4D0CA

Complex of a b21 chicken mhc class i molecule and a 10mer chicken peptide
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
276
structure length
276
Chain Sequence
b'ELHTLRYIRTAMTDPGPGLPWFVDVGYVDGELFMHYNSTARRAVPRTEWIAANTDQQYWDRETQIVQGSEQINRENLDILRRRYNQTGGSHTVQWMSGCDILEDGTIRGYHQAAYDGRDFVAFDKGTMTLTAAVPEAVPTKRKWEEGGYAEGLKQYLEETCVEWLRRYVEYGKAELGRRERPEVRVWGKEADGILTLSCRAHGFYPRPIVVSWLKDGAVRGQDAQSGGIVPNGDGTYHTWVTIDAQPGDGDKYQCRVEHASLPQPGLYSWRSGGGL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MHC CLASS I ALPHA CHAIN 2
publication title Expression levels of MHC class I molecules are inversely correlated with promiscuity of peptide binding.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Immune system
total genus 62
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2014-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4d0cA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4d0cA01
1JPTH 4Z7UA 2RCSH 2DI8A 4ALAH 3LEVL 2BSSB 3TT1H 1JWSB 4APQD 2EDWA 4JY4A 3E3QC 4IRZL 4EUPG 1U92B 4C59B 1X5AA 1L4IA 3QDJD 4NO2A 1CVRA 1CE1L 5DJ8A 4M1CC 1L0YA 1DUZA 3QUYB 5FK9B 3H6JA 1F6LL 3LEXA 3DO3A 4OM1L 3EGSA 3CH8A 4L1HA 4TTDD 5IB5A 1A1NB 4XNMB 4M93B 4EQ2A 5MEQA 4JFYB 3V6ZA 5B4MC 5IM7B 2QL1A 3JWOC 3LKNB 3C6LA 4N0CC 4TYUA 4OSUL 4CL7A 3GO1H 1N6QH 5JR1L 5D2LA 4QRUA 2LTQC 5DD5H 3FOMA 3KPSB 1PKOA 1JGUH 1JPST 5IMKA 4KQ4H 5CZXC 4D3CH 1WBZA 2DS4A 4HXAH 4XNZB 4YUEL 1DTUA 4P4KA 4LVOB 1WEJL 3BKCL 4U3XA 3HNTH 1X5YA 4XP4H 1J7VR 2NY3C 2D4FA 2DLTA 4NQXA 4O5LH 4GLRH 3TCLA 3PL6C 2FB4L 4Y2DA 1EUTA 3GNMH 2DTSA 4RDQF 3C60D 1MUJA 1ZK9A 4WENB 3WDJA 4CRPA 3TJEL 1F6AB 4ZOEA 2GITB 5IUSA 1ZXQA 1XIWD 4XMKH 3F7YA 5JDJA 3BPOB 5EBWA 4OLUL 3IAPA 1MEXH 2NZ9C 1D6VL 1J18A 4NSKB 1CICC 4TULL 5D7JB 3D39A 3VFWB 1FVCB 4G8FB 1C5DA 5E00A 5FCUH 1J8HE 3MA9L 1ZHBB 1F3DH 1YN6A 4P9MH 3WIHH 4NKDB 1MSPA 3MOQA 4PJ5E 1UM6L 4IRSC 3WEXA 1B4RA 4JM4L 4YBHA 4FQ2L 1F3RB 3EYQC 3QRGH 3MRRA 2VC2L 4HIIB 4JN1H 1KV3A 3GJEA 5FYLH 5ALCH 5DJYA 2GCYA 4MA3A 1HH9A 2FX9L 1PYWA 3AREB 1HCVA 3VXSE 3BZFB 1NMBL 4BK4A 2FHFA 1W0VB 1N5YL 2VZVA 3WFCH 4M7KL 3CXDL 4UDUB 3LQZB 2JB5H 4S0TD 1WWAX 1TPXC 2A0LC 3C6LD 5EO0B 4EI5B 3IDNB 3L5XL 1OAQH 1VEMA 4G6KL 1T5WA 1D5MB 2ICWA 3FT4A 2YC1A 2MKLC 2J8UB 2HN7A 2R39A 1CDHA 2FGWL 5GRVL 3JTTB 4OCWL 1S8DA 3O4LA 4RNRA 3ECBB 4P0DA 1A0QL 5TF0A 4P4KD 3L3HB 1CBVH 2FD6H 3DRQB 1SJHB 3MOBH 2XN9E 5JA8B 3QULA 4NQDB 4QRRB 1N4XH 2H1PL 2R0WL 4QHNB 2WIMA 3HB3C 2GKIA 4Z5RA 3ROOA 5AYUL 2K7PA 4Y2DD 4MMXC 3MJGX 5ACZB 5GS2H 2WSKA 5SWQB 3RWCA 2VIRB 1GGCL 1XFPA 4UT6H 3SE8H 3O3BB 1INQB 4FP8H 1J05A 5L88H 2FIRT 4HFUH 5B21A 4QT5B 3BHBA 1UCBH 2YPLA 4M7LH 1SBSH 4BSVB 5IMLA 5HHNA 4XTRC 4PRIB 3S34H 4PLNC 1FZKB 3NCYS 4GRLB 1QA9A 1PDKA 4B7IA 1RZ7L 1AIFB 3EYOA 4NZDA 1SEQH 3O45A 4LP4A 4MD4B 1FSKB 5ISZE 1U8IB 2IFFH 5JIIA 3MJ7A 3MACL 3V9FA 4ERSH 4HCRL 4RGNC 2H9GB 3QRFM 4XVSL 4PJHB 4JRXD 5FHAL 5C9KA 5DO2D 3FCTB 2E3VA 5F1IA 3K81A 4AY0A 2R1XA 1UXWB 4KHXL 2R4RL 3RNQA 4PRBB 4F15C 3UTTA 3LEYL 3VFOA 9CGTA 1YEGH 3LN5A 3UZEA 3R4DA 3MBXL 2GQHA 5ERWA 4UV7H 2XA3A 4F37F 4FQIH 2W9EH 3EJJX 3IJSA 5D7IF 3GB7A 2AJ3A 4N1CA 5GGQH 2N1KA 4NZJA 2VXQL 3MLVL 4JQVA 5BS0E 4OZIE 1BQUA 3DX9B 2XIDA 2HVKB 3PHOB 5IFJB 3FQXA 2V2TA 1KXQE 3NCCB 3O4LD 1WFTA 1ZGLP 5BV7H 3VFPA 3SE4A 3H9HA 3O81A 4RMUA 1CK0H 2F5BH 3EDKA 1UB6A 4P3CH 3LIZH 4XPHL 3SY0A 5CCKL 1AXTH 5B3NA 2WZPD 5MERA 5GS3A 1OM3L 3GSNB 2ARWA 4QTHB 1LE5B 1OSZB 5GIRA 5FYKE 3FHAA 1RU9L 1TNNA 1CFQB 2Y7QB 1QOKA 1I7TB 1EHLL 4NWTL 5FYJL 3ZKSD 2NY4D 5D93B 5E7BA 3C09C 4NN7C 3MV8E 5E7FA 5J11C 2WANA 3EYFA 4XNXH 1QRKA 4PUBH 2EKSA 1MAML 2YPLD 3QUZA 5BW7C 3SDCC 2ESVD 2HLAB 3P0VH 2DQFA 3MRPB 1KB5L 4GKSA 1JGEA 1N7MH 4CVXA 1L7TH 3NPSC 3QIWA 3L3OA 1CD1A 3CC5B 3D0LA 3OX8B 3RDTA 3FT2A 1R6VA 3HHRB 5I16A 3FT3B 3KVQA 3G5XA 1N59B 5D5ME 4FQJL 1I9JL 3OR7A 5CKAA 1YEEL 1LHZA 3TYFB 1N64L 1DFBL 4I0KA 3ABZA 4BFEA 3PWPE 4LSTH 1IEAB 5CSZB 4ODWB 1OGAE 4GQ9L 3VG0H 3UTTD 4UDTA 4XBPA 3O11A 3WE6B 4HQQL 1QRNA 2HMID 1YMHB 2MFNA 4MWFA 1BREA 4K7PH 4ZUTB 7FABH 5GRYA 2F58H 4E0RA 1HDMA 4LAQH 1R3LA 2X4UB 4UNTA 3GMRA 3IDXH 4L9DA 2AQ2A 4KXZI 1G7JA 4EUPH 3BP7A 5MENA 1SY6L 3VFGL 1YDPB 3DYOA 4PJ9C 4CJ0A 1Q9KB 1XCTA 1M05A 3C5SB 2HLFC 1MCOL 2IH3B 1RMFH 4I3RL 5E8EB 5I19L 4WFFE 3V0WH 4LSQL 1CU4L 3SPVB 4P48A 5J6HA 5TDOB 1G6RB 5GRXG 4ZFOL 5J3HD 4NHUE 1FG2A 3FB6A 3VFNB 1CFVH 1G0DA 1XGRB 4YXHL 4RA0C 4UV4H 1FL6B 2Q20A 4JO2H 1OCWH 1S9KC 3CH1B 3BH9A 4I18A 2DN7A 3ZKXB 2VL4A 3V7MA 2D0GA 2DQIL 2VXSH 2ED9A 3EJZD 4XNQA 5DJ6B 3RVUC 5AG9A 4YHIB 5DJ2A 4YWGH 4BQ9A 1IGFL 3QDAA 2OTPA 4GRMA 3FOLA 2EDXA 1NEZA 3E2HB 5DI8B 2QQNL 3QUZD 4YBQC 4WHYG 2PYEB 1CDJA 3O6MH 2HT4D 5ANMA 3SDDA 3QIWD 2X4TA 3MRMB 4XPTH 3RDTD 4FA8A 1LK3H 1MNUH 2BRQA 1RZKL 1KG0B 2VUYA 4LLVA 1Y6MR 4S1RH 4XNYH 1MI5A 4TNWK 2R9HC 1ED3A 2XPGA 5A2KH 5TPWL 3ULUC 1X6LA 2J12B 1CLOH 3WDHA 4QO1A 5DQJA 2QKIB 3HG1E 3BSZL 5AZEL 1KIPB 1Z9LA 1RIUL 4JDTH 4L3EA 1H3WM 1A5FH 3P9MA 1QRND 2WINB 4OGZA 3ORJA 4HKBA 1A7RH 1JE6A 3TT3H 3NAAL 4O02H 3WFDL 3L5IA 4K23L 2ZSVA 1KIRA 4L3CB 4QGYA 4GG6E 1HCFX 5CWSA 4YGAB 1JPSL 5KVEH 2ZUYA 5FFLA 1I7ZA 1OAKL 3FQNB 4BFGA 4G59A 5IVXB 5SV4A 1A7OH 3DSNA 4J6RL 3RZCB 4FQLL 3RUGB 4X99B 3WO3B 2VTFA 2X1OA 4CVUA 3G5VA 4JO1H 4ZG1A 3HZYA 4WI5A 5JQ6L 2DJSA 4Q6IA 4MSWA 1MCRA 2QADC 4FTVE 2I07B 3RY6C 3B9KC 4RFEB 1GXEA 2BNUB 4GW5B 4JFDB 1P5VA 3MYJB 2XNAB 1S3KH 3HMXH 1TFHA 3P73A 4FRWA 3RU8H 4MD5B 3SKOA 5I1DA 5JXEC 4TUKH 1SJVA 4X6FB 1A9BA 3U9PH 1GGBL 3E8UH 4QHUA 4IJ3C 4UQ2A 2X1XR 4Y5VC 3BWAB 2A9NL 4OBSA 1T83A 2BNQA 5D2NC 5DGQA 3DURA 2JCCB 1UXSA 3MOAH 4LGPB 3CLFL 3WIHA 1F3DJ 4H0IA 1A3QA 2UY7A 5M95B 2I60H 5EZJB 2VLMD 1YN7A 2V9QA 3B3IB 1Z9SA 4MHHI 2FRGP 4N0FB 5I8CA 3IAGC 4X9GA 4DZBB 4B41A 4RGOL 4NYLA 4WUKL 1P7QB 1EHXA 2Y5EA 5GXBB 5LGJB 4OD1H 1MFAH 3UXFA 1FIEA 2FH8A 1V05A 4S1SL 1AP2A 4NQCB 5KAQF 1G6VK 4L3ED 4YK4B 5EU7E 4Z9KB 3UO1L 4CN1A 4WO4C 3U4BH 5CD5D 5JA9A 2QEJA 5E70A 1LGVA 1J10A 3DVGA 2RFXB 5DRNB 5CZVL 3WL9B 3WN5A 1KGCD 3KPLA 2WP3T 3DX7A 4LQFH 3HAEA 4XVJL 3VWJB 5CILH 1FVDA 3VRJB 4X5XB 1BZ9B 1UYWL 3O9WC 1H3PL 4HAFA 2CMRH 5D8JL 1VPOL 2ZKHL 1VEPA 3QFJE 1Q38A 2AK4E 4U1MA 4PTUA 4POZC 5IOPA 2R23A 2R56L 4R2GC 1AHWC 1RZKC 3WV0A 5E8DL 3P9LA 1CFNA 2AJYH 4ESKA 1A7PL 2EDQA 5DS8A 5CEZL 3S36L 5J1SC 3R0MA 1JV5A 5E08H 2YBRB 4JVUA 4N0RA 4OD3H 4PV8A 2CRMA 1FRGL 1VGKB 1XGUA 2WBWB 4HMEA 4Y4KD 2C5DC 4Y5YB 1FE8L 3MXVH 6FABL 2BOBB 3BP5B 5DVNA 3U9UB 1F58L 5DSCA 4K71B 5L2KE 4GAYB 2BNQD 4BZ1H 1MPAH 3ZYZA 3QUKA 4OV5B 1WBYA 3H0TB 2V2XB 3SGJC 4LU5L 4QNPE 2W91A 2IPKB 5GGSA 3B83A 4DVRH 5IFHL 1S7SB 2BP3A 1A2YA 3KDMA 4V1DA 5ESAA 4Y19B 5I8EA 3FO9A 5INCB 1VFBB 1BWMA 5FYLD 4OTXH 3JWNC 1MJ7L 2CGRH 4PG9B 1YEKL 2Q7YB 3CD4A 4WU5B 3BQUB 1U8MB 4ZTPH 1NDGA 1QEWB 1G7MA 1GZQA 4HPOL 3DHMA 3LV3A 4ZOCA 1N5AB 3LB6D 4R96B 1TJIL 2NW2A 2ERJB 2VZSA 4HUVB 2HFEA 3RVVC 3T0BA 1UG9A 4RISL 1WGOA 4XBGB 5SX4I 4QF1A 5F21B 4PRHB 4RBPK 3IS0X 4M1DL 3VFSB 1ZA3B 1W72B 3HE6C 4WFGD 5D96C 4ZUWA 1UWGL 4KAQH 4KRPD 4U31A 5TGBA 2Y9RT 4YDLC 4U0RB 2NXZB 4N1HB 1D6EA 5GSVA 1S7QA 5GS2D 1CI5A 3DV6A 5D7LE 4ZMAT 1CVSC 1E6JH 3HC0B 1INDL 3VGFA 2YD6A 3V6FB 3KYOA 4WUUE 4MDIB 2AJUL 1OAYL 5BQ7B 4S1DD 5BZWB 5ISZA 4JZJB 4KRMB 5HI5D 4HWEL 4I9WD 2FX8L 2E5EA 5EU6B 4P2RA 5C2BH 4Z7NF 2Y25A 2DICA 3TZVB 2FX7H 2OSLB 4KI5D 1PD6A 3FHQA 1JHKH 5ALBL 2W60A 4ISVB 2HKFH 4OZGF 4XXCA 5GGRB 1MQ8A 1U8OA 4J4PC 4XH2A 4V1DD 1KYOK 2NY0C 1S9VB 5HHPB 5DC9B 3L5WA 4LCWE 4P46B 1TJGH 2OMBA 1E27B 3NFNA 4HWZA 5JPNA 4Y4HB 4HH9A 1CYGA 3M1BA 1RK1A 5E9DB 4JGMA 1FN4B 5EWIL 5BS0A 5EC2B 2MJWA 4WHYH 1MRFL 2W0FB 1O7VA 3FONA 4YR6B 3WXWH 4MLIA 2YUZA 3G6JE 4OIIL 4PY8J 5JDSA 4EUPA 1AKJA 1M4KA 4NQEE 1BD2B 1UH3A 1NBQA 5EUOF 3G6AA 1IAII 1VESA 5SWSA 4J2XA 3X11A 1AXSA 2YXFA 4LEOB 5EPMB 3AAZA 3QZWG 3L7FA 1CD0A 5CJ5A 2P8LB 4HBCH 4MHHG 2FEEI 1CLYL 3ILPA 2V7NB 4OV6F 1C1EL 2E27L 2R1YA 4DZ8A 4HG4K 1KCRH 5DEGA 2GSIB 4BH8B 3O4OB 4JDZB 1RUAL 2FHBA 4X6BB 3KR3H 3IJHB 4TTDC 1U41A 1A4JB 1KTLB 4UTAH 3ZDZF 3HR6A 3BDYH 2Q86B 2ILLA 1IC7H 4HWNA 1ZT7A 2Q1EA 1T04B 5E95B 3MA7B 3MRHA 2ENYA 4Z0BL 2C4XA 2VDRL 4JM2B 1QR1B 4DVBB 3VA2C 3K2UH 5DLMH 1A6ZB 2D7TH 1AQKH 1NAKL 3W9DB 4Y2OA 4YHLL 4IIQA 4D9RD 4AJ0A 3VGHA 3R8QA 1H3TA 5ICZA 4PRPB 2I24N 2NY1B 2YR3A 1HQ4B 3C5ZD 1F2XK 3FB7B 4IDJL 3NCJL 3CFBA 4MAUH 2VXVL 3QEQE 2YS4A 4L4TD 2F54E 4ZAKA 3QYCA 4WWKA 1CXIA 4FOMA 4QXGL 1T5XB 3RWJB 1NFDA 1E28B 5GRUH 4JRYB 5HGAB 1R5WB 1LDPH 1DQJA 2AQ1A 2OZ4H 1SEBB 1KBGL 1YEHL 2C4FT 1JN6B 3LD8C 4LCUB 5IT2L 1T7XA 1AKJD 5EZIL 1HWHB 1IKNA 3U30C 4K2UH 4LNRA 4JR9L 3DX8B 5SWSD 4YHYB 5CGMA 1XF4B 3VH8G 1MQKL 4NNPL 1Q1JH 2R4SL 3GMMB 2VDNH 1DQLL 4XZUB 4FG6C 4M5ZH 1FYTA 1RZFH 4I0CC 4FXGB 3NN8A 3BH8A 3VD7A 5KSBB 2X9WA 1D5BB 1S5IH 1UZ6E 1VSCA 4NRZA 5C6PB 1MLCB 1IL1A 1UJTA 2P5EE 5LWYH 4DUVA 3HMXA 1QYGH 4KI1A 5DJZB 2BNRD 3MCLH 4P5TA 4U6XB 5DD0H 1VKXA 3PNWA 1XF3A 1KIQA 3GI9L 4OZHF 5B3JE 4A6YB 5EN2A 2ZOLB 4C83A 5C0ND 3C6LC 1PZUB 1LK2B 5IW1B 1Z0MA 3MUJA 3RKPA 4OF7A 5FGCE 2UWEA 1T21B 1FNHA 5E2TH 4JHWL 4Y16D 5F9DC 1P6AB 3C9NB 1JRHH 4YFLF 5ID0A 1WITA 2J5LC 4U1IA 4H88L 1GHFH 2CO6B 1WF5A 3KJ4C 1MJ8L 4X7SL 2VJXA 4JZOB 4X6DF 4QRPD 5F72S 1EO7A 3RVXD 4P4RB 4N0UE 5HXMA 4Y2DC 4U6HB 5C0AB 3O3UN 4MJIB 4WWKD 1U8NB 1G1YA 4UU9B 4EIGB 3NGBC 3UTSA 3NFPA 5JHDD 5F7YC 1MFEL 3UBXG 1VACB 4HS3B 5C9JB 4KGLA 4CMMA 4PJCB 1IGCH 4AH2A 4EVNA 5CGYD 5DYOB 3FAXA 1MRDH 5FO7A 4EOWH 2VN4A 4UOW1 4OLWL 2Z8WC 4OZFG 1ZHLA 1IT9H 1FDLH 5C0GA 2E8YA 1FYTD 3MGAA 3IFOA 5DO2C 1AD0B 2E9IA 5DZOA 3CMOH 3VWKA 4Z7UF 3HTLX 5IHZA 4KUCF 5FKAA 1TCMA 1LE9A 4X9FA 5LJYH 3K4DA 1E4XI 5I1IH 5TFSL 1T4KA 1IKFH 3DECA 3W0WA 1NGPH 2ITCB 4YIQB 2CK0L 3WJLC 2C3HA 1BFTA 1U93B 3QA3B 4C56E 5SWZB 1DN2A 1BM3L 2FJGA 5H35A 3OKOB 5T1KA 5LAXB 1C08A 5FV2A 1AR1D 5K9JH 1DE4A 2Q3AA 5DJDA 1G7IB 2DIBA 3U79A 3BEWB 4S1QL 4K3JL 2ATPB 4OQ1A 2BVPB 1RAMA 2XWTB 5EDXA 1MCSA 2GW5A 1AR2A 4R8WH 3QB7C 2CLZB 4JLRA 5EUKA 4B5EA 2X2YA 2LU3A 3WS3B 3NMEA 2R2EA 4PLJD 5JUEH 4PY7B 1S7XA 1SVZA 4MD0B 4H1LG 3TPUE 4ETYA 2AV7B 1EO8L 3LH2H 4L4VA 4Y5XA 3S35X 2CIIA 5D2LF 1ORQB 3W11D 4WU7B 5I15H 1EAJA 1MFDL 1SMAA 2YD1A 4FQXB 4JPWH 1WC7A 2V5RA 5E03A 4E41D 4JFPA 3MNVA 2CQVA 4G5ZL 5HHMA 4NOFA 4ZYKB 4PTTA 1KENL 3E6FA 1CDYA 1AJ7H 3HUJF 4HUUA 2YK1L 3OAZK 1CLZH 4RMWA 1U8KA 3MLYH 3QSKB 4OIAA 3T3ME 5T3ZD 3EBAA 4NCC2 3ULVE 4U49A 1KOAA 1YPZA 2NYYD 3BKJH 2EDJA 1RD6A 4G8GB 4L1DA 1ZT1B 1F90L 2XTJE 1GVIA 4PJ8B 4G80B 1X5IA 1I9IL 3DYMA 4FFVD 1EEYB 3KPNB 1UWEL 3UDWA 3VWKD 4BJLA 4MA8L 2XKNB 1U9KA 1JNJA 1HKLH 1W0YT 2ICEA 2OQJA 1JPTL 3W0WD 3UC0H 5JOFA 2RCSL 4ALAL 2HMIC 4Y4FB 1QSEA 5CEYB 5C6WH 3TT1L 4LSDA 1ND0B 2I9LB 4JDVB 1EUUA 5L2JA 1MCWM 4KKLD 5DJ0B 5T1KD 1I8KA 1T20A 4JQVC 5ITFB 3FB8A 2VLKA 5C0JB 4HIHA 4YHNA 2VDLH 3PABB 4DOHE 4NBXB 1FL5A 3WUZA 3L9RB 3WNKA 3KXFA 4PGEB 1NC2A 3SO3C 4XMPH 1WISA 3RNKB 3SE4C 2BSRB 5J3HC 3VXTA 4Z7OF 3BDBA 5HHXH 2GJJA 5DD3H 5IEKB 4JAMA 3IDYB 4HKXA 3TIEA 3QJFA 4NQVB 5CSBA 1WFUA 3GGWA 4KK9C 4OD2B 2OJEA 1OD9A 3BOVA 3PF2A 2JB6B 4KDTA 3GO1L 1N6QL 5I1GH 3FO1B 5DD5L 1JGUL 1TZHA 5HHMD 2X7LA 3AS3A 5IGXH 4CW1A 4OLEA 4KQ4L 4D3CL 4R4FH 1DBAH 2Z8RA 4HXAL 4PRDB 4P2OC 3DVNA 2HT4C 2NCMA 1CGUA 3HNTL 4XP4L 1V3LA 3AS2A 3QIWC 3MGOA 3D2UB 4O5LL 5T1LB 2QQLH 2JIXB 3GNML 4OZ4B 1JHTB 4PJEA 3MV9B 5D7LA 4AIZB 4XMLH 4RBPH 4XMKL 5IVOA 1RQ5A 4WUUA 1GOHA 2H8PB 1MEXL 1XGTA 2DTMH 4LHUB 4AQOA 5HI4C 3VXRB 3V0VB 4PGBA 3CGTA 1QSED 5FCUL 5F93C 3H9SB 4Q58C 3STZB 1EVUA 4KZEH 5CBAB 4P9ML 3WIHL 4OAWA 3G08B 4LLWB 1T66D 4ODUA 4QOKB 3U83A 4D0BA 1FNSH 1UFUA 4YEEA 3QRGL 3QG6A 4P23B 3FRUA 2VLKD 2WWKT 1IGYB 3VJ6A 4JN1L 1JNNH 4TNVF 4XB7A 3FQTB 5FYLL 3HC4H 1RZGA 5ALCL 1A1MB 1Z3GH 4PGJA 4LPCA 3KXFD 3O41A 1NC2D 4LLQB 4QWWC 3H3BC 5GGUA 3T2PA 2EDHA 1UZ6F 3O6FA 3AU1B 1F4WH 4PJIA 4IMLB 3WFCL 1TXKA 4OKVA 2H3NB 3MREA 1T6WA 4U3CA 3PDOB 2JB5L 4LIQE 3MRCA 4YFEA 1WICA 5HYJE 3G6JA 1AC0A 1OAQL 3ARBA 3ARTA 4X7TB 4OGXH 2JJVA 1ERNA 3C5JA 3CUPB 2E7LA 3QP3A 1WBXB 3FFCA 1QVOA 3P77A 4OF6A 4NJAH 3RJQB 3UEZA 5SX5K 2DAVA 2OZ4A 5T1DH 4QRTB 1YY8B 5HVHC 1ZSDB 3QIBB 2W65B 3BPNB 3LSOB 1BVLB 2EDDA 4ZSOA 3VRIA 4PGCA 5HGBB 1CBVL 2FD6L 1IMHC 2ZPKH 43C9A 4D8PA 3MOBL 5F88A 5C0FA 3LMJH 1JWUB 1NLBH 1ZT4A 1ZANH 3SDDC 4HBQA 1H5BB 4ENED 4HFWA 1OTSD 4EKXA 1N4XL 2AEIT 4JFEB 3VD9A 5FDYA 1HYSD 4K3EH 4HMCA 3MRBA 4H0GA 5JZ7C 3B8YA 2K7QA 1G7HA 5DEFB 4U1HA 1N6VA 4UT6L 3BP4B 3SE8L 4FP8L 1XEDA 2AV1B 5L88L 2HJFB 5DVLA 4BQCA 4HFUL 2EYTB 1G9MH 1UCBL 2BK8A 3MLUH 4M7LL 1SBSL 3DVIA 5EO1B 5CHNB 3S34L 4L9LA 3BGFC 4UUJA 1Q9LB 5E6IA 1F4YH 1SEQL 1G1CA 2IFFL 3RPIB 4WI8A 4ERSL 2WBJA 4I48B 3MV7A 1WFOA 3DTXB 1LD9A 1UQSA 2LTQB 4TUOB 3HPLA 1B2WH 3HR5A 4GRWH 3IU3A 1GAFH 1JTOA 5J6GB 2WWMD 1YEGL 5DFVD 4Q6IC 1JGLH 1BJ1H 1GC1H 3KPRD 3O6FD 4I4WA 4UV7L 2VLRE 5TQ2H 2KZ1B 4FQIL 2W9EL 4HV8A 5I1HH 1XH3B 3PL6B 3BD3A 3D87B 5GGQL 2ITDB 1ZWIA 4KKBD 5F97E 3ARBD 2HTLC 1QSFB 1MAJA 4G7VH 5E56A 3FFCD 5C07B 3BUTA 3QWOB 3FFDA 1DBBH 2I26N 3MRIA 1OHQA 4GKOA 1Y6NR 5BV7L 3X13B 4PB9H 4AENB 2PO6B 4KK8D 1T83C 1CK0L 2Z31B 2F5BL 5B8CB 3WDIA 1EXUB 4KK6D 4P3CL 3LRSA 3LIZL 4L8SA 4H1LH 2RQ8A 4XCEB 2X70B 5DXWA 1AXTL 2EKJA 5DD6B 1F4AA 5T5NG 1PLGH 2DYPB 3T65B 1K4CB 4KWUA 2NXYD 2JE8A 1I3RB 2GJZA 3DXAB 1BJMA 5BRZB 1C16A 4U1KA 5D7IB 5F89B 3IXAB 4UOJA 3V7AG 3ARYA 2YMXH 3AB0C 3MRDA 2A38A 3TESA 4XNXL 2QLVB 4PUBL 3BW9A 4NUJA 5IKCA 1CN4A 3P0VL 3K2MC 2JELH 3OKEA 3RL1A 1N7ML 1L7TL 3LB6C 3D3VB 1IGTB 3BIKB 3PWUA 3DGGB 3T3MF 3UJJH 1IEBB 5HVWA 4NO5B 1ZMYA 3BI9X 2WBJD 4ZFZA 4X7FC 2AXJA 1YNLH 1QO3A 4I13B 4MJ4A 4XVTH 2CJUH 4LSTL 1GOFA 3P40A 3RIAK 3TFKA 1DBJH 3VDBA 3VG0L 2HG5A 2BJMH 5I74C 3BVNB 2PXYC 5GGVH 4KRPC 3PWJA 2Y1VA 2B0SH 1C12A 1HILA 4K7PL 3U6RB 7FABL 4XCNA 5KSUB 2F58L 2VZUA 2AEWA 4LAQL 2G75A 4O2EA 4F7PA 3IDXL 2EIBA 4TSBH 3TN0D 3CFJB 4KUZH 4BQ8A 3IKKA 1P4LB 2VL5A 3RL2B 2XZCH 5D6DA 4ZUUB 1GOGA 1D5ZB 1B3JA 4QHLA 5ECJE 5F1NB 5JOPE 4FQCH 1RMFL 2I27N 1IARB 3PG2A 2LV4A 3V0WL 3VFTB 5IV2B 3IB4A 2W0PA 3VRLF 5BXFB 4YDJA 4WW2F 4ETQA 1Y0LA 4U05A 1CFVL 2W92A 2CLRA 4K94C 4KI5C 4TVPE 1BFOA 1FFRA 2GTZA 4JO2L 1OCWL 3RGVC 5JHDE 2DMKA 5HYSG 2XWJB 3MLRH 2EE9A 2VXSL 3TIDB 4UNUA 3WO4C 4YWGL 5C86A 5C09B 2ZCKH 4XHQA 4EXPX 1JWMB 5HHQA 1KLGA 3FRPG 1I7UB 3QDGB 2AJZB 1I8MA 3L3KA 4CU7A 4IRJB 4M43H 3O6ML 2C26A 4HS8H 5BOZG 3QZWA 3L6FB 3B2UC 3GFUA 4JEGB 4XPTL 4XBEH 2XQYK 5EO9B 4LFHG 4HC1A 3QO1A 1X5FA 1LK3L 1MNUL 1UM5H 4GBXB 3TWCH 4Z76A 4XNYL 4S1RL 5JW3H 1HIMH 4HJ0D 1A3RH 5DMJB 5F9JB 1NJ9A 2J8UE 5BV7C 1CLOL 4I5BA 3P0YH 4QXTA 4WFEE 4P57B 5ETUB 5J8OA 5L7XH 1I8IB 4PJAA 4JDTL 4FS0A 3RVTD 3SKJH 1A5FL 3EUUA 3WIIH 3RPKA 2FZ3B 1JYNA 1A7RL 1ZS8B 3TT3L 5TE6H 2F9BT 4O02L 2CDGA 2V6HA 2CR6A 2FSEA 1DQDH 4GUPA 4NQDE 2O61B 3F58H 3SJVD 3SN6N 1ZLSH 2ATKA 3RHWF 4MNHA 3ARZA 3WUWG 3TBWA 5KVEL 1HH6A 4Z7WA 4U6VH 4ZS6D 1KELH 3PWLA 1A7OL 1GPOH 1G7QB 3EYVA 2IPUK 2VDPH 3K1KC 1YA5A 5HHVH 4KKCD 3OG4B 4JO1L 4NKMB 4X9HA 5JNYB 2O26U 8FABA 2B5IB 3DLQR 1LEIA 1MREH 1H15A 2B1HH 4PRIE 2XKSA 3M17B 1K8IB 1ETZB 4TRPH 3SKMB 1GGTA 4XXCC 1S3KL 3HMXL 1KPUA 2C1OB 1S7VA 1TVHB 4KK5D 3RU8L 5J9PB 4G9DA 4LAJH 4NZUH 3OR6B 4M9OA 4TUKL 4PJHE 3Q6FB 2W9DH 5C71A 1A21A 1A6VH 5F70A 2EYRA 5EOTB 3U9PL 3E8UL 5F96H 1AO7B 4I1NB 1FZMB 4KI5F 5IHUH 3B43A 3O3AA 1R24A 4PRNB 1CXEA 1IGJA 4F7MA 1NC4A 4O58H 5GS1B 2CLVB 3MOAL 2H32A 3VH8A 2CUIA 4D0CB 1DANT 3PGCA 2I60L 3LRGA 5L0QC 1BIIA 1CDUA 2VNCA 5IF0B 2HVJA 4RQQB 2Y4SA 3VGDA 3GBMH 3OJMB 3FKUS 3VFUA 3P2TA 4ODXA 1L9NA 4BUGA 1Q0YH 2HJKA 4WNQB 4OD1L 1MFAL 3BN3B 3ZE0F 3G5YB 2AXGA 2EO9A 5D4QA 3DBXA 4MX7A 3U4BL 4RAUA 5EOQH 3ESVF 3CU7A 3SQOH 4F7EA 1RHFA 4PJXA 1DDHA 4G8IB 5I76B 2B1AH 1EFXB 4LCYB 1EEZA 5I75B 4NFCA 1CFSA 4NRYA 3D18A 4LQFL 5C0NC 3MGTB 2OCFD 5CILL 4PJDA 1PZ5A 1MIMH 5D1ZA 3IVKB 3RGHA 3WBDA 3FAWA 2CMRL 3T8XB 1CZ8H 1GGUA 3HI6H 4NQUA 3H42H 4IIQC 5E5MA 2IANB 4NFDA 2BCKB 3DVFA 3TVMB 4MCZB 1U8JB 2ZCHH 1F3JB 2QQQA 1Z5LB 3VGAB 2PW1A 3ARRA 3P4MA 4DUWA 3UJIH 3ARDA 2AJYL 3QFDA 1HQRB 3LN4A 3Q1SH 3FQWA 3IDJA 1ZTXH 4YGVB 1XR9A 3VFVB 3P4NA 1NGXA 1S7UA 4RMVA 3RVXC 5E08L 4XI5D 4OD3L 3UBXA 4ZAKC 4WWKC 4HG4J 3MXVL 4TPRH 3RWFA 2WIIB 4BZ1L 1MPAL 3QQ4A 4KJQC 4NN5C 1NC4D 4OZFA 4HZLB 4OCSH 4PRAA 1RVFH 4DVRL 3VI3F 1DQQA 1J12A 5DJCB 1IKNC 4MDJA 4M61B 4S2SA 3WLWC 2CH8A 4DQOH 1Z9MA 4WVRA 3ES6A 1LO5A 2HH0H 4I3GA 3I6LD 5DA0B 5KS9F 1PY9A 3KHOA 3N06B 1N8ZA 4OTXL 2GK0A 2CGRL 1MCBA 1RZ8A 3LKSA 2IPUG 5HYJA 1KB5B 1ONQA 1AC6A 5CIPH 3BUYA 1Z9OA 3GSNH 1BJ1J 4ZTPL 5D1QD 4M3KB 1TDQA 5E8OB 3BPLC 2DLEA 4O4YH 4RWYH 4B0MM 1T1WA 2QADB 3DUHA 3GSQB 5CGTA 3B9KB 1JGDA 3ROLB 3MO1A 1A47A 1BHGA 2ARJA 2YD2A 4IHOB 2GJ6D 4GAFB 4P5TC 2MHAA 4JJ5B 4F8QA 4ZFGH 5CJOH 1AR1C 3EYUH 4IJ3B 5I66A 4WFHE 2WV3A 1IAOB 5SX5H 1R5IB 1FGVH 2A6KA 5D1ZD 5EIIA 4H1LA 5D2NB 2JJWA 4G8EA 4KAQL 3QI9B 1UJ3C 2PYEE 5AAWA 3WNNA 3KWWA 1T22A 1QBAA 1CIUA 1MJUH 2KPNA 3MJ8A 3EFFA 4PLJC 3RWEB 4ELME 3ARDD 1OAXH 1E6JL 2GFBB 1JIBA 3MNZB 1QD0A 3MNWA 5FUCC 4YPGA 1AQDA 4KC3B 5GSRB 1XAUA 2QTEA 3Q5TA 3V5DB 4ZFOB 1I85A 4D2NA 3T0VA 3D85B 4TQEH 2GHWB 2JJSA 4LPXA 5B22A 4YFLI 2GTWA 4JFFB 3VFRB 4WJ5A 5C2BL 4WO4B 3OKLB 3MLTB 1QLFB 2FX7L 4ZUSA 3QQ3A 3TV3H 1JHKL 1Q9OA 2BVOA 4Q74A 5J13C 2HKFL 2VE6A 3U7WH 3ZKQD 1YC7A 5GJTH 1MF2H 1REIA 1NFDF 2VLRA 2B7DT 1TJGL 1G6RH 1P1ZB 1EIBA 4FFVC 3VW3H 4MB3A 3CFKB 3FQUA 3IGAA 2F53B 1WZMA 5EA0H 3MRFB 3MSPA 3VWKC 5F6IC 3Q6GH 5D9SB 4LLAA 2EEDA 1JK8B 3WXWL 1AHWB 3DX6B 4G42B 2NZIA 4BKLA 1YYLH 3TLRA 4HKZA 2D03H 2Q6WB 4JFDE 4PJFE 2IADB 5K33A 1CD9B 3K4AA 2QJDA 4OZGB 4OUUB 4KH2A 2BSSA 5LVEA 2COQA 4HBCL 4NWUH 5IK3B 1DUYA 3BAEH 4PGDA 5MEPB 1KCRL 1I1AA 3EO1B 3FO2B 1BECA 2JCCE 5F7DB 1CGWA 5T3XE 3KR3L 1JP5A 2HA1A 2BC4B 2QR0B 4UTAL 4RIRB 3BDYL 1KEGH 2HT3C 3U2SA 1IC7L 5I1KH 2UWEF 3L3IA 1HHKB 2VN7A 5EUOB 2DQCH 2AXFB 4CADA 1U8HB 3K2UL 4IBLT 1FH5H 5DLML 2D7TL 5IM7A 4M02A 1AQKL 1KPRA 5FECA 5C0CA 4NQCE 1IM9B 3ILQD 4OT1H 1NCNA 1LP9E 4M4RA 3KPSA 5KVMC 5FOJA 1HHJA 4PREB 3TEUA 3W82A 4ZD3H 2CUHA 5INDB 4MAUL 3KYMB 5H2BB 4WTXA 4M8QB 5IJVB 1PKQA 5DK2B 4UAOB 1EDQA 3OG6B 1U2CA 2E7MA 3RI5F 4LRNH 1S7WA 2WQ8A 1J1OH 1TETH 1B9ZA 5GRUL 1GYAA 4MZ2A 5D96B 3UDWC 3LN9A 1LDPL 5E94B 1F6AA 2BVQA 2OZ4L 2GITA 3PGDB 1LEKB 1NBZB 2YSSA 4PP1C 3QQNA 5HTSA 1YMMA 1X5JA 1V7MH 1Z6JT 1EGJH 3BDXA 3TA3A 4K2UL 2EYSA 2H6PA 5CD3A 2EXYD 1Q1JL 2V5YA 2VDNL 4G8FA 3DNKA 4QEGA 4M5ZL 4P5MA 1RZFL 2VAAB 4G9FA 3T1FB 5CINH 4NKDA 4ZTOH 5T3XH 5CEXB 1S5IL 2R0LH 4UQ3B 4NQSB 1I1AD 3KPPB 3CU1A 5JXAH 5LWYL 1DBMH 4QCIB 3VXUD 1QYGL 1Q9WA 5IG7B 4F7TA 4ZXBC 3MCLL 3BP6A 1I9EA 4XT1C 5DD0L 1WZKA 3RWDB 2CDEB 1BQHB 4Y19E 1INEH 4W6XB 1PJ9A 4QRQA 2R2BB 3CPLA 2DOCA 3ZTJG 1PW3A 5IB3B 2XWBB 3O6KH 3T4AB 4UDUA 3LQZA 5TDNB 2OL3B 2FJFA 3QCTH 3T08A 5C0CD 4X4YA 3QXAB 3IDNA 5E2TL 5I6XC 1NLDH 4Y88A 3E3QA 2Z92B 4J1UB 1JRHL 1ZGLA 1F00I 4OIBA 1DCLA 5KN5B 1FL3B 1GHFL 1ORSA 5IMOA 3ECBA 4X4XA 2GAZA 3ULUH 3L3HA 4APQB 1U3ZA 3QR2A 5J57B 2LQRA 3UTZA 1HYSC 2ENSA 3QDJB 2VR5A 4OZHB 4QRRA 5K9KA 4PRHE 3MUGB 1S7TB 2GUOB 2R1WA 2Y6SC 3VGBA 5SWQA 1YPZF 1OGTA 4QHMB 5EU4B 3ZT5A 5MI0C 3QO0B 1INQA 4WRLA 4F8TA 4W70A 1IGCL 1YMMD 1IBGH 3TA3D 1MRDL 4EOWL 4CVZB 3T0WA 1A6UH 4HZAA 4MD4A 1IT9L 5DMGC 1FDLL 4JVWA 4WI9A 4G9FD 4X6DB 1WTGT 3CMOL 2EDKA 3BEVA 4MYWB 4FFWC 3RZWA 4HUXB 4NDMA 4PJHA 2MCPH 1MVUB 2N56A 2BDNH 3OBAA 4XNUH 5I1IL 1PVHA 2OYPA 4L29B 3SOBH 1IKFL 4PDCE 4S10A 1NGPL 3O6FC 4X8XA 4X7CC 2A6JB 4MQ7A 2DQJH 1X3DA 5CJBA 2C1PB 5EBGA 1XGYH 2NY6C 3V4PH 5AD0A 4G6JH 3LKQB 4RFOH 3OKKB 1CICA 2X5PA 1WTLA 4HK0B 5CZKA 4X8JA 3C60B 1RURH 1XF5A 1M6OB 5K9JL 1IZKA 3ARBC 3K8KA 5E9DE 2E7LC 3H7BA 2AP2A 1XIWB 5E1AA 2B39A 4OGAD 3RJDA 2YA0A 1H3XA 1OQOA 3LKOA 4Y7MA 4R8WL 4IRSA 1B0GB 3WIFA 4LCCB 2DQGH 4KK8C 4Z7UB 3B5TA 5KTEH 1N2RA 5JUEL 4HJGB 1TIUA 4NOBA 2C9AA 3LH2L 1BD2E 1AGCB 3CSBA 5I15L 5HDQH 4NC1E 1FCCA 4OCLC 4ELMF 2A74B 4JPWL 1W72H 2FL5A 3UTPE 5DHYB 3CXHJ 1K85A 5CIPA 3QDMD 4KVCH 4NO2B 5EZOH 1LE5A 1OSZA 5JIPA 5B4MD 3HE7A 5DJ8B 4MNGA 3AMKA 1DUZB 1T2JA 4N0CD 1NFIA 2Y7QA 1AJ7L 3TBVB 5J1TC 2BXYA 4Q7DA 3LEXB 1JCKA 3TNNB 3EGSB 5IR1A 1CLZL 4U1LB 3MLYL 4L9LC 5E6IC 1BOGA 3WS6A 5IB5B 5CZXD 3BKJL 4YPJA 3TO2B 5BVJB 1ZOXA 4XWOD 3V6ZB 4PJEF 2DM7A 5KZCD 5IIEB 2Q8BH 3MRPA 2WBJC 4HDIA 3C6LB 3E6HA 3OXRA 1OSPH 2Q7NA 3IDIB 4OQTH 5D2LB 5FAAA 4QRUB 1J88A 4X5WA 3FOMB 4R3SB 3KPQB 3MRKA 5C08A 1WBZB 4WEMB 4LSVH 4P4KB 4WHCA 1HKLL 3I6GA 3UC0L 4PRPE 12E8H 1ZVSB 1QLEH 3HUJB 4JFQB 3RTQC 3QNXA 1T0NA 1P4BH 4NQXB 3WE6A 2NZ9D 3B5HA 1CICD 4Y2DB 5GRZA 4R0LC 5GGSY 1AXIB 3M45A 4PJFF 1MUJB 2NY2D 4CU6A 4M00A 2OR8A 3NGBB 5IQ9A 2G2RB 2X4UA 2DDQH 1KXVC 1RIHH 2VDLL 3ETBF 3V52H 5M7QA 4I3SH 3F7YB 4JRYE 4WDIA 5EBWB 4IRSD 3O2WH 2FJHA 4PJIF 3GKZA 4I2XE 4XMPL 3EYQD 1QPXA 4XPAH 5HYSA 2QHRH 5HHXL 5DD3L 1T1YA 1C5DB 2BOCA 3DRTA 4HX1B 2XFXA 4L8SC 3RWGA 5TDOA 1G6RA 4GW4A 2OK0H 3C8KA 3O0RH 2QSCH 1NGWA 1ACZA 4NP4H 3FRPA 2PTVA 3HA0A 1XGRA 5AZ2H 4JRXB 4ODSH 1FL6A 2KKQA 5I1GL 1WCBA 3MRRB 4NC0B 1IILE 2X10A 3HE7D 3GJEB 5KSBE 5IGXL 5DJYB 2EH8H 1VENA 1CG9A 2GCYB 4MA3B 3NCMA 1HH9B 4R4FL 1PYWB 1AGBA 5E2JA 1DBAL 4I0PB 2DM2A 1LP9F 3CVIH 2QSQA 4ZUVB 4E42B 1TITA 1UKSA 1ZLWK 5EBMA 3KYAA 3LVEA 2QQLL 3KS0H 3B5GA 3QG7H 3VMPA 5IW6B 2VWEC 3S6CA 1T5WB 2ICWB 3FT4B 5I17A 2YC1B 3I2CH 1KULA 2YPVH 4XMLL 1J0JA 4G7YH 2GJ6E 1S8DB 2DM3A 1UVQA 3O4LB 4RNRB 5C08D 4HXBH 2Z9TA 3K7UA 3TFKC 1RIVH 4FQQA 5J12B 4DJMA 4HK3N 2DTML 2OM5A 3RVTC 1KSRA 1A6PA 1P53A 1IC5H 3WUWA 1WQVT 4DKAA 1KIPA 2GY7B 3EW3B 4HAGA 1FO0B 1GL4B 1AI1H 4Z5RB 5BW7A 3ROOB 2WINA 4KZEL 4XTRD 4XWGH 5HHOA 4PJ7A 1N26A 3IJYA 3RWCB 3TBYA 3OAUH 3NIFE 5C0AE 3H3PH 4MJIE 1FNSL 4ZS6C 5D6DC 3WFHA 2NY4B 5DHVA 1VHPA 4LHUG 1J05B 4LHQB 4RGND 1JNNL 4PB0H 3HC4L 5DRXB 2DRUA 1Z3GL 5FGSA 1I7RA 3BHBB 3X12B 2YPLB 4TNWF 4KKCC 5JLZA 5IVXA 2ESVB 1QBLH 4HGWA 1QA9B 4F37K 5KSVA 3EYOB 1F4WL 4PJCE 3RUGA 3O45B 3QPQC 4K7PY 1R3IH 1EH9A 4K8RH 2LVEA 1VA9A 1NANH 1A7QH 4RDQG 3ZTJH 4KK5C 1LILA 4GLRI 2LFGA 4OGXL 2P48B 5F1IB 2XNAA 2YWYA 4NJAL 2NLJB 4IOIA 4MD5A 5T1DL 1DLHB 1CGVA 5A16A 3T0EE 3UTTB 3VFOB 4ODTH 4LFHD 4PJ9A 4MCYA 1EGJA 3GMLA 2ZPKL 2EC9T 4W4OC 5ERWB 1CDCA 4IMKC 3LMJL 1NLBL 1ZANL 3LAFA 4YDVA 3IJSB 4OFPA 3UMTA 3GB7B 2AJ3B 3GBNH 5C92A 5SWZE 4H5SA 1KFAH 1D7FA 3TNMB 4K3EL 4WI4A 1X5HA 2Z35A 4KMTH 3TO4A 1JPFA 1DJSA 1KACB 3PWVB 3FQXB 4YJZL 1G9ML 3PXJA 2VUOA 1NCUA 2P5WA 3MLUL 3AS1A 5F9WC 1UB6B 1S9WA 4X98A 1MWAB 4G6MH 4NQCA 3SY0B 1F4YL 4JPKH 2NY7H 1QR4A 2CSPA 5GIRB 3SDCD 4JFHD 1SHMA 5HHOD 3ZZ1A 3U1SH 2YD4A 4ZS7H 4U1SA 3NIDF 3CFIC 1B2WL 5FDWA 2Q76A 2P8PA 4G6AC 3EYFB 1GAFL 1VFOA 2EKSB 3ZDXF 1X4XA 1OLZA 5FM5O 3QUZB 4PP8C 2DQFB 3VRJA 3REVA 1JGLL 1GC1L 4U2ZA 3KYKH 1BZ9A 2D9CA 4WI7A 4YHKH 1JGEB 4CVXB 1UACH 3ARGA 3QIWB 2VQTA 5TQ2L 4LLYB 4LLUA 5I1HL 2P8MB 5GISH 3T2OA 3D0LB 4G8GE 3RDTB 1GRWA 3FT2B 3WFZA 5T1MB 5HSFA 5LKNA 2IEPA 5AUMA 5CLTA 5I16B 2XQBH 4MJ5A 3G5XB 4FZ8H 4HIXH 3OR7B 4G7VL 4XI5C 4WWID 3TP4A 2G60H 1DBBL 3UX9B 1BX2A 5GS0H 5IBTH 2WM0A 5HYQA 4U6YA 4CMHC 4PB9L 1CQKA 4UDTB 1QFUH 4XBPB 3O11B 4PJ9D 3Q48A 1QRNB 3BYTA 3PHQA 2HLFD 4Y5YA 4MXVE 1J1PH 4F7CA 4MWFB 5K59F 2BOBA 3BP5A 3U9UA 4G43A 3SE3A 4E0RB 3S88H 3JTSA 1PLGL 2YRLA 1R3LB 3PQYE 3VD5A 3GMRB 2ADFH 1T03H 3H0TA 2V2XA 1G7JB 4OB5H 5FV1L 3W5MA 3TO4D 2AI0H 1T89A 2YKLH 1S7SA 1M05B 4OLZH 1EERB 4ONHA 4XAKD 2YMXL 4C56B 5E8NB 5EIVA 2P5WD 3RVUD 4KV5F 3FB6B 3L7EB 5KSAB 4M5YH 1OAUH 2Q7YA 2JELL 4FNLH 3BX7C 3C8HA 3BH9B 4I18B 3UJJL 4YBQD 2P24B 3STLA 1NCDH 1FFPB 1MCLA 3BKYH 5D1XB 3S3JA 3VXUE 1YNLL 5DURD 1DQMH 1HHGA 1T1XA 4JFXA 4K7FA 4GRMB 2Q87A 4XVTL 5IHBA 1RJYA 5I8KH 5MEOA 1AFVH 2CJUL 1NEZB 5D1ZC 1DBJL 3AMLA 4XBGA 1KUMA 3ET9F 2BJML 4XAWH 5GGVL 2YUVA 4PRHA 5ANMB 3ULUD 4NM4H 5A40E 4ZNCD 5KOVC 3DUUB 3ARGD 3VFSA 1ZA3A 5BCAA 2B0SL 1W72A 4LKCB 4Z7WF 4JY6A 2VDKH 1XT5A 1V8HA 2IF7A 3ARDC 4NIKB 3UTQA 3HNSH 3QUXC 4LLVB 3IYLW 4TSBL 4KUZL 3BZ4B 1ED3B 2XPGB 4PJGA 4OLXH 1NPUA 2XZCL 3S36X 3SCMB 3MV9E 1G9MC 5HYEA 1JTPA 4FQCL 3HC0A 1JL8A 4NM8H 4MDIA 4L3EB 5BZWA 5M94B 4HK3J 4XPFH 4JGUA 3P9MB 1TVBA 4HKBB 1MLBA 3VXRE 4YHOH 3ZHKA 5EU6A 2C3VB 2XRAH 4OQTA 4MA7H 2H26A 3H9SE 5HJ3B 1KIRB 3TZVA 5I2IA 3CVHH 3U4EA 1ZV5A 2OSLA 5CWSB 2FR4B 2YXMA 3MLRL 3C6SA 4ISVA 2VXUH 4QOKE 4NPYA 4OI9A 2IWGA 2ZCKL 1LO3H 3RX7A 5FM5M 1I3GH 1GC1C 2LE9A 1B90A 3QEGH 3HZYB 1I8LA 4DCQA 5A2FA 5KSBF 5DMIH 1KLUB 1CD8A 1UT9A 4M43L 4HS8L 5DJAB 4AIXA 2FIKA 4LP5A 4WW2B 4N5EA 5JHLH 1BFSA 3F7QA 4XBEL 1R3HA 2W0FA 4YR6A 5DRZA 1D9KB 1VFAB 1UM5L 3TWCL 4YDKH 2LABA 3SKOB 2I5YH 5I1DB 5IFAH 1UWXK 1KT2A 3SGJA 1A9BB 1HIML 5JW3L 1A3RL 4QHUB 4Y4KB 2DBLH 4UQ2B 3P0YL 4FHBD 5EPMA 2NTSP 4GKNA 5L7XL 2J8OA 2BNQB 2P8LA 3DURB 2V2WB 3SKJL 5MHSD 4MS8C 2YA2A 2UYLA 3VXQA 3WIIL 1YY9D 4PJXF 1UXSB 2HFFA 5TE6L 3EOYG 5C0RH 1IZJA 2WW8A 2APVA 1VADA 1DQDL 3TJHA 2N7BA 4GSDH 1IAMA 5I8CB 2GT9A 2GSIA 3QEUB 4JFEE 4HMDA 3A6CH 4PJDF 1ZLSL 4JDZA 2NXZD 1NEUA 1QTYT 2F8VA 3HRZA 1CCZA 4U6VL 4PBXA 1KELL 1KTLA 1GPOL 3AB0B 1I85C 2VDPL 3BRGC 2L4OA 3W5NA 1AP2B 3I02A 1NL0H 1MHEA 1IGMH 3MA7A 3BYYA 5HHVL 4R4NC 2EDLA 4AEIH 4LGSB 1FLRH 1MREL 2B2XH 1BGXH 5CUSH 4DVBA 2B1HL 4WGVB 3RVWC 2W59A 2X89A 1A6ZA 5DRWB 4OM0H 4JKPH 3VG9C 5EU6D 4TRPL 3W9DA 1KJ3H 3KLAB 4C54A 4DEPB 3DVGB 3HE6A 3KS0J 3TZVD 1BQSA 4AT6A 4NZUL 4POZD 1VCAA 4PRPA 3RWIB 3WN5B 4H25A 3KPLB 2OTUA 2W9DL 1BZ7A 4R2GD 3DX7B 3F7VB 1A6VL 4DWHA 3DETD 3HAEB 3U46A 1NMCB 1FVDB 5C6TH 1IFHH 4UINH 5F96L 5IHUL 1M7XA 3SDAA 4JHZA 2XYCA 4GAJH 4HUNB 4U1MB 4PTUB 4O58L 3CK0H 4EN3C 2R23B 3F8UB 4GRWF 5E2UH 4N5ED 3P9LB 2X1PA 3VXPA 4DKEH 4EZMA 5DS8B 2EXYC 3IS1X 3GBML 1QSFE 4PV8B 1AY1H 4L4JA 1XGUB 2FEDD 4KVNH 1Q0YL 5C07E 5ID1A 1XF4A 2X41A 3E1F1 2X4SB 4DW2H 3CSYA 3RKDD 2AERT 4LRIC 3QUKB 1DEEA 1I1AC 2R2HB 2X4RA 2WLZA 3DOSA 5EOQL 4RSVA 3SQOL 4U1JA 3TJHD 4EXKA 4P9HH 5IB2B 1A2YB 3KDMB 4V1DB 5ESAB 3ZL4H 5DT1H 5I8EB 2B1AL 3GKWH 3DXAE 4X7DC 5BRZE 1CF8H 4U6XA 5D7IE 1FFNB 4D9QE 5CMAA 3IDGB 4M93C 2YPKA 2ADJA 1MIML 1QHOA 2ZOLA 3B6SA 3F7PC 1CZ8L 3S5LB 3HI6L 4K9EH 1NDGB 3H42L 1ODAA 1G7MB 1GZQB 1V3KA 1LK2A 5IW1A 3LV3B 4PLKD 3NH7H 2ZCHL 3FN0H 2NW2B 1CL7H 3D3VE 3OJ2C 4K3HA 3HE6D 3UJIL 1MCPH 4YNYA 2HFEB 1ZLWH 3C9NA 3HZKA 3Q1SL 1KN2H 1ZTXL 3GUTA 5BZDB 5JPMA 1K8DA 5DK0B 4XRCB 4QF1B 3WMSA 1T0MB 4JZOA 4ZPVA 3ZYIA 5KAQG 2YRPA 2MPAH 4P4RA 3SDAD 4TPRL 4ZUWB 4LCIH 4U6HA 3G5ZA 5C0AA 1J0IA 1NGQH 5TGBB 2DBJA 1U8NA 4RMQA 4YO0A 2E6PA 5EZLA 3T0AA 4XCCH 4UU9A 2AAVA 2JK5A 5I1EH 3LS5H 5GSVB 4OCSL 1MIEH 1S7QB 1RVFL 4DGIH 3DV6B 2HTKD 1HWGB 1KF9B 4MXVF 5C9JA 1IQDA 4DQOL 4PJCA 1G0XA 3KYOB 2HH0L 3QCVH 3KAAA 3MV01 4HUWA 2NY0D 3OAYH 1JMZA 3GSNL 4RWYL 3MFGB 4O4YL 4Y1AA 3MR9A 2CD0A 4J3VA 1ZHNB 1MCQA 2W60B 3C5ZB 2RBLA 1T1ZA 3GMPB 1D5XA 1R3JA 1KJVA 1P4IH 1K6QH 4UMGA 1UH2A 2JJTA 1U3HA 3L5WB 4L4TB 4ZFGL 1QG3A 3NFNB 1T7YA 2FGZA 4HWZB 5CJOL 3SE9H 4FQPA 5JPNB 1JYWA 4HH9B 5CEZD 3EYUL 4J3OC 4X6CA 1RK1B 1DVFA 3MXWH 4RCAA 1SMOA 5C09E 3WFEH 5I73B 1FGVL 3I3BA 3IFPA 1QKZH 3OKOA 5JW4R 4NQTA 3BISA 4CAGA 5KS9B 3QDGE 4OGAC 1F11A 2D4DA 5FKPA 3IKCB 3G6DH 1G7IA 1BBJA 3O3DB 2ATPA 5E8PA 2BVPA 4M6MH 1MJUL 3PWNB 4EUPB 5FO8A 1AKJB 4M7ZC 4CNIA 4UB0H 1OAXL 5SWSB 3Q3GB 3X11B 3O6LH 5DR5H 4DAGH 1BIHA 4NGHH 3L7FB 4BFIA 1HHIA 4MD0A 4OCRH 4O2FB 5J89A 5C8JA 4P2CG 1ORQA 4Y8DC 3SKUD 4TQEL 5IB1A 3ILPB 3FJTA 2OBGA 2R1YB 4DZ8B 2CDFA 1PBYA 3EDJA 2D7MA 5I18H 4R7DA 4LSPH 3TV3L 2BNRB 3GSRB 3ALPA 5JQHC 3DO7A 2E7BA 4ODHH 3U7WL 5GJTL 1MF2L 2EICA 4K3GA 4XWOC 1ZT7B 4B50A 3WNPA 3G9AB 3MRHB 2CK2A 4GRLC 5EC1A 1G6RL 2G5BB 5F8QC 1FSKC 1PY4A 3VW3L 1ZT1A 3UJTH 5EA0L 2XOTA 1TJHH 4G80A 3Q6GL 4IIQB 4Y16B 5FEBA 1DLFH 4Y1AD 5D70H 5ICZB 1HXYB 1EEYA 3KPNA 4NO3A 1YYLL 2EEAA 3FN9A 1IJ9A 2XXMB 2D03L 1JNHA 2XKNA 5DC0A 1FV1A 4O51A 2PR4H 3REWA 3CFBB 4AQ1B 4OLVH 2HWZH 4GG8A 1U3HD 3N1QC 4QRPB 4YZFF 2DLFH 1HSBA 4Y4FA 5GS0D 2X4QB 3GMOA 1RULH 3GZKA 4NWUL 1DVFD 2PW2B 3KHQA 2NY2C 5D7SH 1EK3A 1WV7T 1NFDB 3BAEL 4ODBD 1AO7E 4N1EA 5JHDB 3D9AH 1J0ZA 3GSVB 3P9WB 1T7ZA 1DQJB 4FG6D 4X9BA 4FZEH 3CVHA 2Y72A 3PABA 5K9QI 3QNYB 3L9RA 1Q94A 4R6UA 3F12A 4Q0XH 5ACLA 4LNRB 2NPLX 1KEGL 2UY6A 3IETB 1QPPA 4EBQH 2QSTA 5C7XH 3SDXE 5I1KL 3TCXA 4HULB 2IFGA 4WTZG 1TENA 2DQEH 3WJLA 2DQCL 1FYTB 3GEWB 3MCG1 3NN8B 3BH8B 4NQVA 1FH5L 3KJ6H 3FB5B 4MNQA 4ZFFB 3HE7C 3MX0A 2JB6A 3QAZB 4QKXB 4OT1L 4RRPG 1L7IH 2EDFA 5D93C 1EA9C 3HPJA 4ZD3L 5EBLA 2D7QA 2PETA 2IH1A 3WS6C 1VKXB 1E0OB 2BXZA 4P3DA 1XF3B 1KIQB 3O3EB 3P30H 4P2QE 1NUNB 5EN2B 1T0PB 4N9GB 1WK0A 1QSZA 2DIJA 5E4EB 4C83B 5CAYB 1RUMH 4WW1B 5T5FH 3CXDH 3V5KB 3LS4H 5ENWB 4LRNL 2UWEB 1RPQA 1J1OL 1TETL 4HUMB 1A6AB 4R9HA 2JIXA 4L8CA 1MHCB 1JF6A 3GBLA 3Q0HA 1HEZA 4LMQI 4UIKH 2IANE 2XT1B 2IQ9H 4U1IB 5KJRL 3PDGA 1F42A 3D25A 4ONFH 1V7ML 1EGJL 2AEQH 2NX5A 4NRXA 2VLJA 4LHUA 3V6OA 3F7RA 3V0VA 4Y4FD 1JZ5A 2X1WL 3EO0B 4UBDC 3D39D 2BZDA 4E41B 3GRWH 4EDXB 2MQCA 2IGFH 4X0KB 5CINL 4ZOBA 1L0XA 5T3XL 4ZTOL 4K94H 2E7HA 4U1NA 2R0LL 3G08A 3LY6A 1U6AH 2D31B 2VR4A 1QSVA 5JXAL 1DBML 1YUHA 4P23A 3VI4F 2AKRA 2DJUA 1IGYA 1M1SA 3CFDA 4CMMB 4AH2B 3FQTA 2FWOA 1RY7B 1FQ9C 2R29H 2DWEA 2X6MA 5FYJE 2MQ0A 4NN6B 5FO7B 1FLTX 3K0WA 4G3YH 1INEL 3UP1A 3AU1A 4JQIH 1U95B 5C0GB 3O6KL 3GSXA 4IMLA 1LO4H 5B38A 1FAKT 4MNQD 3QCTL 2I25N 3VWKB 4JO3H 1BJ8A 3ZKXC 5IHZB 3JWDH 2IBZY 4TOYH 1NLDL 5KBNC 5K9OA 4HKJB 4P49A 1H8OA 1WBXA 3VMOA 1T4KB 3ZMRA 2M26A 3W0WB 1BQHG 3OV6A 1WAAA 4LQ1A 4QRTA 1PGRB 1CS6A 3QIBA 4QXWA 4ACPA 3E2HC 3X17A 4J8RB 1BVLA 2B4CH 3ULUL 2FJGB 5H35B 4LSRH 2WQRA 5T1KB 4U7SA 1SJEA 4JJHA 4MVBC 1DE4B 1Z2KA 1EZVY 1H5BA 3VD4A 5DJDB 5HDBE 3H9YA 4Z7VE 1FGNH 2R15A 1UKQA 3QISA 4KHTH 2JIXD 1UC6A 5D2NE 5J7CC 1JUFA 3JUYA 1KC5H 4JLRB 1NAMH 5EUKB 1S7XB 1OB1B 2D7NA 2AV1A 2HJFA 5KVGH 1QFWH 2EYTA 4Y5XB 2CIIB 3V2AR 1IBGL 2NX5D 1ES0A 2VLJD 1P9MA 2EDNA 4LHUD 4P2OA 2XZAH 4DN4H 1WC7B 5HGDB 1DQTA 5MHSE 1A6UL 5DWUH 1OL0A 1CXHA 1NBVH 3RPIA 5HHMB 4I48A 4PTTB 2EIEA 3E6FB 3MFFA 4AEHH 1OF2A 4W4NA 3PJSA 2J6EH 4JFFE 2MCPL 2BDNL 4XNUL 1NCTA 2WLYA 4HUUB 4R97B 4P23D 3ZYOA 1BLNA 1U8KB 3SOBL 1UM4H 3RZCC 4XVUC 1YPZB 1YYMH 1JRHI 5T33H 4JHBA 4ZNEA 3VXMA 2DQJL 1XGYL 5GRJH 8CGTA 1H0DA 3O8XA 4YBLC 3V4PL 1B0RA 4G6JL 4RFOL 2ZG1A 1RURL 1TCRA 1EAPB 4HJJH 1XH3A 1A9EB 2F53E 1MCWW 3D69A 4JZNA 2DQGL 2ICEB 3T77B 4M3JA 5JOFB 5KTEL 5C07A 1RJCA 1QSEB 1I4FA 1RFDH 5FUZH 4Z7NE 3LPFA 2RAMA 5D72H 4AENA 2PO6A 5HDQL 5B8CA 1I8KB 4PFEA 4OZGE 1ZLUK 5FYKH 1W72L 4WI6A 5K9QG 1T20B 2UZIH 1WCQA 2DYPA 4KVCL 3TO4C 5EZOL 3T65A 2VLKB 1A7NH 3B8SA 4KK9D 2DKMA 1FL5B 2A83A 3WXVH 2ED8A 5BRZA 5C2UB 3KXFB 1NC2B 5F1KC 2ZUQC 2A73B 5F89A 5DDHA 3IXAA 3CMGA 3VXTB 5GQBA 4YHZH 1M7DA 4JAMB 1I1RA 2IPTH 4HKXB 3TIEB 4UOW0 5B39B 3QJFB 3GGWB 4YK4C 3N1MC 4P2OD 3RAJH 2Q8BL 2OJEB 3CNKA 3T2NH 5AEAA 1OSPL 1HHHA 4NC2B 4OQTL 5EUOE 1IEBA 2Y07H 4NO5A 4F33B 1TZHB 4ELMB 4AZ8A 2X7LB 4CW1B 1FHGA 3DV4B 4FABH 4LSVL 2H2PC 3BO8A 3DVNB 12E8L 2CKBH 1J0HA 3KG5A 4PJBF 3ARGC 1QLEL 4M6NH 3VXMD 4MXWH 1P4BL 3BVNA 3O8XD 2EE6A 3QXWA 1EV2E 5FO9B 4MQXD 5HI4D 4PV9B 3EKCA 3QHTC 1S5HB 4PJEB 3ZDZE 5TQ0H 3CX2A 3HI5H 4M6OH 1H3UA 4TNVK 2DDQL 1FVEB 4GFTB 3TBTB 1RIHL 4YHMH 3D0VA 5JW4N 3V52L 4I3SL 1G84A 3O2WL 5MI0B 4ZPTA 5L8LB 4ZUUA 1XGTB 2NR6D 2L7UA 5MEND 3AY4A 3EDFA 4XPAL 1OAZH 4PGBB 2QHRL 4JKWA 4I77H 3VFTA 4Y5YC 2OK0L 3OHXA 3RIAF 3SE3C 1K4DA 3O0RL 4K71C 2QSCL 4QWWD 4NP4L 3K8MA 3IT8D 4OAWB 5DQ9A 4LASH 3MMEB 3MRGA 4LKXA 4N68A 5AZ2L 5D7KE 4ODSL 1S9XB 3K4ZA 3SDXF 3OB0K 3QG6B 1T89C 3FRUB 4PJFB 2XWJA 1RZGB 2HRPH 2EH8L 4NHCH 2DWDB 5EIQA 4TVSa 3MRQA 3O41B 3TIDA 3NPZB 2GSGA 4Q2ZA 5GGUB 3VGEA 3KPRB 3O6FB 3OGCA 3BJLA 3EFDH 4DKFH 3BFOA 1I7UA 4IS6B 3CVIL 3ARSA 4PJIB 1FZJA 2NMSA 3W9EA 5C0BE 3MRCB 2YUWA 1HI6A 3QG7L 2X4OA 3QJHA 3UPRB 3ARBB 1I75A 3L6FA 3SDDD 3C5JB 1MOEA 3DJ9A 2V5TA 3I2CL 2ERJC 2YPVL 1QVOB 1XCQA 3FFCB 3P77B 4C55A 4GQPH 2BY3A 1Z0NA 1SJXA 1K5NA 1A22B 4G7YL 1ULVA 1LNUA 4HXBL 5JZ7D 1RIVL 5F9JA 3VRIB 3QXDA 4PGCB 1MI5D 2DLIA 43C9B 5F88B 2XI9A 1IC5L 1YY9C 1ZT4B 3QUMH 1MCJA 1I8IA 4WI2A 4HFWB 1AI1L 3LQAH 4K7PX 1BEYH 3DHJA 4XWGL 2FZ3A 1LP9B 2NXYB 3MRBB 4GS7C 2DB8A 1SYSB 4JN2A 4U0RC 2NXZC 4UTBH 1G7HB 3OAUL 3H3PL 4U1HB 3QDJE 2O61A 4OZHE 1QFWM 2AJVH 3K46A 3ULUF 1OQXA 4BSWB 5KOMC 3U7YH 3V95A 5GGVY 1MFNA 1QBLL 4UUJB 3RIFK 3WHXA 1G7QA 1Q72H 5LBSH 3JUZA 2D3VA 2A6IA 3B4NA 4QY8A 5DVKA 1R3IL 3U0TA 4K8RL 2WBJB 2AJXH 2PXYA 5CBEA 3TZVC 1XGPA 1K8IA 1A7QL 1UQSB 4KJYA 3SKMA 3HPLB 2GEEA 4X6DE 3DETC 3HR5B 1TVHA 5J9PA 4KZDH 4P46C 5KVDH 3C08H 2HTLD 1T6VN 4ODTL 5EOTA 1I8LC 1MCHA 1C7TA 1J8HA 4X7EC 4I4WB 3ARFB 4M4PA 2OP4H 5HGHA 3GSUB 4N5EC 4PJ5A 3GBNL 3AVEA 1JI1A 2OL3H 1RHHA 3GRWA 4NCDA 1ZWIB 32C2A 3TN0B 1KFAL 1IEHA 4KMTL 4MMZC 3U7AA 4XB8A 3KNBB 4N8CH 2ORBH 3IDMA 3RGVA 3FFDB 2FEDC 5ABDE 2DKSA 1JZ7A 4RQQA 3VXSA 4NC1C 1FNEB 5HDBF 1H9VA 4Z7VF 1FRGH 4GT7A 3ZSTA 3RKDC 4Z7UE 5TH2A 3LRSB 4L8SB 1O0VA 4G6ML 4TUJA 4JPKL 3D6GA 4WCYH 3TJHC 3ELAT 1J86A 1P84K 2VZ3A 2XY1A 4OFKA 4LLMA 1PX3A 3U1SL 2GJZB 3O4OC 3ULSA 2MOVA 1KTDA 5F7LB 4RFNB 2P7TB 4ZS7L 3UROR 3DMMA 3IFLH 1TLKA 3MRDB 5HI3C 4N90D 2XZZA 3BW9B 4YDIH 4NUJB 3VE0A 5IKCB 2XN9A 1M71B 4YHKL 3KYKL 3R1GH 3OKEB 3RL1B 1UACL 4PLKC 3T8XA 3PWUB 4NT6B 4WHTA 5GISL 4PJGF 5KG9B 3KPMA 2HJLA 1CXFA 2PXYD 1VDGA 4K3DH 4MCZA 3FTGB 2XQBL 3CDGB 1F3JA 1QO3B 4JREB 5E24E 2CRIA 5D2LE 4FZ8L 3ZE2F 2BRRH 4HIXL 3AROA 3WLBB 1NAMA 3LZFH 1HQRA 2G60L 4YGVA 5GS0L 5IBTL 4XP1H 3SDAC 3WSQH 1BAFH 1K3IA 1W8OA 3MZGB 1QFUL 1BFVH 5FGBA 1J8HD 3UBXI 2BSED 1J1PL 1BOYA 2H41A 4LPVA 3VXNA 1C12B 1HILB 3MODH 3HUJE 2WIIA 4XCNB 3HMWH 1KCVH 3S88L 3SJVB 4PJ5D 4O2EB 2HTKC 4E5XA 2ADFL 1T03L 4YC2B 1K9TA 4OB5L 5C0IA 4YXLH 1JYXA 2VL5B 1JHLH 2J6EA 2AI0L 2YKLL 4OLZL 4QHLB 5DJCA 3RGVD 4B53A 5JW5B 4HLJA 3VXSD 2X1QA 5CP7B 5DD1H 4YDJB 4ETQB 1WIUA 4QTIH 3W39A 1G7PA 4L8DA 4M5YL 1OAUL 3D39E 4K8RC 4OCYH 4FNLL 2CLRB 4FXKA 1P7HL 1BFOB 2GTZB 5E8OA 4H0HB 3PV7A 5F3HA 4OZIA 1NCDL 2VO5A 3T3PF 5IEHA 4LSSH 3BKYL 3I6KA 2DI9A 3QIUA 4JRXE 3B2UD 1DQML 2MSPA 1LO2H 2ZSWA 3DMMD 1C5CH 3OJDA 5HHQB 1KLGB 5I8KL 1TQCC 4P59H 1MHHA 1AFVL 1I1CA 3HLAA 1A02N 4OF0A 1I8MB 3L3KB 2DM4A 3LPGA 4LDLB 2BX5A 4XAWL 4DN3H 2XN9D 2BHUA 1TTFA 1VGEH 4OFVA 1R5IA 4NM4L 5DHXB 3QZWB 5IB4B 4YFDB 4U1GB 1QNZH 4ZODA 1IAKB 2VDKL 3QO1B 3BD4A 5DC4B 2VISB 3R06A 5F44A 4Z7OE 3RHWK 4BZ2H 3HNSL 1W0WB 2IAMA 2J2ZA 3MV8A 4OLXL 1NJ9B 1EBPA 1UH4A 2YEZA 4I5BB 4QXTB 1RJLA 3O4LE 4NM8L 4OGYH 3JV6A 4IEFB 2R0KH 4OCNC 5F9WB 1CDGA 3X14B 1T80A 4XPFL 4M03A 15C8H 5ISZD 3D85A 1HOCB 4YHOL 3S97C 4JFFA 3BPCA 3VFRA 2XRAL 1BPVA 4P2RD 1FC2D 3OKLA 1XR8B 3CVHL 4LLDA 4MNHB 5D5MA 2W9LA 3TBWB 1EO5A 2PCPA 1GJIA 1HH6B 4Z7WB 3PWPA 2VXUL 3S96A 3PWLB 1H8SA 5DTFB 2O5XH 1CIDA 3T1WA 3EYVB 2CO7B 1R5VA 1LO3L 1OGAA 2B8OT 2OMNA 1I3GL 1I1FA 2CKBA 3QEGL 8FABB 3BGMA 4U3HA 1N0XH 2YPLE 1H15B 4OFIA 5DMIL 2ESVE 3BZEA 3DROB 1OPGH 5I1LB 4WIQA 5CP3H 5D9SA 5JHLL 3DUSB 5EOCH 5BS0D 2FYYA 2Z8SA 1JK8A 1KPUB 1S7VB 1NCBH 4YDKL 2JJTC 4I2XB 3GDBA 1U3HC 3NZ8A 5IFAL 5BJTB 1L6ZA 3QIUD 4KRLB 1KCLA 2EYRB 5GS0C 3UPAA 2C4FU 1HXMA 2WAHA 2IADA 2DBLL 4RGMB 5F7WC 1DVFC 5DJXA 5GZND 4NHUA 4DKDC 4CMHB 4OUUA 1V5JA 1R24B 3S37H 1IGJB 2AGJH 5J4MA 3UTTE 3NIGF 3ZE1E 3WFBH 1NC4B 3G04A 4O00A 4PIRF 2H32B 3VH8B 4GW1A 3EZJB 43CAA 3IXTA 4WTZA 3PGCB 4PYGA 5FYKD 5C0RL 1RZJH 4JRWA 4GSDL 1IM3B 3FO2A 2ZUTA 3A6CL 2HVJB 2IC2A 1ZLUH 2IAMD 3MV8D 4UZGA 1CE6A 3VFUB 4R26H 1NL0L 5CKGA 4MAYA 1IGML 5E99H 4S0UC 4GMTH 4X9IA 4AEIL 1HHKA 1NFKA 2AXGB 1FO0H 5D1QB 2DIAA 3QPXL 1FLRL 2B2XL 4OCMC 1BGXL 2QHLA 3DBXB 4FMFA 4MX7B 5CUSL 1I1YB 3D85D 3ZYJA 2OTWA 4OM0L 4RAUB 2H2SC 1YEDA 4JKPL 3T09A 4F7EB 4TN9A 1KJ3L 2GJ6B 3SDYH 4PJXB 1DDHB 1PAMA 1UJ3A 3BGAA 2P49B 5EFIA 1CGXA 4PP2B 3PWPD 1CFSB 1TZIA 3HG1A 4NRYB 2VSDA 3ZTNH 5INDA 2Z93A 4PJDB 5C6TL 1IFHL 1NDMA 2DQUH 1OGAD 4UINL 5H2BA 1PZ5B 1OP9A 5D1ZB 3KYNA 4J23A 4FMKA 5A2JH 4PJ8C 1X5GA 3QUMA 5E5MB 1R0AH 3A6BH 4GAJL 4ZAKD 2FECI 1AH1A 3CK0L 3JSSA 4X4ME 4GG6A 1ITCA 2O93L 3P4MB 3ARDB 4DKEL 2HT2D 3DIFA 3HAEG 4JY5H 3FQWB 4KJQD 1GZPB 3PGDA 1LEKA 4YQXH 1XR9B 3MYZA 3P4NB 2WUBH 1NGXB 4NO0A 1H3VA 4WFFD 5F7KC 2J88H 1AY1L 4Y4FC 3SGDH 2Y36H 5I71B 2VAJA 1F4HA 4KVNL 4IOSD 1AGEB 1EEQA 3WLWD 2IG2H 3RWFB 4N0YH 3IRPX 4DW2L 4FTVA 1VFUA 3QQ4B 1QRNE 1LMKA 3GMNB 5GZOD 4OZFB 3L3DA 4PRAB 1DQQB 1LVEA 1RUQH 4UQ3A 4P9HL 5ELIA 3KPPA 2VDOH 3ZL4L 4X6CF 5DT1L 4F9LA 3T0EB 3GKWL 3ES6B 4GRWB 1CF8L 1MH5A 2UVFA 5HVGB 2GK0B 3OB0H 1AGFA 3IDYC 4P5TD 2CDEA 3LKSB 1BQHA 1MWAH 1ONQB 4MAYD 2R2BA 1FFOB 4R4BA 2ADIB 1BF8A 3QT2A 3V8CA 4K9EL 2M8XA 2XWBA 5IWLA 5TF1H 4JFOA 1T1WB 3SGKC 3T4YA 1WZLA 5CFHA 5TDNA 2QBWA 1AD9B 1JGDB 4AG4H 3NH7L 2ARJB 3FN0L 1CL7L 4CBPA 4ORGA 3RWHB 1MCPL 2Z92A 1KN2L 2IMMA 1DBKH 2ZUXA 3INUH 3CFCH 5DUMH 5H94A 1WWWX 2DQHH 3HG1D 4JVPA 5DZNA 3S5LG 5I66B 1VB9A 3OZ9H 4LPUA 3A6OA 4APQA 2A6KB 5EIIB 3TGXA 2MPAL 4F57H 5CS7A 4G8EB 3DARA 3LKPA 4LCIL 4OF5A 3QDJA 1NGQL 2P45B 3GJFB 5ANME 4G6FD 4XCCL 4PS4H 5I1EL 3LS5L 2EC8A 2GUOA 3EFFB 1MIEL 3UTSD 4DGIL 2VLME 4QHMA 5ICYA 1MCCA 1FJ1A 3PDDA 3QO0A 3MNWB 5JORA 2A2QT 3V6OC 1AQDB 4NO0D 3QCVL 4LOUC 4KQ3H 4BA8A 2HKHH 3IF1A 1HYRC 4CVZA 3QFJA 2AK4A 4DFIA 4WJ5B 4L3EE 4P5KA 5FYKU 4FTVD 4ZUSB 3QQ3B 5ESQA 1WJ3A 2ZJSH 1Q9OB 1E4KA 4P23C 2BVOB 2OJZH 1LQSR 4HUXA 3B9EA 2AQ3A 1MVUA 4XXDA 1P4IL 1K6QL 4RMTA 3QH3A 4NNYB 2JF1A 2Y23A 3I75A 3S4SG 3U4AA 1CR9H 1KGCE 4O2CB 3SE9L 4WY7H 1F4XH 4GXVH 1TTUA 4EI6A 3BXNB 3MXWL 3FQUB 3WFEL 4WV1B 5L2KA 3IGAB 4D94A 1QKZL 3PQYB 3OKKA 3BE1H 3G6DL 1IQWH 4FQHA 6CGTA 3QQ9D 4AM0A 1MFBH 1XIWA 3VRLE 3RA7H 4LVNB 3QIBC 4UB0L 2P43B 1B0GA 1OP5K 1S78C 3GM8A 3O6LL 3Q5YA 4UT7H 3GMQB 4KJWD 5DR5L 1OTUC 4DAGL 2VQ1B 4HJGA 4NGHL 3GSOA 4OCRL 4ZXBA 1X5XA 1AGCA 1LEGA 1X7QA 4L4VD 1H5BC 1DUYB 2HT3D 4PGDB 1NGYA 1TMCB 2A74A 1VERA 5DHYA 1I1AB 2BNQE 2OS7A 3OKNA 5I18L 3VXUB 3OKMB 4P9HC 2DQTH 2IALB 4LSPL 3TBVA 4ODHL 3C2SA 3ULVH 4LDEB 3U2SB 3TNNA 3CFEB 4ODVH 5GJSH 5ITBH 4RAHA 1P9MC 1OTTC 4U1LA 2EXWD 4J3XA 3L3IB 5FYLE 5BVJA 3TO2A 4CADB 3MROA 2CPCA 3RI5K 4GKZA 3N85H 4K9EC 3HN3A 5IIEA 1KPRB 5FECB 5C0CB 1YZZA 3ARUA 3UJTL 3QFJD 5I1CH 1WIOA 2AK4D 3IDIA 1TJHL 3EZ8A 4RZCA 1ZAGA 1CTOA 1DLFL 4NCC1 5D70L 4R3SA 4K55A 3KPQA 1HHJB 2OX5A 2PR4L 5BMFH 4OLVL 3SKNA 2HWZL 1KIUA 5IVNA 2X4NA 4KY1H 4N90E 3O8XC 2DLFL 1OW0C 5C0EB 1ZVSA 2GY5A 4PP1D 3NCYP 1PKQB 4MQXC 3HUJA 4JFQA 3EJYD 4N8VB 1RULL 4HSQA 1RK0B 5BVPH 1BWWA 1S7WB 5D7SL 5L2KD 4YH6A 2AVGA 4ELKB 3D9AL 4HHAB 4WFGE 3TH4T 3OSKA 2BVQB 4WGWB 2G2RA 4FZEL 2NR6C 3KPOB 2YSSB 2N4IA 3ZE1F 4YHPB 1YMMB 3ISWA 5FOBB 3CXHK 4Q0XL 4LCWA 3TA3B 4NUGH 2EYSB 2PO6C 5C7XL 2H6PB 4EBQL 5CD3B 1A7BA 1JNLH 2Z31C 2APFA 4DGYH 5B8CC 4KUCD 5D6CB 2DQEL 4HX1A 3SQBA 3KGRA 4ZXBD 1JF1A 4HS6A 4KROD 4P5MB 4H26A 4G9FB 3VCLA 3KJ6L 2EO1A 4I9WE 1WAAF 1SM3H 4JRXA 5CP3A 1G0YR 3QNZA 1L7IL 4N8PA 1Q9WB 1NH6A 2Z4QB 4NQEA 4KI5E 2MMXA 4F7TB 5EOCJ 3BP6B 4I0PA 1IC4H 4V1DE 3P30L 4KDWA 3HNVH 1WWCA 4QRQB 4J12A 3CPLB 1P2CA 1RUML 5T5FL 5FCSH 1BVKA 3LS4L 4ZUVA 4E42A 2FJFB 1YEJH 5I0ZA 5LQBH 4X4YB 4OLYH 5IW6A 3BIAX 3EDEA 4UIKL 4YXKH 2YD7A 1ZGLB 2AEPH 2IQ9L 4M7ZB 2ICWJ 5D7LD 1MJJA 3P4LA 4JCLA 3ZE0E 1ORSB 4BH7A 5IMOB 4X4XB 2GAZB 3O2VH 2Y6SD 4L5FH 3HAEH 3L3JA 4ONFL 3HCVA 5ICXB 4F2MA 3B9AA 2AEQL 4PG2A 4WUUD 5HY9A 1H3GA 3VD3A 2E9BA 1CFTA 3UTZB 1KJ2B 3QDMB 1FO0A 3GRWL 5K9KB 1Q0XH 4R7NA 2IGFL 3OTTA 2R1WB 1T7VA 4K94L 4GAGH 5GGRY 3VDCA 1U6AL 3NACH 2VITA 1OGTB 5DMGD 3WNLA 2IBZX 4B7LA 3AY4C 4RAVA 3QEQA 5DRXA 4FFWD 2R29L 3X12A 4LCWD 3O2DH 2F54A 35C8H 3U0PA 5KZCB 4X83A 2ESVA 2R69H 3OF6A 4G3YL 3GHEH 3JVGA 2CXGA 4LIQH 5A43C 3PHSA 4HIEA 4TSAH 4U4BA 2NY3B 1U36A 4JQIL 3RTQA 1LO4L 1OT1A 4YX2H 4Z0XB 1EZVX 2NY6D 4C58B 4JO3L 3BEVB 4P2RE 4NDMB 4R0LA 3JWDL 4TOYL 4D9RE 1S7RB 1NGZA 4OFDA 4F3FB 4ZDHA 4E9LA 1JBJA 5DVMA 4NQED 2NLJA 1XF2A 1DLHA 2R0ZH 5F7MC 4MQ7B 4I0PD 5ACMA 5TDPB 3DWTA 3MLSH 2B4CL 4LSRL 4NKOB 5AD0B 2KZWA 4IRJC 1CICB 1RI8A 2ADGB 4L4TE 4X8JB 1XF5B 3VI3E 3W2DH 2X44D 2NY2B 5FIEA 1N6UA 4U6TA 3C8DA 3H7BB 5IVZA 5E1AB 2P5EA 1FGNL 4KHTL 5KS9E 4GBXC 3TNMA 3LKOB 1UA6H 4IRSB 2NNAA 4QRSA 1KC5L 3WIFB 1NAML 2XV6B 1N2RB 3JTCA 3PWVA 5KVGL 1QFWL 4UI2A 3WHE1 1YQVH 2H45A 4J3UA 1FBIH 4W6WB 1HZHH 3P4OA 5FA3A 1BBDH 5SWSE 3L3GA 1MWAA 2XZAL 4XP5H 4DN4L 4W6YB 5FUOH 2FL5B 4Z77B 4XC1H 5E6ID 5DWUL 5CIPB 1NBVL 3LDBC 1ZLVK 1TNMA 3HE7B 4MNGB 3MCKB 4AEHL 1TPXB 3JV5A 1XZ0A 1NFIB 2J6EL 2VDMH 5JMRA 3MV7D 2VQUA 2X4PB 5IR1B 5JO5A 1UM4L 3A0OA 1BOGB 2BNRE 3QEQD 1YYML 4LSUH 3IDUA 2A6DB 3V79C 5T33L 3MLPA 2F54D 5CJ8A 4N0UA 5GRJL 2B5IC 3OF6D 4HDIB 5EU5A 3E6HB 4X4MA 3OXRB 4F58H 4LLYA 1UB5B 2D2OA 2P8MA 4HJJL 3RTQD 4X5WB 3U36B 3OXSA 5I8OH 5T1MA 3MRKB 5EULV 4POYA 1G9NH 5C08B 2O5ZH 4ZO6A 3GIVA 3I6GB 4JGJA 4HIJA 2V7HA 5ADOH 1RFDL 5FUZL 3GIZH 3QNXB 1T0NB 4DUXA 2DLGA 1KN4H 2Z0BA 5D72L 3WJJA 4EQ3A 2GYSA 2X9XA 4QRPE 4GXUN 4YE4H 5HDOA 1UEMA 5GS1C 5FYKL 3BKMH 5J1AA 2UZIL 5IQ9B 3SGEH 1SYVA 4UV4L 2GIYA 1A7NL 1NFDE 1PQZA 2F8OA 2P5ED 4RGNB 2BVYA 4WDIB 3WXVL 3AM8C 4V2CB 3VXOA 2FJHB 3QEHA 4M8VA 2JJUA 5IESH 5EB9A 5HYSB 4YHZL 4BUHA 1T1YB 4C56A 2BOCB 3DRTB 3RWGB 2XFXB 3MRLB 5E8NA 2IPTL 4GW4B 3C8KB 4F15B 1IVLA 2F15A 1NGWB 3L7EA 5KSAA 3RAJL 3UZQA 3T2NL 4W4OA 4XPBH 1AGDA 4IMKA 3QWQB 2Y06H 2YOCA 3CAFA 1N3NA 1FYTE 1A4KB 1WCBB 3JWDC 2Y07L 4MB5A 3EOBA 2P24A 2PYFA 3DMMC 4UIMA 1FFPA 1CG9B 1AGBB 5D1XA 3WNMA 5I75C 4FABL 1NBYA 3GI8H 5B39G 4QGTA 3TPUA 2M2DA 5F6HJ 2C7UA 1QP1A 2B4CC 2FNBA 2CKBL 4M6NL 4OF8A 4MXWL 3TFKD 5EBMB 2VABB 3UYPA 2IQAA 3TVMC 3DUUA 2K3TA 1A3LH 1V3JA 3SBWC 1A6WH 4ZQKB 2Z91A 4LKCA 3JBG7 5I17B 3CDYA 2GK2A 5TQ0L 3VGAC 1ZHKB 3HI5L 4M6OL 1PSKH 2UWEE 5HYIA 4KKNA 4YHML 2CUMA 4ONGH 1UVQB 1JFQH