3LN4A

Crystal structure of hla-b*4103 in complex with a 16mer self-peptide derived from heterogeneous nuclear ribonucleoproteins c1/c2
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
274
structure length
274
Chain Sequence
GSHSMRYFHTAMSRPGRGEPRFITVGYVDDTLFVRFDSDATSPRKEPRAPWIEQEGPEYWDRETQISKTNTQTYRESLRNLRGYYNQSEAGSHTLQRMYGCDVGPDGRLLRGHNQYAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAARVAEQDRAYLEGTCVEWLRRYLENGKDTLERADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, B-41 alpha chain
publication title The impact of human leukocyte antigen (HLA) micropolymorphism on ligand specificity within the HLA-B*41 allotypic family
pubmed doi rcsb
source organism Homo sapiens
total genus 79
structure length 274
sequence length 274
ec nomenclature
pdb deposition date 2010-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ln4A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3ln4A01
3T0EE 1SEBA 1ED3B 4OZIE 3V0VA 1YYML 5DJ0A 2P42B 4YC2B 4GG6E 3ETBF 3KNBB 4AM0B 5IHLB 5DUPL 3OAUH 5IW6A 4QHNA 3NCYS 3PV6A 1M7DA 2Q86A 1F13A 4UB0H 5KW9L 1T2JA 4PJBB 2PYFA 2WW8A 1JE6A 5EU3B 5HD8C 4OTXL 1CXHA 3L3OA 4ONFL 3MRMA 5EWIH 4KROC 1JV5B 2AK4E 3OKEB 5IJVA 5LCVH 3MJ9H 3KYKL 1AFVL 5SWQA 3DUHA 1QSED 1GGIH 5ESAB 4FQ1L 4GKNB 3MGOB 2NXYD 1GGBL 4LCUA 5H94B 5IFHL 2GJJA 3BSZL 1U93A 1N5YH 2BX5A 2V2XB 2OZ4A 1DVFA 3C9NB 5FYKE 1OAXL 1R6VA 2YRLA 2FATH 2ZPKH 1N6VA 4QXGL 5FKPA 4YXHL 4FMFA 1NGWB 3RWCB 3CSGA 1G6RH 1QO3A 1BBDL 4JN1H 3CPLB 4KAQL 5E5RB 1WIPA 1GC1H 1WFTA 1T83A 5T1MB 5D7KE 1CN4A 1M05A 1MCJA 4RFNC 5CJQL 3GUTA 4KK9C 4X7TA 3U7YL 2W0LA 3ARDA 5EIQA 1DN2A 1OAUL 5C0GB 3O3BB 3D85A 2K7QA 4P2OC 4UBDD 3ULVC 1ZLWH 3OAYH 4HT1L 5DHYA 2YA0A 4OD1H 2ADGB 5EO0A 3C08H 3HMWL 3P3YA 4L4TD 5MEOB 3BPCA 4OLZL 4JREC 3GMPB 4M93B 4X7EC 3T0DA 3HRPA 4N8VB 3UTSB 2FX9L 2F15A 4RNRA 4H0IA 3QFJB 3SOBH 2BOBA 1B0WA 4HWEL 1NLBH 1YEIH 3T3PF 3OB0K 1QBML 3ULSA 1A7OL 1QR1A 3SDXB 3O8XC 5KVGL 4WEBH 3S3PA 5KSBB 2NTFA 3BP6A 3ZSTA 1U8HB 2CKNA 3DSFH 4L8CB 3L95B 3TH4T 3WNOA 3JTCA 1VACB 5GRVK 1QA9A 3TPKA 1NEZG 3RJDA 3VG9C 5IGXH 4NM4H 3SKMB 5EOCH 3M8OH 1D9KC 1QSZA 2MPAL 2P5WB 1FVEB 3HE6B 5CP7A 5HDOA 2A74B 2YA2A 2R39A 1NJ9B 1N6QH 1J10A 1L4IA 3LVEA 5E8DL 2E7LA 4BFIA 4GBXC 5KSUA 3ZTJH 4FTVA 2JIXD 2UUDH 4N5EA 1GSMA 3N9GH 5FDWA 4JRYA 2OYPA 4I2XA 3QEHA 2HJKB 1ZT7B 1MLBB 4YHLH 3B5GA 3ARGB 1KTDA 3ARFD 2OR7A 3H8NA 2DQUL 3I6LE 4X0KA 4WI7A 4NQDE 4ZFGH 1IJ9A 1HHGB 2QSVA 3PIQB 3QIWD 4GAGL 1NL0L 4O58H 1AHWB 3OJDB 5EU6A 3AC0A 3ME0A 1EZVY 4FS0A 4ODSH 4S11A 1CL7H 1CXIA 3R8QA 3ZKXB 1NC4B 1CICC 3NN8B 4M7ZC 5DMGD 5I1DB 1JGUL 4P59H 1K8IA 3DJ9A 3VD7A 3H9SD 4X9BA 5C6TL 3IKCA 5ID0B 4BA8A 4I77H 3GK8L 3Q6GH 5BW7C 1BFVL 1LMKA 1H0DA 3D18B 5ISZD 4H88H 5JW4M 2X89A 5B22A 2BXYA 2NW2A 3QYCA 3O6MH 4JRXE 3V9FA 4FFWC 1NMCC 5EC1A 5KVFH 4JY4A 5EBWA 2RCSH 5KSAB 2ESVD 3BZ4B 3DO3A 3BPOB 4IS6B 1IM9B 4JJ5B 3D3VE 1C5DB 2ADFH 3MX0A 2VLRD 2E7HA 5JZ7D 4X4XB 5FO7B 1GXEA 3PWUA 1AKJD 5EZIL 5FA4A 2DI9A 1TZIB 4XPTL 4IM8A 3AAZB 3NABH 2GTWA 3BN9C 1SY6A 4U31A 2PXYD 4ZFOA 2FJHB 4OF5A 3KLHC 4HKJB 4O2EA 5C07A 4KV5F 3MRJA 3HS0B 1JTTA 4XX1E 5GZOD 3WXVH 4Q9BA 4S0SD 5HHXL 1YNKH 2DAVA 2DIJA 4G43B 4J12A 4Z7NE 1HSAB 5IROA 3PJSB 3S6CA 3GIZL 4OM0H 3VE0B 1UXWA 2PTTA 5J12C 1CWVA 4NN5C 4JZOB 5I30H 2I26N 3S5LB 3CVIH 5D5MB 4Z0XA 1HQRA 2CIIB 3E2HB 5IBUG 3TNNB 2R2CA 1MCFA 5J11C 1NEZA 3ULVH 5CZVH 4KQ3H 2XY1A 4NSKA 5I66B 1OLLA 5GS1A 4L3ED 1CGSH 4HPOH 2NY6C 1QSEA 1CXLA 4PB9L 2WBKA 2DD8H 4YH6A 1MNUL 4NIKB 1TPXC 1RFDL 4KXZH 2W60B 2BVQB 3NFSL 4J3UA 2Z8VC 5IB3B 3C60D 4D0DA 2W0PA 4I0KA 1I1YA 5IB5B 3HN3A 4O51B 2X70B 4XCCL 4PTTA 4PY8I 1MAML 1QG3A 4PLJD 4M6NL 4KDTC 5IVXF 4EQ2A 4F7EB 4TPRL 1RK1A 3L7FB 5JIKA 5BVJA 1A7QL 4H8WL 3KLSA 4HJGA 3V2AR 4JDTH 3UAJC 2A9NL 1OGAA 3H9HA 2R29L 5EO1B 3BZEA 1CCZA 1E4XH 4AMKL 5JOPE 2HLFD 2AJ3A 5F3HA 1VADB 2H2PD 5GSVA 5MERB 3T8XA 3TA3C 3W39B 1OY3B 3ZTNH 3BWUC 1WT5A 4BZ2L 4G6JH 5C0EB 1BZ7B 3KPNA 2VABA 1OQXA 3T0XA 3TGXA 4NQEE 4M6OL 2XPGB 4UDTB 1R5WA 1X5JA 3RVWD 4PJAA 25C8H 4IOFC 2A0LD 2ATKA 4P2YA 4EJ1C 4JB9H 1P7HL 2MFNA 4U6HA 5C3TA 1YC7A 1NGPL 5GISH 3L5XH 5A2IH 3SBWA 1BQUA 4XC1H 3SDDD 5FM5O 4YZFE 1A8JH 4V3DB 4HPYL 1FCCA 5FM8A 4XCFH 4A6YA 4LCWD 2VLKA 3OXRA 3CFCH 4PRPA 5IK3A 2E7CA 5F6HI 1B0RA 1O5DT 2FJFA 3LIZH 3QQ4B 2NY2D 5D7JD 3G6AA 3OKLA 3SE4A 5JHDB 1N5AA 2NR6C 5ESQB 4U33A 4X6CA 2EH8H 2OP4H 4FG6C 5A2FA 2GAZA 5DMIH 1KTLB 5GRUL 5J57B 2FO4B 4JQVA 4PREB 2E9IA 4PRDB 1S78D 2JIXA 3B9DA 3BHBA 1DN0A 5DQJA 4BSVA 2EEDA 2VZSA 3HFML 3WD5L 1MELA 1JGLH 2ARJA 1AJ7L 4HH9A 4AG4H 3AREA 1F5WA 1RVFH 4R8WH 4R90L 1QLRA 3P77A 4LRIC 2DMCA 3FOLA 5F7DA 3WSQL 4DVBB 3I2CH 3QQ3A 3TCXA 2J1KA 3P11H 3MA9L 5DQDL 5FB8A 1YN7A 2FX7L 3QXAA 3UDWA 1RU9L 3QIWA 1RIHH 5FYLD 4JO3L 3NACL 4Y5VB 3IFLL 4ETQB 1FRGL 4GRWE 5JPMA 2GUOB 3C2SA 5CJ5A 3X3FL 3S37L 5ANMB 4N0UE 5JW4R 5GGVY 4MA3B 4MNQB 1KYOJ 4LQFL 1O7SA 2XQYK 4U1IA 4QXWA 2HTKD 3H9SA 5D72H 1ND0A 2B39A 5C08D 3SGEH 1SY6L 4YHKL 5TQ0H 3ROLA 4LVOC 4JE4B 2ESVA 3PGFL 2BDNL 3LS4L 3C8DA 4U6YB 4DVRH 5B38G 5DGRA 5K59F 2R56L 5C0DA 5FHAH 4BZYA 4IMLB 2VLRA 3WE6A 4G5ZL 4X5XA 1CIUA 3GJFA 1AKJA 3I6KA 3MRKB 5LG1A 5E24E 2I27N 2D0HA 3GI8H 1DBAL 3NOIA 2PXYA 4QGTA 4DGIH 4I4WB 1EK3A 2BNQD 1XCQB 4XPGH 1YYLL 2X9XA 2APFA 3RVTC 3MRDB 4UT6L 5DFVC 4D0CA 3QI9D 4HUMB 2DQDL 2WINA 3D69B 3NFPB 5DJXA 2NY3B 4G8IB 5HGBB 3SGKA 1I7UB 1TNMA 4U6VH 2E3VA 3OAZH 3TYGL 3E3QC 5SX5H 4EDXB 2HKHH 4JFQA 4OCWL 2JE8A 3BP4A 2Y5EA 4XNZB 5TQ2L 1ZANL 2IAMD 4DW2H 4J1UB 4Z7VB 2DQIL 1HHIA 2B0SL 1A6TB 1FO0A 5D2NB 4Q6IB 5ACZB 3EOAB 1A1OA 1RJLA 4CADB 1BWMA 3QFDB 1T2QL 3FB5B 5SWSD 3BGMB 1ZLUK 3UBXA 1R3HA 1J8HE 4TTGA 3TC9A 1JK8A 1I8LC 2OSLA 4OD3L 5TE6H 3SDAD 3DRQB 3IVKA 3HPJB 5EA0H 1XGPA 2MJWA 5EFIB 2FHFA 2JELH 4HAFA 4UNVA 1QLEL 4KMQA 4NN6C 4MS8C 4Y5YB 3IXTA 3B83A 4WV1A 1VGKB 3I6GA 3MLTA 4NRZA 5L7XH 4GMSL 5GJSH 3BEVA 3PWLB 4HFWB 2HLAA 3W2DH 4FA8A 4EDWH 2UZIH 5C0CA 3CLEH 2NY4C 5HTSA 1FORL 2UY6A 4DCQA 3B2UC 2WM0A 1RUKL 5JW3L 1U8NA 4L3CB 3QJFB 2EDRA 3G04B 4NO5A 3UJJH 1AGCB 3B9KD 4UQ2B 3MA7B 1JHKH 1KENH 2V2WB 3MOAL 3U6RB 1KBGL 2Y07H 1JGEA 3P73B 4YDLB 1OCWH 4JFDD 2X7LA 4TSBH 3S88H 4JFHD 2DIBA 3MJGX 1F58H 4PBWD 3ZMRA 4L29B 2BY3A 2ZG3A 3ZDXE 3OKYA 4IRSD 2Q8BL 1ZLVK 4P4KB 3NTCH 4JHWL 2XN9E 1ZE3C 5JMRA 1G7IA 1CGVA 1J05B 4NWUH 1AE6H 3BP7A 1L0YA 2HWZL 1JPFB 5D7JA 4CKVX 5IHZB 2E9JA 4WJ5A 1PG7X 2UYLA 4IDJH 3MRIB 3MV9D 2EYRA 3JVGC 4GOSA 4R9HA 2FBJL 5AYQA 1QKZH 4I3SH 4CN4A 1QRKA 1T66C 3BUYB 5I1JL 5IUSA 4M61A 4LPCA 1IGMH 2Q3AA 2F8XC 2VZ3A 4O2CB 3KGRA 4ZAKD 4W6XB 1G84A 5JR1L 1WAAF 1U8IB 5DUBB 4I0PB 4KQ4L 4BK5A 5L9DH 2QR0A 4FXKB 4NUJB 3RIAF 1UWXH 4C4KT 3NVQA 1JFMA 1QOKA 4G8EA 5B8CC 3EBAA 3TIDA 8CGTA 4NOBA 4QRPE 4JPWH 4AEHL 32C2A 5LQBL 1MFEL 5HDBF 2DQTH 5JMOC 2XNAB 4GSDH 1NCWL 5HYJD 3ES6A 3SKNA 5ITFA 1EGJL 3HE7B 3LRSA 1OW0C 1KFAL 3NZHL 4QCIB 1SYSB 2ITCB 2ZUYA 3KYMA 2AEIT 4KY1H 1QQDA 4U1GC 5IOPB 2VDNH 3BKYH 3D25A 4M43L 3EZJB 4QT5B 4JQXC 2RGSA 1EBAA 4N0CD 2D7TH 2YA1A 3DECA 4MQ7A 2G75B 5A16B 3VFSA 4F7MA 1LEIA 3ECBA 4OSUH 1EZVX 3X12B 4U3XA 3EYFA 3I75A 4TUKH 4X4YB 3C8KA 4HIHA 3HI5H 2LABA 1DBMH 1XF2B 5D7IE 3ZL4L 2BMKB 4N8VG 3M17A 1K85A 3GRWL 4HUVA 2DLFH 1B4JH 3AXLB 1RI8A 3PWJA 4PGDB 1ORQB 2BNQA 3ARXA 5EPMA 2BVTA 3KWWA 4RA0C 3P4MB 3MNWB 4GAJH 4O00A 5E2WL 5F88B 4P5KA 3S4SB 4NNXA 2X4QA 3UP1A 1AGEB 2FB4H 3VXUD 3IDYB 4E5XB 4NM8L 3X14A 3QUXD 1FZKB 2NMSA 3U0WL 2QQLL 3QCTL 2CR3A 4OLXH 2V17H 3LD8B 3REWB 4OCRL 3T2QA 1DQLH 4LVEA 4XAKD 2AXJA 3SKUD 1AXSA 3KPSE 4RMWA 3VXSD 4MJ6B 2PKDA 1X5HA 4HG4K 2XQBL 4GRLC 2IAMA 3RUGF 2VH5L 1VESA 1TVBA 1CGWA 1Q0XL 3NAAH 2VLLB 1A0QH 2HT2C 5JUEL 1HXMA 3KG5A 3ERYA 3AS3A 5DD5L 1U2CA 4EUPH 4FZEL 4C56B 4MQXC 4AIZB 5HD8D 4PJBA 3FONB 1MI5D 3UO1H 4KROD 4PJDA 4WI9A 5DJCA 1KV3A 4TNWK 5SWSA 4DQOL 5DRWB 4JDVA 5F1SA 4XCYB 1BLNB 3K1DA 3MOBL 3JSSA 1JUFB 3DOSA 4KPHL 1I1AA 1YMMD 4KRMB 5I8EB 4EI5A 4TUJA 3S96B 2IANE 5KS9A 4PJIF 4HK3N 5E5MB 1S9WB 4GKNA 3A67H 3KPPB 2AJXL 3G6JB 4WUKL 4NCDA 2EXWC 3EO0B 3BWAA 1UKSA 2GJ6B 2EXYC 4R96B 1WF5A 3OR6B 4N8CH 1A4JB 5BJTB 1S9XB 1E27A 1LNUB 1IAKA 5DRNB 5FUZH 5HYEA 4N0FA 4PFEA 4UIMA 3OKOA 1IKFL 2D9CA 3H6JA 3QUKA 3N85L 3X11A 1TETH 1ADQL 1IAIM 4NC1C 4XPHL 1NC2B 4TOYH 2AV7B 2ICEB 5ETUA 2C3VB 4KK9D 4FFVC 3P0VL 4YQXL 5CLWA 1ZA6B 2EDQA 3QXWA 4QRSB 5FUOH 1GHFL 5HHMD 2ZSVB 5F8RC 3RIFF 2HG5B 1KJ3H 4OB5L 4P2OD 3ULVD 3GHEL 5EH1A 1PLGH 1PQZB 2DM3A 2LV4A 2VUOA 4PJ8C 4F3FA 5DZLA 3MBEB 5T5NF 5IEKB 1UH2A 1SEQL 3MRLA 4D0BA 3LEXA 4LEXL 1BVKA 4PRIE 5I8KL 3RL1A 2R15A 2R4RH 4LFHD 5E8PB 3GBNL 3C5SA 2H2SC 4PJEE 3TM6A 4W81A 2Z8WC 4LSRL 4LCCB 3ILQD 1JTPA 3D87B 1KB5B 3T0EB 5BMFL 3QIBB 1WCBA 3WL9B 1CK0L 4N8VA 3UTSA 3RWJA 3TNMA 1S7SB 1ZHNB 5I76B 2Y4SA 1YEHH 4GG6B 4F15B 3QFJA 5FV2A 3V95A 3TBWB 1IBGH 3VWKA 1S9YA 3O8XD 2ZUQC 4NQVA 4P57B 5GGUA 1FV1A 3TF7C 4X99B 3VFUA 4LPWA 3SDXA 3NCBB 4JKPL 1C16A 3OSKA 1NAMH 4E0RA 2JJVA 5BOZG 1AI1H 4ZAKA 2X4UB 4KUCD 3FOMA 1H15A 2IH3B 3OKMA 4OQTH 5FYLL 4WU5B 3V6OA 5F7EH 5HHVL 1D9KD 1V05A 1FSKB 1IE5A 3RWDA 5KS9F 2IFGA 1XT5A 3O0RL 5GRWA 1U8KB 1FVEA 4JFOB 3IDNA 3O6FB 3RZCB 4N1CA 1YEGL 3IAQA 3UTZB 4AL8H 5JXAH 1NBVH 5MEPB 1HIML 4BSWA 3MACH 3M45A 1WIUA 4LGSB 1G9MC 4GBXD 2YZ1A 4M9PA 1C5CH 3D9AL 4F7TB 3BUTA 2RHEA 3MRHA 3FFDB 4JM4L 3RDTC 2DI8A 3DUSB 4WO4C 3MYJB 4XVSH 1MRFH 3PGCB 3LKSB 4I9WD 4KTDL 4CW1B 4KKNA 3F7YB 5B39B 1TZGL 2GCYA 1MCCA 1J1OH 1K4CA 3M07A 4MA8H 3WFBL 3BE1H 5BO1H 2NW3B 3O81A 1R0AL 2QSCH 3FFCD 4JZJB 5F9WB 1MWAA 4P2RB 2CMRL 2ADJA 3MRNB 3QUMB 4X4ZA 3LKQB 4JLRA 3ZYZA 2GI7A 5DO2C 4XTRC 3SE9L 1AHWA 5EUOF 1CICD 5GRJL 3GDBA 2AXHA 2XYCA 1NC4A 3GMLB 4FQXB 1FVCB 1OSZA 2HN7A 1VGEL 3F7RA 1WEJL 4MDIB 5I1DA 4ESKA 4ZUVB 1XGQA 5ID0A 1ZHLB 5IBTL 2N7AA 3HR5A 4FFWD 1EVTC 2M8XA 3OQ3B 4PB0L 2B8OT 4WUUD 1NFIA 1Q1JH 4QHKI 3AS0A 1LD9B 2JB5L 2OJZH 3IS0X 1OAZH 4ZSOA 4LKCA 4MJID 4FQHA 3KHOA 4M93C 5EZOH 3T0BA 2DRUA 1AY1L 1N8ZB 2A6KB 1C5DA 5IEHA 1TJHL 3QUXA 3QHZL 4P46B 3BN9D 4FRWA 5MEQB 1WZMA 1T0PB 2OL3B 3KLHD 3AAZA 5INCA 1F6AB 4YHYB 1ZGLB 4NHCH 5J1AB 3V4PH 1P5UA 4HKJA 4QWWC 2HFGL 2E27L 5DI8A 3QRGH 5JO5B 3LH2L 3DO7B 1MFAH 3GI9H 4XMLH 5I1EH 3KXFD 2HTLC 4YGVB 3MRFA 3RWEB 3VXME 3NCCB 4EN3C 3HE6C 1FC2D 1XZ0B 2ENSA 2Z9TA 4DUWA 3OAUL 3F7PC 2NY6D 3DBXB 4L8BB 4M03A 3LZFL 3MGTB 1NFDA 4BFGA 4UB0L 1R3LB 2BC4A 1UKTA 3OR7B 2W60A 1NPUA 4FMKA 1JWUA 1I7RB 5IB3A 4ERSH 2Z93A 4X6DF 2IPUG 5LCVL 3MJ9L 5A1AA 4NQXA 3AGVA 5CUSH 2JJWA 3RGVB 5FUCE 1AD9A 2YSSA 1H8OA 1GGIL 4AT6B 4JPVH 4MDJB 2XZAH 4PJHA 4GAYA 1GH7A 2DN7A 3UAJD 4ZFZB 5EN2A 4F7EA 2IG2H 4K07A 1VPOH 1Q72H 4NQTA 3U4AA 3NGBB 1PYWB 1MHCB 3CCHA 2MMXA 3GJEB 1N5YL 4JRXB 3VRIB 3BYTA 1NCAH 3TA3D 2DLHA 5F9OH 3MJ7B 1GOFA 1T7YA 1VFAA 4UV7H 1YC8A 4CU6A 3ZKXC 2FATL 5MERA 4RGNE 4WFHE 5F1IA 4HS6A 3QG6B 4JN1L 1G6RL 2ZP0T 3BD5A 3D3VB 5C0EA 3Q6FA 3L3GA 2WWKO 2ZOKA 4PJGA 1GC1L 1G9MH 4UTBH 2EO1A 4EVNB 4IOFD 4QOKE 1QEWA 2P8MB 2DDQL 4I48B 5TPWH 1MY7A 4MMXC 3QUZC 4L9LA 1JN6B 2YBRB 4Q9QH 5KSAC 2MHAA 5FCUH 4K3JH 1DEDA 5FGSA 4OD1L 3Q3GB 4OCYH 2IWGA 4NKMA 6FABH 5DXWA 3VFOA 1AXTH 5GGSB 1U8PA 2AEWA 1A7RH 4Z78A 4LMQI 1T1XB 1AO7A 1MLCA 2G60H 1FYTE 3CSYB 1TMCA 3MR9A 3L5HA 2YHGA 4YHPB 1HEZB 1MCBA 3IDMB 4DOHE 4FQQA 5IVOA 1NLBL 1YEIL 4HWNA 1XFPA 1FFPB 2VITB 4F9LC 2IGFH 4FG6D 1MJUL 3BEWA 4WFED 4WEBL 5T5FH 4Y2DA 3DSFL 1JL8A 2LVCA 1IGJA 1U58A 3FN0H 3V8CA 4BZ1H 3QNZA 4PGEB 4RGOH 2DBLH 4MA1C 5IGXL 4U1HB 4P3DA 2WBWB 5EOCL 1QBLH 4LLYA 3IS1X 3WHE1 1HYRC 3EJYC 1N6QL 1T22A 1J0JA 3PG2A 4B41A 2YD6A 5DEGB 2DQFA 3E1F1 1EO8H 4P5MA 1Y18B 5AYUH 3FFCA 4EI6A 3PABB 1K3IA 2HFFB 3ULVF 3GSRA 3N9GL 2IADB 5DRXA 4DVBA 1K4DA 4JM2B 3Q2CA 5E1HB 5E4IA 1I85C 3FQNB 1VSCA 4K3GA 2JCCA 2P8PA 3PL6A 3IGAA 1HZHH 4NQEB 4YHLL 4ETQA 4X7FC 2Q7YA 2YKLH 2GSGB 3DMMA 3TCLA 3P4LA 5ANMA 1KGCD 2FGWH 3Q0HA 4OZFB 1WFOA 5DS8B 1A47A 1HHHB 4ZFGL 3JV0A 1MCEA 4ZPVB 3VXRD 4O58L 1IT9H 1TCRA 4E42B 4LVNB 5CEYA 3FT2A 4ODSL 1JPTH 4U6TA 2ZCHH 4WUUA 1CL7L 4QRRD 1DUYB 2HVJA 1R5IA 3PHQA 5HYQA 3QDGA 2D0GA 4P59L 4M7LL 4GS7B 2VLJD 4RQQA 3FT4B 3I84A 2JLLA 4AEEA 4KUCF 1JNHB 4GW4A 2Y9RT 4I77L 3Q6GL 5IG7A 1A7NL 1QSVA 3TJEH 3REVB 1W72B 3O6ML 4CVUA 4RMRA 4HDIB 3MRCB 1QBBA 3MRKA 5J3HC 5D93B 4QRUA 5DD1L 5E7BA 4XPFH 4NO2B 3F12B 1TITA 3I3EA 3VWJB 4I4WA 5DFVD 3T3PE 4Z7OF 2AAVA 2DMBA 2NX5D 5DF0A 2IBZY 2ADFL 1RZIA 1N2RB 4I18B 4GT7A 2P49B 3WN5B 3IFPA 1OAKH 4YAQB 3WFEL 1HSBA 1FNGB 4HWUA 4Y19E 4G8IA 5IT2H 3NABL 5I2IB 5LKNA 5CJXA 1OAQH 3PGDA 4JANA 4PS4H 5HVGB 5J13B 3ARBA 1EX0A 1CBVH 2CDEB 1CQYA 4NZUL 1YNKL 3VCLA 3SJVD 4R3SA 1E28A 1RJZB 4J1UA 1A5FH 4OM0L 2PR4H 1A6TA 4Z5RB 5BV7B 3V6FA 3TT3H 2ZWLT 3MRGA 5I30L 3CVIL 1T6VN 4Q6IA 1S7VA 2PW2A 2V7HA 3AB0B 1LO5B 3ULVL 5CZVL 4G59A 2XZCH 4HS3B 4KQ3L 4ZS6C 3HC0B 1SJHB 4N0UB 4Z6AT 1CGSL 4HPOL 5DJAB 5KN5B 5BS0D 1NGXA 3DVNB 5ELIA 3DRQA 4LCYA 3BPLC 4YBQC 3ET9F 4MS8D 3U0TB 1S7UA 4ZUWB 1WBYA 3NCYP 3IDJB 4IOIB 1IGYB 2ZKHH 3SCMB 4YDKH 3ARZA 5F6IC 1HNGA 3RPIB 1QFHA 4H25B 5I6XC 5HI3C 2NY4D 4HFWA 1MIML 3B2UD 1C08A 4NDMB 4JDTL 4LDEB 4GRMB 4Y1AB 1P4BH 3MLPA 1NGZB 3EJZC 4W6YB 2E6JA 5DEFA 1LE5A 3MJ6A 1E4XL 3O4LE 4ELMA 1X5FA 3AROA 4R7NB 4UQ2A 2CR6A 4ISVA 3MA7A 3ZTNL 4HHAA 1BIIB 3IRPX 4MMZC 4G6JL 3QIUC 4FZ8H 4XBGA 1CD1B 3FB6A 3BH9B 3S4SG 3DURA 3F6IA 1CU4H 1NUGA 4H0HB 5CEZH 5A2LH 4PV9A 4L8SB 2R1XB 3MUJA 25C8L 1J1XH 2QADB 2Y7QB 2X1OA 1ZMYA 1T0NB 2VJXA 3T0WA 1J05A 5GISL 3C6LA 1KJVB 5MENE 3L5XL 4UV4H 1JPFA 3MLSH 4C54A 4XC1L 5EZLB 3W9EB 1T66D 2QQQA 5CILH 4KV5E 4MWFA 1T1YB 3WDHA 4FTVE 3HCVA 3BUYA 1NMBH 3FRUA 3CFCL 2VLMD 2W0KA 4LSSH 2VKWA 4O2CA 2D0FA 4I2XE 3HZVA 4YIQA 3WFHA 1J8HB 1U8IA 1T89A 4U1NB 1KPVB 2EH8L 2OP4L 2FH8A 1ZHBA 4FXKA 4RAVA 2YRZA 3D39A 5C0BA 5DMIL 5L88L 4LRIA 1A9EA 1IL1B 2IQAB 3OXSA 1NMAH 4XMKH 4P9HH 2GK0A 5D2NC 4I3RH 3NCEB 3OGCB 4JEGB 2KBGA 4G9DB 3N0PB 5EU6E 1KJ2B 5J1SC 2J2ZA 2VN4A 3BXNB 3CD4A 4OGYL 2L4OA 3G5ZB 3HE7A 3HRZA 1CE6B 4UDUA 2VR4A 3SKJH 4AG4L 3DX7B 3L3DB 1DLHA 1RVFL 4R8WL 3O11A 3FQUA 1I9IH 1JWMA 2ITCA 5IVXE 3D0VB 4IBLT 5DK2B 5C0FA 4TRPL 1T1ZA 1T20B 3P11L 3S36X 4X83A 4PUBH 2AV1B 4YWGH 2HAZA 1RIHL 4ZO9A 4NC0B 4X98A 3P30H 1AGFB 1F6FB 4LHUD 4PV8A 3O45B 3ZHDA 4QRRA 4G80A 3ARPA 2D7QA 5F7KC 1WFNA 4NKIH 3GB7A 4IHOB 5AD0B 5FF6A 3CMOH 1D5BB 4H5SB 2XN9B 4KC3B 5D72L 3WCYA 4D9RD 4X4YA 3CMGA 2CGRH 3PWPA 3UYPA 1BEYL 1X4ZA 4RDQF 2ZSWA 5ERWB 2BHZA 2ED8A 2BMKA 5TQ0L 2MTPA 1WLHA 5C07E 2EKSB 4PD4J 2BOCA 2EO9A 3WIFA 1FAKT 4G42B 1MCPH 4DVRL 1TCMA 5FHAL 4TSCH 1U9KA 3MREA 4P4KC 4TN9A 1EO7A 3G08B 3MO1B 3TH3T 1QHPA 3O9WC 4E5XA 1U6AH 4EKXA 1XH3B 4K7PH 1FZKA 4JFXA 1CS6A 5EO9B 1GZPA 5BZWB 3E3QA 1CL7I 2CQVA 4DGIL 2C7UA 1F02I 1QSEE 4JFFB 1A1NB 2R23B 1PBYA 3KPOB 5D1QB 4GRLD 4P23B 5D2LA 2ZOLB 2HT2D 3NFNA 4OUOA 5IJKC 4YEEA 3VFMA 5BRZD 3ABZA 4MQXD 5CHNA 1A2YA 1YPZB 2I25N 2H41A 1G0XA 1ZK9A 2HKHL 4AIZA 2AJZB 3FTGA 3FONA 1YNLL 4QY8B 3VFVB 5ACLA 5B39G 3X13B 4CJ0A 4XCYA 3SEPA 5BS0A 4ORGA 1JUFA 1P4LB 1OGAE 3GSXA 2J5LB 2Z92B 5D8JH 4LPXA 3WFCL 4OZGF 3S96A 2R0KH 1N64H 1KCRH 1KNOA 1M7IB 2EXWD 5DJ8A 3KPPA 5JNYA 2EXYD 5FGRA 5GZNC 5TE6L 3LN5A 2XICA 5EA0L 4L4TE 3QO1B 3IF1B 5F97E 5E6YA 2JELL 5LJYH 3RTQC 5D7IB 3RY6C 1XCTA 4KDVA 2DKSA 4FFVD 4P99A 5DK0A 1RD6A 1A14H 1FL3B 5L7XL 1QNZH 3MRQB 4QRSA 3SGJA 3LPGA 2GKIA 4PJ8D 4EDWL 4PIRF 2UZIL 1DJSA 3DIFA 4KXZI 1G7PA 5FAAA 1EDQA 5GGQH 1F3RB 2VLKE 4R0LB 3Q48A 1EIBA 1J11A 4OKVA 4WY7H 2V9QA 5K59E 2H2SD 3UJJL 3RQ3A 3OPZL 1YMHB 5EC2B 5CJOH 1KENL 3AUVA 3AY4C 5I19H 5CIPB 4IIQC 4G7YH 2Y07L 5H37G 2OTUB 4PRHD 4X6CE 3KPSB 4M4RA 2R2HA 4PR5B 3LPFA 1OCWL 3DX9A 5EU7E 4OZIA 2O26U 4P2QD 3JVGA 4TSBL 5IVZB 3S88L 1S7SA 3T1WA 3MLUH 3P0GB 1F58L 2H8PB 3NIFF 4LSPH 3GSOB 1UCBH 3N1QC 3FJTA 4Q58C 1X7QA 1YY8A 3NTCL 4WWKA 4I5BA 1E4XI 2JK5A 4KK5C 4MD0B 4Q97A 4NWUL 4CJ1A 1FGVH 4WW2B 3ALPA 2O61B 3EYQC 2QQNH 1ACZA 2AK4A 2FHBA 4IDJL 2EH7L 5HI4C 1QKZL 3EDJA 4I3SL 3O4OB 3LEYH 4YNYA 4ONHB 2IANB 1IGML 4XNMA 4BKLB 2N7BA 2I9TA 1U8KA 4OUUA 1CFVH 1OD7A 3FQTB 4TVPH 2CLVA 4EIZC 3QEUA 1FIGH 3IDIA 5L9DL 3RDTD 1RUQH 4WO4D 4NP4H 1U3ZA 2F53A 1MCDA 5GGSY 5ILTH 4JPWL 3H9SE 4HUUB 1KIRA 3WNLA 3F6LA 3SE8H 4LSQH 2DQTL 5ISZE 1KCVH 4GSDL 1J0KA 4UUJB 5K9OB 4QF1A 2UWEB 1JWSB 4X6EB 3PP3K 3PQYD 5DO2D 4XTRD 3OKNA 4LHUA 3MRBA 2G5BA 2ESVE 1XIWC 2Y6SC 2VAAB 5IWLC 4Y5XB 1OB1B 1ZT4B 4KY1L 4U3HA 2VLRE 4M6MH 4M1DH 3BKYL 5I8CB 3DGGB 3W9DA 3GMLA 2J6EA 1BQHG 2D7TL 3V6BR 1T4KA 3QEGH 3H42H 4KJQC 4OSUL 3JUZA 4XX1G 5KANG 3W82A 2H6PA 4TUKL 3MBEC 3LOWA 5DURB 1XF4A 3HI5L 5IESH 3K1KC 1B6DA 2CUMA 3EFFB 4LCCC 2PO6B 5J9PB 5GGRY 3N1FC 3QIBC 3TO2A 1E4KA 4DKFL 1EJ6A 2DLFL 1B4JL 4Q6YA 1RJYA 3FHAA 2J8HA 3VRJB 1N59B 4GAJL 3JUYA 4QWWD 4HUWA 5K9JL 1OGTA 4PY8J 2CKBA 2FWOB 1A6UL 2B7DT 2CXGA 5IIEA 2FB4L 2IBZX 2XQYG 3DX6B 5I9QB 5D1ZB 3IJHB 3SGEI 1HOCA 2QKIB 2HTLD 5T1KB 3STZA 4OLXL 2V17L 5BRZA 1DQLL 4LPYA 5IHUH 4X8JA 3CUPB 2P5WD 4PRBA 3WIIH 2H3NA 3OKKB 3HE6D 4EN3D 2YD9A 3V5HB 2IQ9H 4F80A 3CFEA 3ILPA 3TEUA 2Z8RA 1NDGB 3CVHB 3WIHH 3NAAL 1A0QL 1WBZA 3GSQA 3H2WA 4Y4KC 3B9EA 3ORJA 1ZLSH 4CDGC 1P84J 4NQDA 3UO1L 4LBEA 3GBMH 3OR7A 1U92A 2UY7A 4YBHA 1TJIH 4U0RB 4Y16B 4ODTH 2A1WH 3P0YH 2DICA 3L3HB 4FFYH 2ARWA 4P9MH 3WS3B 4QYOB 1A9BB 4F33A 4I8DA 4QO1A 1SBSH 4K2UH 3A67L 2Y5TA 4ODXA 2R2BA 4JO1H 3VFWA 3BVNB 1F3DJ 4N8CL 3GJEA 5F6HJ 2Y1VA 4JRXA 5F21B 1BOYA 1EEZB 4BH7B 5I71B 4WCYH 3AMLA 3MJ7A 4PJ8A 5GRZA 3T4YA 1NEUA 2YN5A 4FQXC 2BNUB 3UZVB 4LCWE 1JMXA 5GGTA 5EOQL 1YZZA 1TETL 3D3VA 4LMQE 4TOYL 3BIAX 3OJMB 3QDMD 4ZDHA 2XWJB 2Z91A 2P5EB 3V0AC 4EVNA 5FUOL 1BQHA 1H3GA 4LK4A 1YQVH 3QUZD 4PRHA 4LAQL 1RZ8B 1KJ3L 1MCKA 2NY1C 2OI9C 5KSAD 4YK4B 1UVQB 4HF5H 1DP0A 1P4IH 2I07B 3H0TA 4P2QA 3ULUC 1IM9D 4F8QA 3TF7A 3GJFK 3S35H 1AXIB 1KSRA 3RX7A 2DWEB 2R4RL 3TPUA 5CP3H 3TZVB 3TN0B 4GKZB 5GGSA 4K3EL 5JA9A 5SV4A 2DM4A 4P46C 3VXMB 3ARRA 1T5XB 1AGBA 3WS6C 3VJ6A 4XP5L 3MFGB 1RHFA 4N9OB 1YEHL 4YHPA 2JTDA 4RAUB 1FJ1B 3EYVA 1I8KB 4MSWA 3DHJA 5GS2D 5F3BA 5H35B 43CAB 1YNTB 5HHNB 1J87A 3ZE2F 1NAML 3RUGE 1KG0B 2JKXA 35C8H 1AI1L 2PW1A 1OAYH 4U7KA 3HAEB 2XV6B 1IEAA 5FYLE 4PGEA 1A6AB 4JVWA 5F7EL 5LAXA 1XGRA 4HW6A 4J8RA 7CGTA 4MB5A 4Q9CA 3EJYD 3IAGC 1VFBB 2NY0B 5JXAL 4AL8L 4ZNCD 5CEZD 4PJFA 3MACL 3U7WH 3L3KB 5C08E 1TJGH 1FFRA 1KB5H 4NKOA 5LWYH 4PJIE 2FRGP 5IMMB 4TSAH 3PQYA 1SJEB 2ZUXA 5DC9B 4HMCA 3RIAK 4XVSL 4L8DB 1MJ8H 4RGNB 3FQNA 5IV2A 4HJ0D 2GFBA 5HGAA 3CLFL 5GGRA 3L3IB 3IU4H 1J1OL 3TVMC 1D6EA 5BO1L 2GSGA 5EIIB 2QSCL 4QOKB 1KN2H 4QGYA 4KTEL 3UPRA 3VGAC 1HI6B 4CVWA 4FOMA 4HXBH 1ZVSB 5HHOA 2BNQE 2YUVA 4EOWH 2X1QA 4MVBC 5FOBA 4GLRH 1DQJB 4LLWA 4HK3J 4BQBA 5BVPH 3GNMH 1DUYA 3ZO0A 1U3HC 3R06A 1JP5A 4F7PB 3KR3H 4HLZH 4LSTH 5CSZB 4KHTL 2LU7A 4RIRB 1FYTB 3MODH 5EZJB 4PY7A 1U95B 3OG6B 5EORH 1GGYA 3KJ6H 1FVDA 1W72A 1Q1JL 3QB7C 4XI5C 3GSVA 4MJ5A 1F8TH 1Z9MA 2OJZL 1V3MA 1P7QD 3GMOA 4UNUA 1HQ4A 5EZOL 3VXTB 1M4KA 4O2FA 1YEDB 3IT8D 1M71B 1KELH 4HFUH 3QUMH 4JVPA 4A2MA 3P9LA 2X4OA 3RY5A 5IR1B 4BSJA 4RMTA 3WHXB 5SWSE 1EUTA 3EYOB 1FNGA 5JHDD 5AUMB 3QH3B 4HUNB 3ZKNC 4EN3A 4LHQB 5DRZB 4YBLC 1RMFH 4NHCL 4F9PA 1D7FA 3V4PL 3MNZB 1XR8B 5KS9E 4Z8FH 3HC4H 4NO0A 2CDEA 4X6FB 1MFAL 1UJTA 3GI9L 3OBAA 3PWNA 5I1EL 1W0VA 5C0NC 2A6DA 1XF5B 3CDGB 3RWHB 5E6IC 5TDNB 4NPYB 1U8JA 2PUQT 4ZS6D 5CBAA 3EDDA 3ULUH 4JO2H 3CU7A 3KDMB 3F5WB 1UQSA 5F9JA 3CXHK 2G9HA 1YN6A 1F4XH 1HINL 5KN5A 2Z0BA 4YBQD 4DZBA 3DVNA 2EYSA 2C1PB 4WEMB 3O3DB 3CZFA 4N9GA 2OL3H 4ERSL 4JFDE 3IDJA 1FE8L 5CUSL 3FT3B 4JFHE 3JV6B 3WYRA 1E6OH 1F90H 4MD5A 4Z7QF 2JB6B 5HI3D 4JKKA 4OFDA 3BQUC 1S7RA 1Q8MA 2CLZB 3GGWB 5EUOE 2XZAL 4Z18A 2DLIA 4PJXA 2IG2L 3O3UN 1VPOL 3EJZD 2P24A 3HUJF 5LGKA 1JYWA 1SEBB 4LVNC 5DJ0B 3ZT6A 1NCAL 4XT1C 1PX4A 3RWGA 4GW5B 4OFYA 4RWHA 2OR9L 5F9OL 5KSBF 1FH5H 4UV7L 3MV9E 2O5XH 4QHNB 5IW6B 3V52H 3PV6B 3QIUD 5FK9A 2Q86B 1FN4A 4L4VD 4GS7C 2CRMA 1UXSA 2PYFB 5J89A 5E0QA 5DD3H 2EZ0C 3BH9A 5IB1A 5JXEA 1G9ML 2B1AH 2DQCH 2MQCA 3DI3B 4H0GA 4UTBL 5IFAH 4XP4H 2ZUSA 3MRMB 4BQCA 4Y19B 4L8SA 4FQJH 5TPWL 5IJVB 2FDBP 3UCRA 5SWQB 4HEPG 3MUZ1 4OM1H 1T80A 2VXSH 5SWZD 4Q9QL 3RIFK 5FCUL 4K3JL 4F9LA 6FABL 4OCYL 3VWJC 1UZ8A 4IJ3B 4PRAA 3ARSA 4LCUB 3U83A 1AXTL 1AIFA 4ODVH 4I18C 5EZLA 1A7RL 3WN5C 1U93B 3V4UH 5HYJE 4XXCC 2G60L 3BO8A 1PKQE 3FMGL 1DVFB 1T7VA 1JHLH 4NJAH 2FJGA 5FKPB 5FGBA 1QO3B 1KXTB 5J13C 4JZNA 2LU3A 1YDPA 2IGFL 1J8HA 3CZJA 1J0IA 3MC0A 4U1NA 5T5FL 5GS0C 3GUTB 4KGLA 3QA3B 3G6DH 4LLUA 4X7TB 3FN0L 3ARDB 3HHRB 5BV7C 4CMMA 4RGOL 2DBLL 5D9SA 3D85B 2Q8AH 3OGCA 3UTPD 1XF1A 1I85A 5DHYB 3TYFA 3MUHL 1A22B 4PJ9A 3VFRA 5EO0B 1QBLL 4WFFD 4PJXF 3BPCB 3BXNA 4XBPB 4YDVA 2Y06L 3ROOA 3H7BA 1JYXA 4XWOC 1MRDH 3BRGC 5F9AC 5E56A 5AYUL 2RAMA 2R4SH 3O4LB 2BOBB 4JKLA 4F37F 2JJSC 1DFBH 3ULSB 3SCMC 1QR1B 4AENA 3MXWH 3WLWC 1GYAA 4LU5H 1JNNH 1HZHL 2NTFB 3LSOB 2AK1H 1CT8B 1QYGH 4NZJA 3O45A 2YKLL 1QA9B 3VXUE 4MAYB 4UOW0 1G9EA 3D5OF 12E8H 4HV8B 2BVYA 1TDQA 1CDHA 1N4XH 3UTOA 3HZYA 4TVPD 4H5SA 2XN9A 4XAKE 2HMIC 1IT9L 4PDCE 3N06B 5CP7B 4JGJA 3ARYA 5MENB 4X80H 2UZXB 3VXSE 1JPTL 4WHDA 1HH9A 2ZCHL 4R26H 4M00A 4UMGA 1KLGA 3QXUA 5DJYA 2NNAA 3IB4A 1DQQB 2BNRD 4BFIB 5KSUB 4NZDA 4FTVB 3RL2A 2W9DH 5D5MF 1P7QA 4G42A 4P4KD 5FDWB 2QADC 4JRYB 3Q1SH 1QPPA 4Q74A 4IRJC 3TJEL 1T7XA 4EIGB 4I2XB 2IEPA 3O9WD 5TFSH 5F1NA 3WBDA 3QEHB 5D1XC 4C58B 2OXHA 3QWRA 5HY9A 4EZMA 4XPFL 5CKAA 1XH3A 3O2DA 2IPKA 5BZWA 1NFDE 1X4XA 4QRPA 1HCVA 4X0KB 3K0WA 4OZFH 3KPOA 5D1QA 3QCUH 1OAKL 1IGTB 5EU6B 4U05A 5IT2L 3EDEA 3OAYK 3RX5A 4OAWA 5E99L 2E9BA 1OAQL 4PS4L 1K8IB 4WI4A 2GITA 3GSNA 1JRHH 1LHZA 3IKCB 1CBVL 4PJHE 5JIPA 4QY8A 5IVXB 3ZDYE 5HXMA 5JW4N 4LGRB 2VL5A 5TE7H 5TDOA 1IC7H 5KSVA 2NW2B 5HPMA 1A5FL 2PR4L 1W72H 3TT3L 5KZCB 5EC1B 5HHME 1OARH 3AFLA 5EBWB 3ULVE 1ZLUH 3LS5H 2XZCL 5GZND 5C3LD 1D5XB 1BOGA 1E4WH 1XF3A 1CLYH 4PG9A 1S7XA 4YX2H 5FA4B 3GSUB 3RTQD 3IF1A 4PGBA 2GTWB 2KZWA 2DL2A 4ZFOB 1I4FA 3MCLH 3RWIB 5L2KD 1FG2A 1CD8A 4O2EB 5C07B 2ZKHL 4HC1A 4LVHB 4YDKL 5KAQG 3K3QA 4WNQB 3GM8A 3UPAA 4O02H 3EO1A 4L4VA 4EEEA 5GS0H 2ATPA 2UUDK 2P1YA 1UXWB 1K6QH 1FGNH 1P4BL 2PTTB 3EZ8A 5BV7H 4Z0XB 4M62H 3KLAB 2YPLD 2BHUA 2RJMA 4NSKB 5EC2A 5T33L 2X4RA 3U9PL 5GS1B 1MIEL 5SWZA 1SHMA 2DQGH 4XH2A 1QSEB 1HHKA 4K7FB 2XA3A 4FZ8L 5GIRA 1M7XA 2Z31C 2NXYB 3PHOA 2R1WA 2HJLA 1T6WA 5CEZL 4HX1A 4K3DH 3EYSH 1H3PH 1ZLVH 4D0DB 2ZNXA 1I1YB 2W38A 1J1XL 4KK5D 4LSVH 4TTDC 4WI6A 4NKDA 4HWZA 2F9BT 5BQ7A 5I1CH 1VENA 3EYQD 4UV4L 4WW2A 3WLBA 1RK1B 4LIQE 3LKOA 5BVJB 4YHZH 3MLSL 3QQ9C 5HI4D 4OV5A 4HJGB 2O61A 5F7YC 3PXHA 1P5VA 4P23C 5CILL 1OGAB 4IMKA 2XTJB 1SJXA 3H9HB 1D6VH 3FFCE 3BZEB 3DUUA 1NMBL 4ONHA 2IANA 2AJ3B 5F3HB 3T8XB 4LSSL 5D6DA 4NNYA 2VO5A 2QBWA 1L0QA 5HBBA 5D71H 3KPNB 1CXEA 1PZUB 2VABB 1KCUH 3VXNB 3NH7H 1INDH 2EDKA 1GIGL 1PFCA 2FLBT 2VC2L 4GW1A 4Y0GA 1GOGA 2GT9A 3T65A 3LPWA 1R5WB 4Q0XH 2J5LC 1NMAL 3CGTA 3QWOA 4QTHA 4XMKL 4P9HL 3AM8C 5ICYA 1PY4A 4LKXA 2FEEI 4U6HB 1Z3GH 4HZLA 3MZTA 3O3AB 1RZGA 2GJ6D 1WIOA 2YXMA 3I9GH 4WUUE 3BJLA 3C2AL 1XIWD 2Y6SD 1MF2H 2IF7A 2VMFA 4MJIE 2VLKB 1KPUA 1L7IH 2VAAA 2VQTA 4PRPB 4F57L 4KRLB 2CJUH 1EFXA 5IK3B 2AGJL 4PRIA 1NC2D 2YS4A 5TGBB 5HHPA 3DGGA 1FFQA 4PUBL 1MFDH 4PJEA 3OKLB 3ZDZF 1N5AB 4YWGL 4XVUC 3SQOH 4X6CB 1ULVA 1I7TA 4C83A 3P30L 1OT2A 4KJQD 2GAZB 2VERN 2A73A 1J0HA 3CNKA 3MBED 4NKIL 1BJMA 1X5YA 3MV8D 4R0LC 5JORA 1WZ1H 2JIXB 3BHBB 1DN0B 1HH6A 8FABA 3KXFE 5DQJB 2NCMA 4BSVB 1BIHA 2CGRL 3TH2T 1JGDA 2W1NA 1YUHA 2ARJB 5M7QA 1KJ2H 3PDOA 3QIBD 3S34H 4RISH 2DWDA 4HH9B 2LAAA 4YDJA 4Z7VF 1GOHA 2ZZUT 4FQLH 2GK2A 4KHXH 3FOLB 2B20A 3BZDA 5F7DB 1MCPL 4ALAH 3VRLF 3ARFB 2J8UA 4YR6B 1O0VA 4TSCL 2FYYA 5E70A 5FB8B 1Q9LB 1YN7B 4DKEH 3QXAB 3QIWB 3C5ZC 4HIXH 5IW1A 5EBMA 3DX6A 2C1OA 3HAEG 1U6AL 2EICA 4K7PL 3VXPA 4NWTH 2CO7B 4Y4FA 5JPMB 5T1KA 1LO3H 4FN0A 4S1SH 1JCKA 2NTSP 4XHJC 1HCFX 4U1IB 3O4OC 2MOVA 3H9SB 3BAEH 3RZCD 5J4MA 4M3KB 1ND0B 1A3LL 2W0FB 3GMNA 4APQC 1E6JL 3QZWG 2YK1H 3IU3B 1MAKA 4Y4KD 3ROLB 4BQ9A 1WWCA 3FB8A 1CF8H 2VYRE 4HC1L 2YRPA 4PP2A 4RGMB 2ESVB 5FIEA 4V2CB 1S8DA 5C0DB 5DA4A 4P5TC 2VQ1A 4OBRA 5E9DA 1NCUA 2OR8A 2VLRB 3WE6B 4Y16A 1QSFD 5IF0B 1VEOA 4YFLF 2JJTA 1AKJB 3GJFB 3I6KB 4YPGA 3WUZA 5D8JL 5HI5C 3RTQA 4P2RD 2PXYB 4KRNA 1LDPL 5L2KA 5DR5H 3VU2A 1KCRL 5C0AD 1CGUA 2OTWA 3S98A 1BFSA 4D0CB 1U42A 5F89A 3RNQA 4Y5XC 5DJXB 1HDMA 4FQXD 1MPAL 5JLZA 4G6FB 4DGVH 4ACPA 2BNUA 3TBVA 1OP3H 2MNUA 3AY4A 4Y4HA 2YPLA 4JFQB 1A14L 4IIQA 2HKFH 1UEMA 1DR9A 3BP4B 1QNZL 4WWID 1WFUA 1J1PL 2NY1D 2YD1A 4WFEE 3I50H 1HHIB 3HR6A 3ULUD 1UVQA 5GGQL 1FO0B 4U0QB 3S3JA 2I07A 4GKSA 3K4AA 5I18H 3T1FB 3C60B 1A1OB 1Z0NA 1RJLB 4RX4A 1HILA 2PO6C 2DWEA 4P46D 1P2CA 2XXMB 5CJOL 5I19L 2P8LA 3CXHJ 4HXAH 4U6XA 3UBXB 1JK8B 1YEFH 3A6OA 4G7YL 3TO4A 2OSLB 1J0YA 4I3GA 2AKRA 3DV6A 3IVKB 2AXFB 4R4NC 4E41D 1RQ5A 3SDAC 1FL6A 3KPRD 4GXVH 1IAOA 3MLUL 5M94B 2QJDA 1FJ1A 4LSPL 2GJZB 4P0DA 2BSTA 4Y2OA 3OKDB 1UCBL 2VXVH 2BY1A 5I9QC 3IXTB 1FNEA 2F8OA 1YNTA 2ZCKH 3I6GB 3MLTB 4HKXA 4WV1B 3RA7H 2B2XH 3BEVB 3U46A 5E4EB 1FGVL 4R2GB 4JFEA 2HLAB 2QQNL 5C0CB 3HAEA 4FABL 5C7XH 4IRZH 2J8OA 4KZEH 4DCQB 3SO5A 1U8NB 3LEYL 1CLOH 1KGCE 4K94C 4NO5B 2VR5A 3FHQA 4MXQA 5E95B 4S1DC 4FQCH 4ZODA 1CFVL 2WQRA 4MCZA 4TVPL 3VXRE 5I16A 5CIPH 3C6SA 2AJVH 1FIGL 4XPBL 4OZGE 4Z95L 3QZWA 1RUQL 2X7LB 5CLTA 4QRRE 2P43B 4JAMA 4U0RC 3HTLX 3SDDB 3RWFA 1S9KC 3RGVD 4QHUA 1XIWA 3MCKB 3K8LA 3W0WD 5FECA 2VLJE 3WJLA 2D2OA 4LCWB 5DVNA 5B3JF 1TQBB 3D2UD 5I74B 3NZ8B 4RSVA 3TVMD 3SE8L 3PWPE 1KTRL 4LSQL 4AZ8A 5DMJB 4WHYH 3OAZK 3GEWB 3BP7B 5SX5K 2NY2B 5D7JB 4UTAL 3KS0H 1MUJA 2WBJA 1E0OB 2UYLB 4OF3A 5CJBA 2EYRB 3SKOA 3DVGA 4MXVF 1OLZA 1FG9C 1KYOK 3K2UH 4DN3H 5I71C 5LGHL 1DBJH 4MVBD 4WIQA 2C3XA 1KCSH 1AQKH 4M61B 4KMTH 4YGAB 1T21B 5F1OB 3MV8A 4M6ML 4M1DL 1PZ5A 1LP9F 2CRIA 1GC1C 5J6GB 4GG8A 3E3QE 4M5YL 4FQ2H 1FYTA 3FB7A 3QEGL 2VOTA 4KJWD 4G8EB 1HE7A 3TIDB 4ZXBA 2AQ3A 5DJDB 4XI5D 32C2B 1WC7A 1JPSH 2CRYA 2HFTA 3AMKA 5D2LE 1FP5A 1TTGA 3SJVE 3T2PA 3TN0C 3R1GH 3BIKA 3ES6B 3NIFE 3SKNB 4PJCF 5ITFB 2WK2A 3LRSB 4Y8DC 2V2TA 4MHHI 1M71A 2KPNA 2VAJA 1WTLA 3ISWA 4KK8C 1BAFL 3C09B 3KYMB 4AH2A 1DQDL 3TLRA 1QQDB 3BX7C 1KEGH 3IDUA 5BS0E 3CFDA 3D25B 4MNHA 5IMKA 3G6JF 5C8JA 4ODUA 5EIVA 5GHWH 4N90D 3P9WB 1NBYA 5C08B 1A4KA 4MQ7B 1S3KH 3VFSB 1UACL 5C0ND 4F7MB 1LEIB 3VGGA 4YDIH 4X6FA 1A6VL 3ECBB 3FO1A 4ODBD 5E6ID 1UA6H 1TNNA 3EYFB 3I75B 3WIIL 3C8KB 2P47B 4HIHB 4XNUH 1Y6KR 1EMTH 3SE3C 3WIHL 4JRWA 3M17B 1EAPB 2BCKA 2RQ8A 3PWJB 4EBQH 2R2EA 2C9AA 1ZLSL 2YR3A 2BNQB 5C0AA 3QEQD 3GBML 5EPMB 3KWWB 3O3DA 2V9TA 5JDSA 1TJIL 4NNXB 4ODTL 2A1WL 2X4QB 3P0YL 4NQED 3QJHA 4C55A 4ELKA 4GUPA 1U3JA 4FFYL 4ZO6A 4OLYH 3BQUD 4P9ML 4CMHB 1BREA 5GXBB 1SBSL 4PLKC 2P7TA 2PCPA 4GG6F 4K2UL 5KOMC 1UWXK 3P40A 2OS7A 3WNMA 1AXSB 4O4YH 5E8NA 4JO1L 3D6GA 2VDKH 3QUYA 4KUZH 1I3GL 2YWYA 2BSED 3UTTA 2M26A 2J12B 1IQDA 2LQRA 2OI9A 1JNLL 2IAMB 4ZFFA 4GW5A 2WANA 1TVBB 3BMWA 3LDBB 3CVHH 1IVLA 4K94H 1HXMB 4HWBH 2QLVB 4ZG1A 3SDCC 3TWCH 1UGNA 4ZYKA 3EFDH 2H45A 2EZ0D 2VLME 4K71B 4QNPF 5C0IA 2FIKB 3FZUC 3ALXA 1BFTA 4PJDB 5DJCB 5SWSB 4JDVB 5CKGA 3LN4A 2WIMA 4Y19A 1YQVL 1I1AB 3V5KB 4LLDA 4HF5L 1QFWH 1P4IL 3EOYG 1MJ7L 4TUJB 3VWJD 4E41A 4EI5B 1KACB 1UYWH 5KS9B 4MQSB 3DV4B 3DYOA 2KKQA 2ZG2A 4EXPX 5F7UA 3BWAB 3MRPA 3VH8G 1K8DA 5C0JA 2LFGA 1E27B 4DAGL 4V1DD 2F53E 1IAKB 4MB3A 3VI4F 1Y6MR 4N0FB 1CZ8L 4UIMB 3NCJH 3BKCH 5EOCJ 3L1OH 3OKOB 1VFUA 3QUKB 1INEH 3X11B 4HIEA 1OTSC 5GS0D 1B6UA 4UAOB 5ETUB 1F42A 5GRVL 3QPXH 3J7HA 35C8L 3SO3C 3QA3A 1GGTA 2ICWB 2VZVA 5DMYA 2XG4A 2BZDA 3KPMA 4F3FB 5D4QA 5I75C 1IGFH 3MRLB 1UM4H 2EDNA 4D0BB 3LEXB 3RL1B 1BVKB 1FIEA 2D7MA 4IRSB 5EUOB 3ZKMC 3C5SB 3MV7D 3MROB 4NZRH 3D2UA 1I8MA 3TVMA 5FHBH 4D9RE 3THMH 4XWOD 1FQ9C 4XBPA 3U7WL 4M1GH 4H1LG 1LO4H 1BHGA 1TJGL 1WCBB 4XVTH 3ILQC 4BQ8A 3RWJB 5LWYL 3TNMB 4FXLA 3TIEB 4TSAL 1JYNA 3SCMD 3O4LA 2IH1A 3ULUF 3VWKB 1S9YB 5D6CA 4NQVB 3WLWD 5GGUB 1FV1B 1MJ8L 3VFUB 1PX3A 5FGCE 4MVBA 4NQSA 1ZA3A 3CJJA 1S5HA 3TFKC 1C16B 3IU4L 4E0RB 4OV6F 1ZGLP 5DTFA 3LSOA 1U3HA 4ZAKB 4Y1AD 2LTQC 1J0ZA 1CT8A 4YJZL 4JDZA 4ONFH 4POUB 1KN2L 4YFLI 4MAYA 3FOMB 5IMOA 1H15B 2DQJH 3OKMB 4HV8A 4HXBL 1H5BA 2HMID 1DQMH 3RWDB 5HHQA 4EOWL 1KXQE 1HHJA 3BPNC 2V5MA 3HB3C 3IDNB 5MENA 3DETC 3SN6N 2EYTA 4BSWB 5BVPL 3JWDC 3GNML 5IMLB 5D7LD 1ETZB 3BSZH 1DUZA 4PGCA 3KR3L 1DQQA 5HYJB 3MRHB 2QADD 3L9RA 5AZ2H 4IRJD 5BRZE 5J8OA 3MODL 5FYJH 3KJ6L 2IJ0C 3JTTA 1ZSDA 5D1XD 4YXHH 5AG8A 1BBDH 2GCYB 4NO3A 1F8TL 1K4CB 4IJ3C 4XAWL 1TVHA 2BY0A 2PETA 5ENWA 1SMOA 5FA3B 3K46A 4NN7B 1MWAB 5CJQH 3FCTA 3CK0H 2ADJB 1KELL 4JLRB 2I5YL 1DVFC 4HFUL 5E7FA 1EHXA 3QUML 3ZE2E 5EB9A 1IGTA 3VW3H 2VDQL 3M1BB 5E6IA 3VH8A 5I1KH 2XY2A 1RV6X 1OSZB 3WJJA 1JGVL 1NUFA 2HN7B 1T83C 1PVHA 2I24N 4Z8FL 4LF3A 1C8PA 3HC4L 1C7SA 4NC1E 6CGTA 1XGQB 2NY7H 3ARDC 4P49A 1FLTX 5IVXA 1VA9A 2A6JA 3HR5B 5JHLH 4L4JA 3R8BB 5KVEH 1P9MA 1NFIB 2XOTA 3FQRB 3QEQA 3QXVA 2YEZA 4J3WA 3G5YA 2VXTH 4ZSOB 4LKCB 2DQHH 2IMNA 4FQHB 4JO2L 4U49A 3ULUL 1OTUC 1D5XA 4QHLA 3BQUA 3MLWL 5IEHB 3QUXB 1F4XL 3OX8A 3W5MA 1VFOA 3SPVA 2YMXH 3BW9A 3LMJH 5DHXB 4GKOA 3LQAC 4LNRA 3GSUA 2OK0L 4PRHE 4H1LA 5INCB 2OL3L 4WVRA 1IEHA 3RWIA 5C0RH 3LN9A 4Z7NF 4P2QE 1N26A 4Y89A 1RHHA 1F90L 3KYNA 5DI8B 5E8DH 4M6AA 3T4AA 3TPUE 2XIDA 4WNQA 3U9UA 3O3EA 4NRXA 2F58H 4H26A 3MRFB 4O9HL 2DJUA 3MBXH 4CBPA 3FO0L 3HG1D 4UT9L 1IKNA 5JOFA 4FFZH 3LRHA 3KLAA 1FH5L 2O5XL 3V52L 2H32H 1XGYL 1NFDB 2AJSH 2Z31D 2E7LC 3EGSA 2B5IC 2N1KA 3QG7H 4K7FA 1NDMB 2BC4B 4N5EC 3MLVH 5DD3L 2IBGA 4CUCA 2B1AL 3UJTH 2DQCL 2VNCA 1I8IA 5IFAL 4XP4L 1D5IH 1JWUB 3C87A 4TTDD 2Z93B 5E94A 3HMXH 2APTA 3HNSH 3B3IA 4FQJL 1QRND 4NQXB 4OM1L 2VXSL 1AD9B 3RJQB 2YSSB 4PTUA 4JFFD 3QQ9D 4WENB 4M5ZH 3DPBA 4PJHB 4GAYB 3T3MF 4P23D 4PJFE 5EN2B 1C1EL 1UC6A 2E5EA 4ODVL 3S3SA 4JM2F 4OF8A 1MEXH 4RFNB 3CCHB 3LQZA 2WWKT 4YE4H 3V4UL 3B8YA 5ADPL 1MSPA 3PQYE 1VFAB 2I9LA 3B5HA 2YUWA 5KVMC 2GW5A 5F1IB 4HS6B 3ARVA 4PP1D 1W0WA 3Q6FB 3MLZH 1JJUA 3L3GB 2VWEC 1B2WL 2ZOKB 3E6HA 3VXNA 3JWDH 4PJGB 3TESA 2QQKH 3MV7A 4JREB 4L4TA 3G6DL 4XPTH 1QEWB 1QACA 3GHBH 3QNYA 4OCXH 4KKLC 2CO6B 2D7PA 3WDJA 3QDAA 4L9LB 1UM5H 4ZUUA 5HHOE 2Q8AL 2JJSA 2MHAB 5IM7A 2QV2A 2YPKA 4NKMB 3O3AA 1W0YT 1YEKH 3VFOB 4N1EA 5ITBH 4S2SA 1U8PB 3TP4A 3PUCA 4Z78B 2Q7NA 5I0DA 1UKQA 4MQTB 1AO7B 1MLCB 1FL5A 1MRDL 5DWUH 1TMCB 3MR9B 1A02N 3ZLQC 3EYUL 3J8F7 2OZ4H 2R4SL 4FQQB 4HQQH 5L0QB 1TENA 4W4NA 7FABH 1D5MA 1FCGA 4XVUD 3HUJE 4LVHC 4YHIA 5TGBA 2WP3T 3KLDA 3MXWL 5EUKA 4LU5L 3BEWB 1BWWA 3UTQA 2WY3A 1JNNL 1S9VA 5HGDA 4X5WA 4Y2DB 5KSBE 5IROC 1IGJB 1U58B 1T2XA 1K3ZA 4DGYH 3ZT7A 3QNZB 5CEXA 12E8L 5DHVA 1ZXQA 3IJSA 4IRJA 1N4XL 1RZFH 4NCC2 4P3DB 3UBXG 4LEOB 4LLYB 2P5WE 4NQCD 3F62A 3CX2A 3KYAA 4X80L 4G7VH 1X4YA 4F7CB 2VR9A 1T22B 1BECA 3V7AE 4HZAA 2DQFB 3L5JA 4MCYA 4P5MB 4KK6C 4EI6B 5ICXA 3FFCB 4ZOEA 1CDJA 2R29H 2W9DL 3GSRB 5DRXB 3ARFA 4AMKH 4YR6A 3ZHKA 5HVHB 3Q1SL 1K4DB 3PHSA 9CGTA 4KGJA 3C5ZD 3LQAH 1QVOA 1QBAA 2JCCB 1Q9LA 5TFSL 3RVVC 5FFLA 1F97A 2P8PB 5AWNH 3PL6B 4BZ2H 5INDB 3IGAB 2O5ZH 4FQIL 2FO1A 1CICB 1JPGA 2EEBA 4M7ZB 4GLRI 4XHJD 2Q7YB 1WJ3A 1RZJH 1ONQA 3DMMB 3DROA 1NGYA 5TE4L 3TCLB 2YN3A 2XTJC 3ARTA 5GRYA 5CMAA 2WIIA 1FZJB 5EBGA 1MQKH 4JKMA 3QCUL 4XZUA 4APQD 1FNSH 1TCRB 1MQ8A 5CEYB 1UB6A 2IFFH 2W0FA 5ISZA 3FT2B 3UC0H 4WUUB 4Y88A 1EGJA 3IU3A 2HVJB 4M48H 1DTUA 1R5IB 1DLFH 2KL6A 1N7ML 2DLTA 3PHQB 4NHUA 3U7AA 5HYQB 1U2HA 1LEGA 3QDGB 4QRQA 1T03L 1U3YA 4P5TD 3EOTH 4RQQB 5F7FA 3AU1A 4GW4B 5IG7B 2FL5B 4PJXE 1WV7T 2M2DA 5TE7L 1SQ2N 5HI5D 3QDME 5IF0A 2C3HA 1EHLL 1GPOH 4QRUB 1X3DA 1OARL 2AJUL 4K3HA 5DJZA 1DANT 5DK3A 3ZE0F 2WZPD 3LS5L 1ZT1A 4OFIA 2RR3A 2CDFB 2EE6A 1RZIB 1E4WL 2OCFD 1CLYL 1JZ7A 3IFPB 4X5LA 3KXFB 1HSBB 2AXGA 5J12B 1ROWA 4NN5B 4XNXH 4AQOA 1OL0A 2X4TA 5J11B 3CC5A 3GRWA 3PGDB 4JANB 3ARBB 2GTZB 4O02L 2Z31A 4L3EA 4OIIH 3VCLB 4R3SB 1TPXB 1E28B 3CAFA 4JQVC 2XKUA 5GS0L 4WU7A 5DQDH 3V6FB 1FGNL 3MRGB 2PO6D 1RU9H 4M3JA 5BV7L 4M62L 2DTSA 5D5ME 1S7VB 2PW2B 3C60A 3T1FA 2V7HB 4JFYB 3IFLH 1QRNA 3AREC 4NBXB 3S37X 3KJ4B 2DQGL 2G5RA 1NGXB 2WNGA 1WAAA 4R4ND 3U2SA 4LCYB 5CEZE 2AXFA 3U0PA 1S7UB 1H3PL 1WBYB 2Q76A 3UDWC 3MPCA 1SY6H 2AEQL 2GJZA 3OKDA 4LSVL 4WDIB 3TA3B 2BJMH 4OCSH 3MFFA 4HUXA 4UINH 2BRRH 5I1CL 3LS4H 4QXTA 2R56H 4YHZL 4YXKH 3O41B 1C08B 5K93A 2CDGB 2YZ8A 1D6VL 5DEFB 1LE5B 3AM8A 4S1DD 4ELMB 1FYHB 3WUWA 4ISVB 3FQXB 3ZSSA 4HHAB 4R7DA 3VFTA 5D71L 1YYLH 4XBGB 2UZYB 5EULV 1KCUL 3FB6B 3NH7L 3OB8A 2ITDB 1INDL 3DURB 4CN6A 3GMRB 1BD2D 4Q0XL 4PV9B 4HK0A 3SDDA 3L3JA 3MCKA 3DVFA 5T5NG 3N50A 1V7ML 4LCWA 1ADQA 3NZ8A 4TNWF 2W59A 3C6LB 3T77A 4RAHA 4R97C 4OCWH 3PP3H 4G6KH 1KT2A 5TQ2H 1WISA 4MWFB 1PG7H 2FGZA 3BD3A 1MF2L 3HCVB 3FRUB 1L7IL 3SGKC 3CFBA 1KLUA 5TDPA 1T21A 2V6HA 4WW1A 3HZVB 1FFNB 4YIQB 2P5ED 3W81A 3WFHB 2DKUA 5J6GA 3ESVF 3SQOL 5JHDE 3CU1A 1OQOA 1ZHBB 5KANI 1XR9B 1MCHA 4RAVB 3D39B 5C0BB 1CFNA 1CGXA 1QLFA 1A9EB 3OXSB 1FBIH 3B6SA 2GK0B 5DJDA 1WZ1L 4Z7UA 2OMNA 1YPZF 3TN0D 5CWSA 5FYJU 2CPCA 4UNTA 3VDAA 3RUGA 1HNFA 1KJ2L 1Z5LA 3JWNC 3KAAA 3B2VL 3S34L 4RISL 3HRZB 4UDUB 4RFEA 4JR9H 1DLHB 4KK8D 2G2RB 4FQLL 1X5KA 3EUUA 3FQUB 3O11B 5T1DH 2DKMA 4A6YH 2OQJA 1JWMB 2EDXA 4XP1H 2HH0L 4ALAL 5IVNA 1P6AB 1NFKA 2LU4A 5C0FB 1T1ZB 2DTMH 2F54D 4WV1C 1CG9B 3JV5A 4WFGD 4DKEL 5CAYB 4APQA 1MCOL 4KVCH 5HYSG 5ESVA 4HIXL 3MMEB 4X98B 5C08A 3P4NA 5E4EC 4PV8B 4R2GC 2C4FU 3CH8A 4NWTL 4QRRB 4PJIA 4G80B 4XVJL 5E8EA 1LO3L 4S1SL 1JIBA 3GB7B 1MCLA 5FO9B 5FF6B 5D7IF 4DWHA 3P9MA 5A2JH 2VLJB 4P5TA 5F71A 3BAEL 4JHWH 1V7NH 4FP8H 3PWPB 4KI5C 5HYIA 4KJPC 2ZSWB 4PBVC 3IXAA 4WTWA 1INQA 3N1MC 2YK1L 2PYED 1EAPA 5FYJD 1ZVHA 1GVIA 1ZHKB 2BOCB 2BY2A 5DUMH 1DCLA 3WIFB 4RGND 5I1JH 3O6KH 1Q94A 1RULH 1CDYA 2DIAA 4L4VE 3VXQA 4WHCA 2J88H 2X2YA 3MREB 2YD2A 5I74C 3QI9A 4MJ2A 4J4PC 2M1KA 1S5IH 1SYVA 3BP5A 5JR1H 4PLKD 3RHWF 4JFXB 1GZPB 1JNJA 1JF5A 1AR2A 2C7UB 5DR5L 1MHEA 5SWZE 4JJHA 2WSKA 2P45B 3I02A 5C9JB 3QAZB 1ZS8A 2AS5M 4Z7UF 1UT9A 4CVZB 3BGAA 1JRHI 5D2LB 3I85A 2LAGB 1ZTXL 5FEBA 2D3VA 3SJVB 4B0MM 4OT1H 3NFNB 5CCKH 3HNTH 2HRPH 3SDCD 3MV11 1NCWH 1AGDA 4DGVL 1UJ3C 5DDHB 1IQWL 3VFMB 1YEJH 3KPQA 5CHNB 1A2YB 2MCG1 3RVUC 2VIRA 3FZUD 4D8PB 5CD3A 3FTGB 3NZHH 2FIKA 4JFPA 1Q9OA 1L6XA 4XPAL 1TZHA 4RRPG 1SVZA 4OZHF 2V7NB 5BS0B 4ORGB 3GSXB 3SDAA 2X1WL 4Z7VE 3V5KA 2X9YA 2VE6A 1F2QA 5C09D 3GJFH 3B4NA 4NN6B 1UG9A 4GFTB 5D2NE 4ZQKA 1T3FA 2L7UA 3VRLE 3IJYB 1DSFH 1KNOB 3DV4A 5DJ8B 4ZUTA 4HIJA 5JNYB 4HXAL 2X4PA 5HGGS 1YEFL 3LN5B 2CIKA 1MJJB 4GXVL 4OI7A 2UWEF 1XCTB 1OTSD 3ZTJG 2VXVL 1WITA 5DK0B 5IP4A 3RA7L 4HGWA 2B2XL 3RKDC 3B9KA 2O93L 3L7EA 5HYSA 1EHNA 1X44A 2R1YB 1FC1A 2ICWA 5E2WH 5DYOA 3DIFB 5C7XL 4IRZL 3MJ9A 4KZEL 2W07A 1G7PB 4JFDA 1CFSA 1BD2A 3AS2A 1FO0H 4OKVB 4TNVF 1CLOL 3ZKMD 2CLRA 4CU8A 2FHCA 4IRSA 5EUOA 4FQCL 1KLFA 4OLWH 4LSUL 3MROA 4TVPE 1T7ZA 3NIDF 3O2WH 5K9QG 2R2HB 5I17A 1KPRA 3DX9B 4OZIB 2CK0H 3TIEA 2BNRE 3MV9A 5E8OB 3ELAT 3TFKD 1G6RA 1X7QB 1YY8B 2YD8A 3BDBA 4WWKB 4I5BB 4CMHC 2JK5B 4R4FL 3N1GC 1YEEH 2E8YA 1N6UA 1K2DA 3MNVA 4U1SA 4DTGH 1RZ7L 4MLIA 3WEXA 2VDLH 4LP4A 4FXGA 2AK4B 5F44A 2DMKA 1I3RA 5B8CB 1AR1C 3E6FA 4YC2C 3K2UL 4DN3L 1IM3A 4YNYB 2BHYA 3HB3D 1DBJL 1KCSL 1ZAGA 2J8UE 3DETD 1NUDA 4KMTL 4XNMB 4ZOCA 3HPLA 2I9TB 4OUUB 2EECA 1J9CT 2VXQH 4QTIH 4K71C 1MCSA 1N0XH 2CLVB 2IC2A 3QEUB 4WUKH 5IMLA 4XCEA 1CTNA 1CYGA 1ETZA 43C9A 3IDIB 1SVCP 4PD4K 1D5ZA 3TV3L 5HYJA 2KZ1B 4FQ2L 4QRTA 1PKQA 2F53B 3HLAB 1I1AC 2HVKB 3IKKA 3V6ZA 4EI5C 1KIRB 1JPSL 4U1GB 1WTGT 1YY9C 3N85H 4RRPA 5SX4H 1EPFA 4XPHH 1NAMB 4LARH 3IETA 4XP6H 4QF1B 3P0VH 3R1GL 2F54A 3QDJD 5FA3A 1DVFD 3GO1H 4NFCA 4N0CA 2K1MA 3OKNB 4OB5H 4PYHA 2BXZA 2G5BB 3MRBB 4LHUB 4GXUM 5L2JA 4K9EC 4KH2A 5JQ6L 2ZUVA 5E9DE 1SEQH 1KEGL 3M1BA 4LFHG 3W9DB 5CBEA 1JVKA 4UAOC 4X6DA 3SE3A 1XGUB 1ES0A 5GGVH 5GHWL 4HCRL 1BGXH 1G1YA 1MRCH 3ARDD 4U2YA 1T4KB 5L2KE 4TULH 4YDIL 2EDJA 2CRZA 2PYEA 3F8UB 3ZKQD 1UA6L 2H6PB 1OT1A 4IEFB 1JI1A 5DSCA 1XF4B 5FGCB 4XNUL 3FQRA 1PY9A 5DJ2A 2ZCLH 1IFHH 1EMTL 1U8QA 1OTUD 5C92A 5T1LD 3VXUA 1FZMB 5B3JE 3TO2B 2YPLE 1PDKA 3TBTA 2F19H 1MREH 2EIZA 1RJYB 5TF1H 4H20H 4WI3A 5CJ8A 2AABH 3BT2H 3BRDA 1JHTB 3R0NA 2V5RA 4QXUH 3TJHC 4HUWB 5F7LB 1OGTB 1YEGH 3VXSA 4BM7A 2CKBB 3E8UH 4U1JA 4MLSA 1DBKH 4MXVE 5IIEB 4OZ4B 3JWOH 1JZ3A 4OLYL 1HOCB 3D9AH 4DEPB 3SDCA 2OJEB 3STZB 5BRZB 3DXAD 4ZMAT 4X8JB 1A6WL 3V6OC 1G7QB 1LP9E 4MNGA 4PRBB 2H3NB 3CX5J 4M8VA 4O4YL 1MI5A 2UVFA 4KUZL 2VDKL 5CGYC 3CFEB 2F74B 3ILPB 1I1FA 1RK0A 3WFBH 1BX2B 1YMMA 3MCG1 1WBZB 4K94L 2AQ1A 4OQ1A 1NCBH 4HWBL 3GSQB 4N5ED 3TWCL 3EFDL 4JRYD 1NDMA 2XG5A 4NQDB 4LBEB 1OWWA 1U92B 2GYSA 4Q9RH 4JFEE 3SE9H 4N0RA 4PJCE 3UXFA 5CSGA 5ALBH 5EWIL 1OP5K 1CFQA 2KQMA 4XGZA 1KOAA 1QFWL 4HIIA 1NBZA 1QR4A 5IQ9A 3ARGC 2FSEA 4F33B 5JIIA 1WEJH 1UYWL 2RFXA 4NN7C 4X6BB 2Y5TB 4ODXB 1REIA 3G6JE 4Y7MA 1EUUA 1XAUA 2R2BB 3VFWB 2VDOH 2GJ6E 5H2BA 4PB0H 1AHWC 3HI1A 3TBSA 5ICZB 3U82B 3X3GH 5HHMA 4PJ8B 1A1MA 4M02A 3PXJA 3BKCL 3T4YB 4P2OA 2ZPKL 3QQNA 5E2TH 5B3NA 2AEPH 4L1HA 1YJDC 1INEL 1OTTC 1AY1H 4XC3H 1HXYA 1TJHH 2MCPH 4ZDHB 2Z91B 2X89D 3MRRB 3QPXL 4KKLD 4HKBA 4KZDH 5M95B 1BQHB 1T04A 5KZCD 3Q5TA 4PRHB 1IARB 2APBA 1QFUH 3NMEA 3PWVA 4P3CH 2R0LH 4UOJA 3U36A 3H0TB 3WKMH 4P2QB 2ZUQB 2HFGH 1OP9A 1IGFL 1UM4L 4S10A 3BPOC 3EW3B 3O8XA 4J23A 3MV8E 3TPUB 4D3CH 5EBLA 1BM3H 1ODAA 3C08L 4NZRL 4JG1H 3THML 1AC0A 1BZ9A 4IDLA 4M1GL 1LO4L 1AGBB 5TH2A 1A7PH 1VCAA 3BFOA 3FO2B 4XVTL 3VJ6B 2NY5C 5FKAB 5C07D 2YD3A 1RIUH 3SOBL 3EYVB 4K9EH 4MSWB 3CFJA 1D9KA 3VFPA 5F3BB 3LZFH 3OL2A 4PJ5D 1FLRH 1H8SA 3QO0A 4J3TA 3QNXA 1DQTA 2PW1B 1J8KA 4UI2A 1EO5A 3WFZA 1QUNA 4GBXA 2NQCA 3LCYA 1IEAB 3MOQA 4ENEC 2DQJL 1NQBA 3RDTB 1KB9J 4WO4B 2DLGA 2WP3O 5LAXB 4QNPE 4ZUSA 1DQML 3E2HC 4AY0A 1XGRB 4YHMH 1CFTA 1QD0A 4NM4L 4J8RB 3M8OL 4LEOA 2VUYA 5B21A 3C5JA 2DB8A 4PJFB 3RZWA 4F7CA 4KK6D 3WXWH 3KHQA 4NKOB 1F4AA 3QDJA 5AZ2L 3PQYB 4G9FD 3RVVD 5FYJL 4AYFA 2BSRA 5IV2B 3U48A 2GFBB 5HGAB 3O6LH 5GGRB 5INDA 3DYPA 3MLXH 1MH5B 3VMOA 5F7HA 4HJ0C 4X7DC 1D6EB 1CICA 1AQDA 3VI4E 1O7VA 1QSFE 1OGAD 2HT3C 5F8QC 2FH6A 2XTJD 4X9IA 4P4RA 3G9AB 3UPRB 2DDQH 4P2RE 3CK0L 1FZJA 1FNHA 5BW7A 5HHOB 2AJYH 4F2MA 5C0AE 3CH1A 2WAHA 1UWEH 3VW3L 4L3AA 5FOBB 4LLWB 4D9QD 4YLQT 4X4MA 4W4OC 5I1KL 4ZTOH 3CFKB 2Y72A 3R06B 1I75A 5FM5M 2ZUTA 3LRGA 1Z0MA 4ZNEE 3OV6A 3BI9X 1B0GA 4MJIA 4PY7B 1P84K 1H3VA 2WLZA 3GMMA 4P9HC 4PJ7A 2NY7L 5T1LA 3L5WA 4LP5A 2FL5A 3RBGA 4L9LC 3F7QA 4H88L 1FVDB 3HUJB 4RDQG 5JHLL 1A3RH 5KVEL 3UTTE 3GSVB 3A6CH 4MJ5B 4BYHA 3ZT5A 1PJ9A 3U4BH 1WSST 2VXTL 1MJUH 5KVFL 4ORZC 1AC6A 5DJ6B 3EAKA 2RCSL 3INUH 3ULUE 3CSPA 2DQHL 1Q9WB 1P69B 3GMOB 3LKPA 1HQ4B 1OWRM 2VLKD 4O2FB 4PRPD 1MWAH 1KIQA 2CDFA 5J7CC 4XBEH 3PDDA 3P9LB 2X4OB 3DXAA 3DTXA 2YMXL 3LMJL 3KXFA 5I1AA 5L0QC 1OPGH 4JN2A 4OI9A 4EN3B 3PNWA 4FQPA 1P6FA 2N4IA 5C0RL 4E41E 1F11A 3KPRE 4Y2DC 2GTZA 3WXVL 4NO0B 1YJDH 4XRCB 1FFOA 2E7MA 3PWNB 1N3NA 4F8TA 2F58L 1W0VB 4JG0H 2A6DB 1R24A 2K3TA 3MBXL 1F2XK 5IFJA 1G7MA 1U8JB 4PRNA 3ARED 4FFZL 1ZV5A 5CBAB 4HKZA 1EEYA 5D96B 4GRWB 4JFYA 1LDSA 1GAFH 2ZUUA 1UQSB 4LPTA 5AEAA 5F9JB 2AJSL 2EDOA 4KDTA 2G9HB 1YN6B 3QG7L 4NZTH 4DZBB 2DD8L 3MLVL 2EYSB 4Z7WA 3UYRH 5HVHC 3UJTL 2VXUH 3CZFB 1D5IL 4N9GB 3VI3F 3HMXL 3HNSL 3PL6C 2NY5H 3KPLA 1X5GA 1IAIH 4WDIA 3TA3A 4MD5B 2FIRT 4Y5VC 3RI5F 4AIXA 3STLB 3W0WE 4PJ7F 1S7RB 3DMMC 4M7LH 4MZ3A 5E00A 4M5ZL 3RNKA 3VMPA 2W9LA 4PJXB 1A7NH 2V5SA 1EHAA 1CVRA 3O41A 2P24B 1P53A 1MEXL 3QDMB 2HA1A 4YE4L 5I8OH 4LLQB 2CDGA 2HFEA 4KDWA 4NGHH 3RWGB 3QUZB 5DD1H 2EIDA 1BP3B 2VSCA 5FK9B 3HC3H 1G7HA 2WV3A 3FQXA 1FN4B 1QFWI 3MLZL 1UXSB 2COQA 3OHXA 3JWDL 5IB1B 2ITDA 4U7MA 2QQKL 3IDGA 4P48A 2Z4QA 3GMRA 3NPZB 3WFEH 3GHBL 4OFKA 3MJ8A 5JDJA 4OCXL 1MHHA 4U1MB 2RB8A 2AQ2A 4YPJA 1UM5L 4JB9L 2MKWA 4BH8A 4ZOAA 2PNDA 1HYSC 4PLNC 1VERA 3S8WA 2XACC 1UZ8B 5DD0H 4PRAB 1YEKL 3F7VA 4NZUH 4U1KA 5ITBL 1AIFB 4UQ3B 2BFVH 4PJ5A 2J4WH 1RSFA 4G6FD 3BO8B 3RY4A 4OCMC 5DWUL 2NY3C 1R3KA 4XCFL 1H3WM 4A2LA 2OZ4L 4MA1B 3D0LA 4HQQL 5CJXC 2FJGB 3LIZL 1DL7H 7FABL 4JZNB 1RZKC 1FFNA 3ARBC 3IFOA 1LQSR 1YDPB 3VG0H 3LV3A 4J3VA 1IGIH 1NBQA 1JF1B 4Z7WF 2EC8A 1A21A 1XR9A 1QHOA 4XNZC 4LLUB 1KC5H 4N90E 3WO4B 1IC5H 5DZOA 4DGYL 4CMMB 5D9SB 4Q6IC 1RZFL 2NZIA 2F8VA 4D9LH 4G9FA 3TYFB 4PJ9B 5C1MB 3VFRB 4CNIB 3VFNA 5C86A 3KJ4C 5DD6A 2BSSA 1JGLL 3LKNA 3QT2A 4UU9A 4G7VL 2VSDA 4YDVB 4LLMA 1MIMH 3MXVH 3ROOB 3H7BB 3WKNA 2MKLC 5DFTA 2G2RA 1BVZA 3G5VA 3H9YA 4D2NA 3T3ME 4EUPG 4KKAC 4Y5YC 3I2CL 3UMTA 3LQAL 4AENB 3S36H 1I3UA 1CG9A 3QEQE 2X5PA 4R2GD 4RZCA 5CGTA 5AWNL 3VXRA 2DYPD 3JTSA 4HS8H 3MMEA 2O5ZL 4MX7A 1T0MA 5C0CD 4OZGA 4V3EB 3Q5YA 2IALA 1LE9A 1RZJL 5FO8A 4CU7A 4DUVA 1ITCA 3QISA 5FO9A 3DWTA 1MQKL 4KI5D 1LILA 2VLJA 3HZYB 3OG4B 4KJPD 1FNSL 4KJYB 2NYYC 1URLA 2IFFL 1EV2E 3AS1A 1HH9B 4JCLA 3UC0L 1P7KB 1FZOA 4M48L 1KLGB 2GEEA 4LIQH 1DLFL 5DJYB 2NNAB 5IKCA 4YDLC 2O5YH 1ZHKA 2W65A 4MB4A 3STBA 1CDIA 3QXDA 4HD9A 3EOTL 3RL2B 1GRWA 4NYLA 1P7QB 1KCGC 4S1QH 5JW5A 4J4PD 2NX5A 5T3XH 5JPNA 3EOBA 2ICES 2HRLA 4WRLA 5F1NB 5DC4B 3C6LC 5J56B 1GPOL 5HY9B 4Z76A 4YHNA 2P4AB 1R5VB 3GI8L 2IPKB 3HZKA 4I13B 5GS3A 5JIHA 2FZ3A 4XPGL 5L88H 3ZHLA 2ZUWA 4QRPB 5C9JA 2NXZB 3U4EA 4CVZA 1AP2A 1OM3H 2C5DC 4OLVH 3SJVA 1WWBX 1EFQA 4POYA 3QULA 4G6MH 3RVUD 4OAWB 1EH9A 2ENYA 1R3JA 4XNXL 4YFDB 5DDHA 3VD9A 1T89C 4U6VL 4OGYH 4I0PC 4V1DE 1AH1A 3EDKA 3MV01 4YO0A 4D8PA 2GITB 2WUBH 1IILE 2ADIA 3GSNB 2J3SA 1I8LA 3CIQA 1NGQH 5C9KA 4L5FH 4OIIL 5I0ZA 2VL5B 3BPLB 5TDOB 4DW2L 2V7NA 4TRPH 5KSVB 5HPMB 3JV4A 1KN4H 1L8JA 1RUMH 4MS8A 2YD5A