3LN4A

Crystal structure of hla-b*4103 in complex with a 16mer self-peptide derived from heterogeneous nuclear ribonucleoproteins c1/c2
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
274
structure length
274
Chain Sequence
GSHSMRYFHTAMSRPGRGEPRFITVGYVDDTLFVRFDSDATSPRKEPRAPWIEQEGPEYWDRETQISKTNTQTYRESLRNLRGYYNQSEAGSHTLQRMYGCDVGPDGRLLRGHNQYAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAARVAEQDRAYLEGTCVEWLRRYLENGKDTLERADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, B-41 alpha chain
publication title The impact of human leukocyte antigen (HLA) micropolymorphism on ligand specificity within the HLA-B*41 allotypic family
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 79
structure length 274
sequence length 274
ec nomenclature
pdb deposition date 2010-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ln4A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3ln4A01
3ZKMC 3MACH 3QR2A 4MHHI 1JPSL 3B9EA 4O00A 5DEFB 2AJUH 3BVNA 4K94C 4EI6A 3QO0A 1T7YA 5BQ7A 1IQWH 3BT2H 1FNFA 3MV11 4KAQL 5GS2H 2OK0L 1DQDH 3LHPH 4LVHC 5FOJA 2XACC 5C0DA 1S5HA 3ZDXF 3TT3H 5HVHB 1F4WH 1YDPB 4RFOH 1G0XA 5BO1L 2ITDA 1XGYH 1G7IB 2A1WH 4K7PH 1IGJA 1S9WA 3SN6N 2C4FU 4KU1A 4OJFH 4S2SA 1WBZA 5IB3A 4M7ZC 2Q1EA 1YQVL 1FSKB 5E6IA 3M45A 4D3CH 3IDXH 2QHRH 4C4KT 1MJJA 4NDMB 4D0CA 5CZKA 2CO7B 5KTEL 5D7JD 3T0EE 4O02H 3CFBB 3D85B 3T0DA 1JZ6A 1LP9F 3S35X 5LWYH 5EFIB 4MNGE 4YDJB 1R3KA 2JTDA 5IBLD 5DJZA 1EXUA 5EU7E 1F00I 4GW5B 2YN5A 4D0BA 3FQTB 3ULSA 4EBQH 4XBPB 2IG2L 2FBJL 3E2HB 2PR4H 5DO2D 12E8L 5F7NC 4GBXB 2R1YA 4U1KA 1YMMA 3NIGE 1MJ8L 4OAWA 3CNKA 1EBPA 5I1KH 2X7LB 4P2RA 5IT2L 4NQDE 5H2BA 5GHWL 3T1FB 2GUOB 5IFJB 3MRHA 4LCWB 3VXPB 4OD3L 4PGZA 1H8SA 3PHQB 1LEGA 1QBAA 4M6OH 4N0CC 4QXTA 1AH1A 5HVFB 1HXMA 1CDCA 2HTKD 3HCVB 4RCAA 2WBJC 4LHQB 5D1QD 2R8SL 4I18A 5DRNB 2C26A 1YJDC 3HR5A 3HKFA 4K7FB 2XN9B 1RHHA 1XIWC 3DWTA 4RIRB 1KCVH 4N8VG 3O2VL 1UH2A 1UM5H 4HMDA 5TDPB 1DDHB 2HFTA 3LKQB 3VMNA 3IGAA 4O2FA 4DFIA 2NXZC 3QUZC 2QTEA 4M5ZL 1FZJA 1IGCH 1A7QL 4GW4A 3DROA 5BRZE 3QWRA 2Q6WB 5E00A 4UBDD 3ZDYE 5K9QG 2CKBL 3U82B 4LIQH 2I27N 4NWTL 5KSUB 1IAKA 1AXSB 4OCWL 3BKML 2AJVH 4LRNH 4UNTA 4PJBF 4JFFE 1JWUA 4PJ5B 5MERA 3HS0A 2EKSB 4TUOA 3UPRB 4BYHA 2VSCA 1KTRL 3DPBA 4Y4FB 1KPUB 1I7TB 1MCNA 5C0CA 2PETA 3EDFA 4JPVL 5EUOA 5GGQL 2X70B 1RQ5A 1NC2B 4UNVA 3BZDA 5KSAC 1OD9A 4XP4L 2LU7A 3HZVB 4QRRE 4NN6B 2LTQB 4IOFC 1H3WM 3LOWA 5F7EL 1K4DA 2IBGA 4YFLI 2O93L 2UYLA 2R29L 5KN5B 5E94B 1T1XA 4L4TB 4M6AA 3VXUD 1I9RL 4DWHA 2P48B 2AXGA 2VQTA 5GRVL 4QRSB 3AAZB 2VXSL 3P0VH 1JZ5A 3VDAA 5IVXF 3WCYA 3RJDA 3D1MC 4WFHE 5F97E 4R0LB 2GITA 3UX9B 4UNUA 4H0HB 5FECA 2B4CL 1BJMA 1MHPL 4I0PD 4HS6B 4PDCE 2EIZA 3OXRB 4HQQH 2SEBA 1X5HA 2K3TA 4JLRB 1GHFH 3MRFB 3WD5L 1MI5E 2ZUUA 4R7DA 2YC1B 1MCOL 1VEOA 4X7EC 1R5VB 1T21A 4XMPH 3S8WA 5JIHA 1FO0L 1MCIA 2IBZY 1V7NH 4E41D 5JZ7D 3QUXC 4LOUD 1BVKB 1X44A 4HV8A 4HAGA 5ANME 1A5FL 1N59B 1LP9B 1FQ9C 2AABL 4M9PA 4RWHA 2NY2B 3QHZL 5DLMH 1ITBB 2ZCLL 4NJ9H 4A2MA 2NZ9D 5CJ8A 5IW1A 1FN4B 2NY6C 1N8ZA 5L6YL 1DBAL 1UH4A 2X4PB 2VH5H 3MUGB 1HIMH 3SKOB 1CXFA 1NGXA 2GTWB 5GGRB 5I76A 4U05A 4UV7L 4G59A 3BHBB 2L7UA 4QOKA 3KNBB 5J3HC 1BEYH 5B22A 3MGOB 3ES6A 5E8DL 5EIIB 3R8QA 4PB0H 1K3ZA 5DD0H 4KRLB 2YPVH 4MXQC 3I2CH 2XWTA 5IV2B 1D5IL 3QNYA 4KKLD 4KI1A 4OZGA 5ISZB 5JXAL 2E9BA 5LGJB 1MIML 4OI8A 4RMRA 1FIGL 3WS6A 3U0WH 4YBHA 5HVHC 5FOBA 3GJFA 5IQ9B 3QRGL 4QRQB 1AR2A 1W72B 2VDMH 2BVPB 3LN4A 5D2NB 2C5DC 4LLYB 4OZHF 3I02A 1F02I 1X5YA 1QO3B 4P5TD 3VH8G 5C9JA 5JXED 4XZUA 4P3DB 3MLTA 5CKAA 3NZ8B 1HKFA 2CGRH 1J8HD 1DQQA 1DBMH 4WHYH 5GRWA 3ET9F 4P23A 1G84A 4XC1L 2QQQA 5CHNB 1A2YA 1OGAB 4FQIL 3ARXA 4Y5XB 4P2QA 5B8CB 2OQJA 2AW2A 3ZSTA 4H26A 3TBWB 4MWFA 1WQVT 2NX5A 3E2HC 1EO8L 1OWWA 1T83C 3D39A 4PJBB 4JQIH 4RGNC 5F3HA 3DRTA 1YEFH 5HD8D 1KN2L 4WO4B 3I75A 4KKAD 4N9GB 1NCDH 1U8IB 1ZHNB 4YHZL 4NKIH 1FAKT 2XV6B 3DMMC 4G6AC 5GS1B 4CVWA 1UA6H 4JRXE 4WUKL 4IS6A 1AGCA 4JZNA 1TJHL 1X6NA 4J3SA 4PJ7A 4WI7A 2G9HB 3GI9H 5IM7A 2BFVL 1CDUA 3P11L 1HDMA 2Z9TA 4M02A 2W0LA 3DURA 5ACMA 2FJFB 2H6PA 1M4KA 4LEXL 5DHVA 1FG9C 4F15B 1I1AC 5HDBF 1A6AB 4V1DB 3PV6B 3S5LG 3IJSB 1A02N 1T20B 1CXIA 3V4VL 4NUJB 3G6DH 1T4KA 1U92A 5IVXB 3KPQB 5HHXH 4QTIL 1I7RB 4LSVH 2DLGA 1JRHI 1TIUA 2CIKA 5I8OL 3FCTB 1U2HA 3U7YL 5ITBL 4X7CC 2MKWA 3IJHB 4YE4H 1NLBH 5JUEL 5ENWA 1F42A 5C0BA 1O0VA 4P4KD 2B0SH 2DDQL 4Q2ZA 5IJVA 2FYYA 4HJJH 2Q8BH 4HWNA 1RZIB 1ORSA 5IF0A 3Q6FA 1S7TA 2V17L 4GUPB 1IVLA 1LNUB 1F58L 5MI0B 1QACA 2VZ1A 2OTWA 5EC2A 5HDQH 1TVBB 1UQSA 3VMOA 1GOHA 3TT1H 1OSPL 4G8EA 4U6XA 2AJZA 1GYAA 5T5FH 1MFEL 4RMUA 3GMNB 3QRFM 1RUMH 1AI1H 2ADJA 4LLMA 4PV9A 4PLKC 3L3GA 2OR9L 3HC0A 3JWOC 2MCPL 3ESVF 4XNZC 2GSGB 1AGEB 4P2YA 1E4XI 3VFVB 2HMID 3V0VB 5DURD 3SEPA 5EWIH 3FQNA 5EU5A 1MFDH 1FGNH 1NBVL 2VUYA 3GIZH 3MJ9H 3CDFA 1UJ3A 5IB5A 4X4ZA 1F4XH 5AG9A 3RX7A 3H3BC 1ZGLM 4Q58C 1YMME 4BSVA 3VCLB 4MAYA 2UVEA 4BZYA 1MREH 5MHSE 4GAGH 2YRPA 2B1AL 4R0LC 1Z9SA 4QRUB 2P5ED 5JA9A 5SWSD 4ZOAA 1MAJA 4NNYA 5BS0A 3MRJB 4XTRC 1YNTB 3TC9A 4PJ8A 1IZKA 2LU3A 3QHFL 1HSAA 1RIUL 2EZ0D 5LBSL 3TN0B 1J1PH 4PS4H 3TVMA 4FTVD 3L95A 5F1OB 4YQXH 1T22B 1X5XA 5DQ9B 4Q9RL 3RAJL 1G7HA 1NGWA 3GRWH 4KJYA 1FFOB 3MRKA 3PGFL 3RBSA 5CS7A 4I4WB 3LKOA 3HE7C 5FIEA 3O6KH 1ZLSL 1CXKA 3QFJA 3FZUD 35C8H 3B3IA 1P9MC 2NY2C 4XHJC 4HG4J 3SDDD 1H5BB 2DQTL 2DQUL 4GMSL 1II4E 2FX9H 5I17B 1DFBL 4YHMH 4NCC1 3OJDB 3KPRD 3VJ6A 1FPTL 5HHMB 1VSCA 5TQ2L 2ZUQB 1I8LC 1CZ8H 3TCLB 4PJAE 3O2DH 2VC2H 2F19L 1QLEH 4U7MA 1J0JA 1A7NL 1WAAA 4G9DA 2Y7QB 4FNLH 1DQTA 4X6CA 4OQTL 1L6XA 5GSVA 4L8DA 3FT3A 4XWGH 4ZAKA 4Z7UF 4ORGA 1DLFL 3BP6B 4HKXA 3GKWH 1L0YA 4KUCD 5IROC 5B38G 1N5YH 2VLJA 3BP7B 2ORBL 4YFDB 1ODAA 3F7VA 1U8HB 1I4FA 1QFPA 2D31B 1KPRA 3RKDC 2RR3A 3BZ4A 2X9XA 1AXTL 3OF6A 2BY1A 2C3VA 2W0FB 5AG8A 3ULVC 1Q38A 2ITCA 3V5HA 2FJHB 3WUWA 4PRDA 3RIAK 2ZSVB 1FVEB 4WI6A 5C08B 5JQ6H 4UB0H 3VD9A 2APVA 4Y2DD 2BJMH 4I9WD 5AZEH 5CJOL 3TNNB 4Y4KA 1KIUA 1I8IB 1X4XA 1D9KD 1GGIL 1U3JA 1HKLL 1KLGA 4KK9D 3U0PB 1FG2B 2XY2A 3RQ3A 1ND0B 2CDFB 2QV2A 4DOHB 5E2WH 3U9UA 1YYLL 4K3HA 1EHLL 4IRSB 1BZQK 4M9OA 1RHFA 1LO4H 1BGXH 4XPBH 4CVUA 5C3LD 3ULUD 2HFGL 4JREC 1KUMA 4J6RL 5J1SC 5HTSA 4BFGA 1UM6L 4EI5C 4M7LH 2R23B 4WO4C 2YS4A 4GW1B 3BYYA 3V5KA 1OAUL 5HVWA 2A6DB 1PVHA 5ADOH 4KUZL 4Q6IA 4YBQD 5GS1C 3WE6A 1EERB 1QRND 3U1SH 3T4YA 3QYCA 3I6KA 5E5RB 5ICXA 4LK4A 3GI8L 5DI8B 1VDGA 4GXVL 1MSPA 5EOCH 1F11B 2G2RB 2Z35A 1BVLA 3FO2B 4RX4D 1WGOA 4LSSH 3CVIL 1A3LL 1KELL 1DUYA 4MMXC 2G60H 2PXYB 1EFQA 3O0RL 4X7DC 5SX4H 3AB0B 2JJTC 5BVPH 4A6YL 2BNUA 1QZ1A 1N7ML 3DIFA 4NQCA 4NQEB 2EH8H 4TVPL 4KI5D 4G8IA 5HSFA 3S98A 5E2UH 1JWMB 4LF3A 5A16B 4Q9QL 4PRHA 5J56B 2BSED 5I8EB 1U2CA 3P2TA 3VGEA 4ZNEE 1YEKH 2XTLA 4HZAA 5IHUH 2QADD 4L3CA 4G42B 3STBA 1U3HA 4JFZH 1IC7L 4W70A 3OB0K 3HAEB 1WCBB 6CGTA 5C7XL 4NPYA 4PJHE 2IQAB 2R4RH 2R0LL 5JHLH 3TFKD 3STLB 5AYUH 3C6LD 3SKJL 2NY5C 2NW2B 4XNMA 5BMFL 3MRPB 1A1NB 5C07B 5B21A 2OS7A 4KRPD 3TBSA 4NNPL 4YHOL 3IETB 5B39B 3UPCA 2NQCA 3TBYA 4JRYA 3QIUC 1ZANL 5GZOD 4KDWA 1JGDB 3QXDB 4F7EB 2XTJE 1C12A 4XNUL 5DEGA 3RVXD 4KC3B 3BDYL 4DAGH 4N0RA 3ALPA 2CDEB 2N1KA 1UYWH 3KJ6L 3EO9H 4X7FC 3W0WE 4F7TA 2GCYB 1UKSA 2A6KB 2BVEA 4Z7UB 4NNXB 1FE8L 1T5XA 3SJVA 4X4MA 5IVZB 5LG1A 3TWCL 1H15A 2EH7L 3OAYH 5DD3L 1CGWA 4HPYH 3C60B 3F6IA 1HILB 5D96B 4HEME 4NHUB 4I2XE 4U6VL 4CNIB 4QYOB 2FWOA 1KEMH 4MJIA 3KPNB 2CLVA 2D9CA 3VG9B 5DQJA 5JOEA 1Y6KR 2YD2A 3QDGA 1DZBA 4YDLC 4PJ7E 3MLPA 3DSNA 4HDIB 4X6DA 4ZFGL 4QHNB 3CFJA 5EPMB 4KK5C 1RIHH 1XCQA 2YPLD 5F70A 2E9IA 4LPVA 5HJ3B 4HD9A 3FFCA 3QZWA 4TNWK 5GGVH 1KJMB 3D48R 1G6RB 1YY8B 2WWKO 1OAZL 2V9QA 2Y36H 5DJ6B 1FYTB 3P73A 4NKOA 3KPSB 3D0LA 2DQCH 3BIKB 2X89A 1U8PB 5FGCE 4UOW1 4WJ5A 1YEDA 1N0LA 1H5BC 3FOMB 1P4LA 3BIBX 3GEWB 1R24A 3RIAF 1NFDF 3QG6B 3KDMA 5JO5B 3CFDB 4XNQB 2BDNH 1DEDA 1TCRA 2KQMA 1LD9B 2BXZA 1YEHH 4PD4J 5D71L 2FSEB 1BD2D 4HH9A 4JO3H 2WUCL 2EXWC 3QPQD 4BJLA 3IS1X 4DKFL 1PYWB 1NC4D 3TYGL 4CVZB 5LAXB 4FHBD 3T65B 3C5ZA 1TFHA 5I1LB 4TVPE 3ARSA 5DYOB 5CUSH 5AZ2L 2HT2C 1FFPB 3UTZB 5BZDA 1JHLH 1PY9A 5IQ7L 4JO4L 4BK4A 1QNZL 3UAJD 2UZXB 1JK8A 1QP1A 1P7QD 5F9WB 4J23A 2EE6A 4V3EB 1PG7X 4N1EA 5HPMA 1FC1A 2ENYA 3QA3B 3SDCC 3ZKQD 3KWWA 1K8DA 1F4YL 3P9LA 4TTDC 1BBDL 4PBWD 3BFOA 1OWRM 1OTSD 1UB6A 2ESVA 2XZCL 4EQ3A 2ATKB 2KPNA 4N0UE 4PJCA 4F33A 2AQ3A 5CCKH 5DRZB 3S37L 2JLLA 3ILQD 1QSEA 4MB4A 5CJQL 3EGSA 4K3DL 1A6VH 5E8OA 3UTQA 3T0ED 3MLRH 2WP3T 2VLLB 2H2PC 4IRSC 4Z8FL 5BS0E 4Y16C 5DVLA 4P9HC 2XZZA 4POYA 5J13C 3SDAB 5E1HB 4TUKL 4FQ2L 3ZDZE 3WXWH 3LMJH 1Z5LA 3CZFB 3L1OL 4U2YA 2MOVA 3D3VB 3QFJE 1MH5A 2P5WE 1F90L 2X4RA 4JJHA 5C0EB 3KYKH 4KK6D 5DT1L 3IKKA 4NQDD 4OF8A 1TJGH 1XR8B 2RAMA 4ZTPL 5JORA 1RFDH 1H8OA 5D70H 4S0TD 3H3PL 1NKRA 4O58H 2PCPB 1Y0LB 3BH8B 3BOVA 5D2LE 2FLRT 2AJ3B 3OKKB 1GZQB 5CIPB 4FQLL 3NAAH 1BIIB 1PSKH 4X6CE 3IDJA 4GQ9L 4Y1AB 3ARGA 1TTUA 1KF9B 5BV7H 1HCFX 3VI3E 2EDOA 5TE6H 5I18L 2PTVA 3RNQA 2LAAA 4OUOA 3IXAA 2HRLA 3TIDA 1NBYB 3VGGA 1TVDA 4R3SB 4BKLA 3V6ZB 1WSST 1YEJL 1MCPH 5BRZD 2I5YH 1QEWA 5DHYA 5C09B 3J8F7 4DGIH 4N0CA 5GRUL 4DZ8B 3C5SB 5DVMA 2WBJA 5FO7B 3O3DA 3IS0X 2MHAB 3ARFD 1LO2L 4ZSOA 4JFFD 3L7EA 3GSNB 4X6EB 2BRRL 1FL3A 3OAZK 5L2KD 4EOWH 3BZEA 5TH2A 3KLAA 1NFDB 1XIWA 2PW2B 4UTAH 4PJXA 3VFPB 1MFBH 5F7LB 1DCLA 4BZ2L 4BQ8A 4CJ0A 1INQA 5CSBA 4JFXA 5C0IA 3D2UD 3C2SA 4LARL 3QUZA 4L1DA 5T1DL 2AXFB 2RCSL 4ODUB 3NIFF 1MQ8A 4HJGB 1HH6B 4QRRD 5ICZA 1RMFL 1U91B 2CJUH 1IQDA 5L8JB 2AQ1A 3ZE2E 3BYTA 1CE1L 4JHWH 4LDEB 4LSRL 1SY6A 2CUIA 3C60C 3ECBB 2HT4D 3KPLA 3MYJB 3ARUA 5D96C 3TA3D 1BQUA 3PQYA 4M7LT 3EFDH 3WFDH 2CRZA 5CIPH 2WUBH 3KYMA 4WFHD 4AMKH 3PWNB 4H20H 1YEEL 2HJKA 3VG9C 1RZ7L 4R4ND 1GIGL 1JPGA 1CTNA 4QY8A 3W9DB 5MENB 4U6YB 3QDHA 4Y19A 4TULH 3TNMB 1JRHL 2VERN 5KSAA 2ICCA 1MI5D 4EXKA 5T3ZL 3F58L 5DQDH 4ZOCA 5DC4B 1QBMH 3FAXA 2VLKB 4PTTB 5TDNA 7FABH 1ZT4A 1TZGL 3SQOL 3HNVL 2J4WH 1CE6B 2AK1H 5EOQL 4JDVA 4AENB 3X14B 1IM3A 5JDSB 5DJCA 4BUGA 2IAMD 1FVDA 1WTLA 4MS8D 3F7YB 2CKNA 3GSNH 4ELMF 3K46A 3ZYOA 4DN4H 2LE9A 4G9FA 1AQKL 2YUZA 4KMTL 3S4SA 4M62L 3FB7A 4YR6B 2FHBA 4HIJB 4EDWH 1YPZE 1X5ZA 1QLRA 1F3RB 4I3RH 1K5NB 5F72S 5MEPB 1INDL 2EEBA 2OZ4A 1EGJH 2VDLL 4Y8AA 2X40A 3RVUC 1S7UB 2V2WA 3RUGB 1H3PH 1E4XL 1MCWM 3BDBA 4DKAA 3QUXA 1UM4L 2VNCA 1VCAA 5DS8A 1LGVA 3QUYB 2QR0A 5E08H 5HY9A 2BOCB 4I0KA 4L8SB 3HC4L 4CVXA 3MO1A 2R0ZL 1AGBA 1VFBA 4LVEA 2XZAH 1LK3H 3AREB 4Z7WE 3VA2C 4WUUB 1IT9H 1V3JA 1U8NA 4ZXBB 5IHZA 2BP3A 1X5AA 4PP1C 1CGSH 2MTPA 4CMMB 3WL9A 1R3HB 2X4QA 3LRSA 4TUJB 4XVTL 5DJXB 1LO0H 5F7HA 5FUZH 3PGCB 4JFEB 5D7IB 5HI5D 5GJTL 1MQKH 1L7IH 4KI5F 3EYVB 3NIDF 2VLRE 1I1YB 4XX1E 5DEFA 4MXQA 2VZTA 1A7RL 2XXCB 1OAQH 4HBCL 4HUUA 5E24E 2X1XR 2F53B 5EIVA 2EDDA 3CXDH 3DVIA 2E3VA 5D7LB 4LQFH 3RU8L 3SDAC 3P77B 3QDJA 2MQ3A 4AIXA 1E6JH 4R2GB 2E6QA 5IESH 4MHHG 1H0DB 3FN0L 1XZ0B 4JDZB 4N0FB 1H3GA 3ALWA 5KOVC 1G7IA 5F96H 4IJ3B 4AEIL 1PG7H 2VDNL 1T66C 1U8MB 3WNMA 1SJEB 4JRXD 1BZ9B 1TZIA 5EU4B 3A6OA 1FNSL 1QPPA 4NDMA 1YY9D 5EU6B 4GKOA 2ADGB 1INEH 1EMTL 4XPHH 3CFBA 3D85A 3PG2A 4UINH 3OB0H 1JGEB 1QSFE 1SYSA 5EFIA 3TPUB 5I73B 3O11B 4YDJA 3UTTA 1RK0B 2W9DH 4KQ4L 1CK0L 1K3IA 2DQFB 4HC1A 2E27L 4GW5A 5I19H 3ZYIA 1JGLH 3OQ3B 3E2HA 1JPTH 1T83A 3KR3L 1CLCA 5IW6B 4HWBA 1T1YA 2FL5A 3IDGB 3PWJB 2VL5A 3O4LA 3F6LA 1IC5L 4AEHL 4J3VA 4GO6B 4ZS7L 1E4WL 1WIUA 3LQMA 1GAFL 2C4FT 5T1KB 3DMMA 1CD1B 4NT6A 4WWKC 3DX8B 4CADB 2J6EL 2DL2A 2X7LA 2ADFL 4M61B 3HE6B 3O8XC 3T1FA 5IFJA 4Y8DC 2BZDA 4LCWA 4U1IA 1VFMA 2P45B 3JWDC 4K07A 3PHQA 5GGRY 3HNSL 3DVGA 1I1AA 3MV9E 4CU7A 4IRZL 2BSSB 1J5OH 1Q9OB 4F37F 2HH0L 3A6CH 4Z76B 3GSVB 2AEPH 4K7FA 4WI3A 5J0BA 5JQHC 5FCUL 4ELMB 1SY6L 4OM1H 4RIRA 1LMKA 1QSEE 3GMPA 3QHTC 2XZQH 1OHQA 3C6SB 1P6FA 3QEUA 3LKQA 3DXAE 3T0BA 5E1AB 1MPAL 4OGXH 3ZL4L 1DANU 1MFNA 1IC1A 3N9GH 3T0AA 1IGYB 2Q6WA 4UV4L 1U8OB 2HFEA 4LBEB 3BGMB 4PY8I 4W6YB 3EUUA 3QUMH 5DC0A 5GIRB 1AXSA 5EOTA 3B9VA 2O5XH 4IRJD 5BOZG 3U2SB 2YPKB 3IYLW 4EN3C 1YMMD 3MFFB 1T3FB 1A7PH 4PJ5A 5KBNC 3UPRA 2EKSA 5MHSD 2RBLA 4Y4FA 1KPUA 3IAGC 5IKCB 1A1OB 3AUVA 2X4SA 2X70A 3C09B 4FQHA 1DLHB 2LV4A 3TT3L 4CUCA 1QFWI 3MRGB 5EDXA 4BFBD 5A2JH 2OJZH 1KCGC 5EBLB 1YNLH 2ZKHH 3ERYA 3ARTA 5TFSL 1URLA 5DR5H 3V6BR 1M05B 5BZWB 3OTTA 3WUWG 1I85C 4U1MB 3IDXL 2OZ4L 4LGPB 3BWAB 2ARJB 3GSUB 3GSQB 5CEYB 5CP7B 4R0LA 1GPOL 3QEQB 5B4MD 1M1SA 5J6HA 3I3BA 2DF3A 2EIEA 3OXRA 5GGTA 1B0WA 4H0IA 1ZGLB 2JK5B 4ESKA 4I3SH 3MRFA 3ULUH 4OI7A 3WNPA 3IJYB 5DZLA 3CFCH 1WV7T 1NCBH 2H41A 3P30H 1HSBB 3G08B 3PJSB 3FRUB 5I74B 3SCMB 3HG1B 5H37G 1PX3A 3I6GA 1BVKA 3HE7A 1QUNA 4NZDA 1KN4H 1N59A 3B83A 3ARDD 1LP9A 5E8EA 3KHOA 3UC0L 5I1KL 1P9MA 2MKLC 4RISH 3HFMH 3DTXB 1FN4A 4LLWB 3AREC 6FABH 1D6EA 3IFPA 2X4PA 2BOBB 1MAML 3MUGA 2I60L 1HXYB 3QB7C 3SKOA 4ZXBC 3MV7B 1V3MA 4L29B 1I8LA 1MWAH 2GTWA 4NQSB 2Z8VC 3BHBA 4WI8A 3KNBA 3V5DB 2AV1B 3NPZB 4HEPG 3MGOA 1KCRH 4LPUA 2XG5A 4PB9L 2EO1A 2B1HL 3GZKA 5GRVK 3P4OA 1KCVL 1UH3A 1MEXH 1UM5L 3ARZA 3SGEI 4JN1L 3SKMB 3O6FB 3OV6A 4XT1C 4JPKL 5LGJA 3GSOB 2OL3B 2Q86B 1SVZA 3UTPE 1IGCL 3EOTH 1F4HA 4K9EL 4AIZA 5E8PB 1I3VA 2A6IB 5CILH 3SPVB 1RD6A 2BSRB 3QQ9C 4QRQA 2CIIB 3QCVH 1W72A 4LGSB 2BVPA 4U1NB 4LLYA 3X3FH 3VW3H 3SO3B 3S9DB 4LRNL 4WU5B 5IK3B 2QQNH 4HC1L 1QO3A 4NRYB 4HGWB 1MCQA 3TBTB 3LD8C 3S3SA 1I9IL 3NZ8A 3RKPA 3TZVB 4KTEL 2AJYH 4HWBL 1PEWA 1VPOL 3LB6C 1H9VA 1OOAA 2XNAA 5CHNA 5LKNA 3UO1L 2BNRA 3VMPA 1OGAA 5I73C 5FYJL 3UP1A 2R9HD 4LKCA 3BXNB 4WU7B 3B2VH 2D2OA 3L5JA 1G7LB 4NZRH 4JM4H 3QO1B 4FFYH 1UACL 3RVWC 3VG0H 1WISA 5IG7B 4EI5A 4WO4A 1XR9B 1YQ2A 3VXSA 4P5KB 3BPNB 3B6SB 5EIQA 3S5LB 1H3VA 5GS1A 3W9EB 2IBBA 1TVHA 5JW5B 5LCVL 2O26U 4PGCB 2Z0BA 3HE6C 5I1IL 3QNXB 2VABA 4KKBC 1Q9WB 4H1LA 4X5LA 4XX1G 2FJFA 2YXFA 3U9PL 5HI4C 4FP8L 4UDTB 2VXUH 2BY3A 4OBRA 4V1DA 3PV6A 5A2LH 3IJSA 2JJTA 4CRPA 1T20A 1V7NL 4NUJA 3HI5L 1WFNA 3KPQA 3RBGA 1U8QB 2I9LB 5IOPB 2IADB 1I7RA 3UJIH 1JGUL 4HBQA 5IP4A 2X4TB 3FCTA 5D1ZD 5I30H 3QZWG 4ODHH 5DK0B 4PJIF 3IJHA 2M1KA 1J0ZA 1O5DT 5C6TL 4NIKB 2XTJD 3MOBH 2DM4A 3QT2A 3GBNL 3MOAH 4RGOH 1LO3H 5T33H 4ZUVB 4DTGH 3W0WD 3D18B 1Q0YL 1X4ZA 3VFNA 1BZ7B 3RGVD 3TJHD 1P84K 4GUPA 3JWOL 2NYYD 3MGTB 4C56B 3QJFA 2W1NA 5CD5C 4PB0L 2ZOLB 4NZUL 4QCIB 4XVUD 3P4NA 3CX2A 5IJKC 4RA0C 3NGBB 3GMNA 2IMNA 4U1LB 1A4KA 2OX5A 4L5FH 5JNYB 3G5XB 1T04A 4OGYH 3QIUA 5C0GB 1GH7A 4KXZI 4LIQE 2GSGA 3BUYB 3VFVA 5DK2A 2OSLA 3ROOB 4TRPL 1T2QL 3R0MA 1S8DB 4MJ5B 2DQHL 5GGTL 5FYLH 1OP3K 1S7RB 4YBLC 2QQKH 5KVDL 3S3PA 1BOYA 2ZJSH 2P8LB 1AO7B 2ZZUT 4X9HA 3FQRA 4FFWC 3MCKA 2EXYC 3VCLA 5F9OH 3PWPB 1X6LA 1U41A 5FYJE 4OM0L 4J8RA 3SO5A 4W81A 3MRJA 1NGQL 4XB7A 3HUJA 5HYQB 5JPMB 3WUZA 2ATPB 4ALAL 4UOW0 1NUNB 4ODXB 1SEBB 1RUQL 5HGHB 1ZA6B 3MRNB 4NO5B 5IBUG 2VQUA 2VZUA 3KPPA 1AC0A 1QD0A 5HHVH 1CTOA 1F3JB 5DQ9A 3PL6B 1JNHB 1B2WH 4NZTL 4TVPD 3MNVB 3EYOB 3JBG7 5FV1L 2X9YA 4XBGA 3VXTB 2FB4L 4G6MH 5I1DB 5I8KL 3WFEL 2XN9E 4X6FA 2HJFB 1KJ2H 1IM9B 3ESUF 3BD5A 4XCYB 1ZLWH 5KVGH 1B4RA 1H5BA 2PO6B 5I17A 1I7UB 3GHBH 5B38B 3OJDA 2OBGA 1QRKA 3ILPB 4D9QE 5HHMA 4NWUL 3TO2A 4PG9B 3MLYH 3BKYH 3FOLB 4PJDF 5D1XB 5E0QA 2JJVA 3NFSL 4ZFOB 3ULVL 3PWVA 3IDYB 1HHKA 4ODBD 4UIMB 5DGRA 1QSZA 3O9WD 4B7IA 1T89C 1RULH 4L1HA 1W72L 4D0DB 3LZFH 1DVFC 4NC1E 1SYVB 1HHJB 4DW2H 3S35L 1Q8MA 4I77L 3A0OA 1T1ZB 1HOCB 3BP7A 4MAYD 3WJJA 2YMXH 4MSWA 4MXVF 5IWLC 5D8JL 1U8HA 4GLRI 3LPWA 5IIEA 3O6FC 2QSVA 1J05B 5ESAB 2NY0D 5BS0D 3SDCA 43C9B 3RA7L 3MSPA 3LKNB 4JPIB 2W0FA 4HJJL 3GMMA 4YDIH 2FJHA 1LDSA 2DS4A 3U6RB 4KJPC 3VWJC 1J18A 3C87A 4XP1L 5C08A 3EW3B 4QRTB 4P46D 3LV3A 3SO3C 3OKYA 3IF1B 4OIIH 3TNNA 1JNNL 2IALB 1JPSH 1XGTB 4L4TE 3WIIL 1FG2A 1E4JA 3QFJD 4KAQH 2P5WD 1RUML 3OAUL 1FV1B 2J88L 1RK1B 1JMXA 2B2XL 2DBLH 4FXGB 2AXHA 4IRSA 1MHEB 3ZDXE 1HHGB 4X4YB 4Y16A 5JHDB 2NY3B 5BO1H 5EWIL 4BK5A 5F1SA 4XWOD 2V5SA 2R2EA 3VFWB 1R0AL 1YQVH 5CEZL 3GJFK 4ZAKD 4JY4B 1C8PA 1W0VB 5I66B 5KTEH 4Y5YB 4WHTB 4QF1B 5DI8A 4E42B 5A1AA 1LP9E 4OD2B 4NN7B 2B5IC 2DQJL 2XFXB 2G2RA 3RDTD 2ZSWA 5IMKA 3VU2A 2BK8A 4PS4L 2IG2H 2FBJH 3QDMB 3RZCC 1NEZB 4E5XB 5INDB 3C2AL 12E8H 3MJ8B 4EDXB 1S7WB 1MJ8H 4Y4KD 1MCKA 3MROB 3O6KL 4NQEA 4YC2B 1GGBL 2DM2A 5IFHL 3DECA 5IT2H 4HUNB 5GHWH 5A16A 2LFGA 5ISZE 5I8EA 1HH9A 2NY5L 3FT2B 4OD3H 5HDLA 1CG9B 4D2NA 2N7BA 1LEIA 3TO4B 4C83A 2H2SC 3H9HA 3HAEA 5EZOL 1WCBA 1C08B 3H7LA 2R8SH 4QGTA 5HGAB 3OX8A 4X9GA 1EEZA 4XWGL 1GGCL 2ED9A 5D2NE 3S4SG 1C1EL 2PTTB 3O2VH 5C07A 1RZFL 1KCUL 3BRGC 2Q3ZA 5B39A 3O45A 5DJ8B 3DRQB 4TSCL 5EUOF 4M5ZH 1FO0B 1A7QH 3DV4B 4PJDB 4GSDL 1JGDA 4F7EA 1OLLA 2CKBH 1V5JA 2CDEA 4MA1B 4NWTH 5L8KB 2GCYA 2A6KA 4OCWH 4OLXL 4NNXA 1X9QA 4JY6B 4PJBE 2WV3A 3RI5K 4EI6B 4NCDA 3C60A 4Q6YA 5BQ7B 2Y06L 4NO0A 3K4ZA 1ETZA 4NHUA 2JELL 3DGGB 4JPVH 4CNIA 2DIAA 2NY1D 4QYOA 5GGQH 3VD5A 2FATL 5C0DB 2FRGP 3VGHA 4URTB 4XP4H 1LO4L 5KVEL 4QHNA 4S10A 4M00A 2ITDB 5F7EH 1PZUB 1U93B 1IGJB 5CEZE 3GGWB 3PL6C 4QTHB 1I9RH 3AS0A 1I1RA 5C2BL 3ARYA 1KJMA 1G6RA 5DK3A 1GZPB 1MCEA 2VXSH 5DJ6A 1FYTA 2F58L 5IVXE 3KPSA 3TV3L 1MJJB 1IGMH 2UUDK 1KFAL 5ADPH 4OD1H 2B4CH 4JPWL 1MHPH 4DK6A 1IARB 2XG4A 4I8DA 3VGFA 1NGYA 4CKVX 1R3KB 4ZO9A 4JKPL 5JO5A 4KKCC 3BEVB 1EXUB 3F62A 4DZBB 4NM4L 5F1NB 1JV5A 4XNQA 3WD5H 1LE5A 2EYRB 4HMEA 1LD9A 1MCOH 1C5DB 2Y25A 1JI1A 2FSEA 2RHEA 2ZCKL 3AVEA 2F5AL 5KZCB 3B9KB 4KDTC 1FO0H 3CSGA 4U1KB 3IDYC 4WIQA 2UWEA 3ZO0A 3UTZA 1FFPA 2R4SH 1G9EA 1A5FH 1QFWL 2AABH 4P2OC 1VFOA 3QHZH 2VLRD 2X4NB 4P2RB 2ZCLH 2PYEB 4OLWL 2J3SA 4OKVB 5H2BB 1IFHL 1Q94A 5E2UL 3RFZC 5L6YH 4OZGF 4TOYL 3CLFL 4X98A 1F4AA 1C7TA 4MA7L 1MCHA 3AS1A 1F5WA 1HXMB 2XA8L 4TYUA 4UV7H 4OZIA 3JWNC 4MMZC 4RA3A 3FMGL 1ZS8A 4I18B 1G6VK 1J88A 1IAIM 5E8DH 2YK1L 2R4RL 3G04B 4ZFFB 1RHHB 1KEGH 5JTWA 3FHAA 4M8QB 4KKNA 5AYUL 3CIQA 5DRZA 3G6AB 1D5IH 5HHOA 5JXAH 3IGAB 2FH6A 3PIQB 1T0MB 1FORH 1MIMH 4YHLH 3MLZL 1DP0A 4CL7A 4MVBC 2V7NA 3DROB 1JFMA 1QSFD 4RFEA 4K23L 4AL8L 2MMXA 4ZS6D 2NY3C 1B88A 3QRGH 3SDAA 1J10A 3EO9L 3BEWA 3REVA 4FG6D 5FDYA 4OZHE 1FNEB 5CGMA 2FHCA 3QI9D 4E0RA 5DMGD 3VWKB 2VDOL 5MERB 1QBLL 3HS0B 4HK3N 4TUOB 4UAOC 3CZFA 5C0CB 4XC1H 4ETQA 2FGZA 4Y5YC 4N9OB 4PJFB 5E4EB 1KEML 1K2DB 4NN7C 4FQIH 5IVOA 1WC7A 1KTDA 4XVJL 2FX7L 1JTTA 1MLCB 5FV2A 4UZGA 1QR4A 3RVTC 1EO8H 2PCPA 4QT5B 1TQCC 2UYLB 2WIIB 3BH8A 3BKJL 3MV9D 1KN2H 2BNQB 3MX0A 1KB9K 5F1KC 4YHZH 1GZQA 1BIIA 4HUVB 4MA3A 4FXKB 5GISL 4Y1AA 4WUKH 5FECB 2CMRL 3FKUS 1QSED 3I84A 1TJHH 4AQOA 2BFVH 3P11H 4WWKA 2EIZB 4HKZA 1VB9A 3CLEH 3DXAD 2SEBB 2F9BT 1IEHA 4ETYA 4LEXH 5ITFB 3EO0A 3WHXB 3O8XA 4R3SA 3TO4C 3V6ZA 5HDBE 1T21B 1X5LA 4JEGB 4RQQA 2AJXL 1EFXA 2V9TA 4PRAA 5E9DA 1OP3H 3RI5F 1HYSD 5L0QB 5C09A 3V4VH 1ACZA 4DZ8A 3C5SA 1WK0A 4KJQC 5I1AB 4HV8B 4QTIH 3QCTL 4BQCA 4APQD 4U33A 5I8OH 4J3OC 2PUQT 1TNNA 3PP3K 1UB5B 1WZ1L 4X6EA 4ZYKA 4XMLH 1L7TL 5GS3A 1BX2B 3U7YH 5ITBH 5IW1B 1NFDA 1N8ZB 2PW2A 3O6ML 3VFPA 5JUEH 3FONB 2DDQH 2E9JA 3JV4A 3W5MA 4YPGB 1NGXB 5I76B 3BESR 3MJ6A 2AXFA 2EDBA 4H8WL 3GMOB 2V17H 4MA1C 4QOKB 4HJGA 1HH6A 1U91A 1F58H 1RUKL 5T1LB 3ES6B 4LCCC 5IMLB 1NFIA 4WFED 4JZJC 4OF0A 3BZFA 1KNOB 1ONQB 4MZ3A 2XWTB 5CCKL 4PRIA 2XWBB 5MP6L 1OSPH 2GT9A 4J12A 3MYJA 3QNYB 4OZGB 1MFEH 3ARGD 3CSPA 1NDGA 4GAFB 3ZLQC 4XC3L 1G6RL 4LRIC 3BPLB 2CDGB 5D7JC 2OR9H 3MREB 2MCPH 3NCYP 3OKMB 5FO9A 1F6LL 5FOBB 1ZVSA 3W9DA 4OLVL 5MENA 3WFHB 2C3GA 4UQ3A 4FQJL 3AM8A 5I1CL 2DI9A 5K93A 1NBVH 4G6FB 2OXHA 4N0CD 4PTTA 2VLKA 2A0LC 3WXWL 5DO2C 1HZHL 2WBJD 1E6OL 3BSZL 1OT2A 1DQQB 3WO4B 1CE6A 4P23B 2B1AH 3VXMA 1ZA3B 4NQEE 4AENA 4PGDB 4ONGL 1I85A 3X14A 1A2YB 4RAUA 3QHFH 4P2QB 2OQJB 1RIUH 3F7YA 3OR7B 3TGXA 5J7CC 4IMLA 5LBSH 4LNRA 2CRIA 4H26B 2NY4B 2NX5B 5E70A 2J7LA 4NKDB 3D39B 4YR6A 5F3HB 3B9KC 4Q9RH 3RAJH 1AC6A 1FDLL 2HTKC 3DX9A 1WAAF 3PGFH 4TNVK 1K5NA 3N1MC 5M95B 5MEPA 3NAAL 25C8L 4X6CF 3V79C 1ZLSH 3RUGA 3D5OF 5HYSB 1N5AB 4G5ZL 4JZNB 3S37X 1OCWL 2DQUH 2DQTH 4GMSH 5C07E 5F7MC 1DFBH 2DYPA 5TQ2H 1KTKE 3AREA 2WQRA 4PR5B 3UTPD 1QFHA 1ZSDB 2AEQH 4WUUA 2F19H 2ZP0T 1A7NH 3E1F1 1CICD 5KSAD 4UBDC 4ZXBA 4OQTH 4DGIL 1T4KB 3GJFH 2R2BB 1N4XL 1A6TB 4PGBA 4Z7UE 1DLFH 1NBQA 3R1GL 4RRPA 3EDKA 2KL6A 1MAKA 4Q0XL 2CIKB 5TDOB 4H1LG 4YFLF 5D7IA 2ORBH 4WEUD 3EYVA 3K2UH 4NHUE 5ENWB 5C0BB 3GMLB 4M6NL 4OCXL 4FMFA 5A43C 4Q2ZB 2FO1A 4JKKA 3H9ZA 2GK0A 4WEBL 4K8RC 5LQBL 3P77A 3BKCH 5CJOH 2FDBP 5FKAB 5A2IH 2P46B 4JHWL 5D93B 2X5PA 4LPTA 4JDZA 1XZ0A 4N0FA 1UQSB 1GGIH 1BFOB 2VUOA 3VWKC 4MX7B 1HKLH 5BV7C 5T3XL 2AJZB 1QKZL 1FYTE 4OFDA 3IDIA 1U8MA 2ILLA 2O5ZL 2ADJB 3KPSE 3BD3A 1SJEA 4PV9B 5EU4A 1NCWL 1U6AL 2P5EB 1YYLH 3HC0B 1EHLH 2ADGA 2XWJB 1MFAL 2HFGH 4GFTB 2P4AB 4J6RH 4LCUB 3FQNB 2C1OA 4EUPA 3O11A 5EU5B 1WBXA 2YN3A 4EXPX 2N7AA 1UM6H 5DHVH 1UJ3B 5IB5B 5JW3L 4Y2OA 1DSFH 3CUPA 4KUZH 1IE5A 5J3HD 5JZ7C 4BSVB 4LOUC 3IDGA 3PWJA 3H7BB 3U36A 3V6OE 3VFGL 3GI8H 3IFOA 4JFPB 3L5XL 1CD1A 4GXVH 2ENSA 4XPGL 2HVKA 4PJ8B 3DX8A 4CADA 2NZ9C 1HSAB 3GSNL 1DUZA 3CVIH 2Y1VA 1A3LH 1KELH 3TVMB 1EO5A 3HE6A 5ID0A 3L95B 4P57B 3BO8A 4P59L 1RU9L 3Q3GB 4WVRA 1G7HB 1NGWB 5L0QC 4KJYB 1WF5A 3MRKB 4I3RL 4ODWB 2HWZL 1OVZA 4WV1B 1WZKA 1N7MH 3THML 4TN9A 2BSSA 3U7WL 1H3PL 3B3IB 4TVPH 3JUYA 3DVFA 3GSVA 3W11D 4Q9QH 5SV4A 5E08L 1FFNA 3CCHB 5L9DL 2J2ZA 3VJ6B 4Y7MA 3DO7B 5DMIH 3H9SB 3D85D 3R0NA 1IC7H 3Q5OA 5FYJU 1NMCB 4G9DB 5C7XH 3A67L 1CGSL 1U8OA 3FT3B 3MQIA 2N4IA 2R0LH 2MSPA 1U9KA 3SKJH 3GNML 5GIRA 5BMFH 3CXHK 2UUDH 5JXEC 1MHHA 2VLJB 1MNUL 4GBXD 3U2SA 3VGAC 4NNPH 1T3FA 3GBML 5IJKA 4G6AD 3BPLC 3BZ4B 3D3VE 4NFBA 4XRCB 5FYJD 1ZANH 4NQUA 5IKCA 1A1OA 1VGEH 4XNUH 3V5HB 5C6PB 3HMWL 3BDYH 2RFXB 4X6DF 4GKNA 1KYOK 1DLHA 3C8KA 4LCWD 1K6QL 5E2VL 1FE8H 4Q7DA 1UEYA 3MRGA 4MJ6B 1DANT 4U3XA 3TH3T 3TWCH 2EH7H 3LQAC 3PP4L 2EDJA 4KKAC 4WDIA 3C8DA 4S1QH 4ODSL 3I50L 5JR1L 1M05A 2X09A 4U6VH 5BZWA 4G8FB 2XN9D 4NHCL 2ARJA 1J7VR 4TSAL 1UWGL 3GSQA 2UZIL 3BP5A 5CP7A 4L4VA 5C0JA 4ZFGH 3SY0B 1UWXK 1YEGL 2A73A 4D9QD 1ZGLA 1C5CL 1UZ8B 2NTFA 3QIWB 3PHSA 1M6OA 3V5KB 1JGLL 1KOAA 3B9AA 3NOIA 4QLRA 1OAZH 5C09E 2CLZA 3FQUB 4MQSB 1KC5L 1HSBA 3T4YB 3HG1A 3O4OB 4PYHA 2YWYA 5D5MA 1A6WL 5AAMA 1NFDE 4Y4FD 1NANI 2FD6L 2Z35B 1BVLB 4ZUSA 4JO1L 3DTXA 4LLWA 1DUYB 4M8VA 4P4KC 1ZOXA 5D71H 1NC2D 2WUCH 3EOAA 1HXYA 4DKFH 3EIFA 1NCNA 3AS3A 2BNUB 4YGAB 3MMEB 4NQSA 3DIFB 5AZ2H 4NQCB 4PJCF 3V5DA 3S7GA 5IQ7H 1CD8A 4JO4H 2A9ML 1QNZH 1AXIB 5KAQG 4L4TD 3SOBL 3D9AL 1T89A 4LF3B 4PRHB 1FCCA 1DVFA 4F9PC 4PTUB 2AGJL 4KRPB 5DUBB 4L3CB 5IWLA 3V52H 1U3HB 3O6FA 3GSOA 2OL3A 4XTRD 1WFUA 2Q86A 2HMIC 4AQ1B 1IAOB 2Y5TB 5MENE 2XZCH 5E8PA 4C57C 3ZTJH 5H37H 2A6IA 3SPVA 1P4BL 5D93C 2BSRA 2G5BA 3VWJA 4UOJA 4I13B 5DUPL 5EO0B 1E27B 5FHBH 4U1NA 3K80A 2VLKE 3S37H 4WU5A 1UKTA 4NRYA 3TBSB 4K3DH 4BQ9A 1ADQA 4PPTA 3HAEG 5KSVA 3TBYB 1D5ZB 4OB5L 3HRPA 4E9LA 4KROB 5EU3A 1C12B 1QFUL 1CYGA 5C0FB 4PJEA 4TUKH 2EZ0C 4FQ2H 1XF3B 1CR9H 3LDBB 1ITCA 1T5XB 5GRZA 3SJVB 3IT8D 3LN5A 3BXNA 4WU7A 4EIGB 1CS6A 2P47B 1WJ3A 4ZO6A 4QXGL 5B39G 1BAFL 1YNLL 3PP3H 5IG7A 2ZUTA 2E7HA 1XR9A 3MODH 2VAAB 4P5KA 3DI3B 1F90H 3FZUC 1F97A 3VFUA 4MJIB 4QXUL 1WEJH 3QDGB 5DT1H 5JW5A 5CKGA 3G9VA 4ZTPH 4X6DB 3VRJB 5JLZA 5ISZD 3CFJB 3V0AC 2Z4QB 1F6AA 1DQJA 3LEYL 1XCQB 5AAWA 3HZYB 1Q9WA 1WFOA 2ZNXA 4WUUE 3FFCB 2E7LC 3LPFA 3UTSB 3H6JA 4UDTA 2DMKA 4FQLH 3RZCA 4WV1C 3VXNB 4LP4A 4NKOB 4GQ9H 4L3AA 2HJLA 4JKMA 3KYOA 4WJ5B 5I18H 4EJ1C 3BN3B 1YEDB 2I9LA 5IOPA 3Q48A 4HIEA 1PLGL 2IADA 4JFEE 1R24B 1KN4L 4O2CA 4WRLA 2X4TA 4BQBA 3KDMB 4P9ML 1AKJA 3KS0J 4PJXF 2DMCA 1Q72L 2I9TB 3HB3D 4XB8A 4HIXL 1YEJH 2F53E 1NMCC 4ZUVA 5GRUH 5D7LE 2DTSA 4P49A 2QJDA 1NQBA 1BZ7A 5BZDB 4Y2DC 1LO2H 3KYAA 1BBJA 1GRWA 5KS9F 3MGTA 2FJGB 2BRRH 1D9KC 2HVJB 4JY6A 3GHEL 2ZOLA 2NTSP 3UROR 3L3HB 1K8DB 3P9LB 2J8HA 3MRIB 3LS5H 4U1LA 1MJUL 1XFPA 1Q0XL 5ALCH 4P5MA 4W4NA 5EU6E 1NFKA 4BA8A 1RJLA 1FLRL 4HJ0C 5T1DH 3QPXH 5BJTA 1F3DJ 4YHPA 5I2IB 3NIFE 3HRZB 1RMFH 1UB6B 2ESVB 3DX7A 3ULUC 3TPUE 2GTZB 4PJCB 2PKDA 1CE1H 1CGTA 3ROOA 5CEZD 4LSRH 4F33B 3JTSA 5GS0H 4V1DD 4GMTL 4DKDC 4UMGA 3MA9L 4MJ5A 3CVHB 1W8OA 3JXAA 1NPUA 1CLOL 5D7SH 3MRDA 1T03L 4NBZB 3T1WA 4B53A 2YA1A 3EGSB 4YBQC 5E8OB 2P8LA 2V5RA 1XGUA 3MV8E 1YEEH 3WFBL 1RZ7H 1GIGH 5HYIA 3PWPA 4LVHB 1XF4B 1KBGH 4B50A 2AI0L 1JRHH 5HYQA 1CCZA 2Y07L 3S6CA 5JPMA 5T3ZH 2ATPA 3T4AA 1GGTA 3F58H 5IMMB 1L0XA 2Y6SD 1SEBA 4NBXB 5KANI 1ZA6A 4GS7C 3MRNA 1S9YB 4NO5A 1RY7B 3P4LA 4F7CA 4JM4L 1TZGH 1F3JA 4RFNC 3SQOH 2VDKL 3HNVH 3PL6A 5EOQH 1IC4L 2CR6A 1MF2L 2X4RB 4ZUUB 1MVUB 1TENA 5I1DA 1S7XA 4NRXA 4M6ML 2J12B 4ELME 1IM9A 1I9JL 3MC0A 2AERT 1OP9A 1AQKH 4KMTH 1AD0A 3NABL 2DMBA 5E2JA 5J8OA 1I7UA 3MA7A 5DFVD 1A8JH 3OGCA 2QADC 1BFSA 3ILPA 2YD4A 5DJ2A 4QO1A 4PG9A 5BRZB 1INDH 3N1FC 2VDLH 4KDTA 2OL3L 3ZKND 3KVQA 3NTCL 1E4XH 3L3JA 2DWEA 3TFKC 1UM4H 3V8CA 3D25A 3Q5YA 4IIQB 3UJIL 3TIDB 2MQCA 3HC4H 1SYVA 4P2OA 2R0ZH 4KRPC 2D7MA 3MJ7B 4MDIA 1QYGL 1T1ZA 1NLDL 4BKLB 1J05A 4K94H 5GZOC 3OSKA 3E3QC 1IGFH 5F9DC 3LKNA 4JPIA 4F7PB 3RVXC 1LO3L 1BJ1H 3LRHA 3P0YL 3TN0D 2UY7A 3D87B 3SDXF 3U6RA 4XVTH 2GJJA 1I3GL 3NCYS 4ZSOB 2XOTA 3L7EB 4LVOB 5E03A 1FL3B 2Q20A 2IANB 3IF1A 4MNHA 2DLFL 5GJTH 3BZEB 2IALA 1XIWB 4KI5E 3BPCA 2FO4A 3NIDE 4PJXB 2NCMA 1ZT1B 1A7RH 3CK0L 1N6UA 2HLFD 4HBCH 1INQB 3IFLL 1RIVL 4LLDA 4JFXB 3WNNA 4F80A 4L5FL 1RK1A 2HTLD 2NXZB 2YKLH 3MBEB 4DJMA 3ARQA 1A0QL 3QEQE 4P0DA 2IQ9L 4MVBA 3O3EB 1MHEA 1HHGA 3KGRA 1IQDB 4Q9BA 4X4YA 1G9MC 5JHDA 3FN0H 4XAWL 5KS9B 3GIVB 4LHUB 1HQRA 4AEIH 2W65A 5KSBA 2VDNH 5F88A 1KIRA 4PBXA 3VFWA 3BMVA 5DJAB 1M7XA 5GQBA 3KYMB 4JY4A 1FNSH 5ANMB 5I66A 4Y5YA 3T77A 4WHTA 4QF1A 2MQ0A 2YRLA 4QY8B 4E42A 4Y19B 1KG0A 3FHQA 4V2BA 4KQ4H 1CK0H 1A3RL 4DN3L 4XCEB 2E27H 4U6HB 4K2UL 5J12C 3D6GA 5TDNB 2X10A 4WI4A 3QDMA 1FZOA 1NEZA 1ZT4B 4AG4L 3FQXB 3MV7E 1RV6X 4KMLB 3VDBA 3WN5B 5C08D 4PLJD 5L2JB 3MJ8A 4AEHH 4EDXA 4ZS7H 4N0YL 1E4WH 3FB8B 1RZKL 1S7WA 4JDVB 1GAFH 5A2KH 3AGVA 1K4CA 1IM3B 3RWEB 3MROA 5DJCB 2RJMA 1CDIA 3UAJC 3KXFA 4D9RD 4EKXA 1U95A 2J6EH 3BN9C 2AK4E 3U46A 2ADFH 1PGRB 4G9FB 2NNAB 3Q5TA 5TGBA 3FB7B 1IL1A 3FT2A 2JIXD 5CBEB 1KIPB 4YGVB 4J4PD 3HNSH 3FRPA 3TO4A 3MLYL 4IDJL 3MXWH 2NZIA 4IRZH 2KUTA 3RZWA 2P42B 1P5VA 5HGAA 4L8BB 1XCTB 2HH0H 3QUXB 1S7QB 3WYRA 3MR9B 2WIMA 5FCUH 4U1HA 3WKML 3W5NA 1SY6H 2QR0B 1P53A 1RULL 2DI8A 3ILQC 3LZFL 2PTTA 3GSRA 5ICYA 1AGBB 2WMPA 3JTTA 1ZAGA 2D7PA 3HPJA 3T0EC 1UWXH 5I9QB 1DJSA 1G7QB 4NQVB 5DJ8A 3DRQA 2F54B 1MPAH 3ZL4H 1S5IH 4PJDA 3FJTA 4UV4H 1RZGB 4PGEB 1JZ4A 2X4QB 3R06A 1JZ7A 2PXYD 4O51B 2XQYG 1DN0A 1XGQB 4LCCA 4NC0B 3WJLC 4OLYL 4JZJA 5SWQA 5TE7H 4N8CL 1A21A 2FIKB 3DARA 3M07A 5I0DA 3JZ7A 4HXBL 2H45A 4HUUB 1ULVA 1YEIL 4NQED 2CR3A 3DGGA 4KK6C 1CFVH 4LRIA 3AY4C 5D7JA 1O7SA 2R56H 2DBLL 4RRPG 2K9UA 5IVNA 3QDJB 3GSWB 3SDXB 1PW3A 2F15A 5FYLE 5E56A 4YEEA 2DL9A 3BE1L 1U93A 1KJVA 3GGWA 4JHBA 5TFSH 4QTHA 1ZHBB 1MLBB 4DQOH 4OCLC 3ORJA 1D5BB 4JO2L 1IJ9A 1BF2A 1GZPA 2YEZB 4KVCL 2OZ4H 2Z91B 1TZIB 3EDJA 5FGSA 5K33A 2CLRB 1EEYB 4ZFOL 1MRFH 4WTWA 5C07D 1GPOH 2APXA 3V4UL 4Y88A 1NCCL 4X5XB 3VGBA 2VO5A 1SYSB 2WINA 3UTTB 4CU8A 3RWIB 1MJ7L 3BEVA 3STZB 3EYSL 4DZBA 5F1NA 2EYRA 3NFPB 1PAMA 2AV7B 1NJ9B 1C5DA 1J1XL 3NH7L 1HINL 5EA0L 4DKEH 4OF3A 5EORL 3IVKA 1R3LA 4RGNB 3B9KA 1T1YB 3X12B 2FL5B 1MCLA 4O5LL 1ZHKA 2P49B 2VL5B 1AE6L 3O4LB 2P44B 9CGTA 3ARFC 3DMMB 4HFUH 4NT6B 4C56E 4IIQC 4EUPG 5DMKA 2HRPL 3EJYC 3UC0H 2X4NA 4WI2A 2PYEA 4RGMB 3JTCA 4OKVA 2YD6A 4MNQB 4YX2L 1MAMH 2I60H 2J1KA 4U1IB 5CBAA 3OKLA 4Z7OF 1X4YA 3CFEB 3DVGB 1I1AB 4TQEL 5AWNL 3ULVF 1NKOA 1BWWA 4LVOC 4OGAD 2YR3A 3G04A 4PB9H 4ZFFA 2I24N 2B1HH 2HT4C 2FEDD 1HQ4B 5ESQA 4M8QA 3GMPB 1FYTD 3TA3C 2HFFA 1OT1A 3G6AA 4UT6L 3KPSD 3QEUB 1KENL 4JN1H 1AO7E 3PIQA 1ZKAA 1T0MA 4JPKH 2DQEL 4ELKB 2VXTL 4R4NC 3MBEC 3PWPE 3E0GA 1J0HA 3G5VB 3MRLB 4K9EH 5DD5L 2HFEB 4B0MM 3FQWB 2ZCHL 3DJ9A 2BVQA 2R1WA 5IW3A 5EOTB 4TSBL 4AEFA 4HC1H 1FNEA 1EX0A 2VDPL 3VWKA 5L2KE 4FQXB 1GOGA 1I9IH 2GYSA 3VXUA 4KTEH 4HWBH 1S78D 3RVUD 1VPOH 1L6ZA 1JF5A 2X4SB 2IAMC 4PJFA 2HP4A 3UO1H 1K2DA 4FQHB 5FYJH 2IPKA 4XNZB 2LU4A 1MLCA 2ZWLT 1RZ8B 1VFAA 1TLKA 5IB2A 3HPLA 4ISVB 4QT5A 1UACH 4PJAB 2WIIA 2K7QA 2BNQA 4GXUN 3WN5C 1ZMYA 4PP1D 1VADA 1FFQA 2EICA 2OCFD 2VSDA 2EIBA 3CX5K 4OZ4B 3T2OA 4HUVA 4FXKA 4E41A 3AC0A 4ORZC 4P4RB 1IGML 2EO9A 5LCVH 5ADPL 4OD1L 3QSKB 3WDJA 5J6HB 3HZKB 2ICEA 5F9JB 4CAGA 5I1IH 5FF6B 2B8OT 43CAB 3RWDA 4ZPVB 3U9PH 4FP8H 5ITFA 4UTBL 3WHXA 1MELA 2Y4SA 5F3BA 2EKJA 1EJOL 1U8JB 2J5LB 3HI5H 3I6GB 3EJJX 3VRLF 1JHTB 1FCGA 3HE7B 5I1AA 3OAYK 2JCCA 2R4SL 2C9AA 1JGUH 1FJ1A 1KYOJ 5HI5C 4LPXA 5E8EB 1UB5A 3IRPX 2UY6A 4HLZG 4ERSL 3NCCB 1BX2A 4GKSB 3EOYG 3D3VD 4PJIE 1D6EB 5I9QC 1LQSR 3IFPB 3U4EB 2A2QT 5C6TH 4U0RC 3FONA 4WHCA 3GBNH 3K1KC 4YPGA 3QNZA 5F44A 1Q0YH 3BQUB 4LMQE 4U6TA 2FCBA 1CF8L 2VLMD 3GMOA 5JHDE 1OD7A 3JWOH 3MLWH 5T1LA 5IMLA 1SBSL 4NZUH 1KEGL 1KNOA 1ONQA 2D0HA 2IPUG 3P4OB 1Y6NR 4FABL 2DIJA 2XWBA 2X4UA 3FB5B 4X4XA 5JXEA 2VWEC 2GIYA 4X99A 2EDEA 4FN0A 1J8HA 1YY9C 1FORL 4YHLL 2CDGA 1NMAL 3MREA 1BJ8A 3RL2A 4AIZB 5HGGS 3HUJF 3OKMA 1B0GB 4TRPH 5GGUA 3WFHA 1S9VB 4J1UA 1JZ2A 1T2QH 1DTUA 5LXGL 5GGTH 2DQHH 4HS3A 4MGXA 3GUTB 4ZOEA 3TJEL 2ARWA 4TVSa 5C09D 3UYRL 1BFTA 5KVDH 1PJ9A 1PY4A 2VR5A 4QRPB 1RAMA 2O61A 1ZA3A 4OM0H 2XNAB 4PGDA 5M7QA 2A74A 1D5XB 3EYQD 1NGQH 2BNRB 4OFIA 4ALAH 4X8JA 3OR7A 4G6JL 4LKCB 1RUQH 1BOGA 2MJWA 4JREB 2ZG2A 3MGAA 4NKDA 2G75B 2YXMA 2QQLL 4EI5B 1J9CT 4NZTH 3VXSB 2VDRL 4NM8L 4UDUA 5F9AC 2FB4H 2NXYD 1TVHB 5I8KH 2VE6B 3WFEH 5HYSA 1YECL 1N5AA 5E7FA 4PP8C 4RGMC 3QIBB 3WIFB 2VABB 4NFCA 1OAKL 4XPTL 1ROWA 3CLEL 4AM0A 4H1LB 1T2JA 4ONFL 1MCJA 4W4OC 1IKFL 3KPTA 4NWUH 1LE9A 4OI9A 3SQBA 4PR5A 5FO8A 1ZSDA 2DLHA 2XTJB 3BP4A 4JFYB 4P4KA 2H8PA 4PJDE 2IWGA 5MEND 2L7JA 3DUUB 1AGFB 3NFSH 3L3OA 1PX4A 3ULVH 1DQLL 3T2NL 4XCNA 2JF1A 4B5EA 3U4BL 1FL5A 2I07B 2R2BA 1A6TA 2VLKD 1W72H 4K8RL 3ROLA 4IRJC 2YBRB 2OR8A 1CFTB 5TDOA 3S35H 4I77H 4XMLL 2WLZA 5D8JH 4MXVE 4I2XB 4LAQL 1EJ6A 1MCSA 1MCRA 4S11A 5F8RC 4F9PA 3GMLA 3RA7H 3MNWB 3PGDA 5ID1A 4FZ8L 2VZ3A 3QDAA 3VFNB 4LDOB 4XP1H 5I1GL 2GJ6B 3WNLA 4EZMA 3QJFB 4POZD 5FKAA 3LPGA 1JNNH 4LVNB 4ODTL 2F5BL 4OBSA 1BFOA 3P4NB 4MX7A 1G1CA 4FQXC 3WIIH 3K8MA 1P7HL 1A1MA 4C58B 3OAUH 2J88H 1U3YA 4FFEX 1HN1A 1A4KB 2R69L 5DC9B 5ILTL 1T04B 2B2XH 3QUYD 3QIUB 2P5EA 5B4MC 4L4JA 3ARVA 2XWJA 3I6LE 5DK2B 2OSLB 4WUUD 4LCUA 4MA8L 5KAQF 4FTVA 1RJCA 3OG6B 4H1LH 5FFLA 4JDTL 4PY7B 4Z9KB 5EBWB 1R0AH 5CEZH 3U7AA 5AD0A 3FQRB 3MCKB 2XYCA 3H7BA 1NAMB 2X1WL 4JFED 4WWID 4JFPA 4R4FL 4WEMB 4J8RB 3ARDC 1L8JA 2DQJH 3HUJB 4R97B 4P2RE 4YDLB 2PYEE 4RMVA 1MRDL 2ZOKB 4OSUL 2OP4H 2YD5A 4FRWA 1QA9B 4Z0BL 4ZFZB 1FHGA 2F53D 3E6HB 2DICA 3G5ZB 3CGTA 3DUHA 4P57A 2DD8L 4OF5A 1FNAA 3KPPB 3Q3GA 4M7JL 4PGJA 3C2AH 5D7LD 3TLRA 5FA3A 2E7LA 2C1PB 2J5LC 3I85A 4ODWA 5HGDB 4R2GD 4N0UB 3B5GA 4WV1A 4XBGB 3GB7B 1J11A 3BWUC 1GGBH 2BRQA 5IFHH 4X6FB 2QLVB 4PJGB 3L6FA 3O2WL 3NCJL 3HI1A 4CGTA 1D6VH 2NY5H 1X5KA 3CCHA 1PZ5B 3FTGA 4K3JH 5LGKA 5EU6D 4YIQA 3TO2B 2YHGA 3DO7A 3H42L 3H9SA 3LB6D 2AEQL 4HWEL 3BQUC 3WIHA 5EZOH 5FHAL 4P2CG 5LJYH 2EE2A 4P3CL 5I8CB 4HXAL 2ZUWA 3FO0L 3PWVB 1HHKB 1UKQA 3LAFA 1GGCH 1J87A 4P46B 4Y2DA 4R90L 4WTXA 4YDKL 5I71C 1C1EH 3RVWD 2XPGB 1D9KA 1KCUH 1RZFH 2HKFL 3CDCA 4MB3A 2FX8H 1EHXA 2VKXA 2VTFA 2X42A 4MSWB 4HK0B 3MV8D 1EAJA 5F7DB 5IIEB 3LQAL 5T1KD 4YXLL 5I15L 3K2UL 2P5WB 4WY7L 4TSCH 5C0CE 5ERWA 3NVQA 4XRCA 3SDCB 4HLJA 5EUOE 4DUWA 1JNJA 4BFIA 4OGZA 3RIFF 4GSDH 3CD4A 3JV0A 4YXKL 4OIAA 3GMMB 4NN5C 3MZGB 4ZD3L 1B4JL 3HE6D 4XI5D 2R9HC 2RFXA 3QXTA 5DJDA 4OLXH 4S0SD 1DN2A 1OF2A 2JB5L 3LV3B 3BKCL 1T0NA 1M7DA 4MJ6A 4BQ6A 1V8HA 1B3JA 4M43L 2E9WA 1EAPB 2BNQE 3QG7L 2Y06H 5DA0B 3MLXL 1CGVA 1Q1JL 1IAII 2JELH 1QRNA 1J8KA 2FATH 4G8FA 4WFGE 3WLWC 1OTUD 1TTFA 5CLWA 4NYLB 1SM3L 4F7MA 1SJHA 4YHNA 4Y16B 5KVEH 5FDWB 3X3GL 3SY0A 2QEJA 2APWA 5J13B 4KVNL 1D5MA 3RDTB 2E6PA 4LSQL 1UZ8A 4CN4A 3QIWA 3BMWA 2R2EB 4N5EC 5C2BH 1EA9C 1L9NA 5J1AB 1DSFL 3FQUA 2F58H 3TV3H 2UWEF 3PDOB 1KFAH 1TETL 5DMYA 4UT9L 4JPWH 1SMAA 5KVFL 3QIBC 4BSJA 5D1ZC 3CU7A 3NACL 4JKPH 1WBYB 2ZSWB 4NM4H 3RWHB 3GJEB 1FRGL 5IMKB 4JY5H 3GKZA 1J1OL 1KLUB 2XTJC 4TPRL 1MUJB 2ZCKH 2F5AH 4DVBA 1EV2E 1JWSA 1WVZA 5F6IC 2YSSA 4OZIF 5SWZB 4PJ9D 4QOKE 3RGVC 3TJHC 3MMEA 2NYYC 3OWEA 1XH3A 3TIEA 3CFIC 1XF5A 1QFWH 4PRPB 1BLNA 3TFKA 2R0WL 4FS0A 4OLWH 5D72L 5EH1A 1IFHH 2CH8A 3RTQD 5DJ0B 4ENED 5IFAL 4WNQB 1NEZG 3AS2A 4OZGE 1HH9B 3CLFH 4TOYH 1BHGA 4PTUA 5DUBA 4MA7H 2AP2A 1JCKA 1T7VA 5DMIL 1LEIB 3QEQD 1YN7B 4C83B 3H9HB 2XA8H 5HHQA 3E3QA 3FMGH 1IAOA 2Y5TA 4LNVA 3QQ3B 5KOMC 1E0OB 3OX8B 5L88L 1EEZB 2YK1H 4NOBA 4P9HH 4GAJL 1K85A 4LVNC 3G5YA 1KIQB 5EO0A 2ICWJ 1XMWA 1E27A 2OJEA 3QWOB 3WFZA 2RB8A 4G8GB 4RAHA 4FQ1L 3SCMD 3FRPG 4KZEL 4LU5L 3O45B 2A9NL 4TTGA 1D5ZA 3MLZH 2GSIB 4S1RL 4MJ4A 1P1ZA 1VGEL 4JKLA 4K23H 4AL8H 1JYNA 4M4RA 2K7PA 2F8OA 4P2QE 5C0FA 4JFDB 1XF3A 2CK0H 2NX5E 1LDPH 1YPZB 2ICES 3D39E 3MV7D 5F89B 2YPLA 1J86A 1R3JB 2VDOH 1QBLH 3K81A 2DTML 2NPLX 3PWUB 2IGFL 4S1QL 3LCYA 4NO0B 3SGJC 1ETZB 2VAAA 3D69B 3HMXA 5E4IA 2AK4D 1CWVA 5JW4Q 3CSYB 4Z77A 4R97C 2L0DA 4XVJH 2FX7H 2L4OA 2NR6D 4KZDL 3VRJA 1MCDA 4HF5L 2K1MA 4QGYA 2Z4QA 4Z7WB 1T6VN 5H94B 2YD3A 4NSKA 4OLZL 3RVVD 3O3BA 4LSDA 5DTFA 3SGEH 3HZYA 3BKJH 5EULV 4H25A 3UTSA 2VDQL 1BD2A 3RWJB 5CGTA 4NGHL 4OFPA 3WIHL 3VXNA 3HAEH 4KJPD 4AH2B 3Q1SH 3VD3A 5L7XH 5GISH 2P8PB 5A40E 1ZTXH 5D6CB 3O9WC 4KY1L 2D3VA 2CMRH 1UWEL 1RSFA 1QHPA 4OQ1A 2VLRB 5EUKB 1NGYB 3TZVD 5E6YA 3HZMA 5HYEA 2I9TA 1LE5B 1JV5B 3IRZA 2NY0C 5C0BE 1W2KT 2WWKT 5F7YC 1G7PA 3N50A 2AJXH 4HUKB 1OARL 2AXJA 2NLJB 4NO2A 2ZG1A 5I75C 2AS5M 2UWEB 4LQ1A 4P46C 3QCTH 1EUUA 3U0TB 3OKDB 2EDNA 1WZ1H 1AY1H 2FGWL 2FJGA 4HPOH 1L7TH 2HVJA 3RNKA 1Q94B 1G7JB 3O6MH 3QWQB 4X98B 3L3HA 4U3CA 3V8OA 3T0EA 3MRIA 3V52L 4X0KB 4LSTL 4FFVD 4OZIB 3UEZA 4H8WH 3D0VB 1ZS8B 5I2IA 3HRZA 4MNGA 5FYLD 1X5FA 5KW9L 1RUKH 2GTZA 1WWCA 3DYOA 5FUCE 4ODVL 4XWOC 5FHBL 3UJTL 5MP6H 3CVHA 4UUJA 5CAYB 3JV5A 3WJLA 5HHOB 4ZAKC 4XC3H 1G6RH 5HI3D 2HT3D 1KJ2A 2FECI 3L9RA 2V7NB 4R7NA 4RFEB 1XF4A 4AK1A 3AY4A 4OLVH 4NQDA 3RDTC 4FQJH 3BEWB 3REVB 1CR9L 1FVCA 4S1DD 5I1CH 5C86A 5IMMA 2ZPKL 5TQ0L 1H3XA 4E0RB 1S9YA 2H2SD 1HZHH 5JIKA 1CVRA 1UVQB 2E7LE 2GJZB 4XXDA 1E6OH 4YHKL 3S97C 1GCFA 3BSZH 4XPAL 4U49A 4YXHH 3MODL 4ETQB 3OGOE 4C56D 3RUGF 1EDQA 4ONGH 3IAPA 4XBEL 4ZUUA 1KSRA 3GK8L 4KK8D 1CXEA 1MVUA 4KGJA 1WC7B 2OM5A 1KTDB 1WEJL 1IMHC 3VFSA 2CD0A 5KANG 2BSTB 4IDLA 1CBVH 1HI6A 3DXAB 4OCSH 3EJZC 4HIIB 3KLHD 1R5IA 3UMTA 1BF8A 2A77L 3H9SE 4HZLA 1FDLH 4ZMAT 4QHUB 1FL6B 1KPVA 5DF0A 5BRZA 2FBOJ 1WAAE 4QWWD 25C8H 4ZG1A 4MA3B 2A6JB 4KXZH 5EOCJ 1JHKL 2EDKA 1IKNC 1I8KB 2LVCA 3NA9L 3W39A 4G5ZH 5FM5O 1OY3B 3ARFA 4JFFA 1OCWH 2EE9A 2CXKA 2Y5EA 2MFNA 4IIQA 4WWKB 5D7IF 2VLJE 3MLUH 4HKZB 2H3NB 1AO7D 4NKMA 1PG7W 4C54A 2DQDL 3MJ7A 4RMWA 1I7ZB 4Y5VB 5TPWL 4ONHA 1BFVL 3PWPD 3EO0B 2XXMB 3O8XB 3Q6GL 4Z7QF 2Q76A 32C2A 2BVYA 4RQQB 5IBTL 1IEAA 1EFXB 3D2UA 1E28B 4PRAB 5E9DB 5FGBC 4DGYL 1CQYA 4F7PA 1LO5A 4JN2B 4NOFA 1N4XH 4U1GB 3RRQA 1RJYB 3R1GH 3C9NB 4Z7NF 2IPUK 4KJWD 4Q0XH 3SE9L 3LQZA 4U1JA 2A38A 4ZYKB 2Q8AL 4QHLA 1G9ML 2IANA 4MCZB 1FNGB 4LEOA 5GRJL 4DUVA 1ZT1A 2XY1A 3CMOH 3BISA 4HT1L 4M6NH 4OCXH 3JV4B 3MRRA 4L9LC 2NY1C 4JM2F 3LS5L 5ALCL 1IM9D 3MBEA 4WEBH 2PO6D 3QPXL 4RBPK 3HMXL 5E95B 5LQBH 2Q7YB 4X7TB 2KZ1B 3O3EA 2XKSA 2BMKA 5ALBL 1G9NC 1MI5A 5KS9A 1NFIB 3GIVA 3BZFB 4LHUA 5GS0L 5FUOL 5D1XD 2YD7A 5CP3A 4PRIB 5T3XH 5D7SL 1EEQA 2GT9B 1QKZH 4HHAB 4DEPC 1NDGB 1JN6B 4Z95L 2O5ZH 4EN3B 5DJAA 4DGVL 1NCWH 1U6AH 4F37K 5ANMA 4L8CA 2R2CA 2JKXA 4HUMB 1MFAH 2QKIB 4X7SL 5FO9B 2IAMA 1JIBA 1ZVSB 1AQDB 1KBGL 3PABA 4GT7A 4UQ3B 3OZ9L 4KRNA 4IM8A 1A9BA 4MD4B 4XCEA 4GLRH 4U6HA 5J89A 3KJ4C 5JW3H 3FQXA 1QQDB 3WN5A 2VJXA 3AU1B 5I6XB 5L2JA 1TNMA 3VFGH 3FB8A 4NQCE 3VXMB 1Q9LB 3L5XH 5EC1A 4FQQA 3UJJL 4XPGH 5F71A 3RWEA 4RAUB 1N0XL 3EOBA 1TITA 1WCQA 3WNKA 4XCFL 1Z3GL 2W0KA 3VRIB 4IMLB 4LNRB 4PRHE 4RZCB 1P4IL 2V2TB 4KPHL 2NNAA 4P59H 1RU9H 4GG6F 1V3KA 4IEFB 5CBEA 1KIPA 4U0QB 4YGVA 1PKQB 3VFMB 4JAMA 5J1TC 3DX9B 3E3QE 4U1SA 4CW1B 2HWZH 5JHDD 1S7VB 3S3JA 2NY3D 3THMH 4Z78B 4MQ7B 1FIEA 3U7WH 5EBMB 4L8BA 1XCTA 3QP3A 1S7QA 3MR9A 3FAWA 1YYML 2X4OA 4YUEL 5L9DH 4C59B 1KTLA 3CVHL 2DYPB 4R4BA 4LSUL 2FHFA 4JRYE 4LLQA 4K94L 1G7QA 4NQVA 3OPZH 1IGFL 2F54A 3SKNA 1U8LB 4KHTH 4NQXB 4ZS6C 3A67H 5HYSG 1RZGA 1ZLUK 4PGEA 4PGBB 5DJYB 3SJVE 3QDMD 4X4ME 3GNMH 3DVNB 4O51A 3QI9C 1C5BL 4NO3A 1XGQA 5DMGC 1MNUH 3DETD 4QNPF 3BW9B 3T3MF 5IGXL 5C0AB 3VI4F 2FIKA 3GBMH 3QXAB 4YLQT 4GRLB 4MJIE 2R39A 4MQTB 5E8NB 1BWMA 3HMWH 3QDGE 1ZLWK 2YKLL 2GK0B 1RZJC 4X6DE 3KPOA 2JJUA 3GSWA 3SDXA 4FZEL 1K6QH 5E2VH 5E7BA 3PP4H 1NGPH 3FFCE 3UTSE 3QUKB 5DDHA 2IJ0C 4ODSH 1ZHBA 1MLBA 3I50H 4JZOA 1SMOA 5JR1H 1D5BA 3IDIB 1DL7L 3LD8B 15C8L 2XA3A 2YEZA 5H35A 4JM2B 4KJQD 4NHCH 3OJVC 2Z91A 1TCMA 4TSAH 5MEOA 1UWGH 2CLRA 1EEYA 2UZIH 5HXMA 5D5MF 5FK9B 1T5WA 4PD4K 5T3ZE 4K55A 1YEGH 4X5XA 4ZQKB 2C1OB 4EUPB 4XP6H 1WIPA 3BIAX 1C5CH 2GK2A 5CSZB 1WBXB 2DWDA 3RWIA 3STZA 5DVOA 2BC4A 3NFPA 2P8MA 3WFCH 2AV7A 1NJ9A 4C4KO 1T6WA 3CUPB 1HYSC 2KKQA 1KC5H 3X12A 4Q9CA 3MBXL 3SGKC 3U36B 2EDRA 4APQC 3IFOB 4I1NB 3E8UL 1A6WH 1KXQE 2M26A 2HVKB 4JGUA 1A6PA 4RDQG 2DQIL 2FD6H 1DUZB 1BQHB 1YJDL 4Y5VC 4JO1H 3DGCR 2MNUA 1W0WB 5ID0B 1TPXB 3BO8B 5I16A 4MNQA 3RL1A 4IOIB 1TQBC 4W4OA 1IAIL 1BP3B 1MRCL 3CFEA 4XNYL 2VL4A 3LRGA 4OZFA 2ESVE 3BPOC 3MXWL 4U1GC 4GG8B 4PJCE 1CIUA 3BAEL 1UT9A 5EO9B 2A9MH 4Z7VB 3TM6A 1HE7A 3SOBH 3D9AH 1J0YA 2A0LD 1C16A 1NMBH 4IRJA 5E6ID 1FFNB 1HQ4A 3ARGC 3DOSA 1T7WA 2AGJH 3QEGL 4GG6B 2DLTA 4ELKA 5BCAA 1U42A 3I6LD 1F13A 3G5VA 3QQ4B 3MRLA 1S5IL 5J06A 2H26A 4BZ1H 3W81A 4PJEF 2VITA 1P4BH 3FQWA 4XNXL 5DUPH 4FQPA 2PTUA 1MIEL 4JQVC 4EUPH 1G7MA 5KZCD 3B9KD 1TJIL 4JGJA 1MHHB 1QPXA 4YEFA 2WY3A 5EZJB 5TE7L 1GC1C 4FQXA 1ZLVK 4N1HB 4UIKL 4OB5H 4WCYL 2VYRE 1QFUH 4P2RD 2PYED 2DQGH 1CFVL 2V5TA 3CH8A 2R56L 4GKNB 3EDEA 1T7ZA 3C8KB 2FR4A 2Z8SA 1RZ8A 3SE8L 2HLAA 1OTTD 3VFTB 2YD8A 3RPKA 4QXGH 4ISVA 1BAFH 5INCB 4PJAA 4WDIB 4WFEE 4U3HA 5IEKB 1WWWX 4YBLB 5I6XC 2Q3AA 4DQOL 1BM3L 4EVNB 4OZ4A 4QXUH 3DYMA 3N85L 4P4RA 3KYNB 5ACZA 3VE0B 1YZZA 3BP5B 4L4VB 1MRFL 1S9XA 5C0JB 1B6DA 4G7YL 3FN9A 2YZ1A 3HZKA 5F9JA 3VXRB 3ZSSA 3ARDA 2A73B 2Z31B 4LSPL 5FF6A 1OW0C 2MPAL 1G0DA 1NL0L 3LEYH 5A3ID 2NTFB 3ARPA 43CAA 4ZPVA 5JIPA 3WBDA 1EBAA 1M6OB 3QWRD 4DKEL 4R96B 1CICC 4MXWL 5CEXA 2CLZB 4K8RD 4X8XA 3V6FA 1U8JA 2P43B 3OXSA 5FCSH 1VERA 3C08L 4ZSOE 5D5MB 1JHTA 4HFUL 1PLGH 1ZT7A 3VWKD 4KFZC 4D94A 2H32A 2IANE 3OL2A 3QJHB 4M48L 4P9MH 4BH7A 1TMCB 4UILL 5J6GA 1Q72H 4PJXE 4R9HA 4ZUSB 4GKSA 4WW2F 1I9EA 5C0CD 1DEEA 3WS3B 1Z0NA 1AJ7L 4HIXH 4W6XB 4HUXB 4JJ5A 3U4EA 3L5HA 1IGTB 3EOAB 4Y4HB 4OFKA 3BQUA 4WGVB 1BIHA 4M1GL 3S36L 2R0KH 5KS9E 2BNQD 3IDMA 3GHEH 2NMSA 4O2EA 5K59F 1VFUA 5IROA 1DVFB 1LWRA 3FB5A 3PQYE 1QLFB 1LQVA 4GRLC 5CD3A 1TDQA 4WFGD 4PG2C 1MJUH 1Q0XH 3GSXA 3P4MB 1FLRH 5D6DC 1ES0B 3U48A 2ADIB 3X13B 4Y19E 1UJTA 1B0GA 2G5BB 3VWJB 1S9VA 3V2AR 4GMTH 3MA9H 4XH2B 3GUTA 1CLOH 4OTXL 1T03H 5E99L 4HLZH 2C3XA 3NFNA 4O9HL 4GQPH 1CL7I 1OB1B 2VISA 5KSVB 4JM2C 2VR9A 3WFBH 5B3JE 4QRPA 4DVRH 5E6ZA 5EU3B 3KHQA 1HHHA 2JJWA 3NCBB 5K9OB 4OCYL 1D5XA 2AI0H 4PJEB 4OT1L 2Y07H 1VA9A 2OI9B 4ZNEA 4G9FE 5ETUB 1EVUA 1REIA 3LN5B 2QSQA 4HKJA 4L9DA 1RUAL 2RIKA 4KQ3L 4ZUWB 2G75A 2WQ8A 2V5MA 4OQTA 3CSBA 2VDKH 4QOKD 2AVGA 5GGSB 4N5EA 1IC4H 4PJHA 5T1LD 1VGKB 1MF2H 2Y72A 3VFUB 5HYJB 5CINL 1FGVL 2CK2A 5D4QA 3UZVB 3QISA 2UZYB 4M6MH 4MCYB 2VE6A 3W11C 2F8VA 4YJZL 2ICWB 5JLZB 1FSKC 1I9JH 3QIBA 3NN8B 3WIFA 3NABH 1TPXC 2B5IB 2HAZA 3PV7A 4RBPH 1F6AB 5D1ZA 4K9EC 1DQJB 4AIOA 2GKIA 3RGHA 3AMKA 1T1WB 4M7KL 3K1DA 2D0FA 2FZ3A 2F54E 3N1QC 1NAKL 3PE9A 5LVEA 4JFYA 4M1CD 5AUMB 3RZCB 2DJUA 3DUUA 2FECL 2OL3H 1AGFA 4HX1A 4LCIL 2CXGA 3W0WA 3NTCH 5CZXD 2HJLB 1AFVL 3LY6A 3KYOB 3L7FB 1U3ZA 4G6FD 3CDGA 3OR6B 2I07A 3RGVA 3TJHA 4HIEB 4O2CB 2QSTA 1XGRB 2YBRA 4GBXC 1CFTA 1AKJB 5D7KE 1QYGH 3RX5A 1NLDH 2DKUA 4P23D 5TF1L 4I2XA 1Y18A 1ADQH 2VWEE 4HCRA 5HGBA 2DN7A 2NW3B 4P2QD 2FIRT 3MNWA 3P0YH 4P99A 1P7KA 3QDJE 3SDXE 3RY6C 1I3GH 2NY4D 2NX5D 1CFQA 2GJ6A 1BBJB 3D39D 3MLWL 2H1PL 2DLFH 5KSBF 3MRMA 3OKOA 4WW2B 1QTYT 2F74A 3CK0H 1V7ML 5IHLB 4NP4L 3DBXB 3IFLH 1RIVH 4XHQA 5TJWK 2D7NA 3ZT5A 4P5MB 4S1SL 1RJLB 2DKMA 1WTGT 5BJTB 1A0QH 4YHPB 4RMSA 2IQ9H 1U58A 1N26A 3B2UC 3DX7B 4P3WA 2VKWA 2WSKA 1I1FB 3UTTE 2XRAL 4XAWH 3V9FA 3JTSB 4A6YA 3PUCA 4IBLT 3MRDB 2XT1B 4JKWA 4PY7A 4RGNE 4IMKC 5EBWA 5C0RL 3ARBB 5HHPA 3QH3A 4YWGL 1XGUB 3O4LE 1L9MA 1S3KL 3MRCA 5F6HJ 4NC1C 3SGJA 1NAMA 1UADC 3JVGC 5LGHH 1ZEAH 2Z31C 3G6JF 3MYZA 4Y4FC 2KH2B 2ZOKA 5C0BD 3T4AB 1A3RH 5I1JL 4DN3H 4BM7A 1QA9A 4ZFZA 1ZLUH 4K2UH 4MNQE 3E6HA 5MEQB 4LCWE 1YC7A 3OG4B 3G5ZA 4F7CB 4OV6F 4AG4H 2J8UF 1S9KC 4N90D 4XGZA 4NN6C 2C1PA 2LTQC 4N0YH 5HGDA 1RZKH 4I3GA 4N0UA 4DCQA 3DX6A 3ZTNL 4HS8L 3LIZL 4YAQA 3GB7A 1S7XB 3O41B 4NRXB 3O9WA 3BJ91 2IFFL 4PJGA 2QL1A 1UFUA 1J0KA 1AD0B 3EO1B 4EEEA 3MA7B 5HYFA 4ZOBA 3OGCB 4HGKC 1PZ5A 3RPIA 4H88L 5CFHA 5DJ2B 1CLZH 4Y4HC 4WI9A 5BW7C 1KB5A 3K7UA 5F1IA 4IDJH 4RNRA 2X9WA 1FH5H 4RAVA 5I8CA 3L3JB 4UT7L 2DWEB 4OZHB 1SVCP 3W2DL 3QCUL 5GZND 5CZVL 3T8XB 1U8KA 3BX7C 3D25B 4QHKJ 3WKMH 4P46A 5ACLA 2XPGA 4P2OB 4MDIB 1YC8A 4PJ5E 4JG0L 3TP4A 1KCSL 2BCKA 4OV5A 4HK0A 5F7DA 4HAFA 2P5WA 4L3EB 4PJ8D 1JTOA 1HNFA 3A6BL 4PRNA 3TVMD 5SV3A 1UXSA 3MRBB 5E5MB 3CC5B 4C55A 1NDMB 4MNHB 4JFQA 1JUFA