1NAMH

Murine alloreactive scfv tcr-peptide-mhc class i molecule complex
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
275
structure length
275
Chain Sequence
GPHSLRYFVTAVSRPGLGEPRYMEVGYVDDTEFVRFDSDAENPRYEPRARWMEQEGPEYWERETQKAKGNEQSFRVDLRTLLGYYNQSKGGSHTIQVISGCEVGSDGRLLRGYQQYAYDGCDYIALNEDLKTWTAADMAALITKHKWEQAGEAERLRAYLEGTCVEWLRRYLKNGNATLLRTDSPKAHVTHHSRPEDKVTLRCWALGFYPADITLTWQLNGEELIQDMELVETRPAGDGTFQKWASVVVPLGKEQYYTCHVYHQGLPEPLTLRWE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title CDR3 loop flexibility contributes to the degeneracy of TCR recognition
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords BM3.3 T Cell Receptor alpha-Chain
total genus 65
structure length 275
sequence length 275
ec nomenclature
pdb deposition date 2002-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1namH02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1namH01
4FZ8L 1JTOA 3RDTB 4W70A 2XACC 4HIXL 5FCUH 2NMSA 1R5WB 4NQXA 1CTOA 4KI1A 2AK4A 2B7DT 5IUSA 3TIEA 5I1CH 2J4WL 2RB8A 2R39A 3X14B 3EJYD 2Z92A 4TNVK 1A1OB 1O5DT 2EE6A 2FGWH 3GMLA 3SKNA 1NFIA 4OF8A 4DZBB 4JFDB 1IFHH 4KV5F 3V5KB 3HAEG 4EUPH 3S8WA 3OKEB 4JDVB 2Q87A 3ARED 3WUWA 4WO4C 3HI1A 4GKSA 5GGTA 1PLGH 4ZAKD 3C5ZC 4PRDA 1ZLWK 3RAJH 2IFFH 4B50A 4QRUA 4QXGL 2EYRB 4M5YL 5C0GB 4PRBB 3MJ6A 3QQ3A 1RFDH 2YR3A 4G6FB 5I18L 3IFPB 5F7HA 3CDCA 2GTWA 3EOBB 4YUEH 5FGCE 5E6IA 5GS1B 5TPWL 2IADA 3SKUD 1CD0A 1HINL 1MCBA 1YDPA 4OGAD 2E7HA 3VFUA 1KCVL 5HHOE 4KI5C 4NOFA 1T03L 2Z8WC 3ZE0E 4ONGH 5C6TH 2C4XA 3ARGB 2BX5A 2XFXB 4U6HA 3WO4B 1UA6L 4YE4L 3VXUB 1RUKH 4U0RC 4RAVB 2MHAB 3CK0H 1QBML 3MRJB 3IGAB 4F37F 3RWFB 2Y5TB 3OWEA 4JREB 4OLWL 3PQYB 3Q6FB 3VXRA 2ZWLT 1MIMH 3V4VL 5HGBB 1C16B 3JUZA 2R29H 4HKJA 4PGDA 3H9SA 4X6CA 3MV8E 3T0EA 3DXAD 5C09B 4PGEB 1CDYA 3STLB 4Y5YC 2OS7A 1OAYH 4HXAH 3NBNA 1WTGT 2H45A 3MLVH 4ZO7A 2RR3A 4X5WB 3CH1B 3S96B 2Y6SC 3P4MA 2CD0A 4GQ9H 5F7FA 3V6OC 5GZNC 4IIQC 2AK1H 4LLQB 2VDML 4YC2C 3SDCA 2NZIA 1NCBL 4HT1H 4F7PB 4OD1L 4CN4A 1K4DB 1J1OH 3KXFA 2NXYC 4Y4FA 4Y5XC 4QRQA 2WUCL 5C09E 3IJSB 4FFYL 1HKLH 3H6JA 3MV11 1ZSDB 4HGWB 4G6KL 3U30B 1FSKC 1WZMA 4JFPA 1GSMA 3L95A 1KT2B 5GSRA 4NM4H 2J88H 1P5UA 3NOIA 4OQTA 1U9KA 4ODTL 2GUOA 4KROB 3WLWD 4H25A 4NN5C 1CL7H 4PTUB 3ZE2E 3HPLA 1NH6A 3NFNA 4V3EB 3A67H 5KANI 1A4JB 4MD4A 4N0CA 2FX9H 5JLZA 2Z31A 5JORA 4BSVA 3IFOA 4N8CL 1FNEB 1T3FA 2DBJA 2DMCA 4YHPA 5GRXG 3LDBB 2YBRA 1OAKL 5EOCJ 4U6HB 1RD6A 3IU4H 4FQLL 2AERT 4D9QE 1BBDL 2XKUA 5HYSB 5KS9A 4X4ME 1WC7B 2Q76B 1AGEB 1PX4A 3MLSL 2IEPA 5DWUH 3H2WA 5D1XD 3IDYB 4KK9D 1I9JL 5IVXE 4RZCA 2D7TL 2H32H 4KHTH 1XR9B 3BWAA 5JHDE 3WL9B 2EXWC 5DR5H 4OAWB 5CEYA 3T2NH 1FO0L 1MNUL 2HTKD 1ZLUH 1F4HA 5FHBH 1UEMA 4JKPH 4P4RB 2X5PA 3LIZL 2J7LA 4XXDB 4LLUB 5GGQH 4M1CC 4FN0A 2DQFB 3W0WA 3KS0H 3DGGB 4OFYD 3V6FA 1LILA 5I1HH 2OK0L 2R4RH 4X5WA 1N5YL 3OKMA 3V0VB 5AAWA 2F58L 2FEDC 3T2NL 3ARZA 2IADB 3QH3B 1Q72L 1TJIH 1V3KA 2JJVA 4UOW0 3FZUC 2ATPA 4LEXH 4KXZI 1HOCB 3WJLC 3B9EA 3EBAA 2R0LH 1YMHB 2W9EH 4BQBA 1JN6A 4NNPL 5BQ7A 5K9JH 1HHJA 2DDQH 5HDBF 3SGDH 4JDTH 4RGOL 4C54A 4UT9L 5GQBA 5CBEB 4LOUC 4DGYL 1BLNB 4S1QH 4IRSB 3FB6B 3PF2A 4WIQA 1UM6L 1KBGH 3FAXA 2Z31B 3Q1SL 5LKNA 1A6WL 3STLA 4JHWH 2QTEA 5ID1A 1A5FL 1OAXH 4KJWC 5CEZE 3LHPH 1AGBA 1OAZH 2APBA 3UYPA 1LE9B 1T1ZA 3NVQA 1F6AB 1REIA 2BCKB 3P4MB 4G6KH 4AL8H 1JGVH 1MAJA 4KQ4H 3C87A 4LLQA 1EMTL 4OLUL 4J3UA 1OCWH 1MAMH 4S1SL 1RZKL 4MB3A 3LVEA 3V0WL 4LEOA 32C2B 4GUPA 5F9AC 1D5IH 4CVWA 5IWLA 4XVSL 3RL2B 4JPKH 3WLBA 1BBDH 3OGOE 4QHLA 1G6RB 1WCBA 3ARFA 1WIUA 2RCSL 4JPVH 4BQ6A 3QCUH 1U92B 2Z93A 5SWSB 3MLVL 1CGWA 3DJ9A 4XXDA 5DD6A 1XCTB 4FQ2L 1MI5B 5EC2A 3GSRA 3DX9A 1HILB 3MREB 4XAWH 1UJ3A 2BK8A 4IRSD 2X1OA 4MMZC 5TFSH 2KKQA 4FHBD 4D9QD 3KDMA 4UOW1 2Z91A 3GSNL 3A67L 1B6UA 4OTXL 1QSZA 5T1DL 4M1DL 2BSRA 3TT3L 3QUXA 5CD5C 4C56B 3MC0A 4TTGA 5JHDD 1A7OH 4N8VA 1WBZB 1A9BB 4NCDA 1IGJA 4KAQL 2YBRB 4QXWA 4V1DA 5KS9B 1G7MA 3RQ3A 5IB1B 3HI5H 3BP6A 1PGRB 3PE9A 4YDIH 5MEPA 4JG0H 4R0LC 4BK4A 4P9MH 5C0BE 3P77A 4H8WH 4NP4L 5C0AA 3QWOB 2Y36H 2WBJA 3HPJB 4QOKA 4PJ9C 5AUMB 2X1WL 3B4NA 3NFPA 3EYUL 1BQSA 3LS5H 1VGKB 3VDAA 1HDMB 1KPRB 5E2WH 5HDBE 1QKZH 2C3HA 4AMKL 1XGQB 5EZJA 5IHUL 2ESVB 1N64H 3U4BH 5TQ2L 1GZPB 2MPAL 3ARBD 5DUMH 1JK8A 4HS3B 4ONFH 2H6PA 4MA8L 4YXHH 5FDYA 4P3WA 2K7QA 4JZJB 4NN6C 4CU8A 5DFVC 4Z7WB 5IGXL 4WUUA 4G8FA 1P84K 2LTQB 4R90L 4LBEB 1CQYA 4DKDC 5FB8B 3BYTA 3B6SA 4PRIE 4HAFA 2A38A 1C12B 2QQNH 3ULVC 2F5AH 2ZG1A 2NY3C 3BKYL 3QNZA 4L4TD 1F3RB 5J57B 5IJKA 4XNQB 5LBSH 5ISZD 3FB7B 2IFGA 2XKNA 5T5NG 2P8LA 3D39E 1FBIH 1NCAH 1IC7L 1QUNA 2A83A 4L3CA 3MRHA 5JUEL 4GKSB 3BGMB 1QD0A 2GTZB 1A9BA 4F2MB 1T1ZB 4UT7L 3MNVB 3X3FH 3MJ9L 1MCNA 2V7NB 4OLEA 5BOZG 1ZGLM 3EDJA 4XGZB 4P2OA 1CR9L 3BEWA 4JZNA 4FRWA 2D7NA 3EOBA 4XT1C 4X6CE 12E8H 3BXNB 4BQ9A 4RMVA 4MZ3A 4P57A 4FQXB 3T65B 1T1XB 1KIQB 3VFUB 5F7MC 5C0AB 5GPRA 1N2RB 1XGPB 2XY1A 3JV5A 4K3GA 4H1LB 3JWDH 4WTXA 1VFAA 2YRPA 4KC3B 4ZTOH 2A2QT 2Y06H 4U0QB 4PJEF 1CT8B 5E94B 4GG8B 4NO0B 2P45B 1X7QA 1S7XB 3V7AG 3RZCD 4P48A 4GG6E 1HK6A 3T0DA 1K6QL 5F3BB 1AGCA 3L3IA 1J8HB 4XNZC 2HH0L 4LCWA 5MI0B 3H42H 4X7EC 2C1PB 4LLYB 5JOPE 2Z91B 1XEDA 1HHGA 4PGDB 4I5BA 5IMLB 2ZUVA 4MCZB 1NSNL 3JWDL 2AS5M 5H35B 2F54E 5D7LD 2NZ9C 4Y5VC 3S36X 4EI5A 2YPKA 1MJ7L 1MRFH 1WBZA 2VITA 5BXFA 3V0AC 5E1AA 1BFTA 4R26L 4YHLH 4G8FB 4FQJL 1EJOH 2GT9A 3O3UN 3UZEA 5F8RC 2DM2A 3C8DA 3QEUB 4JRYE 5EG6C 1X4XA 5IMMA 4HWBL 3OXSB 4P5MB 4U2YA 2IAMD 3NZ8B 5T3ZD 4A6YB 2OP4L 4WRLA 3VFNB 1YJDC 4PJAE 1XFPA 2CRIA 5TE7H 3M17A 4N1EA 2P46B 1SM3H 4P5KA 4QOKB 1CFSA 3MRMB 4HUXB 1AQKL 3HG1A 4JQVA 4MLSA 3MA9L 2HG5A 25C8H 4Y88A 1U3JA 1VGKA 3QBTB 1WSST 1IBGL 2R2CA 3VRIA 5D2LA 2PXYD 3ESUF 1EJ6A 1URLA 1IT9H 1WQVT 4LSPL 4XWOD 2Y72A 4D0BB 1MCLA 2HWZH 3VE0B 1YEKH 4X7CC 4IDJL 4L9LC 4MD4B 5L2KB 4U1KB 1MCHA 2NY0D 1SMOA 4PJ5D 4QOKE 5E8NA 4O4YL 1CXHA 5DSCB 3UAJC 1T89A 4TRPH 1RZIB 5AWNH 1BGXL 5DMJB 4PREB 4H1LA 3V6OE 3Q2CA 1DR9A 1WBYB 5EA0H 3B6SB 4P4KA 5IFAH 1NUGA 4YNYA 1H8OA 4MHHI 3U9PL 3QNZB 1N8ZA 3C6SA 5DJ2B 3F62A 4ZSOE 4PJFE 5F71A 5L8KB 4LCWB 2D03H 1FGVL 2D31A 4QTIL 5CP3H 5FXCH 5SWZA 5LVEA 2YC1B 2H2PC 2PO6D 2YXFA 5ALCL 2RFXB 1F2XK 3BE1H 2DLHA 3BGMA 2Y36L 3D85D 1A0QH 2BNQD 1F90L 1NLDH 3HE6B 2ZJSH 5ABDE 4HWZB 4ELMA 1EBPA 5LXGH 3BVNB 1C5DB 1I9IH 3BXNA 2FYYA 5HY9B 2V2WB 4MVBA 5F21B 3UDWC 1HH6B 3EYVB 2N7BA 3BN3B 4BZ2H 3WXVH 1WZ1L 4NKMA 4ODXB 2FATL 3VFMA 1PVHA 3NPSB 2OM5A 1MVUA 5D6DA 5IBTH 2IH1B 4YXHL 1CFSB 4NN7C 1RUMH 3GSNH 3MOBH 3O4LA 4JQIH 1S7XA 1CGSL 1NCDL 1FL6B 4OZGF 3RTQA 2VDLL 5C6WH 4OFDA 1Z9SA 1JPGA 1KJ2L 2C9AA 3F6IA 4X98B 5CBEA 3RP1A 3QUKA 4JRYD 1QFOA 3FHAA 2RHEA 4G42A 2QR0A 3EAKA 4P23B 4HUUA 1NMAL 1YA5A 3KYKH 2IMMA 2XI9A 4G7YL 4K8RD 1I7UB 2PYED 1G0DA 3O6KL 4Q74A 2BSSB 1JZ8A 3ZDYF 3JBG7 2LVEA 2C1OB 1NJ9B 3ARPA 2ED9A 4MA1B 4G8EB 1OGAE 4XP4H 5EOCL 4WY7L 3RWIB 1BX2B 2WLZA 2X6MA 2ERJC 5KSBE 5I17B 4LHJB 3RWEB 5IMMB 2HMID 4XNXH 3UC0L 1QVOB 4MXWH 4KAQH 1J18A 4POZC 3UJJL 2DQCL 2JB6A 3K1DA 3MNWB 4HH9A 3VXNB 5KVGH 4P5KB 2FD6L 1FCCA 3WFHB 3WLBB 4HUXA 5CGMA 3OJMB 3O2DA 1F3DJ 1XGUB 5ERWA 5FYKL 3UPRA 1QG3A 2C7UA 3QUYD 4QOKD 5C0CB 2AK4E 5D2LB 5HHVH 1ONQB 4QGYA 3GGWA 1LE5B 4N5UA 3DVNB 1A3RH 3OZ9H 3DX9B 1RIHL 3PDDA 4PJHA 4LVHC 2M2DA 35C8H 1EHLL 4U1KA 2VH5H 4GAGL 3T4YA 5E8NB 3S98A 3O9WC 2R23B 5B38B 2GFBB 1D5IL 5JTWA 5EC1A 5JMRA 5IB3A 2IH1A 4UUJB 1IGJB 3J8F7 3BDXA 4RRPG 3UXFA 2QADC 3UTTA 4P4KB 1TVBA 5J1AA 5FECB 1J1PL 3HMWL 1DLHB 3EDKA 2J8UA 3WFEH 1BIIA 3MUZ1 5FHAL 5DHXB 4JO4H 1T0MA 2OJZL 4JHAL 3WSQL 4MQTB 5D1XA 2DI7A 3SOBL 1C5BH 5J1SC 4JKPL 4Y4HB 2MQ3A 2IANB 1S3KH 4OUOA 1LDPH 1INDH 3TVMC 1BP3B 1ND0B 5IB4B 4Z8FL 2A0LC 1KN4H 3RY4A 3QCTH 1FNGB 5I73B 3RWIA 1FP5A 2IAMA 2XTJC 4BH7A 3MSPA 3HE6D 4Y4KC 3MLSH 2EKSA 4NO2A 3H9SE 5DT1H 4Q97A 2W9EL 5LCVL 4DVRH 2M8XA 4XCYB 4WO4A 4NPYA 3CFJB 4PRAB 2VWEC 2F54A 5F93C 3JUYA 4JN2B 5JMOC 4L4VD 4JRXB 2A0LD 4JZJA 2DD8H 3HC0B 1SEBA 3UTPD 4IEFB 1OWWA 5IVZA 4FNLL 1K3ZA 1Z3GL 5CD5D 3WS6A 4MJ5A 3RJQB 2B0SH 1V05A 5FB8A 3U2SB 3UROR 4KK6D 1MJ8H 1RIHH 1A2YB 2GY5A 4FMKA 4OCWL 5DD0H 1M4KA 3H0TB 2G75B 5HHPA 4JQIL 3ULVF 4IMKC 4DGIH 5ESVA 3FB7A 1Z0MA 1FL3B 1KN2L 4PJDE 4P23A 2QQLL 1EFXD 3S37L 1I7UA 5FDWA 2FNBA 5K9OB 1TNMA 4Z7VA 1D5MB 1UB6A 3HNVL 4UUJA 4LL9A 4JFEE 2J2ZA 2VDOH 1EBAA 4NKOA 4F2MA 1Y6MR 2AKRA 3VI4F 4ZD3H 5C0RH 1XF2B 1I9IL 5HHOD 1U3HC 4FQLH 4CNIA 1IM9D 1JNLH 2BXYA 3BEWB 1G0YR 3FFCB 4JZNB 1EVTC 4Q2ZA 1ZHNA 5B4MD 3QQ4A 4AIXA 3EIFA 2ICEA 4LDOB 1QSFE 3PV6A 2VMFA 4ZNEA 4OF0A 5CWSB 2IPKA 4JGUA 5JDSB 4RA3A 4WI6A 1KIPA 2W65B 3KYKL 5E8PB 1HKLL 2WP3T 3AS1A 3V6OA 4N5EA 5B39A 3HC3H 3MUJA 2D03L 3ZKQD 5J11B 1X7QB 4MGXA 3MTRA 1N0XL 3O4LD 7CGTA 2HJLB 1UCTA 1BD2A 2PW2B 4FQ1L 4CJ0A 3PGCB 4K55A 4YH6A 2OR9L 3MLZL 4D9LH 3F5WB 1X5IA 3WUZA 2XTJE 2XZQH 2VXQL 4J3VA 4JO2L 4C58B 4LLMB 1X5LA 3DRQB 4DZ8B 2BVYA 4IM8A 5J6GA 1BWMA 3L6FA 5GRYA 4Y2DD 1IT9L 1QQDB 3SCMD 5E99H 1FZOA 4PLJD 4IRZH 2IPTL 3C5JA 3M17B 4I18C 5MERB 2IPUK 5HHMA 3B9KC 2LU4A 3DROB 3LSOA 1HQRA 1LK3H 3IRZA 1WIOA 5K9OA 3OKKB 2BHUA 1D5MA 3CLEL 4M6ML 1HINH 5GS1A 2DLIA 1FNGA 1V3JA 1AHWA 1RUQL 5MEOA 2DQUL 4K3JH 2EDTA 3LEVL 4LLWA 3KPPA 2IGFL 3CK0L 1Q8MA 1RK0B 4G6AC 3OKNA 3OMZA 5E08L 3H7BB 4ZOAA 1DBKL 3NGBB 4HG4J 4QNPE 1DN0A 5I8CA 2F54B 5GHWL 3RU8L 1CZ8H 4G3YL 2VDQL 3HC0A 4RAVA 3G6DL 2IPKB 4Q9CA 1GGCH 4QRPB 3OAYH 3VW3H 3ARGD 4NQEA 5HD8D 4PREA 2P5WE 3C60D 2UWEF 3DX6A 4J3OC 4YLQT 1ZLUK 5IJVA 4EN3C 1H3PL 4LNVA 3WNPA 3MR9B 2OSLB 3X17A 4RWYL 4GJTB 3T0EB 2GCYA 1JIBA 3C6SB 4KMQA 4UQ3A 5DHYB 3LKPB 1VSCA 3ROLB 2V2XB 1NFDF 4EBQH 1NCWL 4LHUB 3W39B 3ARGC 4HIXH 1A6UH 2J6EH 1IGFL 4OQ1A 3LCYA 3FT2A 5GS0C 5TDPA 3E6FB 2W07A 1UB6B 5E9DA 2AV1B 1B0WA 1JRHH 5ID0B 3S34L 3HE6A 1AKJD 2AI0L 2X4TA 2P7TB 4G6JL 1L6XA 1RI8A 3QUMH 1E27B 5J06A 4ELKA 3FFCA 4X8JA 2PTTA 5T1KB 1YPZF 1YMMB 3OTTA 4Y5YB 3QQ4B 3CFIC 4XWOC 5HY9A 4OV5A 4X5LA 1JTTA 4PJDA 1BVKB 3PV6B 4KDTA 5GSRB 1YC7A 4NZTL 4XX1E 4PD4K 3TYGH 1R3LA 1MCIA 4ZAKA 3AM8C 2WWKO 2H9GB 1H0DA 1ETZB 3PWJB 4UMGA 2W9DL 3RWHA 3QXUA 5C0DA 2XZCL 3QG6B 4WWKC 4YXKH 4M43L 1GGCL 3FHQA 3N1FC 1FNEA 6FABL 3PGCA 5D5ME 4WI4A 4YHPB 3BPLC 4EDWL 5IHZB 4G42B 1IQWH 4M7ZB 2QR0B 1A6VH 1P7KA 4OLYH 4PLKD 4M93B 1NUNB 3LQAL 4ZO6A 1HWGB 1N4XL 1ZWIB 5DF0A 2Q76A 1OD9A 3QXVA 5GGTL 3ZKMC 2O93L 1OTSD 4L1HA 3CZFB 5C0EA 5DJDA 12E8L 5IJVB 1FVDB 3RVXD 4G43B 2X4PA 1S78C 4GMSL 2I5YL 1H15B 4WEBH 5TE6H 4MXQC 3WHXB 4P4RA 2Z0BA 2EYSA 4UIMB 5FGBA 4M62H 3FOMB 3QIBC 4X6FB 4R4BA 1AP2A 1LEGB 1HQRB 3P4LA 2O5YL 2D4FA 5E8EA 1QYGH 5FKAB 4D3CL 2NY5C 5MENB 1N7ML 6FABH 3MLXL 4KTDL 3GSQB 2CJUL 1H8SA 4F9PA 3GGWB 1Q9KA 3ZTJH 4MS8C 4RMTA 4YHNA 3K2UL 1U8PB 2APFA 5JDJA 3G5VA 4WFFD 1H8NA 2QKIA 4BFIA 2I27N 3OAZH 3RVTD 4KJYA 1UACH 2CDFB 1HOCA 3WXWL 3RVWC 4JO1H 2PTTB 1PG7L 5T1KA 2F53B 4G5ZH 3ZDZE 4NHCL 3MLZH 3WKMH 1VFBA 4KKBC 2CMRH 2GFBA 3B5GA 1MREL 4HMEA 3B9AA 3HC4L 1GIGL 3DX6B 5EUOE 4HX1B 1D9KA 3DYOA 5J1AB 3O4OC 4YBLC 5I8EB 1KCKA 4XBGB 4LCYB 1GGIL 2GCYB 4UT6H 5I1EH 5TFSL 3EZJB 1ZMYA 2EDLA 4HLJA 1X6NA 5T33H 4FQ2H 4LHUA 3W39A 5EO0A 1C8PA 3B8YA 3FT2B 2P47B 1LE9A 1FH5H 4QY8B 5SWZD 3E6FA 3C6LC 1JNLL 3DVGB 2YD3A 2AK4B 3K8KA 5E9DB 4Q9QH 4JPKL 5JIPA 5ID0A 3L9RB 3CXDH 3G6JA 1ND0A 1YJDL 4XCCH 4PJEB 4M1CD 2PKDA 3JZ7A 3FKUS 4F15C 4TPRH 1UT9A 3VD4A 4ZXBA 2F19L 4JLRB 4P2RE 3K3QA 4ERSL 1J7VR 4CBPA 1G6RA 1FG9C 3LQMA 5E2VL 1UJTA 3KXFD 4MDIA 5GGSB 4JRXA 4V1DE 5DD6B 4PRID 4ZAKB 4NGHH 1S7QA 4R4BB 3GSWB 3IDMA 2CLRA 5I30L 4DUWA 5KVFH 4L29B 4X4ZA 1K4CB 4EUPB 3OG4B 4JM2A 3CSGA 5MENA 5E6IB 2EEDA 3QFJD 3MA7A 1NC2D 1Q9KB 5ACLA 1KCUL 1YDPB 1FDLL 3SDAD 5K59F 1JZ3A 3QUXB 2VXUL 4C56A 1S5HA 2DYPA 5HHXL 2EH7H 3KR3L 2WUBH 2G75A 3KWWB 3ILPA 5E24E 5A16B 3ISWA 4JJHA 2F53A 1IEHA 1QO3A 4JPWH 3AY4A 5CJ8A 2D9CA 4MXVE 3TJHD 4V1DB 5LCVH 4OKDA 3HI6H 2CDGA 3CXHK 1FQ9C 1TJHH 4P46A 4KRLB 2APTA 2XXMB 1XF5B 2V17L 2Y5TA 3R0NA 5E2TH 1M1SA 1D3CA 5T3XE 1CGVA 4NKOB 1W0YT 1BZQK 3BMVA 2PO6A 2YKLH 4G43A 3P77B 4XVTL 3CCHA 2OR8A 3H9SB 1FVCA 2WBJB 4PJ8D 2ZCKL 4H8WC 5ACMA 5MHSD 3GRWH 3KPSB 1OAXL 2VXQH 2HVJB 3FT3B 3QCVH 1FPTH 4R9HA 1FV1A 4HWUA 1DANU 5FYLD 5SX4H 2NXZB 3WN5A 4MWFA 3SDXF 1WBXB 4PP8C 4GFTB 3L9RA 1FYHB 1GZPA 4NHUE 3SKJH 5CMAA 3LPGA 2AXHA 1V8HA 3HZKA 1K4DA 2F54D 4GXUM 3KXFB 4JFDE 5D96C 1F58L 3ULVE 1I1YA 1II4E 4GAJL 2VUOA 1TJHL 3D0LA 4U1HA 5EWIL 4JR9L 3SJVA 1JNHB 2WUBL 3PHOA 1A3RL 3TN0D 4N0FB 5EU5B 3KPNA 3QI9D 4HX1A 1V7ML 2W1NA 4HDIB 3OB0H 3KJ4B 5TDNB 1HXYB 4UNVA 4DN3L 5J9PA 5JORB 1U2HA 2VIRB 2W0PA 2B1HL 4ZOCA 5EU4A 1T89C 1LWRA 4XPAH 4TSAL 1DVFA 3UZQA 1D5XA 4XVJH 2YD9A 2D9QB 4MXQD 3VXUE 1J0JA 2ZCKH 2FIRT 1FO0H 4HW6A 4LLDB 3O0RH 1Z9LA 1AGEA 3PQYE 1RZJL 1PKQA 2JTDA 2CK0H 1T7YA 2H3NA 5D1ZA 4TNWF 1AHWB 2L0DA 1LNUB 1X3DA 2YHGA 1LMKA 3RWGB 3WL9A 3ZSSA 2ADIB 2BDNL 4PJ5E 1NC4A 3L1OH 1AKJA 1I8KB 4JLRA 4LLWB 4Q0XH 4TVPD 3KPPB 1TETL 3MBEC 3MJ8A 4XMLH 4BH8A 3QFJE 3QNYB 3RFZC 3D5OF 4YHYC 1DE4A 1SJVA 5DZLA 3VGEA 3LPWA 5ENWB 2A6JB 1P4BH 1GOGA 5KS9F 3PWVA 1NEZA 1FV1B 4I3SH 4NQCB 1L7IL 5KVEL 1K4CA 1KIRB 3UYRL 1LEIA 4K94C 5DT1L 1HHGB 1JF5A 4DUXA 5CIPB 1GIGH 5T3XD 1R5IB 3UJIL 2AQ2A 1RZ7H 3DX7B 4JZOB 4EI5B 3QUZA 3GJFK 2OX5A 1JL8A 5EU6D 4R2GC 5DTFA 5FA4B 5B21A 1XIWD 2FJGA 1CVRA 3WKML 3HZMB 3ZDXE 2GT9B 1U58B 5FK9A 2CDGB 1EX0A 1T6VN 3NH7L 5EB9A 43CAB 5F70A 4J8RB 3D6GA 1QRKA 1XF5A 2H41A 4EXKA 1OLLA 1MHCB 3ES6A 4P3CH 3VXME 3W9DB 1P4IH 5EU5A 2BY0A 1DTUA 5F1KC 4A6YA 1OSPH 1WITA 3FB6A 5TPWH 2V5TA 3WFEL 4MJIA 1NGPH 1S9WA 5B3JE 5FUZH 1JHKH 4TULL 3CJJA 4JHZA 2OL3H 4YDKL 4M5YH 5DJ6B 4F7TB 2HVJA 3FT3A 3ULVD 4OLZH 4PP1D 1KGCE 4NQDB 5GS0L 3CXHJ 4BSWA 2DF3A 1D5XB 4JFFA 5TE6L 5EUOA 2H9GA 1WBXA 2J8UE 5DURB 2XIDA 2RBLA 4RGNC 3TO4C 4MA3A 1M7DB 4QHUB 3MBXL 3RWGA 3G9VA 2R15A 3WIFB 3PGDA 1I1YB 1YEIL 5HVGB 3HAEA 4GLRH 4XCFH 1UA6H 3C08H 1DL7H 3HMXL 1DE4B 2EDEA 4NHCH 5FUCC 4ODSH 4DVBA 3S36L 2F53D 2XFXA 3SJVB 3BN9C 4LPYA 1JNHA 2NZ9D 2ZUYA 2MHAA 3MRJA 1ACYL 2N4IA 3TBSA 4R4FL 3Q6GH 5EZLA 1UJ3B 2MMXA 1JYXA 5B8CC 1A7NH 5C0EB 2FECI 4OF6A 3TH2T 4Y1AD 4F9LA 4DZBA 4HKJB 5DS8A 1IILE 3O2DL 2RFXA 3MOAH 2BNQA 4M7KH 4OGYH 3HI1B 2W92A 3WHXA 2BRRL 5I1DA 1DVFB 4NZUL 4W4NA 5BV7C 4PRDB 4WV1B 2YPVL 5F7NC 4C83B 4HC1L 2I5YH 3ARVA 4DEPC 4L8CA 3KPLB 4C57C 4PRBA 2VQ1B 4IS6B 2Q8AH 43CAA 1DZBA 2ZP0T 1QR4A 3CH1A 2G2RA 3S96A 3BVNA 3K1KC 3IS1X 5L0QB 4LCCC 1MHCA 1G9MH 4I1NB 4XPTL 3GBML 5MEPB 1Y0LB 4GXUN 5DVMA 3BHBA 1NC4B 3G5VB 1XGRB 4M6OH 4IIQA 3STZA 3QWOA 4WWID 2H1PL 1MVFA 1S9WB 3IFLH 1QSVA 1PSKL 4OIIH 5DJ6A 2WQRA 5JW4Q 2X2YA 3FZUD 1AD0A 1CICD 4JFFB 4RNRA 1YC8A 1PKQE 4H1LG 4X98A 1KTDB 3TPUE 4DCQA 4EQ2A 2MQCA 3MACH 2XQBH 4HS3A 2FX7L 4EOWL 3CC5A 1GOHA 3DVFA 3BDYH 5C0BD 1NGXB 2ZOKA 4LCWD 4NZTH 2E7CA 1J0YA 1T3FB 3ZMRA 5EO0B 4Z7UE 5I1GL 5D70H 2ITDB 4DVBB 5BZWB 1CBVH 1K8IA 3RDTC 1X5YA 3ES6B 5LG1A 3G6JB 3SGEH 1UGNA 4K9EH 4IMKA 2KPNA 3VG9C 4CW1A 4L4VE 4M7LH 4P23C 3U0PA 2PETA 2E27H 2P8LB 2ED8A 1IQDA 2WBWB 1E4KC 2G5BB 5AWNL 3MRHB 3QPXH 4NQDA 4MX7A 1U6AL 1BFOA 4CL7A 1Q9WA 2OCFD 4KUCF 5E5MB 2VZVA 4HC1A 5I15H 3I2CH 5ITBH 1JGUL 4PGZA 2APXA 4CKVX 1JNJA 1J9CT 3QDJD 1FFRA 3BPOC 3WDHA 4ZPTA 4PS4H 3C60C 4ODUA 1P9MA 2R23A 2VN4A 3FQWA 5ISZE 4G3YH 4W6XB 1Q9OB 5GHWH 3RU8H 3DLQR 3C2SA 1W8OA 4NM8L 1GZQA 1IGMH 1F5WA 1HHJB 4NHUA 1BIIB 3RVUC 3V6ZB 2CQVA 3TBSB 3F6LA 4RNRB 1GPOL 1IAOA 4LVHB 5DUPH 5DYOA 1KTDA 3VWJC 4MZ2A 1LQSR 3AAZA 4DW2L 1T66C 1BFSA 5D9SA 5IEKA 4OI7A 2YD2A 1DN2A 4LP5A 4BZ1H 4ZYKB 3TIDB 1MH5A 3ELAT 3VFTB 1I3VA 2OZ4H 4FA8A 4QRTA 1NGWB 4LLUA 5CFHA 4L8CB 3T8XB 4YDIL 4M7KL 4JFYB 2RIKA 4NRZA 2HRPH 4OZGB 4F7EB 1K8IB 3QHFL 3OKMB 3V0VA 1XZ0A 5M94B 2NYYD 4WUKL 3TFKC 2A1WL 4AQ1B 2D7QA 1H5BC 2W9LA 1HYSD 1X44A 4S11A 4UAOB 3NACH 3FL7A 4GKZB 4CW1B 1FC1A 1OT1A 3IU3B 1P7QB 4NQCD 2Q8BL 4AQOA 4U1HB 3TH4T 4JY5H 2OL3A 3S37H 3IJHB 5CINH 1JN6B 2WANA 3MZGB 3P11L 3BWUC 3OB8A 1U92A 2Z93B 5SWSA 4DGIL 1YEJL 1AD9A 1AD0B 5E5UB 1B88A 3H9HA 2FIKA 1BEYL 2JIXA 4K3EH 4K9EC 5H2BA 5EC2B 4C56D 4N5ED 1KJ3L 1TZIB 4DCQB 1A1MB 1CICB 2FBJH 1XT5A 4EN3D 1FN4A 5ITFA 2KDGA 3T77A 1HWHB 3QUYC 4ZNEE 3O3EB 4EXPX 5T3ZE 4G8IA 4UT7H 1CXKA 2ZOKB 2V2TB 2ZCLH 1I3GH 1IL1B 3QAZB 5ID1B 1BAFH 1RAMA 1UH2A 4WU7B 3SE9L 1AGBB 1QLFA 1U8LA 3GBNH 5HYFA 1RJCA 4NQVB 1GZQB 2WQ8A 1IAIH 3JTCA 3VGAB 4HUMB 5E2UH 3LDBC 1KC5L 5FIEA 3O45B 1AR2A 1IAOB 5IB1A 3LKRA 3FQTA 1LNUA 3AAZB 3GI9H 2H32A 3LAFA 4PBWD 3U7WL 4P3CL 3U0PB 1NCUA 1IGIL 1B4JH 1IQDB 3ZLQC 1WVZA 3HPJA 3TIDA 1DL7L 4LAQH 3VFTA 1MIEL 4LKCA 5I19L 4OLXL 2P42B 1IC4H 3HRPA 4PRHE 1MRDL 4YHML 3MREA 3D9AL 5CGTA 3NTCL 5HYSG 4OZGA 4KZDL 4JO4L 5T1KD 1A47A 5F7UA 1CE6B 1KIRA 1XZ0B 2AV7B 4K7PL 4LSQH 3WDJA 1HH6A 3EYVA 3CFBA 1Z3GH 4ODUB 3BEVB 5IW6B 4MAYC 1JZ4A 5AZEL 5GS0H 4MQSB 1P7QA 1NGQH 5DTFB 5FA4A 4FTVA 4NC2B 4AG4L 4WUUB 1NGPL 2L4OA 4PJGA 4HKXB 4YFLF 1B0RB 2VUYA 1J1XL 2EXYC 1C12A 4TUKH 4P9ML 4KUZH 4NKDA 1B6DA 2CIKA 2HVKB 3I84A 5LGKA 4YBHA 4PLKC 1JTPA 4TUJA 1OQXA 2PNDA 3N50A 3QFDB 5HHMB 5MERA 1JPTH 3S7GA 3LB6C 4O9HH 3ORJA 1MNUH 1B2WL 4Z18A 5C3LD 4L3AA 4RA0C 4Y7MA 5J1TC 2WZPD 1GCFA 3EO9H 2WIMA 5DJXB 4QHKI 3KPRB 3SGJA 4F58L 3RUGF 3TZVC 1QFUL 4KVNL 3U7WH 2K7PA 4NQCE 2DL9A 2ICWB 4AH2A 4YPGB 1EEZA 3VMPA 5ADPL 3UYOD 2H8PB 3TCLB 1J1PH 3HMWH 3N9GL 1JHTA 3OKNB 2Y9RT 1QVOA 1JK8B 1P2CA 3V8CA 2VXTH 4IJ3C 4WCYH 2H32B 1MFAH 3LEXA 1ZHKB 3FQNA 1X4ZA 3O6KH 3SKOB 3PXJA 4Z7WA 4P9HH 2MNUA 1PZUB 4NCC1 4GRLD 4F33A 1EHAA 1DQQA 2O5ZH 3MRDA 1ZVYA 3QYCA 1YNKL 2FIKB 4S1DC 3W2DL 15C8H 1CT8A 5E94A 5A40E 3AS3A 4RQQB 5EZLB 5KSVA 3LKPA 1A1MA 1CICA 1R3JA 1WIPA 1I4FB 1YEJH 5F6IC 1ODAA 3SKJL 1E4XL 5HJ3A 2C1PA 4LLYA 1FN4B 2ICWI 5ITFB 3VFGL 3W5NA 4QHMA 4X9HA 4X6BB 3TA3C 2PW1B 2KH2B 2WBKA 2HFGH 4OM0H 2V6HA 1G6RL 5EU7E 4WU7A 4PJ8C 1NEZG 5DC9B 1WTLA 4Y5VA 3F58L 3GFUA 2MKLC 2P7TA 4O9HL 4Y16D 1C1EL 1UH4A 2J8UB 5GRVK 3O45A 1MWAH 4D9RD 2VLMD 2E7LC 1T0MB 4PJHE 5FA3A 1LO2L 3CU1A 4UT9H 5SWQB 3T65A 3NZ8A 3VFNA 3BP4B 1HCFX 1XGPA 5E6ZA 3VH8B 1KXTB 1OTUC 3EGSB 4WJ5B 4YDLC 3MRPB 4PJBF 3UTTE 1FNSL 4JVPA 4KJQD 4LSVL 4HUWA 3ZYJA 3MV8D 3DXAE 4ZPVB 4PLJC 5E8OA 5IVXF 3WNNA 3H3PH 3I50L 2ZPKL 4LSUL 3IB4A 2ZUQB 4XP5H 1T2JA 4NO2B 3BSZH 1RUML 1X5KA 2AV7A 1HHKB 4PRPD 3BGFB 5FYJU 4I5BB 4NPYB 3CFJA 2F9BT 4O2CA 4RCAA 4FFZH 4JN2A 5SWZE 1MQKL 3LEXB 2D0HA 5IVZB 1KXVC 5BXFB 3ULUF 4FTVB 5IK3B 4I77L 3WYRA 3CZFA 4PJGB 4I0PD 1N0LA 4NQSA 5A2JH 4NOBA 5HTSA 5GRJL 4ELME 3QEUA 5JOFB 1KLGB 4UB0H 1U8IB 3N1MC 3VRJA 5LXGL 1HSBB 2UYLA 2X4PB 5DDHB 5HPOA 3BI9X 1ZS8A 4C4KT 4UDTA 3BPLB 2XZZA 1UVQB 4Y8DC 4KQ3H 1KC5H 5ESVB 5HJ3B 2BRQA 1JGLH 3GMMA 4YHZH 4X6FA 5SWZB 3VRLF 2YC1A 3FN9A 3QHZL 5C6PB 2VL4A 1IFHL 3DOSA 4HS8H 2V5RA 4FZEH 1G7QB 4OGZA 4NJ9H 2B1AL 3BP5B 3UBXG 5J13C 4JREC 1FGVH 3LRSB 4OCMC 4KK8D 1NDGB 2AEPH 4P5TC 5INCB 3JWNC 5IP4A 4ELMB 1U8PA 1KCUH 3JTTA 2H8PA 3QRFM 1T7WA 1YMMD 2CDFA 4WVRA 1ZLWH 3AREA 3DPBA 3WLWC 2HLFD 1TJGL 1ZHNB 4JO3H 2IC2A 5MP6L 3AUVA 4HZLB 2X44D 2VLJB 3PWNB 4MQXD 4F33B 1AO7E 3FO0H 3NA9L 5CLWA 5EFIA 4XXCC 4JFXB 3SQOH 3QEGH 2DL2A 1JWSB 1NC2B 2IQ9H 4AEFA 4K71B 4JRYA 3H42L 1JPST 3QRGL 4XBGA 3G6JE 1RZ8A 1HI6B 1U8QB 1IKFL 4P2RA 5CJXC 4ZPVA 3VXRD 5E8OB 3WJLA 1JPGB 5C0BB 1R3JB 3BQUC 2JJTC 5DURD 3UZVB 2PW2A 1I1FA 3RRQA 4NDMB 1YEGL 1EA9C 1NBYB 4I2XE 1ZK9A 3CUPB 3OPZH 1MCPH 4X6BA 4MAUH 1DSFL 3RWJA 1MH5B 5SWSE 1JWUB 1BJ1J 2MQ0A 4AIZA 1TQBC 1NGWA 1Y6KR 4LLMA 1G7LB 2C1OA 1P4LA 4GG6A 3KPOB 5J6GB 4K8RH 4DAGL 3L6FB 3WD5H 3CMGA 1E28A 4M5ZH 4ZXBB 1Z2KA 4P59H 1C5DA 1U8IA 3UTTD 5I17A 4UU9A 3QZWG 4P2QA 4DK6A 3S3SA 5DEFA 4OJFH 3MJ9H 1Q0YL 4CADB 3R06B 4OZFH 3NFSH 5ISZB 2VN7A 2AJXL 4KVCL 1JYVA 1J88A 2YRLA 1PG7X 4PRPE 3DROA 3ZKNC 3ZYIA 1FJ1A 4M48H 1NDMA 3WFCH 2Q86A 1XGUA 3UPRB 4OGAC 1E6JL 4PUBH 2HP4A 3OKKA 3MO1B 3MLRH 1SQ2N 4OBRA 4LIQE 1NDGA 3V4UH 1A7NL 3RTQB 3MA7B 3H9HB 5C3TA 5MEOB 5C7XL 1KYOJ 3DVNA 5DFTA 2NY2D 3GNML 4N1HB 3GSOB 3QUKB 5L88H 3KWWA 4IHOA 1HHKA 3ILPB 3GI8L 1TENA 3NA4A 3ULUL 4UDUB 2JK5B 5DUBB 4DN4H 4QNPF 4LK4A 4IOSD 1J05B 2DMKA 5C08E 3OG6B 2NY0B 3ZTJG 1LEKB 4LU5L 4KY1H 2BSSA 4PJIF 4CMHC 4YBQC 1I1AD 2EC9U 2VAAA 1E6OL 4OJFL 1LQVA 4JFXA 3OX8B 2UZIH 2XWTB 1FGNL 2FO1A 1HSBA 2ZUSA 5DDHA 4IDLA 4OKVB 4H26A 5T1MB 3G9AB 4QYOB 3LKRB 4OCRL 1UVQA 4KY1L 3JXAA 2IBGA 5E2WL 4X6EA 3GMMB 1T83A 2GEEA 2FHCA 2P24A 3GKWL 2CO6B 5D1XC 4PGBB 2DLGA 1UKQA 1NCWH 1QHOA 5I2IB 3U4EB 1KSRA 4H8WL 4AIZB 1AC0A 3T04D 3PWUB 3W0WD 3QDGD 4JG0L 5BVPL 1OSZB 1R5VA 1P1ZB 4NUJA 4PB9H 1XGTA 1CE6A 4XNMB 1A6AA 3OAYK 1OQOA 1PW3A 5HYIA 2GAZB 4Y4KA 3KJ6H 4PRAA 3CFBB 2XRAH 4QGTA 4PV8A 1UM5H 2A6DA 4OZHB 1MHPH 2V5SA 5GGVH 3VXMD 1FJ1B 4OIIL 4GW5B 3PWJA 1NC2A 5FECA 4O02H 1DLHA 4L8SA 5SWSD 4Z0XB 4KKLD 5C0ND 1KTKE 1HI6A 1U8QA 5T5FH 1B0RA 2AAVA 2DKMA 2FO4A 4XPTH 2KQNA 1FZJA 4WHCA 5K93A 3HNSL 1KGCD 4TSCL 3BKMH 4HS8L 2VABA 1GYAA 3WO3B 1U8KA 1MF2L 1K2DB 1LK3L 1MFEH 3U6RA 3D1MC 1JWUA 4ACPA 5IHLB 3QUZD 1LEKA 3SDYH 5LWYH 3MCG1 2HTLD 1P69B 5IB4A 1TIUA 2BRRH 3KPRA 4HUNB 1O0VA 1NMCB 2H3NB 5TQ0L 3KPOA 1S8DB 2FLRT 5DD5H 2ICWA 4HUVB 3OX8A 5F7LB 3X12A 2AKRB 1AKJB 1I8KA 4I13B 3MRGB 1SBSH 3SQOL 2XWTA 1ZT1A 2MSPA 1F3DH 4J4PC 3QNYA 4WO4B 2YN3A 3VW3L 4YK4B 5GJSH 5FF6A 4CVXB 3FOMA 5FKPA 4HQQH 4UBDC 2FEEI 4GH7B 3SKOA 3TT3H 2Q86B 4ODSL 4QLRA 1OW0A 3NAAL 5E8EB 3MO1A 1KBGL 3QJHA 2PCPB 4Y1AE 3PWUA 1R5IA 4GAYB 5J6HB 2EIZA 3SDDD 7FABH 2JIXD 1FNSH 5JHDA 1EZVX 4E41B 4W6WB 3MV7E 1CS6A 1A6AB 4XBPA 3JVGC 5HHME 1MFDL 4IRJC 3WO4C 1VFBB 3T2OA 1INEH 2X4RA 5DK2A 4Y19B 2OL3L 3W9DA 4V3DB 3PWPE 1QEWB 1XIWC 2NLJB 5DQ9A 1XF2A 5I8EA 4HFWB 1G0XA 2VRAA 1YYMH 2QADB 3A0OA 3GO1H 4OKVA 3ZTNL 4UZGA 1S7TB 5FA3B 5HHOA 5IBUG 4LSDA 5FO7A 4TN9A 4XWGL 5CCKH 3B3IB 3LQZB 2IBZY 2X9WA 3ARDB 1OVZA 1RIVL 4XNUH 2VABB 4I0KA 3RA7H 2VOTA 3P4NA 1KTRL 3T3PF 4APQC 3UO1H 4OCLC 1G7IB 1UM6H 5I2IA 5DEGB 5GZOC 2DMBA 2YK1H 5ANMA 5EZIL 4FQXD 4K7FA 5JNYB 3WIHH 5DD0L 1PX3A 4DKEL 4N0RA 3ULVL 5D7LE 4J6RL 4U7KA 1QRNE 1YNKH 2WK2A 4LCWE 1QHPA 3IFNL 1NANH 2FSEB 5F9OH 3OHXA 4PJCE 1U95B 3L5HA 1TQCC 3TO4D 1QPPA 4O2CB 4P9HL 1GGYA 4TQEL 4HFUL 5GGSA 4CVXA 4NN5B 4Z7VE 4OZHA 4JY4B 2EE3A 4K23H 5JQ6H 3GSWA 3IDMB 5KSAB 4GS7C 5T1LD 4LSTH 4JM2B 4NQSB 4L9LA 3N9GH 3QJHB 3NIFF 3U48A 1C1EH 2J5LB 1KLGA 4Q0XL 1I1AC 4LARH 1QRNB 2OK0H 4J6RH 4OZFG 4YQXL 3PJSB 4UDTB 5C86A 4XC3H 4P2RD 3FJTA 4Z7OF 4XBPB 2HLAA 2V5YA 3GIVA 3ZDXF 5FHBL 3U6RB 3OAUL 5I1KH 4MA7H 4U6VH 4HFUH 1MCSA 1OLZA 4Z7NF 3FFCD 2X4RB 1KPUB 1R3KB 4E42B 2AV1A 5GJTL 3BZFA 3IVKA 2QSVA 4AEHH 1PBYA 5INCA 4DK3A 5GRWA 2IJ0C 3W2DH 1MCRA 3WHE1 5ADOL 2FHBA 1KNOB 4M9OA 1E27A 5CHNB 1NFDE 1U8NB 4JVWA 5DFWH 3D25A 1RU9L 4OV5B 3IXTA 1CFQB 4OBSA 3UO1L 2WAHA 2VDRL 1OAYL 1E4WH 2VDPH 3ARDA 3LKQB 4HLZH 3ZDYE 4CVZB 3P4NB 1M05A 1XMWA 5D2LF 1G7IA 2Z35B 5BZDA 5F72S 5TF0A 3CX5K 5F3HA 4GRMB 5HVHB 3FO9A 3RWHB 1GGUA 1JWSA 3RKDD 1JI2A 4K7FB 1TTFA 5JNYA 5CUSL 1YECL 5IBLC 1BQHA 1MFBH 2NY6C 3CC5B 2EIZB 5DLMH 3OSKA 4P2RB 1OGTB 2NY4B 1KN4L 3PWPD 4OLWH 3LS4L 4AENA 1QFWH 1KB5H 2XQYG 2CMRL 3KLAB 3THML 1WT5A 3MROA 4XHQA 4JN1L 5BS0B 3IDXH 3IS0X 3FB5B 1IKNC 4A2LA 2R1XA 4YX2H 2DQJL 5HI5D 3RWJB 3TIEB 1VPOH 2AXGA 3LMJL 5F7DA 1PAMA 3F7RA 4TTDD 5DQ9B 5AZ2L 4L9LB 4QCIB 4XCEB 1DJSA 3GK8H 2CLZA 1MCJA 3RDTD 5JW3H 1MCQA 1CDGA 1YEHH 1KB9K 3BAEH 3N1GC 5ESAB 3TEUA 3WUWB 5EU4B 4YXLL 1UENA 1BVKA 5AZEH 3BISA 1R3LB 2XKSA 5D7SH 3S5LG 2EYRA 4GMSH 2CPCA 4U3HA 1H0DB 1F11A 4LLDA 5TE4H 3QQ3B 2UVEA 3LKNB 4LMQI 3NCEB 5ANMB 4JDZB 1R3KA 2CUHA 4PRIA 5FOBB 1KELL 3NTCH 3QG6A 1QLRA 2HFTA 4JKLA 1MLBA 2IH3B 2PYEE 5HHVL 4F9PC 4ZUWA 4OD3L 3HS0B 1OGAD 1RJYB 4JHBA 2VLLB 5FCUL 4UDUA 5DUBA 1ES0A 3S3PA 5IHZA 5KVFL 2OTUA 4JRWA 2NNAB 1P53A 1UCBH 3EJZD 3S35H 3LKQA 4PJXB 3UCRA 4NQCA 2FATH 5JIIA 3NACL 2DQCH 3KJ6L 3PQYA 3Q6FA 5IQ7H 5DYOB 4QRRD 1LEIB 5HGBA 4X7TB 4OSUH 4GQPH 1MHEA 3FFCE 5D8JL 5AD0A 4XBEL 4XNYL 4M7JL 3C60B 1CGXA 4WY7H 4R6UA 1OGTA 1YNTA 3UPCA 5BVPH 3BD4A 3V52H 4TVPE 1UXSB 1XF4A 4QRTB 3CXDL 1ZLSL 3UJTH 3T0EC 5J3HD 4NN7B 4PRHD 3PL6C 5HDQH 4FQHA 2AABH 1DBML 2OXHA 1U58A 3O3DA 1AP2B 1LEGA 3A6OA 5CZXD 4J2XA 1MF2H 3EOTH 4F7CA 1F6LL 4KK5C 4E42A 4FQIL 1G84A 1KJ3H 1IGCL 2QBWA 2X7LB 3BZFB 2BNRE 5BO1L 1FCGA 1GXEA 3K80A 1BEYH 1D7FA 5TDOA 2WNGA 1SBBA 2OZ4A 3DYMA 1UYWL 5GRUL 3RIFK 3TF7C 3IU3A 2DWEB 3IJSA 2JCCF 4OGXH 2CLZB 1ZSDA 4HGWA 4JM4L 2OL3B 4Y4FC 3EOAB 3MYZA 4DTGH 3QDGA 3C2AL 3O6FC 3HCVB 1JF6A 1TTUA 2XRAL 2A6DB 3N0PB 4WW2B 1DEEA 1QZ1A 1GOFA 5F3HB 3NFNB 4L29A 3SJVD 2EE2A 2R4SH 1A4JA 2ZUTA 4OLVH 2ADGB 4PJFA 1DANT 4FS0A 3QQ9D 4ZS6D 2BERA 1MUJB 4BSVB 3EO1B 3IFOB 4DQOH 1AY1H 1RV6X 2V2TA 1S5HB 1DP0A 3D39B 3HAEB 3IDUA 4TTDC 3QPXL 3WS6C 1U8HB 4HBCH 5GRVL 5BS0A 1UWGH 25C8L 4MHHG 2AEQL 5A16A 1RJYA 2NCMA 5C1MB 1U8KB 1U8LB 5D72H 1EZVY 2R1XB 1LO3H 5GS3A 3DVGA 1SM3L 3S5LA 5DK0B 4TOYH 3BPNC 4L4TB 3KYMA 2YOCA 1GGBL 1JGEA 1V7NH 3WE6B 2NY5L 2PO6B 4XCEA 1MFCH 3UTPE 4ZQKA 5DS8B 5CEYB 1FVCB 2FEDD 5E4EB 3MLRL 1E6JH 4LKCB 3B2UC 2B8OT 3K4AA 3LQAC 3KPSA 4GW1A 3B5HA 2G9HB 5ICYB 3SQBA 4HK3N 2CLRB 5CGYC 4WU5A 3CDGB 3GKZA 4K94L 4EUPA 2O5XH 1R3HA 5FV1L 3K46A 1Y0LA 5J12C 2YUWA 3BEVA 5IW6A 5J6HA 1P7QD 4BKLA 3QRGH 4YC2B 2BHYA 2DYPD 1QO3B 4JFED 2ITCB 4NKQB 5I1JL 2B4CL 5TH2B 3EOAA 4TUOB 3SDXE 1CFVL 1R24A 1SYVB 1YN7B 1VEOA 4JM2D 5CILL 3P9LA 3RBSA 1UYWH 1XH3A 2V7HA 4D9RE 3MODL 4WW2A 1PEZA 1H3UA 3SGEI 1QSFD 2NLJA 3CCHB 4N0UE 3MGTA 1CDCA 3ZKXB 2BNRD 4MAYB 4UQ2B 4WHDA 3E2HA 1MUJA 4QF1B 1KB5A 1AXTH 1CXLA 5CZVH 4HWNA 3MGOB 1EERB 3LQZA 1EXUB 5JUEH 4PGJA 1DSFH 3W11C 5LGJB 3O4LE 4AH2B 4HF5H 2VR5A 1F6AA 2BCKA 5F1NA 1ZVSA 2BVQA 4WI8A 1I7TB 3A6CH 4H88H 2CH8A 3DMMC 5CMAB 1K6QH 3DV6A 3HA0A 2QL1A 5IFJA 1CTNA 3WE6A 3E3QA 3IAGC 4YDJA 2DTMH 3CFCL 2DWEA 1EPFA 2XTJD 3RL2A 3N06B 3CLFL 3IJYB 2G5BA 3VGGA 3BUYB 4ODHL 2A6JA 1S9XA 4QO1A 4NO0D 4P5TA 3HNTL 3L7EB 2ZG3A 1YEIH 2GSGA 4KXZH 4MX7B 1XCTA 4W4OC 1YEDA 3VD3A 3PWVB 1NEZB 3BT2L 3BZDA 5KSAA 4N0FA 1A64A 3KPNB 1OB1A 4WU5B 2APVA 2JLLA 2AXJA 5FAAA 3AREC 2EDHA 4MCYA 5E08H 4KKBD 3EOTL 3U4BL 1A14H 2ADGA 1ZT7A 4PJFB 5J9PB 1Z5LB 2KBGA 2BSRB 1KOAA 3AFLA 3K4ZA 3F12B 4AT6A 4BKLB 4N8VB 3NZHH 3QUXC 4PG9A 2C4FT 4HWEL 2EDQA 2HLAB 2I07B 1DQJB 1JUFB 1MSPA 1MLCA 2BVUA 2FJGB 4JY6A 4Y2DC 3SCMC 2NW2B 2XWJA 5DK0A 1R24B 1SYVA 4RFEA 4JG1L 1OSPL 1P5VA 1PKQB 4U1LA 2F8VA 3BP6B 2A6KA 5D1ZB 3DXAA 4PJHF 4NYLB 5HI4C 1DEDA 3CSBA 4JFZH 2ZNWA 3RHWK 5A3IC 1M7IA 4FQCH 4OFPA 1MCKA 3QDJE 3TA3B 4KMTH 1JPSL 5AUMA 3T09A 4ZYKA 3PHSA 4RISL 3DX8A 4LNRB 1AO7D 3BIAX 3N1PC 5ENWA 4X4YA 3EGSA 2WBJC 3MGOA 4MQ7A 8FABA 2EXYD 3CDYA 5INDA 1KB5L 1QFWL 2YPLA 4OZ4B 1CN4A 5IIEA 5E5RB 2VL5B 4HUWB 4JFYA 1SVCP 4NQDD 1QBLH 1UZ8A 3VXRE 5EZJB 3PWPA 4HPOL 4XB8A 1KCRL 1T04A 3BSZL 5TQ2H 4PP2B 4RIRB 3H7LA 4BZYA 3D18A 1M7DA 4QHUA 1C08B 2X41A 1LO0H 4Q58C 4BQ8A 4GKZA 4AZ8A 3EYQC 1XCQA 1J86A 2DQDL 3MRRB 4PJDF 2EECA 4YDLB 3MROB 4XPHH 5IK3A 4WWKD 4CMMB 3BUYA 2JE8A 5IQ9A 1OGAB 4OCSL 1CU4H 1AD9B 4WWKA 1XH3B 5JOFA 4FP8H 5DO2C 2JIXB 5IESH 5F97E 5IVNA 4O58L 3V0WH 3E8UH 1VPOL 2DM4A 1OB1B 2FX8H 5JA8B 2DQJH 2HJKB 2XKNB 3TBTB 1JGVL 3HHRB 3SE4C 3O3EA 4XP6L 4KHXL 43C9A 4X6DF 1S7WB 4XVJL 3JWOC 2BNQB 4AT6B 2A83B 1D5BB 3FQXA 5F1IB 4F7TA 3PWLB 4JCMA 5DRNA 3RVXC 4U1NB 5I1DB 5KOMC 2QLVB 4NSKB 5I71B 4PG9B 4JHWL 4U1JB 3MNVA 1VACB 5T1DH 5KTEL 1OT2A 5CSBA 3JTTB 3CFDA 1WLHA 4JM2F 3U7YL 5EUOB 5ETUB 4J1UA 3GMPA 2BFVH 2R69H 3TPKA 2EC8A 3D69B 1AH1A 1N6VA 1FRGL 4FQXA 3PGDB 1XGRA 2DLTA 4OCSH 3QCUL 4ZUWB 3U7AA 3DX8B 4LNRA 2VLLA 1X5AA 1OTTC 1EGJH 2DIAA 3C5SB 8FABB 3MRBA 3RY6C 4AJ0A 2BDNH 5EBWB 3P4OA 4FOMA 4GLRI 3OKLA 4G59A 1AGCB 2VDLH 3MXWH 1J8HA 4MCYB 4MQXC 4NNYB 2ARWA 4Q7DA 5D2NE 4KUZL 2BNUA 3CIQA 4NDMA 1ZT7B 1NBYA 3I3EA 1TVHA 4XVUD 3D18B 4ORGB 1RPQA 2JCCB 3QI9C 5EIQA 3QIWD 4BJLA 2FZ3B 2QSQA 4NUGH 1BM3L 4LCIH 5DMGC 3QCVL 5I8OL 3PIQA 4WTWA 4QHKJ 3EKCA 2F5BL 4L9DA 4MJ6A 4LLVA 4WV1A 4C83A 1DQJA 1JUFA 1D9KC 4LAQL 3QDGE 3IDIB 3W0WE 4EI5C 4CMMA 5EO9A 4LLAA 2VQ1A 2VLKE 4IS6A 1JPTL 1QFHA 2VZOA 1D6EA 4WFFE 5IQ9B 1T5XA 3KLSA 4P2QD 4WWKB 2LTQC 4XB7A 5DEFB 4Q9RH 2VNCA 5JQ6L 5HYEA 1QBLL 3U36B 2X1XR 3ZT7A 3H8NA 4JG1H 3GBLA 2HJKA 4TQEH 5EWIH 3U79A 4N0YL 3SDDC 4BFEA 2JB5H 1MFDH 4CN1A 4X4YB 3HG1B 1INQA 1CE1L 4QTIH 3SDCC 5DJXA 2GJ6A 3VG0L 3QDGB 4U1NA 4PJXE 3OKOB 2VXUH 4LGRB 3U30C 1A7RL 2EIEA 4U1JA 4YPGA 1Q9WB 3O8XB 5E5MA 3CFDB 3HFMH 3TCLA 5TGBA 3L5JA 1CDIA 3QXDB 4IHOB 1IC5H 1P2CB 4S2SB 5L2KA 5F88B 5I6XC 4X6DE 4S1DD 3T2PA 5HD8C 4K3EL 1HXMB 3NCCB 2VZ3A 1NGXA 1XCQB 3MCKA 2FDBP 5FM5M 1FNAA 4XWGH 1ULVA 4NM4L 2NX5D 2NY6D 2ITDA 4HBQA 1NLBL 4F7MA 3GJFH 3CFCH 4YNYB 4NHUB 3V6ZA 2FBJL 3PP4L 4RQQA 5J4MA 1N8ZB 1FYTD 1A4KB 3KXFE 3ARYA 1RVFL 3FT4B 2C26A 2XG5A 2ZZUT 1YPZE 2HTLC 3QFJB 1JE6A 5D9SB 5IEKB 1TVHB 5HSFA 3GBNL 1WISA 4P46C 5MI0C 1FFOA 1O7SA 2ID5A 2CKBB 3CLFH 4HJ0D 5EULV 1MPAH 4GW1B 1X5JA 4Y5VB 1CD1B 5I1AB 3T8XA 3MV9D 4Y8AA 1T5XB 1P1ZA 1XGTB 3A6CL 5HHMD 5I30H 2OQJA 2Y7QB 2WWMC 2VDKH 4YHLL 4HQQL 2EDXA 1ZA6A 4ZPTB 3FQWB 1JFQL 3KYNB 5GSVB 2F74A 4WHYG 2GHWB 4NM8H 5L7XL 1NAMB 5J7CC 1OF2A 3VH8A 4ERSH 2R2EA 4BZ1L 4KROD 1V5JA 3ZHKA 4F15B 2V7HB 3S88L 4ENEC 3ZSTA 3CX2A 3U0WH 4LASL 4EJ1C 5JO5A 4Q6IB 4PBVC 1IEBB 5LWYL 5MHSE 5HBBA 4P2QE 5TGBB 1H9VA 5JPMB 5FYLE 2AVGA 3RZCC 4KRPD 3H3BC 1EIBA 4O5LL 4QF1A 2P48B 3SGKA 1JZ2A 4YPJA 2DQGH 2ENSA 4G8GB 4X80L 2Z31C 5KAQF 1A22B 4NRZB 1DQML 1DVFD 5LGJA 4U6YA 4JFDD 1BX2A 3BKJH 2FH6A 1VADB 4OLVL 4H0GA 3MUHL 3F7PC 2AQ3A 1OARH 1ZS8B 3B2VL 3ZL4L 4APQD 4U3CA 2P5ED 1ZHLB 1CDJA 3S35X 4I3RH 1QBMH 3FT4A 1LVEA 4HH9B 3VXNA 2P5EA 2ZSWB 5IFAL 1FNHA 3MMEA 5FKPB 4ZFOL 3WFHA 2AEQH 2IBBA 4G8GE 2CKBA 1IC1A 3RUGA 2DICA 2V9RA 4ZOEA 4N1CA 3GNMH 3L7EA 2GSGB 4M7LL 5IWLC 3O8XA 4I3RL 2BY2A 3HKFA 2DBLL 1IEAA 1FLRH 4PJHB 1BJMA 5JHDB 3ARFC 3NGBC 4YJZL 1ZV5A 2PXYC 1RFDL 3UBXB 5I18H 4FQIH 2OI9C 1LO3L 1A7BA 1FYTE 4G8IB 1CFBA 4UILL 1DQMH 5H37H 1X5HA 4NIKB 5B38A 1UWGL 3PQYD 3KYNA 5GSVA 3O2VH 1NBQA 1CGUA 3O81A 5JZ7D 4N5EC 1OARL 1F4XH 1QLFB 4OD2B 3NPSC 3UTTB 2QHLA 4JANB 2R2EB 4TVSa 3BDYL 3DBXB 1MFCL 5B39G 5KVDH 2UZIL 5E4IA 5GRUH 1NGZA 4D8PA 1LD9A 1S7SA 5HDOA 4ZMAT 1A4KA 3TN0B 5FO7B 3FQTB 3FQRB 5D7LA 4NYLA 3MV9E 5IQ7L 1I1FB 1YMME 4CAGA 2HVKA 3S88H 2EDYA 3TJHA 3FO1A 4MAUL 3QFDA 3ULUH 1GC1L 4Y4HA 4S10A 2IANA 1QACA 1YEGH 1FO0A 2O26U 3KHOA 1GC1C 2XN9D 2DLFL 2FJHB 2MTPA 4R0LA 4PJGE 1G7LA 1XIWB 4PJ9D 4Z0BL 3HI5L 4RWYH 3O2DH 4EIZC 2J3SA 3SGJC 3HLAA 3OR6B 1T04B 2EKSB 5EU6E 4NC1E 1JHTB 3OHXB 2OQJB 1U95A 3K8LA 4XCNA 2J12B 4CADA 2NY7L 3R06A 4ALAL 4HXBH 3RJDA 4OZFB 3QJFB 5K9KB 1WAAE 4PR5A 1Q9LA 2FWOA 1SEBB 4RGND 4UAOC 3UJTL 1NDMB 4NZUH 4NRYB 1OF2B 4Z7UF 3MLWH 4B5EA 1AXIB 2HT2D 4YHKH 1CDUA 4GMTH 3MYJB 4MDJA 1DQQB 4G6JH 1AHWC 4RGMB 2R0KL 5T1LB 5JO5B 1MQ8A 1RVFH 1MPAL 5AZ2H 2CGRH 2IWGA 1IEAB 1JZ6A 2CIKB 1S7VB 4L4VB 5HI5C 1XGYL 2X4NB 2EICA 3UBXA 1FL3A 1JF1A 3IAPA 2AJSL 1JP5A 2FRGP 4GBXC 1CICC 43C9B 5D7SL 4EDXA 1KLUA 1S7WA 1JZ5A 3ARQA 2PW1A 2IBZX 4YIQA 2VZUA 4WW1A 5IB2B 3EJJX 3PWLA 5DRNB 4IRZL 5IB5A 1KPUA 3MXVH 4PRHA 1JYWA 2VAAB 4LIQH 4WW2F 4XH2A 1NCAL 3ZE1F 3TPUB 5D2NA 2D7PA 5EO1A 1BVZA 2XG4A 5T1MA 3S37X 1CFNB 3O11A 1ZHLA 3VGAC 2ICEB 2ZG2A 3ARDD 1IMHC 2F53E 3QIUD 3STBA 3T3PE 2CK2A 3HUJE 3TBYB 4F3FA 1M05B 4CDGC 1TJGH 3IDXL 5D7IA 3MJGX 5C08D 1U3HD 1AR1C 1JHKL 4TULH 5IVOA 5B39B 3THMH 2FJHA 1BVLA 4LSUH 1FORH 5EN2B 5SV3A 1BQHB 4GSDH 4YDVB 3AC0A 1OTTD 1AXSB 1WZLA 3RBGA 5SV4A 2EO1A 2HJLA 2DQHL 3NIDE 1I4FA 2MPAH 3MNZB 4TVPL 1K8DA 4FZEL 5SX4I 4NNPH 2X89D 3OXRB 1AI1L 3TJEH 2GAZA 4Y4KB 4WUUD 4YX2L 4KK6C 4QHMB 4XNZB 1IJ9A 5ALBH 2IPTH 1E4WL 2VDPL 4PV8B 1CLYL 4Z7WF 3TH3T 2CUMA 4HIEA 1BOGA 3RTQD 4MJ6B 3BAEL 4LLVB 1BFVH 4OD2A 1HZHL 2UWEA 1ZTXH 1GJIA 3G08B 3O4OB 4L8SB 4MDJB 4XMLL 4Z0XA 1NGZB 4LARL 2W91A 2ENYA 4YZFE 1NBVH 5C9KA 4I77H 3TA3D 5I1HL 4ZFGL 3TN0A 2UYLB 3P9MB 5ESAA 4Y16C 5JW4N 2FB4H 2DI9A 3EW3B 3VXTB 4Z7OE 1UKSA 4OB5L 3BP4A 3DETD 5CEXB 5C08B 3RWDB 3OAUH 3UTSA 5I1KL 3LPFA 3KLHD 2AJUL 4M4RA 1VHPA 1G7QA 2GY7B 2IALB 4PRIB 1AQDB 1NUFA 4HJJH 3TNNB 3TM6A 3X12B 5DWUL 1I7ZA 3TZVB 3HLAB 2YRZA 2BOBB 5FV2A 5D2NB 5CAYB 3X13A 1DQLL 5DA4A 4EI6A 2YEZB 1QLEL 3CFEA 1YEFL 1YYLL 2AJUH 4XAWL 4Q9BA 1L7IH 5GZND 3M1BA 5B3NA 2QHRL 4LKXB 1HXMA 4K23L 3SDAC 4JPIA 1IAMA 3PNWB 1KJ2A 4OQTH 5FYLL 1MHEB 1CDHA 5GGUA 4UOJA 4PG2A 4F7MB 3MR9A 1C5CH 5D4QA 3WIHL 5DHYA 1RZJH 2V2XA 1K8DB 2EH8H 4XP6H 4U6VL 2XZAH 4N90E 1PZ5B 3BQUA 3OB0K 4NBXB 1T22B 5E9DD 3DSNA 5TDPB 4EEEA 1RIVH 1FPTL 3LRSA 3BW9B 4XPHL 4PRHB 1BOGB 2FB4L 3VWJA 2DQDH 3D3VE 4V2BA 2Q3AA 1TPXC 1P4LB 4GG6B 1MFNA 2VDNH 3TPUA 3BD3A 5IW1A 3MRCA 4ELKB 3O6MH 4KTEL 4PP1C 4DGYH 1S7TA 4Y5YA 1MAKA 1KCRH 2DLEA 3VXTA 3LZFL 4U7SA 1DBAL 3C8HA 4U31A 1MFAL 3HCVA 4X83A 5ISZA 1GAFH 1INEL 5CEXA 2F74B 5CCKL 5D7IB 4WUUE 1G1CA 3R8BB 1NAMA 5FO9A 5EFIB 5DEGA 1BVLB 5A1AA 5GIRA 4JRYB 3KR3H 5D1QD 3BH9A 4H5SA 2FSEA 1PY4A 4X9BA 4YFLI 5H8DA 4J12A 1U8HA 2F58H 1B2WH 2XICA 1YUHB 4KMTL 3J7HA 3RA7L 4U4BA 1P7KB 3TJEL 1J05A 1Q1JH 4JY4A 1ZWIA 5SX5H 1VCAA 4M3KB 4OCYL 3MLUL 1S7UA 1JGEB 2XY2A 4JGMA 3V7AE 1FDLH 1X6LA 4DGVL 3CMOH 4OZIB 2YKLL 4MA1C 1QRNA 5J8OA 1BFVL 3VJ6A 2YWYA 1MHHB 3SE9H 3BJLA 3VA2C 3PJSA 4E41E 4QYOA 4YHKL 4HIJB 4E9LA 3IRPX 3CNKA 3AU1A 2KL6A 4KK5D 3HI6L 5C08A 3RWDA 4G6FD 4ODHH 3QIUA 3DSFH 4F37K 5FEBA 1QFWI 2P43B 4E0RB 3VWJB 5BOPA 4GSDL 2P5WA 1NC4D 1T0NB 1I7ZB 3MFFB 2EDWA 1VEMA 2BVTA 3INUL 3FO2A 1BQUA 1KLFA 2YUXA 2DQIH 5FYKE 1R5VB 4NUJB 4MS8A 3IF1B 3LH2H 4KKCC 3EDDA 1WFUA 1QFWM 1CFQA 4ZS6C 1YN7A 3P0GB 3X11B 4C55A 5IMKB 2CUIA 2N7AA 3QEQA 1KJ2B 5E2VH 1BHGA 2DQTH 4N90D 5CZVL 2VYRE 3GM0A 3VFVB 3BP7B 4GRMA 4XPBH 1JVKA 4R7DA 3DBXA 1DBJH 4I4WB 1SJXA 1A6TA 4UQ2A 4KV5E 2MOVA 4Y4HD 1J87A 4HCRA 4NN6B 5LQBH 2R0WH 3CVHL 3EDFA 4X6EB 2OZ4L 1EXUA 3KPRD 3RZWA 3FB5A 2P24B 5IR1B 1T22A 5CKAA 2APWA 4NQDE 4UILH 2EE9A 4QY8A 2JF1A 2NY7H 5I8KH 1XGYH 3FCTA 2ARJQ 1A6PA 3GJFA 4HKZB 4M61B 1FIGL 1T66D 5F7DB 3ULUD 3RGVC 3TVMB 1OAQL 4DJMA 4UT6L 3KAAA 2DKSA 3LD8C 1FGNH 3K2UH 3QG7L 2OTPA 3AB0C 4GMTL 1QR1A 5D5MA 2P1YA 3MRGA 1MIML 4ZXBC 5IBTL 1CXEA 1I8MA 1UWEH 4ZOBA 4OZFA 4PR5B 3ULUC 2IAMC 1RZGA 3PGFH 1ACZA 4HXBL 3GJEA 1FZMA 4JE4B 4OLYL 4GW5A 1G9NH 1IQWL 1RMFH 5FGSA 3U46A 1Q0YH 4G6AD 4ZNCD 3MYJA 4JDZA 5DVOA 4E0RA 2DBLH 4G6MH 4UBDD 5KVDL 5FYJH 5C2BH 3EJZC 1QBAA 2JELH 2FO4B 2A9NH 4GAYA 3KS0J 2ESVD 1A0QL 1FZJB 4X80H 2C3GA 3IF1A 3NCBB 4LRIA 1K2DA 3E6HB 1YY9C 5I9QC 5TF1L 1JYNA 1KLUB 3QIWC 3TYGL 4DW2H 2OJEB 1I1CA 4PJXA 4UINL 4PJ7F 3QEQB 4NKIH 5DK2B 3MLPA 3DXAB 1S8DA 3BP7A 3ZE1E 4HUVA 2GQHA 3NCJH 1QEWA 4H20H 1M7IB 2A73A 5FYJL 3WD5L 3QUML 1U8JA 5CP7A 1ITBB 4HH8A 3K4DA 4HWBA 3UMTA 3HTLX 1YNTB 2AXFB 4XPBL 1VEPA 5IHBA 2G60L 4Z78A 1G9NL 4DUVA 3LQAH 4OZ4A 1VGEL 5IIEB 2ERJB 2AJXH 3O3DB 4FTVE 2AJ3B 4KTYA 3TBYA 4F3FB 3WN5B 4UNUA 4NQEE 4MWFB 4F7CB 3FCTB 4ELMF 5DJYB 4U1GC 5KSBF 4MLIA 4PP2A 2FGZA 1KYOK 4JFFD 3TVMA 1C08A 4QXUH 4QRRE 1AXSA 5E56A 1TLKA 3TVMD 1UM4H 1FIGH 3MNZA 4I2XB 3ZZ1A 4E5XA 3VRLE 3ESVF 1L0QA 2E27L 4NZRL 3SE3A 2IANE 5DC0A 4ODVH 1JGDB 1IARB 2B4CC 4PBXA 2XOTA 2Y1VA 4R97B 1DBMH 2VLME 1OPGL 3UTSE 5JXED 3Q3GA 5E7FA 5C0FA 3PHOB 4U0RB 5FM5O 1J11A 3ALXA 2GW5A 4HWBH 3PP4H 5DMGD 1G7JB 1YQVH 1UH3A 1EHXA 1HXYA 3DHJA 2FJFA 1DBJL 3ZHDA 4YEEA 2YWZA 5HHNA 2W0KA 3B3IA 3CLEH 4JRXE 1FG2B 5JHLL 4DWHA 1IC7H 3HUJB 3DO7B 3TP4A 2Q1EA 3UTSB 1WGOA 3GJFB 4HKZA 5IROA 3KYMB 1DBKH 1CF8H 2RJMA 2IALA 4WI9A 2ZNXA 3VG9B 2UZYB 5FCSH 1SMAA 4K3JL 1MCWM 2ADIA 1QR1B 1KEML 2BOBA 3DNKA 4ZQKB 4M6MH 1NKRA 4XTRD 5CHNA 2NXYB 2B1AH 5IGXH 5EDXA 3P30L 4W68A 5IOPB 1KACB 2ORBH 1U3HA 5IV2B 3D25B 3T3ME 5IBLD 3C5SA 4LKXA 1FZMB 5EBWA 3WBDA 1OWRM 3I6GB 4J4PD 5KS9E 1ERNA 2IF7A 3OKLB 1B4RA 1DLFH 1LGVA 2IGFH 1DBBH 5GGUB 5EBLB 4PJAA 2JCCA 5JR1L 2NY3D 4N8PA 4JAMA 4OCYH 5FYJE 2I25N 2F5BH 3QUZB 1CE1H 4KDWA 2WV3A 4BA8A 2E9WA 3GIVB 3E6HA 2MFNA 3IDIA 1KV3A 1AGFB 4N0YH 3HZMA 4TUOA 3GK8L 4P0DA 3SBWA 1D6EB 4BELD 1WT5C 3RUGE 1SJEB 1VKXB 3ARRA 2KQMA 2YZ1A 1CK0L 2AXGB 3DURB 4P3DA 2ZUQC 1ACYH 3KG5A 1QSED 4LHQB 4P4KD 1KNOA 4LSVH 2C3WA 1K3IA 3GSUA 4PY8J 1EFQA 1LO5A 1QPXA 5I0ZA 3QEHB 1I8LA 3KJ4C 3FMGL 4LPCA 4U3XA 3BRFA 2NY1C 4PJ9A 3IXTB 5CZKA 4MMXC 1LDSA 1MQKH 4OM0L 1YNLL 4BSWB 3T2QA 1G9NC 4Y0GA 5GXBB 1AFVH 5FO9B 2Z35A 5BZDB 2NXZD 4ISVA 3VI4E 5L2KD 3LKNA 3D2UB 4APQB 3B9KA 2ZPKH 1R0AL 3DETC 5FOBA 2LAAA 2VDNL 2PTVA 1U0QA 3GB7A 4YDJB 5HPMB 3WIFA 3LV3B 3MCKB 3PHQB 3BZ4A 5GS1C 3VD5A 5A2LH 5IBUB 2JB5L 2XV6B 1L7TH 3HS0A 1YUHA 1F6FB 1UXWB 2F8XC 1I7RA 2Z8VC 4P5TB 1Y18A 1ZVHA 3Q3GB 3D3VB 3FTGB 5KJRL 4RBPK 3EUUA 4NQUA 2ZKHH 2WINB 1CLZH 1HEZB 4MA7L 1SVZA 1MELA 1EUUA 5CIPH 3GMOA 4RBPH 5C0AE 5IF0A 2I9LB 2EDNA 1FG2A 4LCIL 5I8OH 1A6ZB 1HHHA 5DQDL 5T5NF 2ILLA 2XA8L 1A6WH 1CD1A 4P4KC 5I1AA 3KPLA 4QRPE 2NW2A 4K71C 3GMQA 1F11B 1IM9A 4U1IB 2G2RB 4HKBB 5L9DL 1QLEH 3PL6A 4XVUC 1V7MH 2HTKC 3P0VH 1TMCA 5M95B 1EEYB 1GHFL 2Y7QA 5KOVC 3MJ9A 1QLRB 3BHBB 2OJZH 1IE5A 4DFIA 3ULVH 4IIQB 3STZB 4DKFL 1TDQA 1NBZA 4R3SA 5GS2D 2IG2H 2AEIT 1ES0B 5IOPA 2OTUB 2ICCA 3S4SG 4CJ1A 4KHXH 1ZXQA 5F1OB 4NZDA 4XVSH 5INDB 3IETA 2B5IB 1NCCL 4FFWC 2DIJA 2C3VA 3VXOA 2VSCA 5E8DH 2CK0L 1FNLA 2HT3C 4X5XB 4Q6IA 3DI3B 5JPNA 3WSQH 4ZS7L 3PP3K 4R7DB 3OKDA 4RIRA 5AD0B 4QRSB 1NPUA 3GB7B 1ZLVH 4RGNB 1UXSA 1XF4B 2NY6B 1A3LH 2YMXH 1P7HL 3BRGC 2HT3D 5DGRA 5IR1A 4U6YB 5BZWA 1SJEA 3ZT6A 3BQUD 4XVTH 4HGKC 3DURA 3E8UL 4P3DB 2CLVB 3L5XH 1CK0H 2XWBB 4RGOH 3F7YB 4QRRA 1CU4L 5CD3A 1QNZL 2DS4A 3QNXB 5L2KE 5FUCE 2ADFL 5K9JL 3SGDI 2ZSWA 3MMEB 3MOQA 5D5MB 5I74C 4PJCB 4RGNE 1OHQA 1PFCA 3CPLA 1EUTA 1F4WH 1L9NA 5DC4B 4RMUA 3HE7C 1NGQL 2W0FA 3LN5B 3DI2B 4NSKA 3DV4A 1V3MA 3ZE2F 4R7NB 2G9HA 4JFZL 5ICYA 2I9TB 3S4SB 4OFVA 4J1UB 3VWKC 5DJ0A 5BV7B 1CD9B 4U1IA 2A74A 3CDGA 3ETBF 3MCLL 3LRHA 1CF8L 3D69A 1N5YH 3GHBH 3SY0A 4HULB 2R4RL 5E2JA 4ZSOB 3RKPA 2H2SC 1WICA 3QHFH 4JKMA 5ELIA 3ZHLA 4AY0A 3UPAA 4PTTA 2GKIA 1MIEH 2BHZA 5EIIB 1Q9OA 3HR5A 1G6VK 1KPVA 5DQJA 4CGTA 3QO0A 4MNQE 1BBJB 5TH2A 3FQUA 1SBSL 3MRBB 1PG7W 5HI3D 3S5LB 4DKAA 4PJ7E 3P9LB 4WTZG 3UTQA 1OAUH 2MCPH 3P4OB 3FTGA 1LD9B 4QRPD 3SE8H 4GBXD 3E3QE 3FQRA 5D7LB 3SDYL 3AY4C 2OI9B 2WINA 4XZUB 5KZCB 1P6AB 1NFDB 2A9MH 1RZJC 4HF5L 4A6YL 5F44A 4GT7A 3T0VA 1U8MB 3ZDZF 5HI3C 2FZ3A 3E2HB 3ZKSD 2B4CH 1FO0B 5BW7A 4LRNL 1UM4L 5AG8A 5TJWK 1XIWA 5EO9B 1RZFL 1A14L 1JFMA 1DQDL 5JW4R 4J23A 5C9JA 4O51B 4OF7A 3PL6B 3OR6A 2NR6C 1R3HB 3MV7D 6CGTA 4MJ4A 4FXGB 4U7MA 4RDQF 3DV6B 1I3UA 1A1NA 3MODH 5C2UB 3HNTH 4XHJC 4K2UL 2VXSH 5CD3B 3TO2B 4NFCA 4MB4A 3QXTA 1NBZB 3MOBL 1HHIA 4R3SB 3UDWA 4I2XA 3CPLB 2BC4A 3L3HB 2ITCA 3DVIA 2Q8BH 3IJYA 4POUB 3VGFA 2JKXA 3LN5A 4JEGB 1JGDA 5DJZB 1J1OL 4Z5RA 3O9WD 4LVEA 4BZ2L 1A7QL 1N6QH 3O6FB 2VLKD 2A1WH 1NGYA 3BKCH 4LPUA 2R8SL 5F9WB 3U83A 2A74B 4PJFF 4UTAL 2O5XL 1S7VA 4YUEL 3G6AB 4L4VA 1EAJA 3BDBA 3MGTB 3UTZB 4S2SA 2ZSVA 1Z5LA 2DWDB 5FO8B 1KB5B 1F4XL 5E00A 4KJQC 3F12A 5DVNA 3SHSA 2BOCB 1D5ZB 3QWRA 3V5HA 1KPVB 4FQQB 4B0MM 3HUJA 3DO7A 1AY1L 3QDME 3R1GH 2D0FA 4NQVA 1QRND 5A2KH 2EDJA 5F1NB 1ZVSB 2BVQB 1TXKA 5F8QC 3SO3C 4CDHA 3V4VH 1WV7T 3P3YA 4U1LB 1JGUH 3BKCL 4J3SA 2R8SH 3F7YA 4QRRB 2V9QA 4LU5H 1U6AH 3HAEH 1KXQE 4EUPG 1R3IH 3PGFL 2PUQT 2I60H 3TA3A 4B41A 4G5ZL 2DQEL 3LN4B 5AYUL 4ZG1A 2B39A 5L88L 3CFKA 1RUPL 1UACL 2HMIC 1WCQA 1AO7B 4MQ7B 2EIBA 4OGXL 2XQYK 3RVWD 2A9NL 4R7NA 5DJ8B 2OLDA 5GISH 2Q7YB 3MBEA 3NFSL 3WEXB 4NKIL 1UZ8B 1UZ6E 1N5AB 4WFEE 1PQZB 5AAMA 4ZSOA 2HH0H 3HMXA 1ZA6B 5J0BA 2Z8RA 4IOIB 3FFDB 3BFOA 1A02N 3TO2A 4HC1H 4L3EE 5EIIA 4ZO8A 1PSKH 3QO0B 2I07A 4PLOB 3TYFA 3V52L 2VTFA 4K7PY 5I16B 2XWJB 4JFEB 5DJZA 3JV6A 1NSNH 3BMWA 4HKXA 1OP5K 4ETYA 1VKXA 5IW3A 4UTAH 1RMFL 5KSAD 4RAUB 3P9MA 5HVWA 4P99A 3REVB 3CGTA 5E70A 4U6XA 1OAUL 4TUJB 2MCPL 5JPMA 4WTZA 3K74B 4PIRF 4H0HB 4KMLB 5EU3A 1U8MA 1NAML 5FO8A 1O7VA 3TNMA 5KZCD 1SHMA 3FO0L 4M03A 1IGTA 4RWHA 4DQOL 2YPLB 1X9QA 2X40A 1D5ZA 1W0WA 5HI4D 1S5IL 3V7MA 3FN0H 4RFNC 2BMKB 1EEZB 2BY3A 3GBMH 3IT8D 4KJPC 4WHYH 5DVKA 1CR9H 5TE4L 4WGVB 5FYKU 3BKYH 3QUMB 4WFHD 3LV3A 1HHIB 2VJXA 3ARBC 5HYJA 4PV9A 2R0WL 3T0XA 4QEGA 5J89A 3TFKD 3UEZA 2FEEL 5HGHA 1MEXH 4FQXC 3C09C 3TO4A 3RL1A 1UXWA 5FUZL 1A9EA 3MRDB 3L3OB 4Z7QE 2BNRB 4MAYD 3MBXH 4TNVF 2DQTL 3RPIA 4BM7A 5JXEA 5KSVB 3EYFB 4U33A 4YBQD 3UBXI 3BN9D 1BZ9A 1HSAB 4MD5B 3TBTA 3QHZH 1NCNA 3GHEL 2P5EE 4MSWB 2D7OA 3ZYZA 2YPVH 3WCYA 2EO9A 2ADJA 1AE6L 2LQRA 1D5BA 3FQXB 5F1IA 1DDHA 3SN6N 5IF0B 3BW9A 2WIIA 5E99L 3V5HB 4FQQA 1BREA 5HGDB 1LK2B 1T4KA 1HN1A 1BM3H 4G8GD 4HIHB 4QT5A 3P9WB 5ETUA 3GMPB 1ORSB 4OSUL 1MOEA 4PJ8A 3V4PL 3JV6B 3I6KB 4WV1C 5FYKD 3C6LD 4KJWD 1S7SB 1TMCB 3MCLH 4R4NC 3C5ZB 4KRPB 5DD3H 4R4FH 3LMJH 3MRIB 1BF8A 1Q1JL 1CG9B 1BECA 3U36A 1KENH 1CZ8L 4PRNA 4I3SL 1H3GA 3UP1A 2OR9H 4HD9A 2BY1A 4JN1H 1CLOH 3TNMB 2VKXA 4MNQA 4AIOA 4P49A 1YEHL 2CXKA 4WJ5A 3MRPA 1INQB 4BSJA 1IGTB 4Z7VF 4DGVH 1TZGH 2ADFH 2R9HD 2OYPA 3BH9B 2DI8A 4HGMA 5FUOL 1YECH 3L1OL 1TNNA 4NNYA 5EPMA 4AEHL 3I02A 3MV8A 3T0EE 4I0PC 4FFWD 1FFNA 3D0VB 3BX7C 3QXDA 1ZGLA 1U42A 4ORGA 2GYSA 1S7RB 2OTWB 4WHTB 4P9HC 5JW4M 3QUMA 1Q9LB 1W0VA 3PIQB 4OI9A 1S9VB 3LZFH 2GSIB 4PV9B 1RU9H 4RMQA 4HCRH 5D7KE 4XX1G 3V6BR 5KG9A 3I9GH 3ULUE 2DIBA 4HK0A 3RL1B 3S97C 4HS6A 3GSVB 3BRDA 3HRZB 2QQKH 3VRJB 2BNRA 4XI5C 5I75C 5KBNC 3RPIB 1OCWL 5E8DL 2NW3A 1ZA3A 1F2QA 1ZGLP 5JIHA 3U9UA 3G5ZA 1HSAA 4MD5A 5IESL 3BIBX 3D85A 1KFAL 1FYTB 3RDTA 5DMYA 4PJCA 4X7DC 4MNGB 4EDXB 1Z9OA 3QIWA 5F6IB 1KN2H 1I9RH 4FG6C 5CEZH 2IG2L 2QJDA 1FFOB 3BP5A 2VE6A 5IB2A 3BH8B 2GJ6B 1DDHB 1IM3B 3SJVE 3ZT5A 4KKAC 4YQXH 1G7HA 1TETH 4NC0B