2NX5A

Crystal structure of els4 tcr bound to hla-b*3501 presenting ebv peptide eplpqgqltay at 1.7a
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
276
structure length
276
Chain Sequence
GSHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRTEPRAPWIEQEGPEYWDRNTQIFKTNTQTYRESLRNLRGYYNQSEAGSHIIQRMYGCDLGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPVSDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA-B35
publication title A T cell receptor flattens a bulged antigenic peptide presented by a major histocompatibility complex class I molecule
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 72
structure length 276
sequence length 276
chains with identical sequence F, K, Q
ec nomenclature
pdb deposition date 2006-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2nx5A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 2nx5A01
1A6VL 2V6HA 3MRRB 5D1QD 2BJMH 3QQNA 4TSBH 1FIGH 3IXAB 4O2CB 3QIUD 4KI1A 2LVEA 5D7JB 4C4KT 1UM6L 1FL3B 2ORBH 3ZL4L 3WUWB 4RWYL 1EEQA 4HFWB 4FQLL 1BQLL 5JA9A 5C0RH 3TT3H 1NC2D 3QNYA 1KELL 4GBXA 1U9KA 2B0SL 3RU8L 3O3BA 2UVFA 3HC4L 2VXTL 4UAOB 4P9ML 5CBAB 4QRPB 4JKPH 1ZGLP 4O5LL 3L9RB 3UO1L 2EDJA 4DQOH 4JFPB 2B20A 3TWCL 3SQOL 4JHZA 4M7LH 4O4YL 4KHXL 3RDTD 2FJFA 1YMHA 4NM4H 4YHNA 5K9JH 1G9EA 2EO1A 3EOYG 5C0EA 1JPFB 5DJ8A 4OFDA 4PB9L 4FZEL 2HN7A 4HWBL 4CRPA 1PLGL 1P69B 1I1AC 4LAQH 1C12B 3D0LB 3OKMB 1T89A 4O9HL 4OM1L 4HBQA 1ZANL 4U1GC 1BVZA 1SBSH 4DFIA 3T4YB 1JWMB 4NDMB 3HN3A 4JDTH 1Q1JL 2E27H 2IADB 2FX9L 2FCBA 4PJ8D 5IHLB 4HLZG 3S3JA 2FR4B 3ARGB 3BPNC 5I0DA 2GJ6E 1KIPB 1JGEA 3RTQD 4M62H 3H42L 4DOHB 3PGDA 3V9FA 1V3JA 3ZE2E 5KSAD 3CGTA 5SWSB 1QSFB 4EI6B 4JCLA 4YZFF 3TEUA 3MRNA 4ZUUA 2W59A 3CU1A 4XB7A 1G7PA 4Z7UB 3CIQA 1A7PH 4IBLT 3IGAA 3HNSL 4K7PY 1WWBX 2NXZB 4D9LL 1R0AL 2VJXA 4EDXB 3T4AA 2F8XC 5MERB 2ZUTA 1UWXH 4U6VL 4Z76A 3MC0A 4XPAH 2B1HL 3C5SB 5CD3A 3HZVB 1RSFA 4DUWA 1WSST 1QRNA 5ERWB 4ZDHA 5HHPA 3EO1B 4YUEL 5ETUA 3KYOB 2VQUA 5F9WB 5IBUB 3VDAA 1NFDB 4OAWA 5CHNB 3KPLA 5DRNB 5IKCB 3MGOB 2M1KA 2P24A 2FB4H 2FWOB 5ISZB 3O2DH 4OZHF 4U2ZA 5GGSB 1G7LB 3Q0HA 3CU7A 4PJGF 2N7BA 1JZ2A 1R3KA 5DWUL 1OAQL 1RIVL 5EA0H 5IM7A 3FMGH 4H25A 4TRPL 1PGRB 2ED7A 5F96H 3AUVA 2NR6C 4B0MM 3Q2CA 2CRZA 4O2EA 4PG2A 1MF2L 3WFCH 5JIKA 2PO6D 2FYYB 3LKSA 4TUOB 2ARJB 35C8H 2Y06H 4L8DB 2VB5A 4LSVL 5BS0A 5HHMB 5EU7E 1MFDL 3ARFC 5DURB 2R1WA 3WN5B 3F7RA 1GGUA 1NC4A 1ZT1B 2E7BA 3QEGL 4K3HA 1UWXK 2EH8H 3O11B 3VG9B 2CDGA 3T2NH 3VWKC 2QR0B 4P46A 2BVTA 2V2XA 1IQWL 1S7WA 3DTXA 4R3SB 4X9BA 2ZOKB 3MACL 4R4FL 2ZUVA 5D1ZC 4RMRA 2CH8A 4AMKH 3D0VB 3W0WA 5BXFA 3VFGH 2V5SA 3TPUB 1YEHH 3MJGX 1AIFA 3TV3L 4D9QD 5IHUL 2F53B 4AK1A 3NCFB 4U1IB 4JFFB 1IVLA 1C7TA 1DQQA 2R4SH 4XNUH 4F37F 5JMRA 1RUQL 2Z8WC 3HZMA 4NQCA 2C1PA 3SDXA 4BQCA 5J13C 1U93B 2Z0BA 4MNQA 1FZMB 3AMLA 3UROR 3D85B 4PBXA 5I73B 5FYJH 2EZ0D 1CI5A 4FQPA 4H0GA 2X5PA 3FB7A 1OCWH 3HUJE 1MCBA 1RJZB 5B39B 2YD3A 3OR7A 4FQJH 3OTTA 5E5MA 1FN4B 3SKJH 2NXYC 2X9YA 2BVYA 3L7FB 5ALCH 1RV6X 1HINL 3TNNA 4FMFA 1FG2B 1B9ZA 3WEXA 3MLSH 1CICA 2BVQA 2VSCA 5HPOA 2KDGA 1D5XB 3LSOA 4OZGA 5JHLL 1YPZA 4LLVB 1INQA 4I18A 5CD5D 1MRCL 3UPCA 2DM3A 2DBLH 2AV7B 5ICZB 5L8LB 4JFZH 4TNWK 2R2BA 4PJIB 4LGSB 4PV8B 5J12B 5IHBA 2UWEF 2V7HA 3RWGB 1SY6L 1TZIA 4FZ8L 5GGVL 4I2XB 1U8JA 2E6JA 5DYOB 1CF8H 1N5AA 4LVNB 2PTUA 5JHDD 4MA8L 2P5EE 1M6OA 1KCRL 2BSED 1EERB 5D72H 4G3YL 4X80H 4W70A 2O5XL 3ZE2F 2DOCA 4FQHA 2OZ4L 4R4BA 3WNMA 1WCBB 1DTUA 4OQTL 5E24E 5I8OL 3ALXA 3CXHK 3QQ9D 4X6CB 2A6DB 3ET9F 1NBYA 1BECA 1HYRC 3MNZB 1EV2E 5BV7L 4JM4H 4ODXA 1BOGB 2VDLH 2XWTA 3KDMB 4L8SB 5HPMB 1S7UB 3QUYB 1A1NB 3SJVB 1DE4B 2P42B 4X9IA 1OGAA 4XNZC 1Q94A 2M26A 1MI5A 1ZAGA 3MODH 4TPRH 3NFNB 3QXAB 1QLFB 4H8WC 3FO0L 3T65B 2H8PB 3P0GB 2FO1A 2E7MA 3BRDA 5TQ2H 4UU9A 2QQNL 1TPXB 1ZSDB 2ESVB 2K1MA 2HFGH 3ULUH 4NP4L 4LLUA 1INEL 5JXEC 3MCLH 1YQVL 1AR2A 5TH2A 5FYJD 3ESUF 3CCHA 2XQBL 2W0LA 4F3FB 2VR5A 2DAVA 2JJTC 5DA4A 5TPWL 3BMWA 3HLAA 5HVHB 2OR9H 2XZZA 1FZKB 4IOIA 4PYGA 3EUUA 3EGSA 3BKCH 3Q6GL 4JPWL 4ESKA 3T0XA 4LRNL 3K80A 4DOHE 4U1LB 1ZHLA 2BP3A 4P2QA 2LTQB 3KPRA 1UWGL 4WW1B 5EIQA 1CR9L 1AFVL 2H2SC 3CFEA 2VQ1B 4NZUL 5T1KB 2Q7YA 3C8KB 4Z7UE 1YC7A 3JWOL 3TZVA 8FABA 3CK0L 1JUFA 1EAJA 5DHVB 3DO7A 3ZE1E 1NGZA 1HN1A 4ZO9A 5EG6C 1S9VA 4MVBA 3E8UH 5HD8C 1LWRA 2VO5A 4KJQC 4R7DB 1I4FA 3I9GH 3UCRA 2GITA 1U3HA 3O4LB 1KB9J 1ZVSA 4PJEB 2VR9A 4UTAL 4S1DD 3RPIA 1FBIL 4I8DA 5C71A 5D7SH 3EHBC 5DD0L 4XC1H 3B3IB 1U8MB 3FN0H 3H9SE 4YXLH 2DQFA 2F5BH 1J0IA 1KTLA 3OPZL 4O2FB 4Q58C 1KJ2H 1IM9A 4DKEL 1ZT4A 4P4RB 4XXDB 2H9GB 2DYPB 3ZKXB 1NKOA 1IAII 1OY3B 5SWZD 4PV9A 2H26B 1U42A 2CKBH 5ILTH 1P1ZB 3UTZB 1R24B 1KPVA 4LSSL 4IIQC 1F8TL 5JQ6L 3HUJF 4YXHH 4MB3A 5T5NF 1JNNH 3MXWH 4HKJA 1E28A 1GZPA 2DQJL 4ZXBB 3SDAB 5KZCB 5I1IL 1MH5A 3TCLA 1HHKB 4NFBA 1D5IL 4FN0A 5HHNB 4YWGL 3V6ZB 1ZVYA 4LU5L 3MRPB 1CD0A 1RZIB 3CD4A 1KBGH 2W65A 4XX1E 3SOBL 3F6IA 4L3EE 3ULUD 4KKLD 2YC1A 5BJTB 1XF4B 2XKNA 3TLRA 2R4RH 1FGVL 4JRYA 3VFVB 4G6KH 4P2OB 1MCFA 5C2BH 4PY7A 3WHE1 3H9SD 5AG9A 5GJSH 1CD8A 3WFDL 3Q6FA 2R0LH 4TUKH 5CP3A 2EEDA 4C56A 2CDEA 1T3FB 3F5WB 4KJPC 1VFMA 5GSRB 5IQ9A 1A3RL 4PY8J 3KLSA 3TPUE 3WKML 1JV5A 4P5TC 3MLYL 1DVFA 2IPKB 4BSWB 4FQIH 4HG4J 5FO8B 5ITBL 3CZJA 1GOFA 1BP3B 3BH8A 1T80A 4JFFE 3DMMA 4M48L 3MX0A 2C3GA 1MHEB 4M6ML 2CMRH 3B2UC 3SN6N 4HKBA 1I9JH 3WKNA 3GBMH 3O6LL 2NZ9D 1EVUA 1DBJH 5LKNA 3BKJL 3B9KC 1F58H 1QFWM 4JO4H 3BIAX 1OAKH 2R56L 3RIAK 5T1LB 4L3ED 2EXWD 2Z35A 1B88A 3U0PB 1S78C 1A7OH 5DI8A 2HVKA 3EYFB 3MYJB 1NMCB 2PW1B 4L29B 4JPVH 4PRPB 1FFRA 3DIFB 5C0JB 1B90A 5I76A 1FO0H 2AV1A 3CSBA 5CZVL 3R8QA 4UTBL 1CE1L 4JPKL 3CXDL 2IFGA 2FH8A 4L5FL 1T5WB 1OTUD 3HE7B 5L88L 4XGZB 1CLCA 4LCUA 1NAMH 4WFHD 2DLHA 4NGHH 4OD3L 2DQUH 1OQOA 1R3HA 5DDHA 2CLZB 4P23B 1FFOB 4NZJA 2DWEB 4X6EA 3DV4B 4JFFD 1RULL 3MBEB 1Q0XH 2R9HD 3DETC 1BX2A 3O9WC 5C08E 2H3NA 2WWKT 4RQQA 5EBMA 3NFPB 1MREL 2QQKL 4OM0L 4PRDB 4RAUB 4Z7UF 5GISH 5HGDA 5HJ3A 3V52L 4HIIB 2EKJA 4N8VG 1U0QA 3PJSA 3PL6C 4MXQD 5EU3B 4BK5A 3TA3A 3QWOB 3JWDH 2GSIA 3MRKB 3QRGH 4HS3A 4MHHI 2YUXA 1KOAA 3W11C 5FKPA 5IBLD 3N1QC 5DD1L 1CLZH 3SJVE 3KPMA 1CGVA 2D9CA 1FJ1B 2BHUA 2LABA 4MNHB 2WWMD 1YEIL 3PGCA 1DQLL 4KROB 4NQDB 5LBSL 1RMFL 3JTTB 5HGHA 2F5AL 1NFDF 4F9PC 4HEPG 1NJ9B 1U3ZA 3FHAA 4DK6A 1I7TA 1X4YA 4WV1B 2LV4A 4DKAA 2APTA 4HZLB 1JPSL 1QP1A 2ESVE 4Q9RL 4JR9L 3UJJH 3U7WH 4GKZB 1WBZB 4IRSB 5GRUL 1AD0A 3IDMA 5FOBA 2Q3AA 4DAGL 1OAXL 5E9DA 4RGOL 4MMZC 4C4KO 2EDBA 1DBBL 5EPMA 1CFSB 4OZFH 5HGAB 5I15L 1ORQB 2DM7A 3HG1B 5C08D 3U0TA 3C08H 4KMTL 2A9ML 3L5WA 3WMSA 5CGYC 3QBTB 3PWJA 4JO3H 1D5ZA 4LFHD 3OB0K 1A7BA 4NCC1 2BX5A 4OIAA 5LGHL 2YKLL 4GBXB 4HK3J 5KTEL 4QTIH 3RZCC 5A2FA 3O3BB 1D9KD 4GXVH 3QUYD 4OF8A 3SJVD 4OFPA 3Q5OA 2X4OA 5IVOA 3MLRL 3V6OA 3X11A 1BFVH 5IHZA 5D6DA 4W4NA 4L9LC 1FYHB 5D2LE 4E5XA 4M1CC 1BIHA 3DYPA 4I0PC 2FJFB 4LAJH 4YHNB 4HS6A 1U3YA 1R5WB 4W81A 1R6VA 5C0EB 1BQHA 2N7AA 3OAUL 4F7PA 2HN7B 4H26A 4JJHA 3VXUA 3V6FA 1YN7A 3KXFB 2DKMA 3UYRL 2GAZA 4KPHL 5KSVB 1JJUA 3KLDA 5E4EC 1YY9D 1AP2A 3KYMB 2QLVB 2UZIL 1KN2H 2DLTA 4ZOBA 1FDLL 3OZ9L 1C8PA 3HPJA 1G9NC 1CXEA 1RJCA 1JGEB 1FNGB 5F97E 4Z18A 5GZND 3PGDB 2YA0A 5C7XL 4NKOA 3A6BH 1H3UA 4ZTOL 1Q9OA 2FATL 4ZUUB 1G7PB 3A67H 5GHWL 4Z6AT 2VZSA 3IGAB 1GYAA 1E0OB 5B21A 2MQ0A 3DVNA 3OB8A 1X4XA 3GBNH 4PJIF 3T4AB 3TVMA 4UT9H 3EOTH 3BJLA 3DGCR 3MV7D 2JJSC 1SJVA 5B22A 4HUMB 5CD3B 4GRLD 4JM2C 4Y16A 3ABZA 3RHWK 5DJYA 1QRNB 4ZDHB 5HHPB 5SX4I 2DQGH 5ETUB 3CDFA 1KIQA 4OAWB 2MWCA 4UV7L 4LNRB 1U92A 3F58H 3KPLB 1OGTA 2P24B 2YD1A 4NBXB 3S5LG 3N9GH 2BFVH 3GHEL 3MLZL 1EGJH 4WI9A 4X6CF 5LG1A 2Y36L 3A6CH 2KBGA 2OI9A 2BOBB 1ACYL 5GGTH 3VXMA 2LAAA 3OKEA 3QIBC 2P48B 2APVA 5ID0A 1R3KB 4YC2B 4AQ1B 4EZMA 5KZCD 1I8LC 5IM7B 1MCIA 4FQXC 4PUBH 3IRZA 2NY7L 4KMQA 4H25B 3JV6A 3KYAA 3LEVL 3VXSA 4O2EB 2D9QB 4Y4KA 3RWCA 1YZZA 4UOW0 3LKSB 2CRMA 4DKFL 3BZEA 3MTRA 4ISVA 1MFBL 3CPLA 5BS0B 4FP8H 3UZQA 1NC4B 2E7LC 1ZLUK 4S1QH 3ERYA 2CDGB 4ALAL 4P46B 3LHPH 2V2XB 4IJ3C 5BV7C 1S7WB 1BZ7A 4G7YH 1IGIL 3EZJB 3PHSA 1T6VN 5BXFB 3W0WB 4IOSD 3O6KL 3HFML 3GSNA 3RY5A 1MEXL 3TT1H 1FORL 3MNWA 2EDEA 3JTCA 2Q8BH 1NANH 2NY3C 1AIFB 1N7ML 2MHAA 3CFCL 3ARBA 5AZ2H 2ZCHL 3B5GA 3QUMH 4UQ3A 5E70A 3RP1A 1DQQB 2DD8L 5AZEL 2A6KA 4HCRA 3HZMB 4PJ5D 4OB5H 2C1PB 3SDXB 4MNQB 3GMNA 5KVFL 1G6RL 1FSKB 1IMHC 2RGSA 4LHUA 3FB7B 2X6MA 5J3HC 2A77L 4PJEF 3QIWA 5TF1L 3OR7B 5E5MB 2YWYA 3E2HA 1YEJL 4PLNC 5IEHA 3VW3H 1MVUA 3TNNB 3WEXB 1CICB 4G8IA 2BVQB 3LSOB 4OZGB 2WANA 1YPZB 4UT6L 1INQB 4I18B 4G80A 5GGRY 3ARGC 2ZUXA 4ODVH 4OFKA 5GS3A 3JWOC 4BSJA 5IV2A 2DB8A 3PGFL 5GRZA 2R2BB 5DFVC 1Z3GL 1F45A 2GK2A 4M1DL 1KYOJ 4OBRA 3V0WH 2V7HB 1TZIB 4MNGA 1U8JB 4KKBC 2HTKD 4UIKL 4P23D 3LN5A 1N5AB 2O93L 5J6HA 4JY6A 1N0XH 2VZTA 4LMQE 4P3DA 1KLUB 1Q72H 3MRFA 4ZYKA 5K9OA 4R4BB 3VFOA 2FX7L 4HFUL 4CMHB 5BZDB 1DQDH 1NBYB 3GMPA 3LY6A 4YBQD 4XHJD 1ZHBA 3VGDA 3J8F7 4IMKC 4DGVL 4AY0A 5F9WC 1I1YB 4ODXB 1DFBL 2J8HA 1HDMA 2IH3A 2XWTB 4YDKH 5JR1L 2UVEA 3TYFA 3UTTA 4UINL 4H0HB 3OL2A 5D1XA 4QWWC 5CZXD 3T0AA 1OGAB 1IRAY 1EO8H 2AXJA 2C1OA 1Q94B 1G9MC 1YMME 2CK0H 1WITA 3HMWL 1MI5B 2X10A 4FFWD 1RZ7L 4PJ9A 1BQSA 1I85A 1FNSL 4UU9B 3HKFA 4XVUD 1DDHA 1XGYH 3KXFE 5DO2C 3OKOA 3NFSH 1MCWM 4G5ZL 4S0SD 4LLUB 1MNUH 1KLGB 1CXFA 5TH2B 3CCHB 4WEUD 4XP6L 4I13B 5F7WC 3HLAB 1IGFH 1I1FA 2PW2A 3IDIA 4IOIB 3WN5C 3EGSB 5KVEH 3VG9C 3P2TA 2VITA 4NUGL 1TETL 3MV8E 3X3FH 1WBYA 3DX7A 1NGQH 1PZ5A 1ZHLB 4P2QB 5A2JH 3KPRB 5EWIH 1C1EH 3CFEB 1P7KA 1Q0YH 4YK4B 1C5CL 4X7TA 3TZVB 8FABB 1JUFB 1B3JA 2HKFL 5EC1A 3DO7B 1IGYA 5CEZL 2XPGA 1NGZB 1E6OL 2B2XL 1WQVT 1S9VB 4HJ0D 2X4QA 2CIKB 4I3SH 2HFEA 1YMMD 4NNXA 4OV6F 3EO0A 2GITB 1U3HB 4RDQF 4YFDB 1ZVSB 5L2JA 2ZNXA 3MV9E 3V0AC 3RPIB 1JGLH 3IB4A 2RCSH 5GJTL 1QRNE 4XNXL 2G5RA 5A2KH 2DQFB 3HNTH 1IM9B 4YHML 3KXFD 1ZT4B 3WS6C 4KVCL 1HH9A 1XAUA 2ZG1A 1CD1A 4OCYH 4Q74A 4YFLF 2NY2D 4PJBA 1N26A 5EZOH 4PV9B 4JVPA 2JF1A 4GRWH 1S5HA 4NQUA 3LRHA 4PFEA 1ED3A 1KPVB 3WSQL 2R23A 3MV8D 4UV4L 1T6WA 4MXWH 4HKJB 2QV2A 1E28B 1MRFH 3G5VA 1GZPB 3BGFB 4JQIL 2NY6D 3QUXA 4I3RH 5JOEA 3BKML 4ERSH 4Y5YA 4WU7A 4LVNC 3S8WA 5TQ0H 5BS0E 2W65B 3DSNA 3EDJA 2HT3D 5KN5A 5GGTA 5KSBA 2YC1B 3MV9D 3QXWA 5K93A 1JI2A 2XKNB 4JRYB 3GI9H 4DFHA 1N6UA 4PY7B 5IVNA 4KQ3H 5E95B 1RJLA 1PSKH 1NCTA 3Q6FB 5CJ5A 4C56B 2CDEB 4NBZB 2ADGA 2IANE 3WD5L 5IQ9B 5L2KD 2DDQL 4IOFC 1JV5B 1G7MA 4L8SC 2V5TA 3AS2A 1BHGA 3BH8B 3VFPA 2FLRT 1H9VA 2CKNA 2MTPA 4WI4A 5KS9A 3DMMB 4KKAD 1J88A 3SE4A 3LN9A 3W9EA 1G7IA 4HKBB 3U82B 3SEPA 5KOVC 3SDDC 3O0RL 4OCSL 5C0IA 4X4ZA 3WUWG 1OB1A 4W6WB 4D3CL 5EOQL 1A9EA 1MHPH 4K3EH 5FF6A 2BNRE 2KZ1B 3V5DA 4KXZI 3G9VA 4LLQA 1U8LA 5IF0A 3QNZA 1TTUA 4R4NC 5I9QC 3OXSA 1J1OL 12E8H 5DRXA 4PLKD 2Z35B 4M6OL 2DF3A 4KTYA 5DI8B 2HVKB 3MRQA 1F6AA 4OF5A 1YPZE 4GQPH 3FT4A 3H9ZA 3AS0A 5I76B 3FAXA 2AV1B 4U3CA 4XWGH 1C5BH 1H0DA 2YPVL 3QXVA 1P53A 1K5NA 4YO0A 1T1XA 2IAND 4LCUB 1I1RA 4MJ2A 4Z5RA 2V5MA 5CLWA 2WWKO 1R3HB 5DDHB 1PYWA 1CS6A 3NBNA 4X6EB 5B4MC 1P7HL 4LCCC 1JZ4A 5I74B 5FHBH 5IVZA 2ZZUT 1JYNA 1NCWL 1BX2B 1I3VA 1KPUA 2JCCE 2H3NB 5GGRA 5JPMB 4RQQB 5EBMB 2EC9U 1YEEL 5HGDB 5HJ3B 1JNLL 2ZOLB 2PTTA 1E4JA 1KJ3H 5BRZA 3I6KA 1N6VA 3PQYB 3T09A 1NLDL 2BNRD 3PJSB 1QOKA 4OCRH 2ZG2A 4U2YA 4HT1L 4HS3B 2GSIB 4KUZL 4YHOH 2XKUA 1T22A 1UB5A 5FKPB 5KVDL 4LSUH 1NFKA 1I7RA 1CICD 4N0CD 3BWAB 3G6JE 4RGNB 2EDOA 3KPMB 1GH7A 3LKPA 3DSFH 5FYLE 2VQTA 2IBZX 3PGCB 4ZNEE 1H3PL 1KLFA 2J88H 4ODUA 5HGHB 2HMIC 4KK9C 4OSUL 3LS4L 2XZCL 1I7TB 4ZOCA 5BVPL 4V1DE 2VLRE 3UBXB 2BJML 4MJIA 2DKUA 4TSBL 1FIGL 5CEYA 4ZXBC 3SDAC 1EVTC 2BNUA 2K7PA 3QHZH 3KYNA 3KPSE 5CGTA 2ORBL 1JYXA 3WNNA 1AD0B 3IDMB 5FOBB 4UDUA 5C0RL 3TT3L 1WIOA 4U6YA 5EPMB 1EO7A 1KTKE 2V9QA 3QDJE 1PEWA 3R1GH 1KCUH 1BVKA 1WFUA 2WMPA 5FYKH 3VFSB 3BQUD 4JKPL 5HXMA 1X7QA 4HS8H 1F02I 3U0TB 2IPUK 4M6AA 2W07A 4JHAH 3L5WB 3O3UN 1QBMH 4Y4FD 1BQUA 4P2OC 4POZC 4DQOL 3P30H 4EI5A 4JVUA 4LLYA 2NW3A 1CCZA 3VDCA 1D5ZB 4P2QE 3KPRE 4M7LL 4ZS6D 2OTWA 3SCMA 1L9NA 4OJFH 2WV3A 4NM4L 5K9JL 4CDHA 5FO9A 3MRCB 1WEJH 2QSVA 3DOSA 4QGYA 4FFVD 5T3XH 2X4OB 3GNMH 1JZ8A 3X11B 5TE7H 1NEZA 1MCOL 5ADOH 5IHZB 3TO4A 1NBQA 4OBSA 4E5XB 5JUEH 1SBSL 1FVDA 3TCXA 3AAZA 3UTSE 3W39A 4V1DD 5E56A 1NDMA 2VLRD 4G8GA 4LHQB 1P9MA 2PF6A 2E27L 4HS6B 3UXFA 3TJHC 5ALBH 3UJIH 2NNAA 1BQHB 3VGHA 1P6FA 3C5ZD 4F7PB 3KPSD 2EC8A 2FRGP 4H26B 3CLEH 3VXUB 3LS5H 1U2HA 1YN7B 4M62L 3PWPA 4LLAA 3RGVA 3EJYC 2GAZB 4YH6A 3SDXF 4NJ9H 3QDJD 4MGXA 2B5IB 1F13A 3OQ3B 2VTFA 4HUWA 1AD9A 1YECH 1AP2B 1A7PL 1A8JH 1FPTH 1GCFA 4L4VA 3LRGA 3HPJB 3DGGA 4JANA 1A7NH 5EZJA 1BGXH 4JAMA 1TNMA 1HHHA 4C54A 4XPAL 4WIQA 3HE7C 4NKOB 1CGTA 4OZGF 4FFYH 3LDBC 1YPZF 1Q9OB 3MZGB 5ANMA 5IWLA 2NY1C 2AXHA 4NT6A 4LPCA 4ZMAT 5I1LA 3DVNB 3TVMB 4QHKJ 3O3EA 4BZ2H 3FRPG 4R0LA 4GMTH 3UTSD 5M95B 1W72H 2FB4L 4KKCD 4JRYE 3FN9A 3CX2A 5E0QA 1KCVH 3O2DL 4Y16B 5FYKD 4X9GA 5DJYB 1BBJA 2FEDC 3GJFH 4C56E 4QRQA 2APFA 5DHYA 4U05A 4UDTA 4CAGA 1KIQB 5EA0L 3S37H 1YA5A 3U9PH 3AB0C 1U92B 3WXVH 3FMGL 1OGTB 5F96L 3TP4A 3T3PE 1TXKA 3Q1SH 4X7DC 3WFCL 4KROC 4FMKA 5L7XH 3VXMB 35C8L 2Y06L 3OKEB 3RVWC 3SO5A 5T3XD 2N56A 4ZG1A 5ID0B 1MWAH 5HHOE 1K8IA 2EH8L 1I9IH 3JV6B 1E27A 2IQ9H 4G9FD 3T2NL 4ZO7A 3IDYB 2ZUWA 3VXSB 2X4TA 2W1NA 4Y4KB 5E99L 1BM3L 3U4BH 5GZOD 1G0XA 25C8H 3I6LD 3RWCB 1XGQA 5DF0A 4AMKL 5I1AA 1UXSA 3BZEB 4ISVB 3SY0A 4Y2DD 4LPTA 1N6QH 1UYWH 3CPLB 3MJ8A 3OKDA 3VFGL 1A0QH 5FV1L 3S34H 3OX8A 4JFHE 1OARL 4JO2H 3WCYA 1LEGA 2BY3A 1YEHL 2GFBA 1NL0H 3GSRA 1FNAA 2NZIA 3O6FD 2HP4A 4C56D 4XNUL 1BZ7B 2R4SL 1TDQA 4M9PA 3GJFK 1ULVA 1AHWA 1RHHA 4ODBD 3QDGA 3VI4F 2DI8A 4Z7WA 1X5FA 5FYJL 3GSNB 4DW2H 1TJIH 3MNWB 3RA7H 3MRBA 4U1HA 1OCWL 2VZOA 2MHAB 1ZHNA 3ARBB 4FQJL 2R2CA 3SKJL 4UQ3B 1RJYA 4P2YA 5ALCL 3FFCD 2A6KB 5HHOD 3MLSL 3LD8B 3PQYE 3GMNB 5C6TH 2DM4A 3GI8H 1P7QD 4NO3A 4LHUB 5IJKC 2DBLL 4KRLB 4JFZL 4ZAKD 9CGTA 3QIWB 3HE6A 3S88L 1K9TA 2E6QA 2O5YH 1GRWA 3E2HB 4RIRB 5IEHB 1AH1A 1MVUB 5IFAH 4U1MA 1HSBA 4G8IB 4F58H 1P4IH 2XWBB 1CF8L 4PS4H 2SEBA 2BOCA 4PP1D 3FTGA 4JQVA 1ROWA 5AD0A 2IH1A 4G80B 1DL7L 4YFEA 2YS4A 1KIRA 1X9QA 5D72L 5FA4A 5IV2B 5C6PB 3HB3D 4BYHA 3MFFA 5HHXH 1PG7H 1A64A 4LASH 2DTSA 3LKNA 4IRJD 3F6LA 5FM5O 4MNGB 4E41A 2DJUA 3LN5B 3QH3A 3RI5F 1YY8A 3QCVH 4POYA 1VGKA 2YZ1A 4JY6B 4HGWB 1A7RH 4P3DB 1SYVA 4XI5C 2X09A 4LVOC 3WNLA 3MRFB 1KEMH 3IU4H 4ZYKB 4JM4L 1T7WA 5K9OB 3IDNA 1TQCC 2VDLL 3TYGH 3VWJC 1MIMH 3VFOB 2VDKH 2AQ1A 3PQYD 1NCAH 5TFSH 3O8XD 2APWA 3DUSA 3VDBA 2FX8H 3UZVB 3ARSA 1D5MA 2AS5M 2OMBA 5LXGH 1ZHBB 1FV1A 2A73A 1GOHA 2IC2A 3U48A 4NKDA 3LMJL 4TPRL 4DVRH 3LQAH 1ZE3C 2DIBA 5TQ2L 2IH3B 1NAKH 5E8DH 3TYFB 3UTTB 2HFGL 3ULUL 5D1XB 2IALA 5DXWA 3MCLL 5C0FA 4KHTH 2C1OB 3WIHH 1J0KA 4XPBH 2AW2A 3IJSA 1GGIH 4NKQB 3QYCA 2OR9L 4PJ9B 3N85L 4OF7A 3BKCL 2YA2A 3DNKA 1NANI 1DDHB 2C4XA 2DJSA 3WO4B 3OKOB 3KHQA 5J11C 1IC7H 4LARL 4PG2C 3K7UA 3RNKA 4N0FA 4NZRH 5IB4A 3OKYA 1JMZA 2Y6SC 3PG2A 1AC0A 3GZKA 2P7TA 5F7EH 5GGQH 1I1FB 2L7UA 2PW2B 3IDIB 1QQDB 3STZB 3E8UL 2HJKA 2VITB 5CSGA 3I9GL 4P46C 1WBYB 3WFHA 3DX7B 1PZ5B 5DVLA 3JSSA 1A6ZA 1LD9A 5D7SL 1RUKH 4XC1L 4X6DA 1MY7A 3FN0L 1P7KB 5D1QC 4YXLL 2F5BL 4X7TB 4HWNA 1KJ2L 5EC1B 1IGYB 2XPGB 3HMXH 3Q48A 2X4QB 2FL5A 1YYMH 4FQ1H 2IAMD 2HFEB 4NNXB 1HHJA 4YX2L 3EO0B 4EOWL 1A6TA 5L2JB 4WRLA 4ZOEA 2ZUQB 5ILTL 3P0YH 3HRPA 3SGJA 5HYSG 2HAZA 3SKNA 4KRPD 4F33A 1FSKC 5IIEA 2H6PB 4YXHL 3R8BB 1JNNL 1UM4H 3MXWL 5E2TH 5HI4C 4BH8A 3SPVB 1CD1B 4IDLA 1J8HA 2FH6A 4BQ8A 5KJRH 4ONOA 2YWZA 5DD6A 3RDTC 3OGOE 2PN5A 4PJBB 3EW3B 1T7VA 1WZ1H 1S5HB 1W72A 4Y8DC 4XBEH 5I1DB 5GRYA 3VXME 1ED3B 3ULVF 2VL5A 2BSSA 4QRUA 4TTGA 1KBGL 5J9PA 2R23B 4I18C 1DCLA 2HRPL 1JWSA 3K8MA 3EJZC 4LVHC 1FNEA 4D8PA 3G5VB 2HT4C 2R4RL 5EOTA 3SGEH 5I1GH 4G6KL 5C2BL 2Q86A 1AGDA 3QUXB 5GJSL 1P4BH 4Y5YB 4WU7B 4TUKL 2R0LL 3RTQC 5T33H 2QQLL 5F8QC 5KN5B 5FOJA 5KSBB 2BVUA 4K71C 5KSAC 4UOJA 4FQIL 5IT2H 5D4QA 2YK1H 4LQFH 4F7MA 3BJ91 1NH6A 1RJLB 3E6FA 2IFFH 2CMRL 1MAKA 2CUIA 1I9JL 3GBML 3V95A 3VFWA 2ADGB 4XZUA 1DBJL 1LE5A 3ZTJG 3NTCH 5FGCB 1G7MB 1F58L 1YDPA 4MAYA 4GG6A 3KLHC 2B0SH 3VFPB 3VI3E 1OAKL 5KS9B 4QRRE 3LRSA 4JFOA 4Z0BH 3W9EB 1DEEB 1A7OL 2DQIH 1LO0H 2XZAH 1V05A 4JPVL 5C0IB 5I2IA 1U3JA 2AK4A 1PVHA 4OF0A 1OB1B 2D7TH 3CZFA 4WHCA 1A9EB 2OMNA 5FF6B 6FABH 3V5DB 1FO0L 4O4YH 2YPLA 4JPIA 4LLQB 1U8LB 5IF0B 3QNZB 4KJYA 1GOGA 5HI5D 3OXSB 5DRXB 2EEBA 3LEYH 1NAML 4EXKA 3MRQB 4NGHL 1F6AB 4LCWA 2DQUL 1B4RA 3FT4B 4ZO6A 1FRGH 2NLJA 5FB8A 3IU3A 1QRKA 2YMXH 3HA0A 1Q0XL 2PO6C 1H0DB 2BSTA 2DM2A 2VZ3A 1VADA 3BO8A 1K5NB 1RIUH 4YHZL 4LSTH 5GISL 4CNIB 4YO0B 1T1XB 3LKOA 3BN9C 4Z5RB 2X4NA 3W9DA 2GHWB 4PJ7A 3H42H 5EB9A 4NO0D 4JFDE 1PYWB 4JDVA 3JWDL 3QRGL 4JZNA 1UB6A 4I77H 1OP3K 4QRRD 2QJDA 4MVBC 2OJEA 5DT1H 2X4UA 4Y4HD 2UYLA 3ARDD 5TDPA 1BJ8A 1KPUB 5GGRB 3ORJA 3GIZL 2D0HA 2PTTB 5DJDA 5BRZB 4ODWA 3I6KB 1E6JH 1DP0A 2CLVA 1J5OH 3P4NA 4M7KH 4OLWH 3NCYS 2NY5H 1CU4H 2GUOA 5C09A 4OKDA 5HDLA 4K55A 1A02N 1UB5B 3R0MA 1Q9KA 1MCJA 1I7RB 3UJJL 3U7WL 3MJ7A 3CFDA 2XY1A 3LKPB 4WNQA 4UNVA 1KCLA 4ODUB 3VD5A 3BHBA 1ETZA 2XRAH 4HPYH 3OF6A 1BREA 3EIFA 4DZBA 4EUPA 5DJAB 4J6RH 2WUBL 5I1KH 5F1NA 4RMWA 5JXEA 4PRBA 3HI1A 3BRFA 3NA9H 3DX9A 4MJIB 1R5IA 1GZQA 3C08L 3DPBA 5CEYB 3VXRA 4P3WA 1EJ6A 2BNUB 1RURH 3BGFC 3KYNB 2ICWA 2X89D 1RIVH 3WHXA 5HGBA 4JO3L 4JFDD 2XA3A 4UDUB 5CD5C 4KGJA 4U6YB 3LKQA 4TRPH 2P47B 3E0GA 4QTIL 1CD9B 3SKUD 1EK3A 1SJXA 1BVKB 4GXVL 4I5BA 4MHHG 3GUTA 1X7QB 4DKDC 2HTLD 2J6EH 1XIWD 1BFVL 3IKKA 1MFDH 1WC7A 1A3LH 2NW3B 4LLYB 3TFKD 4NNPH 2QQQA 1X5LA 2AJSH 4GKNA 1E4WH 4DJMA 2OTWB 2EC9T 3HRZB 5GRXG 2HT2D 3I6GA 2VABB 5FO9B 2DI9A 2Q8AL 1RI8A 4O02H 4QXGH 4JY5H 3PHQB 1DVFC 4H1LH 3QQ9C 3BP7A 3TO4B 4N5UA 4KJWD 1T66C 4RBPH 4K2UH 1FYTD 3L3GA 4APQA 1FVDB 3UC0H 3AXLA 3W39B 2VISA 1B0RA 1NDMB 1NGPH 4G8GB 5MEOA 1S9WA 3QQ4A 3TV3H 5DEGA 1KN2L 4HUNB 4RGMB 3WLWD 1OLZA 2CK2A 2NNAB 1X5AA 3IFOA 4HSQA 3VI3F 5BOPA 5J6GB 2BY1A 3JV4A 3RGVB 4XXCC 1FCGA 5ECJE 4HH9A 3A6BL 1OP5H 2ZKHH 2EXYD 4G6MH 4HUWB 1AD9B 2Z8VC 4CW1A 3A67L 2KUTA 4IMLA 3RBSA 4L4VB 1HINH 3GBNL 3BGMA 4UZGA 3DGGB 4JANB 4UT9L 1B0WA 5EZJB 4XCCH 3EOTL 3S5LA 1OD9A 4JAMB 4G6JH 2B1AH 5CJ8A 1HHHB 2H1PH 3S3PA 2R2EA 5C3LD 4MAUH 3ILQD 3V4PL 4NQEE 5HVFB 1X5GA 3RWDA 5D96C 5D5MA 3UTQA 1QHOA 5ANMB 2I07A 3LB6C 4E9LA 2DQGL 1JGDA 4NT6B 1YJDL 3CX5J 5EOCJ 5F1SA 5GGVY 5DC4B 3F58L 4NN6C 3O3EB 5FO7A 4NCDA 1BFSA 2BNQB 2RR3A 4QF1A 4R0LB 4TOYH 3N9GL 1K2DA 1EGJL 2ADIA 3A6CL 2Z8RA 2YPKA 1BBJB 4KV5E 4PJFA 1CDBA 2O5XH 4P5TA 2WSKA 4QRQB 5DHYB 4UDTB 5H35A 3VGEA 1VCAA 2A6IA 3ULVC 3TA3C 4PUBL 5EO9A 2I9TA 1BVLA 2EYSA 3G5ZA 3LH2H 1U8PA 4S1DC 4RX4A 5FGCE 4P49A 1OP5K 1IC1A 4RGNC 5KS9E 4KI5D 1JZ6A 3F7PC 3BPOC 1F97A 3NH7L 2R8SH 4FP8L 1U8NA 2Z4QA 2WBJD 2VERN 2VLKA 3ISWA 1K8IB 4NQED 4RZCA 4S1QL 1E27B 1PKQA 4MD4A 3S7GA 3LKRA 2WK2A 1RZ8A 2LAGB 2X4TB 5C0GB 4G7YL 2Z92B 3G5XA 1XGQB 3WL9A 1XFPA 5I1AB 1UXSB 4D2NA 3SY0B 2OJZH 3MJ8B 2C3HA 1D6VH 3OKDB 4KZDH 3B6SA 4KY1H 4Y19D 4YAQA 3V5HA 4YQXH 1QEWA 3OX8B 2EE6A 3O81A 1LEGB 2Q8BL 2GFBB 4JRXA 3GSRB 5KOMC 5AZ2L 4I0KA 3RX5A 2LU4A 3QUML 2Z31D 4LSPL 1AHWB 1T0PB 4RFNC 1RHHB 3D2UD 4OB5L 3ULUC 4YEFA 4Z7WB 5L8JB 3FQWA 1CWVA 5MI0B 5E03A 2XT1B 4ENEC 4HWBA 2DL2A 3WHE0 1L7IH 4C83A 5J0BA 3MRBB 4U1HB 3FONB 3VXPA 1UWGH 4MLSA 1WCQA 1ZHNB 3V6OC 4HMEA 3CVHB 4XBGA 5D6DC 1RJYB 1NUFA 2HKHH 3VW3L 3P9MA 1WAAA 2FEEI 2AEQH 1WZMA 3ZYJA 2Y1VA 3L3KB 1LK3H 4NO3B 4NC2B 1OPGH 4MA1C 4ODVL 1AGEA 1S7RA 3HE6B 4F9PA 1N2RA 3V0WL 4QOKE 5DS8A 3DXAA 4U1MB 3FZUC 3L3OA 1NLBH 1HSBB 2BOCB 4I4WA 2BDNH 3FTGB 4HLZH 5AD0B 2IH1B 1CXLA 1JMXA 1Q72L 1KIRB 5FA4B 4G59A 2ICES 4PJBF 2JIXB 3ZDZE 3MFFB 2W60A 5SX5H 3REWA 2NX5A 3QO0A 3LKNB 5JA8B 1OP9A 4J3UA 4M43H 2GQHA 3GJEA 3WJLC 1DQDL 4P4KA 4PRHA 1ZEAL 3QH3B 1ZLSL 4QT5A 4ZUVA 1VGKB 3SE9H 4XCEA 2D31A 1SYVB 1QNZH 2P8MA 5A3IC 3TVMC 4ORZC 3MXVH 4YWGH 3L3IA 3VCLA 3IDNB 4YDKL 1WV7T 3UTPE 3RZCA 1W0YT 3W82A 1F6LL 3QUZC 4WFFE 4K3DH 2CD0A 8CGTA 2J4WH 4Y16C 1DLFL 2ICCA 1EO8L 3DUSB 3QHTC 4ELMA 2Q20A 4WEMB 2CK0L 1D5MB 3OXRA 2A73B 1FV1B 4LOUC 1AQKH 5KSBF 4NKDB 5B8CC 4L9LA 2R9HC 5C07D 1ZLVK 1A4JA 1U36A 1CG9A 4QOKD 1RQ5A 4RSVA 1A21A 3D3VD 4PYHA 1XGYL 4I0PA 4XP5H 3NFSL 3EKCA 1MNUL 2IALB 4MXQC 4XVTH 4M6NH 5C0FB 1XR8A 2OI9C 4OTXH 1MLCA 2FD6H 3IJSB 2HA1A 3C09C 5M94B 4BFGA 1QLEH 1IGFL 3ARPA 3DJ9A 4YHIB 4U1GB 5KVEL 3IT8D 5SX5K 5AAWA 5GXBB 1T04A 5KS9F 2WWMC 5JMOC 3X3FL 4GMSH 2F74A 1NGQL 3KPTA 2PXYD 5JPNB 5EWIL 3BPNB 3RNKB 3OJVC 1RD6A 4HIJA 4N0FB 5EULV 5IB4B 1C1EL 3WNKA 1P84K 2G5BA 1Q0YL 2P7TB 1FGNH 3D39A 3UTPD 3BISA 1QSEA 2AJXH 3ARUA 4L4VE 4PP2A 3BAEH 3ZZ1A 4FFEX 2HJKB 1I7UA 4I3SL 3NIFE 2ADFH 1MAJA 3ZDYF 5HY9A 4L8CA 1JGLL 1A6ZB 2RCSL 2XA8H 1LD9B 4X6DB 1CDCA 5ANME 2BXZA 3T3ME 3HNTL 4DZ8A 4EQ2A 4L5FH 3MBXH 1KB9K 2ARWA 4PJXE 5CP7A 1DSFH 1BEYH 1BFTA 2BNQE 4OCYL 3EYSH 1A6TB 1B6DA 2XG4A 5CINL 4XTRD 3THMH 3QFJD 5EZOL 4J7RA 5EORH 1D9KC 4TUJA 4U1KA 1EIBA 5CLTA 1F4WH 3LD8C 4NYLA 2H32H 4LCIH 4WHTA 2D7OA 5FIEA 3SKNB 4H5SA 3V8OA 4F33B 1PY9A 2VE6A 1S7SA 1QFUH 3WJJC 4BH8B 4MXWL 1J8HB 4Z78A 1MRFL 4N0YH 3QIWC 5TJWK 3QIBA 5DD6B 1BJMA 5GRVK 1SY6A 1EBPA 1I8LA 1AO7D 4I3RL 3GIVA 4NN5C 1UGNA 4ERSL 3CDCA 5F7HA 4R90H 4JY4A 2VL5B 2BSSB 5TQ0L 2PYED 1JF1A 4QRUB 5J9PB 3TO2A 2OZ4A 4KK8D 4KK6C 1JWSB 2ICWI 1FNEB 4D8PB 3U7YH 4OQTA 5EOTB 4K7PX 3GI9L 3JWDC 2EE9A 3D9AH 5EUOA 2Q86B 1AGDB 4OT1L 4KQ3L 4HLJA 4GW1A 4U1JA 1GL4B 1XH3A 4QRSA 1OT1A 3VFMA 2W92A 2BNQD 4JKKA 3RAJL 3TN0A 4AEFA 3ZDZF 3GSUA 5GRUH 5GZNC 4HHAA 5D1ZB 1EUTA 4S11A 2AJ3A 4LPUA 4FABH 2AEIT 4DGIH 1WBXA 4H20H 5FCUH 1RVFH 1CXHA 5T3ZE 3FL7A 1VA9A 4F7MB 4AH2B 3QWRD 2EDDA 4PP8C 4MQTB 4MQ7A 3HAEA 3E6FB 2AJYH 3DLQR 2WIMA 4KMTH 2R69H 5I16A 1AKJD 2VYRE 3VFWB 4HG4K 3X13A 3S35X 3HZYA 2FIRT 4XZUB 5C0CD 1LE5B 4WFED 2X05A 1MHPL 4K3EL 5BQ7A 3BE1H 5J13B 1YDPB 4NC1E 3LPFA 4MAYB 5KTEH 4GG6B 3BD5A 1UH4A 4Y88A 3AY4C 5D1XC 2WLZA 4IM8A 3MQIA 12E8L 3LRSB 4WTWA 3RVXC 4NN7C 4JFOB 4DN3H 4JKWA 3AS1A 2J8UE 4Z7VE 4KUCD 4LDEB 5I2IB 5TGBA 2AK4B 3OG6B 3CZFB 2DQTH 1I85C 4XWGL 1C5BL 2YPLB 2ZUSA 4JPIB 4MS8C 4WUUD 1QUNA 3WO4C 1H5BC 4KJYB 3BVNA 2GI7A 2HYMA 4N8VB 3T8XA 5F9JA 1Y6MR 4LCWB 1UZ6F 2P43B 2VXQH 5ITFA 2NLJB 5FB8B 3IU3B 1AGCA 3O2VH 4M5YH 1A6PA 2N1KA 3DBXA 2BSTB 3TJEH 1YEFH 3BO8B 1BQHG 3LKOB 1KJ3L 1IAOA 5I19H 1MQKH 3BN3B 1IKFL 2X4NB 2X1XR 3W9DB 2XIDA 2IJ0C 4PJ7B 4TTDD 1KFAH 5KAQF 4OCRL 3CLFH 3S37X 2JJVA 4JDVB 4JZNB 5I30H 1UB6B 3NIFF 4ZTOH 4YHOL 2OJEB 5C0AE 4LSUL 2X4UB 3FRUA 2UYLB 3QI9A 5TDPB 4OLEA 2HWZH 4IMKA 1K6QH 1GGTA 1P5UA 5EU6B 3DSFL 4MQXD 4J3TA 5DJDB 5GS0H 4ODWB 2J88L 5C3TA 1ZT7A 2OSLA 1FZJA 2CLVB 3P4NB 3ELAT 2GUOB 2Q7NA 4E0RA 5C09B 2IPTH 2BXYA 4XNZB 5TDNA 1T7XA 2VZUA 5DQDH 1Q9KB 3MR9A 5EZLA 5F7MC 1KB5H 3MJ7B 3QHZL 1T5XA 3H3KA 3T0EA 1WZLA 3CFDB 4OV5A 1FNFA 2QKIA 4WNQB 3LN4A 3MCKA 3BHBB 1Z9SA 1ETZB 3N1MC 4DZBB 4ETYA 4EUPB 2JIXD 3R1GL 1KCUL 5FYKL 5F1NB 4PRBB 3HI1B 2MCG1 4DGYH 3DX9B 1R5IB 1GZQB 5FUCC 3VXRB 3FO9A 2ICWB 3QUKA 4NFCA 3P30L 1KC5H 5HGBB 3WHXB 3QUXC 4U6TA 4BFBD 3LKQB 4Y5YC 1VACB 4MCZA 4OJFL 5C0AD 1FFNA 4I5BB 3GUTB 4Q6YA 2F54A 1CDYA 2ZSWA 5T3XL 1MCQA 4RAVA 3GNML 5TE7L 5ADOL 3BX7C 1EUUA 3HPLA 3OJDA 2MPAH 1WC7B 4S0TD 4WGVB 5E2UL 4L3AA 2XN9A 5JUEL 3QT2A 4GKNB 1UT9A 5J7CC 1WFTA 4X6DE 4BFIA 3I6GB 4ALAH 1NFIA 3UEZA 2V9RA 3S35L 5INCA 3KR3H 5EO1B 5HBBA 4P9HC 4PTTA 3CLEL 3LS5L 3BP7B 3F8UB 1I1AD 1L6XA 4NJ9L 3L3GB 4APQB 4Z7WF 3AXLB 3K2UH 2VISB 3REVA 1B0RB 1XMWA 3SE4C 1YECL 5MEOB 3WFEH 3QQ4B 5DUMH 3CFCH 5DEGB 3DVFA 1FPTL 1CT8A 3IFOB 3GM8A 4LIQE 4OLYH 4M5ZH 2DIJA 4X4MA 1A7NL 3JV4B 5IVXE 4PG9A 3UDWC 2FZ3A 5GS0D 4KAQH 4BKLA 1BGXL 1JF6A 1PG7X 3BDYH 3K74B 1JFQH 4HH9B 1NBVH 5BW7A 1HIMH 4FFWC 2FEEL 4FFYL 4HXBL 4XPHH 1MJ8H 4CW1B 4NJAH 4X5XB 4Z0XA 4LFHG 4R8WL 4IMLB 1KXQE 3VXTA 2Q76A 4XVUC 3L3DA 1X5HA 3ARED 3V6BR 3BGMB 2C3WA 4JG0L 4BZ2L 4GMTL 3S5LB 2R2EB 1HK6A 1KCVL 2EDRA 3L6FA 1CQYA 4ORGA 3RWDB 5D5MB 2R1YA 1J18A 3UTQB 2I07B 4KDWA 5KVMC 3WS3A 1JGDB 3S37L 1YC8A 4EBQH 4NCC2 3U9PL 4QLRA 3WXVL 4O51A 4CVZA 2VH5H 5FO7B 2J2ZA 2YRPA 1UFUA 1KENH 4LSQL 4QF1B 2BVOA 4JLRA 4X7SL 5I8KH 3VRJA 1K2DB 3Q1SL 1IGCH 1RZKH 2ADIB 2QL1A 4NKIL 1AI1H 2YPKB 5M7QA 5L7XL 4PJFB 4P5TB 1O7SA 4HJ0C 3NABH 1MWAL 5H35B 4CBPA 2A6IB 4LPYA 2I9TB 1BVLB 2NY0B 2EYSB 1IEAA 1I9IL 3G5ZB 1U8PB 4G42A 4G6AC 4NM8H 4GG6E 4M7ZC 4Q97A 3MROA 4QHUB 2KKQA 2NR6D 3U4BL 3ZKMC 25C8L 4ZFOB 4OD2A 4L9DA 5J8OA 1N6QL 1UYWL 3HCVA 1U8NB 2Z4QB 2VLKB 1A0QL 3FN3A 3S34L 4JO2L 2AK4E 3ARFD 2YPLE 1NL0L 1PKQB 4MD4B 3LKRB 4MQSB 1RZ8B 3HMWH 2VDPH 4Q9CA 4TVPE 3G5XB 3VJ6A 4PJCE 3ZDXE 5E8PA 1H8OA 3WIFA 2VUYA 3IVKB 1VGEL 1UKQA 5D1ZD 4LCWE 3B6SB 3GKZA 4YAQB 5GIRA 3V5HB 4DW2L 5IB1A 1QEWB 3RA7L 5D7KD 4QNPF 1MHHA 4JRXB 5BVJA 1TMCA 1MCDA 2NY6C 4KDVA 4OLXH 3WLBB 3M17B 2D7QA 1LK2B 4CVUA 4A2MA 4EI5C 5IW3A 2XZQH 5CKAA 1VFAA 4LCCA 3SE8H 5EU4A 2DQCH 3SCMC 1GC1C 5C6TL 2Y5EA 3FQWB 3GI8L 1NGXA 4C83B 2VDOH 4HJJH 3TBTA 5E1HB 2O5YL 3PL6B 3L7EA 3TO4C 4XBGB 1G7QB 1CDGA 3P9MB 4W4OA 4X6DF 5EU6E 4N90E 5IFAL 2NXYD 4HUXA 1KTRL 4F58L 4PS4L 1P9MC 1B0GA 1RK1A 4OFYD 2JTDA 1D6EA 2VMFA 4MXVE 3KJ6H 1A6WH 3RNQA 4NNYA 1S7RB 5JZ7D 5LCVH 3RGVC 1HZHH 1PG7L 3VGAB 1N2RB 3EOAA 3DXAB 5DS8B 3L3OB 4KVCH 2PETA 5TE6H 3QCVL 4I4WB 4PREA 1KF9B 1KYOK 3IU4L 2YRLA 3U83A 1M7IA 1DUYB 3D6GA 2W60B 1MIML 4NHUA 4PLKC 2VDKL 4Q6IC 5E5RB 5TDOA 3REWB 3VXRE 2NX5B 3QO0B 1NCAL 4XBPA 4HGKC 5TFSL 4X7EC 4S2SA 3GJEB 2FX8L 5FA3A 4PRHB 5JXAL 3DUUA 4QT5B 5LXGL 4ZUVB 3WFBL 4Y0GA 2VN4A 4ONFH 4DVRL 2D31B 2GJJA 1CDHA 3BMVA 4OCLC 3S98A 5T5FH 2P8MB 5F6IB 3L3IB 3VCLB 5EU6D 4N90D 2GIYA 3RWFA 7FABH 1NAKL 4ZS7L 5E8DL 3RZCB 1G7HA 3RQ3A 2WIIA 4K07A 1A7QH 1NQBA 4KHTL 3WIHL 2ENSA 4XPBL 2XQYG 3GMMA 3OXRB 3OKLA 3H7LA 1GGIL 5D7LE 3I3EA 4L9LB 1OAZH 1A4JB 4P99A 4I0PB 4M9OA 3V2AR 4FNLH 3B9VA 3RVTD 4CVXA 1IC7L 3SDCA 5I71B 1XR8B 1H8NA 4LCYA 1MLCB 4NZRL 1RIHH 1T0NA 3KGRA 1GIGH 4P59H 3MLPA 5F7EL 5HYJA 3QRFM 5B3NA 4GG6F 3OG4B 4G8FA 1T04B 3GMQA 5E4EB 4NHCH 4MD5A 2F74B 3FOLA 3MLXH 1CGWA 2OL3H 3ZKSD 1RFDH 4OCSH 3B5HA 2XOTA 1KCSH 3NCJH 4JFEE 2KPNA 5EDXA 1ZGLM 2G5BB 1PKOA 4OF6A 4XCYB 3D39B 2H2SD 4FHBD 3RX8A 3EDKA 1QSEB 1K4CA 2EIZB 3G04A 2RJMA 3MNVB 1NMBH 4PP2B 3HMXL 2VZVA 4TQEH 3OBAA 1DR9A 1YYML 1I7UB 4FQ1L 4ZFGH 4GSDL 3TBVA 1A14H 3ZDXF 1HSAA 4KJQD 5D7LD 5HY9B 4L8CB 4WWKA 2WY3A 1AHWC 4FQ2H 3BQUC 4YDIL 1G6RA 1RUAH 2VWEC 3P0YL 5HHQA 3C60A 5MI0C 4DZ8B 1J86A 4J4PD 3P11H 3UJTH 2F58H 4JM2B 5CP7B 5E2TL 1UM4L 2XKSA 1GAFH 3SGKC 3RPKA 5KJRL 5I1HL 3BRGC 1IE5A 3M45A 3JZ7A 4U1KB 4XBEL 4PJ7F 4Y5VC 1JI1A 1V5JA 4NYLB 4WHTB 4KK5C 2ITDA 5IMOA 4HDIA 1F4AA 4H5SB 5DD5H 1TTFA 3LZFH 2VE6B 5DFTA 1S7SB 1YEEH 3TH4T 1AQDA 4Z78B 4B7IA 4AIZA 3QIBB 5I1GL 4JFED 3C8HA 5EFIA 1P4BL 3GIVB 3SGDI 1CYGA 4JY4B 4Y89A 5GS1A 3QEQE 1EAPA 1JF1B 4Y1AA 1L0YA 4ZTPL 3STLA 3EDEA 5T33L 2VLKE 4UQ2A 3TO2B 3VD4A 4A6YH 5C0BA 5HYFA 1IL1A 1NGWA 3AS3A 3GSWA 1FAKT 5IT2L 1XR9B 2YK1L 5FV2A 3O45A 5EUOB 5F1IA 4FTVA 2CIIA 3VFNA 1LDPH 4GW1B 1Y18A 1GPOH 2IFFL 1XH3B 2QADD 2X1PA 4U1JB 4WDIA 4QRSB 3VFMB 3AM8C 4QXUH 5HI3C 3TN0B 5BV7B 4IJ3B 1N3NA 1A5FH 3GSUB 4D9RE 3NTCL 4HHAB 3IRPX 3IFPA 2AJ3B 4CJ0A 5IB2A 2C4FU 5DZLA 2D0GA 4PD4J 1WBXB 3KNBA 2GTZA 5MENA 1S3KH 3MRMA 4J1UA 5D7IA 3DX8A 3H9HA 1J9CT 4MQ7B 4HKXA 1WWWX 3HAEB 3E3QA 1AXIB 4UI2A 1OWRM 4Z0BL 2NY3B 2DQIL 1LO0L 4JJ5A 5I16B 2ZPKH 2XZAL 3ME0A 3X13B 3B2UD 3HZYB 4KKCC 3ZKQD 2D7TL 4F37K 6FABL 5BQ7B 1OTTD 2BZDA 4AIOA 4J12A 5IROA 4QKXB 3B9KD 3QEQD 4CU8A 1OT2A 3IJYA 4XNQA 1CFQA 5IJKA 2CXGA 1KUMA 3QO1A 1F3DH 3LEYL 4HV8A 2E7HA 1F4HA 1MCOH 1FQ9C 3NAAH 4I1NB 1FRGL 5TGBB 5DJXB 1CFVL 1GGBH 2YMXL 5DUPH 4HXAH 2UWEE 5DVOA 1CFTB 2DLGA 3BVNB 1FC1A 2R29H 1RIUL 4U1NB 4LSTL 3OAYK 3DXAE 5IFJA 4LL9A 3LPWA 1C16A 4D9RD 4U6HA 1QFPA 5LGJA 1JPTL 3FO1A 1FCCA 1NEZG 5JDSA 1AGCB 4I77L 5CJXC 4RAHA 5DT1L 2OQJA 3DBXB 2D0FA 3F7VA 3WNPA 3WXWH 2X1WL 4Y2DC 3BPLC 4CN1A 3DETD 3O9WD 1E6JL 3VWKD 4OQ1A 3VWJA 1J5OL 4M7KL 4OLWL 2NY5L 1MFEH 1CU4L 3PL6D 5F9AC 5ABDE 3O6FC 5ID1A 1IBGH 3O2WH 3HS0B 4JO1H 3U0WL 4WO4D 2GT9A 3QI9B 5D5MF 3SHSA 2P45B 2EIEA 3MCG1 1HHGA 1G9NH 2XRAL 5KAQG 1OVZA 1ZT7B 4HPYL 2OSLB 1G7JB 1FZJB 2I60L 3SGJC 1CL7H 4J6RL 5D6CA 5I1KL 4E0RB 1OW0A 4Q0XH 3NA9L 2WBWB 5TDNB 3MLTB 5SWQA 3MR9B 4HAGA 2GJ6D 4X4XA 1EFXD 1F5WA 1RURL 1IGMH 1T5XB 3Q3GA 5ESAA 3T0EB 5IUSA 2PTVA 4PJFF 4OV5B 2QKIB 3LN4B 2WAHA 4XNMA 5ENWA 2YUWA 3MCKB 1YNKH 2H45A 4OLZH 1LP9A 1XGRA 2MOVA 2IBZY 2QSQA 4LVEA 3U9UA 3W2DH 2J6EL 1AXSA 4RFOH 5GS2H 4B53A 1AY1H 1S9YA 3FAWA 3FO9B 4ZUSA 5EBWA 2EH7H 1D5BB 3QUKB 4EIZC 1T03L 4PP1C 1A3LL 1MELA 4NNPL 5CGYD 2AJSL 1IGJA 1E4WL 4HEME 4MCZB 1EJOH 2XTJB 1FFNB 3QR2A 4PJHA 1VHPA 4P2RA 4RMTA 2F54B 2ZSWB 5E99H 4O02L 1BM3H 4QXGL 4JY5L 4RAVB 3P4MA 3QULA 4EN3D 1MCSA 2Y72A 5D1QA 3HPLB 5K59E 4K2UL 5CIPH 3QIUA 5FUZH 2XN9B 1BD2B 1OARH 1ZWIA 1T2JA 3UC0L 3RL2A 1BOYA 1F4XH 1NGPL 4CKVX 3PP4H 4M1CD 4OGXL 4BFIB 1NFIB 1NC2A 5INCB 3NPSC 4PTTB 3O8XC 5IK3A 1DLHA 1LO5A 4MAYC 3RVVC 4RISH 5TE4H 2MQ3A 3V7AG 1VERA 3NZ8B 2P8PA 2ZSVA 5E1AA 2ZKHL 4G6ML 4MSWA 3REVB 5JIPA 4HUKB 3RDTA 1CT8B 4PG9B 4XCCL 3INUH 1N5YH 3C6LD 4BKLB 1BZ9A 1MY5A 1WAAF 2B1AL 3BXNA 4G6JL 2H1PL 1ES0A 4MAUL 2YD8A 3BP6A 4XAWH 3ZKND 4Z0XB 3VXTB 3S88H 2Q76B 3L3DB 1GSMA 4PJ8A 1FL6A 1Z2KA 5C2UB 4L4TE 4LRIA 5I6XB 3VGFA 1MOEA 1QHPA 4M4PA 5DD3L 4TOYL 2JLLA 2DI7A 3TBWA 5EUOE 3RTQA 5MHSE 1BJ1J 3L6FB 5FFLA 3QB7C 4ORGB 4K94H 1DL7H 1N0LA 3KPQA 2R1YB 4EDWL 2E7LE 5KSAA 4JM2D 4ZD3H 3QHFL 1INDH 3WS3B 3B5TA 5GS2D 3U7AA 5FGRA 4WTZG 2A0LD 4O51B 4AL8H 4CVZB 3U1SH 1CXIA 1UXWA 2AVGA 3LH2L 2BVOB 4JLRB 4G8EB 5F7UA 4WTXA 3VRJB 5IMLA 3P73A 4QRPE 5KSUA 5MP6H 5DK2A 2EECA 1A3QA 2R8SL 2IAMC 2M8XA 4PRAA 4FA8A 5GGUA 3K0WA 5FM4A 1IEAB 4FQXD 4G42B 3MROB 4PGBA 3OJ2C 3SDDB 2VC2H 3LMJH 4YLQT 4KRPC 2BRRH 1KEGH 5K33A 1G0DA 4L4TD 2OJZL 4KZDL 1D6VL 3HCVB 4JHBA 4KY1L 4M4RA 1S9KC 4YQXL 5I9QB 2B39A 5MHSD 2P5ED 1N4XH 1SJEA 1MRDL 3LQAC 1VB9A 3KLAA 3N0PB 4BK4A 3AC0A 3OJMB 2DJ4A 4XPTL 3N85H 5D7JD 3NN8A 3VJ6B 5E8PB 3FQRA 3WIFB 1ZXQA 2PO6A 5GIRB 3VGGA 5IB1B 4HJGA 1L7IL 1Z0MA 4LARH 5SWSE 1MHHB 5BCAA 1N64H 1QSFE 1TMCB 1G9MH 4QRPD 5BVJB 5F71A 4POUB 3LAFA 2HKHL 3G08A 2W9EH 5FK9A 1VFAB 4LCCB 5EU4B 3EYOB 4KTDH 2AEQL 1SEBA 5I0ZA 3TBYA 1NGXB 2NY4C 1LK3L 3AROA 5F9OH 4X6FA 2YD9A 1F3RB 1OPGL 3T77A 2DIAA 2A6JA 3TBTB 2C9AA 5K59F 2UZYB 1F00I 3L7EB 2I5YH 2MKLC 4IDJL 1NFDE 4APQC 2G9HB 4HUXB 3MLWH 1NLBL 1MJJA 4UBDD 4X4YA 3ROLA 3UZEA 1JE6A 1RK1B 4JM2F 4YX2H 3ZSSA 2BDNL 3I3DA 1D6EB 4OLVH 1CFBA 2H2PD 1GHFH 4GFTB 4EOWH 5ISZE 2EDFA 3VXNA 3RNQB 4NNYB 3UAJD 43CAA 3ARGD 3QXUA 4M43L 5DEZA 3EOAB 4LK4A 4JREC 2YN3A 4BM7A 5F7DA 2FJHA 2X44D 5SWSD 1QSFD 2ID5A 2W0PA 4PREB 3SE9L 1JPGA 1QNZL 1HHIA 2WUCH 3MXVL 2OTUA 2NXZD 1M7IB 4NHUB 5TDOB 1XF5A 4N8PA 3K81A 3O2DA 4XBPB 1X6LA 2P49B 4K3DL 5HHME 5DHXB 1C7SA 2J4WL 4S2SB 5F1OB 5FA3B 2HRPH 4GXUM 4UNTA 2VN7A 3DUUB 1AQKL 2G60H 3K1KC 5JHDA 2PKDA 4HAFA 4RRPA 3RWFB 1HILA 5EUOF 1LE9A 5F9DC 1G7HB 5IBTH 4XP5L 4DN4H 5IMKA 2WIIB 4M8VA 5D9SB 2QQLH 4XVTL 4D0DA 4M6NL 1SBBA 1YN6A 1U8KA 1BD2E 4OTXL 4QWWD 4X6BA 3GMMB 5ISZD 2FD6L 3OKLB 3QA3A 4LNVA 4LKXB 4NRXB 2Y9RT 1QLEL 1TITA 2PNDA 5HYIA 2F53E 4LEOA 3ARDC 2IF7A 2NY0C 5GSVA 4HUUA 1H15A 2C5DC 4GMSL 2Z93A 4NBYB 5J89A 4AQOA 4CVXB 3SDCB 1X5KA 4ZFFA 3T2OA 5GRVL 4LCYB 1LQSR 3U79A 5LQBH 1T0NB 2EDQA 1FGNL 4Y5XC 4XXCA 3B4NA 5HYJB 4GT7A 1H8SA 2AJXL 5HHMD 3BAEL 5DURD 4G8FB 3GMQB 4RMUA 3P40A 1JHTA 1QSVA 4MD5B 1LEIA 4I48A 2RHEA 3FOLB 2ADFL 3PXJA 1T4KA 4OZ4A 4ODSH 5HDOA 1MLBA 2XA8L 4XCNB 4K23H 2FBJL 1MFNA 3I75A 1PBYA 2QHRH 4QXWA 5CZKA 5DEFA 5HYSB 4PJIE 1X4ZA 1K4CB 3MBXL 3G04B 1DSFL 1T0MA 4PGEA 3LDBB 3ARVA 4I2XE 1BEYL 1BD2D 3TBVB 2NY1B 3CVIL 1HSAB 3EYSL 3Q5TA 3THML 5EORL 3U6RA 4F8QA 2F53D 1FVEA 1F4WL 2O26U 1G6RB 2YD7A 4LCIL 3IFNH 5ACMA 5HHQB 3C60B 3T1WA 4H0IA 1ACZA 2KQMA 4YHZH 3D85D 1XGPB 1QFUL 4J8RA 3TFKC 1DQTA 4KRNA 4X6CE 3RBGA 4N0YL 4OGYH 3OB0H 2HT2C 3W5MA 1JHKH 3AB0B 1M4KA 2FSEA 1HI6A 4R90L 1NCNA 2ITDB 5IMOB 3MO1A 1I7ZA 4HDIB 4WI3A 4LDOB 3GRWH 4KJWC 5K9QI 3GIZH 1FZOA 1AQDB 3VFRA 3U7YL 4HC1H 3OKMA 4U31A 5IOPA 43C9A 3D9AL 2UY6A 3CVHL 3VGAC 5EFIB 4ONGL 1JHLH 5DHVH 3QEUA 1IM3A 5SWZA 3ULSA 4NQSA 1V7NH 1EAPB 3MJ9H 4TYUA 4Y1AB 3STLB 4UNUA 5A16A 1HQ4A 4UQ2B 5ICYA 5C0BB 1IL1B 1NGWB 1A6AA 4FABL 5J57B 2NY5C 4MA7H 4DGIL 2EXYC 3HC3H 4H20L 5FCUL 1RVFL 3O45B 5F1IB 2WUBH 4FTVB 2CIIB 3MRGA 3VFNB 3D69B 2V9TA 1Y18B 2AJYL 5FGBC 4P4KC 1DQJA 3QZWA 4WDIB 1IC5H 2J12B 2ERJC 2OCFD 1OF2A 4MDJA 3HC0A 2R69L 4NIKB 3JWNC 1N3NB 1L8JA 3IFPB 5IB2B 5F6IC 3BE1L 3QNYB 1ZA6A 3KNBB 1KXVC 2GTZB 4IOFD 1YNLH 5MENB 3NIGF 3BDBA 3MRMB 4J1UB 4EUPG 3DX8B 3H9HB 4HKXB 2F19H 4FG6C 4YDLC 1H3VA 3H9SA 3EO1A 1FH5H 3EYVA 4M00A 4DN3L 4JJ5B 5CHNA 3O4LE 5IKCA 4HQQH 4PJEE 3SDDD 2DQTL 3RY6A 4X83A 1EMTH 1U8OA 3RJDA 1A47A 1YMHB 3I02A 5DMJB 2W0FA 4N5ED 3IJYB 2ESVD 1UJ3A 2Q8AH 5I71C 4XNQB 1CFQB 5DJ8B 5E6IC 1CQKA 3QO1B 4R4ND 5C6WH 4HV8B 3QG7H 7CGTA 2MKWA 3RJQB 3B83A 4DWHA 3MA7A 2VXQL 4Z7NE 2DMKA 2NTFA 3O2VL 4S1RH 3LV3A 4YPJA 1U91A 4M5YL 4KI5C 3GEWB 2BMKA 3TJEL 1YEFL 4TVSa 4XC3H 5IFJB 1AXTH 3KG5A 1C16B 4U6HB 5I19L 1MQKL 1EX0A 1LO2L 2GSGA 5LGJB 1KJ2A 2R0WH 3FO1B 4L3EA 1KFAL 5JDSB 3CLFL 5T1KD 4DK3A 5I30L 5FUOH 2N4IA 3BT2H 3WJLA 5IMMA 3KWWA 3MRNB 5ICXA 2X70A 2OQJB 5B4MD 3F7VB 2C4FT 2HWZL 1K6QL 2O5ZH 2L4OA 2CKBA 3RFZC 4LVOB 2ICEA 3D0VA 3O4LD 5GS0L 3PABA 1TQCB 1BZQK 3VWJB 1LO3H 1ZLUH 4Z76B 3QUZA 3PUCA 2V7NA 5H8DA 2EE2A 3V4PH 2IPTL 3TIDA 5ID1B 4XP4H 5DQDL 5AYUH 1SQ2N 4JFFA 2GT9B 3B9DA 1KB5L 3GSVA 4YE4H 3L95A 2DYPD 1YJDH 1SYSA 5B8CA 4U49A 1T7ZA 4GS7C 1HHGB 3QPQC 2D4FA 3IETA 4QHNA 1G1CA 5D6CB 2HMID 4KK9D 3L5XH 4MXQA 1U8QA 1RJZA 4DGYL 1V3LA 5SWQB 1O0VA 5DFWH 3L7FA 3GK8H 5ESAB 3Q3GB 1TCRA 3K4DA 1KC5L 4ZXBD 3SDAD 1Z6JT 4XNMB 1UM5H 3S96A 3IXTA 4WHDA 1CDUA 1IARB 4RA3A 5E6ZA 2DQDH 5HYJE 1XGRB 5J11B 3U9UB 1AXSB 1S9YB 3VRLE 4ZUSB 2DMBA 3NH7H 5EBWB 4NPYA 4TNVF 1T21A 2MPAL 4WUKL 2R1WB 1ADQH 2RFXA 4OIIH 4PRPE 4HMCA 4P2OD 1IGJB 4POZD 3JUYA 4YNYA 5IQ7H 1NCCH 3RKDD 1HYSD 1DZBA 2YZ8A 3TN0C 3KR3L 4PJHB 4J2XA 4P2RB 5CS7A 3DTXB 1XF1A 5A2LH 1U8IA 2CDFA 4U6XA 1H3TA 2FHBA 3QULB 2AJUH 4XHQA 3ZLQC 5C08A 1IAIH 5D1QB 1JL8A 3NZHL 1BBDH 3P4LA 3QIUB 3R4DA 4N9GA 1ZWIB 4Z7QF 3RL2B 3K2UL 1UH3A 5F89A 4GAJH 3WFEL 5DUML 3N06B 1NC2B 4X9HA 1S7VA 5EOCH 1KJVA 3QJFA 3ZMRA 3A0OA 1U41A 4OLUL 5L9DH 3ZTJH 5J1SC 1FO0A 4K3GA 4LSPH 5DJCA 3TJHD 4GUPA 1WF5A 2KL6A 1D9KA 4Z7OF 4OLYL 3ZT6A 4M5ZL 1RZGA 3QUYA 2IWGA 4L4JA 5IK3B 4LEXH 1XCQA 1DLHB 3GDBA 4NQCB 2Z8SA 4RNRA 5L6YH 4KAQL 1LO5B 1NSNH 4LDLB 4A2LA 1KGCE 1QBLH 3BDYL 1JFQL 1WK0A 1NBVL 1NAMA 2E3VA 2P8PB 2ZSVB 5C0NC 1HIML 5E1AB 3G6DL 4MSWB 3WJJA 4XPHL 1MJ8L 2NYYC 4NJAL 4Z95H 4DCQA 5T1LD 3U30C 3RDTB 5CCKL 1ZSDA 4PRPD 3DRQA 4NQDE 1BZ9B 3BXNB 3WDJA 1ES0B 1NKRA 5JOPE 4YR6A 3TM6A 1JN6A 4OFIA 2AERT 3BP6B 3HE7D 4Z7NF 4LVHB 2Y4SA 1MCLA 3MOAH 1CL7I 4Y1AE 1JPST 5INDA 2OX5A 4EBQL 4PJ8B 1FL6B 2CGRH 2VH5L 3RIFF 3CSPA 1KENL 2PXYC 4YGVA 5I8KL 1A6UH 4U1LA 3MUZ1 1IGCL 3TBWB 3RTQB 1RZKL 2CQVA 1M6OB 3MBED 4R97B 3HG1E 3KPQB 1C5DA 3CSYA 4UT7H 3CX5K 1AI1L 4K71B 5KSAB 1QFOA 3QJHA 4FQHB 3NABL 3OKKA 1KACB 2FEDD 5BO1H 4EXPX 1EHNA 4NWTH 4MA3A 1F6FB 1FNHA 1UXWB 2ICWJ 2V2WA 1BAFH 1ZEAH 1ZLSH 4YDVA 4WCYH 4NM8L 2HJLA 5D2LA 2E9BA 3QI9C 1R5VA 2PR4H 4LLDA 5IMLB 5CJBA 3P73B 3MV7A 4ZUWA 1ORSA 3NIDF 5KSUB 5DK2B 4GRLA 4OZFA 1NUDA 2WBKA 4KROD 4NQDD 4PRAB 1PZUB 3RVWD 3O3AA 3AY4A 5JOPD 5GGUB 2AXFA 1DLFH 1PFCA 4XTRC 1HE7A 3MRIA 2OXGA 4HD9A 4PGBB 2VDPL 1JGUH 1CIUA 3T0EC 1P1ZA 4IRSD 4MS8A 5EUKA 4QYOA 1H5BA 3TF7C 4OCMC 1KIUA 5E7FA 2VR4A 2CJUH 1BIIA 3D1MC 3FT2A 1O5DT 1SJEB 2X4RA 3T0WA 4OLXL 3HG1D 3PWUA 2CPCA 1KCKA 4M3KB 3KLAB 5CUSH 5H37G 3BYYA 5H2BA 2XZQL 1ZGLA 3NN8B 3SE8L 2DQCL 4B5EA 2PO6B 4OGAD 5CEZE 2XTJC 4BQ9A 4GBXD 4HJGB 3VRLF 2VDOL 4HJJL 3BZ4A 3CFKA 3FQXA 5C1MB 1VFOA 4V2CB 2BCKA 2Q7YB 4K7FA 2R1XA 4TSCH 1S5IH 3G08B 5GPRA 5FK9B 1SEBB 3DHJA 3TBYB 1I4FB 3EZ8A 1P5VA 1J1PH 4X6FB 3T77B 2YOCA 2A6JB 3KJ6L 1A6WL 1U2CA 2KH2B 4H1LG 2VLME 5FKAA 5LCVL 1T83A 1HZHL 5FYJU 1KTLB 4KQ4H 1QSZA 1MJJB 1SVCP 3KHOA 5TE6L 4X4YB 3ROLB 2ATKA 4PJ5A 1O7VA 1UCTA 5CINH 5C9KA 1Q38A 3VXNB 4XWOC 43CAB 5F44A 3V0VA 1GJIA 2CRYA 5JW4R 5BW7C 3U0PA 1E4KC 4WHYG 3P4OA 2FJHB 3DVIA 1MH5B 4ONFL 3TCLB 5C0JA 1JPGB 2IGFH 1SEQH 5T5FL 1AR1D 4C57C 3ZHLA 2OTUB 4HPOH 5I6XC 1EGJA 4XI5D 3VG0H 7FABL 1XF5B 2CR6A 4K3JH 3WIIH 4DEPC 3NGBC 5MEQA 1A7QL 1NCDH 5A43C 3C8DA 1LHZA 4XP1H 1L9MA 3CC5A 5E08H 2J5LC 1DUZA 1EDQA 2VLMD 1QRND 5JHDB 2WNGA 4OT1H 4PJHE 5DLMH 4P2RE 1OAZL 1HILB 3HI5H 1QR1A 1LE9B 3DECA 4UILH 3MMEA 3W0WE 2P46B 5IMKB 1XF2A 3RAJH 4FNLL 5F88A 4D0DB 1YN6B 1U8KB 1N8ZA 4X6BB 5JLZA 1DEDA 1P2CA 1RIHL 1GIGL 3QA3B 1DVFB 4P59L 3IDGA 3E1F1 2YD6A 3N1PC 4LEOB 2DQHH 2VDRH 3TH3T 1B4JL 3EYUH 5D7IF 4NHCL 5GSVB 4NQCE 4HUUB 3SDXE 4LHJB 1H15B 3BW9A 3IYLW 4MNQE 2Z93B 2OL3L 3MLXL 3JTSA 1RFDL 4KC3B 2EO9A 4ZFFB 4OI9A 4U3XA 3QCUH 4JDZA 1KCSL 1T20A 3NCJL 4YHYB 2P4AB 3UDWA 4XVJH 1PEZA 2Y6SD 3VD9A 5BS0D 2VIRA 1NMBL 2ILLA 3HAEG 4TQEL 2XNAA 3QUMA 1JWUA 1NC4D 5FHAH 1JHTB 4ZFGL 1LEIB 1T1WA 4I48B 5D71H 1A14L 4LPWA 4OZGE 1T4KB 4OZ4B 4P46D 4E42A 2DMCA 4WGWB 1MLBB 1PX3A 4FQ2L 4ZFOL 4P2RD 4NWUH 4GKOA 1RUAL 3NCBB 3I75B 5DEFB 3TPKA 1HEZA 4OCXH 5I75C 3W0WD 1FE8H 3MV01 3P11L 3UJTL 2F58L 5D70H 1T0MB 5FYLH 4PGEB 3UTOA 5D96B 1GAFL 2R0KH 2C3VA 3ESVF 4ZUTA 2DTMH 3RVUD 5EN2A 1Z9OA 3U6RB 4PDCE 1BF2A 1FVEB 4NN6B 1V7MH 4AIXA 5LVEA 2AJZA 1TQBB 5F7NC 5DD5L 4U0QB 4NQCD 5DGRA 3LZFL 1UKSA 4MNQD 1UWEH 1DQMH 3V4UH 4J8RB 2I9LA 3ZSTA 1IKFH 5HI4D 6CGTA 1MCNA 1YMMA 4W4OC 3TA3B 4CMMA 2FSEB 1HI6B 3MO1B 1I7ZB 1R5WA 1PJ9A 4JFYA 5D2NC 4A6YL 3BIBX 1FZOB 1J0ZA 1OGAE 3VFRB 3KXFA 3BPOB 5IOPB 3BUTA 43C9B 1LVEA 3EJZD 2DS4A 1MCPL 5KSVA 1MI5E 4LLWA 3DX6A 2HT4D 2QTEA 3QEUB 1LDPL 3KYMA 1IM3B 1GPOL 4M03A 5SWZB 3ULSB 4NQSB 4PGDA 2W9DH 3BWUC 1A2YA 4QXUL 4F7TA 5A16B 3B8YA 5GS0C 1HQ4B 5ICYB 1A5FL 1RU9H 1IQDA 3MV8A 1FNGA 3VE0A 1A6AB 2IEPA 3N50A 5E9DB 1OWWA 5DR5H 2WQRA 1S3KL 4PB0L 1VKXA 5A40E 3ZTNH 3MRGB 3VI4E 3FFDA 3AREC 1DQJB 3QZWB 4QO1A 1LP9F 2KZWA 1OF2B 4MDJB 3HC0B 4ZNCD 2ZPKL 3I85A 4K7PH 1CTOA 1YYLH 3PWJB 1IKNA 1RZJH 5IB3A 2AKRA 4RFNB 1ZA6B 5E2WH 1MHCA 3LQZA 3MV9A 4HK0A 1DBMH 1EHLH 1I8KA 3KLHD 1A22B 3ECBA 2UY7A 1VENA 3H9SB 5HDQH 4I9WE 3EYVB 5FYLD 4PJHF 1OGAD 5ADPL 2X41A 1EEZA 4LNRA 3NAAL 1MQ8A 1MI5D 5E2UH 5J1AA 1GGBL 5DUPL 5C9JA 4HXAL 5L2KA 1U8OB 1VFBA 4X98A 3I02B 5CJOH 2W0FB 2R29L 3S35H 2BOBA 1UJ3B 4PLJC 4D9QE 3SDCC 1IEBA 3HNVH 4MA1B 2XACC 3V6FB 4N0UA 4OCWH 3MA7B 1OTSC 2YN5A 4UMGA 2NTFB 1TVDA 3BKYL 3LV3B 1U91B 2GY5A 2RAMA 2BMKB 5CP3H 3WXWL 4F15C 3H7BA 5AEAA 4TSAH 2GSGB 2X42A 4JZOA 4P2QD 4Q2ZA 1KJ2B 3KPRD 1UEMA 3ARWA 4Q6IA 4L3EB 1FLTX 3BN9D 4HH8A 1MFEL 3KPNA 1CXKA 5KVGH 1KSRA 4LF3A 3TZVD 1IBGL 4HXBH 5IMMB 3KWWB 5ICXB 1F42A 2X70B 3O2WL 4I9WD 4JO1L 3RI5K 4R8WH 4MVBD 4DVBA 4FQCH 2CKBB 2ICEB 1U3HD 1WIUA 4JZJC 4WWKC 3PABB 1G9NL 1EHXA 4JG0H 3P0VH 3QQ3A 4M93C 2IANA 4XNYH 3C60C 1TFHA 1CL7L 3QUZB 1UKTA 4JFXA 2V7NB 4JN1L 1RAMA 5JHDE 2MJWA 2VXUH 4FXLA 4Q0XL 3TIDB 4YIQA 1IM9D 1I75A 1DN2A 3GSVB 4GKSA 3L95B 1IGML 1SYSB 5B8CB 5IJVA 2E8YA 1YNKL 1MCHA 3IETB 4LSQH 4QHNB 5F7FA 4X7SH 3QISA 1NCBL 4OLZL 3BH9A 1ZA3A 2BNRA 1U8QB 3SDYH 3W2DL 2OI9B 4RFOL 4NKIH 1AY1L 3BUYA 1QR4A 5E00A 3C09B 3IKCA 2EH7L 1TCRB 5CSZA 3BSZH 3GKWH 4N0CA 5EU5A 4BJLA 3S96B 2CR3A 3IXTB 1RZKC 5CJQL 5GS1C 1EJOL 1NEUA 5JZ7C 1B2WH 3T0DA 1FNLA 4MJ6A 2WP3T 1MFAH 3UYOD 5I18H 4NPYB 1T21B 3B2VH 2RFXB 4JRYD 3ULVH 3HHRB 2A74A 5FUZL 1JZ3A 3VXQA 5CEXA 4YNYB 1F4XL 3PP4L 1EA9C 3ARRA 3DI3B 3S4SG 5FYJE 2YR3A 3KJ4C 1KLUA 2XXMB 1U8IB 5I8EA 2CDFB 4U6XB 3BQUA 2JCCA 5C08B 4BA8A 1VGEH 1HCFX 3SKOA 3AMKA 2W38A 4RISL 5TE4L 1DVFD 5BZDA 4N9GB 4Y4FA 3E3QC 1S7QA 1T66D 4PTUA 5F89B 1WTGT 2DLFH 3DMMD 3SGKA 4OFVA 4KH2A 1S7VB 1I1YA 1KJVB 3QJFB 2K3TA 3O4OC 1FO0B 5DJCB 4GUPB 1D9KB 1RZGB 2VXSH 4Y5VA 1XCQB 4RNRB 3G6JA 1IC4H 3L5HA 3INUL 1N5YL 4NKMA 5IROC 1FC2D 2EICA 3FOMA 4ZNEA 1NAMB 1X5ZA 3ULVE 4R26H 4XAWL 1TIUA 4MZ2A 2B4CH 3BDXA 4DCQB 1QKZL 4V1DA 4F9LA 2VLRA 1K8DA 3GMLA 4RGNE 4WTZA 1NUGA 5CGMA 4NN5B 3RVTC 3T2PA 4JFHD 3C5ZA 3DRQB 3KPSA 3QP3A 2A9NH 1KLGA 4R2GC 4YR6B 1JN6B 3QAZC 4PRIA 4K94L 1WGOA 3QDJA 1YEKH 4HWEH 1S7XA 4ZSOA 5SWZE 3IS1X 4ZD3L 1INDL 4AG4L 2BK8A 3LB6D 1P84J 3VXOA 5INDB 2FGZA 3I3BA 3MLVH 4ZPTA 4AL8L 2HFTA 1L7TH 3U1SL 5JO5A 4YGVB 2V17L 5E9DE 3SBWC 5J6HB 3S9DB 4YXKH 3AM8A 4RWHA 2BHYA 1C5DB 3CSYB 5MP6L 3QJHB 3CFIC 3OKKB 2QBWA 3KS0J 2CO6B 4KXZH 2CIKA 4HIHA 5FXCH 3EYQC 4MA3B 1MJ7H 4YFLI 2V2WB 3ULVD 3PWLA 3TA3D 3ULUE 4F57H 3GMPB 5JXAH 4YDVB 5D2LB 4M7LT 2HJLB 3WFBH 1YEGH 1R5VB 2VC2L 4LLDB 3UTSA 5C86A 3MV7B 4ZUWB 1ORSB 2BRRL 1KEGL 1T7YA 4J4PC 4RGND 4GRLB 4OZFB 1HDMB 1IZJA 4P5MA 4ZS7H 3V6OE 5CMAA 4LQ1A 5D93C 3O3AB 3P9WB 1OW0C 3EBAA 3BOVA 2AXFB 3MRIB 1BFOA 1N4XL 4NN7B 1T1YA 1NUNB 2YXFA 5EUKB 3VXUE 4QYOB 2EDNA 1H5BB 1CGXA 5E9DD 5JOFA 1QTYT 4MWFA 4TNWF 1BIIB 3FT2B 2X4RB 1N64L 1G9ML 3PWUB 2EKSA 5DC0A 1TJHH 3VMPA 4OZIA 4G9FA 4LMQI 3VA6A 5DRWA 5H2BB 4PJDA 2ZCKH 2W9EL 3PDGA 1ZLWH 2P8LA 1ZGLB 5CJXA 4KTDL 4V2BA 3BEVA 4QEGA 1W2KT 4Y2DA 5F9OL 1DJSA 2NQCA 4ENED 1AJ7H 3BZ4B 3CFKB 3FQXB 3P9LA 5AYQA 3UPRA 1U6AH 2BCKB 2QADC 3DROA 2I5YL 4K7FB 2R1XB 3B43A 3QIUC 1NDGA 3K1DA 3ARTA 3MLWL 3O6FA 4GSDH 4WFHE 3FB8A 1SMAA 3U4EA 4OLVL 1GHFL 2ZP0T 1BWMA 2QSCH