1NAMH

Murine alloreactive scfv tcr-peptide-mhc class i molecule complex
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
275
structure length
275
Chain Sequence
b'GPHSLRYFVTAVSRPGLGEPRYMEVGYVDDTEFVRFDSDAENPRYEPRARWMEQEGPEYWERETQKAKGNEQSFRVDLRTLLGYYNQSKGGSHTIQVISGCEVGSDGRLLRGYQQYAYDGCDYIALNEDLKTWTAADMAALITKHKWEQAGEAERLRAYLEGTCVEWLRRYLKNGNATLLRTDSPKAHVTHHSRPEDKVTLRCWALGFYPADITLTWQLNGEELIQDMELVETRPAGDGTFQKWASVVVPLGKEQYYTCHVYHQGLPEPLTLRWE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BM3.3 T Cell Receptor alpha-Chain
publication title CDR3 loop flexibility contributes to the degeneracy of TCR recognition
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 65
structure length 275
sequence length 275
ec nomenclature
pdb deposition date 2002-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1namH02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1namH01
2CDEB 4OGAC 1MCKA 4PJAB 3D25A 3OKDA 5E00A 2YC1A 3WHE1 2BNQE 5E6IA 4RFOL 1VDGA 3ZDXE 1BIIA 2DLGA 4P3CL 1M7DB 4ZMAT 1R5WB 1GL4B 2Q8AL 2GK2A 5CJ5A 3ZDXF 3E2HA 3P30L 3JV5A 2YD7A 1DUZB 4X6DF 5E9DD 4GJTB 3GHBH 1ULVA 2X9WA 5E1AA 3VXPB 2AQ3A 2VZTA 4JHBA 2VZUA 3OKNB 3L7FA 5HYIA 2CR6A 4D0BB 3OKLB 5EU4B 2OBGA 2FO4A 4PJXB 4JKMA 3SKJL 2HLAA 4PLNC 1FZJB 1CLOL 4WW2F 1U8LA 2ZUTA 2OP4H 1P7KA 3CSYB 5IJKC 4PLOB 3P0YH 1QVOB 4ODTH 3MLWL 2D0HA 3I6KA 3D0VB 4U1MA 2GFBA 4XP5H 4H26A 5C0GB 5CGMA 5KANI 1NDGB 4OD3L 2X42A 4WGWB 5LBSH 2CRZA 3VE0B 1XF4B 2ZPKL 5CSBA 2ITDA 3UTZB 4JQIL 1IL1A 2FNBA 4F15B 3O8XC 4FNLL 3HUJA 4JVWA 2BNQB 3ARGC 1WK0A 2VH5H 1KN4L 1EH9A 4N0UE 3WN5C 3ARBA 4Y2OA 1AGEB 1CZ8H 5DRNB 1G7PB 4PJCE 3BZ4B 3H2WA 1BWWA 1KG0B 3MLRH 2IQAA 4JZNB 1T1ZA 3RI5K 4PJCF 1FVEA 2I24N 5FGRA 4EDXB 1JGEB 1IGML 3GHEH 4F7TB 3VFPB 2DAVA 3RVTC 2CKNA 1AGDB 4WDIA 4CN4A 5D2LE 5C6PB 4WW2B 1BZ7B 1LGVA 1GOGA 4F58L 1HILB 3B4NA 5I1DA 5BRZE 3GSNH 2AI0H 4AIZB 5ENWB 5IVXA 2AV1A 4R4FH 5DTFB 2C1PB 3FQTA 1Z9MA 3MRHB 3QUYD 1OSZA 5HGGS 1WV7T 3F6LA 2BK8A 5HHOE 4Q9RH 3N85L 4OT1L 1KB9J 4XVJH 2GSGA 3PJSB 3ZHDA 1G9MH 1NGPL 5J4MA 1BFVH 4N0UB 4ACPA 1YEIL 1QACA 3OG6B 1DBKL 1FYHB 4UOJA 5TQ0L 4EBQL 4PJCB 1XEDA 2R29H 5IB1A 5FYLH 3MRDB 1TNMA 1MIEH 4UILL 5FEBA 4LLWA 1OGTA 3MR9B 4Q74A 2N56A 5DUBA 4K3DL 1FNAA 5D2LB 1MCJA 4OLEA 1HE7A 2D3VA 5K9KB 1ZANH 2H9GA 3K8KA 1DQTA 2X40A 3IAQA 2IALB 4WUUE 3ELAT 5C0CE 2XWTB 4RFNC 1WC7B 2AEQL 2F53D 4WNQB 5GQBA 1CE6A 5BRZB 2YSSA 1LEGB 5KSBA 1NLBL 1P7QD 3DX9A 3HC4L 4I0PD 5IR1B 4NZRL 4HGKC 3T04D 2E9JA 3QUYA 4JN1L 1YEEL 2VZ1A 3QUZD 4PREA 4OKVA 4X4YB 5HHOB 3O3AB 3QFJD 3UTPD 4PTUA 4M93C 1ZLWK 2JJTA 3V7AE 3MSPA 3U9PL 1MFDH 3OR7B 5H94A 2C9AA 3OZ9H 4U31A 2HKHH 2QBWA 1MCEA 5FXCH 5L7XH 2PTUA 3V0VB 1TZIA 4I18B 4HIHA 4HT1L 4S1DC 1OF2B 4TN9A 1NDMA 2QEJA 1NC2B 5FO7A 4ODSH 1OB1A 4A6YH 3U79A 1LO3H 4LLQA 3VW3H 1HHJB 5F72S 3MREB 5ESVB 3WCYA 5F1KC 4R0LA 3L9RB 4XPHH 4O2FA 4WUUB 1V7ML 4KAQH 4BH7B 5C0CB 2F53A 3LV3A 3T1FB 2DQJL 2Q3ZA 5DVNA 1MHCA 2FD6H 2IPTL 3UYPA 3DX6A 4H0HB 4I0PA 4RWYL 1S9WB 3VD5A 4JFZH 2BVTA 3AB0C 2Y6SD 4OM0L 1JYVA 5DQ9A 4R4NC 3OQ3B 3QUZA 3BPLC 3TBVA 5M95B 1E6OL 1AE6H 2XQYG 4MVBD 4AJ0A 4F2MB 1FL3B 2CDFB 3CFEA 3QFJA 4NZDA 5HHVL 5C3LD 3BWUC 5DJCB 2GQHA 1R3IL 4HIEA 3G9AB 3P4MA 2JK5B 4LSQL 2OLDA 1KC5H 5M7QA 3D3VE 3ARDB 1QFPA 2B8OT 4JCMA 3WHXB 2CXKA 3K74B 5IKCB 1E4XH 4O4YH 1QHOA 1B4JL 2NZIA 3C6LC 3VGEA 4I0KA 1OAYL 1XCTB 4LVHB 5DQJB 5EH1A 4H8WH 4JM2F 1H9VA 1MWAL 3GJEA 1QBAA 1X5HA 3BZFB 1ZA3B 2MHAB 3NA4A 1HHIA 2V9TA 3WIHL 2EXWD 1MFAL 3I3DA 2Y7QA 1T66C 4NP4H 3O9WD 2H3NB 2WBKA 4JFPA 3ZYIA 4IMKC 5JUEH 3WNOA 3LMJH 4N8VG 1OAUL 3T0XA 1CXEA 4U6VL 4NQTA 4HWBL 5L6YL 1KCLA 1R5VB 4W4OA 4DN4L 2A73B 3WXVL 5F6HJ 5GISL 4MVBA 3OF6D 3SE4C 3EO9H 4WO4B 3BKYL 1OTUD 3U7YH 2XZQL 2DQDH 4JFXB 5T1MB 3QUXD 3S34L 3D3VB 1J0ZA 5D1ZB 2C3XA 4JO4L 3DRTA 4X6EB 5D7SH 3TNMA 3WSQH 2Z31A 3CXDH 4XMLH 3V6ZA 2CDGA 1BZQK 3BN9C 3GSQA 2F74B 4JO1L 1F97A 1B3JA 4JM2B 1YQVH 1BIHA 3P9LB 1SHMA 3OKOB 1ZHKA 1RY7B 1XR9A 4KZEL 1QTYT 4U1HA 2WNGA 4X0KB 5J9PA 4NQDE 1JFQH 2YPLD 4XXDB 2DWDA 3KR3L 4P5TA 4Z78B 4Y5VB 3T0EC 3UYRL 1MY5A 1UCBL 2YWYA 1FFOB 4UI2A 2WSKA 1N59A 4CVXA 2NXZC 2VDOH 2X4RB 2H8PA 4I2XE 1X7QA 3QXWA 3FOLB 5HDBE 4Q6IB 2BVPB 1UCTA 1RURH 1QQDB 2FX7H 4KKLC 5HDBF 2EDFA 4CVUA 1X5JA 4WJ5B 1KN2H 3NCBB 1MCBA 1WZLA 4PV9B 4TUKL 3HC3H 2FEDC 3KDMA 4JE4B 1UXWA 3CK0L 3FB8B 2JKXA 1HSBB 4TNVF 4LMQE 5ESAB 4X7FC 5FHAL 1TQCC 3RA7L 5DGRA 1AHWC 1HHHB 5HTSA 4GS7C 3ULUF 3LB6C 1NAKL 5IQ9B 4NRXB 4OUUA 1DVFC 3L3HB 3MV9E 4ZS7H 4NQDB 2YPLA 2NW2A 1ZLVK 1KXTB 3EFFA 1S5HB 1LO2H 2DQFB 4XNYL 3BGFC 3L3JA 1CK0H 4L8BA 1FG9C 1HQ4B 2D2OA 4JFQA 1SM3H 5EA0H 1UG9A 3QEQE 3VFSB 1BQLL 4I2XB 4GKZB 3BKCL 4G80A 1NMAL 1QOKA 1S7SB 3NMEA 4C4KO 5D7KD 4MNQE 5BXFB 3ROOA 4ZFZA 1G6RA 5CD3A 1ZGLB 4LPXA 1DBMH 3ZKNC 3L3IA 1UH2A 2EO9A 2V6HA 2R2EA 3WNKA 1UGNA 3SY0A 4UT9L 3MLSH 1OP9A 3NZHH 1MY7A 4LSVH 3F65A 1HYSD 2DQEH 4D9RE 2OQJA 3PHOB 4GXUN 5CZVH 1D5XA 5ID0A 4GH7B 4IIQB 4XPTL 2AJZB 3GMOB 2VQUA 3AM8A 2EIZA 3BHBA 2NY0D 2XQBH 3MV9B 3CZJA 3VGAB 4NKIH 3P0VH 4UU9A 3TJHD 2X4OB 2ZCLL 2BXYA 3AU1A 1FZOB 3SDAD 2BC4A 2IFGA 1TMCA 2AK1L 1S7VA 2QV2A 3O81A 1BJ1H 3DVNA 4JLRB 3BDYL 4ZUUB 4OZGE 3TCXA 2ID5A 4K3HA 4NKOB 3U0PB 3QEQB 4OZGF 5B39B 5I8EA 1HKFA 2G60L 3RX7A 5EFIB 5BV7C 1R3KA 2Z4QB 2APWA 2X7LA 4KKCD 4MNQB 2AJXL 1R3HB 2BSTA 2UVFA 3L1OH 4M5ZH 1NKRA 1OPGH 1AP2B 5FDWB 2VLLB 2GK0A 2HKFL 5B3JE 4DOHE 3O6ML 4DAGL 3UTSE 5GZND 4Z7QE 2OTUA 3HR5B 1N64L 3TN0C 4JQXA 4Z7QF 4ZFOB 1YZZA 3QZWA 3MA7A 3SKOA 4PB0L 1XF5B 1I1AC 3N9GH 2G2RA 4YR6A 3RRQA 1U3HC 3BPNC 5CJBA 1DEEA 5HYSG 2GJ6A 2W92A 4QOKD 5C08D 1R5IA 5FYKE 3RGVD 3G6JE 4OZGB 1JBJA 2CXGA 3BH8B 5BOZG 4HPYL 3OHXA 5FGSA 1TLKA 1ZHNB 5BV7L 3F12B 4FABL 5DSCB 2F58H 4QRRD 2ENSA 4PJGE 4KC3B 3RWFB 4PJGF 1K4CB 2YUWA 5F8RC 1JGVL 3PWLB 1T5XA 3HNSH 4MAYC 4PB9H 4DOHB 1JPFB 1WBZB 4PRDB 3UTSB 3MUZ1 2EC9U 3MRFA 5C86A 1SVZA 2AKRA 2Q8BL 4Z76A 4XVTH 1U91B 1KEGL 1J7VR 3VRIB 3LH2H 3EOAB 5CJXC 1FRGL 1PDKA 5D2NE 3ABZA 5GS0D 2Z91A 5BZWB 2CO7B 1VSCA 4FQIH 4QOKA 4X5LA 5C08A 5FA4A 3IAGC 2OI9C 4BFIB 1I9RH 1L0XA 2FIKA 2GCYA 3L95B 4KROD 3G6JB 2OX5A 4N90E 4X4XB 4CU6A 3VXUE 4M7JH 1UWEH 3PV7A 5AUMA 3JTSB 4OLUL 5D7LE 3V7MA 2IANE 3QUMA 5EU7E 2VJXA 2Z92A 4PRBB 2ADGB 3TJEL 1EHLL 3BXNB 3IDGA 5E8DH 4MQXD 4PJGB 1K3ZA 3HZMB 3R1GH 4N0YH 4G6FB 2SEBA 3CH1B 4HS8H 5AYUH 1IGYB 4PLJD 1F11B 1IAMA 4MGXA 4M6NH 4AZ8A 2ADFL 3ARTA 1NGWA 2RB8A 4U1JB 4AEFA 1KBGH 3NBNA 1T1XA 2QHRH 4UQ2B 3K2UH 5EBMA 4LVOB 3VFTB 1MJ7H 4L3CB 1B0RA 4I3RH 5IUSA 3MLXL 3RPIB 4NNXB 5DJ2B 3AMLA 4LSDA 1KT2A 4KTEL 2IADB 3BAEL 3BVNB 5D2NB 4JZOB 3CZFA 1CD1A 4PG9A 1JL8A 2BDNH 5HHME 5FYJE 5CWSA 4YHPB 2EYTB 1I1YB 5GXBB 5F9OL 4XCEB 3VXUB 3NFNB 4S2SB 5F7FA 2PW1B 4M43H 2IBBA 3QWRA 5EU3B 4ETQA 5D7LB 1OAKL 1X6NA 1C5BL 3FQUA 3TBWB 1DBAL 3OTTA 4XHJD 4NCC2 1T2JA 5I6XC 4LLYB 3K4AA 1FV1B 3FQNB 4BFEA 3MGTA 4I4WB 1MUJA 4K94C 4D0DB 4M9OA 1HZHH 2H2PC 1N26A 4HXAL 4NYLB 4DN3L 1I1FB 5HI3C 5HHXH 5DD0H 1MIMH 3ARXA 1GGIL 4KQ4L 4AQOA 1JNHA 2B1AL 3EOTL 1BOGB 1P84J 1QRNE 1PG7X 1JGUL 1U3YA 4OCYL 1DBJH 3QNYB 4PGEB 3CX5K 3MRIB 4OFDA 4XXCC 3DXAA 3EFDH 1BQHG 4WENB 5HHMB 4JKLA 4BSVB 4CDHA 3MROA 4OFYD 1OCWL 2YRPA 2CUHA 4JVUA 5D6CA 1OSPL 4PY7A 1FVCA 1MLCA 2VERN 4E42A 4HUUA 3U7WH 3D87B 5HVWA 5CKGA 5GRUH 3GSOA 5CGYC 5IFAH 4ERSH 4WVRA 3VWKD 4NHUE 5FFLA 2R1WB 1RUPL 5B8CB 3HZKB 3ULVH 4K94L 3QAZB 1T7XA 4YXLL 4XNUH 2YRLA 4FXKA 4HDIA 3WS6C 3PWVB 2NY2D 4FTVD 2OSLA 4PS4L 1HXYA 2EDWA 5EN2B 1IKFH 3O0RL 3OWEA 3L5XH 4NN7B 1QRNB 5I15L 4PP2A 4RWHA 4KJPC 3DVIA 1MCOH 4NNPH 5H8DA 2B20A 5E0QA 5EIVA 3CVIL 1UA6H 1ZWIA 4N8CH 3NPSC 1D9KD 3QNXB 4OFYA 5LXGH 2VQ1A 3PNWA 4O51A 2EYSB 1DL7H 3CC5A 5EZJA 3UZVB 1TVBB 4JJ5A 4U3HA 5C1MB 4GRWH 5T3XD 4M48L 2EH8H 3MJ9L 1F2XK 3DSFH 3HNVL 4NHUB 2JTDA 1LEKB 1IGJB 3MV7A 3AY4A 5F9WC 4WFHD 4U2ZA 5SWZE 3FN9A 2EDYA 3I2CL 1RUAH 3QULA 4LQ1A 4UUJA 4N8VA 5HGBB 1BVZA 3V0WL 5HDQL 4FTVA 3VI4F 5FYLE 1ZEAL 3Q2CA 3RWDB 1J8HE 3PV6B 4TPRH 1VGKA 4G6AC 1YY9C 4M9PA 1A7RH 2YKLL 3MFGB 2CKBH 2G5RA 4KTDL 3VFOB 4N0FB 3TVMB 2QQQA 5F7EH 2EE3A 1A7BA 2Q1EA 1D9KA 5F1OB 3S5LA 3GSNB 1F6LL 5I1HH 3JUZA 3CD4A 3CFDA 4FN0A 1ES0B 5JW3H 1RIHH 4KRPB 4RRPG 1KCSH 5I1AB 2V5RA 4GXUM 4P2CG 3ZL4H 5ALCH 4PY8I 4KK9D 3AAZA 3OAZK 1H5BA 2X4SB 5C71A 5J06A 5BZDA 3GIZL 5L88H 3W0WD 3CMGA 1MF2L 1RZFL 2PYED 4EI5C 3BPCB 2DWEA 1JNNH 1T21B 1UB5A 5SWZB 2EDEA 1N7ML 1PY4A 3EYQC 1WIPA 4LLAA 3VXTA 5J11B 1OWRM 2XNAB 4EOWL 3HE6D 4Y4HB 1CXKA 4M7KL 1YPZE 2R0ZL 3V0AC 4BQ9A 1J8HB 2JJUA 4IRSC 4L29B 2ICWB 1P4IH 1YPZF 4PRHA 2F19L 1RIUH 4R3SA 4U0RB 2F5AL 3TZVC 2J3SA 5KW9L 4F9LC 3WD5H 1J11A 3MO1A 1H15A 1V3JA 4BSWB 3JZ7A 3BPOC 3C60C 3S4SG 1YNKH 3PE9A 5JORB 3MJ8A 2KKQA 4JZJA 1CLZL 3RY5A 5D7JD 3E6FB 3NFSH 5EIQA 4UB0H 1SEQH 1T0PB 1OD7A 1K5NB 2Y36L 1CU4H 1VENA 3HS0A 1KPUB 3ZYZA 2BCKB 3VXNB 4JHAH 4OLZL 2F54E 1T20A 3W0WA 2MJWA 4OBRA 2W59A 2VC2H 1IGCL 2QR0A 1JRHH 4Y16C 4LLVA 3WFZA 3R0NA 4R2GB 2PTTB 2QADD 1WWWX 3ETBF 1I3RA 4YHML 4U7SA 2HG5A 5KTEH 4GAYB 5IB2B 3RIAF 5J3HC 3HE6A 2HJKA 3PGFL 4RAVA 3TIDB 3PHSA 1YPZB 2XTJD 3FQRB 4OLWH 3V6OA 5ACZA 4M5YL 4EUPA 2I5YH 4JRWA 1DCLA 4GLRH 2EDLA 1F6AA 5CEZL 5MEND 2H2SC 3NGBB 4XCYB 4Z7VE 3U82B 5EO0A 3WUZA 3Q1SL 4AIXA 4Z7VF 4QKXB 3LEXA 3TBTB 5JXED 4DFHA 2ZCKL 1F3JB 2WP3O 4QGTA 3GM8A 2QHLA 1H3GA 3U4BL 1Q8MA 2EDXA 2VE6A 2AEPH 3EYSL 5D7JA 2ITCB 4YH6A 4DWHA 3BH9B 4JFFD 5MP6L 5EBLB 3O6FC 5JPNB 1AQKL 1JUFA 1X6LA 3S35X 3IDIB 3HTLX 1QHPA 4X80L 5KSVA 1DQQA 2F54B 2O26U 4YDVA 4U1GC 1EFXD 2EYRB 2ZUQC 4L4VA 4OQTL 4XPGL 4HEME 2C3VA 4N68A 2CSPA 4MJ4A 5D71L 4ORZC 4AEHL 3BIKA 4G9DB 3I75A 3V4UH 3DYPA 3HFML 2PETA 3QEGL 4JG1H 1U9KA 1MFBL 4MHHG 4KJYA 2D7TH 3HCVB 4FQLH 1CE1H 3LKNB 1BLNA 2B4CH 3WNMA 2PKDA 2HT3D 3ZKSD 1L0YA 3SKNA 3QSKB 5BVJA 4Q0XH 5MENA 4ZDHB 1P6AB 4Z7VB 1U8NA 1UH4A 2FYYB 3S3SA 4W70A 3TV3L 4HHAA 2UY7A 3QG6B 3EYOA 4ODWB 1PYWB 4HZLB 2FHCA 8CGTA 4Z18A 2GITA 5FKAB 2GT9B 3CXHK 4F15C 4CN1A 2JE8A 1QR1A 5JIPA 1NCBH 4X9GA 3TYGH 2E27H 4MHHI 4JFFA 1Z3GL 3MRRB 5DHVA 3NN8B 3M1BB 3BOVA 7FABH 1B2WH 3VFWA 2BFVL 1EFXA 3GSRB 4LFHG 2YD5A 1XIWD 4GBXD 4HS6B 1GIGL 3G5YB 3MBEA 4LK4A 4XGZA 4KUCF 4WI5A 6FABL 3HNTH 2W0KA 3OG4B 1D5IL 1CGUA 1LD9A 4C55A 2DD8L 2OTPA 4E5XB 3C5ZD 3ZT6A 2EIDA 1I4FA 2Y4SA 1QBMH 3K81A 2B2XL 3RAJL 4S0SD 4MMZC 4URTB 1FBIH 4ZO9A 5C0NC 3O2WH 5ICZA 4WEBH 1Q94B 3HG1E 1RFDL 2WLZA 1F4YL 1KJ3L 3JVGA 3JWNC 2IQ9L 3VDBA 4R7DB 5DHYB 3VXOA 4CMHB 1MCWM 1P9MC 4R97B 1A4JB 2R69L 1AKJB 3A67H 4NO3A 5FUZL 5LWYH 5ID1B 1KIPA 2D7QA 5EZIL 1MHEB 2FJFA 1IGIL 4U1NB 2A9NH 3KJ4B 1A7OL 2IFFH 2OMBA 2Z9TA 4YPGA 4OD1L 2AXFB 5KN5A 1XIWA 2NY7H 4GBXA 5KS9E 2VXTL 1KB5H 2IMMA 2Y5EA 2OXHA 3LD8C 2V5YA 3O3EA 1QLEL 1VEMA 1OAQL 3LSOA 2CLRB 4FFYH 1BP3B 3U0WL 3PABB 3C5ZA 1BBDH 5E08L 3K8LA 2O61A 3UP1A 2NY3B 1VGEH 4LSSL 2HVKB 2FBJH 3W39A 1G6RH 1YECH 5SV3A 4YDLB 2KUTA 2WWKT 2BOBB 3R8QA 3VRJB 3HZVA 3PWJB 3HG1B 5JNYA 2UZIL 3HI1A 1VPOH 3X11B 2CO6B 4LBEA 4IRJD 1J8KA 5C07D 3L3OB 4TNVK 4M8VA 4E41D 5IMLA 1U8OB 4OCWL 1BEYH 4I5BB 1YEDA 4G43B 43CAB 5GRWA 1H8OA 5KG9B 4TRPH 5GJSH 5DEZA 1JPST 4OZIE 3QDMD 5CS7A 4HKJB 4POYA 2XN9D 5J89A 4OZIF 1TVHB 2BNUB 2VN4A 4H1LA 3R06A 5F3HB 3RWIB 5FOBB 5KS9B 1WCBA 3U83A 2EDJA 4ORGB 4DVRH 4LLMB 3KPQB 5EOTA 1A8JH 1IM3B 1MEXH 2ZOLB 4LPCA 3QQ3B 3THMH 3M07A 4EZMA 1G7LA 2CRYA 5I66A 5H35B 3GK8L 3FN3A 4KJQC 3VXQA 1LK3L 4RAUB 5T5NF 1WVZA 3SDDD 2QKIB 3ILPB 4YC2B 3REVA 4O2CA 4KJWD 2APXA 4K7PY 5C07A 3GBNH 4Y5YB 4E41A 1ZK9A 5L9DL 3G08A 35C8L 4C83A 2F15A 4U33A 4XTRD 2ADIA 1U8HB 2Y5TA 2FH6A 5EZOH 3UBXI 3QDMA 4OZIB 4LVHC 3MNZB 4J3OC 3V7AG 2XI9A 3VCLB 3OKMB 1VCAA 5CEYB 1LO0H 4WHTB 4Y19E 4NQXA 5F89B 2FH8A 1BQHA 1AH1A 1JTOA 2NQCA 1QBLL 5IBLC 4JB9H 1ADQA 2R9HD 4JQVC 4AMKH 3IDNA 4JDTH 5DMGD 1DE4A 4XB8A 2CIKB 1K9TA 2EE2A 1FIGL 4GRMB 3KPNA 1URLA 4AM0B 4BKLA 4NN5B 1TTUA 3X14A 4CVZA 5DFWH 3X17A 5CSZB 2Y07L 3SDDA 4WO4C 4JPKH 3GSXA 2BSRB 1H3PL 1EEYA 4HXBL 4KDWA 3B3IB 1NBZB 2XWJA 2ARWA 5D1ZC 8FABA 4MA7H 1ED3A 1U8JA 5DFVD 2OJEB 3IKCA 4JPIA 4XH2A 4QXUH 2DQIL 1E27A 4R4BB 3P9WB 4X7SH 4WI2A 4DGIL 3W9DA 3D6GA 4QNPE 1MJJA 4P57B 3ZKXB 5HI5D 4MXWH 3SGDI 4QNPF 3T2QA 5E1HB 1JZ5A 4Y19B 2EECA 3QXDA 4ZPTA 3VFGL 3HI6L 1NBVL 2V5SA 3U0TB 2ZUUA 3QUMH 3GRWL 2MPAL 1CLCA 1OW0C 3NIGE 3QIUC 4ZUTB 3BISA 1WUNT 1INEH 5DQDH 2G5BA 1T0MB 3MXWH 3MX0A 4FQCL 4K23H 3SBWC 1NEUA 4QHKJ 2ICEB 3QRFM 4JFOB 3EZ8A 1P2CA 3O45A 5I8OL 4LSRL 1I85C 2OL3L 5EZLA 3ZKQD 4KDTA 4TOYH 1FNSL 5DR5H 4MLSA 4Q6IC 1I7RA 1W0VA 1I8KA 1KLUA 1KGCD 3P73A 5E6YA 1WSST 4L1HA 4FQHB 2W9DH 1FORL 1AGCB 5D1XC 4RZCB 1Y18B 3HE7D 5GGTL 1A3LL 1GVIA 2HH0L 2AW2A 5GS0H 1YNLL 3S6CA 1F8TH 4P59H 5IB3A 5ETUB 1N3NB 4RSVA 1OTSC 1MCWW 1HIML 1E6JL 5CSGA 5ANMA 2EDRA 5CFHA 5JR1L 25C8H 3V4VL 5IMOB 3CDGB 1GGTA 4RRPA 5GZOC 2C7UB 3MFFB 5T3ZE 4YO0A 2DLEA 1IQDA 1HHKA 4HGWA 3MXVH 4XMKH 1A6ZB 3K1DA 1QBBA 4U6YB 3RWEB 1MLBB 4ZAKD 2YZ1A 1TQBC 2XG4A 3HAEB 1AD0A 5DJYA 1Z5LB 4DW2L 4K7PL 4WU7A 5DJAA 2JELL 3RNQA 4LHQB 1IAIM 4KHTL 3B9KD 5EU6D 4N9OB 3KPLB 4KI5E 4BZYA 3P2TA 4YFDB 4D9QD 2HT2D 3TWCL 2ADJA 3RWCB 2CK0H 3RDTB 4HIIB 2DBLH 3HE7A 1D6VH 3EDJA 4YHOL 3EDDA 1HH6B 1JWUB 4AIOA 2ED7A 1YYLL 4ZTPH 4EDWL 5KSAB 1Q1JL 1YQ2A 1KIQA 1T5WA 2ZUXA 2HMIC 3ULVE 4OJFL 1F45A 3KS0H 4IIQC 4JPWL 4F9PA 1YN7A 3ULVF 1Q0YH 4HWEH 3BO8A 4GKNB 1QO3B 3TF7C 1UENA 2I25N 4MJ5B 3PF2A 4POZD 3D25B 3OKDB 1LEIA 1TETH 5E00B 2YC1B 2C26A 4MYWB 3HUJE 2VLMD 1G7MA 3AS1A 5E6IB 1BIIB 3MV11 2FZ3A 4TVSa 3NCYS 3E2HB 1VEOA 4M3JA 4Q2ZA 4YDJB 4ZAKA 3G6DL 2B0SL 3AS3A 4KVNH 5EOCL 1FHGA 1UQSA 1TTGA 3P11L 3QG7H 2A9MH 1N6UA 3BN3B 3PGDA 3L7FB 3B9KA 5HJ3A 4F3FB 2FHFA 5EU6A 4PGBA 4YDKL 2DKMA 4CVWA 4LMQI 2FGZA 4L3EA 5B39G 2VDNL 3RVWC 2FO4B 2DJ4A 1MELA 3GSWA 5IOPA 2J6EA 4NC2B 2HLAB 4NCDA 1T1WA 4GRWE 5IW1A 1I8LA 3ARFC 5F7DA 3TESA 1AI1L 1P7KB 4GRWF 2O5ZH 2RIKA 3FFDB 1NFIA 4JDZA 1Q0XL 4HC1A 4WI8A 5AZ2L 5C09D 1MRFL 2Y25A 1U58A 3MJGX 4FXLA 4I77H 3RL1A 3I6KB 5IVXE 1YMHB 4JR9L 4U1MB 3QXVA 4FZEH 4H26B 1UVQA 3GEWB 3FJTA 5DVKA 4NRZA 1ZHLA 4RFEB 3SE9L 4XHQA 2ITDB 3RY6A 2FB4L 1IL1B 2VXQH 3HUJB 5DZOA 4M7LT 1A2YA 1T1YA 1JWMA 3W2DL 3ARBB 1C5CH 2BNQD 4OI8A 2OS7A 3W11C 5E8EA 3SGKC 2ZG2A 5FV2A 4LFHD 4MZ3A 4NM8H 5JOEA 2X1PA 1T1ZB 1OHQA 1FVEB 3T2PA 1JNLH 2CRMA 4YJZL 2YXFA 4WEMB 2HTLD 2YA1A 3IVKB 5T5FH 2ZKHL 4NM4L 1T2XA 3OKNA 4DZ8B 2G75A 4NO0D 5T33H 4D0BA 5EBGA 4MXQC 5EU4A 3K4DA 4NT6A 4GRWB 3UJIL 3DYMA 5I1DB 1JNJA 3RBSA 1KJVB 4KXZH 5C09A 5KSBE 3A6CH 3RWGB 4LP5A 4YHKL 4XB7A 1MCPH 1VHPA 4XVUC 5KSBF 5IVXB 2AV1B 2DQGL 2ZP0T 3FQTB 2XOTA 3ESUF 1QVOA 1OSZB 1UM4H 3BP7B 1AGFA 2N4IA 2RFXA 3DIFA 4XC3L 5C0GA 5T3XH 1MQ8A 4AENA 1JWSB 1IT9L 1MVFA 1L0QA 2V2WA 3VE0A 4BZ1H 1I9JL 1A02N 3IFPA 4WUKL 4WV1B 1EO8H 3ARVA 2BNQA 3MUJA 2XWBA 3P4LA 4YXKH 4D94A 4KGJA 2CD0A 3SDCC 4X6DA 5DRNA 1ZT4A 3ZSSA 4NBZB 4NQED 1K3IA 5AG8A 3AFLA 2YUXA 4FQ1H 1KG0A 4JGUA 5BQ7A 1OGTB 3O6KL 5ILTH 3DBXA 2R23A 2WIMA 5DUBB 2YWZA 4FQXB 3ORJA 4LASL 5EWIL 5D1QC 5IHBA 4NO0A 5KVDH 3NAAL 4G42A 2H9GB 2ATKA 4G8IA 5DJZA 5CBAA 5IWLA 1TITA 2F53E 4WW2A 4O5LH 1CE6B 1BZ7A 2OJZH 2YSSB 5KSBB 3DX9B 4OZFA 5EOQL 2NR6D 5BRZD 3QUYB 5FIEA 2X41A 3H7BA 2I27N 4PREB 5ENWA 4OKVB 2YD2A 2NXYB 3LIZH 3OPZL 3QFJE 5D6DC 2D0FA 3UTPE 1P53A 4G6JH 4PTUB 5HHOD 4ZSOE 4IDJL 1DDHB 4UIMA 1J10A 3N1PC 2PXYD 3MJ7A 4AEIH 3S36X 1UKTA 5EU7C 3D18A 4GW1A 4N0UA 1TZIB 2XZZA 4NQEA 3I6LE 2LTQC 4PJCA 1G7QA 2E6QA 1KCRH 3NACH 1NDMB 1GCFA 1KULA 1TIUA 3SE8L 3QDAA 4Z0XB 1UEYA 1OB1B 4LLQB 3MRDA 5IIEB 1UYWL 4LVNC 3PWUB 5CJOL 3NH7H 3I9GH 5F7HA 5A43C 1JYNA 4O2FB 3S35H 3RZCA 3DTXB 2F53B 3LV3B 3BP6A 3PUCA 3WFDL 1MHCB 1PG7W 2IALA 1NMBH 4PJ8D 4WUUD 4I0PB 4KKNA 5BRZA 1LEGA 5DQ9B 3TBVB 1F58H 3T1WA 1RZIA 4HKBA 3CFEB 3QFJB 1SMAA 3T2NH 4HIEB 3P4MB 2I26N 1MREH 1ZLWH 4ZSOB 1EHAA 1BWMA 1A14H 2PXYA 1OL0A 3MYJA 1R3JA 4KPHL 4HFUL 3EZJB 3OR7A 1AXTH 4P0DA 4APQD 3ARDD 4UT7H 4KKBC 4AL8H 1YEFL 3RIAK 3NPZB 2YN5A 5F7NC 3N0PB 3BWAA 3GJEB 3NVQA 4Y2DD 4X7TB 2I60L 4UTBH 2VXUH 1Y6NR 3SJVD 2EXYD 4BQ8A 1XF2A 3ILQC 1MHHB 5DVMA 4M3KB 4JFPB 5MEOB 1H8NA 5E4EB 4LSUL 4WU5A 3O2DL 4NN7C 4PJ8A 4OI9A 1C7SA 3WHE0 5HVHB 4Q9QH 1I8MB 4TSBL 1I9EA 3QIBD 5DHVH 2V9RA 5AAMA 3P0GB 4BQ6A 2GIYA 5DD5H 1RZ7L 2APTA 1PQZA 3BSZH 5ALBH 2QLVB 3PGCA 3MOAL 3S9DB 5FYJL 4U6TA 2P1YA 4N5EC 1RJZA 1FL3A 3MUHL 1CFTA 2PYFA 4NJ9L 1KENH 2CR3A 1X5LA 3MLZL 5E8PB 3E8UH 3DRTB 2VN7A 2YUVA 3TNMB 2HFEA 3D3VD 4LCIH 4APQA 2Z31B 3ARDA 3V6ZB 1JF1A 1S7WA 4PGCB 2QL1A 4HH9A 4MCYA 3ARGA 5GJTL 1HK6A 2Y9RT 1HOCB 3WN5A 5E7FA 4Y2DA 2QQLH 1LQSR 2A2QT 4JM2D 1ZHKB 4PR5A 2VLJD 1XR9B 5DQJA 2QTEA 1KNOB 3SJVA 4Y5XB 1FE8H 3UTTD 4CJ1A 1SYVA 4U1HB 2HWZL 1NH6A 3GHBL 4MXVE 5J9PB 2NY1C 2YPLE 3PP3K 4P5TB 4MXVF 3C09B 1EEZA 5HGHA 3QIBA 1GSMA 5ITBH 4MDJA 4XCFH 2YK1H 2CJUH 3L5IA 1N59B 4CVXB 1FZKA 3IXAB 2H8PB 2OZ4A 1X7QB 5DMYA 2OP4L 1C12A 4OIBA 3KYKH 1TZHA 4R9HA 3P0YL 1NGZA 2ZUWA 4ODTL 5IV2A 4FZ8H 4JFXA 4AG4H 4MDIA 4XP5L 1FFQA 1EPFA 5T1MA 3N50A 1MCFA 1EERB 5LBSL 5HYQA 3KDMB 4LAQH 3O4LD 1UXWB 4XI5C 4UDTA 4B50A 3K3QA 3VRLE 5C0DA 4B0MM 1G9MC 4GG8B 3VRLF 3O3UN 1QFWH 2F74A 3GI8H 1CZ8L 2VLJA 3NCCB 1ZOXA 3HZYA 3UTTA 5DO2C 1QFWM 4OUUB 3MLRL 4HW6A 2YPLB 3ZKMD 3GHEL 3T0AA 1OOAA 3H9SA 2DBJA 3D69A 3L3JB 4U0RC 4L8BB 3DJ9A 4LDOB 4XXDA 1YY8A 3P77B 5I1EH 4JFQB 4H88H 3ZDYF 5IW3A 4NPYA 4G80B 3PL6B 5IVZB 2DKSA 3GSNL 2AI0L 2X4RA 5D7KE 4KU1A 1CS6A 1VFMA 1WJ3A 1MAMH 3TLRA 4H1LH 4R4FL 4ZFZB 1G6RB 4KGLA 2BVPA 2F8OA 5CD3B 3MRJA 3EYUH 3S98A 1FN4A 2WV3A 3L3IB 3O4LA 1A21A 3OR6B 4Q9RL 4FFWD 3T0DA 5EC1A 3SY0B 5FO9A 4XVJL 5F9AC 3CFCH 2XY2A 3FB8A 1G9ML 1BFVL 3WJLA 5H37H 4R2GC 1D5XB 5ID0B 3BDXA 4XBGB 4BA8A 3ULUD 2EIZB 2R29L 3O6LH 1ZLVH 3CLEL 5FYLL 2OM5A 1WFTA 1OD9A 2GJ6E 5IQ9A 4UU9B 4YUEH 1MIEL 1P1ZA 1CGSH 4N0CC 3NGBC 3MV9D 1S7VB 3DVNB 4PY8J 2DI8A 1S5HA 3SKMA 3AGVA 2DQFA 4PP1C 4TQEL 5I8EB 1KUMA 4X9FA 1BVLA 1R3KB 4RCAA 3QA3A 3QEQD 2X7LB 2VL5A 4GKZA 1B4RA 2BSTB 2V17L 2EEDA 3IDJB 1S7SA 4OLYH 2OK0H 1IE5A 3HPJA 1OWWA 1AY1H 4NSKA 1ADQH 4LQFH 2GK0B 5C7XH 3QO0A 1ZGLA 3QFDB 1O0VA 3F58H 3QH3A 2OTUB 1CDGA 4UIKL 1MFDL 5D70H 1BPVA 3MCG1 3MA7B 3SKOB 1OLZA 3OZ9L 2HKHL 3PHOA 5FYJU 1AGBB 2G2RB 5L7XL 2N7BA 4YR6B 2NY0B 3D48R 1DEEB 3GMOA 5LGHH 2GJ6B 2ESVE 3REWB 4QOKE 1B90A 5HY9B 3X13A 1R5IB 4H8WC 2AQ2A 4ODSL 4A6YL 3VW3L 1GYAA 3L7EA 3EOYG 4ENED 4JLRA 2GTZA 4XPHL 1I1RA 3OHXB 4KAQL 1T83C 4TTDC 3WDHA 4KRMB 5BMFL 4P4RB 2FD6L 2NX5E 3ERYA 4Y4KB 2YA2A 4LKXA 4TVPE 3WXWH 4JFZL 1NCCH 4K3JH 3RVXC 4M1GH 1M71B 1CL7H 1K2DA 1T5XB 2DMKA 1AE6L 1E28A 3IJYB 3UPRA 4S1QH 3KLAB 2LABA 4HUXA 1S7XA 1UJ3C 1X5ZA 1ONQA 3MA9H 4H20H 3WIIH 1NBYA 1KC5L 1ZTXH 2AKRB 1CIDA 3LCYA 2E7MA 4EN3C 4O4YL 4ZFOA 4PRID 3VA6A 1XF5A 2ESVB 4QOKB 5FA4B 3LQZA 1D6EA 4H8WL 3EJYC 2FIKB 2GCYB 4XRCB 1MNUH 4F7PA 1AR1D 1JGDA 3QQNA 5AUMB 4OFVA 5HHPA 1NL0H 3P4OA 4NP4L 3FAXA 5F7WC 3LOWA 4OZGA 5FYKD 3CAFA 2XIDA 1J0JA 5JUEL 3LMJL 2Z92B 4R97C 1EZVY 2NX5B 2AXHA 1WAAE 4OCMC 5CZKA 3IDGB 2OR9H 5MEPB 2LAAA 1ZHNA 5DSCA 1WAAF 3EYVB 1J88A 1ZVHA 2SEBB 3KLHC 5GRXG 1II4E 2VWEE 3RWFA 1X5KA 3EO9L 4G6FD 1K4CA 2DQDL 1S9YB 4M6OH 1YA5A 4HBCH 4HUNB 1NGWB 3VFUB 2HFGH 1FP5A 4GAJH 1T1XB 3CX5J 5EBMB 1IFHH 2X9XA 4PRDA 4BZ2H 5FOJA 5D7SL 4FQ2H 4PRIA 3CXDL 1KT2B 5HGDA 5KVEH 1FH5H 4XMLL 2A0LD 3X3FH 3CZFB 3DXAE 4YE4H 3SDXE 1CD1B 1KYOK 4PG9B 1CGXA 3ARUA 3VRIA 3TM6A 1N6QL 1YQVL 1IGFH 5CWSB 3QHFL 3SDXF 3JWDC 1AHWA 2HTKD 4YDLC 1N0XH 3RY4A 1RQ5A 4I3GA 5ADPH 4ETQB 4X4XA 4N90D 1JFQL 3OKKB 1FLRH 3D1MC 4FMKA 2QSVA 4M7ZC 1L7TH 1L9MA 5D7LD 1EVUA 3ES6A 3MGTB 1HEZA 1MUJB 3BXNA 4PJGA 2VDOL 5IESH 4FFEX 5C0BA 1NCDH 1SEBA 1IGYA 4PRNB 1JNHB 1RURL 2FX7L 5AYQA 1KN2L 1FLTX 4OD2A 4WIQA 4UQ2A 5TF1H 4MS8D 3CPLB 3STBA 1NCAL 3RKDC 2YEZA 3FOMA 1IEHA 1LP9F 3AMKA 3DXAB 3F6IA 3RPIA 1G7JA 3SDXB 2IADA 5D2NA 2E7BA 5ITFA 1NMCC 4G8EB 1AFVL 3JWDL 1FNEA 4PY7B 1CFSA 1MLCB 1C8PA 1SYSA 4E42B 4HUUB 4HWZA 4OF0A 1I1YA 2J6EH 4NN6C 3HLAA 1BVKB 2COQA 4ZS7L 2D4DA 3GSOB 3GNML 2PW1A 2VABB 4RMRA 5D7LA 1CGTA 2FR4B 1LO2L 2NNAA 3D5OF 3MV7E 4HC1H 1CK0L 5F6HI 3A6BH 3I3BA 1KFAH 4QY8B 1SM3L 5EA0L 3FQNA 5TGBA 4FXKB 4HDIB 5TFSH 3FRPG 3LHPH 1IKNA 2OSLB 4NYLA 1X9QA 4UINH 4LLUB 3IGAA 1LO4L 4PP2B 2XZCH 1DBML 1XGUB 4MS8A 2VLKE 4QF1A 4CU7A 2NLJA 4WHYH 2HT4D 5A40E 1ZWIB 3MLSL 3NZHL 4LSVL 3QNYA 1F2QA 2DQEL 1V05A 3MRIA 3TN0A 4YQXH 4NN5C 5CZVL 1GGCH 2VQ1B 4B53A 1I7UA 3PNWB 4LAJH 2CQVA 4O51B 1FCGA 1MRDH 2WUCH 4BSVA 3CC5B 4Z7OE 2A6IA 1RK0A 4IRZH 1OM3H 2XQBL 1J12A 4JJ5B 1MVUA 4OGYH 4NKIL 2IAMD 3P0VL 5DLMH 3V5KA 2R4RH 3JTCA 3MV7B 3TPUA 3B2VL 1RUQH 5T5NG 2Y06H 1P7HL 2AJVH 3FB7A 3QULB 4UUJB 2PW2A 3LN5A 3QXTA 1FFPA 1CVRA 3KHOA 2X1WL 1CD0A 2DRUA 5F6IC 2DIJA 2XA8H 3BUYB 1VGKB 4PRHE 3L1OL 4J3SA 1OPGL 4TULH 2VLKB 3LZFH 3V2AR 1P4BH 1QNZH 2X1QA 3IF1B 3SPVA 1FPTH 2EDQA 5IFJA 4PP8C 1WGOA 1D9KB 2E3VA 3S5LB 3TVMD 1TVDA 3CFDB 2ARJQ 5A2JH 4M1CD 4Q7DA 3GO1H 1MHPL 3VMPA 1EUTA 4U1LA 5E5RB 3N9GL 5TPWH 1J1OH 2CLZA 4KRPD 4D9LH 3QI9C 5F93C 1MJ8H 3CNKA 3NABL 2H6PB 2IAMA 5JW4M 1H5BB 5HI4D 2MKWA 3W0WE 1M05A 2OI9A 5DK2B 3DGGA 3QIWD 3Q6GH 3GB7B 2DWEB 2MQCA 4YNYA 4OZFH 1UB5B 3ISWA 4DK3A 3VXTB 3AC0A 5JDSB 3TA3C 5SWZD 5DUPH 3S36H 3Q5YA 2F58L 3DRQA 1A0QH 4OSUH 2W0LA 5EORH 5E4IA 4Y4HD 5M94B 2W0PA 4PRHB 2I9TA 4LOUC 5EUKA 4F7CA 2AEWA 3UDWC 4XWOD 1J8HD 3HNSL 2BY3A 4OCNC 2J8UA 3MO1B 5C2BH 4PB9L 3OSKA 3QEUA 2JLLA 1NCUA 2DLFH 4WHDA 5HVFB 3CLFH 4JZJB 5I16A 4N0FA 4RFOH 2R0LH 4JY6A 1A9BA 4HBQA 1FAIH 4XVTL 4LNVA 1RULH 4ZTOH 5JPMA 1JHLH 3LH2L 1MFEH 3HS0B 1SJHB 1U8MA 3OAZH 3P4NB 2VR9A 4F33A 3OL2A 4ZNCD 4LKCA 3PHQA 4LSPH 3BJLA 2QQNH 4FQIL 3W0WB 5GGRA 2VDMH 3QIWA 4P23C 1I9RL 1DQLH 3QDGA 4M8QB 2QR0B 4L4VE 2X4SA 4KVCH 4V2CB 5GRVL 1PGRB 4B41A 4LLVB 4M7JL 1UWEL 3HAEG 4J4PC 4QRTA 1T21A 1I3RB 5SWZA 2EIEA 5DUMH 1GC1H 3HE6B 2HJKB 4LCYA 5E8DL 5ACZB 4NBYB 4EUPB 5JMOC 2W65A 4QXTB 4Y4HA 3R1GL 1F6AB 4HS8L 5AYUL 3GGWB 2ICWA 1CDYA 3LEXB 3MOBH 1I8IA 4W6WB 3WDIA 4M6NL 1KBGL 1ZVSA 4FNLH 4XP9H 3K2UL 3WS3A 4ODUA 2VE6B 5D7JB 1LMKA 1ETZA 2BSSA 1MJ7L 4NC1E 4JFFE 5IW6A 4I3RL 5I71B 1FQ9C 1JUFB 1S5IH 3E6FA 3UMTA 2V5MA 1FFNA 2AP2A 5FUOH 3VWJB 5KSVB 1DQQB 2BDNL 2D9CA 2VRAA 4L8CA 3VXSA 4D8PB 2F54D 1WT5A 4KI5C 4L4VB 2C3VB 3GSUB 4NHCH 3BIKB 2E9IA 2QADB 5EO9A 4RBPH 4FA8A 3MJ9A 4PJ9B 3ZTNH 1FFRA 1MAJA 3IDUA 3ULVC 3FO2A 3SKNB 5BVJB 1ZA6A 5FDYA 1U8NB 4XBEH 4P46B 2MCPH 3DURA 4B5EA 4P2OB 4HHAB 4P2RD 3WS6A 5HHXL 5DD0L 1MIML 5IGXH 4E0RA 2X6MA 1OP5H 4Y1AA 1KCUH 1QR1B 2YPKA 4OBSA 4UV7H 1F3JA 1NGPH 2VISA 2JJSC 3HHRB 4ZOCA 5GGUA 2NZ9D 2QQKH 4ZXBD 4JFFB 1DBKH 5DHVB 1DBJL 2NYYD 4B7LA 3PP4H 5DRXB 1X44A 2CH8A 5J13B 5EBLA 3EFDL 1BOYA 5JPNA 3VFWB 4RMWA 3F5WA 3HPLB 2M8XA 2JCCA 4P4KD 4JJHA 1WIOA 3VFMB 3MBEB 4K3DH 1EHXA 1NPUA 3U7WL 5D8JH 3TIEA 2HAZA 5GRUL 4PIRF 3BUTA 2JJWA 5IFAL 1WLHA 1GGBH 5DD1L 2OZ4H 4JRXD 4ZD3H 1LD9B 4ERSL 2AEQH 4KK6D 1HNGA 3UC0H 4AT6B 4M03A 3ULVL 4WTWA 1FDLH 2FCBA 1RSFA 2A77H 4ONGH 3WDJA 5ICZB 4P2RA 5CINH 4XNUL 1EBAA 1VKXA 2IPKA 5I1LA 4HCRA 3QG6A 4ODWA 2VOTA 2YPVH 3TBYA 3VXOB 2GHWB 1F3DJ 3L5XL 3U9PH 2GT9A 3WJJC 4NFBA 4NO3B 3IU4H 4ZXBA 1KIPB 3FCTA 3DLQR 1MCOL 4NNPL 1OARH 3T77A 2Q3AA 4IOIB 1UA6L 3MRRA 4N8CL 1CDUA 4P2YA 3NN8A 5LXGL 4P4KA 4QGYA 4YPGB 3WEXB 3PG2A 3MLTB 5KN5B 5KSUB 4PJ7A 4OFPA 5E70A 5I73C 4XNZB 4KUCD 4UNUA 3O3EB 3LEVH 4OZ4A 4JRXA 5DVLA 3LSOB 2EH8L 2P48B 4I8DA 3ALWA 2DQJH 3C5ZB 3DSFL 4ZOBA 3WLWD 4CUCA 2IH3B 1QSVA 4EI5A 3E3QC 4JFDD 3W39B 3MRLB 1RUAL 3QUYC 5CEXB 1KEMH 2LQRA 2NY3D 2DJSA 5DJDB 3HZVB 1KJ2B 3QPQC 3TYFB 5JNYB 4H5SA 3HI1B 3RPKA 4KK8D 1OAZH 4KK5D 4TPRL 4LSQH 4LBEB 5E99H 5C07E 2JJTC 4KZDH 4WFGE 5EIIA 1A7RL 2H2SD 4CN6A 3IU3A 2CKBL 2CIIA 3ZZ1A 4R7DA 3INUL 32C2A 4Z77B 1YEDB 3MGOB 2X4PA 4RX4D 4KUZL 1MHEA 3ECBA 4CW1A 1AXSA 3QDME 5I1HL 2X05A 5JW3L 1RIHL 2YBRB 1KCSL 2NY6B 1Q9WB 1YC8A 4H1LB 3R06B 4P5MA 2E7CA 1WCBB 4HLZH 3ZL4L 5ALCL 4Y8AA 4R0LC 1INDH 1ORQB 4JFYB 3NA9H 4YHZH 5EOTB 4S1RH 3BW9A 1BAFH 5L88L 1G7LB 4RDQF 1EMTH 3ARSA 1JNNL 3CDCA 4JFDA 4I0PC 5I66B 1LDPH 2J4WH 5DF0A 5T1KB 3M45A 1G1YA 3WXVH 3QUZC 1NEZA 3VXQB 1MCCA 1DQJA 3LKPA 4R6UA 5CP7A 3BKYH 3F7QA 5MI0B 3REVB 2DLIA 2ED9A 3H3PH 1KPVA 2BOBA 3PWJA 5C07B 1P4IL 2GTWA 3MLVH 1XFPA 1ZXQA 5L0QB 1U95A 4I3SH 1S7TA 1RIUL 5HXMA 3TT3H 1ROWA 1BFSA 3G08B 3PQYA 5DJ0B 3WD5L 4C83B 2ADIB 2EDHA 4RX4A 1YNKL 2Y5TB 1KXQE 3ULUH 4S0TD 5FK9A 3L5WA 1NGQH 1ZE3C 5IHZB 5JLZA 3QDMB 4XBPA 5KG9A 2Q7NA 3NFSL 3EO1B 4UB0L 1SEQL 5DT1H 4NQXB 2CGRH 5D93B 1CU4L 3RP1A 1JFMA 1KJMA 4ETYA 3NIFE 4FQPA 4B7IA 1JRHI 1TVHA 2BNUA 4FP8H 2DI7A 1EDQA 2D0GA 3IDNB 3KPOA 5E4EC 4ORGA 1DE4B 1U3ZA 3KR3H 4YBLC 2E6JA 3KPQA 4QEGA 4JHWH 2VC2L 1MPAL 1S9VB 3KPNB 1OQXA 4BKLB 1JRHL 5JZ7D 2VZOA 2Y6SC 4YAQA 4CVZB 3V8CA 4GLRI 2VMFA 1H3XA 1JPTL 4MVBC 3W9EA 5KTEL 4O02H 3SDDB 3T08A 5JHLH 1EEYB 1I1CA 2B4CC 2Y1VA 2NY5H 4OLWL 4CDGC 2MSPA 4R96A 2I5YL 2QKIA 2XWJB 3ILPA 5D9SA 8FABB 2VZSA 1ED3B 3U6RA 1BQUA 4MD0A 1U8JB 2PO6B 3FRPA 4TUKH 4PJ5A 4JPIB 3KYAA 4HF5H 4XH2B 4MQTB 2HP4A 3CK0H 3I50H 4Y5YA 4GAFB 1EEQA 1MI5D 5DJXA 1MJJB 5FCUH 4YBQD 2AEPL 4W6YB 2DQCH 5GGQH 3PXJA 4OZIA 2EXWC 3G5ZA 4ONFH 3QNZB 1NAKH 1HINH 5ANME 3OKMA 3O9WC 4WRLA 5DZNA 4U2YA 2DQHH 5CEYA 3QDJE 1IAOB 5JA9A 1BD2A 4GRLB 4Z9KB 3C09C 3H9YA 5JIKA 4MMXC 3M17A 2V2XA 2G5BB 2YMXH 1B88A 1DSFH 3QJFA 5DZLA 4C56A 1F02I 4L9DA 4U3CA 4UBDD 1VADB 4X7EC 3V4UL 4AM0A 2QSCH 3O45B 2DM4A 4JG1L 1OTUC 3BKCH 5EZLB 2D7TL 4FG6D 1KLGA 4FQLL 2Q7YB 2B4CL 3QUXC 1I7RB 1W0VB 3K7UA 4PGZA 1I8KB 4OV6F 12E8L 4Q0XL 3UJJH 1KLUB 1A5FH 2VDLH 1ND0A 3PDOA 3HB3D 4KI1A 2H32A 3A6OA 5J1AB 1ZLSH 1A3RH 4MJ2A 4IOSD 1X5IA 2K9UA 1FGNH 1MI5A 4LSTH 3RTQD 2OJEA 4U1KA 4R4BA 2ZSWA 3G6AA 4OIAA 1CDHA 3TYGL 3MRBA 5IB3B 3PIQB 2E27L 1K6QH 2P42B 5ANMB 1W2KT 3DMMD 5J1SC 2VDQH 7FABL 3QDJB 1Q9KA 5FYKH 1B2WL 3OBAA 1EGJA 3DUHA 4LHUD 5CUSH 2JB5H 3QHTC 4YO0B 1IQDB 1HHKB 4HGWB 4WW1A 3U0TA 4MA1B 5IBUB 4XNMB 2FEEI 1G9NH 3HNTL 4QRPD 1T89A 4W6XB 5DA0B 2OCFD 2X70B 3SGJC 4RMTA 4JFOA 5DJYB 1QBML 2FEEL 3NTCH 3DROB 2ZOKB 4HUWB 4LP4A 4WU7B 5DJAB 5IBTL 3T4AA 5EU6E 4L3EE 3O2WL 4D9QE 4TSCH 4WEBL 5I1CH 4PJDA 1KTLA 4P9MH 5FUCC 3RTQA 3HE7B 3V4PL 1AGCA 2DIBA 2ORBH 3OGCA 4RZCA 3RDTD 1N64H 1T5WB 3A67L 2L7UA 5LWYL 4HKZA 4DKEH 5KSAD 1YN7B 3DMMA 3CSPA 2P7TA 4RISH 3BO8B 2A9NL 2BERA 2IFFL 3K8MA 5AD0A 4M7LL 3EKCA 4LHUA 5IFHH 1LEIB 3CDGA 2NY7L 4PJFA 1G7MB 5TQ2H 4QCIB 2C7UA 1AD9B 2FZ3B 1KB5L 5B3NA 5T3ZD 1TDQA 4QRPA 4Q2ZB 5E6ID 4ZAKB 5IVNA 1G7IA 4WFED 5BV7H 4FFYL 4QHNA 3T2OA 3V52H 1BBDL 1MLBA 15C8H 3R0MA 1UQSB 1XAUA 4J2XA 1VGEL 3BMWA 3HAEA 1U8IA 3RKPA 3KYMA 2FBJL 3PGDB 1EFQA 1XGRB 3B9KB 5EU6B 4PGBB 1G6RL 1YECL 4L3EB 1EJOH 3WYRA 3GSWB 5IOPB 5SX5H 5JIIA 1NJ9A 4J6RH 1T1WB 1VPOL 3LRHA 4WWKB 5F7DB 1HYSC 4V3EB 1NFIB 4JDZB 5C09E 2Q8BH 1E4KC 1GOFA 1T03H 1U58B 5KSAA 3SO3B 3PWNA 1BEYL 4NZTH 1UVQB 2NY0C 2CLVA 4TRPL 4XNQB 2R39A 4PUBH 5GJSL 4P9HH 1ZHLB 3TJHC 3VA2C 5IEHB 3BE1L 3SDAC 1CWVA 1QO3A 3QZWG 1JF5A 1A2YB 1F3RB 4OTXH 1T1YB 3QUKA 2W9EL 1JWMB 4DVRL 3H3KA 4OLUH 2AK4A 4X98B 5E8EB 1MEXL 3THML 3QCTL 2GW5A 4X6DE 3AREB 3ARBD 4DGVH 5ADOH 3DETD 3IDXH 4YDJA 5CMAA 3IJHA 4KKCC 3WE6B 2WK2A 2ICWJ 3DVGA 1NFKA 3BQUD 1S78D 2YRZA 5BS0A 4EI6A 2X1XR 2G75B 4QRQA 4F3FA 4V2BA 3V5DA 3IFNL 4NT6B 1YUHA 4FOMA 5H2BA 4G9FA 5GZNC 5TDOA 5GSRA 3NCMA 5E8OB 2DN7A 3QQ4A 2VUYA 5KVGH 5C09B 3GBNL 4X99B 2OXGA 3FFDA 4EJ1C 1JZ8A 3D39E 5GGTA 1AGFB 2KDGA 1YMHA 5F1SA 2RFXB 3DIFB 4DK6A 2BOCB 1S3KH 4AENB 3UAJD 4LGPB 2EDKA 2V2WB 4RFEA 3RGVC 3IFPB 1LO0L 1SJEB 5I19H 5FM5M 2Q76A 4JB9L 2XWBB 2A83A 3LKOA 3UPCA 1XGQA 4HIXH 1QPXA 3GMLA 4JDTL 4X6DB 3ULSA 4NQEE 1ZT4B 1OW0A 2D03H 5CZXD 2FDBP 3OGOE 3V9FA 1YYMH 4JKKA 4PLKD 3N06B 3BQUA 5BQ7B 3DBXB 2R23B 4Z0BH 4NO0B 5J12B 1BFTA 4JPKL 4G42B 2AXGB 2NY4B 2ATKB 3IVKA 3Q6FA 4YX2H 3CSGA 3GJFA 4FQXD 4G8IB 4EXPX 5DJZB 5CBAB 4DZ8A 5LQBH 4NRYA 1U3JA 3FFCD 4MA7L 2GAZA 4OZFB 1QFOA 1JGUH 4LCCA 1KJVA 1UB6A 3BGAA 4QXUL 4X7SL 3RWGA 3D39B 5B22A 1ZGLP 2YA0A 3H7BB 5GS0C 5HVGB 1B6UA 4K7PX 2A6DB 4NKDA 3T65A 3BP7A 4J3UA 5DDHA 4KROC 2NXYD 2I07A 4UIMB 3AUVA 1JWSA 3MJ7B 4HD9A 3E6HA 2M2DA 1QYGH 4WV1A 4XPFL 2ZUVA 3MRKA 3D18B 4GW1B 1DQMH 3QUML 3CUPB 5ERWB 1NGYA 4NQEB 4MQXC 1INEL 1G7QB 3MXWL 5FHBH 3BEWB 2DM2A 3L5HA 4JFEA 3P9MB 5DFTA 4PLJC 4FXGA 4YXLH 3GIVA 4OB5L 4TOYL 5DR5L 4FQXA 3I6GA 4OFIA 3UX9B 3RZCB 1WCQA 3BP6B 5JW5B 3FFCA 3KYOB 2W9DL 1A6UH 4QTHA 5GS0L 2K3TA 3VH8B 1RZIB 4HKBB 4L8SB 1W8NA 1NGXA 1F8TL 1F90H 1CFQA 3SHSA 5KBNC 2DLTA 4CKVX 1FNFA 2HVJA 3MPCA 3Q5OA 2LU3A 2PXYB 25C8L 1R3JB 3MYJB 1DDHA 4JKWA 5DMIH 1OGAE 3MJ9H 1LWRA 4XHJC 3MXVL 1EIBA 4KRLB 4XMKL 3BWAB 2XT1B 3I6LD 3I2CH 4X6FA 1BHGA 1ODAA 2P5WD 1EX0A 2BVUA 3SJVE 4DEPB 4Z0XA 1XF2B 5IIEA 4YEFA 4H25A 3AXLA 4K2UL 3F7VB 3PWUA 4G5ZH 5FO8B 1PKQA 3IYLW 4WU5B 3C8KB 4PJ8B 1V7NL 2N7AA 2YKLH 3DTXA 5B38A 2YS4A 1FSKB 4P49A 3QCUH 3GMRB 2CK0L 1KXVC 2DBLL 1D6VL 1PQZB 4YFLI 3RVUD 2BNRD 5IB4B 4YDIH 1ZVYA 4U1SB 2HJLA 4ZTPL 3PGCB 4LEOB 1RJZB 4MX7A 5IJVA 3O4OB 3BX7C 1CFTB 1XGPA 1NUNB 2PYFB 3UO1H 5E2JA 2BY0A 1Q0YL 4QHUB 5MERA 4HWEL 4ZSOA 2HFEB 4IS6B 1QLFB 2RAMA 4APQB 4HUVA 3BP4A 1OGAB 3HMXH 4MNHA 3VWKC 1JF1B 1S7WB 1CG9B 1RZFH 2DL9A 5ICXA 4HH9B 3AY4C 4MCYB 4NO2B 2Z31D 3ARGB 4QHKI 1A6AB 2F8VA 2X44D 4I1NB 3ZE2E 3SCMD 3WN5B 2MMXA 3TCLA 4Y2DB 3OJDA 4PJBA 2EZ0D 2P5WA 3ZE2F 2VLJE 4PR5B 3SJVB 1U93A 3UTTE 2NY2C 1PZUB 1SYVB 2O5XH 1CXIA 4X7TA 1FNGB 2VXVH 4HCRH 5CGTA 3H9SE 2A9ML 3SQBA 1PX4A 4OCXL 5DC9B 1EEZB 1MHHA 5HGHB 5MEOA 5AWNH 3QIBB 3DECA 1UFUA 4NNYB 4P5TD 2A6KA 3U48A 4MDJB 4NQVA 1I8MA 3H42H 3BEVA 2BNRA 1FZKB 2R8SH 4OI7A 1D9KC 3FT4A 1C12B 2O5ZL 1NLDH 1TZHB 2CUMA 2MKLC 4HPOH 1NGZB 4X7CC 5IV2B 4I77L 1WEJH 2DI9A 4MDIB 3IRZA 3JV4A 4YEEA 5KJRH 4HZAA 1A7QH 5HYQB 5E7BA 5HPOA 3O4LE 3V6BR 4OLZH 5DS8A 1H5BC 5E8PA 5CJQH 3S5LG 2VXQL 4UDTB 5A2IH 1C7TA 5D4QA 2HFTA 3ZMRA 1GGYA 3FO9A 5C0DB 3B9AA 2QJDA 5JQHC 1JHTB 4Y4FC 3DYOA 3SCMA 5FB8B 4PGCA 1BQSA 2LE9A 3KG5A 2VLJB 3HZYB 3BZDA 1HOCA 3UTTB 4NM8L 5I1GH 5A3ID 4Z7UE 3PP3H 1KNOA 1JNLL 4Y5XA 3H9SB 4CAGA 3OV6A 4Z7UF 1RJLA 1BJ1J 4U6XB 3D69B 5T5FL 1YY8B 5D1QA 2R2HA 3ALPA 1X5FA 5T33L 2MQ3A 5IQ7H 3DV6A 2ZCKH 3N1QC 2RQ8A 1CD9B 1FO0A 4NPYB 4RFNB 3QRGH 1GOHA 5SV4A 2WWKO 3A6CL 2AJUL 3IXAA 3B6SB 2UYLA 4PDCE 1MCPL 3PL6D 2FWOB 2JF1A 5GSVB 4KH2A 5GGSA 3MRJB 1MCQA 1FN4B 4KK9C 1F4AA 1UM4L 2DTMH 4OCLC 3O4LB 5LGJA 3I85A 5E2TH 2AVGA 5T3XL 3N1FC 5EC1B 5FO9B 4BZ1L 4M93B 4U1IA 4YHIA 3B5TA 1ZSDA 3RWHA 2JJVA 2EKSA 4GG8A 2FGWH 4YXKL 3ULUE 3HE6C 1C16A 3DO7B 3U30C 4Z7UB 1I7ZA 3V6OC 3U46B 4FQ1L 1P1ZB 4YK4B 1OTTD 5SX4I 3VGFA 5KVDL 1MRCH 3SKMB 3EDEA 3P77A 4MA3A 4UT6H 3BGMA 2FL5A 1BVLB 4EUPG 4O5LL 3QA3B 2OJZL 1W72A 2VL5B 5D7JC 2FX8H 2QSQA 2AS5M 4CMMB 3FO1A 4DZBA 3PL6A 3BRFA 5IVZA 5I71C 2BXZA 1CICD 4TUJA 5I8CA 4Z8FL 1WITA 3C2AH 3J8F7 2VXSH 5INCA 2HLFD 3HPJB 1R0AH 1U41A 4NSKB 3EGSB 2W60B 2D9QB 3LIZL 3QO0B 1JGLL 2ZCHH 4M1DH 4OCSH 4G6JL 5EUOE 5I1JH 3QH3B 3OR6A 3MRCB 2K7QA 5EUOF 1JMXA 4MD5A 2V7NA 2QADC 2D31A 1XH3B 3Q0HA 3IDMA 3KPRD 1RUKH 4MB4A 2XTJC 3SQOH 4XBGA 3ZDZE 5TH2A 1J18A 4XMPH 1CGYA 1KCRL 3CFBA 3NACL 3X13B 1LK2A 1VFUA 3ZDZF 4TSAH 2GJ6D 5JXEC 3L7EB 3NH7L 1I3GH 2GTZB 3I9GL 4WHCA 3V6FA 3JTTA 1H3WM 3D2UD 1Q72H 3P3YA 2R69H 1UWGH 5ACMA 1NMBL 3BKJH 4EVNA 4LKXB 4G3YH 1CICA 1MQKL 5LAXA 1TJGL 2E7LA 5C6TH 4Y4KD 1K2DB 4L9LC 2C1OA 2KH2B 1F58L 1PY9A 5J13C 1E28B 3UPRB 2GUOA 3LPGA 3IDJA 2BJMH 4HUXB 1S7XB 1T4KA 3T2NL 1ONQB 4GW5A 4RIRA 3ME0A 1MREL 5EUOB 1NBYB 2AV7A 1TZGH 3VD7A 4R8WL 2P5EE 3QFDA 3HC0A 1O7SA 1A14L 1KYOJ 2XYCA 1I7TA 4FFVD 2YD9A 3Q48A 1H3VA 3KPRA 1AXTL 4PRIE 3LEYL 4UT7L 4AL8L 4F7EA 4LCUA 3ET9F 4XP1H 1AGBA 2HT3C 5I1KH 1F42A 1ZHBA 3G04A 3LQZB 1D6EB 4NWTH 2ESVD 3REWA 2H32H 4F7PB 4ALAH 5HY9A 4UTBL 1JGDB 2VXUL 4QO1A 2EDBA 5HHPB 3P4OB 1ORSA 3D2UA 4UNVA 1SBBA 3DVFA 3EHBD 4OF3A 4Q9QL 4OCWH 3OX8B 4P4RA 2NX5D 4K7FA 4Y4KA 5DD5L 2NXZB 2LU4A 4TVPD 4C59B 3BSZL 5ALBL 5C0BE 1M71A 4JFHD 4MJID 2VAJA 4XNXH 1EGJH 2B1HH 3IS1X 3MRMA 2E9BA 3IJYA 4DGYH 1XIWC 4GBXC 3KLAA 1HQRA 2P5EB 1F4WH 5HYFA 2UV3A 1JZ2A 3E8UL 5J6HA 4PGDA 4P2QD 3UTQA 4L4TA 4LCIL 4PRIB 5HGDB 1WIUA 3C5ZC 1O7VA 2HYMA 2OR7A 3CCHA 2YD4A 1TQCB 3G5VA 1KACB 2ESVA 3BT2H 1AHWB 2QQLL 4OAWB 1LNUA 4GS7B 1LK3H 1TJHH 1FE8L 4XRCA 4HQQH 5F71A 1PLGH 5AZEH 2DICA 1PSKH 1VEPA 3QWRD 4HK3J 2R4SL 3MCLH 2VB5A 3ES6B 1EK3A 5I1IL 1HEZB 2NX5A 2UUDH 3FL7A 5ITBL 2YK1L 2CJUL 5MEPA 1J0IA 4JPVH 3EYVA 5C0BB 4MJIA 5IF0A 1SEBB 4U7MA 3KYKL 5DI8A 4D0CA 1S9YA 4AG4L 1GAFL 3CU7A 1QD0A 4OD2B 3VFUA 1GHFH 1OAXL 4P2QA 1YJDH 4G7VH 1QFWI 4ISVB 4LAQL 1T7YA 2WW8A 2K7PA 2YEZB 3FOMB 4GMTH 1ACYH 1G7JB 1IQWH 1FIGH 3J7HA 3PWPE 5KOVC 4H1LG 4NZUH 5ITFB 3HAEH 1QFWL 3DXAD 3U2SA 3GI8L 1FNEB 1CFSB 1MCLA 1SYSB 2FBOJ 4HWZB 1H3PH 4RGMC 3U1SH 4EEEA 3HLAB 1D5MA 1RZGA 4IRJC 5GPRA 5I75C 1HSAB 5H37G 2NNAB 3TPUE 3OKKA 3QQ9D 1XCQB 4ELKA 5I1EL 1WAAA 4H88L 1G0XA 2P8MA 5TGBB 4HIJB 1QSFD 5BV7B 3HKFA 3DO3A 4GMSL 4IHOB 2DMCA 4KMQA 2B5IC 5E2WH 1SQ2N 1MAML 5EO1A 5T3ZH 3IGAB 4PRNA 5JOFA 4F7MB 4QF1B 5E03A 2NLJB 1KIRA 3AROA 4DCQB 4M6MH 3CPLA 3PWPB 1AC0A 3CFCL 1CTNA 2ZNWA 3TN0B 4OLXH 3SDXA 1I7UB 2ZUSA 3QJHA 1A1OA 4RDQG 2A6IB 1RK0B 3SDDC 1F6FB 4G8EA 3O6LL 1U3HB 3BPNB 1MVUB 1AC6A 2H41A 2CPCA 1FYTD 3QPXH 4KJWC 1M1SA 2AJSL 3V5KB 4YUEL 1QP1A 3OMZA 1CGSL 1CN4A 4J1UA 4HJJH 1BVKA 3RGHA 3TPUB 1IRAY 2R2BA 1HWGB 4XTRC 3MTRA 2VABA 2FR4A 3FB7B 2M26A 3MV7D 2PW2B 3LN5B 5SWSE 2LU7A 1FFPB 5E2VH 5IG7A 1QSFA 5GGTH 1T83A 4QY8A 3GDBA 4DQOH 5HHNA 4MAUH 2HJFA 3B2UD 4MQSB 2A1WH 4OLYL 2OK0L 5C92A 5IB5A 3WLBB 3H0TB 2J8UE 2PUQT 4LLUA 1PFCA 1AY1L 2R9HC 1ADQL 4LQFL 3VFVA 4M62H 2WUBH 5DMGC 2J8UF 1UJ3A 1XGUA 3FONA 3SPVB 5IFJB 4QHMB 4ZO8A 1LP9A 3F58L 2VLKD 4WI3A 5K9OB 2IF7A 4U05A 5D70L 4K3EH 4ZUWA 2EO1A 4C57C 4MZ2A 4NQUA 4U1LB 5GRZA 5K33A 4KDTC 2CLZB 5FM4A 4BJLA 1J1XL 1FYTA 4ZS6D 3GJFH 2IAMB 1BGXL 5DMKA 2P4AB 1A4KA 1M05B 2OI9B 3CH8A 3DGGB 3QDGE 3NCJH 4YNYB 5DFVC 3RZWA 1CTOA 5FECA 3C6SB 3OJVC 2VLRD 2FLRT 5SWSB 4YGVA 1CL7I 3DX7A 4MD4A 3ARRA 2XTLA 2NTSP 5DGQA 1J05A 2BX5A 3VI4E 5HI5C 3DRQB 3WXWL 1J0KA 2I9TB 1NCCL 3NCYP 4K3JL 2FJGA 5EUKB 4M1GL 4F7CB 1CL7L 2APBA 1A64A 3BUYA 4HGMA 1HHGB 2J8UB 4PRHD 1K8DA 4S1QL 3IFOA 1A7PH 1JJUA 3QEUB 1N5AA 3MA9L 2DIAA 2DKUA 4H20L 3WIIL 2VLKA 5I16B 1Y6KR 4MA1C 1ZTXL 3SKUD 1DLFH 3IXTB 4JY6B 3IF1A 1A9BB 2HRLA 4KRNA 1IC5H 5JPMB 2AQ1A 5DRZB 1L7IH 1U8MB 4WFFE 3QCVH 1PJ9A 1IC7H 4F33B 4LKCB 3PHQB 3P11H 4JRYD 4Z95H 5GGRB 5CIPB 5IBUG 5J56B 1D5ZA 3QIWB 3O3DA 5T1LA 2H6PA 4X4MA 3VXSE 5GS1A 3QDGB 1M7XA 5D96B 1MNUL 1QFHA 1IZJA 1TFHA 3V5HA 3A0OA 3DSNA 5DK2A 2VLRA 1NL0L 3GB7A 3QB7C 4QRTB 4QYOA 3HE7C 4UTAL 3RNKA 1AI1H 4LCYB 3STZB 1TENA 5AZ2H 5I6XB 3L3GA 2OR9L 5JDSA 4PGJA 4NQCE 4UDUB 5D7IA 2W65B 4RGOH 3LQAH 4F9PC 1ZKAA 4RQQA 3CVHL 4LLDA 1IILE 4OV5A 2EDDA 1I8IB 1NCWL 3S88H 4M6OL 3DGCR 4HBCL 2HFGL 1ZVSB 4GAJL 4Y1AE 3WS3B 4ODUB 1IFHL 2VSDA 4BYHA 1ETZB 3FQXB 2BSSB 1DR9A 4HUMB 5IW6B 1IBGH 4DKFH 4FQ2L 4ZAKC 3LPWA 5JXAH 3OKEB 5KVEL 1FH5L 5LG1A 3X3FL 2BY1A 1FFNB 4JM4L 4YE4L 3LDBC 3PDGA 4JRYA 4GO6B 1IGFL 1SJHA 3P4NA 3WUWB 1NUGA 2JCCE 3B9KC 4L8CB 3VXSB 1B9ZA 3VWJD 4MCZB 4E9LA 1N0XL 4JAMB 2JCCF 2HT2C 2MFNA 5ADPL 4QWWD 4M8QA 4JN2A 5EO9B 2J2ZA 2VAAA 2YHGA 4L4VD 1FLRL 1I8LC 3QWOA 1L7TL 1FCCA 4RBPK 4NQCB 5FGBC 1I75A 3FO2B 4EIGB 4S11A 1ZA6B 4PJ9D 2DQGH 1F5WA 4F8TA 1BM3H 4ODVH 3DURB 5E5MA 5TDNA 2XY1A 4QXTA 5IESL 4P2RE 1CFBA 1NCDL 4U49A 4XC3H 5TDPA 3C08L 3RY6C 3TNNB 4P46D 4POZC 1E0OB 3GGWA 3CX2A 4E0RB 1IGTA 4P2OD 3BIBX 4Y89A 4Y1AB 2YPKB 1ITBB 5F96H 2VISB 5I30H 5GGUB 1OP5K 1CFVH 5TF1L 4ZFGL 3KVQA 3BZEB 3GBLA 2J88H 4K8RD 1OVZA 1N4XH 1VB9A 2L4OA 4XPAH 5CHNA 4X83A 5F97E 4ZFFB 3MACH 2X1OA 3F5WB 1C5DA 2JCCB 3VWJA 4PJ7E 3S37X 1E4WH 1PX3A 2ZZUT 3NAAH 4PJ7F 1YEGH 4WHYG 4F80A 1CGWA 4D8PA 1TXKA 5GIRA 2Z35A 3TIEB 4Z7WE 3MBED 3KLSA 3GSUA 1ITCA 3EW3B 4JRXE 3RUGE 4Z7WF 3VMNA 1TJIH 4HC1L 3RUGF 2KQMA 1JIBA 4L3AA 4PJ9A 3FB6A 3JWOH 3A6BL 1KFAL 2RHEA 1QPPA 5CKAA 1WF5A 3EO0A 4P2RB 1IMHC 3IDYB 1VKXB 1CDJA 2AEIT 2IPKB 4P46A 5TFSL 5I1LB 4JHZA 2JIXD 3LHPL 1R24A 4P2OA 5B4MD 3MOQA 3OJ2C 3U4AA 2RR3A 3C2SA 4LDEB 3TBYB 1RIVH 1AXIB 4UINL 2IH1A 1B0GB 5D5ME 3DPBA 1QRKA 4ZXBB 4OIIH 5KVFH 5D5MF 2EH7H 3FCTB 3GZKA 4GQ9H 2Z8SA 4LCWA 3T77B 4X5XA 3JBG7 3RX5A 5MHSE 5IROA 2BRQA 4N5UA 4Z6AT 3KXFD 4QRSA 4J23A 5DRXA 4YQXL 1GGCL 4P4KB 2HTLC 4LPUA 1RZJH 4PJ7B 1MRDL 1UYWH 2WUCL 3HPLA 5J12C 2YD1A 4IRZL 1OM3L 3C87A 2J12B 3LS4H 3VFMA 4Z7WB 4OGYL 3RHWF 4OZ4B 4JRXB 5DLML 4WW2C 3RUGB 1FO0H 3M8OH 2DJUA 2R4RL 3ROLA 3TT1H 3O2VH 4EI5B 1RUQL 4JFDE 2Y06L 2AJVL 2R0KH 4AT6A 1XR8B 2JIXA 4M6AA 3QXAA 4H5SB 2VUOA 3CJJA 2XA8L 4XVSH 5C8JA 4OZFG 2P24A 1QA9A 5D5MB 1V5JA 5EIIB 3IU3B 4NQSA 4OF8A 5T1DH 2CIIB 3PQYE 2BHUA 32C2B 3TFKD 1NFDA 1JZ6A 1P4BL 1H0DA 3C60B 4XP4H 2X4PB 1QNZL 1FPTL 3KXFA 3OAYK 2XKNB 3ECBB 4X8JA 4CW1B 1AXSB 5FGCB 4IOIA 3GO1L 3WMSA 4PJEA 1QKZH 4P5MB 3VD9A 2I60H 1U0QA 5EC2B 1J1OL 1HKLH 3WEXA 1L6ZA 3MLTA 5KSUA 5FKPB 4D9LL 2NY6D 1MJ8L 1XGYH 3BW9B 1BECA 1AQDB 1W72H 4Y0GA 4P23A 3Q6GL 3MC0A 4JFDB 1XZ0A 2NR6C 2IPUK 1J0YA 2IH3A 5JHDD 4S1SH 4G6KH 4J4PA 1NEZB 3GMQA 1GC1C 2FATH 2YXMA 5DUPL 1DQJB 3LKPB 5CP7B 3MRLA 4I48A 4PJXF 4UQ3A 4XC1H 1NSNH 4LU5H 5DMJB 5T1KD 5CEXA 3MOAH 1A0QL 4OSUL 5DJDA 1KPVB 5EORL 4NUGH 1KJ2A 3TYFA 2GTWB 4JO3H 1U95B 5DEFA 1S7TB 2PXYC 4GXVH 2BRRH 3PQYB 3TFKA 5C2BL 4G8FA 4PJ5E 4WFGD 2D7PA 1SBSH 3EDKA 3K1KC 5FK9B 3L5WB 5AEAA 2DLFL 4IOFD 4Z77A 3CLFL 3MGOA 5JLZB 4BH8B 4OM1L 2R0LL 5D72H 4XBPB 5GJTH 4I18C 5BW7A 5DYOB 1PVHA 5INDA 4RMVA 1QSED 1MJUH 1FAIL 1RULL 4ZTOL 3GUTA 5MEQA 3O6FB 1JHLL 3EIFA 4DEPC 2Q86A 2X09A 1MFEL 1KJMB 2YBRA 3QHZL 4A2LA 1OQOA 1Q9WA 2HWZH 2WBJD 4LEXH 5F7LB 3U36A 4V3DB 4K9EH 4LSPL 1F00I 1W0YT 5KANG 3KPOB 2QQNL 1BD2E 2LAGB 1B6DA 4U1GB 1ORQA 2VDML 4JFYA 4PJ8C 1DQLL 5TE4H 2ZUQB 4KVCL 1FSKC 4C56E 4S0UC 5JHDA 4YAQB 2EDOA 3B8YA 2DQUH 3W9EB 3H9ZA 3KPPA 5DUML 1GC1L 3LN4A 4HJ0D 5T1KA 4G6ML 1EVTC 3MBXL 4IMLB 5K9QG 4R96B 3RL2A 3O4OC 5D9SB 4N1EA 3U6RB 1K4DA 4MD0B 3SE3A 4MWFA 1XF3B 3KPMA 3MOBL 4NFCA 4PJ5B 3D85D 4APQC 1OP3H 3ARDC 1MI5E 4HKXA 4U6HA 5DJXB 5DJ0A 3RFZC 2R56H 2PO6D 3W81A 5TE6H 1NANH 3QO1A 4LPTA 4XP9L 2F8XC 1SY6L 3L3KA 4D3CH 1QSEA 4FQJL 2JJSA 3C5SB 5IHZA 3W5NA 4Y2DC 1KTDA 9CGTA 4JY5H 3G5ZB 3LRSB 1R3LB 2AXJA 5K9QI 5E9DA 1S5IL 2EXYC 3EO1A 2WBJA 4XZUA 3MV8E 3R4DA 5FUOL 2LVCA 1YEKL 2ATPA 1BD2B 3MLYL 2AERT 3M17B 2V2XB 3QIBC 2UVEA 3QJFB 4GRLD 4NHCL 5E94A 1GXEA 3RWJA 4C56B 4NIKB 1YN6B 1S9VA 2UZXB 5D2LF 4L8DA 4ZQKA 4DTGL 1KLGB 3VG9B 3ZTNL 4CU8A 1NAMA 3SGEH 3UCRA 1A47A 1ND0B 3PDOB 5L2JB 4XBEL 2H32B 3KPTA 2MCPL 2YD8A 4OF5A 2ED8A 3U7AA 4NUJA 3D85A 4GAGH 3C5JA 3T8XB 3QPQD 4PJDE 5IGXL 1MI5B 2A6JA 2PO6A 1KCUL 4PJDF 4U1KB 1U8QA 3FZUD 4UV7L 3IJSB 2ZSWB 3G6AB 3WJJA 2VIRA 3KS0J 3MRBB 2CKBA 2QQKL 4JM2C 2FX9H 1ZS8A 5C0FA 3PP4L 4R7NA 1V8HA 1RU9H 3MV8B 5L8JB 3QYCA 4NKQB 1Q9KB 4PV8A 3CLEH 3QNZA 3WO3B 5CD5D 4HJGA 3RQ3A 4I13B 3QDJD 2X5PA 1IAOA 4PJFE 4WW1B 4YZFE 4GRLA 4DKAA 5IHUH 4PJFF 4YZFF 4DJMA 5D8JL 3LD8B 4QRPE 3KJ6H 4Y5VC 4TQEH 4TVPH 3GKZA 3ZE0E 1GGBL 4ZD3L 2OZ4L 3TPKA 5CILH 3UC0L 3ZE0F 1VADA 4CADB 1FZMA 3RVVD 5FA3A 3WFEH 1LHZA 3E3QA 1DTUA 1BREA 1FDLL 1N5YH 2V17H 3T4AB 2Q7YA 4UZGA 2I9LA 2A77L 4ONGL 2OTWA 3D9AH 5DWUH 1L4IA 1RJYA 5CINL 4GT7A 4ZPVA 4PJDB 1KTLB 5J1AA 3RTQB 2VDRH 4ELME 3DHJA 3L3DB 1EV2E 3OGCB 2YPVL 5B21A 5KZCD 4ELMF 4WY7L 4QTIH 4UIKH 2IBGA 4W81A 3IU4L 3WJLC 4PJHE 4HKZB 1E4JA 2EDNA 1GRWA 3STLA 3VXRE 1OARL 4PJHF 5BVPH 3DMMB 3PIQA 2P7TB 4PJIA 4PTTA 1RUMH 5AD0B 5LKNA 2K1MA 3ZKMC 2DYPD 5IMKA 4LHUB 3IKKA 4JANB 4N9GA 4OZHA 1IAKB 2ERJB 2VZVA 1RHFA 3QDJA 4PJFB 4M61A 4KMTH 4YK4C 3UBXB 1I3UA 4QRPB 1CVSC 4U3XA 2AK4E 1FVDB 4XNMA 4F57H 3LEVL 1G7IB 3L6FA 4WFEE 3DUSA 1GZPA 4QHNB 5BMFH 5JO5A 3V95A 1PG7H 4QHLA 1P7QA 2X70A 1VFAA 5C6WH 1U8IB 3PXHA 1IAIH 3KYMB 5TF0A 4HLZG 1L6XA 3MNWA 3MUGB 1M4KA 3DROA 1KEML 2NMSA 2ZOKA 1S9XA 4HUWA 5BS0E 2IPUG 3KLDA 1NJ9B 4FFWC 4XX1E 4L3ED 2FSEA 4ELMB 4G9FE 1OAZL 3BESR 1IM9D 1MOEA 3GMPA 5E99L 5SX5K 4KZDL 4HAGA 3MMEA 3BD4A 4PJHB 4WWKD 4HWUA 3PWNB 3VXRB 2E8ZA 3ZTJH 1JHKH 3ULUC 2CLVB 2DYPA 3E1F1 2IG2L 4N8PA 5HD8D 3VGAC 4X6BB 5I18L 4XPBL 2LFGA 4G8GD 3OAUH 2XRAH 2DDQH 2IC2A 3QUKB 2IBZX 5SWQB 3ALXA 1INDL 4DVBA 4UV4H 2AK4B 3NA9L 4QCIA 4YHZL 4O2EA 1AD9A 4S1RL 5ISZD 1BAFL 1HXMA 4G7YH 1EMTL 1MCDA 5CMAB 3IJHB 3EOBA 3DVGB 1WZ1H 1LDPL 4L5FH 3ARED 2J4WL 5FM5O 4X9IA 6CGTA 5BS0B 4EI6B 1LO5A 2OL3B 1XGRA 4QRQB 4NC0B 3V5DB 4GKSB 1YUHB 2NY5C 2X4TA 5H2BB 5J8OA 4G9FB 5F1IA 5TDOB 1IM9A 1INQA 3H3PL 5DD3H 1C08A 1C1EH 1DUYA 5GSRB 3QQ4B 3MLVL 2RCSH 2XFXA 2A74B 3BI9X 4I3SL 1QUNA 3TT3L 4WWKA 4HX1B 3I02A 4GKOA 3GMMA 3ULUL 3RU8H 2NW3B 1NGQL 1T6VN 5F21B 1A6TA 1MCHA 1N6QH 4XNQA 3QHFH 4G8GA 1PEZA 1Z9SA 4J8RA 5IEHA 5DT1L 3NFPA 2CGRL 5ICYA 4ENEC 4FFZH 4TYUA 1S7RA 2J5LB 3O9WA 2Q76B 1YDPB 4ZODA 4FP8L 2A83B 3LKOB 5GGVH 5ISZA 1KTRL 1XGQB 1CF8H 3TH3T 3GMLB 1WBYB 3OB0H 3ULSB 3X3GH 4XWGH 4X98A 4JHWL 3U4EA 2O93L 3QIUB 1JI2A 2VSCA 4HK3N 3AREA 4YXHH 5E56A 3BQUB 4JFEE 3WE6A 1UXSA 4KKAD 5DJ8A 5C0RH 3OXSB 3OF6A 5I8KL 4O02L 1MCRA 5JHLL 1YEJH 3Q6FB 5J7CC 3TO4D 3GJFB 2NY5L 3QUXA 4X5WA 1YEHH 2KPNA 4PD4K 5GHWH 1S7UB 2NY4D 3FFCE 4NRYB 3O11A 4ZYKA 2GAZB 5E8OA 4LCCB 5HSFA 5D1XB 1UB6B 1NCAH 4HF5L 4X99A 3I50L 4Z5RA 4JKPH 4ZFOL 1HCVA 3NCFB 5F9JB 2VKWA 4J3XA 3FMGL 4JREB 3VXMD 4I9WE 5E24E 4NKDB 3T65B 3D39D 5FCUL 2DQCL 3QXUA 4NBXB 5I76A 1BFOA 3C8HA 5DDHB 1AFVH 2ARJB 5GGQL 3EJZD 3JWDH 1AR1C 1A7NH 2BOCA 2I07B 4R26L 1H8SA 4ONFL 3N1GC 1HINL 4RGND 3EYFA 2AGJH 2DQHL 5ABDE