3LN4A

Crystal structure of hla-b*4103 in complex with a 16mer self-peptide derived from heterogeneous nuclear ribonucleoproteins c1/c2
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
274
structure length
274
Chain Sequence
b'GSHSMRYFHTAMSRPGRGEPRFITVGYVDDTLFVRFDSDATSPRKEPRAPWIEQEGPEYWDRETQISKTNTQTYRESLRNLRGYYNQSEAGSHTLQRMYGCDVGPDGRLLRGHNQYAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAARVAEQDRAYLEGTCVEWLRRYLENGKDTLERADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, B-41 alpha chain
molecule tags Immune system
source organism Homo sapiens
publication title The impact of human leukocyte antigen (HLA) micropolymorphism on ligand specificity within the HLA-B*41 allotypic family
pubmed doi rcsb
total genus 79
structure length 274
sequence length 274
ec nomenclature
pdb deposition date 2010-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ln4A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3ln4A01
2RB8A 3QFJB 5HGGS 5JIPA 3NA4A 3FB8A 1YEJH 4NCDA 5E4IA 4XCYB 1ETZA 5LG1A 5KVFH 1KJVB 5E2VL 4ZO7A 1I8MA 2H8PA 2AABL 2R1YB 3SDCA 1UYWL 3IFPA 1N64L 4QHMA 4O5LH 4ORGB 1BAFH 1RMFH 1N5AB 3D87B 1FV1A 4Y4FA 4NWTH 3RRQA 5EIVA 2O61A 5D4QA 4DKEH 3GJFK 5C0CA 3HPJA 3H3KA 3IETB 1NFDB 5FYJH 4M6OH 3DV4B 1UADC 1CZ8H 3ZKMD 4Y4KC 4PJFA 4UT7L 5CKAA 5IWLA 2VLRE 2AABH 3OKLB 1JHLH 2CMRL 3K80A 4HWZA 4JRYA 3UTSA 4M8QA 2JJUA 1T7XA 3NMEA 3K81A 2YD6A 1U41A 5D2LA 3ZKMC 1CDIA 4YUEL 1W72B 3FT2A 1J0YA 4YHYB 3H7LA 3UDWC 2J3SA 1QFHA 3TF7C 1GXEA 5T1DH 2DJ4A 1WCBB 1N2RA 1C5DB 3B9KB 4OLXL 2LV4A 4OCWH 1PG7X 3SDDD 5AYUL 4X5WB 3VXMB 2FHBA 5T33L 1JHLL 3UTZB 3ZHLA 1LQSR 2VE6A 1U91B 3QYCA 1FE8H 2OI9B 1FBIH 4M7ZC 1NJ9B 5HGDB 5IROA 4CMHB 2A9MH 3DX8A 3D5OF 1YEFH 4GSDL 3CPLA 1N0LA 3AU1A 4POZD 1YN7A 4QHNA 1CFQA 3JWOL 5T1DL 1JYNA 2ZUVA 3LRSA 5JIHA 2VDOL 1KLUB 1R3IH 2E9JA 5I8KL 4NO2A 5F1OB 4NM8L 15C8L 2CKBL 2VL5A 2XACC 3IDIB 4BH8A 4HG4J 2AXGA 1GZPA 1QYGH 5BV7B 1NUGA 5TF1L 5INDB 3SKMA 3UTTB 4HIXL 4N9GB 2AXFB 3BO8A 2IFFH 3D18B 5IK3B 1IGIL 5E2TL 1U8QA 3BT2L 4MA1B 4XBPB 5T3XL 4QEGA 1SQ2N 3T8XA 4R7NA 4DEPC 4M6NH 3TZVD 4H1LB 1IAIL 4G9FE 4WRLA 4AEFA 1HSBB 4OZFA 4N5EC 1GOGA 1RUQH 2CLZA 5KTEL 4LIQE 1L0QA 5IT2L 1FAKT 5FV1L 3WO4B 3WO4C 2LFGA 5JUEL 5E8EB 1T20A 5JQHC 1RFDH 3VD3A 3OB0K 1B0RA 4UBDC 3AS3A 3MRBB 4OT1L 3PDGA 2WIIB 1WC7B 1XF3B 2R1XB 4PD4J 1SJHA 2AJYH 5C0AA 2EIZA 3BP7B 4X5XB 4QRUB 4CMMA 1OTTD 3MNVB 5CBAB 5I1AB 5AZEH 1S7SA 3C60D 1JFQL 5LAXB 4ZXBD 1F58H 2ATKA 5EIIB 5IVZA 2ITDA 1LEKA 2H26B 1GSMA 1G6VK 1T4KA 4M7ZB 1V3LA 1HHIB 1FDLH 3NCYS 4GMSL 1NAKH 4YC2C 4CMHC 3LRHA 5KS9F 1LO0L 4ZXBC 4FABH 5E2JA 4KMTH 4GO6B 4U6XB 1GGCH 1MPAL 1BQLL 4JANA 3N1FC 4EQ2A 3PGFH 3OG4B 2VR5A 1N6QH 4P2OD 3OKKB 2NYYC 5FHAH 1EBPA 1Q0XL 3KS0H 1OAZH 1P7HL 4PY7A 3AGVA 5FYKH 1AGDA 4WW2C 1NGWA 2VLJA 3D39D 3OL2A 3FB7A 4GH7B 3IDIA 5D2NB 5MEPB 3GSNH 3O3DB 4UIMB 4N1CA 3UCRA 2F5AH 4ETQA 3BSZH 3BMWA 1A4KA 5ISZB 2HWZL 5J6GB 1G1CA 4Z6AT 3DECA 3E3QA 1Q0XH 1AD9B 3HRZA 1KCSL 3WFCL 3MUHL 3O6FC 2CDEB 4YDJA 5J7CC 5MHSD 2VSCA 4MLIA 1KN2H 2IALA 4LSVL 5DFWH 4K71B 3A6BL 3B9KA 4UOW1 1UXWA 1D6VL 4Z0XB 1INEH 2R69H 5D1XB 5IHZB 5DSCB 2PO6B 3SE9H 3RVTD 5IOPA 3TBYA 3DVGA 5EBLA 4HJ0D 1T2QH 3ZDZF 1EAJA 1A1OB 5JOEA 1QP1A 4XCEA 5GRUH 4CGTA 1CICA 2DDQH 1BBJA 3BRFA 4X5XA 5I66B 4P0DA 1CK0L 4P48A 5D70H 5DJ0B 4G42A 4PGEA 2EEDA 1QR4A 4YDVB 1DQQA 3V0VA 1S7WB 1KSRA 1G7LA 5DRNA 3R4DA 1V8HA 3GSWA 4A2LA 2LVCA 4IDJL 4PP1D 3VXSB 1T0NA 2O93L 3VD4A 4IRZL 4KK5C 1FL5A 1KYOJ 2VDPH 4LPWA 4JHBA 4PTTB 3C5ZB 4KI1A 4OF6A 4P2RD 3PP4L 3VXSD 2YS4A 4WUUB 4TSBL 4L4VB 1D5MB 1UCBH 4IRSA 4ORZC 4JPKH 1NBVH 2IC2A 2NY1B 1S7QB 1TZIB 3IYLW 4P9HL 4NKDA 1T0MB 5CSZB 5C0EB 4TUKH 4M5ZL 3F7VA 2XA8H 1CVRA 4AQOA 1RZFH 1BOGA 5F1IB 1KEML 2DYPB 1KBGL 1MHCB 3KLAA 3ORJA 3LH2L 2DQUL 2XQYG 1CFNB 4ZO9A 3VFNB 5GSRB 5FECA 5FEBA 5IM7B 4MD0A 1YPZA 4WCYL 1FNLA 4HJGB 4F57H 3C5JB 1FIGH 4BQCA 3ZT7A 4QY8A 2NX5D 4PJIA 2H8PB 1MIMH 3Q5YA 5B22A 3VJ6B 4NHCH 5EUOB 1P4LA 2HYMA 2XA8L 4W6XB 3L3DB 5F7UA 3EW3B 4XX1G 3G6JE 5F3HB 3MODL 1U8LB 3LEVH 1KJMB 3OBAA 4HUVB 2GEEA 1MLCA 3MA7A 4XMPL 3RL2A 3WJJA 4D0BB 3OHXA 3CXDH 3W9EB 5I1DB 1FYTA 4L3EB 3GO1H 1XGYL 4OLUL 1NMAH 1PBYA 1ZLVK 2JIXA 3BKJH 3KXFE 3DO7A 4Y5XB 4YDVA 3NABH 4R0LA 3MNWA 5CJQL 4R8WH 3RX5A 3S88L 3VDBA 3QUZD 3PXHA 2YPLB 4GRLD 3BE1H 4JFQA 3L6FA 4JDVA 2H1PH 1I7TA 2OJEA 1AXIB 4KHXL 2BNRD 5EUKA 2PR4L 3WXVL 1A7OH 3CXDL 1UJ3C 2HFEB 5GGSB 3X13B 1AO7A 5C6TL 4Z7NE 1KJ2B 4I77L 1AGCB 3C8KB 3KJ4C 4TTGA 3QDJE 3QG6A 1J86A 4PS4H 5GPRA 3VWKA 3PGDB 1UM5H 3GNML 3R1GL 2CDEA 1MCIA 1NLDL 4BM7A 1T04A 2AJZA 4WW2F 2Y36L 2IF7A 1EHXA 4OZHE 2FZ3A 2FWOA 4LCWA 4HMEA 3GK8H 4KUCD 4LGRB 1AO7E 1T3FB 4OI9A 5KVFL 1NGZB 1JRHI 1E4KC 1F97A 4QNPF 3D39A 4XX1E 5ICZB 1OAYH 4LLDA 4OGAC 3INUL 1N8ZA 3PP3K 2VXTL 2X42A 4GW5A 3MV01 3GJFA 1A4JA 5EORH 1PX4A 3V0WL 1R3HB 4GRLA 4ZS6D 3S3PA 1TFHA 2M1KA 3SDAA 4PB0L 4ZYKA 3IAGC 3ARDC 4O00A 1CQKA 3QCUL 2A77L 4OCYH 1BVKA 1JJUA 4R26L 4OAWB 4H26A 1WF5A 3HMWH 4PJHB 5I17A 4OKVB 4JY5L 3IDGA 5D2NE 3WE6B 3Q5TA 4Y5VB 4RZCB 2CUHA 5C08A 5HYJD 4GKOA 3VFUA 1N5YL 2VLLB 5DK0A 4GS7B 3RWFB 2ILLA 1MY7A 4P4RB 1YNLL 1OGAB 1UCTA 2EDLA 3W9DA 1GGTA 4EI6B 1KJ2H 1CLZL 3QB7C 5E7BA 1U8MB 3MXVH 1FFQA 2QQKL 2EO1A 2AJXL 4M6ML 4U1HB 2BNQE 4KPHL 3TEUA 4OCRH 3BW9A 3RNQB 3HE7A 5AYUH 3TO4A 5KVGL 2JB6B 1JF5A 4LHUB 4ZUUA 1F3JB 2C4FT 4HJJL 4U7MA 4JDTL 1HIMH 4KROD 1QSVA 1YEFL 4GSDH 5KJRH 3P4MA 4XAKE 5E70A 1QQDB 4YZFF 5HYQA 4N8VA 4LLVB 4JQVA 1OHQA 1T04B 4NM4L 1I1AB 2QEJA 3QZWA 3MCKA 3L95B 2J88L 3TO2A 4PJEF 1KN4H 2E7MA 4J4PD 4NQCB 1RU9L 1MWAA 5I19H 4XI5D 5A2FA 1NCCH 1MCJA 2HJLA 3UTPD 3MJGX 2IH1B 4IIQB 1C08A 2APXA 1ZT1B 1NKOA 4HPOL 4YWGL 4EN3D 4ODTH 2XZQH 4KJYB 2XWBA 1DLFL 3D2UD 4U33A 3ZE0E 5FA3A 4QHNB 1OWWA 1AY1L 5IT2H 3SDAB 3QJFA 5LKNA 4JFQB 5IGXL 1DVFD 2C5DC 3HPLB 4HWBA 3EO1A 2WZPD 1MCFA 3HZVA 4LLQB 3S35X 2Z8VC 1UYWH 5HHVL 4URTB 4LLMA 5DI8B 4MCZA 5AG9A 4YBLC 3UX9B 3P9MA 2X1QA 3RDTD 3O8XD 4P46A 5HY9A 3I50H 3N0PB 4GAJH 3VH8A 5LQBH 3LVEA 1ZA6B 1A6WH 1HKLL 4UT9L 4WI3A 3KYAA 4M8VA 5F8RC 5I15H 5MEPA 1YMHB 3ARGA 4KH2A 4NN5C 5E08H 3B83A 1IMHC 1G7HA 1KIQA 4GKSA 4MDIB 3QUKB 3DIFA 2FYYB 4JG1H 4J6RH 4MWFB 1DQJB 2ZG2A 1OD9A 2BX5A 2YPLD 3T2QA 4BQ9A 1UZ6F 1HHGA 1CD0A 3MLXH 5FKAB 2AEQL 2EE3A 5DVOA 2JKXA 3EYQC 2X5PA 1ZEAH 2AK1H 5LQBL 1P84K 4FOMA 2QADB 1W8OA 3MNWB 4IMKC 5D1ZA 1J88A 1HHJA 5IVZB 5EIIA 2FH6A 4JO4H 3CH8A 4QRTB 3BD5A 5TH2B 4PGBB 2XWJA 4YGVB 4NKMA 4TPRH 4NN6C 1D5BA 3L3HA 1PYWA 4PJAB 3VXOA 2XXMB 2XG5A 1RI8A 4X7DC 4X83A 3BWAA 1QFUH 3S37H 5EOCH 2R9HD 3HZYA 3FONB 3T09A 1TJIH 1BQHG 1WGOA 5AEAA 1OAXH 4R7NB 3V0AC 4RGNC 3WFCH 2CK2A 3SKNB 2CLRB 2J6EH 2FLBT 4NM8H 2BSRB 2R2EB 2ATPA 4L5FH 3MLRH 3SN6N 1EFXB 3MRRB 2B8OT 3BPNB 5ALBH 1F45A 4OI7A 3MUGB 3MBED 3RZCA 1RVFH 5F7EL 3ME0A 5FB8A 1N59B 3RNKA 4XP5L 5IMKA 3JWDL 43CAB 4GAYB 2FR4A 3AS2A 5AAMA 3IKCA 5DHVH 2Y06H 2XQBH 2EKSA 4TULL 1KNOA 4DN4L 4HPYL 4YHKL 2CO7B 4Z77B 2ADFH 2NX5B 1KF9B 4JFYA 2VNCA 2X4RB 2HLFC 2EH7L 1IGFL 3U7AA 1GVIA 3DSFH 2W9EL 4YHOL 4NKDB 4MA7H 4EUPH 3T0EC 1P2CA 3E1F1 3F7QA 4X9HA 4PJBF 4YAQA 1CU4L 2G2RB 1YN6B 2BRRL 2F74A 1JWSB 3B9KC 4RFNC 1CDUA 4P3CL 1BPVA 1RJLB 4P3DA 5I8OL 2BY1A 4G7VH 5GRWA 1KFAH 5ANME 3L3GB 1KPRA 3AB0C 2NY3C 3DV6A 4CN1A 4JFXA 5DQ9A 1NGWB 2VLJB 1RZFL 1S7WA 3CVIL 1C5CH 3TA3D 2BJML 3FO0H 2VR4A 4KJPC 1JF6A 2B39A 3V95A 2WWKO 4YFDB 1G0YR 1I3VA 2HTKD 1LDSA 4LMQE 4ETQB 4KVNL 5CINH 4ODUA 5DI8A 3HR5B 5BV7C 4PP8C 1NAML 5L88H 5DO2C 5HHXH 3MLSL 5LWYL 4YHNB 2Y7QA 1SYVA 2WWMD 5IESH 4AEIL 3FT4A 1F6FB 1QKZL 1PSKH 4I3RL 3MROB 4Y1AE 5I71C 3B43A 2H26A 2XKSA 3N1MC 1T5XA 4YDJB 4YXKH 1BM3L 2ZJSH 3TBWB 4IOIB 4UUJA 1Q0YH 2IFFL 3BSZL 2YC1A 3MJ7B 1BD2A 1I85A 3BGMB 2RFXA 1VA9A 2GY5A 1UEYA 5JXAL 1DSFH 2BSTB 5EPMB 3QA3B 4F7CA 4PJFE 5C3LD 3L7EA 3OKDA 1R5WA 1L4IA 2AV7A 4MMZC 3OR7B 4O58H 5C8JB 1YYLH 5IHUH 4XAWL 4D0DA 1MHPL 1ZANH 4JZJA 4ONHA 4JZOA 5DUBB 5JO5B 1CDHA 1UKQA 2FB4L 4N5UA 4BH7A 3CDGA 1XGQB 4X4MA 4ZNEA 3HNVH 3TNMB 4H1LA 2EC8A 4GKZA 5L2KE 2FDBP 5E6IA 3ARUA 4ACPA 3TVMD 4N0FB 1EJOH 2DDQL 4LVOB 2X41A 3L9RB 1FVEA 2DYPD 1DE4A 2XPGB 4PB9L 5TQ2H 1V3MA 2W38A 2YD9A 2OMBA 1INQA 2Z9TA 4KKCC 3CX2A 3G5VB 4I0PA 3GNMH 2MMXA 3I6GB 3NCBB 2XTJE 3WJLA 3DMMA 1OM3L 2K1MA 2R56L 3L3JA 2OZ4A 3MO1B 2DLGA 1TVHB 4JB9H 3C09C 3ZHDA 4N9GA 3P77A 4RRPA 2OCFD 2YD1A 2ZCLL 2R0LH 4LPTA 5KSAC 1LO4L 5EUKB 3SE3A 1VADB 5GRYA 2YPKA 3T77A 2HVKA 5TPWL 2YKLH 4ODWB 2BNRB 4LDEB 3NH7H 2ADJA 4X80H 4PGCA 2A1WL 1X5KA 2NYYD 5EO0B 2MCG1 5DVNA 1KEMH 2H3NB 4G9DA 5I1EH 1MF2L 1M7DB 3EDFA 1XR8A 3HNSL 2NY0C 1GIGH 1OGTB 5DJAB 4JZNB 4TYUA 3O4LE 3H9SA 5CP3H 4EDWL 1TVBA 4JQXA 3RKDC 3BUTA 1NQBA 4Z7UB 1VFAB 4F8TA 1ZVSA 4PG9B 3KPTA 1NSNH 5FOJA 4D0BA 3OKYA 4MB3A 3V6FB 1LO5A 1HDMA 4PJ5E 4FQQA 1F3DJ 4C56D 3FJTA 2YD2A 4J3WA 1CDCA 4MS8C 3KR3H 4U3HA 2YRLA 1BHGA 1HH9A 4JEGB 4ZO6A 2GITB 4EI5D 2UZYB 1QQDA 4KPHH 4R2GC 1CFQB 3MUZ1 5M7QA 4CVWA 4ZOCA 1DVFC 3IETA 3VXUE 3U30C 3U30B 2ZUXA 3REWB 4KMLB 2XT1B 3SEPA 1TPXB 4Z0XA 2AP2A 1W8NA 4ELMB 1F00I 4C59B 4OGYH 3DVFA 5KVEL 1HXMB 3GBNH 3RGHA 1DZBA 5J3HD 2V5MA 5BW7A 5TDNB 3VXUA 3GMNB 4KTDH 1LEGB 5C0FA 4MAYD 1I7UA 1A7OL 4LPVA 5KSBA 1F4AA 5E8OA 1BZ9B 2NW3A 4X4ME 3FQNA 3G9VA 3SQBA 3TO4C 4R4BA 3QEQE 2NY0B 1FJ1A 2AGJL 3IXAA 4O4YH 2P44B 3VFPA 1RZGB 5FHBL 4N0CC 2JELH 3SGKC 3FONA 2E9WA 5LXGL 5GGQL 1XMWA 3BYTA 3SKNA 4X9GA 3D39E 4WCYH 3WN5A 2MQ3A 4M7LT 4MQSB 1T5WB 3AROA 3SKOB 4ZTOL 5F6HI 3QXAA 5FO9B 4EVNB 2B5IC 5ILTH 1RZ7L 4Y2DA 3I3DA 2VRAA 3NZHH 3QHTC 3SCMB 5SWZD 1NCBH 3W0WD 4F3FA 3NIGE 4PRBB 4QWWC 4Y5YC 1UVQB 5HHOD 3W5MA 1A21A 2VDQH 4XVTH 1IEHA 1M71A 2WBWB 3ARRA 1T83C 2RHEA 3QG7H 4G6JL 3RWCB 4KRNA 3K8LA 3WIFB 1E4XL 4L4TE 2EDWA 4P2QA 3TYFA 1NFDE 4UILH 1A9EA 3VFGH 1U9KA 3NZHL 3OKOB 1A7QL 4FQHB 3RWIB 3RWEA 3C6LA 3UPRA 1JMXA 4L3ED 1EIBA 1YJDL 3UJTH 1UGNA 3GIZL 4L29B 1HSAB 4M6OL 5DC9B 2CRZA 1IT9L 4OCRL 5F1SA 4NZUL 4Y8DC 1ZHKA 4M93C 4JFXB 3QNYB 3ARGC 1KELH 5TDOB 2ICWA 1KIQB 3H9SB 3PL6A 2YWYA 3MRNB 1TETL 3VD5A 5INDA 1UG9A 1I9RH 5GGSA 3ZKND 1IGMH 4NRYA 2PO6A 2EYTB 3O45B 3QHZH 1J7VR 1HILB 3GHBH 3OX8A 1A7PH 2XWBB 4NM4H 2NR6C 2BK8A 3GMRA 4OUUB 1TQCC 3NTCH 1K4DA 4DKFL 3G5YB 5EZOL 3HNTH 4M7KH 1KPVA 2FNBA 4LHUD 3WFEL 4ZFFB 1JE6A 2H2PC 3AMLA 3Q3GB 2Q8AH 3BDBA 5F21B 1F13A 4P4KA 3WL9A 1FAIH 4L3EA 5ICXA 4GW1A 5IFJA 4HWNA 2Z31D 1CE6A 5GZOD 3ROLA 3VG0H 4QHKI 1QFPA 3IJYA 4PJCA 3VXQB 5KS9E 5ESVB 1P7KA 1JZ3A 3MA9L 2WWMC 2YUWA 4QYOB 1UC6A 2NX5E 4JG0L 3MOBH 2GKIA 1HH6B 3MLTA 4JKLA 3CZFA 4J3OC 1FZJA 1RK1A 5GGTH 1V7ML 2C3XA 1EEYB 5CIPA 2NW3B 4KJQC 4LVNC 3B6SA 5KOMC 2RBLA 3EOBA 1E28B 1E4JA 1NC4B 1QLEL 4HHAB 5AZ2L 2BVQA 4HUUA 3VFNA 3P4OA 5D8JH 4RGNB 3TNNB 5BOPA 3RWIA 4L8DA 3AREB 1CZ8L 3LKNA 5B8CC 4HUMB 3ROOA 5K33A 3RJQB 4LIQL 1XGTA 3GUTB 5JPNA 5B4MC 1I4FA 2Z8RA 1QR1B 5D1XD 3S34H 2WBJA 1JNJA 1U8NB 1JI2A 4NKOA 4XBGB 3TP4A 5HHME 1RD6A 2R0WL 3RUGB 1JZ4A 4UUJB 3BZFA 3OJVC 4H5SA 4K8RH 5HHPB 1Z0MA 2BNUB 2XZZA 2MKLC 1ETZB 2X40A 3DGCR 5DRWB 1LWRA 4U1IB 3RTQA 1PKQA 4YEFA 5DA0B 3OX8B 4WW1A 5EBGA 1FPTH 1K6QL 1Q1JL 3WBDA 5ITFA 3STBA 5HXMA 1YEKH 1FBIL 4L1DA 5FYKD 2KPNA 1EXUB 4XNQA 3HAEA 3TNMA 4K3JL 3KYNB 5FHAL 5DJAA 2O5YH 5C0JB 3DTXA 1KCGC 4NZTL 4F9LC 1CLYL 5EU6B 3NPSC 4YO0A 1Q72L 3BVNB 1O0VA 1TENA 4AIZB 4M1CD 1FFRA 2HFGL 1ACYH 2O5XH 5D1QD 5FDYA 3VCLB 1RY7B 2XTJB 1LO5B 5CEZL 2FJHB 3OF6A 3SGDI 1TNMA 1NFIB 2EXYD 3PGDA 2XN9D 4P5KA 2PTTB 1BFTA 1H8OA 4M1CC 2B0SL 2GK0A 3WFHB 5JHDE 2F5BH 4OV5A 3KPLB 1YN6A 3QFDB 3MJ7A 4K3JH 4NSKA 2FLRT 2CRYA 5C0BD 4XTRD 4DN4H 2P8PA 3G5XB 2HKFL 1Q72H 1A1MB 4G6FD 4U49A 5E4EC 4LNVA 4NUJB 3VI3F 1OAQL 3UXFA 4XT1C 4YFLI 1D6VH 2F9BT 4EDXA 1FNSL 1JUFA 3DO7B 2YOCA 1BAFL 2OQJB 4OV6F 2EDBA 4I0CC 2YEZA 1IM9D 5FB8B 2JB5L 2IADB 3P3YA 2ZCLH 5ANMA 2BNQD 5DRXB 2GY7B 1G1YA 3QQ3A 2P42B 1Y6NR 2A6JA 2CDFA 3QPXL 1UEMA 3I9GL 4JM4H 4GW4B 3KJ6H 1MCQA 3T1FB 4FQXA 2XPGA 3O8XC 2GJZB 2DS4A 4RAVB 5C0IA 1MCEA 4ELKA 1ZSDA 5JORA 3IFOA 4HJ0C 2ERJB 1K5NB 3R0MA 1WFOA 4KUZH 4EN3B 4J12A 2P5WD 3OPZH 2VLKA 1CXIA 1SBSH 2X7LB 1NAMH 1YQVH 3EOAA 4QF1B 4PRIA 1RZIB 1RAMA 3SCMA 1A3LL 1B0GA 2IPUK 3K4DA 3KJ6L 4BUHA 2ZUQB 1F3RB 4NKMB 1A6ZA 4H20H 1NLBH 1I9JH 2L0DA 5KVMC 4MS8D 3GSNL 1MRCH 4M48H 3NZ8B 1S7VA 2EZ0C 1DUYA 2QLVB 1BD2E 1QLFB 2XXCB 4PGDB 3U9PL 5CEZD 3PJSA 4FFYL 1UZ8B 3QUYA 1DSFL 5GS1A 1BWMA 3T0EB 4BKLA 4QRRA 3VMOA 4Y4FC 3WFZA 2ADFL 5C2UB 1L9MA 5B39B 2NXZB 3QPQD 3MV9D 1AHWC 1D7FA 3LB6D 3VMNA 5DWUL 1XZ0A 2B4CC 5TF1H 1HI6B 4UQ2A 2KQNA 2WIMA 3Q48A 4X7EC 3TV3L 2ZWLT 5JZ7C 4HKBA 4MAUL 3D3VA 1NFKA 2PCPB 2NY6D 5D1ZD 4F7EA 1UH2A 2LE9A 3ILQD 3PV6A 3DGGB 2RFXB 3G6DH 4ERSL 1FP5A 5JA8B 2IBGA 1PZ5A 4F9PA 3SE4A 1S7UA 3SPVA 1UWXK 1XGRA 4LLQA 5JPMB 1T89A 2MSPA 5DXWA 2Y5EA 4KK9D 4NFCA 1T66C 2PW2B 2BJMH 5H94A 5EN2B 4LHJB 4CDGC 1YEIH 1KPVB 1A8JH 1GHFL 2VE6B 4AIXA 4ZUSA 3UTSD 5HDOA 1NEUA 1NKRA 4LAQL 2VQUA 1AC0A 5I71B 1CBVH 1JNHB 4WHTA 1Y6KR 1NJ9A 2CGRL 4L4TA 3MLSH 2FD6L 3F65A 1LO4H 1HOCA 1OY3B 4G9FA 4MDIA 2X4NB 3ARDD 4KKBC 3UROR 1FDLL 5FFLA 2ZKHH 4Y89A 3V6FA 4WWKB 4WWKC 3BKML 4RA3A 4PJIE 2DQUH 2CIIA 4HWZB 4MA8H 2F19H 4QOKD 4G8FB 1JNNH 3RWGB 1AHWB 3SGKA 1MCWM 4QRRE 5D71H 3X12A 4D2NA 3MRKA 4HFWB 3KPRE 4I0KA 5ERWB 5FYKL 1NSNL 1OP5K 4JO2H 2PO6D 1G9EA 2ZNXA 4XWOC 5EORL 3L5XL 4QT5A 4FXKB 2WQRA 5EOQH 1AC6A 2NY4C 1ND0A 1KXVC 2F5AL 4PB0H 2BP3A 1FNAA 2BNRA 1D9KC 5LAXA 3N06B 1KB5A 3L3OB 1KEGH 4R26H 2ARWA 3IJSA 3W11C 5DVLA 5GJSL 4LKXB 3ROOB 4WGWB 5FDWB 2D7NA 1RUAH 4GXUN 3MV8D 3PP3H 4JFPB 3VFVA 1FLTX 5CGMA 1CFBA 4OIBA 4C56B 1LP9B 4WJ5B 4JKWA 1Y0LA 1UXSA 4LSDA 3QO1A 3VFSA 3S88H 1KTLA 5T3ZH 4F15C 2J5LB 1X5YA 1ES0B 5F7DB 1B4RA 1YY8A 1C12A 1ZVHA 5K9QG 1KB9K 1J8HA 4OCLC 2D7QA 2DM7A 5IK3A 1G7LB 4F7MB 2GFBB 2GTWB 5C6TH 4C4KO 5ANMB 3E3QE 3VI3E 4NUGL 3CLEH 1RIUH 3EO1B 5CJBA 3O3BB 5KJRL 4Q9QL 2AV7B 4NJ9H 3CMOL 5ALCL 4Q97A 3IKKA 2OZ4H 5DTFB 5H2BB 3RAJH 3HNSH 4F58H 1HXMA 1JGEA 2AXHA 1KN4L 5IVXA 4QHLA 5E6IC 2DQDL 3OKMA 4NZDA 3KS0J 2D03H 3V5KB 2W0KA 1UACL 4QCIA 1C1EL 4JRYD 3VI4F 3C9NB 2VUOA 1JGVH 1DVFB 3ZYIA 3QDMD 2I07B 5E5RB 4JAMB 4Z0BL 4Z18A 1J8KA 2VXQH 4LSTH 4QT5B 4U1LB 5T1MB 4NSKB 2IANA 5IWLC 4ODUB 2YN5A 1I7RA 4PRDB 1QHPA 3X3GH 4RWHA 4IBLT 3TBSB 3ZE2E 4I5BA 4UDTA 4CDHA 3HMWL 4GAGL 1XF4B 1WVZA 2YMXL 3BXNB 2GI7A 3QG7L 4G6JH 1LE5B 3EDDA 2J5LC 3VGAC 3F7YA 3TF7A 2FEEL 5CHNB 2WW8A 3MGTB 4KDTA 4MVBC 3CFJA 5DUPH 4LCWB 1JPGA 5C1MB 4Z0BH 3CFKB 4LF3B 5KN5B 3UO1L 1CD1A 4F37F 4J4PA 4ZQKA 3X3GL 1RULL 5T5NG 4JM2B 1CL7H 1T1XB 1J8HE 5A2JH 2H32A 1B2WH 3SY0A 3DX6A 4PRAB 4Y4HB 1K6QH 1Q1JH 4M3JA 2R29L 2HVKB 2GTZA 3PGCB 1HNGA 2P5WA 3WFDL 1QFWL 1QSEE 4Q74A 4BFEA 1HQRB 2PKDA 2NY7H 4P57A 1DEDA 4XBGA 2XV6B 4NNXB 2HMID 2I27N 1X6NA 5IB4A 3O2WH 4I2XB 5IBTH 2FBJH 1CL7L 5EZJA 3EOAB 4QF1A 3MCLL 4X0KA 5IW6A 4GRMA 4NYLB 4DKFH 5HGBA 4UDUA 4RGOL 2NTFB 2E7LC 2CIKA 4HK3J 1SEBB 1RZKL 4KK5D 3Q1SH 4ZOAA 2OP4L 3MZGB 1I1AC 3L3IA 1FZJB 4OGZA 5F7KC 1VFBB 3MV7B 3R1GH 3TIDB 3VG0L 1DLFH 5I75C 3CDYA 3O2WL 1WEJL 3L3DA 3EOBB 3RVVD 3NFNB 5CJ8A 5D7JA 2ICWI 1A7NH 1CIUA 3VRLF 3LOWA 4P2OC 3IU4L 4U7KA 2VR9A 3O9WB 1G9NL 1MHHA 4S0SD 2GCYB 4RDQF 3WJJC 2O5ZL 2BY3A 3QDJA 1IAKA 5F70A 4E41D 3HG1D 3MJ8A 1I4FB 4NQSA 2RR3A 5DSCA 4ZAKB 3T4AB 4M00A 1QLEH 4UMGA 5C0FB 2ZUUA 1WEJH 4P59H 1YYML 3CK0H 1UKTA 3QPXH 5GGSY 2QL1A 2W92A 3BOVA 3CVHA 3BRGC 4UU9B 3JUYA 1K2DA 4UINH 1MREL 3FT4B 3UBXG 5L2JB 1TMCB 1IQWL 2Y25A 1RMFL 2Q76B 4PRNB 2V2WB 2QV2A 1D5IL 3ILPA 1TZHB 1KJ2L 3GRWH 1C5DA 3LMJL 1NMCB 4QXUH 4RFEB 2HA1A 3TZVA 5LGJA 3MRCB 3T2OA 2W9DL 2PETA 1PEWA 4H0IA 3VA6A 1NBQA 5CSBA 1IM9B 4WI4A 4KK9C 4HCRL 4PJ9A 3EYVA 3NOIA 2WBKA 4UDTB 5I1GL 1U93B 3OMZA 4M9PA 2NY5H 3B9KD 2GTWA 2R0KL 1WBZB 3E3QC 2WQ8A 2VAJA 1QRNB 2AK4B 5CJXC 5JW4N 4I13B 3RHWF 5J12C 1S9VB 2VLJE 2APWA 3HS0B 2X4TA 4JFEE 3CH1A 1DCLA 2WUCL 4S1SH 1MFAH 2D7TH 4BELD 1A2YB 3SDAC 4KK6D 2Z91B 4Z7WF 1YC8A 2E9IA 5KW9L 3EKCA 4K3HA 5B3NA 3O2DH 1CWVA 4GLRI 4R4NC 4QRSB 3QEQB 1RK0B 4Q9RH 3JV6B 2PXYA 5JQ6L 2C9AA 2DB8A 4ZD3L 1IGYB 5SWQA 1Z0NA 1IAKB 1FZMA 1DUZA 1TJGH 2YA0A 3FB8B 5FCUL 4HF5L 1MLCB 1I3RB 5HJ3A 1TVHA 5I1KL 2VDOH 2ZNWA 3FB7B 1ZGLM 1EO7A 3QUYC 2XKUA 3VMPA 4I48B 1KGCD 5FA4A 3QDHA 2WUBH 5AD0B 5ADOH 2UWEB 1NC4D 3CC5A 3UEZA 5IJVA 1M7XA 4LCUA 1FSKC 4NO5A 4HIXH 4C56A 4HV8B 1WCQA 4ALAL 4IRSC 4JLRB 2UYLB 4LVHC 3U36A 3JV4A 4JDZB 1XF5B 3TIDA 4FXGB 2YRZA 2XG4A 5IW3A 3V79C 3IJYB 4PJCB 3SKMB 5DRWA 1DDHA 5DK0B 4HLZG 4IHOA 2OR8A 2ZOKA 1A9BA 3MREB 4DN3L 1B0GB 2VXUH 2JCCA 5A2LH 2D7PA 3UDWA 3C5JA 2APTA 5HYSB 2F19L 3X13A 4XVSL 2PW1A 4L9LB 3KXFB 2ZG1A 3NCFB 2G9HA 3FFDB 2Z93B 3I6KA 3UJJH 5C70A 4Y8AA 3O6FB 3KWWA 2BXYA 3IFLH 3BIKB 4I3SL 4NQDE 3QCVH 1WCBA 5GGVY 2BSSA 2DM4A 2UY7A 4M5YL 4XMKH 3QJHA 4FABL 12E8H 2OM5A 1YMME 4Y16C 3DJ9A 4TVPH 5KOVC 2B0SH 2NW2B 1ZS8B 2FSEA 5DQDH 2HLAA 2JE8A 1YMHA 4ODHH 3IDUA 2X1XR 4PLNC 3B9EA 2AJ3A 4O58L 5HY9B 5C0GA 4R0LC 3TT1H 3MPCA 2AEWA 2UWEF 4M5YH 3T08A 4Y1AD 3X17A 2OL3H 4D8PB 4M7JL 5ICXB 3EIFA 1EEQA 2EICA 5HHPA 1RHHA 4RFNB 5FYJU 4QY8B 4UB0H 3V7AE 2C1OA 1D9KA 5DQDL 1ZHLB 2DWEB 5A3IC 1J1PH 5EFIA 4ZUSB 2ZSWA 2WANA 3QO0B 1UM4H 2NY3B 1OF2B 3OR6A 1BF8A 1MFCH 2VDNH 3O3DA 1K8DB 2NLJB 4XNYL 4U1MB 4UBDD 4MJ6A 3V4PL 2JCCE 4FS0A 1MRDH 1EGJH 3BAEH 2Q86B 5GZNC 3RAJL 1S7SB 1R5VB 1DBJH 1S7RB 3A6OA 5D5MB 5IW1B 4LAQH 2CLRA 1KUMA 4Q2ZB 5DD3L 4HGMA 2R0LL 5I1IL 1C12B 2E6QA 3STLB 1ZHNA 4Y4HD 4DUXA 3B4NA 1EFXA 1DL7L 5D7IA 2BY0A 1IZKA 3CDGB 1UACH 2GJZA 4RSVA 3C09B 1C16A 4WO4C 1IILE 5EB9A 3F5WB 1JWUA 5KSAB 3WS3B 2VL5B 1JP5A 3TH2T 5I18L 4GKNA 5BVJB 2QQNH 3HUJF 5EO1A 1LDPH 2ADGB 3QXDA 1YUHB 2ZUYA 3PWVB 1DBKL 2DRUA 1BBDL 2PYEE 4PGDA 5ECJE 2GIYA 4Z7UF 3BN9D 3RVXD 4K94H 4P5MB 3IJSB 3BEWA 1J0HA 1HCVA 1BWWA 4H1LH 4Y5XC 1T7VA 5J9PB 3CCHB 4MNQA 32C2B 5FDWA 3MXWL 4L4JA 2V5YA 2X89A 3IDYB 2A83B 4NBXB 5IB3B 5I74B 2V7HA 3K8MA 4NRYB 4R4FH 3MACL 3OAZK 4PJFF 1JZ6A 2ESVA 1CLOL 1JTPA 2VDQL 1D5MA 2P48B 3SO3C 2OI9A 5E8NA 1CGVA 3V8OA 3EYSH 4HK0A 4MNQE 5MP6H 3T1FA 3WFDH 1EFQA 1CIDA 5JOPD 4R2GB 1MHPH 1XGQA 2XZAL 4YHIB 1AE6H 3RWDA 3VFTB 1A7QH 1HHKB 3HB3C 4M3KB 4BH8B 4U1MA 5E5UB 1PJ9A 4FFVC 5EU7E 3RUGF 4E41E 3ILPB 1CICC 4XCEB 4XP4L 3RPIA 2I24N 4KC3B 1ZVSB 4QWWD 1B4JH 2KQMA 4P3WA 4PFEA 4G42B 3NGBB 2DQIL 4Z5RA 2YD8A 1OD7A 4PRHA 5GRVL 4OD1L 2OP4H 5CD5D 2XNAB 5I6XC 1FGVH 1VKXB 1NAMB 4LGSB 1A2YA 3C08H 4NQTA 3QHZL 4UZGA 3WHXA 1IVLA 2VXSL 1K2DB 4N9OB 3I75B 4MNHA 4XP4H 3BIAX 5FGRA 4D3CL 4G6AC 2IPTH 3F7PC 3CFIC 1FLRH 3RGVC 4R6UA 4OD2A 5F9JB 2PXYD 3R06A 4LCWD 3WFEH 2JIXB 1NDMB 3GGWA 4FZEH 4CMMB 3PWVA 2OR9H 1E6OH 3PDOB 3FQUA 1XZ0B 1J9CT 2FJHA 4FQIH 1MELA 1W72L 4MJIE 4I48A 3L95A 4P9MH 4KV5E 1ZTXH 3UTTE 1MWAH 2OTUA 3IKCB 3D3VB 4P2QE 4D3CH 1ITBB 2IPTL 4JN1L 3SDAD 1FVEB 1CD9B 1UZ6E 4U1IA 1DQTA 3SDXA 4DGVH 1PG7W 4U6XA 1ZVYA 4I18A 4RGND 4XGZA 1AGBA 4P2OA 3S35L 2APVA 3M07A 4YAQB 1N7MH 3CU7A 5ITFB 3ULVC 1ROWA 4YUEH 3V0WH 2Z31C 3CFCH 5HYJA 2PYEA 4UQ3B 1D5IH 5C07A 4IJ3B 3VXTA 1W0YT 5EU4B 1WZKA 1LD9A 4JFPA 4ZTPH 4I0PC 1DDHB 4ZFOA 4NNXA 3BP6A 4JN1H 2W91A 4NZUH 5FUZH 3MYZA 1R24B 1PYWB 3D0LB 5EU7C 4X6DA 1C5BL 4K8RD 1KELL 3ULUE 4YDLB 5E00B 5GGRY 4NDMB 5CBAA 4OLZL 3LKSA 4ZOEA 3OKEB 3P30H 3UTOA 4K07A 4FFZL 1G0XA 1P4BH 3TGXA 5SWSB 1FZOA 5F7YC 5L8JB 3QDME 3ARGB 4K9EL 2A6KA 1BVKB 1LO2H 2FYYA 2PYFA 1SEQH 3HFMH 1TPXC 1QEWB 4LOUC 1DE4B 4ONGL 5SWSD 5ETUA 3RUGE 3WNMA 5K9QI 2AAVA 3F6IA 5B4MD 1S78D 1T7WA 2VIRA 4LFHG 5ESAB 4YX2H 4TSCH 1P4IH 4WU5B 1UA6L 4G6KL 1DJSA 4JQXC 1KG0B 4L8SA 4PJ9B 1XCTA 3DI2B 5GHWL 4NO5B 3S9DB 4LHQB 5TE4L 5FGCE 4AG4H 4K7PY 1PKOA 3TIEB 1DQQB 3ULVF 4S0UC 1HHJB 1CLYH 4PJGF 3JVGC 4L4TD 1SYSA 4ONGH 1AGFB 5IEHA 5T1MA 2ITCB 4LLMB 2XI9A 3GIVA 3KPPB 4P3DB 1DVFA 1SJEA 2AV1B 4IEFB 2ZUTA 3IT8D 1BGXL 3T2PA 3SDCB 5HYJE 4NWTL 5JLZA 3ZL4L 5BQ7A 1JFQH 3W0WE 2X2YA 1J5OL 5F96L 1VKXA 4OQTL 3QCTH 4X6BA 2JJVA 4F7TA 4O2EA 3JUZA 4GUPA 4WEMB 4HT1H 3PV6B 3TZVB 4RFEA 5D7KE 4UT7H 5DURD 3F7YB 1NFDF 5J1AB 2D2OA 3MNZA 1F4XH 3MC0A 2X4OA 2R0WH 1MAKA 5HHQB 1XIWD 4HS6B 4XPTH 4DAGL 1U8PB 3HLAA 3QWOB 3TCLA 2DI8A 1XGPA 2V2XA 3PWUB 2D31A 4NN7B 5E95B 4GAJL 4YHIA 5B39G 5TE6L 1YJDH 3CFEA 2EECA 1RIVL 2V9RA 3FT3B 5AYQA 5I8EA 2BOCA 1U3ZA 4EI6A 1W2KT 1LHZA 4XBEL 1LQVA 4TSAL 3EO0A 5DQJB 3GB7A 3WMSA 4G5ZL 4XPGL 4HG4K 4KJWC 4Y2DB 1NCAH 4A2MA 1FE8L 3VG9B 4Z7QE 3E0GA 4KROC 4QHKJ 3GSRB 4JE4B 5K59E 2JJWA 4UIKL 3SDCD 4JR9H 4X4YB 5FKPA 4IRSB 3G5ZA 3O9WC 3AM8A 4X4ZA 3BDYH 1JGDB 1A7PL 4UQ3A 3GUTA 4TQEH 1EUUA 3KLHC 4B50A 3V6BR 4D9QD 2O5XL 4OB5L 5KN5A 1NLBL 1Z5LB 3CDFA 4H20L 4J4PC 1QYGL 3BESR 3O2DL 1YZZA 1DANU 3ILQC 5E1HB 1XCQB 2GT9A 4RAHA 2Q8AL 3UC0L 2UWEA 3CC5B 5AD0A 4GBXD 3UPAA 2IGFL 4JR9L 4LVNB 1EFXD 3MRIA 3PDOA 4DKEL 1I1YB 2H9GB 3VI4E 1C16B 3BDYL 4GQ9L 3WYRA 2BRQA 1E27A 3IVKA 3CK0L 3EFDL 3CZFB 4OFYA 5C0RL 1HSBA 4OZFB 4Q6IA 1KCLA 4L5FL 4OBSA 3BJ91 1EEYA 5C6WH 5FYLD 4G9FB 1NMCC 5F1NA 1MCOL 5CD3B 2B20A 5F6HJ 1U8KA 4LDOB 4PJDF 5MEND 1YNTB 2VDPL 3QA3A 5JXED 1JN6B 2I9TB 3PP4H 5HGAA 3CGTA 4UOW0 3MQIA 4YBHA 2OTWA 3TN0B 5IQ7L 4KXZH 1S7TB 5EZJB 4GQ9H 4EJ1C 3WNLA 2QADD 5A1AA 2QSTA 1H15B 1WT5A 4JPKL 5JW4R 1AXTH 3FTGB 4R0LB 5EFIB 1SM3H 3VU2A 3ELAT 2DI7A 2R39A 5E1AB 5MEOA 4D9QE 2P7TB 4LK4A 5I73B 4PRPB 3ULSB 3QUZC 1VESA 4JPIB 1FFOB 1CDJA 3WIHL 3GIVB 3KPPA 3WXWH 2VOTA 4I3GA 3LKQB 1E4WL 1ZE3C 3RX8A 4APQC 3JWOH 2I5YH 1VEMA 1ZS8A 2HVJA 5CAYB 5I1HL 5FM8A 2AS5M 5DVKA 2DICA 3E6FB 2B2XL 5E8NB 4W4OC 4NQVA 1P84J 5T3ZE 1HH9B 3PQYE 5DHVA 1I9JL 3KPRB 4E41A 4S1RH 3VFVB 2B1AL 2CQVA 4GLRH 5MENB 5L2KD 3NCJH 3QH3B 1OAUL 5T3XH 1MFNA 5B3JE 3G6JA 4ZAKD 3KDMA 4PJDE 4AEHL 1I3UA 5J13C 2XIDA 3TBSA 3U6RB 5HYSA 2ADJB 5JHLH 2E7LE 3RZCC 3WKNA 5JUEH 2LU7A 1QKZH 2H3NA 4G9DB 1RFDL 4TTDC 3ZT6A 1WZMA 2C3VA 2Q6WB 4YXKL 1HHIA 3OAUL 1JGUH 4IS6B 2VLKB 3SE9L 1HXYB 4LQ1A 1BF2A 2XQYK 3U0WH 1QG3A 4Y5VA 3ULUC 2X4SA 1T7YA 3CDCA 3FQRB 2UWEE 3TVMA 5T3ZD 1UM4L 5ITBH 2DMCA 4PJ8D 1J1XL 1ORQA 3CVHL 4Q7DA 4HIEB 4WFGE 1WBYB 1CGWA 4HAFA 1CXHA 5F8QC 5L2KA 1FNHA 4MA3A 4RMQA 1DN0B 4MD5B 3P4NA 4OTXL 2NCMA 2YUXA 2NTSP 1GGCL 2WSKA 4K23H 4MX7A 4PJEA 5DJZA 2A6JB 2CDFB 3QQ3B 3W5NA 3O6LL 1E6JL 4U1GC 5BZDA 4MQTB 1HZHL 5IJKC 4ONFH 1M05B 3U7YH 4KVCH 3HC4H 5HI4C 1A6TA 5TF0A 3P0VL 3S3JA 2EDKA 3WNOA 4LRNH 4OLWL 1U91A 1WTGT 3QNXB 1J1OL 2P45B 4RCAA 1W72H 2IAMD 5C0EA 1OSPH 4LHUG 4CVUA 5H37H 2QSVA 2X7LA 5CGYC 3TBVA 3QIWA 4IRJB 3TFKD 4JFED 1G6RB 4AL8L 4NFDA 5EU3B 4OF7A 2HFTA 3CMGA 3P9LA 3ARFB 1SBSL 3F62A 2DQCH 4ZQKB 1S7XB 5LBSL 2ZCKL 1HYSC 3MRJB 4Z76B 3RGVA 3RWJA 4PUBL 5C2BH 4N1HB 2D03L 3C6LC 4C56E 5F3BB 3BKCL 3B5HA 4XWOD 4YHNA 1JZ5A 2GHWB 2VQ1A 1GGIL 1Q9LA 3CSYA 4OZIA 2JIXD 3ARDB 5C0ND 3KYNA 1YC7A 5CUSH 2AJXH 4MB4A 5BJTA 5FGBC 1FG2B 4DVBB 1HOCB 2V9QA 5EU6A 4X6DF 3S6CA 3C60C 5A2KH 3QNZB 3QI9C 1S9YA 4MCZB 3MA7B 4NQXB 3RL2B 4HKXA 2Q8BL 1MH5A 1IAIM 2PNDA 5ETUB 3HAEB 1GGBL 4YHLL 3KXFA 2IANE 3QUXD 3D2UA 5CMAA 2HJFA 4PGZA 1TQBB 2OYPA 1U3YA 3K2MC 5CLTA 3KR3L 1YY9C 3T77B 1D3CA 1JTTA 2BSRA 1ORQB 1VENA 5CJQH 4FA8A 1HKFA 3BFOA 3QUMA 1NAMA 1K8IA 2XZCH 3WDJA 1EBAA 3FFCE 4YJZL 2BMKA 3HRZB 4PRIB 1FN4A 3O6FA 1YY9D 4HFUH 3DYOA 4TSBH 1RU9H 2HN7A 3TPUB 4PV9B 1F2QA 3BPOB 2JJTA 4LASH 1NGXA 1CF8H 1CGUA 4XHJC 1U6AL 3EYQD 3SCMC 1QZ1A 3V7AG 5CILH 4IJ3C 1KBGH 4MMXC 1TDQA 1IM3A 2X4PA 3AFLA 1LK3H 4JLRA 3I6GA 4KZEL 3HE6A 5KSAA 5DRXA 1FLRL 3HI1A 1CBVL 1WZ1L 1G7MB 4HS6A 4XB7A 1YPZF 8FABA 1KIUA 3LY6A 3UJIL 1RZ8B 4FXLA 3F5WA 4LSSH 4PJAF 2RCSL 3P11H 3HA0A 5FO7A 3C2SA 4JVWA 4QRSA 4UAOC 2YK1L 1QFWI 2VYRE 3CFBA 5DHVB 1ZTXL 4NO3A 4S2SB 3KLSA 2V7NB 1JHKH 1WTLA 4M93B 4JGJA 3RTQD 2MCPH 3V4VL 5D71L 3O2VH 3QUMH 3T3PE 1S7RA 3OR6B 4QTIL 4X4YA 4OV5B 1LEGA 5B38G 1ZAGA 3HZMB 5KG9A 2A73B 5DEFB 1PW3A 1R24A 1TJHL 2EDJA 1LE9B 1NC2A 3MR9B 4Q9CA 4LLAA 1PY4A 3SDXE 4D0CB 3S5LG 1CLZH 3O3AB 2XY2A 5EZLA 3T0EE 2GUOA 4H8WH 2X4QB 3ZKNC 4YNYB 1OTSD 4XVTL 4ISVB 3NFSL 2BMKB 4PJAE 4EZMA 3FO1A 5HI5D 2N4IA 5F6IC 4NRZA 1E4XH 3W9EA 3SDXB 4WHDA 4RGNE 3CLFH 4S1QL 1FL5B 3JWDC 3RPKA 2NY7L 1MJ7H 1I1CA 1FFOA 4NC1E 4OFYD 2MNUA 4PJGE 3IDJA 2QADC 3DUUB 3PWJA 5CD5C 3GIZH 3G08B 3SJVB 3GK8L 4MYWB 4X6FA 1L6ZA 4PY8I 1LE5A 3GSOA 4Y4KD 3QFJE 1S9XA 5T1KA 3VXNA 3MLYL 3MUY1 1JHTA 3HB3D 3HUJE 4PJHF 4UTBH 5I19L 1RZKH 3RUGA 5I0DA 4NJAL 3VRLE 5I1GH 1MCKA 1Z3GL 5HYFA 1DUYB 4HWEH 4XNXH 4NN7C 4WFED 4O2FA 3TBTB 1IBGL 3H9ZA 3R8BB 3WN5C 3OKMB 2A77H 4OCYL 1M1SA 5D5ME 5LVEA 4YHOH 3ARXA 2DQDH 4NKIL 1N0XL 1H5BA 2HRPL 4XNQB 4ZSOB 1Z3GH 4YDIH 1BFOA 5E5MB 5DZNA 5JQ6H 5J6HB 2DOCA 2IQAA 3G6AA 5DMGD 5ID0A 5GQBA 4XNXL 3EO9H 2GW5A 5FYKE 3X3FL 1KFAL 2NY2D 4HF5H 3ISWA 4ZTPL 5KTEH 2N1KA 4MA3B 5EO9A 3ULUL 1QLRB 4N8VB 1IC1A 5CIPH 3MJ9L 1E27B 3IVKB 4JHWL 1MCBA 3L3IB 4XPAL 2VDRL 3PL6D 3CX5J 4MX7B 3V6OE 8CGTA 1AGEA 3QUXA 4U6HA 1MUJB 1WSST 3BZ4B 5GGUA 3WIHH 3AVEA 4PYHA 1JRHL 4HZLB 5C0CD 3FL7A 3SDXF 3VFUB 5LCVH 5IFAL 5E6YA 5IB3A 2KUTA 5IOPB 2XKNA 4HMDA 3GRWL 3VE0B 3TWCH 2CXKA 3EAKA 3LD8C 3QQ9C 1ZT7A 3UO1H 1LO2L 4H26B 1G7PA 4AH2B 4ODVH 3G5ZB 3VFRA 4PRAA 3ULUH 1BZ7A 2ED8A 4LKXA 3U1SH 4OLXH 3QFJA 4IDLA 5HHMA 5KANG 3LQMA 1T1ZB 1BM3H 1JTOA 2ZJSL 1F90L 3F12B 1GC1C 2SEBA 4U2ZA 1IC5H 3EBAA 1GGUA 1MLBB 1F6LL 4XC1H 5EC2B 3WN5B 4I18C 3C5ZD 4I18B 5TDOA 3PGFL 3QUZA 4ODTL 4NQDB 3BPNC 4RMRA 2ICWJ 1XT5A 4ELMF 5ESQB 35C8H 4Z78A 1NGZA 4UOJA 1XGPB 4CN6A 2FBJL 4JFFD 3O3UN 5DGQA 4HHAA 4RBPK 3N9GH 1TCRA 5BRZA 3CFEB 3BZDA 4U1SB 3LEXB 4G8FA 3H3PL 4FP8L 4HMCA 3CFJB 3SDYH 4GW1B 5DMJB 1RZJL 3DIFB 5FUOH 1TVBB 4ZXBA 3FO1B 1URLA 4TUJB 4DOHB 3QZWG 3FCTB 5HVHC 5ELIA 4JGUA 3O3EB 3CJJA 4PG9A 5DJCB 3QDGB 2VLME 5CCKH 2X70B 2Y06L 4F9PC 2YXFA 4QOKE 2ZOLB 4PD4K 4QHLB 4JRXA 4RIRB 2MWCA 3I6LD 3N9GL 2EH7H 4X6BB 4L8BA 2H6PA 1MEXL 4IIQA 4QXTA 4NQSB 3SGJC 4F7PA 2EDFA 5IVXB 5DEZA 2P7TA 2AEQH 4JN2A 4KQ3H 3D9AH 5F7WC 4G7VL 3V9FA 4LCYA 4X6CB 1QPPA 4WI9A 5HSFA 5CP3A 5DJYB 3SE8L 1EK3A 1DQMH 4NQEE 4OCMC 1AXTL 1AKJB 4X8JB 5D1QC 1HILA 4HWBL 3MCKB 3TVMC 4YO0B 2YA1A 5CSZA 3MV7A 1VACA 4FQXD 1G7QB 3NA9H 4X98B 1QFUL 3FQNB 3MRLA 1I1AA 1IC7L 1OT1A 4K7PL 1AIFB 5IM7A 2IPUG 4OD3H 3MLZL 5FECB 4PUBH 4U3CA 2FJFB 3D0LA 4JM4L 1L7IH 1A3RL 3BP5A 3MMEB 3C6LD 4U05A 4P99A 4I3RH 2AJUL 3SGDH 1D5XA 3T4AA 2Y6SC 4HUWB 2HN7B 3NA9L 2FEDC 3ZO0A 4IS6A 1T5WA 2J4WH 4KI5F 5GGUB 5E2UH 4GG8B 4G6FB 5D2LF 5IB4B 2DKSA 1E28A 2FEDD 1AR1C 2DKUA 1AQDB 1KN2L 4U6VL 1G7PB 2HT3C 3EYUL 4NPYA 2CIIB 1N64H 4WDIB 3RVUD 3X12B 5B38A 1HYRC 3ARBC 3AXLA 1AR1D 2D31B 4ZMAT 3U9PH 3WD5L 4RAVA 4FQLH 2V2TA 2VL4A 1AO7D 1QO3B 2VWEE 4GKZB 2BOCB 4XH2B 5E8PA 3FZUC 3H42L 3KPMB 3PQYD 1MCPH 5KSUA 2Z8WC 3GFUA 4PB9H 5TQ2L 3CFKA 5CEYA 4U6VH 4RQQA 5LGJB 5TQ0H 2ESVE 1OOAA 5ESVA 2BDNH 3NABL 5DVMA 1EX0A 4HS8H 3B3IB 3ARQA 1F8TL 1NBZA 1GRWA 1VFMA 3IU3B 2P5WB 1VFOA 4ZUWA 2FWOB 1JWSA 5FYJE 5EWIH 4GQPH 3QJFB 3KGRA 3H42H 1FGNL 5J56B 2B2XH 3ARFA 3KPNA 2C3GA 2VDLH 4AEIH 4EI5B 2YSSA 4O2FB 2JJTC 4UV4L 3BKYL 3WNNA 4UQ2B 3EJJX 1DANT 4PJ7F 3THML 2NR6D 3MRHA 1J0ZA 3TA3A 1AD9A 4AEHH 2VUYA 1OAYL 1FGNH 4N8CL 5J3HC 9CGTA 4JJHA 3L3KB 3U0PA 2VDLL 3E2HA 1IAMA 1KTKE 4N0UB 4KTEH 3QCVL 1MJUH 3DUUA 3PWJB 3RNKB 3D85B 5IHLB 3FFCB 4JPWH 4PP2A 1MCHA 4X6CF 4ODXA 3SDDA 1BVLA 2NZ9D 2EZ0D 1JPSL 4UNUA 4MA8L 1CDYA 3ZYJA 4YHPB 2W60B 3OV6A 3UAJD 2PYFB 2FX7H 1RUQL 2AQ2A 5EU6E 3RNQA 1KCSH 3P77B 3CNKA 5JW5A 1GGBH 5TH2A 1E4KA 1ZXQA 3DVNA 3KPQA 1UXSB 3O4LA 1YNLH 2DBLL 2EXWD 4QHUB 1WC7A 2NQCA 3HUJB 4ZS6C 2DQGL 5I8CB 4CADA 5FUCC 1EVTC 1Y6MR 1TZIA 4HZLA 2ID5A 2IJ0C 2CJUH 1NGYA 3MNVA 3VFOB 3BEVB 4AJ0A 4HIJA 4PJBE 2RAMA 1KEGL 2Z4QA 3MSPA 4YBQC 5E0QA 2CK0L 5E9DA 4M7KL 2VB5A 2XTLA 3LIZL 3FOMB 4LSQL 2VAAB 3U0TA 1G7MA 3QUKA 4P23D 4XVJL 2V9TA 4JFFB 3MRKB 4IRJC 4YFEA 4L3CB 3U4AA 1CCZA 1U6AH 1NAKL 3D25A 3MFFB 1R5VA 2DQGH 1VDGA 5EG6C 1QLRA 2XFXA 5ENWA 1ZWIA 3KAAA 4X9FA 4G43B 4KK8C 4XVUD 1BBJB 1XGUA 2AJ3B 1I8LA 2AJZB 1FFPB 1N6QL 2BHZA 2J8UB 4MQ7B 2AI0L 2LABA 1H3VA 3GMOA 1T3FA 3B5GA 2YEZB 4G6KH 1UA6H 2BERA 4WI5A 4PGBA 2VWEC 1OGAD 4CBPA 3BKCH 3ES6B 3L7FB 4IOIA 3ZSTA 4U1LA 5MHSE 2XZQL 3KXFD 4I2XA 1F4WH 5AZ2H 3WNPA 2OZ4L 1ITCA 3MRGB 4YK4B 5F3BA 4KQ4L 4O02H 4PGCB 4BZ2L 1AY1H 3DI3B 1TQBC 3U4EA 1KOAA 1RUPL 3VDCA 3V5DA 1G0DA 3LV3B 3EJYD 2GSGA 2APBA 1OP3K 3IS0X 1QSFA 1MIML 4MWFA 1OTUD 3K2UH 4JVPA 4KRPD 4KY1H 1JRHH 3DARA 3K1KC 1HWHB 2WV3A 5D7JB 3NFPA 2OSLA 4J8RB 3WEXB 4HS3B 1T2QL 1F6AB 4JDZA 4V1DB 2FGWH 3JWOC 2VXVH 1MH5B 4YDKL 5KVGH 1U8HB 4HKJA 5IR1A 5BRZB 1F90H 2B4CL 4XRCB 2UY6A 3FQWA 5F9OH 1R5IA 1MFBH 4JHZA 2VC2L 1ZA3B 2F74B 1OW0C 5DHYB 4U3XA 2P5EA 2QSCH 4LCCC 5CBEB 4LCCB 4WHCA 3W2DH 3V52L 3GHBL 2OK0L 1OLLA 3PXJA 3T0WA 1U8IA 4C58B 35C8L 4LP5A 3LS4H 2ZOKB 3G04B 5GGRA 5JR1L 4KZEH 1D5XB 1RULH 1T0PB 2RGSA 2GQHA 1NEZA 1B4JL 4GBXB 5EOCJ 3KWWB 5I2IB 2XA3A 4KHXH 4XPBL 3RGVB 2DAVA 4U31A 4UAOB 1BX2A 1JI1A 1UVQA 1FV1B 3OB8A 1IL1B 3KYMA 4G3YH 3BD4A 4N0CD 4PG2C 2W60A 3QEUB 2VQTA 4OKVA 4M43L 3V4UL 1S9WA 3QIUA 2I25N 4OZGB 3EHBD 1MHEB 1NLDH 5F7LB 2XWTB 3OTTA 4WNQA 1XFPA 3S4SB 2R4RH 3HTLX 3I3EA 4LP4A 1AI1H 5FAAA 5JR1H 1X4ZA 1IFHH 4JY6B 1JHKL 1KNOB 1KENH 1H3GA 2Y7QB 1M05A 3MLRL 1MAMH 1EERB 4G3YL 4IOFD 5D5MA 4GRWF 4NKIH 2YWZA 5TE7L 2A6IA 2P5ED 3WS3A 1ZHNB 4GAFB 4YZFE 3QT2A 4Y7MA 3I50L 3LAFA 3ZKXB 2FX9L 4TULH 2VZ3A 3MZTA 1MFEL 4HLJA 5HHOE 2QKIA 5EPMA 4PBWD 4PV9A 1A7NL 3WHE0 5E2VH 3QEQA 2W9EH 3ABZA 3ARSA 1WWAX 5HGDA 2E6JA 4UTAH 2IPKA 5C0AE 2EDRA 5TE7H 5HI3C 2O5ZH 4TNWK 5SWQB 1YN7B 4ZOBA 3GSVB 4IIQC 3U9UA 4A6YH 3P0YL 5IEKA 3U4BL 2VISA 1L8JA 5GRZA 2Z35B 4EKXA 1T1XA 2LQRA 4KWUA 1LNUA 3JWNC 1G7HB 2EXYC 2N56A 4C55A 4YHZH 3H6JA 1G9MH 2DD8H 4NWUL 3TYGH 1WFNA 5HDQH 4HDIB 3I6LE 4UINL 3U82B 3O8XB 3WXVH 4UNVA 1A6TB 4ETYA 4B5EA 4TPRL 4PREB 1DLHB 3NPSB 4HD9A 5DYOA 1HSAA 1J0IA 3VXUD 4M61A 3ETBF 2V2TB 3HE7B 2JJSA 3WDIA 1QSEA 3NFPB 5C0JA 4NC1C 4XPFH 2HFGH 2ZUQC 3QO1B 5D96B 5E8PB 3VH8B 1KCKA 3C5SB 1S8DA 5T3XD 4DZBB 4FTVB 2HT4C 3TVMB 4C83A 2X44D 3ARPA 5GGTL 1VFBA 4AENA 3EDEA 3LN4A 4MNQB 4YNYA 3BYYA 4HGWB 3NCJL 2Z93A 1OVZA 1F42A 4MA1C 2WBJB 4UNTA 2DLIA 2EDXA 1SEBA 1NFIA 4FQLL 4WFHD 4HUWA 3BD3A 5C09B 3BIKA 1ZLWK 3QIWD 3TFKA 1MCPL 1M71B 5HHNA 5DGRA 3EFDH 1XF1A 3LPGA 4X9IA 2ZZUT 1U8IB 4CRPA 1TQCB 4WY7L 3BP6B 4L3AA 3UZEA 5BOZG 3E6HB 4P4KC 5EO9B 4I1NB 1VB9A 1H3PH 2E27L 2J12B 4CN4A 1RZGA 4N68A 2DQFB 4P3CH 1IQDB 4GXVL 4L9LC 1VACB 1WWCA 3ARBA 3D1MC 2CGRH 4KFZC 2QQKH 5DEGB 3WV0A 2AERT 4K3EL 2XFXB 4G59A 2A6KB 3U1SL 3C6SB 4DJMA 4YC2B 3U83A 4UV4H 5J57B 2H32H 3IFNL 4JFFA 1C5CL 4JZJC 4JZJB 1AJ7H 4P5TB 4YHMH 3THMH 1JPFB 1A7BA 4K23L 2HH0L 5DJDB 1WFTA 5DK3A 4DAGH 5DFVC 2UUDH 5L88L 1PX3A 3GMRB 3MLWH 5DRZA 4FFEX 4QXGL 3MLZH 4WU7B 4D9RD 4ZFFA 4JVUA 1U95A 2WBJC 2P8PB 3G5XA 3JTSA 3KPNB 5DJ6B 3OXRB 4HX1A 5K9OB 1LO3H 1UKSA 1YMMB 1KACB 1ADQH 1IGCL 4XP9L 4KMTL 4LCIH 4U6TA 3B5TA 3D48R 5HGAB 5HPMA 1CXFA 1S9VA 3QUXC 1UB5B 2YD7A 3EYVB 5DS8A 3TA3C 1CTOA 4AYFA 1G84A 3RBGA 5IKCA 1RZKC 1S5IL 1ZWIB 2DBLH 1JPTH 4OZFG 5IMMB 4HC1A 2IANB 4NQUA 1MIEH 4LU5L 1LO3L 3BWUC 3P73B 2DL2A 5TGBA 1VPOH 3TCLB 3MTRA 3DWTA 3S5LB 2MOVA 4L8CB 4J3XA 3P9MB 3JWDH 4D0CA 4M62L 1A6AB 3SDDC 1JCKA 5MERA 4OCXH 3F12A 1CXKA 4NZRH 3K8KA 2ED9A 1O7VA 3VW3L 4CU8A 4ISVA 1R6VA 1UXWB 3HPJB 1HQ4A 2QHRL 1NUFA 4U1NB 4MXWL 5HPOA 3W11D 1V7NH 4P2QB 3TYFB 1P1ZA 2I9TA 1OB1A 5I73C 1BQSA 4MS8A 2OTWB 3TN0A 3V5HA 2EKSB 2KBGA 5IBLC 1IC7H 4OGXH 2C4FU 5KS9B 4RRPG 1K4CB 1ZHKB 4LASL 1B0RB 4CVZB 1EGJA 5DMKB 2DJSA 1CF8L 3AM8C 3P2TA 2WLZA 1U42A 1EHLH 2ZKHL 3BVNA 1NANH 1V7NL 1X6LA 4EVNA 4GW4A 3QXAB 4OBRA 2EDOA 4U0RC 5ISZE 4P23B 2NY1D 4XXDB 4BZ2H 3U46A 2F54D 1Z9OA 5GGQH 1E4WH 2CIKB 3DETD 4AL8H 4KUCF 4KGJA 4YR6A 1L9NA 1OPGH 4OZGF 2YMXH 3I84A 3OR7A 5C8JA 3W0WB 5I16B 3RWGA 1I8LC 2R2EA 2NY4B 4JFDE 1OARL 4HIEA 5D6DA 3EYFA 3TO4D 5IESL 3S8WA 3C2AL 1WLHA 3HCVA 3T65B 1OTUC 5E8OB 1CFSA 5DJXB 4LSSL 1PSKL 3O81A 1PGRB 2ADIB 3VRIA 4QHUA 1CE6B 2EDDA 4XP5H 5IFJB 4BZYA 1IC4L 5JHDD 1FVCB 1BX2B 2J8UF 3G9AB 3GGWB 4NDMA 4B7IA 3DROB 4EN3C 1BEYH 5SV3A 2MQ0A 1HHHB 4K3GA 1SYVB 5EIQA 4QTIH 4YH6A 5F9AC 2E3VA 1OSZA 5KSVA 5I6XB 3GZKA 4Z7OF 2Z8SA 2NY0D 5AAWA 6FABH 3D85D 1MY5A 3ZT5A 5T5FH 5A16B 4H1LG 1JGUL 3CIQA 1M6OB 3QDGA 3QHFL 3DTXB 2CDGB 1CN4A 1FCCA 3MCLH 4XH2A 1DLHA 1KG0A 3H7BA 4L8SB 3LEYH 4L8SC 2ED7A 3KPRA 1AHWA 2FBOJ 1P7QD 4HDIA 5AWNL 4WTWA 4PRNA 4G8EB 1XH3A 4OLVH 4YPJA 5DQ9B 1NMAL 5IV2A 1ZT4A 3BI9X 4O4YL 3E6FA 2JLLA 2A83A 4XPHL 3I75A 3BGFC 3IRZA 1HDMB 3M45A 3Q6FB 5E99L 4MSWB 1OP9A 1B9ZA 5J9PA 1T21A 4PBXA 2BSSB 3MFGB 1RPQA 2Q1EA 3N85H 3T3PF 1P5VA 4GG8A 4XNZC 4CW1B 2Y4SA 1AGCA 3C8KA 2AI0H 4QKXB 3BJLA 1S3KH 2A9NL 2EDNA 4WO4A 4V1DE 4LSPL 4G7YL 1BLNA 3LB6C 2MPAH 4OFPA 1NBYA 2WINB 4WW2A 5TFSL 2X1WL 3GKZA 1F4WL 1N2RB 3ZE2F 3REVB 3DBXB 3SKUD 5D7IE 2H45A 1WWWX 2GAZA 4YIQA 1KJVA 1YYMH 4X5LA 4IHOB 4AK1A 5ADPH 2D4DA 2FH8A 3N50A 4LVEA 5ESAA 1U36A 2VIRB 1KXTB 4JCLA 5KSUB 1AD0B 1NEZG 3IAPA 5B39A 3C60B 1AGBB 4I2XE 5GS0D 1IE5A 1Z6JT 5ISZA 5GJSH 4Y5VC 5GRXG 4HKBB 2HRPH 3DUSA 4MQ7A 5EBWA 2GFBA 4R90L 4PV8A 3RA7H 1ZANL 4ZSOE 4CKVX 4ELKB 2X4PB 3JV0A 2NMSA 5FOBA 1BVLB 4GMTL 2DQFA 3X3FH 1KCUL 3FB6B 3GM8A 4EUPB 2XRAH 2BVPB 5L7XL 2NLJA 2WY3A 2W9DH 32C2A 4HUNB 4OUOA 3QCUH 3L9RA 1MAJA 1I1RA 2EYRA 1WISA 4OCNC 4ZS7L 2F58L 2VLRB 5I76A 4HCRH 4HIJB 3OKEA 1WIUA 2C4XA 3S34L 2Q8BH 1X7QB 1TVDA 5FKPB 2B4CH 5I2IA 2P46B 2WWKT 4PJ5A 3CLEL 4CADB 3FHAA 4NN5B 1IL1A 3KYMB 3TT3L 1JGDA 3M17A 2V7NA 1HXYA 4XCNA 3BEVA 2VZVA 3L3OA 4R97C 4R97B 1S78C 1FN4B 2Q7NA 4TRPH 3VDAA 1IEBA 2Y72A 2OBGA 4QRPE 1WK0A 1TIUA 4MCYA 1P1ZB 3U48A 2DIJA 4PP2B 3FB5B 4KKCD 1A6UL 1CLCA 4G8GA 1YEGH 4TOYH 5DC0A 3REWA 4R96B 7FABL 2HFFA 2FO4B 1C5BH 3VGBA 1QBAA 1MRFH 1RUKL 2E7BA 1RURH 1Q9WB 2ADGA 4KK8D 4WUUA 4FQXB 3AC0A 3UBXB 1F11A 1C1EH 1P4BL 2YKLL 4X80L 3R8QA 3D69B 2A38A 4Q6IC 5FCUH 1A4JB 4K9EH 4O51B 4TN9A 2Q7YB 4CL7A 1DBML 4GKSB 4JO3L 3BPOC 3BPLC 3BQUC 3BPLB 4NNYB 4HFWA 1DBAH 1NMBL 4FG6D 4HKXB 1QRND 2AK4D 2ORBH 1FVDA 1WZ1H 1A1MA 4POZC 3IU4H 2X9WA 3NCEB 1GAFH 3FQUB 4Y19E 4LLYB 5JIIA 4NHUE 1FNEB 3V5DB 1NGPH 2C3WA 3C60A 4X6DE 4YDIL 3QI9A 1CFVL 3AREC 2VN7A 5H94B 3PWPE 5TE4H 1H3UA 1JUFB 3K0WA 1X5HA 1QHOA 3ARGD 3WSQL 4X99B 5BV7H 5D9SB 4XCYA 4U1NA 4H25B 2HKFH 3VRIB 1I8IB 2VISB 5D7LD 1S5HA 3UTQA 1AXSA 4X6CE 2G5BB 3V6OC 4K3DL 4Z76A 5D93B 1QSZA 1Q94A 4YDKH 3LQAL 4E0RB 1KCRL 2FATH 1MREH 5FO9A 3QIWB 5J0BA 1QPXA 1GCFA 4ZUTA 2VZ1A 4A6YL 4EOWH 1T1YB 2CR6A 3ZL4H 4WU5A 4W4OA 4DKAA 1JFMA 3LMJH 2ATPB 1EVUA 3QXVA 2BHYA 5FYKU 1A6VL 3LKNB 3QCTL 1WBYA 4PJFB 4LDLB 3L5JA 5I15L 2QQLL 3TYGL 5BO1H 4G8GE 3P4NB 1RZ8A 3NFNA 4CVZA 4QGYA 1I9IH 43CAA 4L1HA 1U3JA 5J11B 5D2LB 4XNUL 1IGCH 4XP9H 5JMOC 4MDJA 3H7BB 4H5SB 4Q2ZA 4LRIC 3NZ8A 3UTSB 1T2JA 4JGMA 2I60H 5IBLD 1A64A 3OPZL 5D7LA 4ODHL 1QLFA 4JFEA 2Z4QB 2NXYC 1RIVH 3QNXA 4XZUA 4M4PA 4QRRB 4BKLB 5GS1B 5DFTA 1FZKA 4RISL 5SWSE 3HN3A 5DRZB 1JPTL 4N0RA 5IF0A 5DDHB 3TNNA 2EIZB 2YBRB 4DFHA 2NY2B 1VPOL 3QQ4A 4ONOA 3ECBB 1FH5H 1C8PA 4ZFOL 4S11A 4PJDA 3KNBB 5ILTL 4L4VA 3S37L 5C0IB 4F8QA 1U8NA 4OLEA 1SJVA 3IJHB 3QDAA 4K7FB 4P2RE 1FSKB 2E9BA 5KANI 2P5EB 5CBEA 2BCKB 4RGMB 1D5ZB 3PWUA 2E7LA 3EUUA 1MSPA 3MV7D 5HVHB 1X4YA 2R2BB 2F8XC 1TZGL 2ENYA 5L6YL 3MOBL 4MXWH 1MEXH 1T22A 4PLJC 1HN1A 4NBYB 2HTLC 5CP7A 1Q9KA 3EDKA 2W07A 5F7NC 1CD8A 5BVPH 4MAUH 5FUCE 1GL4B 3RDTC 1P9MC 3TPKA 2CDGA 4OGXL 2FJGB 2QBWA 4QXUL 3TA3B 1MCSA 4LMQI 3M1BA 4X7TA 5E1AA 5IUSA 1PY9A 4U1KA 2VKXA 2BOBA 4HH9A 4XCFH 4R2GD 3STZA 3RI5K 2EKJA 4PRPA 3UYRL 5DJ2A 2NNAA 1QBLL 2D7OA 4LVOC 4DN3H 4QCIB 1MCLA 4HUKB 3HE7C 1UH4A 5IEKB 4CW1A 4PJXE 2BRRH 4KTYA 3HZVB 3IB4A 3F58H 3EDJA 3KPSE 1LDPL 4NHUB 4LARH 2VO5A 4KUZL 4JFHE 2X9XA 3IFPB 3CSPA 3NIDE 4K7PH 5J13B 4HUXA 1XCTB 3VCLA 3MV9E 4OUUA 4KKLC 2Z92A 4PJXA 2ARJA 4LLVA 2H2SD 3CX5K 2YPLA 1JZ7A 3BH9B 4Z7WA 1FPTL 1MI5D 3VXRE 1X5LA 5CEZE 1S9YB 1MWAB 4K2UL 3HG1B 4RGMC 3QRFM 5GRJL 2AXJA 8FABB 1CLOH 1N59A 4AY0A 3SCMD 1TJGL 3S97C 3OKNA 4NP4L 2D7MA 3S7GA 4ZNCD 1BQHB 5DA4A 5J8OA 1X5GA 5IB2A 1PQZA 4WI2A 1U8MA 4HCRA 5FA3B 1LNUB 1S7VB 1RSFA 3S36L 5JOFA 1H15A 3U0TB 4JPWL 5EOQL 1MCRA 3C9NA 1R3JB 2LTQB 2LTQC 4G6ML 4P57B 1H3PL 4LEOB 4GRWB 1KCVL 4N90D 4F7CB 4LHUA 3RU8L 3IXTB 1D5BB 4YQXH 4PJ5B 2PXYB 1BZ7B 5GS0C 4X0KB 4QRUA 4EN3A 4XCNB 5J4MA 1X5XA 3SKJH 4DK6A 4P46C 3GMMB 3VFWA 2F54B 5D1QB 3LRGA 1RZIA 3PIQB 5FIEA 2G60L 3GMQA 3PHQA 4LSUH 4XNMB 1GJIA 1QBBA 2NXZD 3HR6A 2QJDA 4FHBD 4KQ3L 4Z7QF 3DXAE 5IMKB 1WT5C 5F7HA 5EWIL 3UTPE 1QA9B 4HIIB 3C5SA 2PYED 1CICD 5IJVB 3VRJA 3AMKA 1VFUA 5D7IB 2EXWC 4EDXB 5CWSB 2NY6C 5D1ZC 4P2QD 4Y4FD 5C0DA 2Y9RT 2GJ6E 4LPYA 5F88B 2XN9E 2K7PA 4YBQD 1DBBH 2QSQA 4B41A 2CO6B 1T66D 5BMFH 4M4RA 2Z91A 3ZDZE 4ONFL 4L8BB 1D9KB 4FRWA 5IW6B 2Y5TA 4NC2B 4HWUA 5FK9B 2Q20A 2X6MA 1FYTD 2F8OA 4IRJD 3ULVE 4NQEA 3GI8L 2ZOLA 3NH7L 3FAXA 4GMTH 3HC3H 4U1KB 5DR5H 3SO3B 4PPTA 3M8OH 3QISA 1ZA3A 3KPLA 4PYGA 3O3BA 5BRZD 5LGHL 4MQXC 4HGKC 4KGLA 4PR5A 5E9DD 3FQTB 2HLFD 1LP9E 2HFEA 5ERWA 1KTDA 3HI5H 4UB0L 1A1NB 5FUZL 1ZLUK 1HHGB 2I9LB 4EDWH 4AM0A 3BN3B 2FX7L 3QH3A 4GAYA 5LBSH 1CG9B 2K3TA 1FORL 1A14H 2Q7YA 5TGBB 3BX7C 5HDBE 1OGAE 1J18A 5I1CH 1UWGH 2BCKA 3MBXH 4G8EA 4K71C 2PTVA 4MD4A 3FCTA 4BZ1H 3ALWA 4QLRA 2J7LA 3VJ6A 3VWKB 5HVWA 3VFTA 2I07A 5CGYD 5I1DA 3T0EA 3IDXH 2J1KA 5DUML 3RBSA 4Y19A 3O0RH 3RWJB 2EDQA 3FN0H 3VFMB 4AQ1B 2DQIH 3MYJA 4FTVE 3VXOB 4TSCL 1SMOA 1G6RA 5DMYA 1YEDA 4OLVL 5HGBB 3AAZA 3E6HA 1X7QA 1DQLL 2VC2H 2DJUA 1EHLL 2BY2A 1UWGL 1IM3B 5K9KB 1AFVH 1MI5E 1JV5A 4ZDHA 3QEGH 4PJGA 1F02I 2XZCL 5D7LB 3O11A 4V3EB 4YEEA 5DMIH 3QIBB 2ICEA 4POYA 4IRSD 3ZTNL 2R2CA 3FN0L 4LPUA 4XPBH 1I8KA 2EE6A 5FKAA 2MQCA 5F9WB 5K59F 3QQ9D 1CS6A 2NY1C 5F44A 5DD5H 3NN8B 4S10A 3DETC 2B5IB 3DMMD 3FO2B 4PJCE 3Q2CA 3QSKB 2W65B 3DX9B 1SY6H 3GI9L 5DK2B 4XXDA 1D5ZA 5CILL 2V17H 4KQ4H 4O02L 2ZCHH 5EUOA 1K9TA 1LP9A 5IFHH 3STLA 3FB6A 4QRPD 2R0ZH 5LXGH 1KIRB 3MV8B 4AIOA 1RUPH 4XMPH 2AJSL 4Y5YB 5FM5M 5GS0L 2HG5A 4GXUM 3BP4A 3NACH 2X09A 4J3UA 1G9NH 3NPZB 1R0AL 5IHBA 4MZ2A 2BSTA 4JO2L 2VLKD 3MRMA 2NTFA 5HHOB 1AE6L 3CFCL 2YK1H 2V17L 4S1DD 1KCUH 1OQXA 4PRPD 5FGBA 1NC2D 4JZOB 5DUBA 1IGYA 2Q3ZA 1ZOXA 4MJ6B 4ZODA 1NDGB 1JNLL 1KC5L 2QR0A 4H25A 4NKQB 2R29H 1FFNA 1I1FA 3V6OA 1IKFH 4JM2A 3G6JB 1NPUA 2VZTA 3BPCA 3MYJB 1CI5A 1EMTH 2ZSVB 4PJHA 1U3HD 5I17B 5F9OL 3O6ML 3QXUA 3ESVF 3QIBC 3P0YH 3OF6D 5J06A 2PW2A 3U4BH 2AEPL 4WIQA 5C7XH 5HD8D 3TLRA 1C7TA 1K8IB 3S37X 1X4XA 4DFIA 1CGSH 3ZKSD 2VXSH 3RWDB 1YEIL 1W0WB 3DRQA 1JNLH 5D7LE 3B9AA 3KPMA 3WJLC 3DXAD 1F4HA 4MVBD 3OGCA 4Z7NF 3QDMB 1S3KL 4NT6A 3X11A 3NBNA 5CJOH 2VXTH 3KJ4B 5D6CA 3UP1A 3G6JF 2VH5H 4DGYH 4WFGD 4FNLL 2DN7A 3OZ9H 1RQ5A 1J11A 4J3SA 1PZUB 1YY8B 5ALCH 1I7RB 4PRDA 4P4KD 5DF0A 1MWAL 4JO3H 4WENB 1CDBA 4O2CA 15C8H 2CKBH 3I6KB 1X5ZA 3FFDA 2BNQA 4NIKB 1KENL 4Z7OE 4WWID 2SEBB 3KPQB 4CU7A 1N6VA 1U3HA 5JW3H 1UM6L 4NHUA 1H9VA 1C08B 2X4QA 4JRYE 4YPGA 4G8GB 3WLBB 1XF2B 1QFOA 1I7ZB 4PTUB 2JCCF 2VH5L 4DGYL 2FRGP 4HXAL 4XP1L 4LEOA 4LQFL 1BIHA 1WV7T 2FECI 4BSJA 2VXQL 4KJWD 4TVPD 1RIHH 1YEHL 4WFFD 3MA9H 2P4AB 4RAUB 2P5WE 2GCYA 2BVPA 2CKNA 4LPXA 3E2HB 2HMIC 2FATL 2KZWA 5E8EA 1EXUA 4OT1H 1F4XL 3BN9C 1KYOK 1TNNA 3HZYB 1BFVL 3VD7A 1O7SA 3D39B 4XP1H 4LLUA 4EUPA 1BOYA 1UJ3B 4LPCA 4XC3H 1F58L 3GKWL 4NYLA 4MLSA 1NBYB 2WINA 1SEQL 3OAYK 4BH7B 2QQLH 2PF6A 1LVEA 5KS9A 3MV7E 2ZSWB 4AMKH 4FTVD 4EI5A 1NH6A 5DMKA 5I1LB 2VITA 1P4IL 3QFJD 3QFDA 5IB1B 3NCYP 1WQVT 4HQQL 3ROLB 2UZIH 4MJIA 2R0KH 5DJYA 1RIUL 2YBRA 5CKGA 4QNPE 4HPOH 2GAZB 5B8CB 4B0MM 1JYXA 3JZ7A 4CAGA 5EA0L 1NEZB 4NUJA 1MQKH 1WWBX 3VXNB 1ZHBA 3SJVE 3RIFK 4RISH 1AH1A 4JFOA 3LSOA 4BUGA 4G80B 1XH3B 4XP6L 1GAFL 1G6RL 5EBWB 3B6SB 5IVXF 3KVQA 4LL9A 1ADQL 3Q1SL 1FNGB 4JFZH 2EYTA 3UC0H 1KCVH 1EPFA 4KRPB 4LEXH 1CFVH 4XC1L 4QRPB 2CD0A 1REIA 3CFDA 2X4OB 3DUHA 4HS3A 3RIFF 5CP7B 1R3KB 3CXHJ 5B3JF 1KTDB 5ID1B 4I5BB 4BSWA 4KI5E 5CWSA 2OL3A 1N4XH 5EU5A 1TZHA 1YEJL 1CG9A 2HTKC 5HYQB 1KLUA 2OMNA 1M7DA 1H5BC 1ZA6A 2OXHA 3QO0A 3MRCA 2Y07L 2G60H 4JQIH 5C0BB 1G6RH 1ZV5A 3O4LD 4Y4FB 5BJTB 1VEOA 2R23B 4P2RA 3SOBH 1L0XA 1DQDH 1ZMYA 1T83A 2NXZC 5C08E 3KYKH 5E00A 3RWHB 4W70A 4GJTB 3MRDA 4WFHE 1QSFD 1UFUA 3PG2A 3TBYB 5J12B 4JRXE 2HJLB 4C4KT 4NQEB 1EDQA 5IEHB 4LNRB 4KJYA 3LHPH 3TH4T 4JKKA 5E03A 4XNYH 1XF5A 3L3JB 5GZOC 2GK2A 1HWGB 4CNIA 2FO1A 3ARWA 2ICES 3FHQA 1QBMH 3C87A 5A40E 3RL1B 2BXZA 2F53E 1SMAA 1AP2A 2EDYA 1CR9L 3VE0A 4V1DD 5E6ZA 3JV4B 2R1XA 3U79A 4TTDD 2VDML 3MX0A 4U1GB 4PTTA 2I5YL 2VABB 2DI9A 3KHOA 4TQEL 2VJXA 3I9GH 4MZ3A 1OCWL 5FGCB 4HIIA 4HUUB 4XHJD 4F37K 3EOTL 3KPSA 3FT3A 1BJ1H 4WI6A 1EJ6A 1IKNC 1RVFL 1BP3B 2E5EA 3M8OL 2YPLE 4M1GL 3EJZC 4LCIL 1INDL 4FN0A 4ONHB 5L9DL 4QRQA 3QUYD 2DQEH 3N1GC 5ACZA 4K2UH 3MUGA 3RZCB 1OAUH 2W9LA 4LCUB 1J10A 4PDCE 3RP1A 3O41A 3MJ9A 3GSRA 4Z7WE 1ED3A 1BFOB 4NP4H 1NCWL 5E5MA 3IXTA 4WW1B 3EJZD 4OD3L 1R3IL 4FFWD 4JHAH 1EUTA 4GG6B 2ERJC 1FL6A 4AENB 5F72S 4NHCL 4EEEA 3BHBA 3T4YB 3MLUL 4JCMA 2MJWA 1MRCL 2NY6B 1K3IA 3DVIA 4M48L 5D1ZB 3W39B 4BZ1L 4YFLF 3MODH 3GRWA 3AB0B 2DTML 5SX5K 2CRMA 1FCGA 5MEQB 4ZD3H 4P2RB 4M6NL 4HFUL 3WIIL 5HHQA 3WUWB 3RWHA 3EYSL 4P59L 3GO1L 4X5WA 4WI8A 4JHAL 3QXWA 3BRDA 4XCCH 4P5TD 3MRPA 4LBEB 1MFCL 3SDDB 1T2XA 3SGJA 3O2DA 4PJ7B 2O26U 3PQYA 5BW7C 3MLUH 4XRCA 4XWGL 6FABL 1YDPB 1PQZB 4LSUL 1HYSD 1EEZB 2V2XB 4P5TC 3F58L 5CS7A 1FNGA 4N8PA 5CINL 4G9FD 2PR4H 2WAHA 5AZEL 4MXQC 1YECL 3O6LH 3DRQB 4TNWF 1OGTA 3CFDB 3G6DL 5IMMA 3KLHD 4C57C 5E2WL 4E0RA 1Q8MA 1MCCA 4FZ8L 4Y88A 3UPRB 3VXQA 4Z78B 1PG7L 3BZEA 3GMPA 5HGHB 4PRHE 4I9WE 4YHML 1FFNB 1I1FB 4OIIH 3VXSE 1XIWC 2R0ZL 4HUXB 4BA8A 5GRJH 2X05A 3ZYZA 4WU7A