4D0CA

Complex of a b21 chicken mhc class i molecule and a 10mer chicken peptide
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
276
structure length
276
Chain Sequence
ELHTLRYIRTAMTDPGPGLPWFVDVGYVDGELFMHYNSTARRAVPRTEWIAANTDQQYWDRETQIVQGSEQINRENLDILRRRYNQTGGSHTVQWMSGCDILEDGTIRGYHQAAYDGRDFVAFDKGTMTLTAAVPEAVPTKRKWEEGGYAEGLKQYLEETCVEWLRRYVEYGKAELGRRERPEVRVWGKEADGILTLSCRAHGFYPRPIVVSWLKDGAVRGQDAQSGGIVPNGDGTYHTWVTIDAQPGDGDKYQCRVEHASLPQPGLYSWRSGGGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Expression levels of MHC class I molecules are inversely correlated with promiscuity of peptide binding.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Immune system
molecule keywords MHC CLASS I ALPHA CHAIN 2
total genus 62
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2014-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4d0cA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4d0cA01
3OB0K 5LJYH 4PJ7E 3VXQB 3JTCA 2IAMD 1A14H 4X80H 3PABB 1F58H 1G6RL 1LWRA 3O3BA 1OQOA 4OCLC 4KUCD 3BP6A 1WT5C 3LQZA 1I1FA 5EO1A 4YHKL 3VXPB 1G7QA 4I5BB 1BVLB 1DANT 4P4KB 3VRJB 4OZHF 1UXWA 3LSOB 1JN6A 3BO8B 1BBJB 3I6GA 4GXVL 1TJHL 3WNLA 3GMPB 4BQ8A 4GKNB 2NPLX 4CVWA 1TJHH 5E8OB 3ZT7A 4JQXC 3UJTL 4YK4C 3EGSB 2HP4A 1F3RB 3D2UA 1W72B 1MFAL 3SDCA 4FQXB 5EOCL 3GGWB 1AXIB 2J6EA 4E0RB 2FX8H 3R0NA 4KKAD 1T1XB 2H32H 1HXMB 1OB1A 4NO0A 4S0TD 2H32B 4TVPH 1RIHL 4YXHL 3KLHC 1CXLA 1A6WH 3PWPE 3NACH 3KPPA 1G0YR 5BJTA 1DN0B 3C2AL 2X4QB 1V7MH 4J6RH 3IDIB 3BGMA 1NGWA 4TPRH 5CJ5A 4PG9B 1TZGL 3STBA 4N9GB 3O8XC 3NA9L 1SM3L 1T89A 4I0PC 3P30H 1ZS8B 1KN4H 1MFEH 4L3ED 2DJSA 2XIDA 2G60L 5JPMB 3WHXB 2NY1B 4AEFA 4WWKD 1LO0L 3RY6A 3QXTA 5MENB 2X4RB 4CMMA 1LEGA 1KJ2B 1RI8A 3IKCA 3P77B 3QFDA 2GK0B 2W07A 4GOSA 4PJ7B 1J05B 4HC1H 1VGEH 3G9AB 1PG7X 1EUUA 4KJYB 3DVFA 4I2XA 1VGEL 3AY4A 5KVDH 2H9GB 5TE6L 1S7WB 3SDDB 4AG4L 1M1SA 2R1WB 2Y72A 4EDXA 2CDFB 3GSRB 5DD3L 1UH2A 1N3NB 2VITB 3HZKB 3WS3B 1RIHH 1Q9WB 1SEQL 4X7TA 5T1KA 5K9JH 3MLPA 3W9EB 4WIQA 5AZEL 3ZE2E 1W8NA 3IJSB 1RMFL 1K8IA 4XX1G 5DURB 4MWFB 1EO8H 3X12B 1A4KA 4YXLH 4OUUA 4JE4B 1NLBH 3CDYA 5SWQA 5HHXH 1EBAA 5B4MD 1G7JA 3OZ9H 1F11A 1RZFH 3NZ8A 5A3ID 1TCRB 5LQBL 4OCRH 1HNGA 1MIMH 4NZTL 5KN5A 3QJHA 4A2LA 2VQ1B 5IB5A 2DN7A 4KKCC 3RVWD 1P1ZA 5DDHA 2A6DB 3JV6B 2FB4L 2DM3A 4L9LC 3HAEG 3SCMC 4PGEB 4D0CB 5C07E 5CMAA 5IFHL 1ORQB 3X11B 4ELMB 5DJAB 5ECJE 2VXQL 2XA8L 3MXVH 4AIZB 2NXYD 4R9HA 4DVRL 2W38A 1OWWA 3VXSD 1YNTA 1DN2A 3MRGA 4YGVB 4L29A 3P77A 1T4KA 4GW5B 5HGHA 4OLVH 3IXAB 4Y88A 2F74B 1F02I 5D6CA 3PGCB 1DEDA 4R0LC 1B4JL 3B2UD 5LBSH 1MJJB 3CVHL 4I18C 1SYVB 4Y1AA 4P2OA 2GITB 2VZTA 3RL2A 3KYOA 1PGRB 1I75A 2I5YH 1YEHL 4AZ8A 5DSCB 3E2HB 3UTZA 1UENA 5MEQB 4IOSD 5C0DB 4PRPA 1AR2A 5F88B 1A1OA 1YPZB 5C0EB 4NUGL 4JR9L 5BJTB 2WINA 5HPMA 1YEJH 2MWCA 4LKXA 4U1KB 4YFDB 1JZ7A 1A21A 5FM4A 1CBVH 1KJ3H 2CIIA 1CFVL 2AJZA 2CK0H 3BPLB 3FTGA 1UB6B 4AMKH 4L3EA 2ADFL 4LSPH 3KPRD 5JO5B 3BP7B 5DUPH 2VWEC 3R06B 4X8XA 5GGUB 1EIBA 4FQCL 8FABA 5C0CE 1F3DH 5FA4A 3RQ3A 4UMGA 3D48R 4QEGA 4OLYL 2DJUA 4JPKL 2JB5L 3T8XB 1VA9A 1KELL 5KSAC 2NR6D 3EHBD 3DYPA 3WD5L 4BH7B 3KLHD 5BO1H 1EFXB 1JRHI 1MHCB 4JFQA 3VGFA 2IMNA 2PW1A 4L4TA 4QRRE 4X6EB 3VGAB 1Q1JL 3R4DA 1EEUA 3WS6C 3BW9A 4ZUWA 4YDJB 4N0UE 2WSKA 3VFMB 1P4IH 1U41A 1MRFL 1XIWC 1TIUA 2RQ8A 1NMAL 5INCA 5I1EL 1OAKH 3BD4A 4V1DB 3PWUA 1A7PH 3N1GC 3QUXB 2JELL 3VJ6B 1AO7A 1IGTA 3QA3B 4M4RA 4GBXD 2BSED 4KRPC 4KWUA 1T21B 4OZGB 3QDGE 4U7KA 1IGCL 1LP9B 1M71A 1RJYB 1PKQA 2VXSL 5C0GA 3ULVC 2W0FB 4FA8A 4PGJA 3BGMB 2AQ3A 1MAJA 4ZNEA 3CC5A 3HI1B 2QQLH 3WIFA 3EYFA 1XGQB 2AJSH 5FYJU 3G6DH 3GM0A 2Y5TB 2A6DA 4EOWH 5E56A 1FG9C 3MV9A 5DUPL 5D72H 3QDJD 1PG7W 1PY9A 5KN5B 1MCOH 6CGTA 4TNVK 3S35H 4RMUA 3MO1A 5F3HB 3EDDA 4RGNE 5EO9B 2FDBP 3NIGE 5IW1B 4HFUL 3ZL4L 3OAYK 3CXDL 2X10A 5D7JB 4P4KD 3O4LD 4YHIB 5C6TH 4W4OC 3BO8A 3OKEA 1HN1A 2VLKA 5HPOA 5I18H 4HUWA 4R90L 5I74B 3CSGA 3HR5A 4HUXA 3M17B 3W9DA 1FL6A 3LMJH 4HLZG 1QRNA 2W60B 1E27B 1J1PL 1HKLH 5CJQH 4MA7H 1ULVA 5BRZA 2DLGA 2JTDA 1F6AA 4XAWH 4M7LT 2X41A 5D1ZC 1WWAX 3VRLF 3CH8A 3CZFA 4M43L 5ENWA 1TPXB 3EUUA 3PNWA 1CFNB 2NY5C 4XVJH 4V3EB 5JA8B 4ENED 3AMKA 4Y5VC 4TOYH 1P7QD 2W9EL 1CFSB 3D3VA 3EBAA 4OJFL 3OKLA 4DFIA 3TPUE 4XMPH 3IDXH 3STLA 2NY2D 1AHWB 3EYUH 5F7EL 2XY1A 3EJJX 1ZLVH 3GBNL 2WK2A 4KKLC 2H2SD 2DWEA 4ZS6C 4N68A 1U3JA 3AU1A 1FNSH 3TM6A 1EFXD 4W70A 5J1SC 3RZCD 3HI6L 4KK6D 1XH3A 2R0LH 4I3RL 5FYJL 4DQOL 1ZA6A 1QLFA 4K8RL 1JE6A 5E6YA 5BVJB 5LCVH 4MSWA 4JLRA 4DZ8A 5JDSA 5I1GH 4HH9A 4OIBA 1TJGL 1MWAB 1VGKA 2R39A 2X1QA 1KB9J 3EAKA 4RDQG 4NPYB 5FB8A 3C8KA 3HFML 4RAUA 3DVNB 5IROA 5L0QC 2YK1H 3GO1H 1REIA 4N5ED 4U1HA 3T4AA 1UZ8B 2K7QA 1KCKA 1INEL 3UYRH 3MBED 4JVUA 3DMMC 1HWHB 2FX7H 1BQHG 3DUUA 5ISZB 1N5AA 1R24B 3L5WB 3IFNL 3QDJB 2B2XH 2L4OA 3INUH 3LKSB 1DLHA 1F90H 5F93C 5GGSB 5FK9B 3S4SA 3S3SA 3V6FA 5A1AA 3NCYS 1D5MB 3BPOB 1LK3L 1SJVA 4IMKA 5GSVB 3N9GL 2AERT 4XB8A 4G7VH 4ZFOL 2Q76B 3IAQA 3OAUL 4F2MA 4JANA 5HGBB 3EYSL 3U46A 1DUYB 5I9QB 2JIXB 5DEFA 3MPCA 4GRWH 3BISA 4LLWA 2GT9B 4OCSH 3DRQA 3MRIA 3RWJA 4RMTA 3WUWB 5JR1L 1GSMA 1AHWC 5DJ2A 2ZKHH 5BZDB 5MHSE 1GOGA 1S7SA 2Y36H 3QFJE 5I8EA 3AXLA 5HI5D 2DI7A 1I7TA 4PJIF 2VDML 3LKNB 4XCEB 4NKIH 4DZBA 1U3HD 2W9DL 1DZBA 1ZHKB 3VFVA 2G5BA 1I9JH 2D7TL 3UYOD 1S78D 1RHFA 2HKFL 3C8KB 2A74A 2CIIB 4DGYH 1O0VA 4K7PX 4AEHH 5GGVY 5DJZA 3H7BB 5IG7B 3TWCL 4DKEH 5HHOA 4UBDC 2ED8A 4XPFL 3F58L 4HFWA 1IAIM 4Z5RB 5ACZB 1OSZB 1CXEA 4P2QA 5IJKC 1UWEL 3QCTL 2C3VA 3PQYA 2X70B 1ZA6B 4CDHA 1DDHA 1QBBA 2ENYA 5E2VL 1BBDH 4JDVB 2AAVA 1JVKA 1S7XB 3L3GA 5TH2B 1LO3L 2YS4A 1UVQA 4I0PA 2B39A 4OFYD 3VXME 3MRHA 1AH1A 2YR3A 4F9LA 2UVFA 4O9HL 3VXUD 3BQUD 2V2WA 3BZDA 5E1HB 3G5ZB 3RY5A 1A4JA 3S5LG 1MREL 4G9FA 4LCUB 1SVCP 2GCYA 3PHQB 1MI5A 1LQVA 1U3HA 4QRSB 4JY4A 3MLYL 1T04A 2NMSA 1JCKA 5C08D 2FIKB 4M62H 3DGGA 4PGBB 1X3DA 2Z8VC 1T7VA 2X4PA 2N7AA 4NO2B 5L88L 2X4NB 4D0DB 4X6CF 2O93L 3O6FD 1FZJA 5E8NB 2ATPA 3QDMA 2NNAB 2CJUL 5JW4R 3KPQA 3MC0A 4U1HB 3UDWA 1XIWD 3VXUE 4Y0GA 2Y25A 3HG1A 4PRNA 1JNHA 1U8JB 5AWNL 4LSDA 2WANA 4QGYA 4F37K 2IADA 3SJVD 1FHGA 2GTZB 1IGMH 4WEBH 3KPNA 1QEWA 1B4RA 4ODVH 3ILQD 3HZMB 1YEKL 1RUKH 4NQVA 2HJKA 1BAFL 3RWGA 3T0XA 4PR5A 4JRXB 3ZMRA 2PF6A 1AJ7L 2YD3A 4JG1L 4WY7H 3QUMB 4ETQA 5GGSY 1EUTA 3BQUA 4ETYA 4G8EB 4HWEL 5DVLA 4H20H 3DBXB 1EO5A 3SBWC 5D5MB 2A1WH 2XACC 5AYUH 4AG4H 3IS1X 3IJYB 5DQ9B 5I8OL 1MLBB 2Q8AH 3RUGE 1KSRA 4F7CB 4WUUD 4AQ1B 1T5WA 4HIEB 1FPTL 5EB9A 3EDFA 5C9JA 1QVOB 3PGFH 4S11A 4N8VG 5DJZB 2EZ0D 3MROB 4KHXH 1OWRM 2FATH 5FO9A 2YZ1A 1JGLH 1T04B 4N0YL 5IR1B 1AGFB 3GEWB 3O3AB 4KMQA 1D7FA 4G7YL 3PWUB 2DMBA 3Q5TA 1OAZL 2EDLA 4YNYA 3WKML 3P9WB 4PG9A 1LQSR 3OKNA 4JQXA 4LHUB 3LRHA 2BY1A 4WHTB 4U1MB 3KPMA 1F13A 1U6AL 3HB3C 1BZ7A 1DEEB 4ODBD 5FHAL 2YPKA 3RWDA 3KR3H 3B4NA 3M17A 1QZ1A 2HH0H 1JGEB 4OB5H 3UROR 3VXMD 2NTFA 2A1WL 3TF7A 1BQLH 4OLVL 1RUMH 4YPGA 2UWEA 4Y1AD 4CGTA 3EGSA 4X6DB 2EICA 2I07A 1DL7L 2ESVD 3GMPA 3TNNB 3TEUA 5T33L 1BFTA 2Z8WC 2A0LC 3LQAC 3OKDB 2D7MA 3ULVH 4JFED 3K3QA 3O4LE 4PGDA 1YEIL 3PP4L 4MA7L 4G8GA 1QVOA 4N90D 2O5YL 3Q3GB 3B9DA 4DN3L 1U0QA 3KDMA 4YHYB 3GJFK 4FTVA 3BT2H 3MJ8A 4P49A 4N5EA 1FORH 4PJ5D 2NY1C 3ORJA 1X5ZA 4YHPA 1CR9L 2ERJC 3MBEB 4IBLT 1MELA 1C08B 1XF4A 1BM3L 3FB5B 3NABL 2C5DC 1NDMA 1UQSB 4DOHB 3V52H 3MNWB 2P45B 1U8PA 5ISZD 1C1EH 1LD9B 6FABL 3PDDA 4KFZC 5J9PB 2EDXA 5ITBL 1KFAL 5DUMH 3C5SB 4YWGH 1BREA 3PGCA 3U4AA 3HZMA 1IZJA 3T3PE 5DD3H 3KPOA 3F12A 1K4DB 1R6VA 3B6SB 2ADIB 3PHOA 4AY0A 3RGVA 3RVTD 2HRPL 4NKMA 3CVHH 3DNKA 3UAJC 4U7SA 4H5SB 1Y6KR 3O2DA 1J1OH 1IEAB 1ZLWK 5KVGH 3DX6B 4WUUB 1G7LA 5JIPA 3VG9B 2DI8A 1C5CH 3CFJA 3UO1L 2DM7A 3QNXA 4Y4KA 2APTA 4NNPH 3WDIA 5DD1H 1CD9B 4Y19E 4XAKE 4U6YB 3T4AB 1X4ZA 1A5FL 3VG0L 2VLJB 3LQMA 1P9MA 1EMTL 4PLJD 1WAAE 2NX5A 4QOKD 4KVCL 3ET9F 3VFGH 3VW3H 2AJZB 4ZOCA 2P8MA 1NGZA 2YEZA 4OAWB 2ZOLB 3GSUB 1ZWIB 2EEDA 5EU4B 2VXTL 2BCKA 1AQKH 4K23L 4E9LA 4D9QE 4PJEA 4U1KA 4WFEE 1HYRC 1DQJB 4UINH 5F9WC 4PRAA 2BHZA 4L8DB 3TCLB 4K2UL 1CG9B 1AFVH 5MI0B 3UTQB 5JORA 3DV6B 3MRKA 1BOGA 3O41A 4H1LB 2CD0A 1OSPH 1UJ3C 4KJWC 4LVNB 1PZUB 3B43A 4R7DB 5C0BB 3UJJH 4CNIB 4OZHB 5D7LA 3RL2B 4HUWB 3E8UH 1KCUL 2XRAH 1OAQH 2R4RH 4JM4H 3HUJB 4F57H 1RK0B 5L2JA 1PG7L 2VDRL 3L3HB 4PJ7A 3GDBA 3N1MC 2ICWB 3WCYA 2KH2B 4MJ6A 5JUEL 3CVHB 1AQDA 4H26B 3IXAA 4OZFG 1KNOA 1IVLA 3MLTA 1PDKA 2OM5A 1EEZA 4P46A 4ZUVA 2AV1A 4KAQL 4L8BA 3QHZL 4O4YL 1HHKA 4DKDC 5IJVB 2UZIH 4NRZB 1JMZA 3B5GA 1ZHKA 4JR9H 4OFPA 3MNZA 4OF5A 4UTAH 3SE8H 2Y9RT 4XWOD 3DJ9A 2DD8L 2X4NA 1VPOH 3DSNA 5IMLB 5C2UB 1BVZA 4NO0D 3QO1B 2NY3D 4LMQI 3RBSA 4IMKC 2OXHA 4PJBF 4KHTL 1INEH 1PY4A 4F7TA 1AIFB 5HHME 2GAZA 3RDTC 1G9NC 5HVHC 4WFFE 1M05B 1S9VB 1N6QH 5L2KA 1DQQB 5SWZB 3PWVB 3UPRA 3BEWA 1PG7H 3OKEB 5FCUL 2DBLL 2ZSVB 1EVTC 1EJ6A 5MENE 1HCFX 1KC5H 3T1WA 1YEDA 3L3GB 1HQRB 2OX5A 4Q9QL 3LRSA 3LKPA 4JRXD 2Y7QA 4JM2B 4EQ2A 2XPGA 3V6ZB 4QRPD 4L4VA 2XQBL 2VXVH 3EZJB 3RVUC 4DN4L 5EC2B 4LASH 1CDCA 3LRSB 2OTUA 4XPHH 2FSEA 3U0PA 5HJ3B 4IOFD 4NQDD 1QTYT 2AS5M 5CGYC 2AJVL 1MNUH 4QTHB 1ES0A 4PRHB 3WFDL 1TVBA 3HE7A 1X5IA 1KPRA 2R1XA 4LRIC 3HPLB 3MLZH 1R0AL 2F19L 1E6JL 1LP9F 1OD7A 3SPVB 5J3HD 2WMPA 3MV01 2FH6A 5E9DB 4N9GA 1FO0H 1NCDL 4FOMA 4MAUH 2FWOA 2J8HA 1QSEE 4K3EH 5I8KH 5IMLA 1OTUC 3DV4B 1XIWB 3PL6C 5JZ7D 1UEMA 3UTTD 2VZVA 5DRNA 1KOAA 2EIEA 4F80A 2V2TA 4EDWH 4LHUD 2X89A 4JFPB 5FF6A 5C2BL 5C0BD 4ZS7H 2E7HA 1A14L 4NZUH 3MJ6A 2OTPA 4Y4KC 1D6VL 2AXGA 2FJGA 3O2WL 4TTDD 4S1SL 2DQUL 5GGSA 4F8TA 5C07D 1BZQK 3WFHB 3B2VL 2ICWI 5EU3A 4RFEB 3L3HA 3DRTA 3IDMB 3I6LE 1J0IA 1RK0A 5L2JB 3NZHL 3U4BH 5J13C 3L95A 1CFNA 5KW9L 3S88L 1CQYA 1T22B 4WTXA 2V9RA 1R3IH 3KHOA 1OARH 2H6PA 3OBAA 3MQIA 1I8LC 2FSEB 3B5TA 1WBXA 4JFEB 3W39A 5CGYD 5C0EA 4YAQA 4XC1L 4M5YH 1LDSA 1F11B 1QP1A 4ZSOB 5MERB 2W0PA 4XMPL 4HPOL 3HMXA 3QI9C 5I8KL 2A0LD 1RY7B 2LU4A 2XZZA 4JHZA 5D2NE 4EI6A 1JWMA 1SEBB 4MXVF 2QHLA 2WBJD 3EDEA 3FQWB 3LD8B 4G42A 1KENL 4G7VL 2X4OA 2ARJA 1GGIL 3M1BA 4WENB 2CKNA 2NW3B 3GB7B 5D7SL 3AS0A 1LK3H 4HG4J 3I50L 3ULUF 3GSRA 2DQEH 2YC1B 4HIIB 4XZUA 5FXCH 2H9GA 5GRVL 4U6XB 3SGKC 3JWDC 4NCDA 4L3EE 5GS0D 3IFOB 4Q6IB 4CMMB 4LLVB 3LKRA 1T1YB 4LARH 3MGOA 3GHEH 4OLEA 4IJ3B 1QFWL 4LDOB 2FWOB 1PZ5A 1YYMH 5ALCL 3EJZD 4LBEA 4UU9A 4K55A 4P59L 1T7ZA 3QA3A 4Y89A 2GJJA 3OKMA 4MQTB 4YK4B 4G9FB 3HKFA 4LCUA 2X42A 4RMRA 1BEYH 1FL3B 5DJXB 3HE7B 1W0VB 2NX5D 3BP5A 4HT1L 4QOKA 5JIIA 3U0WH 3WJJC 3FZUD 3MOBL 3QIUB 2IH1A 4OQTH 4IRJC 3TZVB 2MOVA 5AZ2H 1VESA 3CZJA 1EEYB 3P0YH 4CMHB 2M2DA 3U2SA 3VG9C 4UV7H 1XGYL 5C9KA 5E2VH 3GHBL 2OK0H 1AXSB 3V4PH 2HRLA 4ODSH 1AJ7H 1MCSA 2YD5A 1AE6H 1ZOXA 1TVDA 5D7JA 5IFHH 1T0MB 4D8PA 4PD4J 3QG7L 2X4RA 3CDCA 4P2QD 2FX8L 1OCWH 5I8OH 3U7YH 3TV3L 1G7QB 4P4KA 3T2PA 2AEQH 1ZLUH 4LLYB 4QXTA 3T77A 3VWKA 3QEQD 5EOQL 3QQ9C 5BO1L 4YXHH 4RX4A 3ZDYE 1CD1A 2AJUL 1JYVA 4IM8A 5DHVB 4LCCC 4U2ZA 5BZDA 2OI9C 1ZSDA 2WIMA 4Z7OF 4U1SA 4Z78B 3PWJB 1WBZA 4ZPVA 3OKMB 1BF2A 3ZE0F 2N7BA 3PP3K 4NO5A 1M4KA 4NO0B 3I75B 3C8HA 1FBIL 4HAGA 3MLXL 1L9MA 1YZZA 1EZVY 3FFDA 3BEVB 1IEBB 5KSUB 4LDLB 3J7HA 2PYEB 3P0YL 2WBJB 5DK3A 5BRZE 5GRJL 3HMXL 4OQ1A 1ZT7A 1NFKA 2OJZL 1FV1B 3CFDA 1GPOH 1AXSA 3IKKA 3TN0A 1T66D 2OS7A 4X6DE 1JZ5A 3NTCL 1LO5B 2CGRH 2BMKB 3HNVL 1YYML 1ACZA 3PGDA 1S7QA 4MD4B 4MXQD 5DC0A 1JBJA 2GY7B 2J8UF 1K2DA 2OSLB 3C2AH 3HUJE 4MLSA 5E00B 3VA6A 1VGKB 1ITCA 1X5YA 4AYFA 3HE7D 4JZNB 5DJDB 5GGQL 2IH3A 4Z0XA 3F5WB 1IMHC 1MFCL 3C5ZB 1I1AA 1F4YH 1K5NA 3RIAK 4H8WH 5F96H 3DOSA 4LGPB 5J6GB 4N1HB 2YPLA 5BQ7B 2ATKB 1JYNA 1SMAA 3OKOB 4DVRH 2P42B 2HTKD 4JG1H 3SQOL 3LEVL 4IMLB 1EK3A 4LHUA 3H9SA 4N1CA 1H5BC 3U1SH 1DUZA 1AQDB 4MMZC 2DIAA 1D3CA 3NIDE 3RVXC 3LOWA 4MXWH 4RQQA 4KZDL 3VGEA 5CWSA 2LVCA 4HDIA 2UZYB 1RK1B 3FL7A 4KQ4L 4AL8L 4QRPB 4O51A 2V5MA 2BNRE 3WNMA 4MQ7B 3T0BA 3MROA 3MV7E 5D5MF 4JQVA 3MJ9A 4R7DA 2AEIT 3ALXA 2AGJL 3K80A 3BZ4B 4JRXE 5EN2B 1MCJA 3MRCB 1FLTX 2CKBB 4NQDB 5KG9A 5ABDE 2IAND 2P8PB 2IWGA 2ZNWA 1A5FH 4HKZB 4MYWB 3X12A 1CFTB 5KTEL 4OZIF 4CBPA 1KIRA 2P49B 4MWFA 1GHFL 5CZVH 3C08L 3MLSH 2AW2A 5CHNA 4JGUA 1FGNL 1J18A 2IPTH 3B9VA 4ZDHB 3VH8A 4K7PY 4URTB 1YUHA 3LD8C 1EX0A 2CDEB 3WO4B 1YNKL 4WTZG 4WW1A 5I74C 5ADPL 1VKXB 5IB4B 1OT2A 3VMOA 3BX7C 4S1DD 1BQHA 1H3WM 3QH3B 2NYYC 4GW1A 2XRAL 4M61B 4I9WE 3PDOB 4XH2A 2NY7L 3KPOB 2XTJE 2LQRA 2F54E 3QUYD 4OBSA 4OLWH 2JF1A 2ORBL 3F5WA 2WM0A 2DMKA 5IT2H 4K71B 3A6CH 4M48L 5DJ0B 4GW4A 4F9PA 5A16A 1WZKA 5DD5L 1T3FB 1MI5B 1INDL 2XWTA 4M48H 1M7IB 1OTSC 1FIEA 3HPLA 4LBEB 5E00A 1BPVA 2N4IA 1CDBA 1F4YL 2XICA 3ZSTA 3WFDH 2FRGP 5HHPA 5CUSL 3FT4B 1MNUL 3JWDH 3STZA 3BQUC 3Q3GA 1FVDB 2Y07L 4GBXC 1F3JB 5H2BA 1HHHB 1L6XA 4G9FE 4NQSB 5ACMA 4X4YB 5AG8A 1LE9A 4JHAH 4JFHE 4XBPA 1KTKE 3MFFA 3GJEB 4GKSB 4M03A 1OSZA 3SGJA 3FQNA 2EXYC 3IXTB 2CMRL 4FFWC 4I3SH 4LQ1A 5CEZL 5F7HA 1XF3A 4HIJB 3SDYL 4PLNC 4JVWA 2VZUA 3ZTNH 2BVYA 3EYVB 2DLEA 3QUKA 4KK6C 3U0TA 5L6YH 3MSPA 1P5UA 5DRWB 3QUYA 1QLFB 5SWZA 3UYPA 4R3SB 2VABA 1T2XA 3CFEA 5GS0L 2DQCL 1C5CL 1A9EB 1GGBH 4NM8L 1MCHA 3HG1E 4IOFC 3BAEH 1IT9L 1BECA 3QG6B 4NZRL 4QRUB 5FAAA 3WE6B 3ARDA 3L3IB 1EEQA 3OR6A 3B2VH 4OQTA 3QR2A 4OV5B 4GO6B 3V4VH 5C0AE 1LE5B 1CD1B 3HFMH 3NA4A 2DD8H 5IBUG 4OI8A 5EBLA 1PBYA 4I2XE 4QGTA 1JV5A 4YR6A 2VDMH 5CSZB 5K9OB 3NPSB 1GC1L 4RZCA 4UUJB 2YN3A 2NTSP 3S4SB 5F6IB 3O2DL 4EN3B 5BZWA 5IIEB 3SKOB 1IILE 3WNKA 1LDPH 4U6HB 4KV5E 5JHDB 5BW7C 1J0KA 1CI5A 3X11A 4I0PB 1UVQB 4HIIA 2YC1A 3DUUB 1ZGLB 3OXSA 3VDCA 3GK8L 5C0BA 4CNIA 2EC9T 1SYSB 4G6KL 4PJIE 2X4UB 3DBXA 1MVUB 2KPNA 1NAKH 4YBQD 5GRWA 1TPXC 5D2NC 5EBMB 5DRWA 3E6HB 4HS6B 1JNNL 1IM9A 3FQRB 4P2QB 4ZPTB 3B9EA 4KI5C 4TUOA 5C07A 3WIHH 1FYTE 2SEBB 5MP6L 4R7NB 2FZ3A 5LKNA 3P0VH 5SWSD 4NRXB 4P2RA 4V1DD 1VEMA 3AY4C 1A47A 1Q72L 1IGIL 3MGTB 4JY5L 2ARJQ 1JPST 1SBBA 5D6DA 1PYWA 4XC1H 1S7RB 4W4OA 4JFFB 2B4CL 2HN7A 5LGJA 1IKFL 4MVBD 3LKRB 4MJ4A 5C08A 5CILL 5T1DL 1MIEH 1BEYL 5CGTA 3WNPA 4Y1AE 3DURB 4QWWC 2YBRA 5CJOH 2APBA 2FX7L 3G04B 3DI3B 4PJBB 2A77H 1T03L 4QHLB 3FO2A 3LKPB 3VCLA 1UC6A 1I85C 2VDLH 5GGTL 5DEZA 3TO4D 3SE4A 3P9MB 4G8GE 1BZ9B 1S8DB 1DQQA 1T83C 3D3VB 2DM2A 3BP4B 1IL1A 1SEBA 1FCGA 3O4LB 4Q2ZB 2F8XC 1MAML 1E6OH 3KYAA 4JFPA 4QLRA 4M61A 3E1F1 5A40E 2N56A 1R3KA 1EFXA 1MHCA 2WBWB 2WIIB 1DR9A 3PIQA 5LWYL 2ZKHL 1RURL 4OLUL 3Q48A 5AAWA 5JQHC 1QRKA 2OJEB 4XHQA 2MMXA 4KJPC 1MFAH 1A7NH 1MUJA 3KYMA 4UB0H 4Y5XA 3BZEB 1FNAA 1JGUL 5DJDA 4PYGA 1PQZB 3ARDB 5C0CA 2FBJL 4G8GB 2HJLA 1QRNB 5HYJB 4UTBH 1W0YT 4NHCH 4X8JA 1CTNA 4ODUA 1TVBB 4HPOH 4PB9H 4XMLH 1ES0B 3QIWA 5C92A 1U8KA 4KXZI 4NPYA 5FB8B 2EDQA 2E5EA 3MA7A 5F70A 1HSBB 3TBVA 2JE8A 4MMXC 3K8LA 3C6SA 3X17A 4KRMB 3T2QA 1EV2E 4JN2B 3M07A 2X7LA 5DI8A 4G9DB 5TF0A 1OL0A 1YDPB 4J2XA 3V4UL 1L7TL 1X5GA 1BVLA 1NDGB 3QI9D 2H45A 2YKLH 2YA2A 2DKMA 1ADQL 3FQTB 4PLKC 3NH7H 3GIVB 3BWAA 1CFQB 5TQ0L 1ZGLA 1T1WB 3H3BC 3PABA 4LEOA 3WFBH 1AE6L 1KXVC 4PRBB 1U6AH 2WBJA 1IL1B 4KZEL 4P5TA 1MCQA 3P4MB 1S9WB 5DD6A 4EIZC 3V5KA 5JXAL 1EA9C 4IRZL 5D7KE 1JHLL 3W81A 3ZHDA 1CICB 1W0WA 5FYKH 4L3CB 1FDLH 3P4NB 4FQ2L 4N9OB 5BOPA 1IGTB 3LEYH 3A6OA 5E6ZA 4GW4B 5A16B 1QFWH 5E2UH 1B4JH 1J7VR 3QUMH 3TZVC 4WVRA 3MGOB 1F2XK 3L5XL 4U6YA 5DFTA 5B21A 4TPRL 4JFFD 2IANB 2KUTA 1XZ0A 3RZCA 2YRLA 2VLKE 3RI5K 3IFLH 4O5LL 3U6RB 2HN7B 3QUYC 7FABH 1P1ZB 5DDHB 5LGJB 2ZJSL 1S7RA 2MFNA 4NQCD 2JELH 5DWUH 4P48A 4KK8C 4ZQKA 5KVFL 3ARZA 1L7IH 3EFDH 4PPTA 4GAYA 3OKKB 5FUOL 2DQGH 4XCFH 4APQC 5M95B 1KB5H 2CDEA 5IQ9B 5GGUA 3QHFH 3H7LA 3JTSA 5ALBL 4TYUA 2OR8A 3FQWA 4P4RB 1JWMB 4JQIL 5E5RB 4GXVH 3ESUF 4HWUA 4YUEL 3TN0D 3I9GH 4JB9H 4KI5E 4NN6C 2BMKA 2PETA 5INDA 1T0PB 1RURH 2X4UA 3T0AA 3DHJA 3WXVL 4WHYH 4G43B 4LHUG 2ADGA 3IDXL 1LK2A 4JM2D 1UACL 2EZ0C 4NQEA 3L3JA 2A2QT 3OG4B 2GFBB 5HHVL 2NY0C 1GRWA 1NC4B 1WC7A 3LCYA 3BP5B 1FLRL 4ONFL 1YMHA 4UOW1 2EDBA 1GH7A 4Y5YC 4YH6A 4ZFFB 4R97B 2JK5A 4NBXB 4L8CB 4GRLA 4M7LL 4OIIL 1CXKA 1PAMA 2GJ6E 1MI5D 3GBLA 5HXMA 2C3HA 4M5ZH 2FIKA 4ONGH 3DXAE 5SX5H 3FFCA 1A2YA 1YJDH 4Q9RH 4HKBB 2I9LB 3QQ3B 3FO0H 3QEUB 3QNXB 4Y4KB 3CVIH 4NJAH 4E41E 2HLFC 3RU8H 4LP5A 4P2YA 3S3JA 3RAJL 4NOFA 1H3UA 2E7MA 3GMMB 2XY2A 2XTLA 3FB8B 5TQ0H 3VD9A 5IKCB 3RWDB 3T08A 3GKWL 4DFHA 4WJ5A 4X9IA 4Y5VB 5GZOD 4WW2C 4D0CA 3MA9H 4OUOA 4Z8FL 1RZKC 2C3WA 4BK5A 4FP8L 3SDAC 4WHTA 3ULVF 1G6RA 1FIGL 2M8XA 2VLKB 2ADJB 4L8DA 3AMLA 3TCLA 3RWCA 4QWWD 2ZUUA 3SO3B 1OTUD 2LTQC 3HS0B 3RTQB 5HHVH 3G6JF 5BMFL 4LHQB 1ITBB 3NPSC 4L5FH 1HHIA 4XCYB 5CEZD 3WHE0 3T0VA 3BVNA 25C8L 2XKNB 4XXDA 2I9TA 3MCKA 1XGPB 1D5ZA 1B3JA 5F6IC 3SY0A 4DN3H 2HG5B 5C0JB 2H6PB 1RZFL 3JWNC 1T83A 4HHAA 5IT2L 2IANA 3SE9L 4EZMA 3CFJB 3OSKA 1IAIL 2JCCA 4WI2A 1XGPA 5GZNC 3VXNA 1M6OB 3F7RA 1P6AB 3AB0B 1VADA 5ETUB 3VE0A 5I2IA 4BELD 1XF5A 3QWOA 1MWAA 2C3GA 1QLEH 3MYJB 1A6VH 1M7DB 2JJTC 2VB5A 4D9LH 5I30L 4PJGB 1WJ3A 3NVQA 1KIPA 1FZMB 4JPVH 3V8OA 1X5JA 5I17B 4R97C 5IB3B 3BEWB 4FP8H 2NY1D 1YECL 4XPAH 4RQQB 4U3XA 3BJ91 1WK0A 2YMXL 1BQUA 1SBSH 4XH2B 3EO9L 1RU9H 4XP4L 2HA1A 2HRPH 1UQSA 2YPLD 3D3VD 1BZ7B 1DEEA 3HNVH 3FO1A 4OCNC 1KC5L 3QNYA 5D1XA 5K33A 5FCUH 4Y19D 1F5WA 1Q0XH 3BKML 3UPAA 3SJVA 4PFEA 4UIMA 2RB8A 2NY4D 4XX1E 2PTUA 4X7EC 5IV2A 4GH7B 5A2JH 1JTPA 3CH1B 1R5WA 43C9B 4NDMB 1S7VA 5MEOB 4CU6A 2DQIH 4ODXA 4QRTB 4WFHE 5CEYB 5E5MB 1KTLA 4CMHC 4OM0L 3DVNA 2QSCH 4RGMC 2QQKH 3RU8L 5KTEH 5F1OB 3T1FB 5H8DA 4QHNB 1CDIA 2B0SH 1DVFB 4GSDL 2P8PA 4K3DH 5EIIB 4GRMA 1RUAH 1NBZB 3IGAB 5EU6A 4ZXBD 1DSFH 4JVPA 4EQ3A 1T1ZA 5J06A 5EO1B 4KXZH 3GSWA 1IKNA 4PV9B 1WBYB 3TZVD 5K9KB 1V05A 4FQQA 2HKFH 1OLLA 1YEDB 1VFAB 3O3BB 4NWUH 1IBGL 3LN4B 1A6PA 1D5IH 2VABB 1EGJL 5I9QC 5L0QB 1CLYL 1SJEB 5D93C 4OV6F 3WD5H 3VXSB 3BP4A 3G5YA 1JFQH 2GK0A 3QDME 5IW6B 1E28A 3VXMB 4D0BA 3VXUA 4I48B 3ARPA 1JL8A 1TZHA 5D7IF 3MRGB 3QQ4B 1ZA3A 2IAMC 1TTGA 5BVPL 1G0DA 1N6VA 5IOPA 3CFKA 3TJHD 1TETH 1CGTA 4PV8A 3LKQB 1PEWA 1OP5H 3QO0A 1ZHBA 4CU8A 1JYXA 4MQXC 5E7FA 2NXZD 4OZFH 2QL1A 3MMEB 5E03A 1FL5A 2UY7A 3NN8A 4LIQL 3VXSE 1MF2L 1YN7A 4JZJC 3DX8B 4U6VH 1KACB 5D2NB 3MNZB 5FM8A 4OZHE 5BRZB 3KPPB 1GC1H 4CJ0A 4BSWA 2IGFL 3EKCA 3T3MF 3CFBB 5CKGA 4V2BA 3BIKB 3ARSA 2NQCA 4NRXA 4UQ3B 4F37F 2X44D 5ERWB 1TJIH 4X83A 4NC1C 4MJ2A 3RRQA 3O9WA 2YXFA 3S35L 4LPCA 4E41D 2GJZB 5GHWL 4PR5B 4HWZB 5D6DC 3RVUD 1T0MA 1U3ZA 1M7DA 2BERA 2YA1A 3BWAB 4A6YA 1S7XA 4TQEL 5EO9A 2CDFA 4W68A 3MFFB 4H1LH 4Z7UE 3TN0B 3MZTA 3G9VA 4W6YB 1CK0L 4I2XB 3KLSA 4IRJD 4S1RL 5ESAA 3KHQA 4JKLA 2DLHA 5EH1A 1KCRL 4NQED 1I3RA 3HI5H 2DQEL 2MKWA 1IAII 4LSRL 2E27L 1GGCH 5CINH 1QSFB 4L9LA 4XVUC 5JW4Q 5CP3A 1U8HA 1VENA 3AUVA 1U95B 2Q7NA 3QAZB 4OCSL 1IC4L 2IPKB 5F9OH 1WTLA 5K9OA 5F1IA 4LSQH 5I71B 3FJTA 2IPUK 1GIGL 3MLUL 4NDMA 3SDAA 3TNMB 4ZPVB 2ZOKA 1BIHA 1T7YA 4XXCA 2ICWJ 4OZFB 2UWEE 1XCQA 4QYOA 2DLIA 4M1CD 1KIQA 3EFFA 3ULVL 1N7ML 4XMLL 4Y4KD 4W6XB 4KTYA 5FUCC 5K9QI 2I60H 1NCBL 4NYLA 2QQQA 3AS3A 1A7OH 1JIBA 1RZGB 4JJHA 5IKCA 4JZJA 4JDVA 1AXTH 3O4LA 1YC7A 1KIQB 1LO4H 4F33A 3VXTA 3Q6GL 4TSBH 3OHXA 5A2IH 4MHHG 1NFDF 2OBGA 2RCSL 3QFJB 1CLCA 4HIJA 2LE9A 1YNTB 4OGYL 1UH3A 2O26U 4PRID 2VZSA 1IRAY 4KROC 2PNDA 3BGFC 1MAMH 2AJ3A 5FYJD 4ODSL 5E94A 4PRHA 1A9BB 1WZLA 3H0TA 1GOHA 4M6OH 4WNQA 2XKUA 3C60C 5E99L 1ZE3C 2DIJA 5T1MA 1IGYA 1S9KC 4PUBL 3LKNA 5D71L 5DJ8B 3SY0B 4I0KA 2F54B 2WV3A 2IG2L 5GJTH 1ZGLM 3FO9B 4HIXL 3ARTA 2W1NA 4FFYH 1G7JB 3C09B 3I2CH 1YQ2A 2NY3B 3T2NL 4JG0H 4EN3C 1H3XA 2ZOLA 2R8SH 3MV7A 1A7OL 1EFQA 3FQXA 3O11A 2YD1A 4X0KB 3EOTL 4E41B 2ZUXA 1TTFA 3TFKD 4GRWF 1CTOA 5SWZD 1ADQH 3SKMA 4JFEE 5AWNH 4L29B 3MGAA 2PUQT 4FNLH 3ZT5A 3LKSA 2AK4E 4N0CC 3FO2B 4WI7A 2GJ6B 4K8RD 1BJ1H 5DVOA 5ALBH 3ULVD 3ES6A 1WIOA 4IRJB 2YD8A 4P9HC 2YPLB 4DUVA 3O0RH 4NWTH 5FO8A 2VLJE 4Z76B 5D96C 1CGWA 1MWAL 1V7NL 4O2CB 4LAJH 1U8OB 4HKJA 2Q86B 2DB8A 2I27N 2R29L 5DR5L 1PD6A 1RZ7H 2MCPL 1NH6A 4LGRB 5IWLA 4PGZA 1U8NB 3T4YB 2YRZA 1LP9A 4PJCA 4WUKL 2CUIA 4NN6B 4KDWA 2EKSB 1RFDH 4H88H 1G7IB 5INCB 3T0ED 1VADB 5ETUA 3VE0B 2FZ3B 2VQTA 4HH9B 1IC5H 4M1GL 2BJMH 3EHBC 1MH5A 1F6AB 3F8UB 1DVFC 1UA6H 4NQCA 1PX3A 3MACL 2PW2A 3BW9B 2C26A 2F54A 3W39B 3RHWF 4AEIH 2VXUH 1P5VA 4GAGH 2Y06L 1IAOA 2CUMA 3B9KD 3SGDI 2IALB 3D69A 5E9DE 2FEEI 4BSVB 1XGYH 4HGWB 3MRRB 3UC0H 1OTSD 2P5EA 5I1LA 3ARBC 1OAZH 1HH6B 2OJZH 4R26H 4HFWB 8FABB 5IFAL 4D8PB 4FQHA 4OGZA 1YQVL 3BE1H 1UM4L 3WBDA 1QEWB 2ZSVA 4WUUE 4LSVH 1HH9B 3MXWL 4LAQL 1N59B 4MD0A 4J3TA 4M6OL 3JWOL 3VXPA 5JXAH 4ZFOB 3CLFH 3SKNB 4LP4A 4JKPL 4G6JL 4LSUH 4H1LG 4K94L 4MXQC 2I25N 4Y5VA 1OAQL 1S7VB 3ZE1E 4ERSL 4JJ5B 3W0WE 3NFSL 1ZVSA 4KI5F 3L3KB 5JW3L 3HPJB 3L3OB 4UAOC 2ZPKH 4F7EB 4LEXL 3BSZH 1V7ML 4J6RL 3LN5A 4JKMA 3BPNB 3QEUA 1KYOJ 2R4SH 1U3HB 3U83A 1YN6B 2G5RA 4LASL 3OJVC 3KYNA 3BN9C 2OTWA 3HC0A 5LAXA 3S36X 2RBLA 2WW8A 4OF8A 5FO9B 3ZE1F 4CVXB 4POYA 1DVFD 4XAWL 4HWBL 3N1FC 5FOBA 3L3DB 1LNUB 2B5IC 1UM5L 3CAFA 1RSFA 1L6ZA 4YQXH 1IQDB 4HZLB 1W8OA 2PCPA 4HC1A 4WHYG 3IB4A 2AXFA 1WV7T 3PXJA 3RNKB 5DRZA 3IXTA 3V6OA 4AMKL 4D9QD 1CD0A 1I8IB 4YZFF 4XNUH 4M02A 4KJPD 2X70A 1T2QH 3JVGA 3MA9L 5TE6H 4HX1A 5B22A 1MHPH 2YPVH 4EUPH 5J3HC 4NUJB 4N1EA 2LU7A 1YUHB 3QUMA 4WFHD 4ETQB 4Z77A 5CD5D 1MHEB 3BFOA 2J8OA 3QWQB 2P7TB 4P3WA 1TMCA 3H3KA 3PWVA 3RWGB 3F7YA 4KQ3H 5IMKA 3P4LA 1PFCA 1ONQB 3DO3A 1FH5H 2I07B 4KK5D 5C0BE 1KG0B 3VH8G 3I3EA 4NGHL 4XNQA 3BD5A 5SWSA 1U92B 4F7EA 2DQIL 1QSZA 4NUGH 5FA3A 4JRYD 1I9IL 3U9PH 4TUJB 9CGTA 1NSNH 3OAYH 4QXGL 3E2HA 1XZ0B 1J0ZA 1VPOL 3BT2L 5IVXE 4Z7WB 2QKIA 3H9HA 1EAJA 5I30H 4PG2C 4QTIH 2BOCB 2HVKB 4MB3A 4Z9KB 2CIKB 4B0MM 1AY1L 2YXMA 5HDBF 3MLWH 3HE6C 3WFCL 2IEPA 3PUCA 1T2QL 5GRXG 3M1BB 4K3EL 2H41A 1IAKB 2EIDA 5CS7A 1TCMA 3U9UA 1N0LA 3QXAB 3NFPA 3QISA 4DGIL 5EORH 3PV6A 2G2RA 4J1UA 1MVFA 5ISZA 2R4RL 1NAMH 5KANI 3QJFB 1NFDA 3BD3A 4ZUSB 3ECBB 3MRBB 1IKNC 5ID1A 4P23D 1MRFH 4QXUL 4Q9QH 3A6BL 1E4XI 3MRNB 1NC4A 2JIXD 3JUZA 4MQSB 1MY7A 3O3UN 1S9YB 3MGTA 4OTXH 5HYFA 4PJ8A 5DD1L 3QEHB 4X5XA 5DJ8A 3GRWH 4XP9H 4KKBC 4UNUA 3ARDD 2XWJA 4QXGH 4X7SL 3QPXH 5BS0B 3BUYA 3IU4H 5JLZB 5MEQA 2EKSA 1UWXH 4DKFH 5T5FL 1AQKL 2PXYC 3VI3F 3WV0A 2K7PA 4OLUH 4FFVD 1U8KB 4P3CL 2PKDA 3C2SA 3RKPA 1AC0A 5EC1B 4BZ1H 1BFOB 1A3LL 1OTTC 3MLSL 4HCRH 4CL7A 3L5JA 2XZAH 5DJ6B 1RD6A 1F4WH 4HUKB 2FNBA 2PYED 4F3FA 2I26N 5DUML 3GSNB 1MCOL 4HAFA 4WI5A 4YDLB 2DWEB 2YA0A 2ZUWA 3QI9B 2NZ9D 4U6XA 1RUPL 5HYQA 1ORQA 3HNSH 4ELMA 5JW4M 4YFLI 1EAPA 1MCRA 3FHQA 4D3CH 1KJ2A 5JA9A 2QEJA 3ZYOA 1KEGH 2VC2L 5FFLA 4KK8D 4RGMB 3RY4A 4U1LA 1UB5A 2EDNA 2VRAA 4IIQA 4G6AC 2J12B 4S1DC 4QO1A 3I3DA 4WI8A 4L3CA 3EO1B 4IRSA 1JUFA 3WO4C 2VDOH 4WHDA 3G5ZA 5F1IB 3BN3B 1I7UB 2VL5B 3KXFB 5IUSA 5HBBA 3ARBD 3IDIA 4FTVD 4KV5F 3FO9A 5DHVA 4L1HA 4U1GC 3MRHB 3BMWA 2X40A 3KJ4C 5C08B 2WWKT 4RRPG 5DMGC 3WLBB 1TZIB 1I9EA 4Z18A 5B38B 5IVNA 4QY8B 4NKIL 2APVA 5IWLC 3P11L 1AGCB 2MPAL 4PJ5B 2A73B 2X4TA 5IBLC 3O6FB 1J0YA 3MLWL 43CAA 1A7RL 2C3VB 1JTOA 3SEPA 3TT3H 3KJ4B 4X4ZA 3H9YA 4LL9A 5EORL 4LRNH 2V5RA 4RMWA 5GRUL 2FJGB 4ZXBC 5AAMA 5LQBH 1RZ8A 3RPKA 3TESA 5L2KB 3JV4A 4UQ2A 5I76B 4PRIE 2VE6A 5GGTH 1IARB 1QBMH 1X5KA 3LPGA 3NCJL 5DK2A 1ZS8A 1DLFH 3IRZA 3EYQC 4K3JH 3WLWC 3AROA 4MX7B 4JCLA 3QNZB 1F97A 4RAVB 5CJQL 3BZEA 1S7SB 5C0ND 3W2DL 5D1ZA 1NC4D 3E2HC 3S34H 4CVZB 4WO4A 3SE8L 1ZVSB 1TJGH 2MSPA 3MBEC 3MRBA 1GXEA 1WVZA 5BS0D 2XWTB 5F44A 3KYOB 5KVDL 4JO2H 3QDJE 1AP2A 1G1YA 4LLDB 3SGJC 2BDNL 3GO1L 5TQ2L 2C4FU 1ZVHA 2W9LA 4YHOH 4K94C 3ILPA 1NPUA 1HZHL 4DWHA 1V3KA 1MIEL 3QEQE 3RTQC 4FQHB 4LPYA 2FJHB 3B9KB 3TO4C 5B39A 4I18A 4KJQC 1YEGL 3PP4H 3T0DA 4XPFH 2GJ6A 3DYMA 3OKOA 5DQDH 3F7VB 3ARRA 4I5BA 3SKJH 3VRJA 4EBQH 1JPFA 1NKRA 3CCHA 1VFAA 3NCJH 4Q74A 3JSSA 5IQ7H 2ICES 5EZLA 4TVSa 5INDB 2YUZA 4H1LA 4R4FL 3V4UH 1NCCL 3MODL 4E41A 3TH3T 2V7NA 4X7FC 4I4WA 1ZKAA 3CX5J 3UTTA 4U0QB 4HQQL 2XA8H 1CCZA 2PXYD 3JTSB 2DLFH 5IFJB 2OQJA 2J4WH 4WI4A 1U93A 3AB0C 1QNZH 2BNQD 32C2B 4P5TD 5IMKB 3D1MC 5JR1H 3UP1A 1H3PH 4MD4A 3IJSA 4EEEA 5J11B 3ZSSA 1A1OB 1YPZA 4YAQB 2FGWL 4LCWA 1SEQH 1NAMA 3IJHA 3T0EE 1CXHA 1MCIA 1OAXL 3DX9B 3ARBA 1NCAH 1MEXL 1YN7B 4G5ZL 2Z0BA 5E8NA 4OM1H 2WBJC 1CVRA 2B1HH 3QP3A 4FXKA 1XR9B 3QUML 2W92A 4DOHE 3BDYH 2VR5A 3N50A 2Z93B 1GJIA 3EOTH 1JGLL 2A77L 2HFFA 3DPBA 3VFUB 3EIFA 3RA7L 5DRZB 1ZT7B 3INUL 2BSSA 4PY7B 4XP6H 1ZANL 4F7PB 2W65B 5ITFB 4UV7L 2RIKA 4LOUD 2FLBT 1JGEA 4FFEX 1VACA 2X05A 3MREB 4OGAC 3WKNA 4ELKB 3D9AH 4WI9A 4WV1C 2D3VA 2VDNH 1BQHB 1KEML 1X6LA 3FQTA 4MB5A 5E99H 1QO3A 4IRZH 3MRJA 3S34L 4Y19B 5KVEL 1UEYA 4WCYL 4LCWD 4XNQB 3NAAL 2VAAB 3FN0L 5D1XD 2NY4B 1FNEB 1GZQB 4N8VA 2EDRA 2H32A 2R29H 4K3HA 1KCUH 1JGDA 1UACH 5ALCH 4GBXA 1FNGB 1HIML 2MKLC 4PGDB 1UJ3A 2P8MB 2KDGA 3SKNA 3W11D 1IC5L 4M1GH 1U95A 1FVEB 4M7LH 4OIIH 5CZXD 1SY6A 2NR6C 4XCYA 4JQVC 4BZ2L 4GBXB 4HMEA 4P23C 5IHZB 5E9DD 2VITA 3FB6B 3UTSB 3X14A 5I8EB 5FUZH 2FECL 1ZHLA 1P84J 3RKDD 2WUBL 3AS2A 4B50A 1BLNA 4EN3D 1ND0A 4ODVL 3LVEA 1X7QA 1CDUA 2IFFH 5J11C 1OAUH 1FO0B 1RZGA 4OZIE 1IAOB 1OP3H 4F58L 2V2TB 2VAJA 5EPMA 4M00A 1R3LB 2WBKA 3RX5A 4RMSA 5IBTH 3HC4H 1HOCA 1ORSB 4JDTH 2FL5B 2LFGA 5EZIL 3D0VB 1S5HB 5GSVA 4YEFA 4F15B 2PXYB 1T80A 2GTWB 5JHLL 1T3FA 5D71H 4ERSH 1DBJH 3NCYP 4FQ2H 4IMLA 5AEAA 5KSBB 4K94H 1S5HA 3UTOA 2EDHA 3TA3B 4NIKB 4HG4K 3BKMH 3FT2A 4JCMA 1BJMA 1QSFA 3RVWC 3I2CL 4EVNA 3FN9A 1KCSL 3MUJA 1PKOA 4IS6B 1YMMD 3ARBB 1OB1B 5AUMB 4ONGL 5SWZE 1Z6JT 2EECA 1YPZF 3FHAA 4XTRC 3RWHB 3DGGB 2R69L 4HIEA 3EYQD 1QACA 4UDUB 4HUVB 4LCYA 5H37H 4JN1H 4BQCA 4XXDB 4QRSA 2QR0A 4NQTA 3OB8A 2DM4A 2W60A 1QQDB 3KLAB 3DX7B 1UCTA 3CFIC 4HD9A 2MQ3A 1A4KB 4POZD 2GHWB 4HLZH 4J8RB 3M45A 1G9NH 3I85A 1P7QB 3VXSA 4ORGB 3CMOL 1RUKL 2ZG3A 2Q6WB 4K9EL 2Z91B 3NABH 3U2SB 4OZHA 5HVFB 5HVWA 5MHSD 1T5XB 3U1SL 1NCUA 1A8JH 3LQZB 2EO9A 1XF1A 5L8KB 4N5EC 1DDHB 1DFBH 1INQB 3CFDB 3BZFB 4AL8H 3QZWA 2E7LE 1FV1A 5AYQA 2CH8A 3MRJB 3D25A 1U3YA 4OSUL 2VIRA 2O61B 4FABH 3QB7C 3VD4A 3UBXG 4WW2B 25C8H 3RZCB 3DMMA 4X9HA 4Q97A 4XCNB 1LMKA 4PJDF 3H0TB 4X4ME 5KOVC 2DJ4A 2VDPH 3T4YA 2CLZB 1WISA 3PV6B 4PJCF 5GGQH 5A43C 5KSBA 1J1PH 1YEFL 4OD1L 5TPWL 4BH8B 3OJ2C 3PHQA 3A6CL 3CZFB 1OP9A 5HY9A 2P47B 2JK5B 3PV7A 4XCCL 3UTSD 1DBML 4U1SB 4Z78A 5MEPB 3QXDB 4WHCA 1FYTA 4K8RC 4NJ9H 1R3LA 4R8WL 5E7BA 4K9EH 1JF1B 3D39B 4KROB 2AQ2A 4Q9CA 5I8CA 5KSAD 2FX9L 4GSDH 4MAYB 4PJXA 2ADFH 1D5BB 5IEHB 5DFVC 1WICA 4P57B 2VE6B 1TJIL 3ZE0E 4OZGE 2XKSA 5ADPH 2D31A 2APXA 3NIDF 5D72L 5CJBA 4K7FB 2CR3A 3U0TB 1IFHL 3GBMH 1P7QA 1FZMA 4P4RA 1D5MA 4N0FA 1U8PB 1I8MA 5ICXA 3CK0H 3TJEH 4P9HL 1KCLA 5AD0A 1JK8B 4GKSA 1JN6B 3Q6GH 1KJVB 5CEXA 5GS0H 5DZLA 4NZUL 1MJUH 1JGDB 4XCEA 2Q20A 1O7SA 3S37X 1PQZA 4O4YH 3B8SA 4KPHH 1LO2L 1ZK9A 1HSAB 3SCMA 4RFOL 4ZFGL 1RZJC 2D7QA 1G1CA 5IK3A 2IQ9L 3VFOB 3UJIL 3PG2A 5B39B 2QHRH 4IRSB 3U36A 1NMCC 5L9DH 4FXGA 4O2EA 5GS0C 3QCUH 1A6VL 4D9LL 1UYWH 2AEPH 3TBTB 1R0AH 1LNUA 4M1DH 3WYRA 1ERNA 1BZ9A 1S8DA 4UAOB 4P9ML 2DL9A 4N8CH 2EDTA 2AI0L 2F9BT 4MZ2A 3V6FB 1U3HC 2F58H 5DF0A 1NDMB 2FHCA 2B2XL 1JRHL 3KPSD 3MBEA 3L9RB 3K2MC 1LDPL 2VKXA 2LAGB 5IB4A 4XZUB 3O6FC 5HYJE 3O3EB 2F15A 5CGMA 3P4OB 2B5IB 4LRIA 4R2GD 4Z7QE 1SJHA 5D8JL 1Q94B 3TH2T 4HHAB 3FQUB 3F7PC 2X9YA 1XGRB 4KUZL 1I4FB 4LCWB 4PJ5E 4XGZA 3GUTB 2DDQL 2UWEF 5B3JF 4FFZL 4RAUB 4E0RA 3UX9B 1UJ3B 1L0QA 4N90E 5EDXA 5F7DA 2G5BB 4U0RC 4ZO8A 1HHIB 1KNOB 2R15A 4X8JB 4HPYH 2DQJH 3V4VL 2AABH 4C4KO 3AGVA 3FOMA 4JKKA 2KKQA 1K8IB 3MUGB 2DLTA 2CDGA 2IPTL 1A3RH 2H2SC 5IGXL 4JFDA 1I7RB 4L1DA 4PDCE 1AD0B 1CGSL 4MAYD 2QV2A 3W11C 2AI0H 5D70L 4PJAF 3E8UL 4KRNA 3TJHC 5GGTA 5C2BH 4AEIL 3S9DB 1Q9OB 4POUB 3S6CA 3FFCD 4G3YL 2JB6B 4NQCE 2X5PA 4CN1A 2EYSA 3IKCB 4ODTH 3HI6H 5C6WH 5ICZA 3IU3B 3V95A 2CPCA 5B4MC 2CKBH 1KTLB 1S7UB 4S2SA 3EYSH 3PWNA 2OP4L 1Q38A 4LFHG 1CL7L 1L8JA 4WV1B 1A6AB 1IM3A 3C9NB 5I1HL 4XCNA 1A6UL 4ZFFA 1V7NH 3QEQB 4JFFA 2DLFL 1XGUB 4GQ9L 3V2AR 5FYLE 1OPGL 1HHKB 4IDLA 4PTTB 4MQXD 1YMMB 1NGYA 1MREH 4JHWL 32C2A 4IRSD 4YBLC 3HMWL 1BIIB 1WCQA 4KKLD 3L5XH 4GXUN 1KPRB 2R1XB 5GGVH 3WL9A 1KGCE 2UZXB 1NCNA 3WS6A 3PWPA 4GUPA 2R2BB 3HCVA 5CIPB 5EPMB 3TLRA 2PO6C 3VFNA 4J8RA 5D70H 3Q6FA 1HDMB 3KPLB 1ZLVK 4RDQF 2DBLH 2AKRA 4M7KH 4OT1H 1SYSA 3O6MH 4OBRA 5CIPH 4P46C 5BCAA 3KPSB 2OCFD 3QRGH 4Q9RL 2VC2H 3UTQA 1NGPH 3BKYH 3MO1B 1FRGL 5JIHA 5C09A 2O5ZL 5JHDA 4P2OC 1H3VA 5IM7A 1JHKL 3WUZA 2V6HA 3M8OH 4XBGB 3RNQB 1KTRL 4PJ8D 3ZKXB 4UT6H 2VKWA 2BNQA 2V17L 4UV4L 3BXNA 3I3BA 3VWJC 1N26A 4GRLD 4JFXA 4YWGL 1I4FA 4NN5C 4Z7WE 4ODXB 2GK2A 4KZDH 3THML 1AO7B 4RISL 5HPMB 1AI1L 1FN4B 5DJ0A 1WBZB 2Q8AL 4PBVC 4R96B 3K8MA 2D03H 1BWWA 4BYHA 1Q1JH 3PDGA 2D7TH 4Y5YA 1R5IB 4O2FB 3BDXA 3IETB 3FB7B 2Q7YA 2R4SL 5EO0B 2GSGB 3OZ9L 4RNRB 5FDWB 4WW2F 1NCTA 1RJLB 1Y0LB 3FAWA 5E2WL 4S1QL 1OVZA 5HHXL 3VFWA 2AK1H 3G5VA 4NT6B 1YEIH 2VO5A 1WQVT 4JPWH 3QAZC 4KKBD 4N0CD 4PJ9B 5BOZG 1N59A 5KVFH 1RZKH 2WUBH 3CLEH 1T4KB 4GW5A 5F6HJ 2Q87A 2JCCE 5HGHB 5FV1L 2R9HD 3L1OL 4TRPL 5LGHL 3E6FB 2QQNH 2R0WH 5IW1A 1H15B 5H94A 2CK0L 5EWIL 5J1AB 4Z7VF 1UB6A 4LAQH 3U4EB 2V17H 4UV4H 4Z7VB 1KULA 4XT1C 3U4BL 3U7YL 4IOIB 3O4OB 4OB5L 4P3DB 1FNGA 4OLYH 1B0GB 2ED7A 4OCXH 4WW2A 3UTPD 1I3RB 3DX9A 1F00I 1EGJA 1HEZB 3CSPA 4PUBH 5FKAB 2NXZB 3CXDH 5CZXC 4LSUL 1I8KB 1FVCB 1ZLWH 2OJEA 3MRCA 4KY1H 5C7XH 3KXFA 3LV3B 5FM5M 2DAVA 4U3HA 1CE6A 3CXHK 5JOEA 4R90H 2FLRT 1NFDE 4RBPH 2P5WB 4BFEA 3KG5A 2E9IA 1HXYA 1SM3H 3G6JA 2R69H 3SJVE 3TJHA 4N0YH 1CXFA 4M8QA 4JO1L 3MJ7B 4TULH 3VFMA 4OLZH 4O02H 1Z0MA 3WL9B 3V9FA 1I9RH 3UC0L 3QRGL 4NO3B 3VXRA 4XBEH 3O6LL 1TENA 1IGCH 1YN6A 2CUHA 4F58H 3F7VA 4OGXH 1E4JA 2YD4A 4NFDA 1Q0YH 2JJVA 4BZ1L 3G04A 1C1EL 3QIBC 2RJMA 1C7TA 3C5JA 2J8UE 5FECB 1F4XL 3TFKC 3CX2A 3EYOA 1MWAH 4V3DB 4ZD3L 1AHWA 5I1KL 2ADIA 4EJ1C 2NY3C 3T2OA 5AYUL 5ICYB 1KTDB 4JB9L 4OJFH 5D1ZD 1AFVL 2EIBA 4NQDE 5D7KD 4QCIA 3X3GL 1HHJB 5E70A 3IT8D 3CFKB 2V2XB 2MQ0A 5D5ME 2N1KA 2MCPH 1BQLL 4S10A 1E4XH 3SOBH 1KPUB 1D9KB 3TIEB 4QRPE 4HS3A 3TIDA 5FEBA 1ZT1B 5BS0A 4XP1L 4AM0A 4GG8A 5DA0B 4L4TE 4MSWB 4DZ8B 1FVCA 3LB6D 3LZFL 4FTVB 5DMIL 1EERB 4F7CA 1WBXB 3NCFB 3FONA 4A2MA 3BOVA 3L5HA 5AZ2L 4AJ0A 2UUDH 3DV6A 5HHMD 3WDJA 4ZNCD 1T66C 4MDJA 3VFGL 4JFHD 4H25A 4RSVA 3ARDC 5FOJA 2J3SA 4K3DL 1GHFH 4Y4HC 3B9KC 1IAKA 3TO4B 5IG7A 3QDHA 4YHLL 3K81A 3U30C 3FQNB 3ZDYF 1KB5B 3JWOH 3OKKA 2NTFB 4GXUM 5GRYA 4Y4FD 3WEXB 4PJ7F 1CICC 1MCFA 2WQRA 1XGRA 3DWTA 5EFIB 5IB1B 4I3SL 2YPKB 1F6FB 1F4AA 3SDXE 1Q94A 2ZCKL 4PP2A 4X5WB 2UV3A 3GMQB 4ONFH 4LNVA 1U92A 4Y2OA 3OG6B 4G8GD 1PKQB 12E8L 5JIKA 1CIUA 1A7PL 5T3XD 4PRIA 2UZIL 2VZOA 4EI5A 2FEDC 1A9EA 3MLVL 4JRYE 4MNGA 4ZYKA 4DQOH 4PRHD 1DBMH 2V5YA 2WWMC 4ACPA 5F9DC 3IU4L 4ORGA 1FORL 1A0QL 2AJYH 2OL3B 4WRLA 3ARQA 4TUKH 5GGRA 3ULUH 4U31A 3SGDH 4UINL 3MRDA 3PXHA 2WUCL 4FQJL 3ARVA 1MCPL 2FO4B 4ZD3H 1QPXA 2BX5A 3QDJA 4GMTH 3OF6A 4B5EA 5JPNA 4P9MH 5I6XC 3MRRA 4MDIB 1YDPA 4GMTL 1I1FB 1XAUA 4L3AA 3T3PF 3IFPB 2EE2A 5DYOA 4A6YB 1KLGA 1LEIA 1I8LA 3R06A 5HD8D 4G6JH 1LEGB 4J4PA 1JI2A 4XAKD 1KLFA 3TYFA 1XR8A 1S78C 3C5ZC 2G9HB 3U4EA 3EOBA 3VD7A 3SGEH 3TJEL 1I7UA 2VL5A 4P2RB 1CICD 5EU5A 1FGVL 2HFEA 2Z31A 3N9GH 2C1OB 1JUFB 1U93B 3GSNH 4RGOL 3CD4A 2DWDA 5ICXB 1MFNA 4R7NA 1ETZA 1FJ1B 2ZUQB 5EZOL 1FNEA 4N8VB 3AXLB 4NZRH 2GTWA 4CW1A 3GSXB 1SVZA 2A83A 2IQAA 1CDYA 3O2WH 1DP0A 5FKPB 5DJ2B 2E7BA 4U7MA 4KUCF 4FZEH 4ALAH 5C86A 5KW9H 3IYLW 5F72S 1KJ3L 5HHQB 4WV1A 2AXHA 4DUXA 5EUOB 3QO0B 3VFRA 1MCNA 5IJVA 2QQLL 1P2CA 3JXAA 2EE3A 4YO0A 1FGNH 2Z8SA 3V5HB 3ZKXC 3SKOA 3KWWA 3SE3A 4F7PA 3GB7A 2NW3A 3TF7C 4C58B 1YY8A 3T0EA 3NCBB 1SJXA 1WLHA 3A67L 4PJ9D 4F57L 4FMKA 3ELAT 3TT3L 2RFXB 1HK6A 5F7EH 1HKFA 3TWCH 3U82B 4DKEL 2ATKA 2MTPA 1BQSA 3HA0A 4G6AD 3GMRA 1DBAH 1JFQL 1KN2L 1P4LB 2WQ8A 5JUEH 3VI3E 5ANMA 3GM8A 3JBG7 4PJ8B 1X5AA 4A6YL 2CRZA 5DD5H 4PJHB 1B6UA 3BZFA 3MODH 3FMGH 3V6OC 2J5LC 1JNNH 2D7NA 1FAIH 1ZLSH 3L3JB 1BAFH 1BJ1J 3GSQB 3UZQA 1R3JB 5C8JB 5L8LB 5DK2B 1LO2H 3ZKQD 5DK0B 4KVCH 1G9EA 1K2DB 2BVOA 2E27H 4DUWA 3F7YB 5EOCH 4MA1B 1C16A 2AJVH 4UU9B 5E94B 1QRND 2P8LA 4CKVX 5E5MA 2VLJA 5DTFA 2VNCA 5IBLD 2QSQA 4TOYL 2PR4H 3FKUS 5EOQH 4GQPH 1JZ4A 4P5TC 1EHLH 2IF7A 1WITA 2R1YA 1HCVA 2GTZA 4FFVC 2CLVA 4P4KC 2UY6A 4J23A 2NCMA 4QT5B 3QWRA 3FOLA 2DTSA 3GBML 4Z7VE 1T03H 3OTTA 4J3WA 3K1KC 4JFZH 5KS9F 1J5OH 4LLUB 1ZANH 1CGVA 3AM8C 2G60H 3C5SA 5BV7C 1Z3GL 1H8NA 5C0FB 3WFEL 1KN4L 4PV8B 2IBZX 3S35X 4XWOC 2DMCA 1CD8A 5E4IA 4YZFE 4G80A 3MLRH 3HC4L 3HZYB 2XA3A 3QIBD 5CAYB 3H9SD 4AK1A 3TA3D 1I8KA 4YDLC 3L3KA 5E2TH 4LEOB 4HULB 4MX7A 2VL4A 3L3IA 4UIKH 2WP3O 4YHNA 1E27A 3IDNA 5HGDB 2PTTB 2UYLB 4MS8C 4ZO9A 1XFPA 4MJ5B 1MI5E 4M6ML 4M1DL 4S0SD 4YC2C 5FYKD 3Q1SH 1NBQA 4FZ8L 3WSQL 3AREC 1UZ6E 4PY8J 1MCLA 1F8TH 1TTUA 1IJ9A 3OPZL 5GJSH 1VFBB 1QSEB 4HF5L 3RZCC 3KWWB 2FO1A 3FTGB 5C0NC 1UGNA 1P9MC 1S9VA 2C9AA 3NCEB 4P57A 4WEBL 5F7NC 3AC0A 1JP5A 4C56E 5E4EB 2XQYK 1OGAA 4MNQA 3FMGL 3RKDC 2VAAA 5D9SA 1GZPA 2HKHH 2NY6D 1RUQH 1GVIA 5D1ZB 3S96A 1XGUA 4PJGE 3TA3A 2E9JA 1NBYA 4O9HH 4UT6L 3QNYB 1JPGA 1M7XA 1OCWL 1RZJH 4DAGH 1ZT1A 2LV4A 4JJ5A 3ECBA 4H0GA 5B39G 4MQ7A 2R23B 3THMH 3N1QC 4Q2ZA 1BX2B 3DMMD 4OF6A 4PG2A 3CSYA 1H3GA 3MRMA 5DMKA 4I13B 4L9LB 3SE3C 5K59E 4JM2C 3MV8A 3SGKA 3D2UB 3F62A 1NFIB 4ONHA 1G9MC 4JFYA 5E2JA 1CXIA 3KS0H 2WLYA 1YNLL 1FP5A 5DJYB 3ZTJG 2VYRE 4E42A 1TVHB 3CUPB 2YWZA 4H25B 4DKAA 3C5ZD 1X7QB 5BXFB 4IRSC 5JTWA 4S0UC 43CAB 4CN6A 5HHMB 4XPGH 5T3ZL 2X4TB 1B9ZA 1NGPL 1KCVH 5FA4B 1AD0A 2Z9TA 4PV9A 5D2LE 4DW2L 1T1ZB 2O5YH 3MRKB 3MNVB 3BP7A 4KDVA 1RULL 3HCVB 3PWPD 4HWZA 5CIPA 4NRYA 1DCLA 3AAZB 3WHE1 3QIUA 3CDGB 1MLCA 4LIQE 4HBQA 3V52L 4YHIA 4MJIE 3V8CA 1OM3H 5GRJH 4Y4FB 1QNZL 4AEEA 3P0GB 3TBSB 4ODWA 2ZG1A 1IZKA 1WCBB 4J7RA 1EVUA 4QHUA 5CBEB 2EH8H 1CF8H 5E8PA 4IIQB 4LSQL 3FZUC 2HVJA 5CLWA 1VEPA 5C0DA 3I6LD 3KXFD 5EN2A 1MCBA 1WAAF 4JM2F 3HNTH 5IVOA 5FYKE 1AR1C 4OFVA 4W6WB 4M5YL 1B0RB 3ISWA 3NIGF 4I3GA 4HMDA 4D2NA 1EHAA 5BRZD 4O51B 3EDKA 1RQ5A 12E8H 2ZJSH 2P24B 4OCRL 5TGBA 2CJUH 1FC1A 4GKZA 4PRPE 4UZGA 3MOAH 3ILPB 4TTGA 2ZSWB 5IEKB 4XCFL 4BJLA 4UNVA 5IQ7L 4H8WL 5F96L 2CIKA 4KMTL 2BY3A 4X0KA 3VFWB 4R26L 4EI6B 1Q0YL 1K6QL 3C08H 5EU6D 4C83B 4QTIL 4OGXL 4NO5B 4U1NA 3VI4E 4BUGA 2DQHL 1ZEAL 4K7PH 4KGJA 1EXUA 3R8BB 4M6AA 1YA5A 3ZDZF 4FQ1H 1DBKL 3T65B 1FJ1A 1RUPH 3EW3B 4P2RD 2AV7B 1ONQA 2DTML 4HK0A 2XZCH 1CS6A 4ODWB 1D5ZB 3GKZA 4OM1L 4OFDA 3RFZC 4KQ3L 4KTEH 4LPUA 4U1GB 3GGWA 5D1XC 5CEYA 5AD0B 2I5YL 4HK0B 5HYJA 1A22B 4B41A 2FJFB 4XRCB 1LO5A 1OAKL 4N0UA 4XPTH 1TXKA 5ELIA 3UTSE 3DHMA 5IP4A 4MHHI 5HHNB 4KTDL 1EHNA 1HHGA 1CQKA 1HI6A 4G6FD 3MOAL 1BHGA 1NUGA 2HVKA 1L7TH 4PJ5A 3QDGA 3RWHA 5JW5A 5DJYA 5FDWA 1D5BA 1GL4B 2NX5E 3CJJA 4WFFD 1FFRA 4ELKA 4X7CC 5GS2H 4HIHA 2VLRE 5LGHH 4ZXBB 2R2BA 3KYKH 4PJEE 3DV4A 3MCLH 3MV9D 4MA8H 2C3XA 5H37G 5H35A 5FYKU 1EHXA 2HH0L 5IMMB 1UG9A 5JPMA 5D6CB 1R5VB 5CD5C 3KPTA 4JFDE 4MNHB 1ACYH 4ZAKB 1P69B 2VLLB 4M9PA 1QFHA 2DWDB 5DS8A 4NC2B 3LV3A 3D0VA 1QHPA 2CLZA 2BXZA 1ORSA 1HOCB 2BSTA 2IBZY 3DECA 4P5TB 3QNZA 4RAVA 1U58A 3WDHA 2V5TA 4PJXF 5LXGL 4ISVB 1MJ7H 4ZTOH 1YY9C 5FO8B 2NY7H 2DYPA 4XPTL 1XEDA 1B0GA 3L7FA 3VG0H 2XI9A 1HKLL 1ND0B 3VGHA 1AKJD 1HILB 3W5NA 4NJAL 1QRNE 2BOBA 4Y8AA 5J7CC 3ARFA 1I9RL 5CBAA 4NNXB 3RI5F 3BKJL 2AXFB 5DZNA 3GJFH 4QRQA 3SDAD 2EO1A 4UILH 3TYGH 1S7TB 4OD3H 1KCGC 5LVEA 3O11B 3UPRB 3QUZD 4CVXA 2YD7A 1EZVX 2Z4QA 2H8PA 1CZ8L 4HGWA 3LN4A 5FGCE 1Y0LA 5IBTL 4MS8D 3R1GH 5EZJA 5HTSA 3LKOB 5B38A 4E5XB 5T1DH 3CCHB 3AU1B 3ZYJA 1KFAH 2VDQL 3D3VE 2F58L 2XTJC 3QT2A 4LNRA 4AH2B 1KJ2L 4PBWD 1NL0L 1KIUA 4EDWL 3HZYA 4G80B 5BZWB 2OI9A 4YHYC 4OKVA 2NY6B 4HUNB 4MCYB 3RUGB 2VLRD 4P46D 5IF0A 3ZDZE 1HHJA 1CDHA 4JFXB 4ORZC 4LLDA 4OTXL 4DN4H 5F7LB 3SDXF 3A0OA 3ETBF 1T1YA 3ARFD 2H1PH 3SE4C 3DMMB 3MLVH 1II4E 2NY6C 4ZOEA 3UTTE 3S5LB 5C0RH 5D7IE 1IE5A 3FCTB 1DN0A 2WUCH 4X98A 3QRFM 2P1YA 4JREB 5I0ZA 2EDDA 3OJMB 4XVJL 4Z7WA 4GAJH 2NYYD 1NEZB 5ADOL 5F89A 5CEZE 1UKTA 4PJFA 1HDMA 2D03L 3KPLA 4PREA 1BLNB 4W81A 2DQTH 3QUKB 1NL0H 1NUNB 5GISH 1O5DT 1K3ZA 2DIBA 5SV3A 3A67H 3ZL4H 1AR1D 2Z92B 4ZAKD 2J8UB 3Q5OA 1IGFL 4XP5L 5EU5B 5J6HA 2FH8A 3HAEA 4XP6L 4HKXA 1UXWB 5L6YL 1U8HB 4LQFH 3F58H 4PGCB 1QFWI 2X2YA 2FD6L 4GT7A 1SY6H 4K8RH 2HJLB 2ZG2A 3HZKA 2RAMA 4U4BA 1GZQA 3HR6A 5MI0C 1IQWH 3QJFA 3KYMB 4Y5XB 2HT3C 3IAPA 2X9XA 1KJMB 2YSSB 5IJKA 5EOTB 4S2SB 4Q6YA 4BFBD 4E42B 4JY4B 1RIUL 4OF3A 5EU3B 2W59A 3SQBA 1JNJA 2F19H 4BM7A 5DO2C 1BJ8A 3QUXA 3VJ6A 5T3ZE 3VWJD 1NQBA 5HDQH 4FHBD 3GHEL 1FYHB 4LSTH 2BK8A 5GGVL 3P11H 3RJDA 1RJLA 4UTBL 4JZJB 3CIQA 1QKZH 3SDCC 1I9JL 5FK9A 1CFQA 1QKZL 1K85A 4BZ2H 1HQ4A 5I8CB 1C08A 1FO0A 4LF3B 2I60L 1GGUA 1Z5LA 3KPMB 3WN5A 4NKDA 4QT5A 2X1WL 1F4HA 1FAKT 1VKXA 4ZTPH 2LABA 4G6KH 5KVMC 5DQDL 2Y5EA 3MJGX 3GSXA 1KV3A 1N64H 2X7LB 2GJ6D 5DI8B 4AQOA 4TSCH 4BA8A 1JF5A 5CP7A 1FAIL 1ZLSL 5A2FA 3QBTB 1T6WA 2UVEA 3HUJF 3UPCA 2BVQA 3E0GA 3PWLB 1G0XA 2CR6A 4GG6B 4NNYB 4LDEB 4WNQB 2HFTA 3O3DB 4DGVL 1KEMH 4HJJH 1ZA3B 4OM0H 4ZUVB 4ODUB 3GZKA 2BVQB 3E3QE 3DTXB 4DZBB 2P48B 4JO2L 3U0PB 4JLRB 1K4CB 2R2EB 4RWYL 2CKBA 4NQDA 3GI9H 5K9JL 4AT6B 1IAMA 3ARED 2EXYD 4HH8A 3LY6A 4Z7WF 3CSBA 2AKRB 3D39D 4HIXH 3R8QA 1F3JA 1JPFB 5GGRB 5KSAB 5BS0E 3DVGA 5HHPB 1QSFE 4QOKE 1WZMA 4UT9H 4KK9D 1MH5B 1DVFA 1KBGH 3O9WB 1JZ8A 2BFVH 3L7EB 4R0LB 1M05A 2W0LA 4XWGH 3F6IA 3ULUD 2XWBB 3FO0L 5TGBB 3VGDA 1CFSA 2GSIA 2A6KB 1UXSB 2HT2C 1T20B 4YQXL 4PJBA 4UOW0 5JXEA 5F3BB 4PB0L 4K3JL 1BM3H 3NH7L 5TFSH 2APFA 2J4WL 1BFSA 4X5WA 4EVNB 4JDTL 2WZPD 5IV2B 5I1JH 1WC7B 1U8IB 35C8H 1G7LB 35C8L 4ODHH 4JZNA 1VEOA 2CLVB 3BPLC 2G75A 3WXWL 3JVGC 2Z35B 3EOYG 3VWJB 1X4XA 2X4SA 2VR9A 3HNTL 3MJ7A 3SN6N 3IDJB 5IB2A 3DO7A 2WLZA 4G6FB 5F8RC 1JPSL 3QWOB 4IDJL 1A7BA 2XN9A 2VUOA 4MAYA 4PJXB 3GSOA 1QA9B 1WGOA 5DZOA 1VB9A 5EOCJ 5FUOH 4YHKH 5JPNB 1NBVL 1X5XA 3Q0HA 4X4YA 5EUOF 4OGAD 2PW2B 1JHKH 4PIRF 3GMLA 3KDMB 3MV9B 1QSVA 1XMWA 3K4DA 3WIHA 3QDMB 4EN3A 5IIEA 4HJGA 1B2WH 4WFGE 4PJAE 1U58B 5E08L 5T1LA 1D9KA 3KNBB 3MLRL 2BSTB 3NCCB 1WIPA 3GRWA 3WMSA 4NNYA 1BX2A 5IF0B 5J12C 3RUGA 5DFVD 4EXPX 4R4NC 1DUZB 2V7HB 1FDLL 4WO4B 3LN5B 3PWJA 1MEXH 4G5ZH 3OR6B 4KY1L 5CILH 3DVGB 1XF2A 1MFDL 3AREB 4G8FB 3GMQA 1OY3B 3BKCH 2YD2A 1CLZH 3LZFH 3QWRD 4JREC 3ULUE 5IVZB 2OMNA 1JF6A 5EZOH 3VXRB 1JHTB 4JGJA 2FYYA 5C0AD 2VZ1A 3MACH 3GMMA 1P4IL 3BPCB 1U8LB 1RJCA 2H8PB 4S1QH 1IAIH 5FO7B 4TSBL 4GRMB 3G08B 1EJOL 1KIPB 4JN2A 5FGBA 4WFGD 2NLJB 4XVTH 3FFCB 4NNXA 2AJXH 2Y07H 4CADB 5L2KD 2VXTH 3GJEA 4Y16A 1J11A 3L6FB 5TFSL 4YC2B 1TMCB 5M94B 4BKLB 4NWTL 1X6NA 1OSPL 5DA4A 4V1DE 5FHAH 3U7WH 2F5AH 2VDQH 1V3LA 5BV7B 3LS4H 4O58H 2JJSC 2FGZA 4PGCA 1EGJH 4BKLA 5KG9B 5HI3D 15C8L 4MCZB 2VLRB 2DQFA 1HINL 5JMOC 1DBAL 2GT9A 1RJYA 5DS8B 4EIGB 3VRLE 4L5FL 5HDLA 2V5SA 4APQD 2C1PB 4PJCB 4EUPG 1MJUL 3U48A 4YPGB 1PZ5B 5ACLA 3L3DA 1OGTB 1BD2A 4JFOB 3ZT6A 3FFDB 2F53E 3VWJA 3QDGD 1JPTL 1KCVL 2VDKL 1NEZA 1NSNL 2NY0B 4M7JH 3WKMH 4ZXBA 4UTAL 5F7UA 5IEHA 4UQ3A 4NKOB 1IC7H 3LIZL 2YZ8A 3CFBA 2HFFB 3VFUA 4R8WH 5HYQB 4OD3L 2XTJD 3CMGA 2A6IB 1RZIA 4UI2A 3HTLX 2NNAA 3DSFH 2MCG1 5CZVL 5T3ZD 3ZE2F 4Y5XC 4NO3A 3SKMB 5FUCE 2ARJB 4RBPK 5KAQG 2BZDA 1MRDH 3HRPA 4FN0A 4Z7UB 3MRQB 2VLMD 3K7UA 2IFGA 3PE9A 4M93B 4UDTB 4W4NA 3S8WA 3VFSA 3RVVC 1I1YB 4HK3N 1UADC 2EDJA 3LDBB 4MD0B 5T1LB 1TZHB 2BNQB 2P46B 4GRLB 3EDJA 1O7VA 1WCBA 2XWJB 5JLZA 1LE5A 2YOCA 3GSQA 2SEBA 4LVEA 1P7KA 1X44A 3G5YB 3P4MA 1MHHA 4A6YH 3PF2A 4M93C 5F88A 4Y19A 2VXVL 3OX8A 3EO0B 2XXCB 4U1JB 4P2OD 3ROLA 1OF2A 4R4BA 3HLAA 5ID1B 4RFOH 5DSCA 4R2GC 4HWBH 3KVQA 4MZ3A 4DCQA 4JZOB 2Z4QB 3EO0A 1MPAH 4PP1C 1G9NL 3TBYB 4UIKL 4U6HA 1EH9A 1CE1H 3VFTB 3NGBB 4TUKL 3ULUL 2ZWLT 1IEHA 1JGVH 4L8SC 5B3NA 4QHKI 3WFCH 3MYZA 5I1KH 3UYRL 3HG1B 3WHXA 3VXTB 5JW4N 1KJ2H 1A6ZB 2HFGH 2KZ1B 2X9WA 1XGQA 1C5DB 2CRYA 3C9NA 1J5OL 3PJSA 1U42A 3MR9B 5LG1A 5DHYA 1OAYL 5L7XH 1A6TB 1HNFA 5GZND 4XMKL 2OZ4H 4NQEB 1SY6L 4ZSOE 3GSNL 5ICZB 3QHZH 5DVKA 1E28B 4C56A 5CSBA 1JNLL 3N85L 5MP6H 4B53A 1AGDB 4DVBA 1YY9D 4XP9L 2PYFA 1S7TA 1YJDC 5KSAA 5J56B 5I1GL 2CQVA 1QLEL 2P5WA 4PJGA 2L7UA 1H3PL 3MRPB 5D1QB 3S7GA 4LSSL 5CBAB 1LEKA 3V7MA 4MDIA 2YSSA 2QR0B 3ROOA 5HHMA 1OP3K 5E8DH 4HUVA 4JHAL 2R2EA 4PY8I 5DUBB 4KH2A 1MFBL 3GMOB 1FO0L 1NCDH 2PCPB 1JRHH 3PP3H 2VJXA 3PQYD 3MV8E 3TVMD 1VFOA 1I3VA 1TNNA 3HAEH 5MENA 3HI1A 3PWPB 1YEEH 1A9BA 4ZTPL 5J1AA 3IVKA 2PO6A 4JDZB 4D9RE 2EIZA 2R23A 4PRIB 1G6RH 4Q0XL 3D87B 4JO4H 1W0WB 4N0FB 4LPVA 2C7UB 4PJIA 4F7MA 4XPHL 3LMJL 5IMOA 1QFWM 1Q9KA 1A6TA 2Q86A 1WWCA 4XHJC 1PEZA 5D9SB 5JQ6H 4WWKC 2EYRA 2JCCF 2M26A 5EUKA 2Y6SC 3FB7A 2BNUB 4MA3A 5GGRY 3OR7B 3F65A 4ZG1A 1N4XH 3NPZB 5GXBB 5I66A 1U91B 1R3IL 3SDCD 4WI6A 1MRCL 5HHNA 2VR4A 1AGEB 3STLB 1QSEA 4GS7B 3TFKA 4FXGB 3MYJA 2JB6A 1L0YA 2DQDH 3DIFB 3KXFE 2BOCA 2D0HA 3TO2A 5AG9A 5I1LB 5BQ7A 3SGEI 1U8MA 5ENWB 4FQQB 4WO4C 3G6JE 3GSWB 2WY3A 3I6KA 2JLLA 2A9NH 5EC2A 1TETL 3S4SG 4AH2A 5GRZA 2FIRT 1MUJB 2GFBA 4OGYH 4HEPG 5D4QA 4YHMH 3H6JA 3I50H 3UMTA 2J2ZA 3I6KB 3KPSA 4G43A 3HAEB 1N0XL 3VA2C 1QYGL 1UKSA 3NCMA 1MF2H 3P0VL 4HQQH 3TIEA 1EPFA 4H20L 2GITA 2E7CA 3GJFA 3GUTA 3IDJA 5IB2B 5I1JL 5T5NG 2FGWH 4Y2DD 1NANH 4GQ9H 3X13A 4PJFB 3WFHA 3TV3H 4LSTL 3MLZL 43C9A 3ZTJH 5F7YC 1YY8B 3T0EB 4NP4H 5DLMH 1A1MA 2NW2A 4YFEA 1A7RH 1J8HE 1MCDA 1S9XB 5D1QD 5CD3B 1AI1H 2BOBB 1RMFH 4X4XA 3VXRD 5DT1L 4KK9C 3VFPA 1X5LA 3B2UC 3OPZH 3CU1A 3IFLL 4OKDA 3C6LD 5FF6B 1WUNT 4ZS6D 3T2NH 3F6LA 5CD3A 3WLWD 3K2UH 4HEME 2XFXB 4HUMB 3STZB 3WIFB 2R1YB 4HGMA 5CLTA 4F3FB 2E6JA 4P2QE 2W91A 4K71C 3TVMB 1XIWA 3OKLB 2IAMA 1XCQB 4QYOB 4OQTL 2X09A