2NX5A

Crystal structure of els4 tcr bound to hla-b*3501 presenting ebv peptide eplpqgqltay at 1.7a
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
276
structure length
276
Chain Sequence
GSHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRTEPRAPWIEQEGPEYWDRNTQIFKTNTQTYRESLRNLRGYYNQSEAGSHIIQRMYGCDLGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPVSDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA-B35
publication title A T cell receptor flattens a bulged antigenic peptide presented by a major histocompatibility complex class I molecule
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 72
structure length 276
sequence length 276
chains with identical sequence F, K, Q
ec nomenclature
pdb deposition date 2006-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2nx5A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 2nx5A01
3VRLE 1FGVH 2NXZC 3BE1H 5L0QC 4U1MB 1N6UA 3QCVL 4OIBA 4KY1H 3NN8A 5JPMA 3DBXB 1MLBA 3K7UA 1T1XB 4WI3A 5EUKB 2BOCA 2O61A 5FUOL 2APBA 1S7XB 2E7BA 3DMMA 5J1AA 3MX0A 3ARVA 3LEYH 2CUHA 1DQQB 3OJVC 3ARWA 4Q7DA 1LO2H 1YEEH 1QVOB 4H26A 1CDGA 1N0XL 4RRPA 4QHUA 3TV3H 3HTLX 5FGCB 4YBLB 4XH2B 5KVEH 4JPIA 8FABB 4LPTA 3ELAT 1CGXA 4PJ7A 3DRTA 2P46B 1IGCH 1EGJA 3GB7A 3BPOC 1Q9WA 2DBLH 4Y4FC 5DJXB 1AE6H 4XP5L 4ZDHB 1FGNH 1WEJH 1WWBX 4HJ0C 4V1DE 2F53D 4YBQC 4D0BB 1G7LB 4YXHH 2WK2A 1UQSA 5EBMA 1X5HA 3ZE1E 4QTIH 1R5WA 3MLWH 3V0VB 5KSAD 3T4YA 1S7QA 4L8SB 6CGTA 5IT2H 1I9JH 1TZGH 4EUPB 4EN3D 5GS0L 2APXA 1SJEA 5A1AA 2ATKA 1I4FB 1AHWA 5SWZD 5ID0B 4Z78A 1B0GA 4KI5C 4A2MA 4Y5VA 4G9DA 3O81A 2ED7A 3VD4A 5IFJB 4CVZA 1IARB 1KG0A 1A6UL 4LGRB 1G7JB 1BBJB 3PGDB 1JFQL 3JXAA 4MD5B 1II4E 3L3HA 1EXUA 3KYOA 1M6OB 3BWAB 5GRXG 3PGCB 3HCVA 1DTUA 5C08E 2J6EL 4M5YL 4DZ8A 5FEBA 1G6RL 1FZMA 5FECB 3HC0A 2FL5B 2EC9T 3ULUL 4U1JB 1TCMA 3B5HA 1JK8B 4R8WH 3MYJA 4Y4HB 1ZT1B 4NKIL 2Y36L 3OGCA 2PETA 4HUMB 1P2CA 4UQ2B 1DDHB 1QZ1A 1WBYB 2R2EA 4HUXA 2E3VA 1K6QH 1JNJA 4PJGA 3IFLH 4QYOA 2VERN 1WC7B 2B4CL 3DUUB 1U6AL 4C56E 3CXDL 4F37F 4AG4H 4ODUA 1LQSR 3GHEL 4OZ4A 4M1GL 3VW3H 3LPGA 4N0YH 2G5BA 5FYJH 5I1DB 2AJXL 3GMQB 2V2XA 4QRPD 1VA9A 4LHUA 3QJHB 4W81A 1D5XB 5EU3B 3TYFB 1WSST 5L2KD 3HG1D 3E6FA 2AV7A 2Q7YB 3RPIA 4S1DC 3DVGB 1NFDE 3QQ9C 1LK2A 4ODHH 4PJEF 5IROC 2E9WA 4NO3B 2OQJB 4HQQL 1CD8A 3CDGB 4HG4K 1IKFH 4ZO9A 4PJDA 1TVDA 3DX7A 4ODBD 3F58H 5EWIH 1XIWB 2VDOL 3IDIA 4M43L 4XI5D 4XP1H 2W9DH 4G43B 4NQDD 1AQDB 3O4LB 3VG0H 4P57A 3LRGA 3OKKB 1GC1C 1QLFA 2NZ9D 5D1ZA 5BMFL 1P4BL 3BKYH 1IFHL 3L3DB 3KPRB 1FQ9C 3DX9A 4JRXE 2IPUK 2EYRA 5DJ8B 1P6FA 4CMHB 4I3RL 4TSBL 3HR6A 1N59B 3LMJH 1NL0H 4OKDA 4XGZB 3O2DA 4HKZB 1DLHA 2YMXL 1MIEL 1N2RB 3IDMB 4UT7L 3ZKXC 4ALAH 1GAFH 4JRYA 4Y2DC 5D2NA 5KAQF 2NY2D 3G9VA 2I60H 5H94A 1YJDC 2QADB 3MA9H 1QSFA 1KCVL 1T2QL 25C8L 4WW2A 4P3CH 2FO4A 2ZSVB 4L8BA 3BP5A 4DGYL 1HN1A 5TE7H 3KYKH 4G42A 2HVKA 5EPMB 3PP4L 1B2WL 4MA8H 2GJ6B 2V17H 2OMNA 3LB6D 3TP4A 4LASL 3UTSA 1FVEB 3DYPA 4HXBL 2X6MA 3KLAB 1K8DB 3A6CL 1RJZB 3WUZA 3D39A 1NCAL 4J3XA 1G9MH 5IVZB 2AI0L 3DLQR 4G7YH 4QT5B 3QUKB 2ORBH 3BDBA 3U30B 5JHLH 3MJ7B 4XHJD 4RSVA 3WFDH 2BY0A 2DQEL 5E8DH 1ZLSL 4P4KD 5ILTH 2EDEA 1ZGLM 4RAUB 4OB5H 4D9LL 4WI8A 5GZNC 2LVEA 2Y7QA 4PGDB 1A64A 4YAQA 3WN5B 3IAGC 4CJ0A 4MMZC 4MZ2A 5BJTB 3JV4B 2D9CA 2OR9H 4OLYL 3IS1X 4U1IA 5D8JH 4NQED 2A77L 3HRPA 1J0JA 1UWEH 3G6JF 5IROA 3OHXA 3FHAA 5AD0B 1QSEB 1U41A 5DI8A 5KS9A 3JWDC 4N0UE 4XBEH 2FJHA 3SGEH 1HH9B 1X7QB 3VA2C 5JQ6H 3C6LD 1CI5A 4Y1AB 4YPGB 3ZTNH 2VDRL 3C2AL 4GRWB 2YPLB 3KJ4B 4Z7WB 3TPUE 3OPZL 5FA4B 4XB7A 2IADA 1KIPA 1RZFH 5IR1A 4QTHA 4Y5XC 4BZYA 4OJFL 3O3UN 5T1KA 3ARTA 3QUYD 5H2BB 3TZVD 1DUZA 3VXRA 1RZ8B 4BQCA 4OLVL 1AGDB 5C9JA 5CD3A 3WKML 4APQB 1R5IB 1BX2A 3WS6A 4YDVA 2EE6A 4AT6A 1OB1B 2VN4A 4HUWB 1UJ3C 4P3DA 2W60A 4E5XB 3RBSA 1ED3A 3QIUD 3QI9D 4JB9H 1QP1A 1I3VA 1FNHA 3QDJB 1W72H 1IM9D 4PY7A 2YSSB 1JV5B 3MRJB 2XACC 4ZYKB 3NPSC 2DLGA 2ICES 4K94H 1RZJL 1F4YH 3MV8D 4YHNB 3V4UH 3QQNA 4PP1D 3I84A 4JCMA 3DUHA 3GKWL 1CN4A 2PCPB 2V7NA 1KIUA 1QBAA 4B5EA 4XPHH 3BIKA 3ZKQD 3RDTC 1L0XA 5A3ID 4W4NA 4QRQB 2OTWB 1I1AB 3RWJA 2VH5H 3BRFA 2CLZA 2AK4D 3KXFA 3B2UD 3SE8H 3E6HA 1ZHNA 2Z0BA 4KK6D 5C71A 1J10A 2B0SH 5D7JB 1UJTA 3ORJA 1NANI 3FJTA 4Q6YA 1HZHL 3TT1L 1JFMA 3QDGB 1P7KA 4X7TA 1P5UA 2R4RH 1WT5A 3Q48A 4JFYB 5IMMB 4N5EC 2BNRB 2CDEA 5BZWB 1UACH 3GBML 4OFKA 3CUPA 3TBTA 3Q1SH 4LP4A 3ULVF 4K3HA 1YY9C 3CVIH 2DQTH 4GQPH 5HHME 5J06A 1AQKH 1OARH 1E4WL 1DBKH 3RIAK 3HS0B 5T1DH 5F88B 1NGPL 1DBBH 4GBXD 2Q8BH 3BVNA 3TEUA 5IVXB 1IM3A 3RVVC 1E28B 1AO7B 3GDBA 3A67L 4EUPG 3QCUH 5HVWA 4YGVA 5E1AB 2E9JA 1L0YA 1T7YA 4H8WL 1RZGA 4K3DL 5EOQL 3MREA 4YBLC 3E3QE 4WEBH 4UQ3A 4Y5XA 5C0AA 1FNLA 2FBJL 5HYQA 5F97E 1PSKL 3DV6A 4MVBC 3W11C 3H9YA 2XNAB 1XFPA 3O6KL 4LCIH 1X9QA 4PV9B 3MCKA 1QFWM 1MCDA 2R4SL 3R8QA 4YHLH 1KXVC 4HJJH 2IMMA 3L3GA 2DQFB 3SHSA 2IBZX 4PYHA 5DQ9B 3K46A 4P23A 4NPYB 3IKKA 4S0SD 5DTFB 5E24E 4L8SC 4MLSA 3MRLA 3RVUC 2XKNB 2CUIA 1S7VA 5FYLL 3D0LA 5GJSH 1PLGH 4X6EA 1KYOJ 4PJEE 3ARZA 3QG7H 3BZEA 3WLWD 1FO0A 4KVCH 1ZANL 3LEXA 1KBGH 2C9AA 2ZKHL 3Q3GA 2OR8A 4WWID 4GAGH 5DJ6A 1DUYA 4GH7B 5HJ3B 3GIZH 3EFFB 5JZ7D 1IZJA 4R7NB 2GSGA 2H32B 3JZ7A 3P0YL 3LIZL 3T08A 2ZPKH 4NWTL 5DEGA 2H1PH 3EDJA 2P8LB 2ZZUT 3IGAB 3H9HA 4CW1B 3V2AR 4NOFA 3JWOH 3JV0A 1IBGH 1U8NB 4N5EA 4JDTL 1VFAB 1RJYB 4QXGL 5T3ZL 3UYOD 4Y4HC 5CIPH 5K59F 2HTKC 3DBXA 4OZHF 1HK6A 4UB0L 4G8FB 1T1XA 1WUNT 3T1FA 1T0MB 3LV3B 4UIKL 4M8QB 3DJ9A 4YK4B 4QHLB 2VLKD 1LO4H 3S9DB 3RY4A 1J05B 5FM5M 2LTQC 5B38A 4KRLB 3L7FB 1CXLA 3WS3B 1A6WL 4YUEL 3TBYB 5I30L 2BNQB 1QVOA 4OIAA 2OZ4A 2AJ3B 4IJ3B 1D9KD 3GBNL 2G60H 3GEWB 4ZOAA 5FXCH 4P2QB 5JPNB 1GGUA 5I8EB 2FD6L 2EKSB 5LBSL 5FKAB 1S7UA 3D18B 1N5AB 3MRGB 8FABA 2XXMB 4RFOL 5B22A 5MHSD 3GI9L 1EHNA 4PS4L 5GQBA 5MERB 3ILQC 4NBXB 4I5BA 1QBLL 4EEEA 2VDKL 3MOBH 5DJXA 4L4TD 5EFIB 4G8IB 2IPTH 5F1NB 3W39B 4NHUB 3UC0L 3SKJL 2DRUA 1G7LA 3NCYP 1FH5H 1RZIB 1XGUB 1XIWC 2EKJA 1MFDL 1C08A 1UWXH 4J6RL 5ALBL 1KEGL 3MODH 5DURB 3F5WA 4GKNB 4QNPF 1CD9B 2RHEA 3BPNB 4GXVH 2H3NB 5HDQL 2XWJA 3CFJA 4MA7L 2VXQL 5AYQA 2ADFL 1WAAA 4EIGB 5IMOB 2WIIA 4JPWL 1MJ8L 5F7DB 5T5FH 4CMHC 4YFLI 1NUGA 1YN7B 4QRRB 5IP4A 5IFJA 4PB9H 1AXSB 1JGDB 1G7JA 4IBLT 5IUSA 2DMBA 3FB7B 5CCKH 4PJBF 1BBJA 4LAQH 3PGDA 5IEHB 4MD5A 4IDLA 1M6OA 3DROA 2BJML 2QADC 4J4PC 5LCVH 3RAJH 3B9KB 4K3EL 4DN4L 4LLQB 2PO6B 5IK3B 4HCRL 2VLRB 2D0GA 2ARJA 5FECA 4G5ZH 4OV6F 2A9NL 4K8RC 3RU8H 3N9GH 4U1JA 4XRCA 4OD1H 5ERWB 1PGRB 4MAYD 1JK8A 1P1ZB 2WAHA 4X5LA 3W0WB 5I76A 4UQ2A 1DDHA 2D0HA 3HRZB 1WITA 1AY1L 4K7FA 1RY7B 1T2JA 4WCYH 2AEPH 5E2WL 1CLOL 3U30C 3CPLB 3DUUA 3TA3C 1GH7A 3G6DL 1MHHB 1H0DA 3BAEH 3M1BA 2EXYC 2FNBA 4L8DA 4XTRC 3VFWA 3ZTJH 1JYVA 1IAIM 2XN9D 4P2YA 1F90H 5IBLD 4UT9H 3WN5C 1NAKH 5I1DA 2FX9L 4KDTA 2OJZH 3QJHA 3KPQA 1D5XA 4X6FB 4PLKC 4DKFH 2DKUA 3BGMB 1OAYL 4K9EL 4FRWA 5C09E 2AJUH 1RVFL 2P44B 4M6OL 4P5MB 5ESVA 3DVGA 2G5RA 3L3KB 4GS7B 2VLJA 1LP9E 2DICA 3STZB 2AEIT 4IRSA 1WVZA 1DQLL 2X4PB 2HTLC 2OP4L 3WFZA 2OQJA 5JQHC 3CDGA 5HHVH 5MEND 4G8GB 5I0DA 1H3UA 3HHRB 1KIQB 4OGYL 1CFQA 5D71L 3SDDA 2FATL 3NCEB 3VXME 1XIWA 5DDHB 3KJ4C 4LPUA 1MCEA 1XCTA 3NTCL 4M4PA 5E99H 1XT5A 4X5WB 1AQDA 3O4LA 1A7PL 4MNGB 5EIIB 3IB4A 2X4OA 4OZIA 4XNYL 5IESL 2F8OA 5D6DA 5DK0A 3ULVE 4QKXB 4Z7UF 5TDNB 4BSJA 5DJ8A 3WDHA 4WFFE 2G9HA 4APQC 1U3HB 4YFLF 3F7PC 4HKZA 4FNLL 3SKNB 1TENA 3BKMH 2J8UB 2X4TA 4JZJA 3L95B 3OXSB 1PKQA 2ZCKH 3HE7D 1YEHL 2EC9U 1LEIB 1F4XL 3HUJF 4QOKD 4RQQA 4J4PA 4C57C 1LO3L 4CAGA 2Y6SD 3DARA 1J0IA 4O2CB 1IILE 4OFVA 2CIIB 5E8NB 2X2YA 4JFFA 2GJ6A 4QHKJ 2ZCLH 1FNEA 4RGNC 5IHUH 1KEML 5JOPE 2XXCB 4UOW0 4JHWH 1KJMA 3U46A 1IL1B 1K8DA 3REWA 1I1AC 4KVNH 2X89A 3T3PF 5IVZA 2OL3L 3CC5B 5L8JB 3QUZC 3KS0H 4DWHA 1BIIB 1MQKL 3QUKA 5GPRA 3S4SB 3AUVA 3MJ7A 5D7JC 3KPNA 2IFGA 4IDJL 3F12A 3PABB 4FG6D 4LU5L 4AEIL 3W5NA 5DD6A 4G3YL 1T22B 2N7AA 2C1OA 4QHKI 1U8LB 4TNVF 4DKAA 3UTTB 4X83A 1OTTC 2FR4A 1DBMH 3U7YL 5BJTA 1KB9K 3JV4A 4NOBA 3TBWB 3TJEL 1D6EB 3UAJD 1OAKH 2DN7A 2DQDL 3LKOB 5T1LD 3EDKA 4P2OB 2I25N 3C5JB 2VQTA 3RVXD 3A6BH 2HLAB 4NQCE 4IMLA 5ISZE 5AD0A 1VESA 1QSEA 1IGMH 1YYML 4H1LB 4ETQB 2A0LD 5FHBL 4KUZL 3TC9A 1A22B 1QFOA 4WUUD 1ADQH 2X70A 5HHOA 1XGYH 4XPGH 1AC0A 3GMOB 3PWLB 4Y1AA 5E8EA 4X80L 4BK4A 4F7CB 5I1EH 3DURB 2YPLA 5JHDE 4X7EC 2EDQA 3K81A 1FNGB 3FONB 5DS8B 2R1XB 3VXUB 4GMSH 5JORB 3C5SB 5FYKL 5C3TA 4NM8H 2VR9A 3ZL4L 3BYTA 2H2PC 3VXTB 4KHXH 1CXKA 4F9LA 1GGYA 1RUPL 5H2BA 1AI1L 2ZG1A 3BKCL 3OKDA 5K59E 4XBPB 2YEZB 4TTDC 4KC3B 3E2HB 3WD5H 2XZQH 4DOHB 3RY6C 3AY4C 2BVEA 1QBMH 1A1OA 4Y19B 5I18L 1OB1A 1YNKL 5DMKB 5T3XD 5EZJB 3BKJL 5HYIA 3L3IB 4E5XA 3P30H 4TPRH 4A6YH 2NTFB 4LHJB 1X5AA 1P84K 2P8MB 3QDJA 4LKXA 3NCBB 1DBJH 1JV5A 2FCBA 4I0KA 1QFWI 1R3JA 1UCBH 4D94A 4JM2F 1HEZA 3RTQD 2PCPA 3BZFB 5ANMA 4JAMB 1ZS8B 2WIMA 3BO8A 2OTWA 5KSAB 3QEQD 5DRXB 1Q0YL 4EN3B 1RJLA 1UM4L 5D7JA 4Y7MA 2MPAL 4LPWA 1JPFB 2BVOA 4PJAF 2ESVD 5SWZB 3S34H 4OQTL 4Z18A 1H5BA 2HT4D 4JFYA 4XC3H 4YHIA 1HDMA 5F44A 4QNPE 5ALCL 4MCZB 1T7VA 2HJLB 1IT9H 1BZ7A 1GZPB 5BZWA 3HI5L 2Y5TA 3V4PL 3G9AB 2P7TB 2NCMA 1S7TB 3QFDB 3ZKSD 5F93C 1UYWL 4GSDL 1MHEB 1IAMA 3O6ML 2X09A 2UWEF 1ONQA 3QULA 3HS0A 1HQRB 1CE1L 3MACL 4YK4C 3UJJL 1YEJH 1E6JL 1IAIL 5IVXA 2E27H 1P4IH 4PR5A 3B6SA 2NY7L 5F96L 4DTGH 1KOAA 1ZVHA 2HH0H 1NAMH 3O3AB 3IDXH 4IJ3C 2VZUA 4R90L 4Z0BL 1A7NH 1DSFH 3U79A 3OKOB 1MWAB 2D4DA 1DLFL 2KL6A 4BQ9A 1UWXK 4PJ7F 2BZDA 3S35L 1GGIH 2UZIH 1VFOA 2R0WL 3S36H 4OUUA 1SM3H 2VXVL 2X10A 3AY4A 4OLEA 4QRPB 4S1RH 1BREA 1WBZA 4EOWL 1UA6L 2HT3C 4QGTA 3G5VB 4JZOB 4NJ9H 5I1KH 3ZDZF 3HG1B 2NNAA 1IQWL 1KCRL 3BH9B 5EU4B 2HJKA 4Z8FL 3MV7A 3OG6B 3SN6N 5LGHL 4PP8C 3O3EB 4NNXA 5DTFA 1T4KA 3HMXH 1TZIB 3CSYB 3LKPB 1KTLB 2VL5B 5TFSL 4GAYB 3BPNC 3EO1B 2XKNA 2BVYA 4YHKL 2HRPH 4KK9C 4JFHD 5E08L 1KJ2A 3FO2A 2VN7A 3MGAA 4AM0B 4FOMA 4FFWD 1MI5D 3UX9B 2W65B 3U0PB 1EBAA 2J4WH 1A6AB 5JR1H 5C0GB 1T1WA 2DM2A 3G04B 4RMSA 1CXEA 3NMEA 5C07E 5KTEH 3VFRB 5GS0D 5HJ3A 4DGIL 3EFFA 4I9WD 5ELIA 2PYED 2HP4A 3PF2A 4ZUWA 2H32A 5FUZH 3UPCA 4YHZL 3FRPA 3B9KC 3ROLB 1BJ1J 2ZNXA 3HAEA 3HZVB 3MLPA 2PO6C 4CVWA 1LWRA 1FFOB 4NC1C 4PJHA 4U1HA 2ZOLA 1HINH 3IGAA 4CW1A 1PY4A 3P3YA 1S78D 4KMTL 3GMLB 1RJYA 4WUKL 5LVEA 1NCNA 4PJXB 1I8KB 4Z7UE 3ZKMC 3EHBC 3LV3A 3FKUS 4M8QA 5TE4L 3IAQA 4XP6H 2D9QB 2VDMH 5L7XH 4MJIE 4IIQB 4PJGF 3ULUD 1K4CA 1QQDA 5EU6D 5J89A 3WS3A 2HKHL 3TIEB 4WI6A 1F6FB 2Y25A 2AJ3A 4FFYL 1IGIH 2E8YA 4FFZL 4P2QA 4UTAL 4X7CC 2XWBB 5FKAA 1G0XA 2VIRB 1N5AA 3VFPB 5SWQB 4GS7C 5TQ0L 3SE3A 1T89C 3TYGH 5JDJA 3OJ2C 3SDYL 5CKAA 1MIMH 3T0XA 5EFIA 3PIQB 3T3PE 3JV5A 3K2UL 3QXWA 5F1NA 2MJWA 3WIIL 3UTPD 5BS0D 4PGEA 1C16A 2EDHA 5DD0H 1XGUA 3OKYA 1WICA 5BRZD 3G08B 4XBGA 1F3DJ 5GGSY 3LEVL 4GKNA 4NZRL 1D5BB 5HY9A 2H3NA 5IJVA 2AQ1A 2R23B 5IHBA 3MXVH 3TWCL 5IMOA 4U05A 1YN6B 2BMKA 1AJ7H 1CL7I 3WL9A 3C6LB 3S4SG 1YN7A 4QRRA 1U3HC 1JGDA 4FXGB 4YE4L 3SJVD 4NRXB 2GJZB 5IEHA 2PTTB 5JW3H 1TVHA 1KT2A 4QLRA 5AZ2L 1A3QA 5F3HB 1CBVH 4FABH 4LEXH 3QUYB 3B9KA 3TZVB 2YA0A 2IBZY 1B90A 4WW2F 5IK3A 4NT6B 2VLRA 1XH3A 3GRWL 4AY0A 2BDNL 1CFSB 3LZFH 1XF5B 2ERJB 2XZAH 4Y8AA 2EDBA 43CAB 5ERWA 5IWLC 4PRID 4H1LG 3RKDC 1X5ZA 3IDNB 2AK1L 5B3NA 3QIUB 1P1ZA 1ODAA 3GSVA 2VKWA 1XR8B 3H0TB 4UTBL 3UTQA 4OCNC 1IM9B 2X05A 1U8KA 2GSIB 3H3PH 3QBTB 1OSZA 5DGRA 3CPLA 3DXAB 5EB9A 2DOCA 4KJPD 5I1CL 5L6YH 4GW4A 1MHHA 2EE9A 3MV8B 3QXTA 1KJVB 3CGTA 5E8OA 1BF8A 4HK0A 1NC4D 2X4SB 4PB0L 2H9GB 3ARGD 3DX6B 1NFIA 5D7KE 3D6GA 5AWNL 4O02L 1JPTH 4UV4H 4NRZB 4L3ED 1QD0A 1RZKL 1UXSA 1OPGH 2AK4B 4DQOH 5F89B 3GSNL 3P9WB 4P2OC 5F21B 3L6FB 3A0OA 3QUMH 3STZA 2OR7A 3B3IB 2X4QB 3LQMA 3MRBA 4P48A 3NIDF 1DL7L 4PD4K 5KS9F 4MDJB 2GKIA 1FJ1A 3LY6A 4X8JB 3MV9D 2Q8AL 5I1LB 1XMWA 2VISA 4NBYB 2P24B 4OD3L 5CMAA 4EDXB 5BQ7A 3UYPA 2WLYA 5C2BH 4PJAE 5KVGH 3H9SE 1MCNA 4CVXB 5KJRL 4L5FH 2V7HB 4K2UH 2BVPB 3R1GL 2PW1B 5J6HB 3ZT5A 4AH2B 4HD9A 4HLZH 4GBXB 5IMKB 3MUHL 2VRAA 4HPOL 4YHPB 4OV5B 2CLVB 3FO9A 4JO4L 2NY6D 3E2HC 4FQLH 5TDNA 1E4XL 3PP3H 2UWEE 3ZHKA 3MMEB 3SKNA 2QBWA 3L95A 2RCSH 2Q1EA 4LBEB 5F7MC 5KG9B 2C3WA 1LEIA 4NYLB 3BDYH 2P8PB 1YUHB 3LVEA 1WTGT 2LFGA 2BSSA 1Z3GL 3DO7B 4GG6A 1F6LL 1FPTH 2CIIA 1C7SA 1H8NA 4JG0L 5E8NA 1P4LB 4NKDA 4IM8A 5C7XH 2YPKB 3VFSA 3ARDD 3KYMA 4NZDA 2JJSC 4X6DF 4RMWA 1IL1A 1NGQH 1I7RA 5HHNA 4XCCH 2A6JA 4PGJA 3LS4H 4OBRA 5KSAC 2A9MH 3PQYD 2XPGB 3LKNA 2ADJB 1IEBB 3CC5A 1CFBA 5HGDB 3AREA 3M8OH 4EN3C 5GRVK 4N9GB 5DQDH 1MAJA 2DLIA 3ZDZE 3PABA 4M3KB 4XNUL 3PHOA 4QEGA 4S2SB 1EHXA 1T22A 2I24N 5D96B 3IXTA 4QXTA 3OV6A 4M00A 3FFCA 5IB2A 1WZ1L 4C4KO 5JXEA 2APFA 3TBWA 2CIKB 1MFCL 2Y9RT 4MXWH 3IDJA 1Q9OB 4MJ5B 3HR5B 4I0PD 1WV7T 2WP3O 2HLAA 1A3RL 2DB8A 1BAFH 5EO0B 4U1GB 4JGUA 2CJUH 4PJIB 4NQTA 4CU7A 2DJ4A 5D72L 1NGWB 3DNKA 3PWLA 1FLRH 4F7CA 3PNWB 4PBVC 3FONA 5DS8A 3VXUA 3KPPB 3OAUH 5JORA 3NBNA 2QSCL 3WHE0 1R0AL 3FQTA 5BOZG 1ZVYA 4NQUA 5JLZA 1U91B 3INUL 3JVGC 1P9MC 4W70A 2V2TA 1TJHL 1Z0NA 4O4YH 2YBRB 2C4FT 3ULVH 4KQ4L 1D9KB 1IC4L 2Y36H 2J3SA 1PKOA 4EDWL 4Y19A 5I1GL 5CAYB 2JJUA 5DMKA 1BQUA 1INEH 4PRPD 4PJGE 2EDWA 1JZ8A 2FEDD 1BVLA 4LCWD 3DRQB 5E0QA 5H8DA 1QUNA 2P8MA 1MPAL 3MRMB 3OF6A 4GW1A 3GMRA 5D1XD 2E7CA 4LDOB 1TQBB 4RAHA 5EA0L 4L4TB 3ESVF 1BF2A 1GGCL 4M48H 3HI6H 2CKBL 2K7PA 2DDQH 1YPZB 3QWRD 5CINL 3BZFA 3S5LA 2JJSA 1H3GA 5F9OL 4XI5C 1OP3H 3F7YA 4S1QH 5BV7H 4YQXL 4U1NA 1MUJA 5F6HI 5FYLD 2NZ9C 3D25A 5E2VL 4ONHB 3NOIA 1Q9KA 3MLVL 3MXWL 4XAWH 1JPFA 3UJIH 4G9FD 2ED9A 2JJTC 4OI8A 4UUJA 1KCUL 4N8CH 4O5LL 1AFVL 4JZNB 2VDLH 4M7JL 5BVPL 1FVCA 1OWRM 1MLCB 5AZEH 2CSPA 1GZPA 5KVFH 4NN5B 3N1QC 4FZEH 1B0WA 1UWGH 1HH6B 3QFDA 4HXAH 1NGYA 5AG9A 1HKLL 3EO0A 1U8IA 4KI5E 2YUZA 5IJKC 3CXHJ 1LD9A 4IIQC 4XNXL 4HBCH 2WUBL 5CEYB 1Z6JT 4HS8L 2QLVB 3TVMD 3D3VD 4JRYE 1CR9H 1X5KA 3LB6C 5DSCA 2J88L 5T3ZD 4RAVA 2Q76B 3KR3L 1J1XH 3EOBB 3CD4A 5I19H 1KJ3L 1A1MB 5DVMA 5IEKB 4UBDD 3L3JA 1H3PL 3C5ZA 2P47B 4F58L 1KB5L 3NFNB 5GIRB 3OKOA 1MWAA 1QBBA 1NANH 3THMH 4OIIL 4I18B 4XHJC 1KELH 4MDIB 1M7IA 4P4KC 1JWSB 1BD2A 4F37K 2BSED 2XN9B 3I2CH 1KLUB 4OCWH 1ZVSA 3Q6GH 1QYGH 3BMWA 4QRPA 5F7EH 3AFLA 4OGXH 2AXFB 4IHOB 3FT3A 3G5VA 4KWUA 3BH9A 5EU4A 3BEWB 5DJ2B 5DRWB 1TZIA 3CSYA 3LKPA 1KTLA 2R29L 4M7KL 2VL5A 1S7WB 4LSSL 3Q5OA 2YD4A 4GAYA 2XG4A 1LE5B 5K9JH 5C0JA 3U2SB 4AM0A 5MENB 1R3KA 4KDVA 2FHCA 4RX4D 3C6LC 2W65A 1WAAF 3L5HA 2BRQA 2WBWB 3U0PA 1A6AA 1DN0A 2ZCHH 5DT1L 3G04A 5GJTL 4P9HL 1FG9C 2X7LA 3NIDE 1IKNC 4PRHD 3VFRA 3TIDB 1FC1A 2EXWD 1U2CA 5ETUA 1IAOB 2P5WD 4JFPA 3QUYC 3TZVC 3ROLA 2JELH 1JF5A 2VLLB 3HZVA 3BISA 2JJTA 2YUXA 5D5MB 1FFOA 3V7MA 5DK2A 2ERJC 1U8QB 2GI7A 4AYFA 4BFIB 2NLJA 1KCGC 3HC4H 5CIPA 3HE7B 3QIUC 3QI9C 1I8KA 4KJWD 1QFUL 4XNZB 4YXKH 2R9HD 4I2XB 1NBZB 5K9KB 4XZUB 3QHTC 1EO7A 1U2HA 1QR1A 4AEHH 3TO2A 1NBYA 1RFDL 3VCLA 4PP1C 4DFHA 3TIEA 1S9KC 1W0WB 3QFJA 4MXQA 3KG5A 3F7VA 4U2YA 1ZOXA 2XOTA 1YNLL 3ARYA 5A3IC 3ZYIA 3ROOB 3RNKA 3QHZH 3B2UC 4KK6C 5T5NF 3QA3A 3PHQB 1NH6A 5JUEH 5SWQA 4MCYB 3NIFF 4WWKD 4XAKE 2FEEI 4X6DE 3T8XB 1JHKL 1FFQA 2B2XL 4M7ZB 1ZA6B 4EIZC 1F4HA 4V3EB 1A14H 2Z92B 2OTPA 2RBLA 3QWOB 4QY8A 3KXFE 5DWUL 2EE3A 1JTTA 5DO2D 5IF0B 1WWCA 2ATPB 3WE6B 3PP3K 3G08A 3H7BB 4OZFH 4LNVA 1AH1A 3ZZ1A 3T0ED 5HYJE 4JM4H 5JA8B 1NLBH 4GBXC 4WUUB 4CRPA 3ZHDA 2PTUA 1JRHH 4LSPH 5IW1B 5E94B 4OZIF 1YN6A 2MCPL 3DSFL 4K3GA 4G80B 4LCUB 2A73A 1FL3A 1SEQL 4RFEB 2FGZA 1ZE3C 4FXGA 4XVTL 3FN0L 4R0LB 1UXWB 5CUSL 4NRXA 3IFOB 3K8KA 1S7RB 2PTTA 3VXPB 1A0QH 2MWCA 4GRLD 5CGMA 4IMKA 1VB9A 4FQJL 4PIRF 5H35B 1UM6L 3NFPA 1I1YA 5KSUB 4WJ5A 1V3JA 1CFSA 3PV6A 1BOGA 1U0QA 3VFMA 4CDHA 5MP6H 3HKFA 2BFVL 5DMIL 2AEQH 1JNNL 2GT9A 3IDNA 3QIUA 4JQIL 2VAAB 3CVHB 5DJDB 1XR8A 1MFEL 3H0TA 4KZEH 4KK8D 4ELME 1IM9A 1MJJB 2GSIA 1ZKAA 3ZYJA 4J8RA 1VEPA 2Z93A 1I8LA 3DXAA 1IRAY 2XG5A 1KJVA 1ZA3B 1EAJA 4JRXD 4BZ2H 3NZ8B 3G5ZB 2X4SA 2H9GA 2JIXA 5D96C 1T66D 4GMTL 1JYWA 1R24B 3IJSB 3WLWC 3EBAA 3NACL 1H3VA 4NKQB 3ECBA 3KPOA 1W0VA 3QEQB 2XQYK 1JNHB 3PGFH 1QEWA 3O6FA 5JZ7C 5F89A 2HFEA 1ZEAH 5FCSH 3TLRA 5BZDB 1TMCA 2ESVB 4ERSL 3ET9F 3UO1L 1F02I 1U58A 4WY7L 2X4QA 3L5XL 4U1GC 4DCQA 1ORQA 3IDGB 1J18A 3OSKA 4OLWH 3WLBA 1UM5H 4JHAH 5HD8D 2ADGA 1S5IL 4X8JA 3QEHA 1LO0H 4HIIA 5I1LA 4V1DA 4EDXA 2OSLA 5D93B 1T5XB 3C09B 4UOJA 4D9RE 1G84A 1QRNE 4CVXA 5HI3D 2IEPA 2V7HA 2VDNL 4G6KL 2VDQH 4XPAH 2BVPA 4CU8A 2W9EL 1BQLH 4J23A 5E00A 5J6HA 4M6ML 2MKWA 3V5KA 4YHPA 3DUSA 2CLVA 3GMMA 4ELKB 1UVQA 5CJQH 3QXDA 3X17A 1D9KC 4XCEA 3SBWA 5FYKD 2HT2D 4LBEA 2IGFL 4IRJD 1EJOL 1IEAB 5KG9A 4NYLA 3LKQB 1GPOH 5F1SA 4XCYB 2P8PA 1YUHA 3IU4L 2D31B 4Z95H 5HGHA 1OP3K 5JMOC 4XCNB 3DO7A 1ZT7B 2LU7A 1EMTH 4X6CB 4ZAKD 1TQBC 3MRPB 3HNVL 1P4LA 4XMKH 1CLYH 2NY5H 3I6LD 3IRZA 5GGTL 5C08A 3WSQL 3MUY1 5LAXB 5FGCE 1X6NA 5DVNA 4AL8H 5GRWA 4BSVB 1WCBB 4M7LT 3LQAL 4J3VA 5DUPH 3IFNH 3VH8B 4OF6A 1F45A 1D6VH 2ZUSA 3VD3A 5FHAH 1CYGA 1IEBA 4JLRA 3QDAA 3RVTD 3U9PH 5FOJA 4N9GA 3O6LL 3BOVA 5FGSA 2VNCA 1NMAH 1QRKA 4JO1H 4R26H 1FVDA 4C56A 2EDLA 2HYMA 4S2SA 1MI5B 3SY0A 3O2VL 3R06B 4XMPL 3KPSB 3V8OA 3LD8C 2FX8H 3ISWA 3TJHD 3B2VH 1MF2L 3V52H 2KUTA 1FRGL 4JFDA 4JGMA 3BQUD 1TETH 4NN5C 4AENB 3UP1A 5IHZA 2PYEB 1Q9OA 1EGJL 3CX5J 4PJCB 1WAAE 3HR5A 4ZUVB 3EYSL 2F5BH 3RWCB 3VI4F 1N8ZA 1NFDA 3HMWL 1UH2A 1Q0XH 3VD5A 4LLMB 3IKCB 1CFTA 2YRLA 1KPVB 1V7ML 2UVEA 2XY1A 5A2JH 4H5SB 5IVXF 4JN2A 5J3HD 1NGWA 4MAYC 3FFDA 4JPKH 3SDXB 4QCIA 2HFFB 3PNWA 5CJOL 4EI5D 2V6HA 2EH7H 2APWA 3KPPA 1AGEA 1U93A 1UZ6F 1VFUA 5TF1L 1G6RB 1QSVA 4I18C 2VXTH 3KPTA 4F3FB 2XRAH 5C3LD 5EU6B 4UT6L 4KJYB 5DJYB 2ZSWB 1TCRA 4JFXA 4LSRH 5F7LB 5IBLC 3SKOA 2YBRA 5DGQA 1NPUA 1OSPH 5DUMH 1D9KA 1FIGH 3MCLH 5C6PB 2D03L 2HA1A 4ZOCA 3WFBL 4A6YA 4TTGA 4HGKC 4MQ7B 2WBJD 3C60D 4PJ8D 5HHMD 4NN6B 1F58H 3MRMA 2PW2B 2CLRB 2DYPD 4L4TA 2BRRH 4MB3A 5E9DD 2YK1H 3OZ9L 5BS0B 3V79C 1TQCB 1TFHA 1PZ5B 4MS8A 3QQ4B 4JFOA 3N1GC 5BRZB 3TNMB 2GAZB 2IFFL 4TSAH 3BESR 5E2UH 5IBUB 4UV7H 1RSFA 1CS6A 1HYRC 3FTGB 4KRNA 3H8NA 6FABH 3GM0A 3MLSL 3TBVB 4I4WB 4JN1H 4GAJL 3V0WL 3QQ3B 2DLFL 4RFNB 4JY5L 3FAWA 1OL0A 2QR0B 3U9UB 1GHFH 4JZNA 4ZFGH 3GSUA 4NJAL 4PJHF 1BFVH 2OM5A 2DQCL 1Z9LA 1B0RB 3O4LE 3SJVB 4TULH 3HE7C 3OJDB 4MQXD 2IQ9L 3OR6A 4H0HB 4JFED 2EO1A 1RIUL 3D69A 3ES6A 3KPRE 4ZO7A 5FM4A 1QFWH 2AGJL 2Y6SC 1NDGB 1K8IB 4QHNB 2R0ZL 1D5IL 1SEBA 4XPBH 3ARFD 5CEYA 3B5TA 4ZTPH 5GGQL 1E6OL 1ZSDA 3RBGA 3MA7B 3GSXA 4WHDA 3LHPH 3ARUA 4N0UA 1A3LH 1C1EH 4PRIB 4MWFB 3Q5TA 1KYOK 3EOBA 2Q3AA 2BCKB 3X3FL 5ADOH 4FTVB 5D70H 2C4FU 3RIAF 2FH8A 3FMGL 5F71A 3TPUA 1L9NA 3OR7B 4OLUL 3SOBL 2HFGL 3ZE2F 4MDIA 1JWSA 2GJ6E 3QHFH 3P77A 4YO0B 1OTSD 1NC4B 4AMKH 3ARGB 3L3OB 1KLUA 4K7PX 5F7WC 3O2DL 5IFHL 3CFKA 1RULH 4LNRB 3GI8L 4JO2L 4L3EB 3TT3H 1UZ8A 3UAJC 5CEZE 4WHYH 5DJ2A 4M61B 3DOSA 4MX7B 4F57H 3N0PB 3LPFA 3RVXC 2EIEA 1CVRA 1VDGA 3OB0H 1J8KA 1I7ZA 1LE5A 2A0LC 4ZD3H 2KZWA 3MLUL 2WUCH 4OCXL 5C0IA 4XNQA 2IG2H 3MV9B 2ENYA 4MA1B 4OGAD 3ARXA 4XVJH 5I1HL 5DZNA 4R0LC 3CMOH 5DRNA 1BLNB 1OF2B 4TN9A 4CBPA 5AAWA 1QSEE 3TIDA 3VWKA 5EC2B 1IMHC 1RU9H 3L9RA 5D7LD 3FOLB 1T0NB 5AYUL 2CK0H 1IAOA 1EUTA 5D7IB 1IC5H 2VLLA 1A5FH 1OAUH 1FN4A 4Y1AE 2NY6B 3MPCA 4ODVL 4HEME 4GRWE 1ACYH 5T1MA 2YPLE 4Z7NF 5ACLA 4Z7WE 5F6IB 4PV8B 5L8KB 5E56A 1U8QA 2RR3A 4C59B 4YIQA 3HE7A 2FX7H 2VUYA 1D5ZB 1SMOA 1X5IA 4KPHL 1BJMA 5K9QG 3ARBD 4TUJA 3GHBH 1RUPH 5E6IA 3RWEB 1YMHA 3MLRH 3AU1B 1DVFD 3D0VB 4XWGL 4N8PA 1U8PB 3BPLB 3P0VH 4XC1L 5HHPB 4KI1A 4LRNL 3ARDB 1J12A 1W0WA 1ORSB 4XXCC 2VQ1A 5HHXL 3QPXL 5ESAB 5HDLA 5JXAH 3TFKD 1T3FB 2NR6D 3QDJE 2MQCA 4FZ8H 2XIDA 4LSTL 4ZS7L 2KQNA 2YXFA 2H8PB 3DX8B 4R4BB 3IXAA 1G9NC 5F70A 3WIHL 4OD2B 1SY6H 1G7IB 4MCYA 4OCYL 3KYNB 3P11L 3O2WH 3T8XA 1CDIA 4G6JL 4QRUB 4LQFL 1XF3A 2HT4C 3CAFA 4RWYL 3EO9H 4P4RA 2PXYA 2DMKA 1T21A 2Z92A 4NM4L 3SGJC 3QWOA 4FQCH 3BGAA 1CE6B 3BH8B 3QIBD 5D93C 2RIKA 3C09C 3QP3A 3I3EA 4FA8A 2C3VB 3TNNA 1BJ1H 4KFZC 4M02A 2HFTA 4I0PB 1FYHB 3QDGE 5LQBH 1Z5LB 1T04A 3VH8G 3PWVA 1GZQA 2ITCB 2BNRE 3LKSB 5GSVA 4X6BA 1MCQA 4EBQH 2EDXA 2D4FA 5DA4A 4G80A 4JO3L 2R0LL 1R3IH 3VI4E 4XPTH 3MROA 4ZXBA 3E0GA 3JV6A 4R0LA 1UXWA 4G6ML 1JHTB 2X41A 1K5NB 2CDGB 4ONOA 4F80A 3RI5K 2R2HA 2YN3A 5IVXE 4MJ6A 3DVIA 3W9DA 1E6JH 5C0BB 3S88H 1AO7E 5H35A 4XHQA 4RGOL 2NY7H 3N06B 5F96H 5CBEA 5KSUA 4LIQL 4NP4H 2EYTA 1RPQA 2YOCA 2X5PA 5HVHB 3HLAB 1UZ6E 3WHXB 4N90D 1WFOA 3QH3B 3PJSA 4ZPTA 4NZUH 4LCWB 2MFNA 5GRUL 1GC1H 4KAQL 4YH6A 1D7FA 4BZ1L 4WTWA 4HULB 5D1XB 4B53A 3MLZL 4AIOA 4JEGB 3NA9H 3O3BB 4HC1H 1CL7H 3ULVD 2DWEB 3G5ZA 4FFWC 1MRFH 4XXCA 3V95A 4ZOBA 2EDKA 5JW4M 2QJDA 2DJUA 5CSGA 1MCHA 1HHGB 1S9WA 4PJFB 4XCFL 1JNHA 1U95B 5H37G 3MLYL 1YJDH 2KZ1B 3PWPD 5GS0C 2OK0H 3QUMA 3K3QA 4X9IA 2P42B 4POUB 4G9FB 3WNPA 4MSWA 4E41D 1CXFA 1QFHA 4Q2ZB 5DD5H 1CFVL 2R1YA 2DWDA 4WHTB 1S78C 4R96B 15C8H 4G7VH 5I8OH 2I07B 4YGAB 4MHHI 1T5XA 2BHZA 1A7OL 2UZXB 5IGXH 4F7MA 2R15A 3LN5A 3U7WL 1U8MB 1KGCE 4I3SL 3U4BL 5I1JH 4ZODA 3MJGX 2FWOB 5CSBA 2ARWA 3QWQB 5GRJL 1A1NB 3ULUC 4U6XA 4I48B 3TVMB 3D3VB 2QHRH 3CK0H 5IBUG 1FV1A 1EO8L 1FO0L 3MJ8A 4N0FB 3I85A 4Y16D 3QRGL 4ORZC 2HWZH 4FS0A 1KN4H 2B4CC 3LKQA 1BECA 5FDWB 4XCYA 5KBNC 1ZGLB 3WO3B 4KHTH 1B6UA 4E0RB 5FOBB 4NN6C 2D31A 4S0UC 2BNQE 4XCNA 1ZT7A 4QGYA 1FZOA 5E8PB 3JWDH 1KV3A 5T33H 1NEZB 5EORH 5GSRA 3EGSB 5C0ND 1ETZA 1T20A 4P2QE 3WNNA 5IQ9B 4J2XA 1TQCC 4WFGE 3ZE2E 4NHCL 3VH8A 3LSOB 1I9IH 5JHDD 1MEXL 3MOAL 2KKQA 3GM8A 4U33A 4EI6B 1TJGH 4Q74A 4DFIA 4M8VA 2XQBH 5CSZB 4Z76B 4TUKL 1RUAL 3SDYH 1UKTA 1JZ7A 1DFBH 4BH7B 5DUBA 1B4JH 1OAXH 2ZOKA 2C1PB 1BBDL 3KPSA 1HXMB 3CLFL 5CGTA 1ROWA 1FORL 4JPVL 2A6DB 4PRHB 3BSZL 2AABH 4XVUD 1DR9A 4ZTOH 4PJCA 4ZUVA 2P5WB 1RHFA 2GFBB 4I1NB 2C7UB 1T5WA 2Z4QB 2XZCH 1JTOA 4QRRE 1LP9A 1CFNB 3F7RA 4R7DB 1VSCA 4LLMA 3IKCA 3W2DL 1EZVX 4GQ9H 5ID1B 3DHJA 4D9QD 3C8KB 4H5SA 1DN2A 5HDBF 2RGSA 4MQTB 4LF3B 1INQA 1JHLL 5EZIL 5FF6A 2BSRB 3I50H 3SDCA 3GJFB 2WZPD 4I8DA 3VXMA 1XCQB 4Z7NE 4XNMB 4ONGL 4NC1E 2VLRE 3BPCB 4LL9A 4PPTA 5JW4R 2W0LA 4ODSL 4F3FA 3CFCL 4KJPC 4N0CA 2LU3A 2E7LC 4KJYA 5DJYA 3MRDB 4XMLL 4NQVB 1U92A 5TF0A 3ARGC 1JPSH 3FQXB 3SCMA 4LPCA 3OB0K 5F7HA 1HE7A 3UYRH 5C1MB 1YA5A 3W0WE 2C3HA 3EFDH 3QO0B 2IAMD 2EDNA 1A7RH 2AJSH 2EIZB 3KDMB 2NW3B 5EZLA 3P4MB 1JWUB 4MNQD 4MQ7A 4ZQKB 4YHYC 1PQZA 1UH3A 1ES0A 3LKRB 4EJ1C 1QNZH 3MJ9H 4WWKB 3RFZC 3F7QA 2PW2A 5FV2A 1UENA 4LCCB 2OZ4H 4MA1C 5BS0A 4C83B 1P7HL 5CBAB 4ODWB 1QFPA 1PZ5A 3GK8L 3QQ4A 4CJ1A 4O2FA 1KTDB 2VAJA 2FECL 5FGRA 3TNMA 2GAZA 3RY5A 1MRDL 2VITA 2XA8H 4PG9B 3T65A 3QCTH 3T0EB 1BP3B 4Q0XL 5HI4D 3GO1L 4FQ2H 1REIA 3TBVA 4G8GE 4I4WA 4ODTL 1EEYB 1MREH 2NY6C 3HE6D 2AAVA 3MNWA 2QR0A 3U9UA 5LKNA 1V3LA 5F6IC 2AJVL 3C9NA 3VI3F 1XEDA 1B0RA 2P5EB 4QF1B 5FYJU 4NO0D 3OWEA 1NCWL 1N64L 4K23L 4JR9L 4GRLB 4MNGE 4MAUL 2P48B 3I9GH 3NVQA 4EUPH 4OCRL 1QHPA 1P6AB 3TO4A 5EU7E 4NDMB 4BKLB 1K8IA 5ICXB 3H2WA 4W6WB 2DQIH 1R5VB 4JJHA 4NQCA 5ISZA 4U1LA 2J8UE 1UT9A 3BPLC 1YEIH 3QIWD 2ITDB 4D0CB 3U82B 1XZ0B 3ARDC 1FSKB 1DBAH 4WTZA 4MWFA 5I66A 1OLZA 1MJ7H 3NAAL 1JGVH 4MNHB 1I1FB 1NSNH 3P73B 4EQ2A 4FTVA 4FMKA 5EU5A 5EN2A 1IEHA 4RMTA 4OKVA 5DJZA 1RZJC 3VFOB 4F8TA 5J9PB 4AQ1B 1J1OL 2DQHH 4YO0A 1KN2L 1E4KC 1NC4A 4PREB 5GISH 3L3OA 1VFBB 5F9WB 4BQ8A 4X5XB 4JY4A 1RUKL 2BY2A 2CK2A 1MHCA 2O93L 2BVUA 2I5YH 5L9DL 2OL3B 3VRJA 5BO1L 4MX7A 1RZ7L 1Q72L 5I2IB 4NO2A 3WO4B 4I0PC 3IU3B 4M1CD 4M5ZH 1K2DB 2E6QA 3UTTE 4PGCA 43C9A 2V2WB 4M62H 1W0YT 3D85B 2FZ3B 2JE8A 2X1PA 3U7AA 3D2UA 1NBVH 5AUMA 1OGAD 3N85H 3BT2H 3EUUA 1YDPB 2R39A 2NX5B 4PJ9D 4OUOA 1X4YA 4NZTL 4YDLB 5INCB 5ICZA 5EC2A 1ZGLP 5KOMC 1F13A 2IF7A 1T0NA 2MNUA 2AV1A 2NQCA 4TNWK 4UILH 5D7IA 3BP6A 3QG6A 1OCWL 1LK3H 4IEFB 5LJYH 4Y5YB 4P46D 3DI3B 5GGRA 5HVHC 4K3JH 4H8WC 1NJ9B 4PV8A 5TDOB 4Y88A 3VXUE 4IRZL 3RZCD 1FYTB 1V7NH 4JG1L 5HPMA 1A6TB 4HMCA 4IRJB 2FEDC 4W4OC 1D5ZA 4V2BA 3JSSA 4S1SH 1N4XL 5LWYH 4J7RA 5D1XC 4DOHE 5CJ5A 1HWHB 4ZAKB 1JE6A 3AU1A 2F54D 2Z31A 3D0VA 3RGVD 2VZ3A 4L8CB 1OAZL 4Y19E 1KCLA 5HHPA 1NLDH 3MGOA 1KENL 1HOCA 4HHAB 4JREB 1J0ZA 1YEFH 4NUJB 3NA4A 4EDWH 1ORSA 3CFEA 1BM3L 1T3FA 1CLZL 2OYPA 2EIDA 5C0RH 3RWIB 1JP5A 3JWNC 1MPAH 2QQNH 1ZHBA 3WUWB 2OXHA 5FGBC 4OF7A 5IG7B 3QAZB 5AEAA 1M7DA 3QEUB 1MSPA 1E4KA 5TGBA 3HA0A 4ENED 4K8RH 2FSEB 1XGTA 4P9MH 4WNQB 1SBSL 3RQ3A 1M05A 1CE6A 3RA7H 3BH8A 4NQSB 4NNPL 3BQUB 4BELD 1MJUH 1NEZG 1FLTX 4OZFA 4I13B 1H3XA 4KTDL 5SWZE 3U0WH 2A6IA 4NCC2 4I0PA 4BM7A 2YR3A 3VU2A 5CEZH 1AR1C 1Z5LA 3JTSB 1JWMB 1KCUH 1OT1A 1V5JA 1CK0H 2LE9A 4OFYA 3TN0D 1QA9B 1Z2KA 5FB8A 3RP1A 3ZT6A 2ITCA 3TVMC 3NCJL 3LKSA 5IB3A 3PG2A 4MD4B 4P49A 3WKNA 3IF1B 1YEKH 5FCUL 3SE9H 5EZOH 4EI5B 1SYVA 1J5OH 4BQBA 4UBDC 1K5NA 3MRKB 3QPQD 3VFGH 5KW9H 4K7PY 2ICWB 4PTTA 3RX7A 1IC1A 4O00A 5C0BA 1J8HD 2JB5H 3DYMA 1HI6B 4AQOA 2DF3A 5D1QD 3OKMB 4D8PB 1WISA 4GUPB 2DQUL 1JVKA 5J12B 3HLAA 1VENA 4HKBB 12E8H 3CJJA 5DA0B 4NFDA 5C8JB 4GRWH 3O9WD 3WHXA 1F4AA 3I6GA 5EIVA 5GGUB 4YEEA 1CCZA 2WBJB 3C60B 2N1KA 1BD2E 3OKNA 4PJ8B 5C0CD 1H15B 4FQIH 1VGEL 3IDYB 1F8TH 4DAGH 1IAKB 1KXQE 4HUUB 3O3BA 4QRPE 2CD0A 2DYPB 5CP3H 2E9BA 5E9DB 1PX3A 3ZDXE 2FJGB 4LLVB 4AIZB 3HG1E 3P4LA 5DEFB 3QWRA 2ZJSH 4NUGL 3CSBA 2CGRL 4ODXA 2ZUYA 2B1AL 1HHGA 3AROA 1A6ZB 1C5BH 1GSMA 4PJFA 4UOW1 3DMMD 2YKLH 2EXWC 2R56H 1RUQH 4U7MA 5BVJA 5FGBA 4HG4J 1A8JH 3MLXH 1GYAA 4XWOD 4Q2ZA 1WK0A 1NFDF 3E8UL 1FNSH 5EO1B 1N5YH 4R96A 2V9RA 3I6KB 2I07A 4WU7B 2C26A 2L7UA 3AXLB 1S7SA 1ZLUH 3FB8A 4JFEB 4KJWC 4MZ3A 1I8IA 2R9HC 3VFTB 2C3GA 1J1PL 3MRCB 1U8MA 5TH2A 4KTEH 1V05A 5B3JF 3ARFB 1KJ2L 1RHHA 1DQML 4XP9L 4I48A 5ITFB 1L7IL 2IJ0C 3FRUA 3HZYB 2FHBA 4HH8A 2N4IA 4OSUL 4PJXE 1EHLL 2FIKB 1CLCA 4FXKB 1ZHLA 4N0FA 2EH8H 5IBTL 3T0BA 4DW2L 2DQJH 5FDWA 2R1WB 1ZGLA 5HSFA 4E0RA 1BFSA 1AP2B 4WWKC 5CEXB 3MR9B 3MSPA 2E7MA 4GKSB 1Q38A 3BP4A 4LCCC 1NEZA 5F1IB 1FGVL 3BE1L 5L8LB 1I8MB 3QEGH 5IQ9A 4KY1L 4K9EC 4UU9A 3M45A 3AS2A 3UDWA 5EBWA 1NUFA 2OTUB 1I9EA 5DO2C 4LAJH 5DHYA 3CFIC 4W6XB 2RAMA 4HEPG 4EI6A 4CU6A 1ULVA 4P2RA 5CSZA 3SKMA 3T0EC 1K4DA 2APTA 3LEYL 4KUCD 4WI9A 4HV8A 3VRIB 1LO2L 1J9CT 1YEEL 2QQKH 4L9DA 4BH7A 4P5KB 2KDGA 4PRAB 4HDIB 4RX4A 3AB0B 4HUKB 3VGGA 4ZFZB 3TGXA 2C1PA 5JIPA 3TV3L 5A40E 3V8CA 1HXMA 1S3KH 4PGZA 5KVEL 3UPRB 2A6DA 4GRLC 1KTRL 1LO5A 1IGCL 3IFPB 4D3CH 1A6VH 3MRFA 5D7LB 5MEQA 3NPSB 2DBLL 2JJWA 5KN5A 4PGBB 2GFBA 1AE6L 2Z4QA 1S5HB 1FAIH 1FGNL 1WEJL 1CICD 4HGMA 1CFNA 4R7DA 3DTXB 5ID1A 1LDPH 4YXHL 3KNBB 4XVTH 2DTMH 1FSKC 2NZIA 3C8KA 3FN0H 4UNUA 4QTIL 3MLWL 4MYWB 5BXFA 3CH8A 4LLDA 4NRYB 2FB4H 5EBLB 3G5YB 5IT2L 1I9JL 1LE9A 4KK8C 1TZGL 1XCQA 3ARBB 3U6RB 5F7KC 2B8OT 4HCRA 3H9SA 1URLA 2H32H 4TSCH 3FZUD 4DEPB 5E95B 4ZUUB 4HJ0D 1DVFB 1INDH 1Q8MA 3FT2B 4Z0XA 3A6OA 3MRDA 1L7TH 3F6LA 2D7NA 3FQXA 3G6JB 5F9WC 5E6ZA 4D0DB 3QO0A 5I1AA 2H6PA 3I02B 2UWEA 5D1ZD 3DXAE 2IPKA 1CD1B 1JWUA 4HWZB 4ZQKA 3MV8E 2COQA 3LKRA 3WO4C 5JW5B 4XVSH 4WV1B 4JY6B 3KVQA 3V6FB 5DVKA 3CXHK 1CT8B 4R4FH 5HD8C 1EFXD 5F3BB 4R8WL 4OCSH 3MNZB 2AK4E 5CBAA 3GSWA 4ODWA 3QIBB 4HFUH 4HWEH 3BJLA 3GSNB 1QSFD 3EOTH 2XWTA 1K6QL 4O2EB 5HI3C 2OXGA 3IFLL 4I3GA 4YDLC 4PBXA 5HYEA 1XF4A 3T0EA 4JRWA 4JKLA 1TTUA 4AG4L 4GFTB 4F8QA 3MRNA 3VW3L 4N0YL 3UTSD 5FYJL 3HI1A 1PG7H 3KAAA 4Y5YC 3WUWG 3DGGA 1U42A 2IQAA 1F00I 1M71B 3D39D 5F7YC 4OLXH 1OTUD 2P5EA 1WZKA 2HT2C 5GHWH 3V9FA 4IRJC 1UKSA 4GRLA 1TZHA 1EO5A 4ODHL 3GSOB 1NUNB 5CZVH 2JKXA 4POZD 5GXBB 4P99A 3OKEB 4ZAKC 3EDFA 1R5VA 1I3UA 2PYFA 1IKFL 4ZUTB 5D7SH 1DP0A 4L3CB 3ZKND 5HHQB 3DV4B 4JREC 1XZ0A 3G6AA 3F58L 4Q6IB 5EWIL 3MUZ1 4M7LH 4XP1L 2W9DL 1HHHA 5J0BA 3QQ9D 4IOSD 4TVPE 1SBBA 4MNHA 3VG0L 4YR6B 3ARSA 1I1FA 3JTTA 3P73A 2EC8A 2GTZB 2R69H 3BKYL 2ENSA 3RVTC 2BVQB 2O5XH 3GUTB 3VFOA 4WIQA 5J9PA 3QAZC 5FKPB 2F9BT 2FGWH 3CZFB 3LMJL 1NL0L 4PREA 5IB1A 5D9SA 1WBXB 3MRHA 5I8KH 2VLMD 1MRCH 2YD8A 4ALAL 1GAFL 3RWGA 4X5XA 3TJHC 5K9QI 3WXWH 4Q97A 5I16A 2JCCB 2MMXA 1IGYB 2MHAB 3BQUC 2I60L 3MA9L 3PWPB 4P3CL 5T1KD 2YPVH 3FQNB 1EZVY 3GSRB 3KHOA 4HGWA 3OL2A 4HKXB 4U6YA 3EYVB 3VXRD 4Z77B 5LXGH 5TE7L 4E42B 3KYKL 2LTQB 1KC5H 4FHBD 1F3RB 2FYYB 4NWUH 4E41B 1K2DA 4MA8L 2V17L 3FO0H 3N1PC 2V2WA 3WNOA 3D85A 3TH3T 4JFDE 1CGSH 2FZ3A 5J3HC 3DVNB 1RURH 3QNXB 4EI5C 4NNYA 1G9ML 4TQEH 3VXQB 5J1TC 4G7YL 2NX5A 5ECJE 4RWHA 2ORBL 5JHLL 3WFDL 2Q7NA 3MRIA 4WDIA 5E8DL 1B88A 5ILTL 1IGJB 2GY5A 4LLUB 1CG9B 2VABB 4Y4FA 3OQ3B 4OTXH 4QXWA 2W0PA 4OB5L 2LAAA 4JVUA 2O5YH 5FFLA 4OF0A 4U1SA 2DLEA 1QG3A 3EYUH 5I1IH 1T1ZA 5J12C 4KH2A 3GMPB 5TDOA 3VWJD 2OR9L 1FYTA 5GS2D 5B3JE 4Y16B 3B8YA 1I7UB 5D8JL 4IRJA 4F7EB 1UWEL 3QDMD 1FIEA 2NMSA 2QTEA 3X13A 4Z5RA 2WBJC 3C60C 4FP8H 3L7EB 4PJ8C 1M1SA 4WEMB 1MCLA 4XPFH 4PY8J 3IDYC 1A4KB 5E1HB 3X11B 5KVDH 3KPLB 5D4QA 3OKLB 4ZAKA 4XBEL 5M95B 3MUGA 5JQ6L 4L8CA 4K7PH 3ZTNL 3RNQB 4NUJA 2PR4H 5MHSE 3WXVH 3SPVB 1RZFL 1QLRB 3O45B 3SE4C 1F97A 3FCTB 3WUWA 4PY8I 4L4TE 1SY6A 1ZLUK 2YC1B 2FLRT 2VZVA 5F72S 5IG7A 1FZJB 3ZSSA 2CKBB 4QXUH 4OZHB 1YPZE 2VXSH 4R4ND 4WI2A 2DAVA 1F6AB 4KMQA 5DRZB 5J57B 2FSEA 4O58H 4WNQA 1CQKA 3WFCH 2YD3A 5C0AD 1EVTC 4F7TB 4NQSA 1G1CA 4MQXC 3MBXH 1LNUB 1MY7A 1KPUB 4WEUD 1W72L 3OBAA 2M2DA 2W0KA 4ZS6D 1AGBB 2X9YA 5E5RB 3V5HA 1G7QA 4K94L 3FQWB 4OQTA 3TA3B 1FDLH 5CLTA 1F4YL 1JWMA 1VPOH 3V4UL 2QSQA 1AKJA 1QA9A 3ARFC 5DR5H 1KCSH 1BJ8A 2F58H 1QPPA 4WO4B 4MD4A 4P23D 4XPHL 4LLWB 3IF1A 1IC7H 4EI5A 5KAQG 4ONFH 2VH5L 5DFWH 3SE8L 2F74B 3TM6A 2IH3B 2B0SL 3IRPX 4ZFFA 1JNLH 1Q9LB 2OX5A 3BW9B 4OLZH 1UEYA 4DGVH 1JYNA 1FBIH 1KACB 4H1LH 2R4RL 1OTSC 4GUPA 1GIGH 3P2TA 3HPJA 1OM3H 3RWFB 2IAMB 1UACL 2F8XC 3Q1SL 5C8JA 1KB5B 1XGPB 3CVIL 2DQTL 4MNQB 3MRRB 1AQKL 2Q86B 1OARL 3PDGA 1DBKL 2WBJA 3EYFB 5T1DL 2XN9E 1LEGA 1DBBL 1UB6A 2Q8BL 5DC0A 4HUUA 4YDKH 4HC1A 1ZTXH 2DYPA 4PJBB 1Y18A 2GCYA 2A2QT 4N5ED 5SWSA 4KK5D 3U1SH 3PWNB 3QCUL 5JO5B 2EDRA 4AIZA 3AB0C 4OGAC 4Y2DA 1HXYA 2E7HA 4LLYB 4WEBL 1RIVH 3SE4A 2QSTA 3S8WA 3UTZB 4LCIL 5CZXD 3QZWB 2ZUQB 1U36A 1JUFA 1XGRA 1N3NB 2GY7B 4XX1E 5MENE 2A6KA 3NH7H 4PJCF 3OMZA 1CGWA 5DJCB 5EC1B 4HJJL 5DC4B 3HE6B 4KKBD 4MJ4A 2A38A 3BEVB 3SGEI 4X6DA 3UJTH 4RGNB 7FABH 1LP9F 3I6KA 1U8OB 4X4XA 4WU7A 4Q9RH 4OM0H 4NO0B 4HW6A 1CGUA 1NCDH 1RMFH 4C58B 3RZWA 3MRQB 3ZSTA 5HTSA 5LGJB 3QUZB 3VFTA 4X0KB 3SDXF 3ARBC 4GAFB 3WIFB 5D5ME 3H42H 2ZUWA 4H88H 4DEPC 4DN3H 1DVFC 3ARFA 5HYJA 2R0KH 5GJSL 1PLGL 4N1CA 1HSAB 5ITFA 3QG7L 2ILLA 1DQDH 4EVNB 4KVCL 4FXKA 1NGXA 3TFKC 3MLTB 1KBGL 2NR6C 3V5DB 4GG8B 2AXJA 4GAGL 3GIZL 5HGBA 2O5ZH 1B9ZA 3ME0A 1V3KA 2XICA 2R1WA 1HNFA 2ZPKL 2H1PL 4GW5B 4PLOB 1EEZB 5CEXA 3CX5K 3IJYB 3QO1A 3WHE1 4HS3A 4WV1C 4GKSA 3MNVB 3JWOL 4WFED 2B1HH 2ZUXA 5F1IA 1IBGL 3EYOB 1RQ5A 5CGYD 1EBPA 1RZKC 4P5TD 1VGKA 1KXTB 4BSWA 3HNSH 3QIBC 3GGWB 3UBXB 2OTUA 1FL6A 4MD0A 5L2JB 4CL7A 3OGOE 1BZQK 1OWWA 4FXLA 1MWAH 4HIEB 1LO4L 4HUNB 4MMXC 1HKFA 3SQOH 4ELMA 3OG4B 1LMKA 1UH4A 3HUJB 4DKEH 4BUGA 3VJ6A 1ACZA 2FHFA 4ZFZA 3GMNB 4YBHA 1OGAB 2G60L 3VXOA 4NO5A 1UJ3A 4PJ9B 3EKCA 1SMAA 4DVRH 5DD1L 1I9RH 5FA3A 3IFPA 2OJEB 4WUUE 1BGXH 1JZ2A 3MOBL 32C2B 5CILH 2VDPH 2IPTL 1MCBA 4P46B 2VZ1A 1QLEH 3DTXA 3KNBA 3RZCB 4HZAA 1FH5L 4Q6IC 3RDTA 1GJIA 2Z91B 2DKSA 2VLJD 1FE8H 4NRYA 3MODL 1NMBH 4UDUB 2V5TA 3G5YA 5C0EB 3ARBA 5JW4N 2AKRA 4GXVL 2PF6A 5C6TH 2F19H 2SEBA 4IRSD 2V5SA 1QRNA 4LSVH 3NABH 3GRWA 4ZUUA 2F54B 2EICA 1DVFA 3RGVB 5T5FL 3SDDD 5T3XE 2JB6B 3C08H 4F33B 3FB6B 4PB9L 1XIWD 1NDMB 3QNZB 4XT1C 1P84J 3TFKA 4U1MA 4JHZA 5CCKL 3RGHA 4JFZH 4LAQL 1GCFA 4D2NA 4OM1H 4H20H 3R4DA 4QRTB 4R3SB 3V6OC 1YYLH 4M4RA 5EUKA 1CD1A 4HWZA 5LCVL 3RAJL 2FBOJ 1S7XA 5A16B 3MJ9A 4ISVB 3NZHH 3Q5YA 4WV1A 3F6IA 2VXUH 4JY6A 4G5ZL 1DQQA 4I77H 5TDPB 3V6FA 4OFDA 3RU8L 4LDLB 3U36B 3N9GL 1CT8A 5FV1L 2MTPA 3OX8B 4OD1L 5F3BA 3QEQE 2EDDA 3MNZA 5GGVY 5EOCH 5EH1A 1VCAA 3QIBA 5I6XB 3R0MA 2QADD 4WCYL 2AEPL 4XH2A 4F9PC 2ESVE 4MVBA 1I3RB 1ZHKB 3BIAX 4HIXH 1BZ9B 3OAZH 5JIKA 1G7HB 3BAEL 1FL5B 4JFFD 2LVCA 1F90L 4ZDHA 1U8JB 4UT9L 5D7IF 1NAKL 1WIUA 5FO9B 2OJZL 4ZSOB 2W91A 3PE9A 4D0BA 4DKFL 2X9WA 2AJUL 4FMFA 4Y16C 1UADC 1E27B 3U4BH 5HVFB 3V0VA 4L8SA 4Q58C 1PVHA 4HLJA 1WTLA 4EUPA 5GRJH 1RD6A 2GQHA 1J8HB 1I4FA 2QQLH 5D1QB 1YQVH 3OKEA 5ID0A 5HHVL 1FFPB 5HHQA 5C0NC 3DV4A 5JNYB 4Q6IA 4UNVA 3QRGH 4HPYH 4PRBB 1RK0B 1PFCA 3K74B 5E99L 3QJFB 4G8EB 4YR6A 4DK3A 3V7AG 5C0CB 1QSED 4X6CE 1G7MB 3BWAA 2Z35B 4Z7OF 5GZOD 3PGCA 1S9YB 5E2TH 5HHOD 5FKPA 4KXZI 1CIUA 2GITB 1CVSC 4P0DA 1UC6A 3CZFA 2ZP0T 2FL5A 4O9HH 3CIQA 3NN8B 5JPMB 1CGYA 1MLBB 3BKML 4KRPD 2ZCKL 2BOCB 1ZT1A 1F2QA 4Y4HA 4YDIH 2ZUTA 2O61B 1RK1B 3DI2B 2WM0A 2MHAA 3V6OA 1T83C 1WBYA 3PWPA 1PEZA 3GSRA 2YZ8A 4JFHE 4GRMB 4Z77A 5DMYA 1WC7A 4E42A 4NQXB 1MI5E 5F9DC 1L9MA 1CZ8H 3KPSE 2ZCLL 5IHUL 3GMQA 4WO4C 4OT1H 4JHWL 5A43C 3DVNA 5EU3A 4JPIB 4YDJB 4PJ7B 4I9WE 3TYFA 2PYEE 3QNXA 1KPRB 1Z0MA 4PJCE 4KVNL 5E5MB 3GB7B 3HNTH 1YECH 5J8OA 3VXQA 3H6JA 2Q7YA 3CCHB 4DKDC 2W07A 3MYZA 1XF1A 2D0FA 35C8H 1CG9A 2GW5A 1MNUH 5TPWH 4NO3A 5K33A 1UQSB 3HN3A 2HMID 3SDXE 1NCUA 4GKZB 1DBML 4RDQF 3GMPA 4M1DH 4C4KT 5EZIH 3QZWG 4YWGH 2IAMC 3T4YB 4HT1H 1S7QB 2J8OA 4Y16A 1OAKL 1CD0A 1JGUH 4G43A 4F7EA 2ATKB 1PEWA 3OKKA 3A6BL 4FQ1H 3ULUE 1AHWB 3L7EA 3MFFB 5EU6E 4Z78B 1B0GB 1IGML 1TJIH 2V5MA 4P59H 3L3DA 3KPRA 3X11A 4G9DB 5ABDE 3OKLA 1ADQL 4CVZB 1KG0B 4LRIC 1XGYL 4PJ5D 4XPGL 5J4MA 2MKLC 1F2XK 1N59A 4XGZA 1JMXA 1VEMA 1QKZH 5I1EL 4CADB 5E2JA 3KYOB 1N2RA 3IDMA 4GMSL 1I3GH 4LMQI 4NM8L 4DZ8B 2ZG3A 4KHXL 2J2ZA 3ABZA 4TVPH 1FZMB 2ZSVA 4PJFF 2YC1A 5HI4C 2VE6B 2ZUQC 1T03H 3WD5L 2XZQL 5EPMA 5BS0E 2CH8A 3MYJB 3HE6C 4LSUH 3S6CA 4PLJD 1F6AA 2VC2H 1CXIA 1QBML 3SGDI 3OGCB 5BRZE 4P9HC 1P2CB 1FVEA 5DK3A 2R2EB 3GZKA 1LHZA 3KLAA 3P30L 4TPRL 1RJZA 4A6YL 4F7TA 4ODUB 1DBJL 5DFVD 3VMNA 4QT5A 1AGBA 3B9DA 4OZ4B 3CU1A 3FQWA 1IQDB 3TA3A 1UCBL 2MCG1 4FFVD 3UBXG 1CICB 4RAUA 1YEGH 2XKSA 1A4JB 4RISH 4PGDA 3VXSB 3WN5A 4H0GA 4WO4A 3E6FB 2AV7B 4LLWA 2YD5A 3MV7D 4YHMH 4JFQB 1C5CH 5C0FB 3CMGA 3RJDA 5FUCC 3TPKA 3UTOA 2F74A 3CLEH 1A7QH 1RUMH 4L29B 3T2PA 3BW9A 1MHPH 4U6VH 3T2NH 3S34L 4U0RB 2WQ8A 4JCLA 2BHUA 4NGHL 4PJDB 3RRQA 2IBBA 3DX7B 4PRIE 4XC3L 4OQ1A 1UFUA 1HH9A 1X7QA 1OAQH 1GGBH 5KSBB 1IT9L 2R8SH 4YPGA 3AC0A 5GRVL 4FTVE 4HS6B 4Z7WA 3RI5F 5FA4A 1QLFB 1XGPA 5D1ZB 4MNQA 3MRRA 1EV2E 2Q86A 1KFAH 2BX5A 4NFBA 3GFUA 5JDSB 5J13B 2E7LE 3D48R 2EYRB 4M1CC 5FM8A 3IVKB 1YEJL 1TITA 3UROR 2E27L 1P4IL 5CP3A 1RZ8A 1AGDA 4LRIA 5DLMH 4DTGL 4L3EE 1V8HA 1EFXB 2HH0L 5D2NB 4APQA 1NAML 5C9KA 1R5IA 3IDXL 3CX2A 3BD4A 5TQ2H 4DUXA 2ID5A 4HUWA 1QSFB 2VSDA 4WW2B 2FO4B 1A7NL 1DSFL 3J8F7 4PJ9C 3BP5B 2Y06H 5IW3A 4G42B 4LPXA 2YSSA 4LK4A 4PD4J 4TRPH 3MRJA 3ZE0E 4ZYKA 3WDJA 3QZWA 1GGIL 4J1UB 2OCFD 2UZIL 3MV9E 3S36L 3UTSB 1SM3L 3FAXA 4YHNA 2F53B 4S1RL 4P46C 2BOBB 1S9XB 1YMMD 3D39B 4NJ9L 3D9AH 5I1KL 2JTDA 3RZCC 3PL6D 5DMJB 1U8OA 1F4WH 1HIMH 4TOYH 3BGFB 2DD8H 4R2GD 3K8MA 4QRQA 4JJ5B 1I1AA 3HMXL 5D7IE 3W82A 3QUZA 5D6CB 4HWBL 4X0KA 3QNYB 3LH2H 4RBPH 2HRPL 4YAQB 1PD6A 3KJ6H 3QDGA 4HWUA 3RGVC 5DQJB 1MFBH 3WJJC 2J4WL 5IMMA 5JR1L 4U1IB 3BHBB 2BNRA 4YX2H 3MLTA 5IM7B 1NC2D 3O0RH 3EYQD 5KTEL 1BQHB 5A2LH 4HFWB 3WFEH 2NW2B 5DI8B 5KS9B 3HFMH 1R3LB 4L4VD 5FUZL 4HMDA 1D3CA 1NCBH 2Q6WB 4GW5A 1EEZA 5F88A 1FP5A 1HINL 3MNVA 3OAZK 4Q9QH 1E28A 1AO7A 4ENEC 1ZLVH 4LCYB 4Z7OE 5E1AA 5IR1B 1AXTH 4QTHB 4BJLA 5I6XC 1CGTA 1P53A 3TBSB 4RMUA 5L2JA 2UY6A 3ALWA 1DUZB 3VXRB 2A1WH 2VDML 5ENWB 2XNAA 5L7XL 4HIEA 2A83B 1J87A 2Z8RA 4PV9A 1JGLH 3RY6A 4AK1A 1CF8H 2DQFA 2AS5M 1OGAA 3GNMH 5DQ9A 1IGIL 1MAMH 5L2KB 4PY7B 2YD1A 3LDBB 4NPYA 4UDTB 3QPQC 3HC3H 5GGVH 4B7LA 3TYGL 1MFAH 5FYJD 1MIML 5D1QC 4LSQH 2V7NB 5E5UB 1Q1JH 3BIKB 4CNIB 3VWJB 4NSKB 5DD0L 2CLZB 1ZHNB 1W8OA 2Z91A 3NFSH 5ACZB 4NQDB 3QDMB 5EUOB 4RRPG 5C0BE 4UDUA 3V4VH 1I85C 4R7NA 2EECA 3F65A 4YHOH 3MXVL 2P8LA 1AJ7L 3V6BR 2CDEB 1BEYH 3WJJA 3LQAC 3CUPB 3TBTB 4F33A 3FB6A 1NDMA 1U8NA 3QNZA 1VFAA 3RL1B 2ICCA 1PAMA 4LCWE 2NY2B 4KDWA 3QXUA 3VA6A 5JW3L 1MCOH 4G8FA 3DMMC 4KMLB 1T0MA 4FQQB 2DLTA 1KLGB 1CBVL 4FABL 4LEXL 4XP4H 5A16A 4QHLA 5IQ7H 1TNNA 1QHOA 4JKPH 4XWOC 1J05A 3X12B 4PUBH 5IFAH 4QRSB 3LZFL 2ICWJ 3HZMB 3L7FA 3TBYA 2EIBA 2XZAL 2BNQA 3SO5A 1T7WA 1RZGB 5KVMC 3MREB 4KQ3H 4OZGB 4PJFE 4ZFOL 4UQ3B 5C0AB 3L1OH 5FYLE 5HYQB 2D2OA 2D7TH 2CR6A 5JPNA 5I8EA 1PBYA 2EKSA 3D18A 3MCKB 3H3PL 3MRGA 4G9FE 1I3RA 1ZHKA 4M6NH 1CU4H 3TH4T 5MERA 4P4KB 5L6YL 4TVSa 4YJZL 1FL5A 3L3GB 2ICWI 4AIXA 1IAII 4G8IA 3KLDA 5FO9A 3W39A 2BNUB 4P23B 4NHUA 1JPTL 3GSQB 2AJYH 2Y07H 4UV4L 2M26A 1RZIA 4YLQT 1OPGL 4DQOL 3ARED 4NQEB 3D0LB 3QUML 2DL2A 1J0YA 1N7MH 4CUCA 5GGRY 1AHWC 1OD7A 3T0DA 2HKFH 2GIYA 3C87A 3D3VE 3TESA 5T3ZE 4Y2OA 4KZDL 3BZEB 3FFCD 1FO0B 5F7DA 4AEFA 2YN5A 5JXED 5JNYA 2CO7B 3Q3GB 4KI5F 3PDDA 1AXSA 1DUYB 5DJ6B 5C2BL 3U83A 5KVGL 4FFEX 1FCCA 4OI9A 3FB7A 1MCPH 2GSGB 3LCYA 4L5FL 4HBQA 4PRDB 1FFNB 3H3KA 4K2UL 2X4RB 1I85A 1YC8A 2Z35A 5IVOA 5IOPB 4LLQA 2PO6A 3S37H 5GGTA 2GITA 4FQLL 5ITBH 2CUMA 2YRZA 3UZVB 2Y5EA 3VXUD 3T1FB 2RCSL 1JF1B 5T3XH 4P2RE 1RK1A 3QI9B 3W0WA 3BDYL 1WFNA 2PKDA 3CVHH 3HRZA 2JF1A 5B38B 1VERA 3I3DA 4UIMB 3X3GH 4GRMA 1FPTL 5E6YA 1J0KA 4NQXA 3BP7B 1A9EB 3I75B 1P69B 1CICC 5C7XL 1NCCH 4UINH 1JPST 1EPFA 4LMQE 2VMFA 2B7DT 4Y19D 2XY2A 1I7TB 4PFEA 5DF0A 1IGFH 4PRHE 4X6FA 1S7UB 1NGQL 4XCCL 1M7XA 4YDJA 3BGMA 4NC2B 3ARPA 4GXUM 2DI9A 3LS4L 5L88H 1KPRA 5E5MA 2A9ML 2P5WE 4HF5H 3HZKB 3OF6D 3CCHA 4P5MA 4I5BB 1G9NH 3M8OL 2CMRH 4X7SH 3L3KA 5DQDL 2YA1A 3HPLB 1T89A 1RIHH 2IAND 3FZUC 4U0RC 5TE6H 2GUOB 4U1KB 2X4PA 3T1WA 3F8UB 2XZZA 4G8GA 1C08B 4GKZA 3VGBA 4J3WA 4KV5F 3BD5A 1KIQA 1CDYA 1N6QH 1VKXB 3F5WB 1EK3A 4MXWL 3EZ8A 5DDHA 5A2IH 2DQGH 1TLKA 5D1ZC 2DM7A 3VGAB 4X5WA 2XWJB 2LU4A 3CFJB 4TNWF 3LS5H 4MNGA 2WIIB 3MFFA 5J13C 5EIIA 1BAFL 3ZMRA 2ZUUA 2CJUL 5DD3H 1SYSB 4IOIB 3CH1B 2CDFB 2XV6B 4N1EA 3QCVH 3KYAA 1FLRL 3BN9D 5D2NC 1U3HA 4P5TB 4CADA 1QTYT 2J8UA 3DROB 3OXSA 4RA0C 1HQ4B 3OAUL 4WW2C 2NY3D 3QB7C 5FUOH 5B8CB 4X4ZA 2ARJB 2XI9A 4O2CA 2VE6A 1BQHG 5DHVB 4XRCB 4O4YL 3KLSA 2XTJD 1N0XH 3ULVL 4RBPK 1MOEA 5I76B 5IWLA 1INEL 4U3XA 3RWHB 3C5ZD 1X5XA 4K7FB 1OTUC 3T0EE 1X5LA 3BGFC 4WFHD 4MHHG 1H0DB 3M1BB 1BD2D 1BIIA 4L8DB 3S4SA 3VFWB 4POZC 4ORGB 1IQDA 4XP5H 1CICA 4M48L 1ERNA 5ESQB 3HI6L 3KPQB 1A4JA 3ZKNC 2DDQL 2P5EE 1U8LA 1PYWB 3VXSA 3UTTA 4KTYA 4LARL 4JFQA 5ESVB 4S1QL 5BV7L 5C0FA 4RNRB 1D6EA 2VLJB 4CKVX 3LKOA 1OT2A 4LVEA 1ZLVK 5GS0H 4P2OA 5K9OB 4IRSB 3C5JA 4XAWL 4L29A 3UJIL 4H1LA 4ETQA 4N8CL 1CFQB 3SDDB 2VDLL 1A6UH 4JDZB 1XCTB 5E70A 3GMOA 5KSBA 2DIAA 1JFQH 5AZEL 5KVFL 1NCTA 3DURA 4HS6A 4FZEL 1FNGA 1UWGL 2R1XA 3MBED 3DIFB 1YNTB 4HXAL 3C5SA 2X4OB 4OZIB 4JKMA 4URTB 3QRFM 2J6EH 4M5YH 5DK0B 2VLKB 3VXTA 5JDSA 1G6RH 3IVKA 4HBCL 1JI2A 2G9HB 4XBPA 2YEZA 3ULUH 3E2HA 1CR9L 2X4TB 3WS6C 4JZJB 4ELMF 5H37H 1EFXA 1J1XL 1PKQB 5LG1A 5I19L 4NKIH 2P49B 4RQQB 3I3BA 5EZJA 2V9TA 3L3IA 4G6AD 3LDBC 1G0DA 2NTFA 2B4CH 1U6AH 3THML 3CXDH 5HDOA 5KOVC 1KELL 3AS3A 4IOFD 3GHEH 4M1GH 4JFFB 4J1UA 3I2CL 3PDOB 1FNEB 3QFJD 4OCWL 2AJXH 4MB4A 4MXQD 1MFNA 3Q6GL 1QYGL 2F53A 5F7EL 1E4XI 5C6WH 1KJMB 4OGXL 3U46B 3TF7C 2BOBA 3REWB 1S9XA 5JMRA 2NX5E 4LVNB 3VWJC 1AD0B 4JAMA 1IGTB 1ZS8A 1O5DT 5M94B 3SO3C 4JJ5A 5KSAA 3KPNB 5DRXA 3RUGB 4HJGB 3F12B 5D6CA 3NCMA 2D7MA 3NCFB 5DD6B 3QNYA 3L5JA 2WBKA 4EN3A 5K9JL 4BH8B 4HQQH 1NQBA 2C1OB 1WT5C 5SWZA 1Z9SA 2FR4B 1JF6A 5DQJA 1FYTE 1A21A 4C54A 2J12B 3C6SB 5FYKE 4M43H 2VDOH 2ZCHL 2X1WL 3LD8B 4MCZA 3BHBA 2HJLA 3KWWB 4X9BA 5IM7A 2NY2C 2PN5A 1PX4A 3V6ZB 1BQHA 4HFWA 1I1RA 4IMLB 2P7TA 3KHQA 5BMFH 2NW2A 1S7TA 1P4BH 1IFHH 1R3LA 1MHEA 4N0RA 2JELL 3I6LE 1HQRA 2Q6WA 2X70B 5HHOB 4I3RH 4TSBH 4R4NC 5E8EB 2ZNWA 2YMXH 1MIEH 4UT7H 3OAYH 4KRPB 3MOQA 4MAYB 3HC4L 4LCYA 3O3AA 5DYOB 2C4XA 4YXKL 1KCVH 1T2QH 25C8H 3WIHA 2CXKA 3TBSA 4ZS6C 5CS7A 5B39B 1W8NA 2HVJB 4WHCA 4BFEA 3OKDB 4DGYH 5ENWA 4AEHL 2Z9TA 5FYKU 5J7CC 2A83A 4HK3J 4G6FD 3JVGA 5ADPL 2P45B 3PP4H 4GO6B 1B2WH 1P9MA 2GHWB 4LASH 1A1OB 1XAUA 4HXBH 2NY1D 1VADB 4P23C 3A6CH 3ZT7A 1XR9B 2OI9B 4JZOA 1NCAH 2QL1A 4LKXB 5L2KA 3HG1A 2AI0H 3QHZL 3O3EA 4UDTA 2DQEH 3DXAD 1MCCA 1R3JB 2NY4D 2RB8A 5JUEL 1ZLSH 2EYSB 3MJ6A 5DZOA 3EO1A 4D9LH 5HGGS 2CR3A 2Y1VA 1HEZB 2JIXD 1A14L 4M03A 5ANMB 3TF7A 5FDYA 5B38G 4CNIA 3BO8B 3VWJA 3IAPA 4NSKA 5C0GA 4OLYH 1TXKA 3TCXA 3RVWD 3O6FD 1C12B 2A77H 4WU5B 1RJLB 5ACZA 4NQDA 3QDMA 5EUOA 1L8JA 2BVOB 2L4OA 4JM4L 1VHPA 4M9PA 4RMQA 4KV5E 3UZEA 1NLBL 1H5BB 1A2YB 4YHIB 3NCCB 1HDMB 1JRHL 4LSPL 5A2FA 4PJ5B 1U8HB 4KK5C 1BZ7B 3T4AB 4V1DD 4K71B 2VDRH 3C2AH 4YNYB 1FAKT 2Y5TB 1WGOA 3OPZH 4OF3A 3RL1A 3GMLA 2EDFA 4PJXA 5JIHA 1A0QL 4QOKB 3GJEB 1ONQB 1T7XA 5JA9A 1EA9C 3QULB 4OJFH 5LGKA 4FQQA 1KLGA 2JCCF 5SWSE 4PR5B 4JVWA 5CZXC 5E9DE 4OLVH 5IJKA 3B6SB 4IIQA 2UY7A 3WKMH 3X12A 4A2LA 4QRSA 4N8VB 4KKBC 3HZMA 5MP6L 1HHIB 1X5GA 2AEQL 4ZMAT 4OZGA 3VMOA 4B0MM 3T0VA 1FCGA 5E03A 4KZEL 4TVPD 1WWAX 3VGFA 2XWBA 4W68A 2VIRA 4KKLD 3VFPA 4Y4KD 1RZJH 4OUUB 4P4KA 1NKRA 5C08D 1WBZB 4LP5A 4BZ2L 3O41B 3GKWH 3DPBA 1AGFB 3PIQA 1OQXA 2NNAB 2BNUA 2HJKB 3GSQA 3MV7B 4JFEE 2HLFD 4NNXB 1ZWIB 1T4KB 3PGFL 5T1LB 3ERYA 2NXYD 4LPVA 2B20A 4NQEA 1MH5B 3VGAC 1CXHA 1ZEAL 1HZHH 3TT1H 1KJ2B 3FO2B 1D5BA 4C56D 4Y0GA 2R23A 4U31A 3NPZB 4OLWL 1T1WB 1UM5L 4JHAL 4L9LB 5KSVB 3C6LA 5CGYC 1LO0L 4ZNEA 4JFDD 3GBMH 5CHNB 4P5TC 2P43B 3FB5B 1OGTB 3U48A 4XXDB 2GJZA 4ZUWB 1Y6MR 1IKNA 1E4WH 1N26A 5B8CC 4PRDA 1FFNA 3HAEB 2VDQL 4XPAL 5T5NG 2H2SD 2X4RA 1BQLL 3UMTA 1NGPH 4PJHB 4U1HB 5F3HA 2ZOLB 3N1MC 3QUYA 3TZVA 1T80A