L 2VSCA 4PUBH 1FZOA 3RRQA 1DFBL 2LTQB 3QAZB 4YDKL 2O5ZH 1RK0A 1YQ2A 1IKNC 2PR4L 3ARFC 3V0WL 1AGFB 1AO7E 4AMKL 5TDOB 5KVFL 1FQ9C 4JDTH 4XP4H 4HDIA 4PR5A 5I2IA 5BXFA 4NPYA 2H1PL 2YPKA 1TZIA 4QXGL 3I02B 4JANA 5DRNB 3KPOB 1C8PA 2DOCA 5D72H 5TF1H 1XZ0A 8FABB 5EZJA 5DFVD 2AABL 2CIKA 4WWKD 1NEUA 5HHXL 4MA3A 4F7MA 3CZFB 3NH7L 4XTRD 3VFSA 2EE6A 1VDGA 1NGYA 4QGTA 3AGVA 1F58L 3RZCD 4GRLA 2PTTB 4ZUWB 1DE4A 4HK3J 2RFXB 4Q9QL 1N3NA 3BO8B 4AQ1B 3RA7L 5I76A 3LEXB 4G8IB 3RKDC 1KLFA 4HQQL 4CN6A 1CT8B 2DQHL 1F4XH 3BZFB 1KB5B 4M7KH 2DI9A 1NGPH 1RUPH 4U1KB 4NQTA 5FYJE 3EYVA 5EBMB 2AJZB 3PABB 3BE1H 3VU2A 2BNUA 1WAAA 1MCPH 4LK4A 2HP4A 4IRJC 5CD5D 1OWWA 2BOBB 4MXWL 1B4JL 4FFZL 3HCVA 1ES0B 4MA3B 2MWCA 1AQDB 3Q48A 1T1WA 1XF4B 4PV8B 1MCNA 2EICA 2DD8L 2OCFD 5IBLC 3DRQA 5FO7B 1OTUD 3WN5B 3G6DH 3GSOB 2H3NA 1RZGB 1SJVA 1HSBB 5C0GA 2R1YB 4N5EA 4I2XA 4EUPA 4KZEH 4LPXA 5K9QG 3P11H 4UQ2B 2GAZB 5CMAB 3BPCB 2X1QA 2XACC 1JZ4A 3TNNB 5ICXA 1UJ3B 3VI4E 3N85H 5DWUL 2O5XH 4ELMB 3QEHA 1X5FA 2Y07H 1NLDH 3FO2A 1R3JA 3SDXA 5FCUH 3B9KB 4X9FA 5GS0C 1L7IL 2IAMD 4RGOL 3NCBB 1ZLVK 4HGWA 3DV6A 3TYFB 1DCLA 2APTA 5C0AB 4UDTB 4UZGA 1FFOA 1S5IL 2FH8A 2HTKC 2UVEA 4NWTH 3RGHA 3FKUS 5DUML 3VGDA 2EDDA 3O4LE 1NCBL 5EC1A 1V3JA 5DFTA 2R4SL 2C4XA 3FT3A 1TQBB 3C2SA 3UYRL 4H5SB 4ZFOL 1NC2D 1XR8B 4HBCH 4YHOL 1JWUA 2ZOKA 3LKQB 3WXWH 1I1RA 4YLQT 5CZVL 1C5DB 3EDFA 3ARSA 1MFNA 3Q5OA 3GHBL 1JN6A 2I07B 2WAHA 3BYYA 3NN8A 4JN2B 4AY0A 4PLJD 3H0TB 2CKBA 1WFOA 1U8NA 2X42A 1CF8H 5DJYB 2WLZA 3E8UH 4Z76A 1RUQL 1XF2B 1YNLH 5K59F 3LQZA 1GGIL 1QLEH 2FEEI 1F4WL 4LMQE 3UTZA 3HUJE 4LLDB 4GKNA 4X6DF 4M8QB 3REWB 3GJFB 2CQVA 3QDGB 1J8HE 1GSMA 4K9EH 4URTB 3FTGA 1ZA3A 5ISZD 4L9DA 4ZTOL 4NSKB 5EU6D 3T2NL 3NIDE 3F7VA 4U1MB 1U8KB 3I6GA 1OOAA 3X3FL 4KI5D 2BVOB 3ABZA 4M5ZH 3D69B 3LKRB 5C0CD 5AYQA 3S35X 5MEQA 3BP6B 5F7LB 5I75B 4BSWA 2GJJA 2X4TA 4UB0H 5IR1A 4X6CB 1FLRL 1NAMH 2A77L 3QA3A 4HD9A 2Q8AH 1PX4A 4KGLA 4RX4A 2AV7A 1DANU 4FP8H 4J3UA 2FATH 2A1WH 1R3HB 4YO0B 1DBAL 1ZT4A 4UOJA 4MJIB 2F8OA 3HRZA 2MCPL 5KW9H 5T3ZD 3KR3H 4HHAA 15C8L 3TV3L 1MAJA 1A0QH 3MO1A 5TE6H 2A0LD 4YXHL 4ONFH 4PJCF 1ZA3B 1S7RA 5AAMA 3TNMB 4NNXB 3N1QC 5C1MB 2HT3C 4LLUA 1D5ZB 1IBGH 1IMHC 1FL6A 4N8VB 4P46B 1DL7H 3LS4L 5CGYC 3C6LD 3ULSA 5GS1A 3B6SA 3KYMB 4P2RA 4LHUG 5MEQB 1T89C 2DQEL 3PP3H 3O2DA 1A1NB 1FL5A 3CFEB 5DUPH 4KXZI 3IFLH 4MQXC 3TBTB 5HHOD 3BIKB 3P77B 3JV4B 4Q0XL 2EE3A 5I74C 4KTDH 5EG6C 4IOSD 1UVQB 5EU3A 4FMKA 5BS0D 4PJ8A 3C09B 3X17A 5LXGH 3HI6H 3WKNA 4XAKD 4NO2B 1QACA 4HHAB 4OT1H 4C56A 1DUZB 3LKNA 4U1IA 4RRPG 5DO2C 4Z18A 1CL7L 1BGXL 1R5VA 2UZIH 5T33H 4X7CC 3MUGB 1INQA 1AR1D 5DJ8A 1UXSA 5GS1B 3F7PC 4OLZH 1BQHB 4MD4A 3S7GA 1T1YB 4L29A 1M71A 1XH3A 4AZ8A 3BRGC 3GB7B 1U95B 3TPUA 3PF2A 4H88L 1V8HA 4NO0A 3DUUA 5FV2A 3QG6A 2GYSA 4U6XA 1LO2H 4Z7QE 1P84J 3IAPA 3ZE0E 2XXMB 3GJEB 1MHCA 3MLXL 5DJXB 3WFHA 4IRSC 2R2EB 3V5DB 2O26U 4X0KB 2CPCA 4Q97A 5DXWA 3HE6A 4U1LA 2FBOJ 3QFJA 3MRRA 3NTCL 3CDYA 3VDBA 2W38A 1AIFA 2HWZH 4ZXBA 2OJZL 4E42A 4WUUE 3NZ8A 4NT6A 5GGSB 4AEIL 1SEBA 3RHWF 5AD0B 5DJ8B 3ZDZE 1YY9D 5DUBA 4Z7UE 3LQMA 4FZ8L 4ZFZB 1OAKH 4LSRL 2F8XC 4Y4FC 2X4QA 3EOBB 3BKMH 2E7LC 1U8HA 4OZIB 3K0WA 3TT1H 4NO0B 5IB5B 35C8H 5HYSG 3QXWA 4ODVL 3IXTA 2FBJL 3QO0A 1OT1A 3QSKB 3GSRB 5GIRB 4RWHA 1YQVH 3T0XA 4OCSL 5T1MA 4X7SH 1B9ZA 3RWIB 3G5VA 4O51A 3H42H 1OAUL 5I19L 3CFKA 5GZOD 5C71A 4QLRA 4UIKL 3MRMA 1MCWM 4PGBB 3SPVB 4XP5L 1YDPA 4U1LB 4ODHH 3I50H 3PHOA 2F8VA 3RI5K 3DOSA 1FFPB 5D8JH 2RGSA 4NHCL 3V5HB 1S8DB 4MNQB 2NX5A 2VXQL 4ISVB 5KAQG 3R8BB 2Q6WA 5BQ7B 2A73B 4R4FH 4R26L 1IC4L 1NCCH 3VXTA 4N0UE 3ETBF 3E6HA 5FA4B 2AAVA 5L2JB 3NA9H 4OM1L 3KJ4C 1S7SA 3SE8H 2A2QT 3OB0H 3MROA 4FHBD 5FDWA 2OI9A 4MX7A 4KK6D 3T0EE 1MFEL 1MLCA 3RY4A 1FNSH 5IVZB 1WZMA 1FRGL 4WI7A 4P4RB 4WY7H 3KPNA 2X7LB 3MRKB 4MXQA 1E27A 4PJ7F 2BNQA 3VXNB 3K7UA 4N8CH 4LSQH 3DNKA 1OAQL 4JZNA 1S5HB 3H9SD 1BVKA 4HC1L 1UB6A 5INCB 2F58L 2JK5A 5CEXA 3OKOB 4KHTH 3SO5A 5F7HA 3WNLA 4PJ5D 1T7ZA 4HCRA 2VISA 1RIUL 3ULVL 2Q86A 4JFZL 1BD2D 3H9ZA 3FRPG 2J8UB 4TULL 4AIZB 3FMGL 3MZTA 5A2IH 4XVUC 5CZXD 1DLFH 1KENL 3UPRA 3TJHA 4XVTH 1HN1A 2ZSVB 5L7XH 3V4UH 4HIXL 1CDUA 2IADA 2ZJSH 5CS7A 4JQXA 5SWQB 3UYPA 1ADQH 1DBJH 4PB0L 3K4AA 5F1NB 3C60A 5HDLA 5HGBA 2WUBH 4WFGE 1ZHNA 4MNGB 5IVXF 3WUWG 2X10A 3GMRA 4FQIH 5E6ID 2NTFA 5HVFB 1EZVX 4B7IA 2F9BT 1D5MA 4FQ1L 1NFDE 3MJ8A 5D1QD 4XB8A 3U48A 5I1LB 5F7DA 4G9FD 1XGYH 1IE5A 1ZSDA 3IFNH 4RISL 5LGHL 4IIQB 2ZPKL 3OWEA 4LKXA 2CXKA 4F15C 1KLGA 3QUKA 2EZ0D 3T09A 4WI2A 1J0YA 3ARZA 4WEMB 4OTXH 3P4OA 3RIAK 3ROLB 4F8TA 2RAMA 5C0NC 3F5WB 1VFBB 4OLYL 4FQXD 4X4ME 5AZ2H 5FYLL 1FL3A 2HJLB 5D1ZB 4XBGA 3ZZ1A 1AXTL 4DEPB 2J12B 4U1NA 4LLYB 3TVMC 2CJUH 3O45A 5D7KE 4K7PY 2CDEB 5ID0B 4RMSA 5IB3B 2IH3A 3TBSA 4OLXH 1B3JA 4UT6L 1LEGB 2HLAA 4WWKA 5ITBH 1AC6A 3GRWA 4QRPD 2DLFH 4TOYL 4DZBB 2EC9U 4ONHB 3CVHA 3DXAB 1TENA 1BHGA 3LMJH 4MVBD 3CCHA 4Y16C 5I73C 1NUNB 3PWVB 1U36A 2NY1C 4YNYA 4MAUL 3ESVF 3P73B 1RAMA 4X9IA 3RZCA 3CFDA 1ZHLB 2K9UA 1XIWC 3O4OB 1W72H 1YN6A 5DHVH 5HHMB 1MCKA 4WW1A 3VFGH 3NCYP 2ARWA 5HHVL 1JV5B 4UT9H 3MBEB 2J3SA 2ESVD 1WBZA 4L8SA 4WI5A 5IVOA 3NFPB 1HQ4B 4F7TA 1CXIA 3ZKMD 4IOFD 5B38B 1I8KA 4Z5RA 3VXUD 2F54B 4MD5B 5B39B 4LASL 4M7LH 2VDOH 2AK1L 5HVHB 3MUJA 3WO4B 3BGAA 4XPHL 1QLFA 1EO5A 4U6VL 4DK3A 3FFCA 3S3JA 3N0PB 3RWCA 4ZNEA 2EIZA 3C5SA 3HI5L 3BP5B 4XCEB 5C0RL 4CVUA 2Q20A 4X98A 4TTDD 1EHLL 5CBEB 1H3PH 3GSWA 3HC4L 3MJ7B 3X3GL 3X14B 4XMPH 4LRNH 5C0IA 1EVTC 4NP4L 5FIEA 1PLGL 2EDKA 2P7TA 4QF1B 5EUOF 3IJYA 3KYNA 1IGCH 5EDXA 3PWPE 1CLOL 2Z31D 2OTUA 4YC2B 3DUSA 1LHZA 3S37L 2R0KL 4ZPVA 3KS0J 3I6LE 4NO3A 1EJOH 2C3HA 2RCSL 4XNYL 4HKJA 4PJDB 4KQ3L 1QZ1A 1AGCA 2DKUA 2BSSB 4ZFGH 5D2NC 4GRWB 2DQUH 3O41B 4WHYG 4RIRA 2XWTB 4IHOB 2HFGH 1G9MH 1JGEA 1CGVA 3SHSA 2Y5TB 3SO3C 4U6HB 2DQCH 4KDVA 1X5YA 4FFEX 3TO2B 5HGDA 1NC2A 1MEXL 5DVKA 5TE4H 1ZA6B 2BP3A 5I8KL 3ARWA 3RIFK 4PRPB 3PV6A 1OGAE 1WTLA 3PL6C 1NLBL 3W5NA 2HFEA 3RU8H 1X5GA 4RAUB 4OCYH 1NH6A 1U41A 3AAZA 4ODTH 1MVFA 2YEZB 3VFRA 3QUML 2DLEA 1IM3A 3KPQA 4JFYA 5IHBA 1E6OL 2O5YH 1T6WA 4A6YL 3G6JA 3LKSA 3EO0A 3ES6A 3B2UC 2ORBL 4CMMA 2IAMB 3OKEA 4PREB 3TP4A 4G80A 2QSQA 1CIUA 3QUXD 3ECBB 4C55A 2EYSA 1A22B 4KJQC 4ZD3H 2VDRH 4FQQA 1KN2L 3L9RA 3TBWA 2VMFA 2FL5A 2H2SC 1A7NH 3V4PH 4P49A 3BAEL 2WIMA 1I9EA 3OKLA 1FIGH 1INDH 2F5BL 4OZHF 2VLJB 3IKCB 4J6RH 2YD6A 3K4DA 5ISZA 3UJIH 1C1EL 1RU9L 3QCUH 3LH2H 4X4YA 1L7TL 3LSOB 4QRTA 3L1OH 4GLRI 5DD3H 4JM4H 5E2UH 3N9GH 1T83A 3WJLC 4D0CA 4P2OD 3WIHH 1FC2D 2C5DC 3L3JB 1ZVSA 4Y89A 5J1AA 4BFIB 3MRHB 1DVFD 3OL2A 3PXHA 4TUOA 2W60B 3M17A 3HR5A 2WY3A 1AJ7H 3VFWB 1Q9KA 4OBRA 3UC0H 5F96L 1I8IA 1SVZA 4GAGH 1Y18B 3AS2A 2AJUH 5TDPA 1G7IA 2N7BA 4NN5C 5GSRA 3ZT6A 4QGYA 4TQEL 3LOWA 1CE1L 3MOAL 5GJTL 5MHSD 4GAJH 4N1CA 5DHXB 3ZMRA 1VADA 5CGMA 3K8MA 2EH8L 1RD6A 3DGGB 1RZKC 4XP1H 2GITB 5EU6B 4KRLB 5C09D 3VJ6A 2PXYC 4UTBL 4F33A 1A4JB 1J1PL 3KPSA 4KRPD 1WBXB 1K4CA 2GFBA 1GXEA 3RX7A 5DD1L 3V7AE 5C0CB 3C6LA 2ZCKH 3GSNA 3S4SA 5DK0A 3WE6A 4HIEB 1A4KA 1QO3A 2EEBA 2CK0H 1LK3H 2G2RB 4GBXC 3REVB 4K3DH 1HXMB 3O2WL 5DMKB 2RB8A 3MNZB 4I3GA 5CGTA 1MI5D 4TYUA 4WDIA 1I8IB 4QOKE 3FO1B 1VKXB 2Z91B 1Q9OA 1B0GB 4G7VL 1YEEL 3IDIA 2J8OA 4GT7A 1H0DB 2R2BB 1YC7A 2HFTA 4E41D 5DRZB 4G6JL 3QDMD 1DUYA 4XMKL 5JUEL 3U30C 4ODWB 4BJLA 2H32A 5ERWA 4MAYD 3WFEL 3IJSB 5LQBH 1MCOL 5FA3A 3VJ6B 1BLNA 5IIEB 1CG9B 4L8DA 5T1LA 3IF1B 2QSCH 5GRUH 1HCFX 4NDMB 2FJFB 3L5JA 4PJEB 1S78C 4TNVK 5HTSA 3U79A 5I30L 4LCWB 4O2CB 1LEKA 1Q94B 5HHOB 5EFIB 2AK4B 1K6QH 1SJXA 3HG1D 1G6RB 1I4FB 2DJSA 5HI5C 3RTQD 5BS0B 3NIFE 3VWJD 4H1LH 1P6AB 3GMLB 1OD9A 5ADOL 1DQLH 3ULVC 1IGTA 4L8BB 5SWSD 3BW9B 4S2SA 5JW4R 4HS6A 5EBGA 3T08A 1AXSB 1ROWA 4X7TB 1C08A 2DWDB 3B8SA 5HHPB 5FA3B 3WFBH 4BELD 1ZANH 2Y25A 3U36B 4XNZB 1RK1B 1HEZB 2NY0D 1A6UH 4HW6A 4PJ9C 2W0KA 4OQTH 4PTTB 1NBZA 4UBDD 4JR9L 3SCMA 1ORQA 2HH0H 3H9HB 4YX2L 1A7OL 2EYRA 2CGRH 3V4VH 5I16B 1Q9WA 1FFRA 3BKYL 4S1RH 3R8QA 3G6AA 1DJSA 5ACZB 3C5ZB 2DJUA 3F58H 5FGSA 3MCKB 4DUXA 5C86A 4P5TB 1UZ6F 3B9AA 2C3WA 3L6FB 3VFNA 4FMFA 5HI3C 2ZUVA 4K3HA 3F65A 5GRJH 3NOIA 5DJ6A 4XCCH 2X40A 4A2MA 2BJMH 2A9NL 5FYJU 5MENB 2EXYD 2YPVH 3B2VH 5CINH 1KJVB 4X7FC 2VB5A 2HVJA 1FCGA 4WUKL 3BN9C 3INUL 1EAPB 1H3VA 3WS3B 4Y5YB 5L88H 1I7TB 4F58L 1T66D 2VR5A 4P2CG 2FLRT 3WHXB 5EBLB 2CRZA 2JTDA 3L5XL 5EOTB 2H9GB 4GRMA 2G9HB 3EYUH 5E2TL 1A9EB 3DHJA 1MJ7L 3MACH 1P1ZA 1GPOH 5BJTA 5F3BA 5FOBB 4Z78B 3V6BR 1QOKA 1KCVL 3H9SA 4J1UB 1S7QA 3DVFA 4JG1H 2R56L 3SKMA 3IXAA 4S0SD 5TPWL 1NGZB 3ARED 1WUNT 2H45A 4PJ5A 3NCMA 3BESR 2N56A 4X6DA 3D0LB 1BD2A 2BNRB 1JJUA 2YPLB 4YBQC 4LHUB 5E8DH 2APWA 1JPSL 1I9JL 3IDXL 3K8KA 1BFVH 4PRNB 4I2XE 2J8HA 1K85A 1YYLH 1GGCL 1PD6A 2HT4D 2XRAL 2VQ1A 5E99H 3RGVA 3KPPA 4OF8A 3HPJB 3UYOD 3SDXE 5E6IA 1CLZL 4IJ3B 4U33A 1HXYB 3MV8A 4I48B 3JTSA 2G75A 2P4AB 5D1QA 3QEGH 3DVIA 2F15A 3LKOB 2JELH 1JL8A 1UB5A 1YECL 3VA2C 3TIDB 5IROC 4NKOA 5E94A 4PGCB 4PJCA 2W1NA 4EI5D 4I0PB 3RDTC 3T77B 4F2MB 1ND0B 5E2VH 4LSVL 1JNLL 4X5LA 4ODUB 4NNPH 4JQIL 4F9PA 1EEZA 3SBWA 1HCVA 1WJ3A 4FQXA 3T4AA 5IQ9B 3EOAB 1HHHB 2ZG1A 3RPIA 1MHPL 2NXYC 4R96B 5CWSB 1EO8H 1WQVT 4EN3A 5D6CB 2C3XA 4LLAA 2E7CA 3LZFH 4X6CE 3AUVA 5C7XH 3O9WB 4UU9A 4PTUB 1T1XA 1YEDB 4M1CC 3ROOB 1BIIA 4L3ED 4BK5A 4PJAF 4G9FB 5LCVL 2ATPB 4KQ4H 4MVBA 3I2CL 1U3JA 4MJIE 4M1DH 4PG2C 3ZHDA 3WIFB 2P8MA 3KLHC 1I1AC 2G60L 2IWGA 3QIUA 1HIMH 5GGTL 2KUTA 4H8WH 5HYSB 3BP4B 4WHTB 1DANT 1FG9C 4LMQI 1ZT1B 2VC2L 2OTPA 2QQQA 2GSGB 5GS0H 3RWJA 5F1OB 1S7UA 3Q3GB 4HKBA 5DA4A 1AKJA 3VXUA 4P3DA 3A6BH 1NAMA 4ZS6C 4NWUH 3RWDA 2X89D 2V5SA 5EOCH 2QHRH 1OL0A 4QRPB 2OM5A 5IEKA 5FYJL 1RFDH 1MAMH 4LEOA 3MV7A 3HKFA 4I4WB 4V2BA 5JXAH 3O3AA 3RQ3A 4JPKH 4M9OA 2LAAA 2R29L 1MFAL 2R1XB 2X4OB 2FSEA 4OD1L 4OUUB 3V6OA 1UQSA 4WJ5B 4ZUUB 3TYGL 1MAKA 3RUGF 2RIKA 5J89A 4KKBC 3ILQD 2Z31A 2ESVB 1ITCA 1KIQB 3GKWL 1NCAL 3JV6B 4W4NA 5KVGL 1NDMB 3LRSA 3CSYA 4PRHB 3L3GA 3SDDD 5IMKB 5HGHB 1XGTA 1U3ZA 3EJZC 1ETZB 3PNWB 4YGAB 2VXTL 2VXSL 4TUKH 4LLVA 2HFFA 2W65B 4WIQA 1XF5B 3U6RB 3B3IA 1E4WL 3QR2A 3FQXB 3O3AB 3TBVA 3QG7L 4N8PA 4XXCA 1LE5B 4C56E 3VXQA 1KCKA 1JE6A 4TNWK 2AV1B 2MTPA 3RVXD 5EU5A 3CK0L 2XQBL 3QNXA 4WO4D 5AEAA 2MCG1 3DECA 3VXRD 4E5XA 4WNQB 1FSKC 4GRLC 1FYTD 2NY4B 4I1NB 4HSQA 5DF0A 5JHLH 2NCMA 4YHLH 1CICC 4NUGL 4HEPG 3ZT7A 3VFPB 4JFDA 1F00I 5C0DA 2WBJC 3AS1A 3GSUA 3R0NA 2X4UB 4F7PB 1FORL 3WUWB 4RGND 4OZIE 4PGZA 3U0TA 3HAEH 1LO3L 3QUXA 2XTJC 2DLIA 4K71C 1LE9B 5IV2B 1KCLA 3KJ6H 1KG0B 5E8NB 1U8JA 3FO0H 5BRZD 32C2A 1Z5LA 2LU3A 1OB1B 5HDQL 1QYGL 4PJ7A 1JHLL 3U4BL 3KDMA 4ZFFA 5KG9B 1ZK9A 4PJFB 2QQKH 1OPGH 4RDQF 1TZHA 1GC1L 3VGBA 3QFJE 3Q6GH 3BKCL 5D70H 3MUY1 1TMCA 5EZIL 4RBPH 3OAUH 4NCC1 3DX9B 4XPGL 2JIXD 4N5EC 2HKHL 1I3RA 3NIGF 4HZLA 1IAIM 1WF5A 4O5LH 1HQRB 5BVPH 1DVFA 2I5YL 3RWGB 2DQJH 5DVNA 5HJ3B 5F7UA 3G5XB 4ZSOA 2AEPL 5IBUG 5KBNC 1D5BB 3Q6FA 3NA4A 4G8GB 5IVXA 1MCWW 3G08B 1T0MB 5C70A 3VD4A 4ZFOB 1IFHL 1MCQA 5I1JL 4N0CD 5DJDA 3TH3T 1ZEAL 1BZ9B 4L9LA 2GSIB 3HLAB 4JJ5A 4XP6H 5C09A 2XN9B 2X70A 3GSVA 3H3PL 4ZS7L 5H2BA 3RP1A 2R0WH 2CMRL 1FG2B 2FX9H 5CP7B 2NX5E 3I3DA 4UILH 4P2OB 3WHE1 2J8UE 4NQDB 4WFHE 4CMHB 1AGBA 5A16B 5B8CA 4LQFH 1F4YL 1JFQL 4YXLH 1CR9H 3VXPA 4U1JB 3LQAH 1P4IL 1X4XA 2OK0L 3VWKD 3DSFL 1MI5A 5I6XC 5EIIA 2A83A 4KROD 1TVHA 3GI8L 2YXMA 4HPOH 3WFZA 5K9JL 2D7TH 3PWNB 3ARGD 3K46A 2OQJA 4GXVL 4E41A 4J23A 3QDMA 5D2LB 5JOPD 4MNGE 4AENB 4P2YA 1KCUL 5FO9A 4XRCB 4MAYA 1YUHA 4FQLH 5JZ7D 1PW3A 3MLZH 4CVZA 1MHHB 2EDJA 3TA3A 2V2TA 4KRPB 2JF1A 2N1KA 2E9IA 2KZWA 4HF5H 2AQ3A 3UTPD 3ZL4L 3O6KH 1E4KA 2YZ8A 5E08L 1DZBA 4R4BB 4HK0B 2XOTA 2IFFL 1TPXB 1IL1B 2CDFA 4NQSB 3KWWA 1UEYA 2DTMH 5D7SH 4I77L 3ARFD 1HZHL 3L7FB 1QFWM 3HG1A 1VFUA 3RL1B 1A6ZB 5C08D 1RI8A 3P2TA 3RTQA 3VWJA 2BXZA 1FN4B 2VLMD 3C08L 1SJHA 1DFBH 1EGJH 2CLRB 1ADQA 4YDKH 3IETA 2PR4H 2VYRE 2WWKT 3V0WH 2FX8L 4N1EA 2D9CA 4AMKH 5KVFH 1MJJB 4Q2ZA 2ZG2A 1FZMA 3MLVL 4JZJB 1Y6MR 3VFMB 3S36L 4M5YL 1KACB 3QUYC 4XNMB 4ODSL 3UEZA 3MOBL 2YKLL 1QR1A 3ZLQC 3EO1A 2IANA 2XKUA 2X9XA 4GUPB 4Y4HC 1A6WL 5HHXH 5J11B 5I17A 1NJ9A 4AQOA 2DBLL 1G7JA 3NH7H 5EUOA 1V7NL 3RKDD 5DJ2A 5C6TL 1MHEA 1F58H 4Z95L 3V0AC 5E1AA 5SWSB 2EC9T 1JF6A 4Q9QH 12E8L 4ESKA 2JKXA 4PJ8C 5J06A 4RA0C 4F37F 4HQQH 3FFDA 1Q38A 2DQHH 5DK2B 3GBML 4BQ9A 2Q3AA 4NM4L 4IRJD 3VW3L 2VJXA 3K74B 2IALA 3P9MB 3I6KB 2CSPA 4NCC2 5T1DL 4DW2L 3ZKSD 3ERYA 4G42B 5IBLD 3NGBC 2CDGB 1N6UA 2IPTL 4NHUB 3ISWA 4MXWH 1B4JH 1NCTA 1KB9K 3ARPA 3OHXB 4JFXB 4FFZH 4WW2C 4NN6C 1EZVY 3D3VD 3PHSA 1TVBA 3D85A 2DD8H 1X5XA 4LP4A 1W72A 5DHVA 5KSUB 4B7LA 5HYQA 2ICEB 4WV1C 1KPUB 1T04A 3ARDC 3BDXA 2P45B 1UEMA 1UKSA 4JPIB 3LAFA 1KN4L 5GS0D 5HXMA 2BMKA 1ZLSL 1T21B 5DWUH 4W6WB 1T20B 1LO5B 4D0BB 1FNFA 5FF6B 2HTKD 4PJDE 1JTTA 5EZLB 1BOGA 1T5XA 3AREA 5C0BD 2YC1B 5KSVA 1L7IH 1FNEA 4OZHA 1EH9A 4E9LA 4RGOH 2X1XR 4X9GA 4ZNEE 4X9HA 3TBYB 5DVMA 1NBQA 2FZ3B 4NKIL 4XT1C 5F1IA 4QNPE 5J6GA 2EDHA 2W0LA 4OFPA 4GG6F 4PRBB 5DUMH 3X13A 1MFBL 1M7IA 5DTFA 4NRZB 4ONOA 1NCBH 1RZFL 2AXGB 2R4SH 1MQKH 5L2KB 5I66B 1CK0H 3BUYA 3KGRA 3DV4A 2BVYA 3FQUB 5D9SB 2I27N 3UYRH 5CIPH 5D1XB 3P9WB 4AM0B 3IJHA 2FJGB 4YHOH 3ZKNC 4YUEH 4CW1A 4KU1A 3QEQD 2W59A 1HHJB 5CZVH 5K9KB 5FKPA 3GHBH 2O61A 4M03A 1FO0B 3IDYB 4PGDA 1VEMA 3BD4A 4P59L 3C8KA 1GZQB 3GFUA 1FE8L 1IEBB 2Z4QA 4RSVA 3S5LG 1A1OB 1GHFL 1YMHB 4HAFA 1SYSB 3S96A 4YHKL 5J6GB 3B9DA 3V6FB 1KPVA 3DX8A 1RUQH 1QQDA 3NAAL 5GGSY 3K8LA 4QRSB 1I1FA 1GGIH 1F4WH 4MD0A 1BBJA 3V5KB 4WTWA 1SHMA 4CBPA 3D25A 5GGUB 3ZSTA 1CD1A 4ZDHA 1NPUA 1T3FA 4ZTOH 4RAHA 2ERJC 3T2NH 3U0PB 4YHIA 2XA8H 3WFDH 3GMQA 1TQCB 4U3HA 4QO1A 3G6JE 3X3FH 4N68A 2NXZC 2ZOLB 4ZODA 1J05B 3N1MC 4V1DA 2P8LB 2Q7NA 1DTUA 1QSEB 4RQQA 1FLRH 2A6KA 3IDNB 2A77H 3C8HA 1QFHA 1EAJA 2ZNXA 5KVMC 4FZEL 2V5MA 3KPMA 1ZLWH 4JRWA 4EI5B 1TITA 1RJYA 1IAOB 2NQCA 2HT3D 1I1FB 4OGYL 3MRGA 2MCPH 5EU6E 15C8H 1E4XI 2R2HB 3O11A 5CGYD 3B83A 1T2QL 4LEXL 4KI5E 4F7CA 2GY7B 5C0CE 2DYPA 3U2SB 4MQXD 4OGAC 3WIHA 3C60C 4XZUA 3LN5B 1ZS8A 1ZTXL 1FJ1B 4UQ3A 5EC2B 2DQEH 4MA1C 2ZUQC 4L3EB 3E0GA 1X9QA 4WGWB 1M6OB 1X5LA 3TO4B 1R5WA 4KC3B 2VN7A 4Q0XH 3P9LB 4R0LA 3V79C 1YNTB 4PY8I 2CLVB 5T3ZE 5DO2D 4O2FA 1YN7A 5SWZD 4O9HL 2PW1B 2K7QA 3MV9A 4YE4L 1G7HA 5CJBA 3BKJL 3IYLW 3L3IB 4YBLC 4YFLF 5IW1B 1PEWA 1KC5L 3O3UN 4JEGB 3OGCB 3F7YB 1CL7H 4J7RA 4PJEE 5TGBB 1FLTX 1BGXH 5C07B 2P5WB 2I26N 1FNGA 4R7DB 1FP5A 3ET9F 5HHOE 1XGRB 2AK4E 5JDSB 4GKSA 2IQAB 3QCTL 2PCPA 5TDNA 5FFLA 5EU7E 5BS0E 1NMBH 4H88H 2AJ3A 4GKZA 3CFJB 5F1SA 5H94B 3UTQB 4IRSD 2VLRD 4PV9A 4L4VA 3CDGA 3FHAA 4XAKE 3STZA 2J88L 4WTZG 2LE9A 4JLRA 1BZQK 3UJTL 3MLWL 5ID1A 4R9HA 4WO4A 3MLXH 4P5KA 3VXRA 3GMPA 3AXLB 3IAGC 1FNHA 3EYQC 4JFOB 5J1TC 4U6YB 4Y4FD 3NTCH 5JMOC 2SEBA 4DCQA 2N4IA 3T1FA 4O02L 5SX5K 3NABL 2JCCF 1BX2A 3L3OB 3KXFA 3SDDB 1FGNL 1NSNL 2ED7A 1F90L 4GJTB 1FGVL 4AEIH 3ULUC 1KJMB 1QP1A 4DVRL 1KFAL 1A7PL 2MQCA 3VXSB 3O8XA 3QZWA 2R69L 5JA8B 1P6FA 5I1DB 1MQ8A 5FAAA 1N6VA 1UJTA 4H1LA 4OZFG 4ODVH 1RZKH 1K8IA 2FBJH 1S9VA 2X4RB 3H3KA 1E4XL 1OAUH 5I19H 1JYVA 3VXRB 3ZE1F 2FCBA 1DQQA 5BV7C 4DGVL 1FYTB 4UIKH 4JHWL 4QRQB 3UTOA 1X5ZA 2JIXA 4XP5H 4QTHA 4ZUTA 3T4YA 5J6HB 2SEBB 3TZVC 4G3YL 5BMFL 4BH7A 1NAKL 3DRTB 2YD5A 4NHCH 2ZUSA 3BJ91 1T6VN 3Q0HA 4OQTA 4YBHA 4EDXA 2VXQH 2BCKA 2UVFA 3MRBB 3O3DA 4PJGB 3U9PL 3IDMB 4R26H 1IC4H 2WINB 1VGKA 4XNQA 4APQC 5FO8A 3L5WA 1MCBA 5BRZB 1YJDC 4HJ0C 5B22A 4OM1H 3HI1A 3RVUC 1CDYA 1N26A 1ITBB 1VA9A 2UZXB 5B3NA 4F8QA 4N0CA 1XMWA 4POYA 4L4JA 4YAQA 4PB9L 3WNNA 2PYED 4QXWA 1MFEH 1LO4H 5E6YA 4U49A 4PRIB 2MFNA 2W9DL 4D9LL 5IHUL 4KDTC 2E9WA 1CDJA 1FRGH 2NW3B 3TIEA 2X4PA 1B0RA 3HB3C 1HINL 3GKZA 3I75A 4LVHB 4EOWL 4JVUA 2DWEA 1OAQH 4XVUD 4HC1H 4BH7B 2F58H 43CAB 5D7JA 1FVDA 2CO7B 4JRYD 1Q1JH 3BD3A 5A40E 1RIUH 1VFAB 3ULVH 3O3DB 4JFZH 1K5NB 3ALXA 3GM8A 4HIIA 4MNHA 4I5BB 1QSFD 4TULH 3FMGH 1VB9A 3KG5A 3ZYOA 2LV4A 1U8OA 3L5WB 1KENH 3OKNA 5L8JB 3ARGA 2GUOA 1B6UA 1TNMA 4HKXA 2YD7A 5FB8A 5ANMA 1U8LB 4M6ML 4M8VA 4PB0H 2QTEA 5IB2A 4PJAA 3EDJA 3H9SE 4NN7B 3MFGB 2JE8A 3H6JA 4PJ5E 3NVQA 2NYYC 4NQXA 4LNRB 3SKOB 4LVEA 1BD2E 2CO6B 1HNFA 5IFJA 4FQ1H 4FTVD 1WBYB 1XAUA 1I9RL 4GAYA 4X6EA 3SE3A 1IKNA 3ARFA 3VWKB 3D39B 4JFFA 1I3GH 5C0ND 2WIIA 4RISH 5LGHH 2ZPKH 4KROB 4N0YL 5K9OB 5INDB 2FRGP 3EFFA 5I1IL 4MB3A 2P24B 3TVMD 5F9JB 4KMQA 4PRDB 4OLYH 2NY2C 1DBBH 5FYLH 1KLUB 1AGEA 1AXTH 3BH9A 3JWDL 1ZGLP 1QBLL 4MJ5A 3CUPB 4G8EA 2H8PA 4LSPL 3OXSB 4JGJA 4Y16D 1U92A 4QHKI 4G9FE 2NY1D 4OCRL 4I3RL 1LDPL 4NQED 4UT6H 3IFOA 4OLWL 1ORSB 1NGWB 3O3BA 1IAII 1UWGL 3TWCH 1XIWD 3RUGA 3WL9B 2QSVA 4TOYH 3WKML 5KZCD 4U0RB 5C08B 2ADJA 1J1OL 4K3JL 1XGUB 2R0LL 4JHZA 3ULVF 4QXTB 2AEWA 4HZAA 5ALCL 4NBXB 3H3BC 5ICYB 5FUZL 1TXKA 3VMNA 2ADFH 2V7NB 5FK9A 5HHVH 4NQCB 1UGNA 2C1OB 4WFED 4CGTA 4XC1L 1KB5L 1A2YB 5E0QA 4Z77A 3MV01 3R4DA 4QRPE 2I9LA 1QHPA 4M6AA 2NY5L 3WSQL 1P4LB 4IS6A 1UCBL 1A3LL 2HN7A 4F57L 2AK1H 3O3BB 3QFDB 3CU7A 4XPHH 5L8LB 1FAKT 4OFVA 3WJJC 3T65B 4U6VH 1KF9B 3IVKB 4YHPB 4YDJB 1CDBA 3D3VA 4JFEB 3U7WL 3HI5H 1ZHBA 1KT2A 2CLZA 2VUYA 5DQJA 3WS6C 5IBUB 2NNAA 2OP4L 1EHLH 4BQ8A 3HC4H 5M94B 1ZT7A 3MR9A 2ESVE 4WHCA 2YD2A 3PWUA 4NP4H 1UXWB 2AP2A 2HT2C 9CGTA 1H3TA 1PLGH 3JVGA 1LD9B 5MEOA 4IOIB 4PRHE 3S37X 4IRJB 3T2QA 1CLOH 3UPCA 3VXUE 2YRPA 3WYRA 1XF1A 3KLAA 1BZ7A 3S37H 1QG3A 3CFBA 2R0KH 3WIIL 1C5BL 5C0BA 5GRVL 4U3XA 4HH9A 2RCSH 4XNYH 2GK0B 3R1GL 4OCXL 4NYLA 2B1HL 3UXFA 1LEIA 4ELKA 1XT5A 4JCMA 5D7LB 2VOTA 5IT2L 2FIRT 3U46B 3BVNB 3KYAA 4HUXB 1JMZA 1P7QD 3SCMC 4OBSA 3PL6D 3S34L 3QEUA 4JY6A 2B5IB 1QFWI 1XCTA 5DR5L 3VE0A 2V7HA 1H9VA 1MEXH 1ZT7B 1L6XA 4ZUSA 1R0AL 1DDHA 1WV7T 5IMOB 2YHGA 5I8KH 2A74A 3QEQA 4ZPTB 2B4CL 3JTCA 3B2UD 1KTLB 2XZCH 4R3SB 1NLBH 5JO5A 4KJQD 5BOPA 2M1KA 1EXUB 5ACMA 1A14L 3DMMB 3QUMH 1PJ9A 3HS0B 3MRJA 4W70A 4A6YH 5C0BB 2H2SD 2ORBH 4OM0L 5LAXA 3NBNA 5F9OL 1U8MA 1EK3A 1MWAB 1WCQA 4NBYB 1A5FL 4PJFE 3N50A 5J12B 3QBTB 2A6DA 1U8IB 1CLYL 4G7YL 4QT5B 1LK2B 5IFHL 1HOCA 3BAEH 2WBWB 4OD2B 1OGTA 2F5BH 1V05A 4EBQL 5JMRA 4M02A 3TLRA 1KTKE 4HIHB 3BMWA 5JNYA 1C1EH 4PGJA 4JZOB 1RU9H 4XBPB 2IPUK 3HN3A 2VLKD 4DWHA 1L7TH 1F6FB 4WI6A 3LV3A 5IGXL 4U1SB 3QWOA 3VD7A 4LCCA 1CIDA 2E7HA 5D7IB 3HAEA 3AU1B 5LVEA 3E3QE 3V8OA 3DARA 1JNNL 1EEQA 4UAOC 3NZHL 4GXUN 2IH1A 4RNRA 2UUDH 5C0FA 1MCLA 1RPQA 6CGTA 4ORGA 1JYXA 4CUCA 2PXYD 4BA8A 3PUCA 5I1GL 1CE1H 1QEWB 4PGEB 1TZGL 3MOAH 4NUJA 5GJTH 3L3HB 1AD9B 2EH8H 3RHWK 1T89A 2GT9B 4Y19B 4D94A 2EKJA 4UTBH 1J1PH 4FQ2L 5ACLA 2DQFB 4GBXD 5DD1H 3HFML 1IRAY 2MKWA 3PP3K 4YDVA 3RGVC 4JN1H 4XGZB 5CD3A 4HPYL 5D71H 1J5OL 2FD6L 4GOSA 3D2UD 3BQUB 4A2LA 3O2WH 1RZIA 4Q9RL 2EDQA 2DAVA 1PDKA 2ADGA 3AY4C 4G7VH 2Q7YB 1YEEH 1U3YA 4P23A 4GQ9L 4OI7A 4PJBB 2D0GA 5C09E 3OR7A 4G6JH 5JORA 4XMKH 5JUEH 2GJ6D 3FT2A 1S78D 2YR3A 1YPZF 1ED3A 3FO9B 3PGCA 3ALWA 3T04D 1F4HA 4F9PC 4E0RA 3SBWC 4OV6F 1XF3B 1S9YB 1W2KT 1A6TB 2DRUA 3P40A 4JRXD 5LJYH 1H3WM 5I74B 1J9CT 5HI5D 3W39B 2IG2L 1BIHA 5I30H 2I9TA 3ULVD 2YRZA 4EN3C 1MI5E 2R9HC 4P5MA 4LOUC 3J7HA 4X6BB 1X7QA 3OKYA 2AI0L 4ZO8A 5HYIA 4N9GA 4E41E 2BVPA 5SWZB 4AH2A 5ADOH 2X4SA 1W0WA 4JY4B 3ZE2F 2DBJA 1WISA 4MCYA 3PJSB 4DN3H 4JKPH 1KIPA 3EJYC 3CX2A 2VWEE 4PJ9D 2XYCA 3QIUC 4FQCH 4K9EC 1UKQA 3QXDA 3E2HB 2E7LA 4GLRH 4M7ZC 3G9VA 1UKTA 1PKQB 3EGSA 3VFOA 2VABA 2BSRB 1Y0LA 1IQDB 3OKDA 4Y5XC 3W2DL 1J8KA 4F7EB 2FWOB 4MXVE 1JI1A 4LVOC 1A7OH 4YX2H 4OV5B 4G43B 2PYFB 1FVEA 5E9DD 4IRSB 1FZJA 5SWSE 4EVNA 4XCYA 5MI0C 1EGJA 2VLRB 3D9AH 5IBTL 1UM4L 3S5LB 3BKYH 5HI3D 4XB7A 1G7QA 5EZOL 2Q87A 4L1DA 4MS8C 4PY8J 4MCYB 1T7YA 2WM0A 3L95B 5FYLD 3O3EA 2YUZA 3MXWL 3VXMD 2YWZA 4DGIL 3V6OC 3T3PF 1SJEA 4KPHL 5EN2B 1F13A 4Y4FB 3QAZC 1HKLL 1UWXH 4HXBL 4GG6A 3ZHKA 3BN9D 2LU7A 4NHUE 4M93C 3QNZA 4WI9A 3O6FA 4OCWH 5E8OB 2A9NH 3JWDC 4D0DA 4QCIB 4NRXB 1X6LA 4BZ1L 2V5YA 1UFUA 1CBVL 3AROA 4WUKH 2QEJA 4POZC 2OSLB 4UDUA 5A2JH 3INUH 2OMBA 1B4RA 1ZWIB 4POUB 4F58H 3O4LB 6FABL 3BH8B 2PYEA 3TGXA 2IPKB 3L5XH 3VGEA 1E28B 3CH1B 5F7YC 4XNUL 4K07A 2D7PA 5IMMA 2AKRB 3MCLL 1CDCA 3TEUA 3HRPA 3DURA 3PHQA 3LN9A 5E2TH 3P30L 1MJ7H 2XWBA 2L0DA 3KHOA 4LCUB 4PJIF 5F44A 1HWHB 3R06B 3SDCA 1NANH 4YBQD 1KCVH 2E6PA 2HTLC 1B0WA 2R56H 1N2RB 2BRQA 5TPWH 2OZ4L 1I8MB 3WLBA 3FT4B 4JRYA 4OZGF 2OL3B 5F9WC 3KLSA 2ENSA 5CLTA 4ZQKA 1QSFA 5CEZH 3U4EB 5D5MF 4N0FB 2WUCH 3S8WA 1KNOA 1JPSH 1MCHA 1I9JH 2V2XB 3IDXH 4JM2B 3OV6A 4D8PA 1PY9A 3F62A 3HUJB 3QXAB 3FAWA 4PY7B 3UPAA 4NKMA 5DQDL 3WCYA 1PVHA 2XRAH 3EIFA 3W0WD 3ZKQD 4X8JB 4DZ8B 3TPKA 3MNWB 4UTAH 4AT6B 1DN0B 2CIIB 3QH3A 5GGVY 4YK4B 5AYUL 3DIFB 1CLZH 3H9YA 4I8DA 1XCQB 4FQPA 3RDTD 3SJVD 5TH2A 1N5AA 4FTVA 5MERA 2E9BA 1YECH 2F5AL 3WO3B 4HCRL 1ACYL 4YHMH 5C8JB 4BYHA 1JRHI 2FB4L 4NJ9L 4MDJA 3B9KC 2XPGA 2NXYD 1JNLH 4YHYB 5HVGB 2G5BB 5CIPA 2AQ2A 4JQIH 1D9KB 4KJYA 2F53D 2UWEF 4KV5F 3MLUL 4XI5C 2OJEA 3H8NA 1IGYA 4HXAL 4M1CD 3TCLA 1MHPH 4I18B 1GGBL 4KJPC 4Y16A 4ZAKA 3QRFM 4HLZG 4BZ2L 1QSEE 4KVCL 3SGJC 5C9JA 1TQBC 2AEIT 4HFWA 4F15B 1DQML 5GQBA 4AG4H 4QRRD 4QY8B 3KLHD 4Z7WF 1I1AD 2BZDA 3MRFA 4J3VA 2DQGL 1XIWA 3L3DB 5EH1A 5LCVH 1I85C 4J3XA 3I2CH 3UX9B 4GW1B 4EUPG 3MMEA 2QKIB 1SBSL 5GGRB 1WEJL 4Z7NF 3TVMB 4Z7VF 1VEPA 3EYFB 4OZFB 3V2AR 1QNZL 5GGTH 5D7IF 4NCDA 4L3CA 2VC2H 3DTXB 4ZS6D 3BRDA 5LKNA 1P4BL 4L3EE 4Y16B 3HPLA 2NY1B 3VI3F 4MJ6B 3BWAB 4NQEB 5DVLA 3TA3C 3DROB 3QNYB 3AMKA 1HHKA 4Y1AA 3DBXA 25C8L 1E4KC 1M05A 4CADA 5FYJH 3VD5A 4PP1C 3MBXL 3GRWL 3W9DA 1C12B 3QJHB 3CVHL 1F6AA 4KKBD 5FGRA 4IMKC 4BQBA 2R29H 5I75C 3ZTJG 5KN5A 1MFAH 4OB5L 2JCCA 4OI9A 2WWKO 5B3JF 4OD1H 2APFA 5DI8B 1C7SA 4Y4KA 2E8ZA 3TYGH 3QQ4B 1R3IL 4WU7B 1CGUA 2KPNA 3EJZD 1NCAH 3RY6C 5KVGH 2QHLA 5CHNB 4OD3L 1BVLB 5H8DA 4WUUB 3A6OA 2PTVA 3SN6N 2IQ9H 4YQXL 3RWFA 4QHKJ 4Z7UB 2VXTH 4I0CC 2VXSH 3CLEL 3BMVA 4D9QD 4DVBA 4WW2F 1PEZA 4GRLD 1YEHL 4PYHA 3ME0A 5DDHB 3QG7H 1RVFH 4KDWA 4H0HB 1GOFA 1CICD 3T8XB 2GTWA 5KSBB 3CPLB 5C2BL 2BFVL 1I7RA 1OY3B 2XQBH 2WBJD 3CK0H 1KCGC 5DJCA 3OMZA 3GUTA 4TPRL 1BF2A 2XKNA 2AJXL 1JPFA 4G8FB 2XTJD 3MGTB 1CZ8L 8CGTA 5D2NB 4NUGH 3IDGB 4Z0XB 3VXSE 4CVXA 2YSSA 4NO5A 3HNVL 1A9BB 5ENWB 4RGMB 3GEWB 5AG9A 1FORH 5IEHB 5IW3A 3IT8D 4GH7B 2B2XL 1LO3H 1HILB 1YA5A 2RR3A 3EOYG 5LBSL 3BHBA 1TJGL 2VIRB 1W0VB 5EO0A 4N0UB 1EERB 1NUGA 4K7FB 2ICWA 3SGDI 2Y23A 1P7QB 1QYGH 5EBWA 2YBRA 1JHLH 1S9XA 3U4BH 4FXGA 3UTTD 3PL6B 3VXRE 1HSAA 4N5ED 1KIRA 5DJ0A 5HGAA 4YIQA 4JFHD 3UZQA 1FYTE 4BFBD 4K7PH 1GC1H 1FHGA 3T0EB 3MRQA 4PJHB 4PRAA 1L0QA 3BKCH 4KUZL 2VLKA 3BPOB 5EZIH 3TCXA 4XPGH 1CD9B 3EHBC 2HKHH 3MRCB 5GS3A 4RAVA 1MCSA 5F89B 4PJGE 5I18L 1VEOA 3IGAB 1ERNA 2I5YH 5FKAA 1L0YA 1F3JA 1GOGA 4U1HA 5BRZE 1T7WA 3BZEA 2FR4B 4QYOB 4P9HL 1F45A 3LIZH 3PWLA 1JPGA 3CC5A 5KVDL 2AEPH 3EDKA 1RZ8B 4JO1L 1YMMD 2WMPA 2PXYA 3BGMB 5E2WL 1DLHB 2Z35A 3N1PC 1YEKH 1CCZA 4OSUL 4RFEA 1IFHH 1LQSR 1VPOH 2Z8SA 5F7MC 5I1JH 3CH8A 3RWHA 1ZEAH 1A7BA 5I8EB 3VCLA 1KPRB 5T1KD 3F12B 3S3PA 4D3CL 2GCYB 4TSAL 1JUFB 5IHZB 3P4MB 3HZMA 4KMLB 4KI1A 4NZTL 4ZS7H 4DOHB 2AXFA 1U91A 3TN0B 2CMRH 1U3HA 5DEGB 3H7BB 1H5BA 2X5PA 4FQHA 3IU3B 1I3VA 2DQTL 5D6DC 1GJIA 4R2GB 1F4YH 1JFQH 2HJKA 4B53A 3PQYB 3D2UA 3JWNC 1P4IH 4LAQL 3VFVA 3MUZ1 3F6LA 3DSFH 3K3QA 2H6PA 5HHNA 3QQ3B 4U1GB 1QA9B 5CSZA 3T0WA 5IM7A 3KPTA 1R3KB 3T0DA 3GI8H 2BOCA 4BSVA 1MCIA 1S7TB 3MLTB 5K9JH 5H35B 1G9MC 4YHNB 3UTSD 1F97A 3HZVB 5ESVA 4UV4L 4GXVH 1I7ZA 1OF2B 2GJ6A 2WW8A 1KCUH 5E8PA 1TLKA 3OR6A 5BZWB 3HC0A 1KELL 4HC1A 5EORL 4GBXB 3ZL4H 2A38A 5E08H 5D93B 4NC1C 4LBEB 2IFFH 1OSZA 4ODXB 3U7YL 1TNNA 2CR3A 5CEZD 3QIWB 3OF6D 4RX4D 1XGPB 4MA8L 4JO4L 3CMGA 1MRFL 4I77H 4LF3A 1HZHH 2VL5A 1A6VL 1AHWB 4MMXC 5IB4A 3VRJB 3WFHB 5F3HB 3NIDF 1G6RL 5JOPE 3PGDA 3FQWB 4BKLB 4BM7A 3MRLB 4FN0A 1RUML 3QUYD 4YGVB 2V9QA 2OXGA 2DF3A 4S11A 3LDBB 4Y4HD 4X7DC 4ZYKA 1B2WL 3MLVH 3QULA 4L4TD 1QVOB 2HYMA 1KCRL 2VDMH 2Y72A 3S36H 4M5YH 2YA2A 4ETQA 4P2RD 4JRXB 4ODSH 3MOBH 2YKLH 1RIHL 2EO1A 3ZT5A 4JHBA 3BIAX 4NKDB 5C08E 1A6WH 3WDHA 3MGAA 2VLME 4PJ8D 5E9DA 1V7NH 3V9FA 5C6TH 3QB7C 4Z95H 4LLQA 2NW2A 2Y36L 4UMGA 1EX0A 4R0LC 12E8H 1EEYA 4IIQC 4JFQA 1U8QB 3VXMA 2P44B 4PJ9B 5CILL 2YK1L 3GBMH 4OFYA 4NM4H 3W9EB 3VW3H 5KSAB 5ETUA 3Q2CA 2EC8A 4R6UA 4KK8C 3ARBB 1JF5A 1BAFL 3MX0A 5TQ0L 4G6ML 3VGAB 5BW7A 5GSVA 4DW2H 3GMOB 5FM5M 3KPLB 3NMEA 5E8EB 2IPTH 4DEPC 4P4KB 43C9A 3FOMB 2YA1A 3RI5F 3ARDD 3EAKA 3DO7A 1WGOA 1CXEA 4JDZB 2PKDA 5JXEA 1Y6KR 3SGEH 7CGTA 4YR6A 4LLQB 1NFKA 3S97C 3WXVL 1TCRB 4Y5VA 5I9QB 4NRYB 5LWYL 1P7KB 1IM9B 1OAZL 4MQTB 1Q0YL 1NDGB 1KN4H 1UZ8A 1ZLSH 3ALPA 5IESH 1OGAB 2NR6C 5CJQL 2Z92B 1G7MB 1RUKH 4R7NA 3MREB 4L8CB 1TVDA 4G9DB 4DQOL 4N90D 2F74A 2P5EB 4OGXL 4QHMB 3NPSC 4Z7QF 3QHFL 3CJJA 1R24A 3ZE0F 3MBEC 3UAJC 1FH5L 3QDJD 1PKOA 3SDAA 5JHDA 4YDLB 2XA3A 1NC4D 4NKIH 2VE6A 3GMMB 3IDUA 3UJJL 4KJWC 3ZKND 3EYSL 3RBSA 3O8XC 4XCNB 1MFBH 5T5NF 1KB9J 2FIKA 3QP3A 1Q9LB 1XFPA 2EYTB 3EYOB 3C6SA 3WO4C 4K2UL 5I71C 5AUMA 1SEQL 1MFDH 4P0DA 2BVQB 3W0WA 5HYJA 2VR4A 2HVKB 2C7UB 3ZO0A 5TF0A 5C6WH 3B5HA 1BFOB 3L7EA 1I1YB 5JOEA 1T5WB 2P49B 5C0BE 3THMH 1QLRB 1R5IB 3RDTA 1J11A 3SJVA 3BE1L 5HSFA 4P59H 1J10A 1FE8H 1Z3GH 3FRUA 1UCTA 2D31A 4HUNB 1QSVA 2IF7A 1GHFH 2XFXB 3F7QA 3NIGE 3T2PA 4YHKH 1DEEA 1IEAA 1H15B 5IMLA 4PP2B 2DIAA 5FECA 3NAAH 1CE6A 1YNKL 2AGJL 2YRLA 1HDMB 3EFDL 4JAMB 5I1KL 2NXZD 1SMAA 1T4KB 1FV1B 2F53A 3QEQE 4R97B 5JIIA 2P8PB 3I3BA 2UY7A 4RZCB 1YY8A 1BEYL 3QI9A 4QHUB 1JK8A 4KK9C 1CFNA 2A6JB 3OGOE 1IEHA 1F2XK 4M6OL 5DRWB 1WCBB 3QUMA 5JW3L 1K4DB 1RZJL 2Y07L 5FHBL 4A6YA 2FX7L 1NLDL 4UUJB 4MQSB 1ZXQA 3I9GL 3BX7C 5F7KC 1JHTB 2MHAB 1I1AA 1HYSC 5DRXA 3EBAA 2WBKA 1CXLA 5IP4A 4TVSa 2EDLA 4L3AA 4FZEH 3PV7A 1YPZA 5D7JC 1DEEB 3DETC 4H25A 4XPAL 3ARXA 1G1CA 1ODAA 5FYKD 3VRIB 4OGYH 4OGAD 4MWFB 3C60D 3D18A 3RNQA 4HS3A 3CXDL 3FJTA 2YUWA 4MDIB 1G9EA 4Y2DA 1JZ6A 1T2QH 5E03A 5E5UB 5IQ7L 4HBCL 2AS5M 1RJCA 4LEXH 1J8HD 2NLJA 3DYOA 3V7MA 4V2CB 5DJAA 1MCEA 1EFXD 4XH2A 1D5XA 1ZTXH 2HG5B 1NMAL 1RIVL 4QRRB 2YZ1A 4X80L 2JB5L 1XR9A 4Y7MA 3GSXB 3STLA 1HHGB 1A3RL 3U82B 3GGWA 4PJBE 1YNLL 3SE3C 4X5XB 3CDCA 4P9HC 4DN4L 4F3FA 4O9HH 2JJTC 3FB5B 4YE4H 4P48A 3BGFC 4NQUA 3EKCA 3S9DB 5TFSL 4UNVA 1NFDF 3IS1X 1DQJA 1RJLA 5E5MA 2OBGA 1MSPA 1KC5H 2PETA 2Q8BL 4HS8L 2FEDC 3KHQA 1CFQB 2VZ3A 1DQDL 4HMCA 1C16B 1EJ6A 5DEZA 4TUJB 5IG7B 2ZZUT 4HIJA 1OLLA 3MYJB 3QCTH 4UB0L 5EO1B 1L8JA 4MHHI 5E4EC 3S88L 1QRNA 5SWZE 1FZOB 1MNUL 2DKMA 3MRDA 3EYQD 1RHHA 2J88H 4M61A 5DD0H 2AW2A 4HK3N 1CICA 2GKIA 1RK0B 3FB7A 1F3DH 3UJTH 3MLWH 5GGVL 3WNPA 2WBJA 5TE6L 4HDIB 3ULUD 3F8UB 2ED9A 4PR5B 5I2IB 5BXFB 1PKQE 4NPYB 4UV7L 1DSFL 5EIVA 2YPKB 1TZIB 4JANB 5JTWA 2QJDA 4O02H 4LU5L 3NABH 2NY6C 1Z2KA 3D87B 1XZ0B 5EZJB 1FGNH 1NSNH 4M48L 1F90H 2CIKB 1FGVH 5H37G 5IF0A 4DVRH 4H26A 1KXTB 1A7PH 3RIFF 4F7MB 1FCCA 2VLRE 3FFCD 3AFLA 1RV6X 2R69H 3VFSB 1NGYB 3BWUC 1FYHB 4PJIA 4GRLB 3GDBA 4Y0GA 2DLTA 1FZKA 1DE4B 3UTTA 1N3NB 1LNUA 2CD0A 2EECA 5I76B 4KGJA 2YOCA 3TZVD 1AXIB 2P43B 1E4XH 4OZGA 5GPRA 1EFQA 3S4SG 4RBPK 1I75A 4H8WC 4Q6IA 2E7LE 4DGVH 5CLWA 4JHWH 4S1DC 2XTJB 3EYVB 3PIQA 5D5MA 4APQD 5BMFH 2BNUB 3LB6C 1HH9A 1IZKA 1NAKH 3JVGC 4HJ0D 1A7RL 3RVUD 4LSTL 4KZDH 3HCVB 1IAKA 1T1WB 4XNZC 4LL9A 3M8OL 4WRLA 1YMMA 3DRQB 4HBQA 3VG0L 3LN4A 2UY6A 2H3NB 5C0GB 2FJHA 2GK2A 3HB3D 4I2XB 4EUPB 4PB9H 5T1KA 1G9NL 1Z0MA 3PDOA 2W9DH 4D9LH 1LP9F 5IHUH 1UYWL 1K2DA 5ICXB 3DI3B 4JFPA 3FQTA 3QEHB 1WWCA 5FGCE 3FO2B 1EBAA 2DQIL 5EPMA 5DC4B 1R3JB 3AS0A 3SDXB 1KTDA 3C5ZC 2XXCB 1JGDA 4NNYA 1WWBX 2DTSA 1O7VA 5CFHA 2PN5A 2NMSA 4HGWB 3DV6B 5DJZA 4P5TC 2ITCA 3WEXA 5F88A 1FFOB 1REIA 3BKML 4N9OB 2DM4A 4F37K 5DEFA 1YMMB 5HPOA 4FOMA 3TH2T 2BC4A 5EC1B 2PYEE 2ZUUA 4FFVC 3FT3B 3UTSA 1YQVL 2RQ8A 4EI6A 3DLQR 2NYYD 4MGXA 4YFDB 4M6MH 4Z7WA 1JWUB 5KS9F 1OM3L 2ZOKB 3DYPA 4JG0L 1GZPA 1WZLA 4Y5YC 4YDIL 5I1HL 1OAXL 1JN6B 2VQUA 3NN8B 3BEVA 4JRYE 1RMFL 2CKBB 4OLEA 3VMPA 2VXUL 3G04A 4IMLA 3S35H 3T0VA 4Z7VA 1I7UA 1A6PA 1U8NB 2DLGA 4JGMA 3OF6A 1I9RH 2GIYA 1NBYA 4LCCC 4Z76B 3OXRA 1A1MA 2Y5EA 2NY2D 3LQZB 3UTZB 4N0YH 2Y9RT 3BP7A 3QHTC 4GKNB 4TNVF 3WUZA 3QUYA 2PNDA 3FTGB 4RMVA 2E5EA 4HT1L 3QUZA 4Y4HA 3KPSD 3F7VB 4L4TA 5JPNA 3I6GB 2ADIA 2GJZA 3V6ZA 3JWDH 1JNJA 4UI2A 1QBLH 1ZHKA 2WANA 4FTVE 4LSPH 2VDLL 4WFGD 4BSWB 2X4TB 4OCRH 4I3RH 5IR1B 3X12A 1P69B 1LDPH 3BSZL 4ONGH 2VITA 3RVVC 4OLWH 3QA3B 4LHQB 1UWGH 3WKMH 2AV7B 1ZLUH 4PJXA 4IJ3C 4NQVA 1FDLL 1P53A 2F19L 3RNKA 3WMSA 3HTLX 1ZT4B 1J1OH 1KULA 3HRZB 3MRNA 2BY2A 2X2YA 4HUWA 1RY7B 3UMTA 3MO1B 5DQ9A 5IW6A 5ALCH 1S7RB 5FUZH 1G0YR 2D7OA 2KH2B 2VAAA 4I0PC 4YWGL 4LLUB 5T1LD 1FL6B 4P23C 1AO7A 4NQEE 5JQHC 3P4NA 4XC1H 4WW2A 1KB5H 3ULSB 5CBAA 3LRHA 3B6SB 4JKKA 4P2RB 2P48B 3IFPA 2XZQL 3KYKL 2VDPL 1FL5B 3VXOA 1CFSA 2NY5H 3WSQH 1UCBH 4X5WA 1A3LH 4F57H 1RZJC 4WV1A 1OTTC 4CJ1A 5EU3B 3QJFA 3SKNA 3IFNL 3LQAC 4PJXB 3QDHA 4PJ8B 3ARDA 4OKVA 4YH6A 2HT2D 2FEEL 2ZP0T 3O9WC 5FUCC 1DBML 3U7WH 2AJSL 2WK2A 4W81A 5GGTA 4XX1G 4NZRL 4ALAL 5BVJA 3FOLA 4C56B 3G5ZA 2OP4H 5GXBB 3WNMA 3LKNB 4WFEE 4U1IB 5E00A 5MEPA 4JO2L 5JW5A 4MCZA 1CFVL 1R5VB 4AEEA 1INQB 2OLDA 1UXSB 3AB0C 2MOVA 4MD4B 3WIIH 1C5BH 3NIFF 4L29B 1M71B 1XH3B 5DT1L 3SCMD 2BSTA 3TPUB 3R1GH 4OCXH 3QDJA 2B1HH 3LPWA 1NC4A 3DUUB 4LCIL 3QG6B 1CVSC 1J86A 4RMWA 3TFKC 5IT2H 3BN3B 5KSBE 4U6XB 2DS4A 2LQRA 4ZO7A 1JF1A 1MHCB 3S34H 2Q76A 5DR5H 5ICZA 3MUHL 5KJRL 5DMIL 1A02N 1R0AH 3HE6B 5D2NE 3MSPA 3QFJB 4MQ7A 1B90A 3MRRB 5DGQA 3VFGL 1UM5L 2B4CH 5BZDA 1U6AL 1AIFB 3MLYL 4ZXBB 4E42B 3NZ8B 4NT6B 4JY5L 3BXNA 1SEBB 1A14H 3DI2B 4RMRA 5DUBB 4BSJA 2I24N 2R1WA 3D48R 1FO0L 1ZGLA 3ZE1E 5CKAA 3TC9A 2X4QB 4OM0H 1UWEL 4X99A 1U8HB 3FCTA 5F7FA 3O6FC 4FS0A 2V2WA 3HZYA 1A5FH 2XNAA 3IXTB 3QO0B 2IPUG 4G7YH 1CLYH 2PTUA 3FHQA 4QHLA 2ID5A 3OKMA 4AEHL 5T1MB 4IM8A 4PJHE 3G5VB 4O51B 1PZ5A 4U05A 3CFKB 1H3PL 4J12A 3V8CA 3LD8B 3GJFH 3MRMB 4HWZA 5J7CC 4W6XB 3CFCH 1YDPB 1AGDA 3PHOB 1UH4A 3GIVA 3JV5A 2CUIA 2QR0A 3JTTA 2GTZA 3MNVA 1VESA 1BWWA 2XIDA 1MLBA 5IGXH 1PSKL 2NX5B 5C0EA 1WZKA 2Q6WB 5JPMA 3MGOA 2VTFA 2ZCHL 1JNNH 2NY4C 3VXTB 5K33A 3SDCC 1PBYA 3NZHH 2RJMA 3E6HB 4RFOL 1MCDA 1ZLWK 4ELMF 1IKFL 1S7SB 3MROB 2OI9B 2DMBA 5FDWB 2ERJB 4MX7B 3RFZC 4M62L 5I1GH 4CNIA 1E6JL 1TZGH 2L7JA 4KKLC 4ZUVA 1MLCB 3NCYS 2NXZB 2VLKE 4DOHE 4LARL 5DD5L 3RGVD 3KPNB 1FVCA 5ESQA 1E27B 1A47A 1J8HA 2BNQB 2OXHA 4KHXL 3P0VL 4JZNB 1S7WA 1BVKB 3OB8A 1UB6B 2VH5L 3DO3A 3MV8D 1EFXA 2JK5B 4OCYL 5CEXB 3PQYE 2WQRA 3HFMH 2VISB 2O5YL 3C9NA 2Q86B 1SYVA 4HPYH 1J5OH 2FD6H 1CU4L 4BH8A 3UPRB 5F1KC 4Q9RH 2ZG3A 3EZ8A 4JDVA 3L3KA 5HYEA 5DYOA 4LDOB 2UYLA 4ZOBA 1IGJA 2ZSWA 2IADB 1BREA 3SDXF 4D9RD 3C60B 1FFNA 5HGBB 4GQ9H 2MPAL 4YPGA 1ZHNB 2FO4A 2QQLL 3ZYJA 3STBA 2ZUQB 4X83A 1BJ1H 3GMRB 3LH2L 4P2QD 2X9WA 4DGYL 2R9HD 4EN3D 5JIPA 1F11A 1U93A 2NTFB 3O0RL 4LOUD 4Q74A 3RWEA 1UACL 5EB9A 1G9NC 4JM4L 1D5MB 4S1SH 5F70A 3MJ8B 5EUKA 5F7DB 2WNGA 3UBXA 1JPTH 2IG2H 4Q58C 3JWOL 3MODL 5I0DA 4ZAKC 1ZSDB 4XMLL 1S7VA 4LKXB 1OWRM 1KLGB 3QUKB 5C0JA 3MRIA 4M00A 3EJYD 2AI0H 2AJVL 2JB6A 3QIUD 3K2UL 3P4OB 1HH6A 4K8RL 2YD4A 2W0FA 3FB8A 4HUVA 4X6CF 4GAJL 4QOKD 3DVGA 1FL3B 2VZVA 4XBGB 5DHYA 1PG7X 2VKXA 3BDYH 4U1NB 4JRXE 1MRCL 1J87A 4MHHG 3O45B 3VG9B 3SDYL 3QIBA 4X9BA 4HKZA 1AKJD 3ULVE 2IH3B 3TBSB 4TNWF 2ZCKL 1JGVL 2HLAB 4PBWD 3TH4T 4WWKB 1G7PA 2VRAA 1U42A 4EIZC 3CVHB 3ILPA 1HWGB 3W2DH 3MV7D 3CCHB 4JO3L 1WIPA 4MS8D 2XWJA 4YNYB 1S7VB 4WU5A 1OP3H 3RZCB 2J5LB 1MIEL 3CFDB 5IBTH 2JB6B 1UM4H 1TPXC 1YN6B 4MSWA 1F02I 5EU4A 4BK4A 1NBVL 4D2NA 3TZVA 3HMXL 5EZOH 4WW1B 2H26A 4Q6YA 4HGKC 4HV8A 1B88A 4CU6A 3MXWH 3BFOA 1WBZB 4L8SB 4DGIH 2XKSA 5DMGC 4KPHH 4F7TB 1ZKAA 5DZNA 2JLLA 4Y4KC 5GGRY 1HKLH 1QRKA 4APQA 4POZD 1I8KB 1D6EA 4HXBH 4Z5RB 4Q7DA 1JNHA 2KQMA 2X41A 3T2OA 3OZ9L 4LPVA 3BZ4A 1QLFB 5E9DE 4BZ1H 3FQRA 5F21B 3FFCB 3MQIA 3FONA 2LVCA 1CBVH 1W8OA 3RWCB 3SY0A 4HLJA 2EIZB 3C5SB 3WD5L 4KDTA 4HJGA 3RX8A 4X98B 5BV7B 3DX7A 4WHDA 3VFTA 3GSWB 1M7DA 6FABH 2I60H 3VXME 5C0IB 4YEEA 2HTLD 5J11C 1Z9MA 4M1GL 5DD6A 4XNUH 2P7TB 5JLZA 3IJYB 3KYNB 1NCWL 5I8CA 2OTUB 3P30H 1TFHA 3BEWA 2HRLA 3MJ9H 3DUSB 4JFDD 5BCAA 2P5EE 5GS2H 1CXHA 4ZPVB 1KIUA 2CRIA 4NO3B 5DSCA 4LSSL 5C92A 1A6UL 4HKJB 1MUJA 2ILLA 2OZ4H 1AGCB 4OF7A 1JWMA 3KNBA 2ED8A 4I13B 3CXHK 1VFMA 2HH0L 4RIRB 4YXKL 1WITA 1JGEB 1II4E 5FV1L 4PLKC 3KYOA 3PP4L 1FAIL 2OS7A 5HY9A 5HGDB 1NC2B 1GOHA 5CEYA 2XV6B 5DQDH 3OAYK 3F58L 4YJZL 3DX6A 3PV6B 4OZIF 1NFIA 1S9WA 2HFEB 4UIMA 3GK8L 3AAZB 3S6CA 1D6VL 4QHNA 3VFRB 3MFFA 5FXCH 1IM3B 3C5JA 3KPQB 4JFYB 5AYUH 3BZDA 1BBDH 3G6JB 3LKSB 5GRJL 3EO0B 3ES6B 4CMMB 1GIGL 2EXWC 3B9KD 3OKEB 4G80B 2V17L 3BIBX 4XWGL 2EYSB 3LVEA 5TQ2L 2F5AH 4R8WL 4FQQB 5C0AD 1MREL 3L9RB 1ACYH 3TBWB 5F6IB 2FL5B 3TT3L 4XI5D 1KBGH 2FB4H 4HX1A 4LKCA 3HE7A 3EZJB 3OKLB 4NJ9H 1N6QL 2WV3A 4KJPD 3W0WE 3EUUA 1T1ZA 1CN4A 5ISZB 1SQ2N 3KPRD 1C5CL 3J8F7 4X4YB 3MLUH 4LDLB 3EYUL 4HXAH 3HA0A 4QRTB 1W8NA 3GHEL 4C83A 4XHQA 4ETYA 1GGBH 3SJVE 4D0CB 4JGUA 2IMMA 4NBZB 4Y8AA 4BZ2H 1ZVSB 4KVCH 2C1PA 5J1AB 3D0VA 5D1XC 3BPNB 1DQMH 1KEML 3MA7A 4TUOB 5J9PA 3M17B 3HR5B 1U3HC 2DQGH 1H5BC 1Q9KB 1NFDA 5TDPB 4XCFL 1NMCB 1G7IB 5ESAA 4DKEL 3IDYC 5GSRB 4H0IA 5I1EL 2C4FU 1BJ8A 2F53E 1BFVL 1LMKA 1WEJH 3NFNA 1VADB 5A1AA 1JI2A 4LVNB 1YYLL 1H8OA 4LAJH 3QDGD 5J0BA 2J8UF 4OAWA 3PDGA 3TA3D 2Z93A 1X4YA 3KPSB 4F33B 1K4CB 2GFBB 3SQOH 2ITDA 1P4BH 3MYZA 5IFAL 5E24E 2ZUWA 3C6LB 3HNTL 4QRRE 4PP1D 3GSNB 3WJJA 3GZKA 4DFIA 3S4SB 1U58A 2A6IA 5DK0B 3WE6B 3SGKC 3ZDXE 1A4KB 1QO3B 3GNML 4X6FA 5IJVA 3WS6A 3UO1L 1YPZE 1OD7A 5TE7L 25C8H 1TQCC 1JGLL 4WDIB 3VD3A 1TIUA 3MBXH 2EDYA 1MIML 1Q9OB 2ARJA 3GIZL 3IDIB 5E2VL 1OP5K 1T22A 1VGEL 4AIXA 3FB6A 1NGXA 4MJID 4NNPL 1R3LA 3DWTA 1DUYB 3M1BA 1N8ZA 3OKKA 2RHEA 4GW5A 1PQZA 2EDXA 2H32B 5ERWB 1T7XA 1R3IH 2EKSA 1BLNB 4TSCL 4L8DB 5T1LB 3LS5L 5T3XL 3OAZH 4OFIA 2VR9A 2Y7QA 4XXDA 1T03L 4LLMA 1ACZA 3ZE2E 2IAND 3OX8A 5SX4I 3JBG7 4OD3H 1NCUA 1QBML 4LCYA 2E8YA 1LEKB 5HHQA 4LPWA 1QFPA 1HNGA 4JPWL 4YQXH 4KWUA 2ZWLT 2VAJA 2VERN 3X11A 5JW4M 5IB1A 3CLEH 4GRWH 2R4RL 1IGTB 3VFUA 1P9MC 5HPMA 1YEHH 3QCVL 4S2SB 2DIBA 3GO1L 4GG8A 4HS6B 4KFZC 4WI4A 1RZ7L 1QR4A 1HIML 1C08B 2XT1B 3TO4C 2D0HA 5C2BH 2BFVH 3FQNA 3RJDA 1VENA 3RKPA 2ATKA 4TPRH 2EIDA 4FXKA 3C2AL 2ZKHL 5GS0L 1CZ8H 3ARUA 4J4PC 3CGTA 4FFYL 4PG9A 4JB9L 3PWPA 3T1WA 1NBZB 1Z6JT 1G7LA 5DS8A 3SCMB 1ORQB 1CD0A 3OPZH 4D9QE 5CUSL 2B2XH 2EYRB 5LBSH 5BW7C 1LP9A 3HR6A 1TJGH 2HJFA 1MWAL 7FABH 1Q9WB 3D85D 3MXVL 4HMDA 4O4YL 1HHIA 3G6AB 1EBPA 1UADC 3EHBD 2XTJE 4S10A 5EO9A 1O5DT 3DVNA 5JXEC 4KUZH 3VFNB 5LGJA 1WAAE 4K8RC 4QXUL 4Y5VC 1KUMA 2Y6SC 5DJ6B 1AP2A 5DZLA 1KJ2H 1NEZA 4LQ1A 5F71A 3GSQA 2DM2A 2J1KA 4HUMB 3ARRA 3U9UA 1FIEA 1HI6A 3A6CL 2HVJB 1VACA 2OTWA 4P9HH 5KS9A 2UUDK 5KVDH 3UTTE 4JO1H 2IMNA 4LLWA 2PO6C 4JFHE 5J13B 3SDAC 4OZGE 2GY5A 1T0NA 4PJDF 4GRMB 3QRGL 1MJ8L 4D3CH 4TSAH 1P1ZB 4GRWF 4JREC 5BJTB 5F3BB 4GSDL 4UAOB 4NZTH 3H9SB 1MH5A 1S7QB 4CU8A 3SKMB 4LGPB 3IXAB 4PJ5B 4X6DB 3FAXA 3EDEA 2DQTH 4MNQD 4C58B 1BD2B 3VH8A 3AY4A 2MQ3A 4QRUA 2YD8A 3VA6A 1YMME 3P3YA 4LAQH 4O2EA 1T0PB 2PW2A 2EDNA 3MRPA 5F8QC 4FXLA 3VRLE 2X4NA 1X5KA 3G5YA 3QWRA 1ZE3C 3QO1A 1U8PA 2VLLA 2VQ1B 4UV4H 5CCKH 2ZUXA 3RGVB 3KPPB 4P2QA 5B38G 4UNTA 5E6IB 3HZKA 5GS2D 3OAUL 1KELH 1K8DA 3QZWG 3MV8B 4J8RA 2C3VA 3JTSB 2G75B 4KKAC 5D1QB 3QI9C 4V1DD 4H1LG 4P57A 4HG4J 1UB5B 4OLUL 3U7YH 4X4XA 3MJGX 4AK1A 4NKOB 1Q8MA 5E94B 1P2CA 1F6LL 4PJCB 1N59A 3O2VL 4EQ3A 2R23A 4MA8H 4JO4H 3IDJA 4LVHC 1MRFH 4WFHD 4PIRF 1A6VH 3UTSE 5ITFA 4GAFB 2W07A 2CKNA 3SGDH 1G6RH 3OJDA 3OJMB 2VXVL 1EEZB 4P99A 4Z7WE 3G6JF 1CFTA 4FQXB 4NC2B 1RUMH 4QOKA 3T4AB 5C3LD 4NZDA 3RPIB 4ORZC 2DYPD 1KSRA 1IGFH 2NZ9C 4OZ4A 4Y5XA 3U4AA 4EN3B 4HFUL 1B2WH 2P1YA 1KCRH 3ZDYF 5HDOA 4Z7NE 4UU9B 4Y2DC 1S9KC 1IARB 1T1XB 5CEZE 1BIIB 5IKCA 2ZUTA 1RIHH 3V0VA 1CI5A 4MS8A 1Q0XL 2KKQA 2HKFL 2P8MB 1OAYH 3VI3E 3QIUB 3MV9D 3CSGA 1O0VA 2NY3C 2Y36H 4KK8D 1UM6H 4L4TE 1AGFA 5AWNH 5TDOA 4P2RE 2OR9L 5CILH 2YK1H 3JV0A 3RWJB 1S7UB 1UWXK 4HKBB 1U2CA 1AKJB 3VXUB 5B3JE 4P3DB 3I02A 1NAMB 5DRNA 1BAFH 4PS4L 5MI0B 4G6MH 5TQ0H 3RWDB 1EEUA 3KPOA 5I15L 8FABA 2R0ZL 1N5YL 4PJXE 5IEKB 4KTEL 4Z0BL 4LEOB 3MV7B 4U6TA 3P0YL 3DXAD 4GFTB 5CSGA 3CZFA 4L4VD 5JW4Q 2FSEB 5IJKA 4PJEF 1UQSB 1EGJL 2PTTA 2ZUYA 4ZUWA 2NR6D 4TSBL 4KKCC 2RFXA 2CUMA 2Z8WC 3BO8A 3WXVH 2XI9A 3LEXA 4G8IA 4U0RC 1EMTL 4M93B 5HHMD 1CT8A 5LWYH 2XQYG 1OAZH 2Z31B 4WVRA 1Q0YH 4LIQE 5F9DC 1XGQA 2QADC 3BZFA 1KB5A 3MBED 3UAJD 3LRSB 4XVSL 3CSYB 3DJ9A 3KXFD 3L3GB 5CJQH 4U1KA 1MPAL 1XGTB 5EBMA 3TPUE 2AJZA 3PABA 4KJWD 1PY4A 4DQOH 2F54D 4OGXH 3O8XD 4GQPH 3QHFH 4LLVB 2HFFB 2OL3L 2BOBA 1FH5H 1K3IA 4OFKA 3B3IB 1ES0A 2B20A 1AQDA 4YFLI 3TBVB 2V9TA 3ARYA 3SKJL 3UJJH 1XF4A 4PV8A 3EYSH 3VXQB 5KVEL 1OT2A 5FO7A 3WN5A 3GSOA 1LILA 1I8LC 5EU5B 1RZGA 1HSBA 4CAGA 3QNXB 1BWMA 2R1YA 4E5XB 4K2UH 1SEQH 2EE9A 2E9JA 4UQ2A 3RL2A 2GAZA 5CMAA 3BPCA 2W9EL 1BMGA 5F9WB 1XGQB 3TNNA 1VCAA 1UJ3A 4JFDB 4N90E 5C0DB 1H8SA 4ELMA 3GSUB 1J0IA 2AERT 5BO1L 4Q6IC 3B9KA 3QDJE 3U0TB 2HRPL 3QUXB 4TVPH 1LGVA 5E6ZA 3HC3H 3TYFA 1U8JB 32C2B 5C0AA 5KANI 1Z5LB 4UDTA 4GMSL 4PJ7B 4HEME 3KDMB 4KK9D 4ZFFB 2HLFC 1RSFA 1YNKH 2AGJH 1TZHB 3EFDH 4HWBL 3SGJA 5I1KH 3KPRA 5JIHA 3IB4A 4H5SA 1TMCB 1XR8A 1MELA 1BEYH 1HYSD 4HUUA 1I3RB 3RL2B 4PRPD 3LKQA 4HZLB 4RFNC 1C5DA 1I85A 4M6OH 3N1GC 2B5IC 5JW3H 3U1SL 1RZJH 2I07A 5FHBH 2FX7H 1DVFB 4JN2A 1WSST 3I9GH 5D7JD 4FNLL 3H0TA 3DETD 5HDBE 5KTEL 4ZSOB 4XHJC 5DJYA 3Q6FB 4EZMA 5IVXB 3DMMC 1JZ7A 1XF2A 3GBNL 5DJDB 1JTOA 4XPAH 4LLDA 4C54A 4L9LB 4M8QA 3REWA 3GJFA 1A7QL 1MQKL 4J3OC 4JJ5B 2KL6A 3QDGA 2BNQE 1CK0L 3CXDH 3KPRB 2VLJD 5C09B 2EE2A 1X6NA 2X70B 3GSVB 5H2BB 5IQ7H 5J12C 2VDQL 4NSKA 5EA0L 4YUEL