4D0CA

Complex of a b21 chicken mhc class i molecule and a 10mer chicken peptide
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
276
structure length
276
Chain Sequence
ELHTLRYIRTAMTDPGPGLPWFVDVGYVDGELFMHYNSTARRAVPRTEWIAANTDQQYWDRETQIVQGSEQINRENLDILRRRYNQTGGSHTVQWMSGCDILEDGTIRGYHQAAYDGRDFVAFDKGTMTLTAAVPEAVPTKRKWEEGGYAEGLKQYLEETCVEWLRRYVEYGKAELGRRERPEVRVWGKEADGILTLSCRAHGFYPRPIVVSWLKDGAVRGQDAQSGGIVPNGDGTYHTWVTIDAQPGDGDKYQCRVEHASLPQPGLYSWRSGGGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords MHC CLASS I ALPHA CHAIN 2
publication title Expression levels of MHC class I molecules are inversely correlated with promiscuity of peptide binding.
pubmed doi rcsb
source organism Gallus gallus
total genus 62
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2014-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4d0cA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4d0cA01
2VLRE 2AJVL 3GJFK 4WJ5B 2A0LD 3SKNB 5F1IA 2NNAA 3MO1A 5IVXB 3WO4C 2IALA 1LO4L 3LDBB 4OZFH 4DUWA 2R8SL 3QZWB 4WW2F 2H45A 2VXQL 5CBAB 4HKBA 5GRVL 4R2GC 3GSNA 5SX5K 1FFPA 5KSUA 3FO2B 4EQ2A 4X6BB 1P1ZB 1RJZA 1NCBH 4N0CD 3O4OB 3EO0A 3MRHB 3AM8A 1J1XL 1AKJA 1MRCL 4NRXB 4X6CF 3ARRA 3NOIA 4K9EC 1IILE 4NNYB 5SWSE 4HFWB 3DRTA 2CKBA 4UV4L 2DQTL 4XNXL 5E9DE 3U2SA 3UC0L 3LMJH 2IADA 1J1XH 4M8VA 1MRCH 3HNTL 1WISA 3O3BB 1MVFA 1ZGLP 2KKQA 4KKBC 4UV4H 4XNXH 1W72B 3WBDA 1L7TH 3HNTH 5CLWA 3R4DA 5FM8A 5C8JB 2UZIL 3GMRB 1NCTA 2GQHA 2BNQB 4PJHF 1U58B 5EG6C 5E08L 4LLMA 2HWZL 4X4ZA 3RI5K 3QO0B 5D7SH 4MJIA 4Z8FL 1BVLA 2ZUQC 2YEZB 5DEZA 4PY8I 4RQQA 5JNYB 4MZ3A 4V1DB 2P8LA 1J8HA 2IBGA 4Y2DA 4D0CA 3IU4L 1UT9A 4BUHA 5IQ9A 3SKMB 4JFXA 4Z8FH 1DUZA 1I8IB 3D85B 5LG1A 2FECL 3HRPA 2ICWA 3K4DA 4Q9CA 3S5LA 1HSBB 1RJLB 3IU4H 4EZMA 1KCRL 4PGDA 4OAWA 5D7JC 1MCFA 2NXYC 5DEFA 4POYA 3BKJL 3AS3A 4P2QB 5D2NB 4R4FL 3VXME 3BUTA 3ARDC 4LLVA 2VDRL 1B0RB 3DVNB 1KB9K 1A02N 4XAWL 1RZIB 4LKXA 5FYJE 4JE4B 1EVTC 3BKJH 3O81A 4H25B 4MJ6B 4NDMB 5EPMB 2WINB 4MNQE 1XF2B 5IROC 4DGYL 5C0FB 1UKQA 2IJ0C 4HH9A 3LRSB 4WY7L 4XAWH 4QXGH 5IV2B 2GY7B 2ZCKH 3C09C 3I85A 3P30L 3Q2CA 4WI5A 4LMQE 4DGYH 3VGBA 1NQBA 4MCYA 2FO4B 2HTKC 4WY7H 3I3BA 1KLGB 4ETQB 1VPOH 9CGTA 1YDPB 4X5XB 4XI5D 1ORSA 1UVQA 4HT1L 5KBNC 1IC4H 5B22A 3P30H 2P47B 3MUZ1 3GB7B 5JOEA 4PG9A 4L29B 1AGFA 2F15A 4LEOB 2IPUK 1X5FA 2ED8A 3W82A 3WN5A 3U79A 1CE6A 3F6LA 2XIDA 3X12A 4DKAA 4U1NB 2BNQD 3SKOA 2G60L 3VCLB 3F12B 4JHZA 1NCAH 1JWUB 3F7YA 2BNRB 4PRHA 1HQ4A 2X5PA 3U82B 4P5TC 1ADQA 2EH7L 4X80H 5FOBA 2P5WB 4BK4A 1I7TA 4TNVF 4X98B 1UM5L 3DTXB 4IS6A 3BPCA 4QCIB 1S5HB 3REVA 3QJFA 3UTTA 4NN7C 5J13C 3QAZB 3L7FA 4KMTL 5EBLB 2V5MA 3D85D 5JUEL 2BVQA 5AZ2L 2RQ8A 4IEFB 5DS8A 1UM5H 2HT4C 4MD5B 3MCKA 5F88B 1OM3H 4ODVL 3NGBB 1TZIA 1R5WB 5SV3A 4KMTH 3MV7D 4U0RB 4TVPD 4F7CB 4P2QD 2CUHA 4FQIL 5JUEH 1NJ9B 3O3EB 2FX7L 2WIIA 1K4CA 1I4FA 4N8VB 2F58L 2DS4A 2WUBH 5GJTL 5J12B 4LSTL 2FJFA 2YSSA 1BEYL 5C70A 4MLSA 1D9KB 1FGVH 2CKNA 1T5XA 5I6XC 3LVEA 2PN5A 1OARL 3AAZA 5BZDA 1H5BC 5L88L 5DI8A 1WIOA 3D2UA 4WUUE 2DBJA 3U1SL 5IT2L 1EZVX 3QUZB 4XCFL 5TQ0H 4PTTA 1F4WH 5D2LF 3S8WA 1GZPB 4OV5A 1C8PA 5DMIL 1OSPL 1LHZA 3TBWB 5ADPH 5HDQL 5I74C 2OS7A 3SDAB 5TDNA 4RFNC 1A4JB 3W0WB 1CXIA 4BSVB 3NA9L 2ATKA 3KPOA 3BN3B 3TM6A 4WO4C 3CGTA 4I48B 4JO1H 1E6OL 4LSSH 2OL3H 2XZAL 5C07A 4B5EA 1EFQA 2LV4A 5I2IB 2CH8A 3MREB 4P9HH 1VFBB 4XGZA 2BNRD 1KJMB 3H0TB 4P5KA 5D7LA 2A0LC 3VH8B 1E6OH 4CVXA 2XZAH 4P59L 2P5WD 4UUJA 3L1OL 1DL7L 5F9AC 1YPZF 3U48A 2DIJA 1KN4H 3FFDA 4UDTA 3BPNC 5CJ5A 4OBRA 4E0RB 4WTXA 1FH5L 2EIZA 4P59H 4Z7VA 4GSDL 3L1OH 3DROA 1DL7H 1OTTD 3VFWA 4Y4KB 3EZJB 4LCCA 2VR9A 4N0CC 5D4QA 3KPMA 2FJGB 4MVBA 1F90H 1QBML 2CIIB 4HS3B 4L9LC 1CGXA 4GSDH 4JRXE 1QBLL 5CLTA 1F11B 3P0VH 3CVHB 1WWAX 3TFKD 3V4VH 1GGIH 5GISL 1HOCA 4XP4L 4KDTC 4B50A 3U6RA 1QBMH 2IQAA 5KS9F 1FG9C 4Z5RA 1QBLH 5FM5O 1D9KD 2QSTA 3UP1A 3KPQA 1YMMB 5GISH 1HNGA 1OP3H 3KHQA 2WLZA 4XP4H 4C56A 4RMVA 4XCEB 4FS0A 2WLYA 2EDRA 1LILA 3Q3GB 5FYKD 5FXCH 2GJZB 1LO0L 3VDAA 3ORJA 3RU8H 1YEKH 3QUZD 5HI5D 3O2WL 3OKKA 4P23D 1T5WA 4FNLL 1GRWA 1MREL 3AFLA 3LH2L 5T1KB 2EDOA 2SEBA 2ZSWB 5EO1A 4PP1D 5DA0B 1C1EL 1QEWA 1MREH 3BT2L 3D39A 1PX4A 4K7PY 5ACMA 5HXMA 4NBXB 1FNSL 3TIEB 1ONQB 3U9UB 1URLA 2XY1A 1YECL 4PBWD 4CADA 2IPKB 3I84A 2RB8A 3P9LB 1TDQA 3QXAB 1C1EH 5E1HB 5KJRL 4JG0L 2GI7A 2J8UB 2ZUYA 3BT2H 3QNYB 3VGGA 3CSYB 1E4XI 4C4KO 2J3SA 2YUZA 3MFFB 4GKZA 1FNSH 1XF5B 3VJ6B 4JDVB 3FO1B 1BBJA 3H9HA 4J4PA 1F58L 4QLRA 3VRLE 3LDBC 5I1GL 4ZDHA 1UZ6F 4GW5A 5KJRH 2DQIL 3KNBB 1XCTA 3KWWA 3H9SE 3T09A 5DJ8B 2E7LA 1F58H 2BMKA 1ZOXA 5I1GH 1W8OA 4G8GA 1J05B 4Y4KD 4XC1L 1IGYB 4MMZC 1J0JA 2JB6B 3O4OC 1UWGL 3HNVL 4N5EA 3BGMA 2DI8A 5ACZB 4DKDC 1FVDB 5KAQF 5INCA 1S7QB 5ICYB 1G9EA 1K2DB 5HHOE 1ED3B 3BRGC 5EZIL 2EO9A 5EZLA 1QR1B 2MCPL 1HZHH 5DA4A 3HNVH 3MA9L 4XI5C 2YPLA 4FQXB 3RRQA 3FZUC 2X4UA 2IMNA 5CSGA 3WIIL 3V4UL 1YMMD 2ID5A 3CVIL 3C60A 1Z9OA 4A6YB 2VLMD 3IFLL 5IBLD 3GHBL 3MA9H 3MLTA 4L3CA 1X9QA 1JPSH 5E8NA 4J1UA 1YNTB 4ZPTB 4JFFD 4WW1B 3WIIH 3V4UH 4PY7B 4KK6C 3CVIH 5DRXB 3PQYA 2BERA 1G7PB 4JPIB 3IFLH 3CCHA 3O4LE 3GHBH 2PXYA 4FZEH 5GS0D 2YPKB 3MRDB 3JWOC 4FXGB 4KI5D 5T1KD 4KKAD 1TMCB 4NNXA 3V6OC 4D94A 2GUOB 3LKSB 2O26U 5E4EB 5DZOA 3VXRB 3OKYA 4Y19E 3WFCL 2BOBB 4OSUH 4D9RE 1B90A 2HJFA 4YLQT 1KYOK 4LLWA 1VERA 1CL7H 4HV8B 5IHBA 2A6IA 4YDJA 1OGTA 5D1XB 1BHGA 1GGBL 2X89A 4F15B 2VDQL 2AV7A 4LF3B 3WFCH 4LVOC 4G7VH 1Q72L 4MD4B 3CFJB 1DQLH 5E24E 2DQGH 4ZO6A 1GGBH 3OGCA 3C6LC 3I3EA 3CX5J 5CWSB 4UI2A 1Q72H 4L8BA 4U31A 5JLZA 1ULVA 3HA0A 25C8H 3N06B 2LVCA 4U3XA 3GMOB 4NN5B 3S7GA 3ALPA 1NFIB 1HXYB 5T1LA 3MNVA 3RZCC 3HI6L 5FB8B 1NGWA 2X40A 5GGTA 3NZ8B 3ZDYF 4L3EE 5LGJB 4JZNB 1Z6JT 2IFGA 3OKMB 4DN3L 5E6IB 4LQ1A 5LKNA 5FYLD 4L4TB 3VXNA 4AM0A 2R9HC 4FQXD 3HAEH 3VG9C 3RJQB 1NUDA 3U0WL 3HI6H 4RFOH 5KOVC 1J7VR 5F1IB 5E00A 3MO1B 3CZJA 4ZUVA 2IALB 4DN3H 4JQVC 2VZTA 4RDQF 4F58L 3KG5A 4Y5YA 4JPKL 1KJ2A 4L5FL 5C3TA 4GW4A 3U0WH 1CCZA 4K2UL 4HKBB 3UBXA 3GSNB 5F8RC 1EXUA 1FFPB 1KXTB 4GRMB 4AEHL 3LD8B 3W11C 4F58H 1RJZB 2F53A 5F1SA 1NGXA 3IDJB 4XBEH 4ENED 4L5FH 1BM3L 3EO0B 5M95B 2VZOA 4DAGL 4K2UH 5C0AA 1QKZL 3HMXH 5CD5D 4AEHH 2VAAA 3JUYA 5DSCA 3KPTA 5L2KA 3VXRD 3DRTB 2CKBB 3U2SB 3QAZC 1KIRA 5F7DA 4DAGH 2IADB 1OTTC 4JY5L 3V2AR 1QKZH 1IGCL 3O41A 4PJCE 5D1XD 1QR4A 3NGBC 1F3DH 3LB6D 1D6VL 4U0RC 5EU4A 2J88H 4H20H 4WU5B 4JY5H 3VDBA 4NT6A 4G8FA 1RSFA 5GRWA 3FN0L 3TFKC 1IGCH 3NZHL 4HWBA 5EBWA 4JN2A 1X5IA 3GSQA 1JFMA 4Q74A 2BY0A 5J12C 4MXWL 3MRQB 4Z7UE 4YH6A 4P46A 4F2MA 3F6IA 4PD4K 4YHMH 2OTWA 3C8KA 4MJIB 1BVLB 3NZHH 1TZGL 4RQQB 4MXWH 3IS1X 2OI9A 3LQAC 2BC4A 2P8LB 3B9EA 3WFBH 2CK2A 4Y2DB 4D0CB 1N6VA 4EI5A 5IQ9B 3B2UD 3EOAA 4JFXB 1DUZB 3KJ4C 3QCUL 1TZGH 3P2TA 3QUZC 3RL2A 5HI5C 4KUCD 5MHSD 1F97A 5AWNH 3PWVA 2MTPA 3QNZA 4YZFF 4N8CL 5E6ID 2ICWB 2XZZA 3S5LB 1I1AD 1IGTA 3SDAC 1XGTA 4PGDB 4OAWB 5DEFB 3TYGL 4ODHL 1QFOA 4XHJD 3RQ3A 4LGRB 4N8CH 4YX2L 2BP3A 1RZFL 4PV9A 4LLVB 1OWWA 4ZUTA 3ZTNL 3OMZA 1NFKA 2ZZUT 3TYGH 4ODHH 3D48R 2VDNL 5CMAA 4YHYB 4DCQA 5HHNA 4NUGH 5DFTA 2XQYK 1YJDL 4S1DC 4YX2H 1H0DA 4HH9B 1R5VA 2BRQA 1JMXA 3ZTNH 4ZFGH 4JFED 4ELKA 1KLUA 2VDNH 4GRLA 4HUKB 3F62A 3ME0A 4RWYL 1HHJA 5M94B 1JBJA 4M00A 4MCYB 5HHXL 3B3IA 1KB5A 5F70A 1RIUL 2K1MA 1ORSB 1UVQB 4QOKD 4G8EA 1MNUH 4ELMF 4PG9B 5HHXH 1AGFB 1MCKA 5I1EL 5K59E 3WN5B 1HYRC 4HK0A 4BQ8A 1CE6B 2BSTA 5KW9L 3RWGA 4QXWA 4S11A 4FP8L 3X12B 2HP4A 2Y36L 4YFLI 2G5BA 3SKOB 5JXEA 4F9PA 4R6UA 3DI2B 3RGVA 3RI5F 3F7YB 4PRHB 1HQ4B 1QFWL 4MJID 5KW9H 3EOYG 5SWZA 5FOBB 3HRZA 3UPCA 5H35A 4FP8H 1I7TB 2Y36H 4DFIA 4P2RA 5IB3A 4AEIH 5FFLA 5EDXA 4IS6B 4Y2DD 3BPCB 3ARPA 4OUUA 2YA1A 3QJFB 5F72S 3REVB 1PW3A 1QFWH 3UTTB 4PP8C 3GRWL 3L7FB 2FLRT 4XMLL 1E4JA 2BVQB 1KT2A 5DS8B 3MCKB 5CSZA 3UO1L 1WEJH 1GZQA 4JKMA 1CDGA 1H3VA 4KI5C 2FEDC 4KKAC 1TZIB 5DHVA 1JZ8A 1SEQL 2WIIB 1K4CB 1WT5C 2V2XA 3QUML 4YXHL 3V5DA 3CPLA 1ZA3A 2H3NA 1IEAA 5C0CB 3M1BA 1U3JA 5I76A 1BVZA 2UUDK 4G80A 1FVEB 2FJFB 4PS4L 2YSSB 3BD5A 5FIEA 3VXSE 4K3DH 1WFNA 4HIHA 3QUMH 2P8MA 1T5XB 5B4MD 4OCWL 3QYCA 3AAZB 4NGHH 3X11A 5BZDB 3BPLB 3NPZB 3RNKA 3HLAB 3CDGA 5DI8B 3D2UB 1KNOA 4I2XA 4L4VA 3HE6A 1PKQB 3IKCB 4GFTB 5CZVL 3MLYH 3G5ZA 4PTTB 5F7UA 2V7HA 3IXTA 1A4KA 4OCWH 3D25A 1MFAL 4OV5B 4OF6A 4HLZH 4MJ2A 5KSBF 2F5BL 1UXWA 5TDNB 5E95B 5CZVH 4PGCA 2ATKB 1DANT 3NCFB 2VL4A 1XH3A 1AR1C 4OQ1A 3KPOB 1T6VN 4IOIA 4KMLB 1MFAH 4FN0A 2BHUA 3VU2A 4LCUA 5CP3H 4W4OA 5FKPA 4KVNL 3DXAA 4J23A 5IVXF 4KFZC 3RP1A 5HVWA 2KH2B 3CXDL 4OI8A 1M1SA 2NZ9D 4N0UA 3T2NL 4XGZB 4FQXC 3K81A 2DBLH 1F45A 4PRHD 5D7LB 4KVNH 4CVXB 4UUJB 5F7KC 2A77H 1J9CT 4NC1E 2EDYA 1FZJB 2ZG2A 4IOFD 3IFOA 4EXKA 4IIQA 3FFDB 4UDTB 3X17A 5FO7A 1S9KC 2DKMA 2AEPH 4HWNA 3O6KL 3UTTD 2EIZB 3ZT6A 1IQWL 3DROB 3FN3A 1YC8A 3T8XA 1YQ2A 3VFWB 4HJGA 1G6VK 5TPWL 3KJ6L 3NMEA 3CX2A 3KPMB 4ENEC 1I9RL 3O6KH 4YJZL 3LZFH 1KN2L 3BHBA 3HC0A 1IQWH 3QIUA 4OQTL 2Y25A 3WS3A 2XZCL 1YYMH 2R39A 4G3YH 5TPWH 1HOCB 4G6KL 2H2SD 3U6RB 5C0CD 3SJVA 4MXQA 3O11A 2IQAB 4CU8A 1NAMA 3IB4A 4Z5RB 5J3HD 2E27L 2A38A 5EU7E 4OQTH 4W4NA 1U6AL 3DSNA 4K8RD 4WRLA 2Z8VC 3KPQB 3MLRL 4OZHA 4Z7OE 2HFEA 4F15C 4HULB 4GRWB 4C56B 1AQDA 4AK1A 4IRZH 3V0AC 2E27H 3V5KA 3D2UD 1HEZA 3Q1SL 1U6AH 4MGXA 1MCPL 3BYTA 5FV1L 3MLRH 1IAMA 2NY7L 4X8JB 2VLKA 1T5WB 4G7YL 1VENA 5J1SC 2FH8A 3B8YA 2NY3B 2NY5C 3Q1SH 3RZWA 4MLIA 2XT1B 2SEBB 5EO1B 3AU1A 2NY7H 4GBXA 2H8PA 4M4PA 4NN5C 1QEWB 3QRGL 3LN4A 4G7YH 3D39B 2Y72A 4HDIA 3VFRB 5CEZH 4CADB 2GJJA 2FZ3B 1IGJA 1AP2A 2APBA 5E6IC 5ICXB 1I3GH 5FGCE 2X42A 4ZTPL 3GUTA 5D7LD 2HRPL 4GKZB 1BAFL 1S7TA 1BBJB 1D5BA 3H9HB 4XHJC 1W0YT 2NY6B 3P9WB 4ZDHB 1QSFA 2WP3T 4GW5B 4JFHD 3DVGA 3QDJA 3CH1A 3VGFA 4P48A 2X4RA 1XCTB 4I1NB 3KWWB 4MA8L 1BAFH 4PJIA 1CGVA 2AJYL 4UINH 4OZIF 1CFBA 4G8GB 1UCBH 4HUMB 3UTOA 3RY5A 3BGMB 2RBLA 4MA8H 3AM8C 4DKFH 3NIDE 2AJYH 3ABZA 4M61A 3FB6A 4S2SA 4TQEL 5EZLB 1DBAL 3NBNA 4EVNA 5E2WL 3BPOB 1EHLH 3MZGB 2YPLB 1UEYA 1WITA 4LU5H 2X4UB 1EHAA 4G6JL 4XNYL 1UWXK 4TQEH 1DBAH 3C60B 4YO0A 4C56D 4ZODA 4HCRH 1P69B 4LSPH 4L3CB 3MLTB 3WIHL 5E8NB 2AQ1A 4J1UB 3SE3A 1YEIL 2K7QA 1RIVL 3V9FA 4DK3A 2QQLH 5CKGA 4BH7A 1RD6A 3SQOL 4G6JH 4XNYH 2CUIA 4WFGD 2Q87A 1MAJA 3PQYB 2H1PH 4JQXA 1M7DA 3S37L 4U3CA 3CCHB 4S1RL 1FJ1A 2PXYB 4K7FA 4CKVX 2NY3D 1RIVH 5IHLB 5D9SA 1GAFL 3SQOH 3T0AA 5DZLA 1B88A 3F8UB 1BQLL 3UDWA 1BZ9A 4NNXB 1F02I 2UWEA 2OCFD 1MAMH 3S37H 4O02L 5IVOA 3KPSE 1N2RA 1I1YA 1RU9L 1J86A 2VZ3A 3DARA 4TNWK 3QHFL 1WAAE 1WWCA 2W9LA 4PJXE 4X9FA 1GAFH 4RRPG 4OM0H 2HJFB 3T2QA 1BQLH 3C5SA 4LLWB 3QWOA 4XPBL 5DD1L 3SCMA 4O02H 2A6IB 4PLOB 4YDJB 1OGTB 2X10A 1RU9H 5KVFL 5EO0A 1FIEA 3VA2C 3QHFH 4E41E 2AV7B 4YE4L 3GSOA 4WWKC 2NY6D 5DD1H 3SGJA 1U8KB 3FKUS 2QADB 1A64A 3OGCB 4BJLA 3BQUB 4NO0A 5AEAA 5EU3A 3LRHA 4YHYC 4L8BB 2DM3A 3A6OA 1UWEL 4G8GD 3AMKA 3S88L 1VGEL 2D0FA 4Z7QE 5B4MC 5JLZB 1G84A 5IR1A 3PNWA 1XAUA 1OW0A 4N5ED 4WI2A 5E94B 3D3VA 5T1LB 3MNVB 1UWEH 4JO3L 4MCZA 3S88H 1VGEH 1KGCD 1NGWB 3L5HA 3A6CH 4JLRA 5I73B 3ARGA 4P49A 4ZPVA 1OTSC 2YPLD 3VXNB 4AM0B 1OCWL 1IKNA 1E4KC 2H9GA 4MQXC 4JO3H 3RWIB 1JPST 1NMCC 2P5EB 3CUPA 5E00B 2Q3AA 4ZUVB 3EDJA 2M1KA 4C55A 4MWFA 3S34L 4Y5YB 1OCWH 1TJIL 4XX1E 1KJ2B 4YDKL 4GW4B 4R26H 4UIKL 3MBEA 4XH2A 3K8LA 3B83A 2H32A 3BP6A 3C08H 1R3KB 3PQYD 3R0MA 4RGNE 3UBXB 5E99H 4G6ML 3JV0A 4OUOA 2NZ9C 2VMFA 2PXYD 3S34H 2NX5E 2Q86A 2Y06L 2F53B 5JDJA 1NGXB 3CZFA 5IVNA 4YDKH 1LP9A 4NQDE 1EJOL 5C0AB 3G6DL 2AERT 3ZKND 5DGRA 4JFOA 5DR5H 1M4KA 4IOFC 3GM8A 2QSCL 3HAEG 4G6MH 3RVXD 1CD1A 5DSCB 5L2KB 2Y06H 4OB5L 2EDNA 1PKOA 1KIRB 5F7DB 1JZ5A 5H8DA 4J3WA 4DJMA 1B0GA 4EDXA 3MLWH 4XPAL 1MRDH 1QVOA 3O41B 2QJDA 2X89D 3E6HB 5BJTA 4M9OA 2BHYA 1VEMA 3NAAH 5TE6L 5EU4B 3VW3L 1WCBA 4NT6B 5LQBH 4G8FB 4XPAH 1CN4A 2J12B 5EBWB 4JN2B 5I1HL 3GSQB 5E2VL 3BQUD 3VGAC 3TO4D 5GXBB 5J3HC 2AP2A 4P46B 5CGYC 5TE6H 3UTSA 3VW3H 4N0RA 4PP2B 1NDMA 4K8RC 2OTWB 3SDXA 3C8KB 4Y88A 4O58L 2EDHA 4KTDL 2P49B 4OIBA 5DMGD 5I1HH 3JUZA 3UJTL 4K7PX 2XKNA 1G9NC 2OI9B 1IARB 1UM4L 2BC4B 1JRHI 3ZDZE 4KI5F 4EI5B 3MPCA 4LCWA 5T1LD 5IK3A 4O58H 2XTJB 3LPFA 3RL2B 5L6YL 3VD5A 3S97C 4WHTB 2C1OB 3PWVB 3WHXA 1UM4H 2JF1A 3MV9A 2P46B 1NBVH 1P4BL 4HUWA 1IGTB 5DHXB 1XGTB 5I75B 1KB9J 4XP6H 2D31A 2P5ED 2RJMA 1ZAGA 1T04A 4TTDC 4K3JH 3IU3A 3SN6N 2J8UF 4HW6A 3ROOB 5E1AA 3U4BL 4P57A 3QIBA 4PV9B 3ZHDA 4MAUL 5JOPE 1IAOA 2YRPA 1I1RA 5D6CA 1W2KT 5EC2B 1MJ8L 3WNLA 1RQ5A 4ZAKA 4DCQB 5HHNB 1N5AB 3TBSA 2WANA 2FIKA 3U4BH 3DNKA 1JL8A 5JDSA 4H1LA 5JPNA 2RGSA 2F53D 4MAUH 1H0DB 2VLRD 4Q6IA 1R5VB 1NANH 4MNHA 5GGQH 2Z35A 4ELKB 3OAUL 5C0AD 1BJ1J 2OTPA 4GRLB 3TO2A 2CLVA 1ZLWH 2W9EL 5SV4A 4DW2H 1HHJB 4N8PA 4NC1C 4N90D 3HZYA 5DT1H 1IAIL 4AH2A 4OLYL 1KB5B 4J12A 1PG7X 1NL0L 4J3VA 2W9EH 1C7TA 3Q5YA 4LCCC 4G8EB 1YY9D 4RCAA 4MNQB 3QXDA 4MVBC 1IAIH 1XZ0B 5BOPA 2QR0B 1NL0H 4HK0B 1FG2A 2BSTB 5T3ZL 3RWGB 1ZMYA 3C5ZA 3UBXG 1V7ML 5SWSD 2G5BB 1G7JA 4XX1G 1KEGL 1DCLA 3SQBA 2F9BT 4P46D 3RGVB 3TCLA 3TPKA 3QDGE 3B9VA 3HC4L 1N6UA 1SJEA 5T3ZH 4BH8A 5SWZB 3EBAA 3HRZB 5H35B 3WDIA 4BFEA 4P2RB 3B4NA 4FXKA 4I3SL 3TA3D 1QA9A 1S7SA 5IB3B 1RJYA 2OM5A 5I1JL 4DZBA 3HC4H 4OUUB 1IEBA 5BMFH 2DI7A 4NKDA 3MUJA 5ADOL 4A2MA 4V3EB 4WDIA 4Y16A 2ADJA 1A6TA 1KT2B 3SDDA 5GIRA 5I1JH 5CSZB 1EO8L 1GZQB 1I8MA 5C08E 2BOCA 3ARTA 5EA0H 2YRZA 5IHUL 4NQEA 2G2RA 3JVGA 1JPGA 5IUSA 5ADOH 1Y18A 1EA9C 3BMWA 5DHVB 5T3XL 5IP4A 2V2XB 3L3KA 3THML 3V5DB 3VFSA 1JYVA 1EO8H 2F54A 2RIKA 2L7JA 1ZA3B 2X4SA 3HUJA 2H3NB 1IEAB 3M1BB 1NEZG 2W59A 5IHUH 5I76B 3DVIA 1ZK9A 4G80B 3WKNA 1PBYA 2BK8A 4HIHB 1OP9A 5T3XH 3VD7A 3ARXA 6CGTA 1PZ5A 1NFDA 2P8MB 2NTFA 1KJ3L 3THMH 4OD3H 3X11B 3EUUA 2DICA 3RNKB 4J4PC 2NY6C 1KNOB 4GRLD 4I2XB 4L4VB 2E5EA 2GJ6A 3HE6B 5BVJA 1PEWA 3O6ML 3G5ZB 5JOFA 3RHWK 1HINH 2V7HB 1A4KB 3IXTB 3D25B 4HS6A 4OZGE 3KPPA 5FYJD 2E7LC 1BZ7A 4NOFA 1UXWB 5CEZE 7CGTA 5E03A 4KKNA 4N5UA 4KUCF 5SX4I 4PGCB 4MNQD 3O6MH 3MV8E 2HYMA 1XH3B 4N5EC 5HSFA 2ICCA 4LCUB 3FQXA 1CD0A 5FKPB 2YXMA 4U7KA 5FUCE 3DXAB 1TJHL 4ZUSA 4DZ8A 4RGOL 4QRRA 1EBAA 1ZHNA 1JN6A 3LKQA 3BPOC 3G6JF 3RGVD 4TVPL 3OXSA 1FFNA 2ENYA 5EOTA 1NLDL 5I9QB 1DQML 2DLTA 4LASL 1KG0A 3C60C 3B9KA 4RGOH 4HLZG 4P2RD 1UKSA 4YBLC 4JEGB 4IIQB 1MPAH 1MRFL 2Q20A 3CJJA 5DUBA 1MI5E 5H37G 3WUWA 4LPUA 4I0CC 1NLDH 5F3HA 1DQMH 1UYWL 4YFLF 3ZKQD 2FGWL 3LEYL 4PLKC 4ZFZA 2DQDL 3ILQC 4LASH 3TF7A 2AVGA 1V7NL 5DUPH 3SDYL 4NNPL 4HUXA 2PXYC 4QNPF 3T8XB 4CAGA 4HJGB 1MRFH 3V7AE 1U8HA 4LMQI 3ZT7A 3D18A 3WV0A 4DVBA 1UYWH 3BHBB 3HC0B 3DGGA 3ZKNC 3QIUB 1DBKL 2XKSA 3RNQA 1ZT1B 1V7NH 3WS3B 3QB7C 3T0BA 1SBBA 3SJVB 3O11B 1NAMB 2O5ZL 5C09A 1DBKH 1LQSR 4AQOA 3MC0A 5KVDH 4GLRI 4JHWH 5DVLA 4XPFH 1G0DA 4OZHB 2HFEB 5GZOC 2ZUWA 1AQDB 5LCVL 2O5ZH 2YA0A 2XN9A 3V5KB 1HEZB 5A2IH 1JF5A 3IJYA 3HE6D 4ZOCA 2QADC 2R23A 1L9NA 2VDLH 2VLKB 4YEFA 5C9JA 2OR9L 2YD9A 5LCVH 2E9IA 3U30B 2I60L 1NGYA 3O2VL 1PD6A 2XWTA 3W5MA 2CIKA 4DFHA 3U7YL 4QRTA 2YS4A 3AU1B 5A2FA 2H8PB 4EQ3A 5JHDA 2OR9H 1HXMA 4CL7A 1CDYA 2P24B 2OR8A 3LN4B 2DKSA 2LAGB 3UXFA 4I9WE 5GJSL 3T0EE 4HDIB 1Q1JL 1LQVA 3CMOL 3DXAD 3U7YH 3VXUA 2YXFA 3TV3L 4YNYA 4YHLL 4QXUL 1IGJB 1AP2B 3H3KA 2DM2A 4Y4FB 4ERSL 2OQJA 3L3IA 5KTEH 3HG1A 3GUTB 4CDHA 3X3GH 1D5BB 4YHLH 2WW8A 4QXUH 1QSFB 3L3HA 1ZLUH 5D5ME 3DVGB 3QDJB 5AZEH 2R2BA 5CHNA 4D2NA 4KV5E 3CH1B 4Y5YC 2X4RB 1ZEAL 1FDLL 4PJIB 3F58L 4BFBD 3EZ8A 5DRZA 1WWWX 5E8DL 4U1JA 2MJWA 4K3EH 4PJGF 5BS0E 1INDH 1X6LA 2MSPA 1FDLH 4JFDA 5I19H 2OK0L 1YYLL 5KG9A 1O5DT 4CU7A 4M61B 5E8DH 5HVGB 2CK0L 3P77A 3FB6B 4S2SB 4X9GA 4WI9A 1BF2A 5DVOA 3EYOA 4OGXL 4EVNB 3TPUE 2A1WL 3OJDA 4PJHA 2C7UA 4HPOL 1YY9C 3MR9A 2WUCL 3UYOD 1A3RL 2UZYB 4YO0B 3SY0A 2ARJQ 4OGXH 4UU9B 1FN4A 1A21A 1D6EA 3O3AA 5EUOF 3LQMA 2QV2A 3U7WL 4BH7B 3QDME 2EZ0C 1DLHA 4FFVD 3KYOA 1PZUB 5HYIA 1A3RH 2VLKD 1H3UA 1M7DB 4P46C 1FJ1B 4K7FB 2GTWB 1YY8A 3TN0C 5FF6A 1HIML 2XFXA 3ZE1E 5D9SB 2DQJL 4PJ9A 1TITA 1EGJL 5CBEA 3ULVD 1BZ9B 1KYOJ 2UWEB 4HAFA 1N2RB 5J89A 4EI5C 3MGOA 1QUNA 4Z0BL 2X7LA 5CGMA 2XTJC 2DQJH 1TQCC 4Q2ZA 1JF1A 3C5SB 2B0SL 3QWOB 3E3QA 4Y4FD 4M1GL 5HTSA 2C9AA 5EO0B 5I75C 3GSOB 2KDGA 4LAQH 4L8DA 2AS5M 2BXYA 2VXVL 1CLCA 2B0SH 4HD9A 1QSFD 4NCC2 2AXGA 4NZRL 1A6VL 2R15A 5AAMA 1P6AB 3QDJD 1FHGA 4HFUL 1BQSA 1OB1A 4NO0B 5EU3B 3KDMA 4MA7L 3CC5A 2VXVH 3LKPA 4WU7B 4NQCA 1L6XA 4HFUH 3U7AA 2Q8AH 1MJUL 1CVRA 4FMFA 4GRLC 1E4WL 3D3VB 4XB7A 2VXSL 1MIEL 4MCZB 1T2JA 4P2YA 4JLRB 5ESAA 4QHMB 1KTLA 3ARGB 4XXCA 4ZPVB 3GHEL 1CVSC 3BEVA 1E4WH 2L0DA 3GI9H 2H9GB 5EH1A 1MIEH 5TE4L 4PJ5A 3CUPB 2MOVA 1Z9SA 1AE6L 4QGYA 4MWFB 3GHEH 3JV4A 1CDUA 4JGUA 1X5XA 5FA3B 5ACLA 4B7LA 5TE4H 1KIQA 3MBEB 4XH2B 2H32B 3BP6B 5JXEC 1TFHA 3MROB 3RWFB 4F9PC 1AE6H 3LSOA 1X5AA 3GK8L 3C2SA 5GGVH 2JELL 3CZFB 4LBEA 1LP9B 2JIXA 2EO1A 1F13A 5AYQA 1VCAA 5C86A 4JFOB 2YD5A 1YEEL 5DMKA 3CFCL 1CD1B 2P1YA 1GC1C 3GK8H 4TNWF 2R56L 3BP5A 2ZUXA 1NLBH 3FFCE 2I25N 1EAPA 3TT1H 1B0GB 4EDXB 1JZ6A 3F7RA 1YEEH 2X4OA 1F6LL 3CFCH 3O4LD 1P7KA 1QVOB 4P2OD 1ACZA 1S9YA 3IDXL 3R0NA 1OPGH 5FCUL 5BJTB 4Q7DA 1BX2A 2HMID 5T3ZE 4JZOA 1WCBB 1ZSDA 4PD4J 5B3JE 4GRWF 4JREB 5AYUH 3IDIA 3RA7L 5FCUH 3NA4A 5FUOH 3I6KA 3UTSB 5TF0A 5D2LA 4KMQA 1NDMB 3SDXB 2IANA 2A6JA 3RA7H 2XKNB 3G5XA 1G1CA 3P4OA 1I8LA 3IFNH 1LE5A 1JFQH 4U1SA 2E8YA 1KFAL 3HE6C 3D3VD 4LCWB 5IK3B 4Z76A 4HIXL 2R69H 3QULA 2DIBA 3ARGD 3MV9B 3FB7B 2PNDA 1KFAH 5GRVK 2OZ4L 2D31B 4GMSH 4LLYB 4JHBA 1T04B 4HIXH 4MMXC 2FBOJ 3IU3B 2G9HB 2X44D 5E1AB 4P57B 1QRNA 3QIBB 1YPZA 2O61A 4IJ3B 3D5OF 1IAOB 3GRWA 1MFBL 1QFWM 2OZ4H 5D6CB 3MBED 4HGWA 4P3DB 4ZAKB 5GSVA 1II4E 3TBSB 1L9MA 1DBMH 5D8JL 5JDSB 1PQZA 4H1LB 5JPNB 2NY1C 4UB0L 4Q6IB 5I9QC 4X99B 1KULA 4MNHB 2Z35B 4GG6E 3TO2B 3QUMA 4G5ZH 5DQDL 1J5OL 4IIQC 2DYPD 3RTQA 4UT7L 5D8JH 2GKIA 2VDML 3HZYB 5HVHB 4UB0H 4AH2B 3QUXA 3BDXA 4KH2A 1QLEL 1I1CA 1P84K 5KS9A 5DQDH 1J5OH 5E2UL 1SJVA 2AK4E 3QXDB 2VDMH 1TNMA 1MIML 4PV8A 3QIUC 1QLEH 3LPGA 4PJAA 2APTA 4IRJD 1M71A 2X05A 4HBCH 3C5ZB 5E2UH 1RZKL 3R1GL 4MHHG 3SGEH 3BEWA 4MXQC 4JHAL 5CP3A 1OVZA 2V6HA 3TCLB 3UTSD 2BJML 4UZGA 1UH4A 1SJEB 3DVFA 3MMEA 4BH8B 1C5CL 2ZJSL 1BPVA 1RZKH 3R1GH 3KYAA 2VN4A 5ISZE 4FXKB 5KZCB 43CAB 1QA9B 3INUL 4JHAH 4NCC1 4JJ5A 5GPRA 4BQ9A 5MEPA 3H9ZA 1RJYB 5CD3A 1X5JA 3QFJA 4DZBB 3QHTC 4LCWD 3DRQA 1FZKA 4NKDB 1C5CH 4JM2A 3WKML 5I8OH 4LDOB 3MUGA 3ULUH 1CXHA 1XGYH 2B5IB 4WDIB 4Y16B 1TIUA 1A6TB 4JY4A 3U30C 3SDDB 4JDTL 4LNVA 5GIRB 1I8MB 1IJ9A 5BV7C 4PYHA 2BOCB 2NQCA 5JIHA 4NQEB 3WKMH 2G2RB 1JPGB 2G75A 1CXLA 4GBXC 1Y18B 3IT8D 4HJ0C 2ZG3A 4OLZL 1XFPA 3QIBD 3L3KB 2X4PA 1H9VA 1JP5A 2Z92B 4UOJA 3VFSB 2F54B 2X4SB 3HUJB 2GK0A 4LPXA 2H2PD 5DD0L 3UTQA 4ZAKD 4UNVA 1PZ5B 1NUNB 4OLZH 1NFDB 2R0KL 2NTFB 3QQ4A 1AHWA 2E7HA 5F93C 5F6IB 5F6HI 5DD0H 5TDPA 4CUCA 5F9JA 1OHQA 1FBIL 4JY6A 1CQYA 5BVJB 1Q38A 5GRJL 2R0KH 4TSAL 3PHOA 5J0BA 5JOFB 2V9QA 1KPRA 4HS6B 4OGAD 3KPPB 2VQ1A 5IFHL 1BZ7B 1FBIH 1KPUA 3V0WL 2YHGA 1P53A 1I7ZA 4TSAH 3ZKMD 4FHBD 5E7FA 2A83A 1LMKA 5I1AA 2EC9U 5IFHH 3FQXB 2VZUA 5HDBF 3V0WH 1P6FA 3C5ZD 4ZUSB 4DZ8B 4PJ8A 3JWDL 2EKJA 3FHQA 4QRRB 4TUJA 2AXHA 1ZHNB 4NHCH 1JN6B 3LKQB 3PWLA 4H1LG 5HBBA 2Z31A 1N0XH 3OXSB 5JPMA 1FFNB 1WTGT 4TOYL 3HE7A 5EOTB 2HJLA 3ETBF 5I18L 4Z18A 1KG0B 3B9KB 4U6XA 5HGAA 3JWDH 4ZFOL 3MODL 1KLFA 4H8WH 3TEUA 5DXWA 5DUBB 3SE3C 2JJTA 3BVNA 3WUWB 4JRYA 5F3HB 2NPLX 2Y9RT 2YC1A 3DV6A 4ZFZB 1TJGH 4JQXC 4HUUA 1R6VA 2X41A 3MODH 4BM7A 4GAGL 3SDDD 3ELAT 2CDGA 3T4YA 4ONGL 4OTXH 1SYSA 5T1MA 3D18B 5HDOA 1VHPA 4DVBB 1MY5A 3OV6A 4OBSA 3UDWC 3DGGB 2N56A 5IVZA 3RNQB 3I6LE 4YBQD 4HMEA 1T1ZA 3P73A 4GAGH 2C1PA 5F9OH 1N26A 1JMZA 2F54D 3LV3B 1RZGA 4X9BA 4Y4HD 2B8OT 3O3UN 1XT5A 2VXUH 5C09B 5EOCJ 1EERB 3SCMC 3EDEA 4EEEA 4NM4H 4OFKA 3RVTD 2COQA 2V5TA 1HH6A 3RDTA 4IOSD 3QXUA 2XN9B 3IJYB 4K3HA 1MJ7L 3QI9A 5DVMA 2R23B 3RHWF 2IAMA 2XNAA 5C9JB 1OAKL 3EYUL 1UEMA 3EDKA 3VFNA 2B4CL 4OLUL 1SQ2N 4R96A 1NGYB 3NCYP 4X4XB 2XWTB 3VXPA 5IEHB 3KVQA 2CIKB 1MJ7H 4U6YA 4XPTL 4QRTB 3WIHA 1OW0C 1NCNA 2VLJA 5JHDB 3EYUH 1HXMB 1ZS8A 4KVCL 4FABH 1PYWA 1CIUA 1S7UA 4XCCL 3HC3L 4XPTH 3VXUB 4YNYB 1YEHL 3HMWL 4QRRD 4LSRL 1T20A 3ZDXF 4MNGA 3O6FA 2HKFH 4JB9H 2OQJB 3L3IB 1IKNC 3HG1B 1OGAE 1N8ZA 4X6CE 2XOTA 4DGVH 2AGJH 3A0OA 5B3NA 3B9KD 3HMWH 1MHCA 4ZNEE 3L3HB 3RKPA 3RX8A 3MX0A 2R2BB 3E2HA 5CHNB 3IJSA 4C59B 2JCCE 4MQSB 5ALCH 4EIGB 5DRZB 1OP3K 1ERNA 3KYKL 4U1JB 3BZDA 2WP3O 5CS7A 3QUKA 4XZUA 2GHWB 1YMHA 5KG9B 2Z93A 3QPQD 1WTLA 5A3ID 4LL9A 2CDFA 3KYKH 1F6AA 3P77B 3IKKA 1B2WL 3H2WA 4FXLA 1XR9A 1UQSA 3EYOB 4I4WA 3LRGA 5EWIL 3OJDB 1LK2A 4IM8A 4X7CC 2MNUA 1VFUA 1U2CA 5CSBA 3HPLA 3SY0B 4PUBH 4RMTA 2HKHL 2ZSVB 3VE0A 3O0RL 4NKIH 5HI4D 1FN4B 4UAOB 5EWIH 1QRKA 3WUWG 2XN9D 1D6EB 2QQNH 3O3AB 3QFDA 3I50H 4TUKH 3DX6A 4JREC 1DLHB 1X5ZA 3KYOB 2CXKA 3QUYA 2XI9A 4C83A 3IDNA 4B53A 4ODXA 2HKHH 4UMGA 3R8BB 5JIPA 3O0RH 3FO0L 5MENA 5BXFA 1YY8B 5FF6B 3U4AA 1U2HA 4C4KT 2XFXB 2VUYA 4PJ9B 4B7IA 5D7KD 1XGQA 5CBEB 3GJFA 1MF2L 4UQ3A 2EEBA 3WDHA 4G9FE 1CS6A 4M7KL 3MGOB 5FECA 2X7LB 1FRGL 3VXUD 3CNKA 4Q2ZB 1JF1B 1MF2H 1RUPH 3LN9A 3DMMA 5A2LH 4M7KH 1XGRA 3K1DA 2BDNH 4L8DB 2AXGB 3MRMB 3QIBC 3QPXL 3AGVA 4IJ3C 4ZO9A 4ODTH 1YEGH 3T3ME 1OB1B 3ZYOA 3N0PB 2ZUVA 3ARWA 3KDMB 1IMHC 3CC5B 1NGQL 1NAKH 2FHBA 3LKPB 1G0YR 1RZ8A 5D93B 4NKOA 4NQCB 4OKDA 4KRMB 5ANME 2ESVE 5J6HA 3S3JA 4Q6IC 1A9EB 5J1TC 1PLGL 4RA3A 3HI1A 1MCCA 1T0NA 3WSQH 4L1HA 1NKOA 1CL7I 5GGSY 4GH7B 4X9IA 5HVHC 1RMFL 3MRIA 1PLGH 4OGAC 1KTLB 3SGDH 3OWEA 4YXKL 4JPWL 1IL1A 1WIPA 2OSLA 3BEVB 2Y1VA 4ZXBA 1JNNL 2XXCB 4GG8A 4PJ5B 3ZKMC 4QRPA 3S3PA 1IC1A 4TSCL 2EEAA 1RMFH 2W07A 1J1PH 4YXKH 3JV4B 5DD5L 3ZTJG 3C5ZC 4JFYA 1DJSA 1KIQB 1QBAA 3WO3B 1BQHB 3LSOB 5JW5A 4RNRA 1B4JL 2K7PA 3WD5L 4LBEB 5L2JA 5EIVA 2JIXB 4PRIE 1S9XA 1KCKA 5DMKB 5CINL 3ILPA 2UVFA 5F89A 3O2DH 5MERA 3BP5B 3WD5H 2VDKL 1EDQA 4LCIL 1EAPB 4HGMA 3PWPE 4PLJD 2QHRL 4Y16C 4YIQA 3HB3D 5C0RL 3SDDC 2X4OB 3MUY1 1P7KB 5CINH 1A2YA 1S9YB 1UCTA 4PJEE 5F3BA 1BX2B 1WWBX 3JVGC 2VZ1A 4LCIH 3JV6A 4JZOB 4TYUA 4ZSOE 3N1FC 1CFNA 1ZSDB 4YBQC 4OZHF 3KPSD 3IDIB 4NJAL 4ETYA 4HSQA 1IC7L 3SDCA 5D2LB 1HI6A 1KC5L 4XNUH 5DLML 2IANB 3ULUE 2A6JB 2X9YA 5C0ND 4NQCD 4CGTA 1NDGB 5DD6A 1IBGH 2XA3A 3G5XB 3P4OB 1NGZA 1IAIM 1IC7H 2D4FA 1LE5B 4U1SB 4RGMB 1KC5H 2O5YL 5DLMH 3Q5OA 3ULVF 4WJ5A 4Z76B 4NHUE 2OXGA 3RWEA 1T7VA 5HDLA 2HVJA 3D69A 3TJHA 2XICA 5CCKH 5BRZA 3DLQR 1WBZA 4C54A 5JIKA 1MHHA 4PJ5D 5F1NA 4KRPD 2NCMA 3LCYA 5KANG 4Q0XL 4XVSL 5F9WB 1KUMA 1QRNB 5HI3D 3RUGA 5D1ZA 1YPZB 2O61B 3EFDL 4K71B 2B1HL 2P44B 1JRHL 2LFGA 4XVJL 4HGWB 1UACL 4NRXA 5GSVB 2AJ3A 4Q0XH 4XVSH 3QR2A 2XZQL 1IGML 1PQZB 4PJIF 3EFDH 5E5MA 1JRHH 2NW3A 4LSDA 4XVJH 3B9KC 3FT3A 1UACH 4WHDA 3QUMB 4BQBA 2XA8L 3RTQB 2XZQH 4POUB 1WC7A 1H8SA 4HQQH 3TF7C 3MA7A 4PTUA 5KS9B 1FFOA 2YZ8A 5K9QG 3AVEA 2R0LL 3B5HA 2NX5D 2FD6L 4YFEA 3RWHA 4PV8B 3J7HA 1EH9A 1WF5A 3E0GA 3QPQC 4PJAB 5A3IC 1CDJA 5T5NF 3V6BR 1M71B 3KXFE 4P2CG 1T1YA 3A67L 3IAQA 3BEWB 1JGVL 4WVRA 2FD6H 1BMGA 5JNYA 1N7ML 1PDKA 2C4FT 3LS5H 2NZIA 2FJHA 1FE8L 3MMEB 2XYCA 2BVUA 2B2XL 1EVUA 1SY6A 4F7PA 1JGVH 4U6TA 4P9ML 3QEQE 4JJ5B 5MEPB 4RBPK 5CD3B 1AI1L 3QFJB 5J6GA 1SHMA 3DRQB 1FE8H 3NFNA 4KHTL 1FZKB 4F37K 4JM2B 2HVKA 4MDJA 2B2XH 2UWEF 1N4XH 4UILH 2J6EA 2WK2A 4R3SA 4WFHE 5HJ3A 3MUGB 3MV7A 4KK8D 3L3GA 1CLOL 4OD1L 5D2NA 4JY4B 4XWGH 5JZ7D 1OAXH 2VIRA 3MLSH 3QIWA 4KHTH 3DVNA 2M8XA 4PRBA 1UZ6E 2G75B 2DJUA 4OLXL 3RWJB 3LKRA 1P7QD 3BIBX 3WXWL 1QRND 5EPMA 2X4PB 2KQMA 1GIGL 1VEOA 4LLAA 4O2CA 3QCVL 2W91A 1Z5LA 4ZD3H 3UTQB 5ABDE 1H8NA 3ZKSD 5HPMA 3WXWH 3FOMA 1M6OA 2ORBL 1T0PB 3QQ4B 5JMRA 1AHWB 4DK6A 4OZIA 5FM5M 1WBXA 3T08A 3WDJA 2PCPA 2EE2A 3QCVH 2NY4B 1IEHA 5TDPB 5F9JB 2OP4L 4P4RA 5CZXC 4D9QE 4JY6B 3OKLA 3RTQD 3VXTA 2ORBH 3PHOB 2V17L 2BRRH 4XP1L 1KPRB 3K4ZA 5E7BA 2VQ1B 2OP4H 4WGVB 4WEBL 2H6PA 2OMBA 2DN7A 1MWAL 2D0HA 2V17H 4J7RA 1W72H 2A83B 4WENB 3GMLA 3JWOL 5I1AB 3D9AL 4RAUA 1S9VA 3HHRB 2BNRA 4WEBH 3GSRA 4PJ8B 2GTZA 1FYTE 3AS2A 4TUJB 4OLWL 4NUJA 3UJIL 4APQA 3JWOH 5JPMB 1FL3A 4QCIA 2DQHH 2HJLB 5EU6A 1CE1L 4EI6A 4U6XB 1EFXD 5EBLA 5HGAB 1RUAL 1U8MA 1JZ2A 4NPYA 4NSKA 4OLWH 4UAOC 3UJIH 4KK9D 3BVNB 4HGKC 1LP9F 4KUZL 1FO0L 4JRYB 4H26A 4JM2D 2YC1B 3DV6B 4C57C 1CE1H 3BIKA 1MFNA 4F7CA 2D7TL 2GK2A 4RMWA 1AQKL 1NJ9A 2ITDA 3MUHL 4GAYA 2CDGB 2D7OA 3QDGD 3T4YB 4KUZH 5HHME 1FO0H 1X4ZA 5E0QA 1SYSB 5T1MB 4DWHA 4PJ9C 1V3MA 2W38A 5FV2A 43C9A 5IVZB 2CDEA 1NCCL 1XIWC 1D9KA 2D7TH 3FB8B 1T1ZB 1O7SA 3P73B 2C1PB 2LU3A 1CXFA 3CLFH 3GIVB 4FTVE 1QSVA 4Y8DC 3WFZA 5KVGH 4F9LA 3E3QC 3LQZA 4HEPG 3HB3C 3VWJA 2P7TA 4GAJL 3ZZ1A 5C08D 4AZ8A 4P23A 1HH6B 3TBVA 3SDXF 2NY4D 3RDTB 3PF2A 3L5XL 1GPOH 2DWEA 3FT2A 3ZDYE 1LWRA 2IMMA 1A3QA 4GAJH 2IAMB 2XNAB 4FFZH 4KRLB 2APFA 1RHFA 3S4SA 1S7WA 3GKZA 1HH9A 2YPVL 4R96B 1AGDA 1Q0XL 3VXPB 5C0NC 4U6YB 5D93C 4QY8A 4YC2B 4MD0A 4KKLD 2X2YA 1ZLVK 2LQRA 2VLJB 4RAHA 1DVFD 3OAYK 1ZS8B 5FHBH 1PYWB 2V5YA 2YPVH 1S7UB 5GGRY 1Q0XH 5CJXA 2OXHA 1DSFL 4GLRH 1QD0A 1UENA 1T20B 4XXCC 4MNGB 4H0IA 3O6FB 1FIGH 2HH0H 5ELIA 2ZCHL 1EGJA 1N8ZB 4OCMC 1KJVA 1MFEL 2Y7QA 5J11B 1DSFH 1MHCB 5EN2A 3PGFH 5KAQG 4G8IA 5F7NC 1NUFA 5HI3C 3F7PC 4JPVL 3OJMB 3E2HB 3ALXA 3IJSB 2ZCHH 3LOWA 5BW7C 4JRYD 2EDLA 1NCWH 3CK0L 2XQBL 3QT2A 3QUKB 3VFGL 3ARUA 4WI6A 1OTUD 4WFFE 4PDCE 4XZUB 1KXQE 1CGYA 1YMHB 4NFBA 3CK0H 1T3FA 3U46A 5B39A 3OKOA 2Z93B 1FSKC 3K8KA 3EJYD 2LU7A 2XQBH 4LVNB 2CDFB 1F6AB 1XR9B 3M07A 1YMMA 3VFGH 3LQAL 2Q7YA 1UQSB 5F71A 4I4WB 2N4IA 1YJDC 1LK2B 3MLZH 3Q3GA 5B8CA 4KXZH 2R0WL 5DJ0A 5T33H 1OP5H 5FHAL 5LJYH 4JFFA 2HRLA 3HPLB 3LQAH 1TENA 4O9HL 1FLTX 3IETA 2UY7A 1T7ZA 5FYKH 3O8XC 3QFDB 4NIKB 5GZNC 2R0WH 3DX6B 1ITBB 1Q94A 4NZTL 3QUYB 4FQPA 2IAMD 3IDNB 2BNUA 4NN6B 3H42L 4WGWB 4X83A 3UTPE 4ODXB 4C83B 2A2QT 4O9HH 5MENB 5BXFB 4V2CB 3O9WA 3QWRA 3NTCH 1XGQB 3GJFB 4NZTH 1EBPA 1VB9A 1I8LC 3H42H 1O0VA 2IPKA 4UQ3B 4QRSA 3GKWL 1P4IH 3DWTA 4RGMC 5GGVY 5FECB 4K07A 4X6DA 3KHOA 4KTYA 1BOYA 1XMWA 1G0XA 1NGPL 1R3HA 1LGVA 3DMMB 2ED9A 1I1FA 3O6FD 1RK1A 5JZ7C 4Y0GA 2CQVA 2C26A 3KNBA 1XGRB 2IBBA 4YPJA 5I16A 4OCLC 1X4XA 5EOQL 1ZTXL 3WNNA 3JTSA 1NGPH 2EDEA 5F9WC 2VISA 1AXSA 4FFWD 4K71C 3BMVA 5DO2D 4ZFFA 3T0ED 1YC7A 5J56B 3SO5A 3EYQC 5EOQH 5BZWA 2NY0D 1A1NA 4ELME 4YHPB 1RZ8B 2BY3A 1ED3A 4NKOB 5J6HB 1SYVA 4FG6D 3HI1B 2LAAA 1T0NB 3CFEB 4XVUC 4YR6A 3REWA 4M6OH 3H3BC 4FQJL 3RTQC 5BVPL 3IDGA 1PEZA 4M93B 4XNMA 3ZHLA 1ES0B 3KLAA 3OHXA 2FH6A 3QUXC 3MRIB 4A6YA 3HCVA 3GBNL 3KLHD 1KSRA 4PGBA 1HCVA 1IL1B 2OSLB 2HTLD 1U42A 2DLIA 1E28B 1JNLL 4O5LL 4ZXBB 5F1OB 5BVPH 3P11L 4GG8B 1JTOA 3UZVB 4QRPB 1UADC 4Y1AE 3M8OL 1RUQL 2QKIA 3GBNH 1MY7A 2PTTB 3MRDA 3STZA 1JNLH 5E2JA 3GMPA 2CGRL 4JFYB 3P11H 3QEHA 3M8OH 4ODBD 3U0TA 1RUQH 4ODUA 2GUOA 2R1YA 3CSPA 4PJ7A 4Z78B 5JW5B 4RNRB 4ONFH 3QXVA 5I1DB 4P3CL 1PVHA 5F96L 2CGRH 2FX8L 3U9PL 5L2JB 2QQQA 1S9XB 2BSSA 2VWEE 4BZ1L 4M5YL 1CFVH 5KSVA 3QJHA 3K4AA 4B41A 1ZWIA 1SJXA 5F89B 5D1QA 1RURL 4R4ND 4P3CH 4JM2C 4DOHE 5I1CL 3U9PH 3EYSL 5FOJA 4ZTOL 4N1CA 4YIQB 4M5YH 3DMMD 5CZKA 4ZMAT 1CZ8L 3UEZA 5HVFB 3MJ6A 4YBHA 5DMJB 1A2YB 1RURH 2VC2L 5F3BB 2NLJA 5I1CH 4QGTA 3JV6B 3EYSH 4JN1H 5LBSL 3BAEL 1CFNB 32C2A 4PJBB 1CZ8H 1BD2A 1I9IH 2WV3A 5C0BA 2IG2L 1A14H 4WI7A 3ROLA 5KSBE 4JM4L 3PP3H 3C87A 3SDCB 4S10A 1HI6B 1N5YH 1NFIA 4YFDB 2EYRA 1J0HA 1AHWC 2IG2H 5DD6B 1QSEA 2HJKA 1NGZB 5DJAA 4JM4H 4MSWA 5C0JA 2NY4C 2FHCA 4MA3A 3OKMA 4J6RH 5IVXE 1I1AA 1BF8A 3S37X 3RWEB 5I1KL 2HVJB 3D69B 3VGDA 2ARJB 4R97C 3EDDA 2YKLH 1WLHA 1NCBL 4ZXBD 3G6JA 4BFIA 2K9UA 5BRZB 1G7LA 1UGNA 1WBZB 1MHHB 5F1NB 4LIQH 4QRPD 4EXPX 1BFTA 4S0SD 1FGNL 2I07A 4FQHA 2HT2C 3WNKA 5I1KH 4RMRA 1KF9B 5EZJA 4GRMA 1JTPA 3VGHA 3RUGB 5D1ZB 3TP4A 1CICB 5KSAD 1X5GA 3Q0HA 4HAGA 3IDJA 4PJ8C 3LMJL 4JFEA 5JW4R 1FGNH 4GKNA 4HK3N 2AJ3B 2Z31C 4POZC 3HE7C 5E5MB 1SBSL 2NW3B 4Q9QL 2EH8L 4LPVA 3FT3B 5EFIA 1EMTH 2XWJA 1P84J 1Q9OA 1L7TL 5IGXH 2AABH 2JJTC 4QOKA 1WV7T 1WC7B 2VZSA 4TUOA 5JO5A 1SBSH 1UB6A 3OG4B 2A9NH 3VD3A 1HE7A 4Q9QH 2IH1A 2EH8H 4OLEA 3MA7B 4PTUB 2BNQE 4WU5A 1FFOB 2AXFA 5D7SL 3FCTB 4LRIC 4ZS6D 1OTUC 1CU4H 2BY2A 3RWHB 4WFED 1C5BL 3MRQA 4XP5H 5EC1A 1OSZA 4UBDD 4V1DE 3V6OE 1T1YB 4HZLB 3EO9L 3W39A 3OKEA 4OKVB 1CGWA 3FFCD 1C5BH 3SDCD 3ZL4L 1VA9A 1JGLL 3NIDF 1NANI 4XWOD 2NY5H 4MHHI 2FJHB 3OZ9L 3OAZH 2A74A 4F7PB 1J0IA 3EO9H 1BECA 3RDTC 2J7LA 4KKCC 3ZL4H 1JGLH 5T3ZD 4P2QE 5J6GB 5ESVA 1KIUA 3DSFL 1HQRB 3QI9C 3NFNB 3OZ9H 3FAXA 4NC2B 2HVKB 4MDJB 5HJ3B 2IAMC 4R3SB 4PGEA 3MV7B 3ARSA 3TJHD 3L3GB 2WBJC 1IAII 2FR4A 3DSFH 2VIRB 3QIWB 1ZLWK 5BRZD 4YC2C 2MHAA 3MOQA 4L4JA 4PRBB 4QXGL 4ZFOA 4N1EA 2ZCKL 1S5IL 3LKRB 3OR6A 3PV6A 5D1ZD 1CICD 4JG1L 1MCSA 4F7MA 4O2CB 1WZKA 4MDIA 5A2JH 3GSNH 5IWLA 4QYOA 1VPOL 1Z5LB 1S5IH 4R90H 4HKXA 4EUPA 3G04A 4HKJA 2D7MA 1IC4L 4XAKD 3SBWA 5HPMB 3FOMB 1M6OB 4JG1H 4OZIB 4PJXF 1WBXB 1CGUA 2PCPB 2E8ZA 4PJGA 2IPUG 1MLCA 5T3XD 5E5RB 4LSQH 1IGFL 3DX7A 4P4RB 5E2TH 1TNNA 3OKLB 3E2HC 2YMXH 4FFWC 3VXTB 1F3JA 1K5NA 3BWUC 1XCQA 1CFQA 3QZWG 1NCAL 1IGFH 1INQA 2BVPA 1A7BA 2H6PB 3AREA 1Z0MA 4X80L 3BZFA 4FG6C 1KCGC 3TLRA 1YQVL 2P5WE 2UUDH 3GMLB 1T03L 2FL5A 4RAUB 3LKNA 1S9VB 4LVNC 3VWKD 1F5WA 3GSRB 4ODWA 3UTZA 3QQ9C 3DURA 2GTZB 5EUOA 2C3GA 5ESQA 1NUGA 3KLHC 1YQVH 4NUJB 2HN7A 3DO7A 4APQB 1DN0A 4DTGH 2HTLC 4GQPH 1T03H 4MX7A 4WI4A 4X7EC 3S36L 1FL3B 2YN3A 1OM3L 1FVCA 1P9MA 4M03A 5EU6B 2L7UA 2B1AH 4EI6B 2AK4D 3RVVD 1U8MB 1C12B 4NPYB 6FABL 4NSKB 5GS1A 1CI5A 3S36H 1X44A 4F37F 4H26B 2WUBL 3NPSB 4I3GA 3BIKB 3QUYC 4NN6C 4X4ME 1J1OH 1WZ1L 2PR4H 1RPQA 4U1GB 6FABH 1FGVL 4LCYA 1I8KA 1MQKH 2ITDB 4GAYB 4HIJA 2F74A 4LFHD 3QIWD 4RA0C 3KYMA 4TPRH 4TRPL 43C9B 5C0CA 4XNQA 2XTLA 1FVEA 2YN5A 4PRPA 2CDEB 1WZ1H 4XVTH 2OBGA 5TQ0L 1F4WL 5FYKE 1LO5A 3GJEA 4TRPH 5J06A 3RY6A 1NCDH 3HLAA 2P8PA 3DMMC 3LQZB 5FGSA 5ADPL 3U36A 3L3JA 3VWJB 2P7TB 1PKQA 3IKCA 1EIBA 3HR5A 3N1QC 15C8L 5FYJU 3W0WE 2JB5H 4P23B 3KS0H 4J3SA 3TBVB 4CN1A 2RFXA 2CMRL 3DYPA 2DWEB 3C8HA 3FT2B 4JO1L 4LSSL 2OL3L 3C8DA 1JHLH 2W60A 2R0ZH 4J8RA 4X7TA 1PGRB 2A6DA 15C8H 1AO7A 3S4SB 1DQQA 3VI3F 1ZVHA 1S7WB 2CMRH 3I6GB 4P9HL 1ND0A 4LFHG 1HH9B 3G08A 1AGDB 3P0GB 2IEPA 4HWUA 1EV2E 3R8QA 1VFAA 4QY8B 5T5FH 4MD0B 1QNZL 3EAKA 3JV5A 3SEPA 4PYGA 1ZHBA 1KN4L 1HILA 5K9KA 3GBLA 4M93C 1WUNT 4QRUA 1C5DA 5CGTA 5JHLH 2R4RL 1QNZH 3ZDZF 2YA2A 1FZJA 4APQD 1NBYB 1ADQH 4JO2L 1KJVB 4X6EA 2Y7QB 5IB4A 1F90L 5EU6D 1OAZL 2R4RH 3IRPX 5EN2B 4G8IB 3P0VL 2ZUTA 3V4VL 1GGIL 3VFTA 2C4XA 4JO2H 4NZUL 1C08A 5DEGA 1OAZH 1ETZA 4YHNA 1SVCP 4UTAH 2I9LA 1MCHA 3KPRA 4HEME 3IYLW 4NZUH 1JWSA 5HY9A 2PYEE 2VZVA 1T3FB 3U46B 5B39B 5DURB 2DWDA 3OKOB 2D3VA 1SEBA 2VLME 4W70A 5CFHA 1G9NL 3RU8L 1YEKL 2R2EA 2VWEC 1F42A 1XF3A 2Q7YB 3RY4A 4PJAF 3GIZL 1WZLA 4PJDA 4WEMB 4DN4L 4K8RH 5ILTL 4PREA 5B8CB 2CPCA 5DJ0B 3VWJD 4ZS6C 1OQXA 4YDLB 4NC0B 4JFFB 1G9NH 1FC1A 1S7RA 3CFBA 1ZHLB 4X8JA 4KI5E 1IC5L 3GIZH 3IETB 1CT8A 4DN4H 5ILTH 4LLDA 4UBDC 3I6LD 1Q94B 5L8LB 4O2EA 2BNUB 2PTUA 3SDCC 5HYSA 1IC5H 3B9DA 4XWOC 3MLXH 5DFVD 3O9WB 4N8VG 4JM2F 3EHBD 1ZLUK 2VRAA 1QACA 2J8UE 2FO1A 3FB5A 3VFRA 2YUVA 5IB5A 1R3IL 2FZ3A 4QRSB 5ICXA 2W0FA 1FZMA 1JI2A 4X6DB 4OZ4A 3TJHC 1R3HB 3WE6A 1R3IH 3OXRA 5F7EL 1I1FB 1RK1B 3WCYA 4M1DL 5I16B 3BH8A 4FQCL 3S96A 5DJ2A 3EO1A 2YD8A 4OV6F 2JTDA 3JTSB 4Q58C 1Q9KA 3B8SA 1TVBA 3PGCA 5F7EH 5D1ZC 2VISB 1AXSB 3TCXA 4M1DH 1HZHL 4ZFFB 3FQNA 4FQCH 4PJFA 3FOLA 2Y6SD 5D7IA 5BZWB 2EC8A 4JO4L 1A1NB 4OD2A 1NKRA 1YEJL 4P0DA 1KELL 1HHGA 1SYVB 4LAJH 3IJHA 1MOEA 2FSEB 2NR6D 1A6PA 4YR6B 5C6TL 4JCLA 3REWB 5DURD 1ZE3C 4JO4H 1JPSL 4JANA 1YEJH 3VH8G 4LIQE 4D0BA 5ERWA 3IDGB 4X7DC 4XNMB 1KELH 5BQ7A 3KLAB 3OHXB 4NO3A 5HD8D 4X0KA 2AQ2A 3HCVB 3QISA 1KACB 5C6TH 4PGBB 2DL2A 2XWBA 3SE9L 4FZEL 4EJ1C 8FABA 1TCMA 1FNAA 3PDOA 4HS8H 5LXGL 3IF1A 1H15B 2P43B 2R1XA 1S78D 2QKIB 2DLFH 2RCSL 5IG7A 3SE9H 4DKEH 1GHFL 2ZUSA 2VYRE 3STZB 3GMPB 3WFEH 3JTCA 3QEHB 4OSUL 3VXRE 5LXGH 4P5MA 2KZWA 1QZ1A 1CL7L 3U0TB 4F33A 4OF3A 4ODUB 2R1YB 4PJ7B 4V2BA 3FQWA 2RCSH 3O9WD 3QWRD 1GHFH 1UJTA 3P4LA 2P48B 5B39G 2X70A 2BSSB 4G7VL 1LO2H 5KSVB 3QJHB 3SGKA 4GUPA 1DQLL 1ZWIB 4L9LA 3U83A 2YBRA 2VDPH 2DQGL 5D1QB 4YPGA 3V6ZA 1F2XK 4HWZA 4L8SA 1FAIH 4K94L 5DK2A 4XPGH 5D2NC 1IAKA 2JE8A 2ZG1A 3D87B 4KROB 1U8KA 4N0YH 3OSKA 3QIWC 25C8L 2NLJB 3BQUA 1KCSH 5DDHA 3TO4A 4KI1A 2X9WA 4K94H 32C2B 7FABH 3NN8A 5ETUA 1BD2B 5C0BB 3GO1L 1ITCA 3ROLB 4LARL 2Y5EA 1AIFA 2WQ8A 5E94A 1K8IA 1JPFA 2J8OA 2EYRB 4L4TE 4RFOL 3GO1H 1KOAA 1A7RH 4M5ZL 1QSEB 2HJKB 1IM9A 4LARH 4MSWB 5DJAB 5C0JB 1IE5A 4MA3B 3SKJL 1G6RL 4XBPA 1I1AB 1Y0LA 1KPVA 4U2YA 3RWIA 4D3CL 5D70H 3OX8A 4Z7WA 2P5EA 1BIHA 4M5ZH 3D6GA 5DC4B 3SKJH 4BUGA 1G6RH 3PHQA 4FQLH 4HKZA 4BFIB 4D9LH 3G6JB 4XBEL 1G7LB 4RSVA 5HYJA 2M26A 4D3CH 2I07B 4FQHB 2DQCL 2X4QB 1R3KA 5EZJB 1LK3L 2BSRA 3HMXL 1F3DJ 3K8MA 4KHXL 2VLRA 5BO1H 2VERN 4JFEB 3EIFA 4GKNB 2DQCH 2GYSA 4KTEH 1LK3H 4APQC 4KAQH 5C9KA 4KHXH 5I1IL 3FQUA 3GSWA 3LEVH 3MZTA 3TVMB 2J88L 4H20L 4M8QA 5EFIB 2XWJB 1Q9OB 3K74B 4GO6B 5IIEA 3QH3B 4QOKB 1FAKT 3NH7L 4ZOBA 4TUOB 1DLFL 5D1QD 5CP7A 5FM4A 5JO5B 1UB6B 3E6HA 5I1IH 3NPSC 3MXWL 2IH1B 3MJGX 4LHUA 4U1GC 5D5MF 4YHML 2AXFB 4KV5F 3K0WA 3NH7H 4KROD 2QTEA 1DLFH 4MJIE 5DD3L 1UG9A 5SWSA 1BFOA 5E9DA 3MXWH 4ZOAA 1GSMA 5EC1B 4PRID 3WFBL 1D9KC 1OSZB 4PP2A 1U8IA 1J8HE 1BD2D 5C0BD 1AD0A 1U8LA 3W39B 5IJKA 3OKEB 5DD3H 5AWNL 3TA3A 3CU1A 2W9DL 4F9LC 4NQSA 3NCJL 1MWAA 3VWJC 2ICEA 2A74B 3BN9D 1IT9H 4YK4B 1QSED 5J57B 4P23C 4WHTA 2C1OA 2W9DH 5JQ6L 1BLNA 3NIFE 1J0YA 5ESVB 3NCJH 1KCUH 4M48L 5FGRA 1QLRA 4PGEB 4PP1C 4H0HB 1HDMA 4LPYA 1D5IL 1Q0YL 4NUGL 2XQYG 3ROOA 4H5SA 5IMLA 5DFVC 1KJ2L 5JQ6H 2FR4B 4CMMA 3FTGA 4EBQL 2MHAB 4M48H 4ZFOB 4ZFGL 5EC2A 4KQ3L 1FYHB 3T1WA 3OR6B 3SGEI 1N5AA 1D5IH 1Q0YH 2C5DC 3PV6B 5EO9A 5FA4A 4YXLH 3EFFA 1KJ2H 5F7HA 4F7MB 1A7NL 4MDIB 4EBQH 5CJXC 1FLRL 3TYFA 1VDGA 4QYOB 4KQ3H 4HKXB 4EUPB 3G04B 3C6LA 3H3PL 4HKJB 3H9YA 3VXMA 1MNUL 4D8PA 1A7NH 1F00I 4PJGB 1FLRH 1MLCB 5JMOC 4X7SL 3TVMD 3QWQB 4OFPA 3DX7B 1OAQH 4MJ4A 3H3PH 2Y07L 2KZ1B 4Y4KC 1F3JB 1K5NB 3X3FH 3RGHA 1XCQB 1RHHB 4MNQA 2ZOLA 3BISA 3B6SA 1A0QH 4NWTH 2Y6SC 5DJCA 1XZ0A 4WHYG 1CFQB 1MCDA 4X7SH 2QR0A 1INQB 3MSPA 2BVPB 3AREB 2Y07H 4HHAA 4M4RA 3BZFB 1DANU 2LABA 4PRHE 3EOBB 3MNWA 4XMPH 4AEIL 2FL5B 3QCTL 3LKNB 1BGXL 3HS0A 4HWBH 5CJBA 3WO4B 4ODWB 3UTZB 3MACL 3V79C 3GSUA 4JQVA 3DURB 5EUOB 1V3LA 5ESQB 3UTTE 4XRCB 5IBLC 3ZMRA 2HN7B 3DO7B 3NCYS 1DN0B 3QCTH 4MX7B 5B8CC 1BGXH 3EKCA 1WEJL 1FVCB 1V3KA 4YDLC 3MACH 4U1MB 3KPLA 1FCGA 4LSVL 5GS1B 1S78C 3B43A 4YUEL 4GJTB 5FO9A 4U1KA 5GS0C 5FO8A 2W0KA 4U1HB 3WNOA 5CIPH 4PB9H 3X13A 1A6UL 1WZMA 3L5JA 4K3DL 4LSVH 4YUEH 4LCYB 1I8KB 4NFCA 1K3ZA 4HIJB 3O9WC 2F74B 1R24A 4OF8A 5CEYA 1TTFA 3KYMB 4NGHL 2EDDA 4XNQB 2LVEA 3DUHA 4PRPB 1A6UH 1NBZA 1I3UA 3QEQD 1JWMA 2N7AA 5FGBC 3MLYL 3LPWA 5TDOA 4CVZA 1T21A 1LO5B 3N85L 3GJEB 3GZKA 4I18A 4PJBF 3O6LL 2P8PB 3U36B 3L3JB 5DK0A 4YWGH 1AC0A 2GFBA 4JGMA 3NFSL 4Z0XB 3HR5B 5EORL 5E8EA 3N85H 2RFXB 3S5LG 3O6LH 4OCSL 1R3JA 3TZVA 1W0VA 3MXVL 4O51A 1T7YA 1CXEA 2W60B 4J8RB 4X7TB 3NFSH 5H37H 2A6DB 1KB5H 3UAJD 1F4XH 5EORH 1T1WA 5DK3A 5C07E 1AO7B 1DQQB 1GJIA 2C3XA 1F8TL 3LS4L 1ND0B 3G08B 4OCSH 4MS8A 2DBLL 1TVHA 3MXVH 3ARED 1VFAB 4WUUA 2A77L 2J8HA 4W6WB 5D7LE 3K46A 5CUSH 2R29L 1ZHBB 4QHNA 1F8TH 3LS4H 1HILB 1JE6A 5K9KB 1FNFA 3BDYL 2AEPL 1VFMA 1C5DB 4QRUB 4M3JA 3TESA 4EUPG 3RUGF 2VITA 2CR3A 2R29H 4Z7VE 1GC1L 4M7LH 3DGCR 2YK1L 3WHE1 3BDYH 4UNTA 1A7QH 4X6EB 5IB4B 3LZFL 4NYLA 5J4MA 5B38A 1GC1H 2QSVA 1YYML 4G3YL 2YK1H 3VFTB 3NCMA 1C08B 4BK5A 4L3AA 5DEGB 1ETZB 4YHNB 4RISL 1ZT1A 2YOCA 2I9LB 5CD5C 1NH6A 3KPRB 2X6MA 5E4EC 4ONHA 3WS6A 5HY9B 1JWSB 3BP4A 1UKTA 2DWDB 4GRWE 4IRZL 4C56E 1SEBB 3P0YH 4PRPD 1OF2B 4RISH 4U6HA 5HYFA 3NVQA 1CDCA 5D1XC 3K3QA 2R2EB 3MRNA 1XF3B 4N0FA 3LB6C 4PJDB 5FCSH 4WFGE 1LDSA 1ZLSH 4PREB 4JRXA 4WI8A 3BIAX 4KROC 1K6QL 3AB0B 3DV4A 1S7RB 3CFBB 4TULL 4MQTB 4P5TB 4ZUUA 1CT8B 3BP7A 3GI8H 1NBQA 4M62H 2ZOKA 4LLDB 4JQIL 1JNHA 2APXA 4DQOL 4J2XA 1K6QH 2DQFA 3D39E 3BFOA 4O2EB 4ZUWA 5CEZL 4AYFA 4TULH 4HWEL 3QO1A 1AO7D 5HYSB 1U8JA 4RMUA 2P24A 1I3GL 5M7QA 4JQIH 3B2UC 4DQOH 4E5XB 1U3YA 2FWOA 2GSGA 4ALAL 3FB5B 5IB5B 4HWEH 4Y4FA 2W0FB 1FZMB 1I1AC 4U4BA 2GAZA 4QHKI 5T1DH 3HI5L 2OMNA 4AEFA 4OZ4B 3IGAA 4ALAH 3ARDD 3RPIA 3WE6B 4KWUA 4UINL 5FUZH 3OXRB 1Y6MR 2I5YL 2E7LE 1UCBL 3AMLA 3BH8B 4G8GE 3S96B 5DJ2B 1OD7A 3EO1B 5HGHA 3HI5H 5HGBA 4DKFL 1I3RA 4W6XB 3R06B 1K3IA 1Q9KB 1TVBB 2NXZB 3PGCB 2Z0BA 3RJDA 3LD8C 2I5YH 3CMGA 3V6FB 4JKKA 3FQNB 4PJFB 2BCKA 5GGUA 3FOLB 5D7IB 1ZHKA 1EHNA 1KGCE 1JNJA 3JSSA 4OD2B 1B6DA 1EHLL 1B6UA 4LU5L 1HHGB 3KPRD 2YPLE 3IJHB 3L95A 4HCRL 4LSPL 3ZE0F 4WV1A 3H9SA 3I9GL 4JANB 5L7XL 4LQFH 4D0BB 3VG0H 3UJJH 5ERWB 2QQLL 5BQ7B 2GITA 5DJYA 1BVKA 4NO3B 4X0KB 2H1PL 4CMHB 1PX3A 1JPTH 2XWBB 4BZ2L 1J0KA 3I9GH 4UU9A 3PQYE 5L7XH 8FABB 2QSQA 4WWID 1N64L 5HHOA 2CO6B 3PDOB 1BIIA 1VFOA 3IF1B 4OZFA 2R1XB 4P5TD 1MAML 5IG7B 5BV7L 4BZ2H 2GTWA 1QQDA 1D5XA 2B7DT 4GS7B 1N64H 5INDA 4XCNA 4OM0L 2YD3A 4P5MB 5AG9A 4F33B 3FQWB 5BV7H 4Y2DC 2GW5A 2RR3A 1GOFA 3H7LA 3ES6A 1CLZH 3TBTA 3NIGE 1FORL 4U05A 4J3UA 5CILH 5ALBL 2HFGL 2X70B 4FQ2L 2NY2B 4UOW0 4GUPB 5DRNA 4L9LB 4P2OA 2YBRB 3O4LA 3I75A 1HYSD 5F7WC 2F8XC 4YPGB 3V6ZB 3SGDI 4E42A 1FORH 4F80A 3TJEH 4HWZB 4FQ1H 1FFRA 4KGJA 5ALBH 5EUKA 2HFGH 1A7PL 1SMOA 3QG7H 4L8SB 4FQ2H 5DK2B 3UTPD 1IAKB 2VXTL 1UH3A 4CJ1A 3BYYA 5DDHB 3TO4B 1JZ4A 2VO5A 4Y19A 2P42B 3NCEB 1A7PH 5GS2H 3TBYA 4YHKL 3WFDH 2NXZD 3NN8B 5ETUB 4WU7A 1CF8H 2VXTH 3EDFA 3VA6A 4OFYA 5HHVL 5HYSG 4LPCA 3A6CL 3WUZA 3W2DH 4DOHB 5IWLC 1AIFB 3ZE2E 1K8IB 4YHKH 2Z8SA 1JPFB 1Z0NA 4QRQA 5HHVH 1IM9B 4QHMA 2D7NA 1YN7A 3HPJB 3MV01 1K4DA 4D0DA 4XBPB 2E7MA 1Y0LB 1KPVB 4R26L 3OX8B 4Z7WB 5DYOA 4FFYH 4WO4D 3UAJC 3C08L 4H88H 1DQDL 5E99L 3WN5C 1FZOA 3PHQB 3MCLL 3MRRA 4HKZB 3AREC 1J11A 5FA3A 5HYJB 1TZHA 2F53E 1SMAA 5GS3A 5DR5L 3WJLA 3MROA 3RWFA 5GRZA 1DQDH 1XGPB 2BSRB 4L3EA 5C0AE 2EDTA 3MCLH 5SWQA 4DUVA 3SPVA 2VLRB 1MFDH 5L2KE 2B4CC 4N90E 3ARBA 2AJVH 3MLUL 2AV1A 3GGWA 3MLWL 5E8OA 2DYPA 1MRDL 3TNMA 3QXTA 1UA6L 2YD7A 1P9MC 1LO4H 3FQUB 5EBGA 3GSWB 3RPKA 3SOBL 3NAAL 1JYNA 2R8SH 2V9RA 4M8QB 3VFOA 4XB8A 2DQEL 4Y1AD 5GS1C 2NY2D 3VMNA 5LQBL 3MLUH 4AMKL 4Z7NE 5IIEB 1NMBL 2VXQH 4LNRA 4PR5A 2YUXA 1UA6H 5CP7B 4CBPA 4YEEA 3T0WA 3MRKA 3SOBH 1KCLA 1L0YA 4LHUB 2DQEH 1DZBA 4N9GA 3K2MC 4AMKH 1NMBH 4IRJA 2JCCF 3H7BA 2HFFA 5SWSB 2H2SC 1BFOB 3L9RA 3PHSA 5E9DB 4Y7MA 1AD9A 1X5HA 2BZDA 3Q6GL 3UC0H 2DQTH 2VR5A 1Z9MA 1U8IB 3IVKA 1AD0B 1OT2A 1U8LB 4PJCA 3TA3B 2XTJE 3RY6C 1VGKA 2YD1A 3BPLC 4YGVB 3ARZA 4NQSB 3Q6GH 1NBVL 1DN2A 3VI4F 1MWAB 2EDFA 4CNIA 4KJPD 2ICEB 2ZNXA 3BDBA 4XP6L 3CH8A 4X5WA 4PY8J 1IM9D 1VACA 3JXAA 4K3JL 4Z7UA 1BLNB 2UZIH 4X4YA 3FB7A 5E08H 2HWZH 1HWGB 1RULL 1NC4D 3ZDXE 1QLRB 3T0DA 4OCRL 1HDMB 4LLYA 1WQVT 2G9HA 1IM3A 4X6DF 4H5SB 5C6WH 5IMLB 4CMMB 3FTGB 1I7RB 1RULH 5GGQL 5HYJD 1J87A 2MQ0A 5J1AA 4KK5D 4OCRH 4P3DA 5ICZA 2YD2A 5JA8B 2W0PA 2AAVA 5FA4B 5EO9B 1FO0B 4DW2L 1HNFA 3EFFB 4LVOB 2ZP0T 4WWKA 5IKCB 5JORA 5DT1L 4X99A 1FPTL 2H32H 3TYFB 3S35L 2EIEA 1KCRH 3C6LB 2VE6A 3VXMB 1A1OA 4XPHL 4D8PB 2WQRA 1AH1A 4R4FH 1OOAA 2XV6B 1FPTH 3S35H 1M7XA 2VDRH 3OB8A 3QHZL 2YR3A 4XPHH 2ZOLB 4X8XA 3B6SB 3L6FA 1JVKA 3RZCB 5DJCB 1F2QA 1QFPA 4LHUD 3QHZH 3SKUD 4HHAB 4UT6L 3T3MF 4M7ZB 3T65A 3MNWB 1E4KA 5SWZE 3VG9B 3FZUD 1I9JL 5E9DD 3IDYB 4IRSA 4HXAL 4P2RE 2OL3A 2EXYD 1CDIA 3HS0B 5BMFL 2MKLC 3GSUB 4UT6H 1H8OA 4HT1H 5DC9B 43CAA 1I9JH 3LAFA 4HXAH 4KK6D 3LEXA 1MH5A 1WSST 5EA0L 1EHXA 3AB0C 3VRIB 1VKXA 3KPLB 4PJ7F 5C92A 5D72L 5FO9B 4U1KB 2PETA 5FO8B 2XPGA 3UYPA 2NY3C 2G60H 1RZJC 4V1DD 1U3ZA 2DLEA 4LGPB 4LHUG 3CD4A 3X13B 5I66B 5D72H 2EH7H 5ITFA 1MSPA 3PWJA 2Z92A 4F3FA 1R24B 5CEYB 5HPOA 4OD3L 3VDCA 4Y4HA 1CR9L 4URTB 1NBZB 1JWMB 1HYSC 3PWUA 3KLSA 4I2XE 4L4VE 1RVFL 2GCYA 1DUYA 2F8OA 5AZ2H 5TDOB 4AENA 4CVZB 1HINL 3ARVA 1T21B 5E8PA 4I18B 5TF1L 4XXDA 4MXVF 2APVA 1CR9H 3C6LD 4ODVH 1JJUA 5DK0B 4H1LH 5DUML 2CRIA 2AEWA 3VXMD 2GFBB 4ORZC 1RVFH 4FQIH 5JIIA 2FX7H 5E8EB 4U7MA 5TF1H 2NXZC 3GMQA 2F58H 1R3JB 4OLVL 3TZVB 3VXSA 1W0VB 5GJTH 4O51B 5DUMH 4LSTH 4PJEF 1BEYH 3DXAE 1T1WB 3RZCD 2IF7A 3KJ4B 2DF3A 4OLVH 1OARH 1TVHB 4N0UE 2PUQT 4WUUB 5L88H 4ZYKA 2R9HD 1WBYA 3GM0A 4QHNB 3U1SH 5IT2H 4HBQA 1MPAL 1QG3A 2DIAA 3ULUF 4XCFH 3IRZA 5DMIH 1OSPH 5HDQH 2PO6A 4CMHC 4RAVA 2VITB 4IHOA 5DUPL 2ED7A 3V8CA 3NA9H 1VESA 2GY5A 4EKXA 3E6FA 3PABA 2CRZA 4F8QA 3W11D 4NYLB 4WCYL 3VFPA 5B38B 3TH2T 3BD4A 5MEQA 3BGFB 3BW9A 2YWYA 4GS7C 2D9QB 2D0GA 3WXVL 3DJ9A 3CXHK 4EIZC 5AUMA 4U2ZA 3MYJA 4WCYH 2NTSP 1SVZA 5KVDL 3SJVE 3MBXL 4JHWL 4M9PA 3RVXC 4XPFL 4MAYA 4ONHB 1KV3A 3WXVH 3LV3A 1Q9LA 3KYNA 3BP4B 4PRNA 1B9ZA 4OZHE 1EPFA 4UOW1 3VFUA 2NY2C 1FH5H 4U6HB 3SGKC 1BP3B 3MBXH 5TGBA 3Q48A 2V5RA 3OB0H 3MRNB 4L9DA 2VDLL 4N0FB 2J1KA 3HFML 4L8SC 5JA9A 2VLKE 3FHAA 4MJ5A 2VN7A 4JRXB 2AJSL 1S7XA 3GDBA 3MRLA 3HN3A 4RRPA 3DV4B 3EGSA 3BQUC 3TO4C 4U1LA 4HZAA 1RUML 2PYEB 4ZUUB 3HFMH 3BP7B 3ULVE 2ZOKB 2FYYA 4X4XA 3TZVD 1JNHB 2AJSH 3MFGB 5IEHA 2DQFB 5DMGC 1MHPL 1QLFA 4ZUWB 2HFTA 2EKSA 3QO1B 4JR9L 2Q8BL 1RUMH 1U8JB 5ID0A 1FP5A 1FNHA 4MS8D 1L0XA 5KTEL 1EUTA 4KJPC 1HWHB 3FRUA 3X3GL 3MRJB 1A7OL 4WUUD 2FWOB 2GSGB 4NFDA 1MHPH 1X5KA 3SDAD 1TPXB 5I73C 4JR9H 1LO0H 2Q8BH 3W0WD 2MPAL 5E6ZA 5AZEL 5C1MB 1QSFE 3G6AA 5DF0A 3O2WH 2GAZB 1OLLA 4PLNC 4FNLH 3QDJE 4M7LT 1A7OH 3IGAB 4KXZI 2QHLA 2YD6A 3B5TA 3RPIB 3EYFA 4PJIE 3LH2H 2QLVB 4K3EL 2MPAH 1E0OB 1INDL 4YDVA 2ADIA 2Z91A<