5IB5A

Crystal structure of hla-b*27:09 complexed with the self-peptide pvipr and copper
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
276
structure length
276
Chain Sequence
GSHSMRYFHTSVSRPGRGEPRFITVGYVDDTLFVRFDSDAASPREEPRAPWIEQEGPEYWDRETQICKAKAQTDREDLRTLLRYYNQSEAGSHTLQNMYGCDVGPDGRLLRGYHQHAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGECVEWLRRYLENGKETLQRADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, B-27 alpha chain
publication title Metal-triggered conformational reorientation of an HLA-B*27-bound self-peptide
rcsb
source organism Homo sapiens
total genus 73
structure length 276
sequence length 276
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ib5A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 5ib5A01
2W0FA 5E4IA 2O5YH 1BAFL 3S36X 2VR9A 3T08A 5JHDB 2VLRD 2DQJL 1XR9B 2YUXA 3BEVA 4G59A 5CJOH 3CSYB 1KJVB 4MAYB 5EO9B 1NDMA 2YZ8A 1MWAB 1OW0A 3PHOB 5JNYA 1LE5A 2H26A 5FECA 1DQDL 2H2SD 3IS0X 1PW3A 2EE9A 4E5XB 3EBAA 3M17B 2I60H 4M48H 2HN7A 4WCYH 4Y2DB 1V05A 4WO4A 2X2YA 4UBDC 2F8OA 1LO4H 5FB8A 5JPMA 4HF5L 1JF1B 5D6DC 4DVRH 1ZT4A 3B3IB 2DQHL 4JFQB 3MBXH 3JWDC 3MJGX 4IOFD 4EUPB 4ZOBA 2IANB 3S7GA 3U30B 3QI9D 2PKDA 4F80A 5E8NB 1PG7X 3V0WL 1AGEA 1BFOB 5KVDL 3GUTB 2H41A 5FYKL 2EE3A 1EEZB 3QAZC 3L95B 1PJ9A 2OTPA 3BAEL 1WZ1H 1NBZA 3Q6GH 3U0TB 2AV7B 2EH8H 5T1KB 1B3JA 1DN2A 5F72S 5L88H 1ZA3B 4Z9KB 1LHZA 3MLSL 4NC2B 4E41D 4MA3B 4LLDA 1CD1A 3GMQA 5E2JA 4KRLB 4OKVA 4AL8L 4C83A 1F42A 2UUDH 2E7HA 3RP1A 1A7QH 2EDDA 5GJTH 4JKLA 2B4CL 3HZYB 2MWCA 5IB3B 3FFCA 1I9RL 1FFOB 5E99H 1BLNA 2EEDA 5EA0H 1RUPH 2V17H 3UYOD 3RDTB 4S1QH 3KPPA 1UH2A 5IB4A 3BP4A 3S4SA 4FZEH 2LABA 1ZVYA 1GRWA 3BXNB 1FC2D 1H3XA 5SX4H 5KTEH 5CUSH 1K5NA 4GBXB 1V7MH 3NFPA 1XGRB 4F8TA 3VGEA 3AY4A 1U6AH 2QTEA 4JO2L 3QDMA 3GJEB 1SBSH 3MV7D 4H0GA 5HI4C 4PJXE 3ZTJH 3BRFA 3ISWA 2C3VB 4NBZB 4TVPE 4EQ2A 3UPAA 3V52L 1S9WB 2Q6WB 2CDFA 3G5XB 1T21B 2A74B 2AJZA 2JCCA 4MNGA 3SE4C 2DWDB 3RUGE 1ERNA 4L3EA 3EYVA 2QLVB 2UWEB 1BBJA 4GRLA 4JN2B 5TH2B 3D25B 4X4XB 3O4LE 1UKSA 4ZPTA 3IFNL 3QUZD 5E2TH 4PGCA 1BEYH 3JVGC 4WNQB 3GSRA 1ZANH 5DJZA 1HYSC 2CRIA 4JQIL 5FA4A 5LCVL 1KCGC 1HZHH 4ZXBD 4LCUA 1N5AA 3ARGA 1JGVL 4LU5L 4FRWA 5FKPB 5EORL 4LIQE 3OKKA 3TNNB 3H9SD 4KZDH 1RZ7L 5J12C 2NXZD 3PL6A 4LHQB 5JLZB 4LARL 1XIWA 2ARJA 4G8GE 5CKGA 3MRLA 4G6JL 4PJXF 4H88L 5DJXA 3MRHA 4QTIL 1DANU 1WBYB 4FZ8L 3LZFL 5JDSB 4AEFA 4JHWH 3BPLC 4MZ3A 3WN5C 3TBYB 1X5GA 3WFDH 3HPJB 1FZKB 1KB9K 2XN9E 5D7SH 3FTGB 3FQRB 4EVNB 4W4NA 1W0VB 2MJWA 2AV1B 1J5OL 2UY6A 3G5YB 5HYFA 5ALCH 1YECL 5FYKU 5LXGH 1DP0A 1HHJA 1H5BC 4LCCB 2XKNA 4R7NB 5F9WB 5K9JL 4Q97A 4PRHE 4WRLA 2NYYC 3UO1L 1K8DA 2ADJB 1IM9A 4X7CC 1PLGH 3VG0H 4XWGL 2HT4D 3JBG7 1UM6L 4XMLH 4OGYH 4X6CE 2EIDA 5J6HB 3QCVL 5JPNB 4OD3H 4KUCD 3I6LE 3E2HB 3B8SA 4LQ1A 4P5KB 2A6KA 2MHAB 3S37X 2CK2A 5C07E 3O9WA 3LS4L 2VWEE 1ZSDA 3BH8B 5TDPB 1EFXD 1F4AA 3U0WH 3HAEB 4JRYA 5L2KE 4TVPH 3U0PA 4D9LL 1A9EA 4MSWB 3MNZA 2R1WA 3CDGB 4WW1A 5AUMA 2YD3A 1X5HA 1T83C 3SKNB 2XV6B 2MMXA 3D69A 4HD9A 3W9DA 2KZWA 3H0TA 1E6JH 1RU9L 1MOEA 3DROB 4PS4L 1JNHA 2B0SL 1HXMA 1EUTA 1ZLVK 5DQDH 1FORH 4FNLL 4X6CF 1JPST 1M7DB 1T7WA 4AJ0A 3MOAH 2D0GA 3EOTH 4OCRL 4Y5XA 4LAQH 3MX0A 2BNUB 2A77H 4RZCA 4YBQC 4LIQH 1R6VA 4NJ9L 2EKSB 1S9XA 2DMCA 4WEBL 5GSVB 3CLEL 4Y1AD 2V5TA 1S7TA 4HH8A 1MPAH 2BOBB 4BZYA 3CFEA 3OJMB 1SBBA 3K81A 5EC2A 1JZ5A 4G42B 1OGAB 3TJHD 3G6JA 4MA8L 4F2MB 5B8CC 3KYKL 4RBPH 4QHNB 1J0ZA 1GGIL 1KEML 3HN3A 4KWUA 4HIHA 4ZS6C 1VACA 4I0PC 1DVFD 5DD3L 1UWXH 3C09C 5I75B 5JW4M 1AO7E 1G9EA 3OPZL 2AABL 4ISVB 1AD0A 3HFML 1VPOH 1BZ9A 4I2XA 5AD0B 5TDNB 4M8VA 1A6TA 3FB7B 4F33A 5HBBA 4OLUL 4IDJL 3UJTL 1IRAY 4YQXH 5C3TA 2VDLH 1YEFL 4ZPVA 4B7LA 2EYRA 4IIQB 4QHLA 5FYJD 2J3SA 4D8PA 2PYEB 1OF2A 1BOGB 3L6FB 1S7UB 2A0LD 3T0AA 3VXSA 4KV5E 4LLUA 3I85A 2BMKA 5EPMB 4P2QB 3E8UH 1IKFL 1XGUB 2WAHA 4XVJL 4JFYA 1KV3A 5GGRB 3OGCB 1OCWH 3TCXA 5SWQB 2FSEA 4X5LA 1XF2A 1J8HA 2YPKA 3FZUC 1LD9A 1X5JA 3MUGA 5DUPL 4I77L 3LOWA 3UJJH 3KS0J 3VH8A 1P2CB 4PJIB 3B2VH 4O58L 1HHKB 3VI3E 1HCVA 2XTJB 5IVXE 4DAGL 4NKQB 5IFJA 1Q0YH 25C8H 2ZCHL 3W0WD 2PCPA 4WGWB 2R29L 3HC3L 4OCXH 4A2MA 3KPNB 1KTDA 1CGSL 2ZUXA 4JEGB 4KTDL 3VGAB 4NQEE 1Q72H 4C4KO 4X9GA 4KQ3H 5DFTA 3KNBB 2VH5L 2H2SC 3ZTNH 1A7RL 5GZND 4NM8L 3UYPA 2UYLB 5FCUH 2XICA 3D39B 3DI3B 3MUY1 2OXHA 4OT1H 1OM3L 4JY4A 3U2SA 4FQJL 4FQ2L 3P9MB 1JPSH 2NY0B 5DHXB 2VLKE 2BC4A 3JUZA 3NCJL 5GRJL 4Y8DC 2Z92A 2VAJA 3C08L 1CDBA 1MJJA 3P4OB 1Z0MA 3G5VB 4IOFC 3SDDB 3WXVH 1MCLA 3QI9C 1G7IB 3K2MC 2XWJB 3B5HA 5B39B 4JFED 2C9AA 4NN5B 1KGCE 5CZKA 1VGKB 5DJ6A 3SDCB 5EUOE 2GK0B 2OYPA 5C0IB 5GGQH 3BD5A 1IL1A 3IJHB 4Y4HD 3F5WB 3OV6A 3CU1A 1BECA 3VI3F 5IVXF 5I15H 4X7TA 4MQ7A 1M71A 5DJ0B 1R3JB 3H3PL 5C6PB 3OBAA 1NGYA 4Z7WA 4LCIL 1ZT1B 4RWHA 1NPUA 1DBJH 1CDJA 4Q0XH 3QHFH 4YBLC 4AY0A 4PBWD 1XCTB 3E6FA 4U6YA 1QQDB 3WLBA 3CUPA 2RFXA 4QCIA 5EU5A 1LK3H 4P9HH 3ZL4H 1KC5H 1NAMH 2ZOKA 3O3EB 4CAGA 4HCRH 1VENA 2P47B 1OB1A 2V2TA 2G5RA 3QDGE 5KW9L 4HHAB 1KTLA 4TYUA 5TQ2L 1BBDH 3VXUD 3JWOL 2R2BA 5EUOF 4KKCD 5I1HH 1NDGB 3WUWA 1CDCA 5C0AA 2MCG1 1CFVH 1XH3A 2ADFL 3QAZB 4Q6YA 2QSVA 3ZDZE 4Z7NE 3P40A 4LKXA 1MJUL 1HXYA 3C2AL 3ZDYE 4K71C 4P4RB 1ZGLB 4W4OC 5C92A 4RAVB 1XF1A 3GSUA 5KG9B 1U58A 3NPSC 2ZCLL 3C60C 5GRWA 1DQTA 1T1YA 3D6GA 3TCLA 4EIZC 1J1XL 1CXEA 4PY7B 3CD4A 5F7EL 3C5ZA 4YFEA 4TPRH 5ID1A 4PGEB 2R8SH 1HCFX 4MNHB 4L1HA 5INDA 5CBEB 4OLWL 1T20B 3IDMA 5TQ0L 3VXTB 4HKJA 4WEUD 4KHTL 5C0FA 4WIQA 4BZ2H 2CDEB 4GFTB 3G5ZA 4R4FL 3MROB 5D5ME 1JZ7A 4LHUA 4MA7H 2P24A 3CNKA 3QUZC 1NBQA 1AY1L 1FAKT 1JI2A 2G2RB 5LGKA 3R0MA 4OQTA 4KKNA 4Z7NF 3QIUC 1I1CA 5IG7B 3SJVD 3QIWC 3CXHJ 1RMFH 2L4OA 4PJEE 4ZO8A 4A6YB 1WK0A 4PJBE 2W9EH 2KKQA 1PYWA 3WKMH 3QYCA 2R0WL 3TVMB 3Q5OA 2EE6A 1AGDA 5HDLA 2EC9U 2IH1B 5T5FH 2WP3T 4O5LL 4YC2C 2ZPKH 3S96B 3P0VL 4S1SL 1QKZL 3TJEL 2NW3A 1PEWA 2VABB 3MRPB 4WUUD 1FFRA 3WHE0 1GGBL 4OAWB 4XNQB 3ULVD 3CFKA 5D5MF 2ICWJ 3FRPG 4MJ2A 2WSKA 5GJSH 3CU7A 2F8VA 5IQ9A 1HHHB 4NDMB 4P3DA 1VFAA 4JFDE 5HYJB 2MSPA 3REVA 1YMMA 5DDHB 5DEGA 4ZFGL 43CAB 1JGLL 4P0DA 3JV0A 2VAAA 1K4DB 5GIRA 2RCSH 1RULH 1HH6A 5ESAA 3VFNA 3BP5B 3MLUH 4PJEF 2ZUQB 2HT4C 4PJBF 5HJ3A 3Q3GB 4BH8A 2LVEA 1OAZL 1X6LA 3V4PH 2R9HD 2NY3D 5GS2H 1IGFH 5KS9B 4X4YA 5J12B 3U82B 3CPLA 3IF1A 5D2NC 3UP1A 2K9UA 2X4UA 2B1AL 4QO1A 3LKPB 2YUVA 4GUPA 5I0DA 4OUUA 5I71C 4PJXA 3NA9L 1TIUA 3EDJA 1G9NH 1OHQA 5EU6B 3R8QA 2ITDA 5I8OL 3FB6B 4LL9A 1DBAL 4HS8L 3L5WA 1U41A 1FBIL 4NNPH 5HGAA 3T3ME 4HS6B 1GHFL 3MFGB 3TBVA 1WISA 1ZK9A 4TULH 3VXOB 2VRAA 1RZIB 1HK6A 3QUYA 3HI5L 2R0KL 5DRNA 1BQLL 4X80L 3O4LA 3W5NA 2XFXB 5ICZA 2C4FU 1CIDA 2QEJA 5DVMA 4KC3B 3O41B 3VGDA 3AS0A 2GSGA 1JNNH 3LEYL 1J05B 1YUHB 4EOWL 2VQ1A 4ONHA 4NO0A 3DURA 1C5CL 4WI9A 2F5AL 4M8QA 4MXQA 2UZIH 2YC1A 4UT6L 1PSKL 4PYGA 2YD2A 3GJFK 4GSDL 1PQZB 3REWB 3SO5A 3OKNA 2OBGA 3QEUA 2DQDH 4G8GA 3S35H 2G5BA 3ZHKA 3PHQB 2HVKB 3VFWA 1XGQB 3QBTB 3TJHC 5T3ZL 4JZJC 4W6XB 3T3MF 1DUYB 2X4TA 4M7ZC 5FUCE 2OQJB 1XAUA 2Q86B 1OGTB 4ODHH 3P4NA 4F8QA 1E4WH 2IAMD 1QRND 2EXYC 2WUBH 1VEOA 3CMGA 1GXEA 5I1KL 1KLGA 4DW2H 3T1FB 4RFEA 5IBUG 4PRHA 3TYFA 2QQLL 5DURD 5IHZA 1OT2A 2A0LC 1RUML 1U6AL 4KJWD 3VD7A 3IVKB 1IM3A 3QQ9D 5EFIA 4LBEB 4X6CA 3WJLA 4ZYKA 3AROA 3SBWA 3C2SA 5E9DD 2X4RA 2QV2A 2AK4E 3GNML 5IJVA 1KLUA 1NCWH 3RWIA 1NCUA 5C07A 1CQYA 3K8KA 3FRUB 5B8CB 1FH5L 3BH9A 3D2UA 4XI5D 3LN5B 4IOIB 2BHYA 4G3YL 4PP2A 1P4LA 4XVTL 4G8FA 4I0PB 1MVUB 1ZGLP 3P30H 1H9VA 3C09B 3VFGH 4CJ1A 1MLBA 3JTSA 4APQC 4HPOH 4BH7B 1II4E 4RX4D 4YGAB 4OQTL 5HHNA 4D0BB 4WW2C 3H2WA 3DGCR 1UKQA 4IHOA 3S97C 1CGTA 4LLVA 1BQUA 1CDGA 2XZAH 1MIMH 1UB6A 5GZNC 3THML 2N7AA 3OAZH 4U6XA 2R4RH 2V7NA 4R0LA 3VWKA 3VI4E 5IESH 4RWYH 2WUCH 3QUML 5L0QC 5KVGL 3BWUC 4ZDHB 4NO3A 4NO2B 4Z7UB 4EKXA 1QSZA 3L3GA 3LEVH 1YNLH 5IQ7H 1YEKL 5E5RB 4PJFE 3SPVA 2QKIA 4MD5B 3DGGB 1JHLH 5D96C 3MRKB 4PTUB 2P4AB 5HY9B 5L7XL 2OR8A 1BD2E 4GXVH 5E00A 2PO6C 4TVSa 5HGBA 1NCNA 5FYLD 2LU4A 4XPGH 3OZ9H 2YHGA 4BFIB 3MUJA 2HFEA 3V5DA 4WFEE 1AXSA 1AJ7H 1FVEB 4OIIL 3WHXB 4J3XA 4L8BB 3JV6B 4UNVA 5CEXB 3RGVB 4YUEH 1AE6L 1AO7A 3RVUD 1NCCH 2IPKA 5DRWA 3BKCH 3IXTA 1A6UL 1YYLL 3T4YA 4MD4B 3VI4F 4GW4B 5MEOA 2DTSA 2HJLB 1OSPL 5EO0A 3HI6H 4TOYL 4UOJA 1NAMA 3GFUA 1CFNA 4LVOC 1D5XA 4PJ7A 4EI5A 4HCRA 3MTRA 4ORGA 5JW5A 2EIZB 4MCYB 3BW9A 1K4CB 6FABL 4ONFL 4X7SH 5I16B 5D7LB 1QSEA 4MDIB 2QQNL 1WQVT 4KKCC 3T77A 2BNRB 4TNWF 3N85H 2BVPA 3FL7A 1RUQH 1D5MA 3CFCL 3K4DA 5IMKA 1CFSB 1FNSH 2A6JB 4E41B 4XTRC 2EDJA 3LRSA 1U8KB 4RFNC 3BGFC 4RNRB 2FYYB 5CEZD 4TUOA 2DL2A 2Y36H 1NKRA 4DGYL 5IVXA 5GS1C 5J56B 4YFLI 4UB0L 4YBLB 2C3WA 1LP9B 2H9GA 3F58H 15C8H 2I9LB 2VIRA 2EYTB 1WT5C 3O3DA 4UTAL 4OFYD 4NQEA 3UROR 1I3RA 2LFGA 5DK2B 2DLFH 4GKNA 5BMFL 4KUZL 3RU8L 1BF8A 2LU7A 4NKIL 1JNJA 5BRZD 2MCPH 2J2ZA 3RBSA 3V6OC 3HNTH 5F7DB 3RWDA 4N9GA 4P4KA 1YEHH 5CSZB 4KI5D 3SGKC 1MFBH 4K2UL 1Q94B 2IG2H 4FQIH 1PKQA 2W0FB 3N06B 3A6CL 1FVDA 3IJSB 1RZ8A 3L3JB 3QHTC 4IS6B 5MEPB 5ALBH 4KDVA 2M2DA 5F6HI 5EUOA 1OAXH 4G6AD 4JM2D 4B5EA 4PJ8A 4PPTA 3DX9A 4K71B 1I9JL 1K2DB 1WIOA 1EV2E 1U8OA 4WY7L 2HJKB 3NPSB 4LLWA 3C60B 3MXVL 5IVZA 4HWZB 1CI5A 1XZ0B 4OLVH 3QXUA 1X6NA 4OLEA 1WTGT 3KJ6H 3OSKA 1ND0A 5T1DL 1MCHA 1R24A 2FATL 2FEDD 3D3VB 3W39B 2FR4A 1AQDB 5DVNA 5E4EC 1CGWA 2ZWLT 3G9AB 2RR3A 4BQ8A 4NKMA 5BZWA 3LSOB 1UWEL 5HPMA 2UVEA 2HN7B 2PXYD 3CJJA 4NKOA 4BQ9A 3OQ3B 4QXTA 4ELME 4Z0BH 4ALAH 1QBML 3RAJL 4CMMB 2IPTH 2ARWA 4ODUA 2WIIB 2ZSWA 43C9B 1AGBB 1FNGA 3CSGA 3TYGH 3QUZB 1CU4H 1WJ3A 1L7TH 1QRKA 1P4BL 5DMKA 4CNIA 2XWBB 1NJ9A 3QIUB 4OBSA 4EN3C 1ZMYA 4NC1C 3WLWD 2DDQL 3WJJC 3QIWB 4MXWH 3M45A 1A3LH 3EYUH 1QOKA 3IFPB 4OLZH 3H9SB 5EG6C 1G7MB 4U6VL 1G0YR 1U8IB 5JMOC 3GMQB 3ZYOA 2NZ9C 3TH4T 1IGYA 4OKVB 4PJDE 3M8OH 1IILE 4GRMA 3GSVA 1L9MA 1NKOA 4HIJA 3V95A 4C83B 3DECA 3V8OA 3VCLB 2F54E 3RNQA 4CUCA 3OB8A 1HE7A 1T7ZA 3HMWH 2J7LA 3BQUA 3EYFA 5LAXA 1VFUA 2FGZA 2I9TA 5EU3B 4ELMF 4L8DA 2G9HA 4U2ZA 3A67L 4E9LA 2E8ZA 2J4WL 4NC0B 1GL4B 5D1ZD 3VWJC 2YRPA 3G04A 3PIQB 1EGJL 1Q8MA 2ZKHH 3Q6FB 4UILL 3MRBA 3T2NL 3TWCL 1HHGB 4R3SB 5D5MA 1FYTE 3TO4A 1P4IL 3BP4B 3S4SB 4C56E 4HC1H 5EN2A 5FV1L 4M9OA 1INDH 1NSNL 5E08L 1UA6L 4JZOA 2XQYG 1MJ7L 3WKNA 1Y6MR 2FX8L 2QADD 1FZMA 4XNXH 2JE8A 6CGTA 5LVEA 5BV7L 4UT7L 3NFPB 4PJEA 5EIIA 1YY8B 3V4UH 4YHZH 4OTXH 2F53E 4X6DA 3RTQD 3CX2A 4L4TE 5D2NB 4IM8A 5BXFA 3T3PE 1RFDL 3HS0B 4P2OA 1UCBL 1AXIB 3L7FB 4XC1H 5I71B 4YHOL 2COQA 3PQYA 1F58L 1EFXB 1JUFA 1F8TH 3FO0L 4U1MB 4PRPD 3ULUE 1NAML 3AGVA 5FXCH 3WD5H 2N7BA 3O3BA 3WNOA 4JG0H 4MHHG 1Z3GH 4JFFE 3MXWL 4MJIB 4GW5B 1YDPA 3QPXH 4NFDA 1OOAA 1FZJB 4UIKH 2H3NA 2IAMC 1E4XI 1JHTA 1QNZH 3PWUA 2UVFA 1SYVA 3ARGB 2CDGB 4LCWB 4IJ3C 1IEHA 5HHMD 5DUMH 4Z7VE 5BS0D 3RVVC 1BVLB 5KAQG 3C5SB 1G7LB 1XIWB 2HFGL 1IT9L 4WWID 2AJVL 1TENA 5DJAA 3HB3C 3PG2A 3T3PF 4Y1AB 3WFEL 2DIAA 3ARYA 2YSSB 1MRCL 4L4VD 4HUVB 4U0RB 2WV3A 2CK0H 3MJ7B 4G7VL 1TVBA 4K94C 5ILTL 4U1HA 3U9UB 3C8HA 3IT8D 1ZLWK 5E8PB 3QFJB 4WFHD 3ULUF 2XRAL 3UPRB 2JJWA 1MI5E 1B2WL 1DL7H 1I8IA 4JZJB 3NAAL 4HV8B 2UV3A 3FRPA 1MQKL 5FUZL 4GAFB 4X4ZA 1KJ2H 4M7ZB 2X4OA 1GCFA 4LEXL 3KYOA 1YN7B 3QIBD 3F7PC 1HHJB 3FQUB 4NPYB 1AFVL 4HGMA 2ATKB 4H26B 2OR7A 1MJ8H 4Z7VF 1SMOA 1ITCA 4JANA 4XPTL 4JFHD 4Z95L 1PX3A 5F1KC 4XAKD 3BISA 4D0CB 1F4XH 3V8CA 3E3QE 1BM3L 4N5ED 3DTXA 4LAJH 5BVJA 1MUJB 3BMVA 1V5JA 3UDWC 3PP4L 5CGTA 3OJVC 1IQWH 1HSAA 4XP4H 1ZSDB 4PLKC 4PJHB 3HHRB 4JKMA 1A6WH 4ONGH 1OD9A 2DJUA 4M1GH 4XBGA 1GGCL 1A9EB 3ARFC 4NOFA 3QULB 1QZ1A 4L9LA 4WW1B 3DBXB 3I6KB 3ULUH 2D7NA 4OZ4B 4XCEB 2WQRA 3GSXA 2EDOA 5EOCH 4OZIE 2WW8A 4APQB 4MNQE 2YMXH 5HI5D 2OMBA 3W0WB 5DYOB 4WW2B 2DD8H 2RCSL 4GW1B 4Y16D 2BNQE 5FHAH 1X5LA 1HXMB 2PTTA 5JMRA 4BFEA 2IGFH 2DQIL 3HZMA 4LSPH 1AD9A 1EX0A 1DN0A 4PG9A 5ITFA 3MLWH 1JN6B 2HVJA 4HUWB 5L0QB 4PREA 1S9XB 4O2CA 1E0OB 4JPVL 1S7TB 2NPLX 5BZDA 4QTHB 3SKJH 4J12A 3V4VH 3QO0B 4JFEB 5IR1A 1KULA 5JW3H 5D96B 3X3GH 3MYJA 4JFXB 1CG9B 2HH0L 1FE8L 5C0BA 1JTPA 3KLSA 3RPKA 2PO6B 4I4WB 3U7YH 1IFHH 3GB7A 4X0KB 5FHBL 2DQUL 5F7HA 3LHPH 3RWJB 2ZJSL 4NT6A 4I2XB 3QJFA 2A9NH 3UYRH 4V2BA 4BZ1L 2OK0L 1RZGA 3T09A 4KMTL 3CXDL 5EH1A 4UQ2A 5EBMA 4AENB 5JXED 1T2QL 4DGVL 3LN4A 1BREA 3CFBB 4D8PB 4QRPE 2OJZL 4G6FB 4JRXA 4ZOEA 5MEQA 4LVOB 3VFPA 3VXSB 1U95B 5DHVH 1NEUA 3SQOL 1CVRA 4GO6B 1N64H 1GYAA 1JPTH 3SGJA 4F9LC 1GZPA 4WWKD 2Y7QA 4QHKI 4KI5C 1XF2B 1AI1L 3C9NB 1F00I 3FO9B 5H37G 2GY5A 5E2VH 4PJCA 4V2CB 1DQLH 3JV4B 5MERA 2Y5EA 1IZKA 1C12A 1JV5B 5BV7C 2JIXD 1BD2A 1CBVH 4FQQA 1FVCA 3IDYC 4J7RA 4HH9A 4RFNB 3BGFB 1S7VA 1PZUB 5JXAH 1YC8A 1T03H 4KVNL 5GS1B 4UIMB 3HCVA 2FEDC 2YBRB 1FRGL 1HYRC 3DETD 3U36B 1MHPH 2EZ0C 1D5IL 5KSVA 3SE8L 5CJXA 3O3AB 4JQXA 1A22B 1QSFD 4WHTA 3DLQR 4ODSH 5DT1L 4JY6A 3R1GL 12E8H 4P5MA 4Y4KA 5GGVH 3GI8L 4LNRA 4U1JA 5A16A 2NX5A 5F3BB 4RGMC 4R7DA 2AEQH 1NCWL 1CLZH 1RJLA 1VB9A 5BOPA 5ACLA 3V5KB 8FABB 3MBEA 1JFQH 2J1KA 4KJPD 2VDMH 1OLZA 3WLWC 4MJ5A 4L1DA 3VFOA 3FO1B 2OZ4A 1IVLA 1OARH 4G8IA 1R3LB 3AU1A 4X7TB 1RVFL 4WV1A 4N8VG 2IQAA 1CLYL 4J6RH 3QDMD 3UTTA 5E7BA 2FGWH 1WFOA 1I1AA 3ARQA 3B9DA 4LGSB 4XPAH 5I17A 1AP2B 3MLVL 3E6FB 1MIML 4WJ5A 5JA8B 1PDKA 3HE7A 4OCNC 4D3CL 5IUSA 1FP5A 1INEH 2RFXB 4I3RH 5E4EB 5DI8B 4GAYA 4WUUB 3T0EC 3STZB 4L3ED 4Q6IC 1INQA 2VXUH 4H8WL 2D2OA 2ZOKB 4R4BA 2Q8AH 4HJ0C 2C3XA 2D7QA 3SGEI 4GRLD 5I8CB 2IJ0C 4ZOAA 3INUH 4JFOA 4XPFL 5CD3B 1Z2KA 3GMNA 5DD0L 5E8OA 4HKBB 1T1ZA 4EN3B 2HWZH 1RK0A 5T33L 3P11L 1F3JA 1DQMH 1P69B 2QADC 4HT1H 1I3VA 1F4YH 2FD6L 3O2WL 4EI6A 4G9DB 3VXNB 3NOIA 4PRDA 3PL6D 2RIKA 2Y06L 4P23A 1CE1H 3JTCA 4XNMB 3RTQC 2DTMH 2BJML 1EHNA 1HKLH 2B39A 2V2WA 5BW7A 4WU7A 2P45B 3MGTA 4LSQL 2AI0L 4MCZA 5F7MC 5INDB 2R0LH 5ERWA 2CIKA 1QLEH 2L7UA 3IDMB 1HQ4A 3I50H 5JUEL 2N4IA 4YXLL 1ZXQA 4EUPG 1F5WA 4PYHA 4XP5H 4HPYH 4OSUL 3B6SA 4QRRA 4O2EA 1FN4B 5D1XC 4LQFL 4ZQKB 4DZ8B 3VWJB 4AG4H 5KVEL 3KYMA 3MOQA 1NFDB 1JRHI 5CIPA 1S5HA 4MB5A 4MYWB 5D71L 2YKLL 3SDYL 4YFLF 5HGDB 5H37H 3F65A 1RUQL 2ICEB 3QDAA 1IM9D 1ROWA 5DGQA 1B6DA 5DWUL 3WDJA 3C6LA 3MNWB 5I1IH 5E2WL 2B1HL 1RUAL 2HTLD 1G7QA 3QUMB 4OZHA 1OP3H 1MHEB 1ZS8B 4OZFG 3RJDA 3EO0A 5ESQA 2IANE 1TZGH 2D3VA 3FMGL 3EOBB 4XCYA 4KAQH 4QHUB 1VFOA 3O9WD 1U8QA 2A1WL 4GXUN 1DFBL 2HAZA 4A2LA 1R3IL 3DYOA 3DSFH 3LH2H 2VL5A 4JRYD 2CGRL 1JZ6A 1FNLA 4OCYL 4F9PA 2CIIB 3GRWA 1KJ2A 2VDOH 1FG9C 4Y8AA 4TUJA 1E6OL 1ZKAA 2C1PB 4FXKA 4U3CA 4OJFH 4GQ9H 4QXGH 3QIBC 4JKPH 1R3KA 1YMMB 4QT5B 1CVSC 5ISZB 1KIUA 2IAMB 3P9LB 4AYFA 3S34H 1JGUL 2DQTH 1TCRB 1K3ZA 4GG8A 2EH7L 4WHCA 5EOTB 5IW6B 5HJ3B 4IJ3B 4X99B 1VKXB 1CL7I 1HI6A 4UNUA 3FAWA 4R9HA 2HT3D 2F58L 2LE9A 3WS3B 5EBGA 3CPLB 1KFAH 5INCB 3BN3B 4PP1C 4N5EC 3IFOB 4MJ6B 5DSCA 4Q7DA 5BJTA 3WL9B 5IB1A 4L4TA 5EZOH 3OF6A 1C5DB 5EU4A 4XCNA 3RX8A 1KPVA 1RIVH 4F37K 1BMGA 3WIFA 2CLVA 3DRQB 1NLDH 4AEHL 1DR9A 1LMKA 2BK8A 5GGSY 3GK8H 3EYOA 1BIHA 1H3GA 1JHKH 3FT3A 4U3XA 2NTFA 3MLTA 1H15B 2IBBA 5GZOD 5HI5C 3HNVL 4KY1L 4RMUA 1QLFA 4J8RA 4YWGL 4Z78A 1GPOL 4JFFA 4BQBA 2AJSL 4FQCL 4X6FA 1D6VL 3D18B 3IU3A 1I1RA 1RV6X 3LQAH 4OM1H 5HVHC 4V1DE 3ARSA 4M7JH 4F7EB 1MWAH 3X3FH 4W70A 2P43B 3S36H 3LDBC 3WIHH 2OZ4L 3BN9C 2VYRE 1F3RB 1V7NL 2E6JA 3DURB 4NZUL 2UWEE 4JZNA 4G8EB 5GGUB 1RIHL 1E4KA 5DFWH 3OKNB 2ZG2A 1YEGL 4G9FA 2G5BB 3C8DA 4LGRB 4YHMH 3VFWB 4EUPH 3TN0A 3TIDA 4ZAKA 2DYPB 3GO1H 2I5YH 4RMRA 4LDLB 1J8HD 2HG5B 2AEPH 1DQJA 4EQ3A 4YDLC 2F74B 1LDPL 3BMWA 3GI9H 4OFPA 1SJEB 3MLRL 1VEPA 4KHXH 1KBGL 2X4TB 3ARFB 1FV1A 3GJFB 3VFVA 2CKNA 3AAZA 1MI5A 3AUVA 2XZCL 3PP3H 3GKWH 2A73B 1DUZB 1P7QD 1S5IH 4YDJA 1CICD 1F6AA 5CZXD 1PG7H 5E6ID 1LO0H 4ZNCD 4WEMB 1XGTB 1I1YB 1CZ8L 1OW0C 1EO8H 4G7YL 1ES0A 5CMAB 4JDZA 1GC1H 3UC0L 3BZEA 5IMOB 1P6AB 3OAUL 4CGTA 3CMOL 4JPIA 3ZKMD 4LEOB 4I8DA 5JXEC 4JO3L 4OLXL 2ED9A 2BSED 1MHHA 3F7VA 4YHZL 2UWEF 3WFHA 4DTGH 1U3HA 4OGXH 4HUMB 5E94A 5DHVA 1A6ZA 3EO9L 3HAEG 1SY6H 5E1HB 1NC2D 1CFTA 3MCLL 1QPXA 2VXSL 3MFFB 1IC7L 5F1NB 2YZ1A 4IRSD 2A9ML 4F15C 1F3DH 4WWKC 3E3QA 1ZOXA 3EO1B 3Q48A 4MX7A 2DWEA 4NUJB 2I07A 1FNEA 2V6HA 4WI7A 1YN6A 2R2HA 1H3PH 3BJ91 4FA8A 3QDJD 4ZFFA 1MFAH 2CLZB 1P84K 1NBVH 2G60H 4KDWA 3N0PB 3RRQA 1RZFH 2DBLL 2Z31A 5EC1A 1CLCA 4XZUA 3MLXH 1MCSA 4EDWL 1Y18B 3SKMB 3E1F1 2X09A 1F13A 1NBYA 5KBNC 2JK5B 3QCTL 4NFBA 1G0DA 4NZJA 4PJ9A 4MNQA 1I7ZB 1ULVA 4LLVB 1FGVH 1P1ZB 1FLRL 1PY4A 3OR7B 5CHNB 3A6BH 3DUHA 2V7NB 3ARBD 2R1XA 3MV8B 1QBAA 3O3UN 3SY0B 1AQKL 1MCKA 4UU9A 3R06B 1C5BH 4JN1H 2GSIB 4WI4A 3WFZA 3DVIA 2YPVH 4DUWA 4EXPX 4U05A 3TBTA 1NAKH 3B2UC 4NO3B 3MRFB 5EZJA 3P0YL 1NQBA 5F96L 5A3IC 1OLLA 3MPCA 4F58L 3UZEA 4JGUA 1B0RA 4KJPC 1IGIH 4XHQA 5SWZE 2GITA 5IF0A 4RGOL 4JFPB 2N56A 35C8L 4KQ4H 2PTVA 5ICXA 3PDDA 1E4XH 3MUHL 3GRWL 4LRNH 3X17A 4LSVH 5ELIA 2W59A 4JG1L 5BV7B 3IDYB 4ESKA 5JDJA 2NY1D 5CD5D 3C5ZD 3CK0L 2EE2A 2VITA 5F93C 4RMSA 1ORQA 4UV4L 1GVIA 1UB5B 2DQGL 3C5JB 2GK2A 3DXAA 1T0PB 1V8HA 3KPLA 3GBLA 5F7UA 1G6RL 3QNXA 1T3FA 3O81A 1A6VL 1SEQL 4OZGA 5IK3A 3I9GH 1D5XB 4GAGH 1XGYH 3PWVB 2JJTA 3KLHD 4QRPA 1KB5A 1ONQA 3EAKA 3K80A 4AMKL 4RGMB 5IMLB 4G6ML 2CD0A 5DMYA 1MNUL 4WU5A 3P9WB 5GS0L 1UZ6E 4N0YL 4FQ1L 1B90A 5DJDA 4YEFA 1JZ8A 5KN5A 4I18A 2A6DA 2DIBA 5EUKB 3MA7A 5HHOE 5C2BL 4PY8I 2XYCA 5DQ9A 2BHUA 5ACZA 2PYEE 5M7QA 2APWA 1U8JB 2D03L 3ZMRA 4L5FH 4TRPH 2OTUA 4XXCA 1JVKA 4TUOB 5JHLH 1F4WL 1LEKA 4YXHL 4XNYL 3QO1A 1UWXK 3S3JA 1BX2A 5I66A 1HDMA 4HS3A 4XB8A 4NQSA 1QBLH 3M07A 1S7XB 5BQ7A 5C3LD 2X4QB 3T0EB 1T2XA 4G80A 3QEQA 4KXZI 4ODTL 4LDOB 1UZ8A 4Q6IB 5B39G 1G7JB 4O9HH 5T3XL 2BVQA 1WFNA 1B4JH 1EDQA 3HAEH 4R96B 1RD6A 4PJIE 3S37H 3GIVB 1H3WM 4KVCL 1NCBH 4OF0A 2XTJE 1ZHKA 1RK1A 1JGDB 3PWJB 4JVPA 5C09B 1B88A 4LSSH 4FFEX 3KDMB 2Y6SC 1DBBH 1T04B 3D39E 3DX9B 1U3ZA 2DN7A 2OS7A 1MFEH 2WWMC 3VE0B 4LLWB 1KJ3H 2HTLC 3WEXA 1YJDH 1DEEA 4TNVF 3RTQB 5ESVB 3BEWB 4PGDB 2FO4B 3RVTD 3EFFA 3B8YA 5DMJB 3ORJA 4XCCL 4M5YL 2ESVB 2FR4B 4HMEA 1GSMA 5DHYB 1XGPB 5ID0B 4I9WE 2IQ9H 1MIEL 3GBNL 4TVPD 1NCDH 2P5EB 1CGUA 2B7DT 3D85A 3KYNA 4PJIF 1ZA6A 4PTTA 5IHUL 2UZXB 2AJXL 4F7CB 2EYSA 4HMCA 5D1XB 3ARDA 2ZSWB 5AYUL 4PV9B 4IMLA 2W65B 3QUYD 4JDVB 3O4LD 2GCYA 4OF8A 5EIVA 5ETUA 5IJKC 3P73A 1QLRA 2QSTA 4Q9QL 2GAZB 4N8VA 5F1IB 5BS0B 1HILB 4NO0D 1BJMA 2M1KA 2HT3C 4MXQD 1TJGL 3FONA 1S9VB 1AR1D 3MSPA 4HIJB 5JOFB 4G8GD 4L4VB 4TTGA 4H20L 4PRNB 2WBJC 3BGAA 2CLRA 1ZTXH 2HTKD 1RUKH 4KMLB 5AWNH 1YNKL 4HQQH 5LAXB 4MS8C 3BP6A 2XY1A 3HC4H 3MYZA 4MQTB 1XCQA 4L8DB 1MREH 4EEEA 5GRUL 3MRMB 1YEDA 2R69L 1IAOB 1OAUL 4KK8D 4M1DH 2R1YA 2BRQA 3U83A 1KENL 4WFGE 2XN9D 3MRBB 5JHDA 3QIBB 3O8XD 3QEGL 1TPXC 3BKML 1XR9A 3NCEB 3CSYA 1KJVA 4MAYA 5EO9A 1A64A 2JELH 1MWAA 4LKCB 4PB0L 4PRHD 3HE6C 3PHOA 3WIHA 2IALB 5ANMB 4RQQB 5ICYB 4E5XA 4LOUC 4HLZH 3M17A 1LO3L 4X6DB 4Y2DA 3GEWB 1JF1A 3I6LD 3B3IA 3B9KC 4JFQA 3J7HA 4EUPA 4YHKL 4DN4H 3PQYB 2IANA 1VA9A 4K9EC 4GT7A 4WI2A 5C07D 3DOSA 5FM5O 3OG4B 5E8NA 5CKAA 1OTSC 1EMTL 3D2UD 3PF2A 2NY2C 2P8LA 3GUTA 1EEZA 2VUOA 3L95A 1KB5L 2GTZB 1N0XH 2E7LC 4ZG1A 1RIUH 5TGBB 1VDGA 2AV7A 4HKZB 5IVOA 1CICC 1X5IA 4HIXL 5E6IC 2GHWB 2Y07H 5FA3B 5HGGS 4MA3A 3RWGA 3KPOA 3PWUB 4NQDB 3NZ8B 5A2KH 2Z4QB 5HVHB 4HT1L 3O2VH 3L9RB 2YA1A 1H3TA 3LDBB 1T6VN 4BSJA 3VWKD 3K74B 5CBAB 1C8PA 4QRSA 2GJ6E 5IBTH 2VQUA 4OZFA 3HZYA 3S98A 1F97A 5IB3A 1FDLL 1SY6A 4RISL 4JY5H 4QY8B 4H5SB 2FBJH 4N8PA 4IRSC 3NZHH 4X5WB 5HYJE 5GS0C 4FQLL 3JWDH 3RDTA 3MRRB 5D7JC 4YDLB 4HZAA 1MEXL 3WFCL 4POYA 4LMQI 4Y4FB 3BXNA 3VXPB 5EOCJ 3MACH 4WI5A 2NY6C 3R0NA 2FX7L 1DBML 1X7QB 4GBXA 4K3HA 1XGRA 1XF4A 2AK1H 3CVIL 3WNMA 3RL1B 5HYQB 4S0UC 5D9SA 3BT2L 1AO7D 2I24N 3GJEA 2V7HB 1KTKE 2R39A 5H8DA 1YNTB 2Y9RT 3ARBC 4E42B 1S9WA 3HUJA 4ETYA 1I1FB 2Q6WA 4ZFZA 3G5XA 1F90H 3WSQH 2A74A 4EI5D 1C16B 2DWDA 3KHQA 4K3JH 1IAIM 2X9YA 5FM8A 2UWEA 2O26U 4JN2A 3NIDE 5D7KE 5TH2A 1J1PH 4DOHB 4F15B 4R8WH 1CLOL 3D25A 1CT8B 4X4XA 3SE9H 1AKJD 4NBYB 4JKWA 1DBKH 1IC5H 3MR9B 2FEEI 1KEGH 4DN3L 4NWTL 2AW2A 4IRJC 4XP6L 1JL8A 2OI9C 3DNKA 5KS9F 1MCJA 5FKPA 2JIXB 4LSUH 1KCLA 3GM0A 2BY2A 4A6YH 3I2CH 3QQNA 2F19H 4XBEH 5CD5C 4JLRB 4CRPA 2VXQL 4XH2B 5JLZA 3WS6C 1QFOA 3LIZH 1UCTA 4XAWL 3BYYA 3W81A 4NQED 4KU1A 1WBYA 5J06A 2GUOB 1FJ1B 1M1SA 3HZMB 4AEIL 5ITFB 3PGCB 2HVJB 3WXWL 4Q9CA 1QSFB 3TBYA 4U2YA 4PREB 3KLHC 1FZKA 2VLKD 3STLA 2O5ZH 9CGTA 1ZEAH 1YYML 2D7PA 3NIDF 4M3JA 4XMPH 3FTGA 3FQRA 4EVNA 1W0VA 4XP1H 2AV1A 3SKUD 4P4KD 3G5YA 2NY5L 4JM4H 4XVSH 1T89A 3OAYH 2HT2D 1KGCD 3IDGA 2ADJA 1YA5A 4ZD3L 1BGXL 2CJUL 4DVBB 5TJWK 4GG6B 4HFWB 3GB7B 5CJQL 1DANT 5E2UH 4N9OB 1TITA 5DZNA 2VZ1A 4NT6B 3CX5J 4K7PY 5ADPL 1CL7H 5JPNA 3DMMD 1RZGB 4J3VA 5JIPA 3E2HA 4JB9L 1CXKA 4FS0A 4P5KA 2MHAA 4J4PA 4K55A 5KSAC 1A5FL 4X6EB 1M7IB 5FYKE 2J6EH 3MREB 4ZS7L 5D2LE 1DDHB 1UWGH 3BH8A 5TDPA 4JRXB 2WP3O 3HMXL 3HAEA 3RHWF 1FL5B 1IEAB 3AVEA 2CR3A 3SCMD 1GIGH 5IEHB 1WUNT 3CDGA 5LG1A 3SKNA 2X41A 3QDGD 3LQZB 3QB7C 4PG2A 3GIZH 1YQ2A 2J5LB 3T4AB 4PJCB 2KUTA 3MRDA 3KG5A 4ZO6A 1OAYH 4KK5D 5MI0C 5GGVY 3MLYH 5GRZA 1CXLA 2VL4A 3NCFB 5GS2D 4WDIA 2DMBA 3JV5A 1M7DA 5DD5H 1RZKL 4RAHA 1OAKL 2BNUA 4MWFB 4PRBB 5F3HA 2EKSA 3GBMH 5GSVA 1AXTL 5HD8D 1EHAA 2BOBA 5IFHL 3BQUD 3VDAA 5DMIL 4JPKH 3U46B 4RGNC 4ZTOH 4G42A 1OGAA 5ADOL 2XXMB 4QHNA 3OAZK 2NX5B 3O6FD 5AG9A 5C0CB 1BAFH 1N7ML 2ZNXA 1T5WB 2VZVA 4KZEL 3TO4D 5EOQL 2HLFD 2OXGA 2DQJH 1FO0L 1EBPA 4ISVA 2BOCB 1WBXB 4QRQB 1L7IL 3FB7A 5FAAA 3DX6B 1DQDH 1YEEL 1V3JA 1NGQL 2IQAB 2D4DA 3VXMB 3H3BC 4IIQA 2PYEA 4YPGB 1BOGA 1F2XK 1AR1C 3H9HB 3L6FA 4XVUC 5F6IC 5J0BA 1IKNC 2ADGB 4GKZB 1RURL 1FPTL 5D7LE 4HF5H 4M62L 2WQ8A 5EPMA 4P2QA 2DQHH 2HTKC 3HE7B 5CP7B 1XGUA 3BUYB 5I1CL 5GGRA 2GEEA 3V0WH 1A4JB 5DK0B 5SWQA 5KVDH 2RBLA 1NUFA 5FYKH 4KK8C 1T5XB 3BAEH 1IGJB 4JFOB 1P2CA 4U1IA 1KELL 2BERA 4PJIA 4C57C 3EDDA 2DQCL 3O8XC 5EU7C 3MLSH 1HHKA 1JP5A 4U4BA 4JFDD 1LP9E 3BHBB 3KPRB 2AAVA 3KPNA 3P2TA 4AL8H 5DJYB 4LLMA 1QD0A 3QG6B 3KNBA 1G9ML 4Y5YC 5B38B 3LRGA 3N9GL 2UYLA 4Y88A 5DUBB 3D39A 4NQCE 4K7FB 4OCLC 4M6ML 2B4CH 2DAVA 1J8KA 3P9MA 3S8WA 3MGTB 1I9RH 2WBJB 3G5VA 3SDDA 1S9KC 2WLZA 3UTSE 1G7IA 2XWJA 5B39A 2VWEC 1A9BA 3QP3A 1VGKA 1WCBB 2GK0A 4NSKB 4XCFL 1IGTB 1NGPL 3IJHA 3F5WA 1DLHB 4M02A 5FGBC 2P5WA 2J8UB 5CIPB 1Q9KB 4OGAD 3FCTB 2VDKL 2A38A 1EH9A 3V0VB 5DJ0A 1TPXB 1LP9F 1R3JA 5FO8B 5KZCD 1PBYA 2W92A 1ZT1A 2CMRL 4JO2H 3D3VE 4JFZL 4NQTA 1D6EB 3HE6B 3MV9B 2LV4A 1YEIL 1XCTA 4JJ5B 3QUKB 3SOBL 3V52H 1QQDA 3MMEB 3EZ8A 1JPGB 4H1LB 2VDPL 5J9PB 1CDUA 1NANI 3RVWD 3EO0B 1KNOA 2ICCA 2VLLA 2R23B 5I1LB 2IMNA 3O3EA 4S11A 5D6DA 1NGZA 4PJ5B 5E70A 4YNYB 3TV3L 2ZG1A 5CSBA 3OHXB 3B9KB 1A2YB 2LAAA 3EGSB 4HHAA 3IFNH 1J0KA 1ODAA 3T8XA 4TUKL 4BSVB 1NDGA 2NY2B 4P59L 1A3RL 4JQIH 5LCVH 1KJMB 5IV2B 1I8MB 1Z9SA 4TUJB 5FK9A 5F6HJ 5SV3A 1JGVH 4LU5H 1ED3B 1P7QB 1QR4A 5EORH 4P4RA 2CUMA 1CICB 1ZGLA 2O61B 4RAVA 5KG9A 1RZ7H 4LARH 1URLA 1G6VK 3QXWA 2ADIB 4PY7A 4G6JH 4H88H 2XZZA 4LASL 2NLJB 4QTIH 1QFWM 4PGEA 4MNHA 4P9HC 5CBEA 1J10A 4FZ8H 3LZFH 1G6RB 3FFCE 3IDIB 1T20A 4ZSOB 1G0XA 5D1QC 2MQ3A 2OL3L 3VXTA 3W82A 2P1YA 2ENYA 1NC2B 5DSCB 4OB5L 2CDEA 1K8IB 4IRSB 1I7TA 3MROA 4S1RL 1J5OH 4L9DA 3UJIL 1YECH 4PJAA 5D7JB 3TA3C 2AK4D 2G2RA 5J6GB 4I5BB 1A1OB 5K9JH 3UO1H 4GKOA 5L9DL 4LRIA 5IG7A 1EVUA 4Z77B 4A6YA 2NY6B 3FT3B 4HXBL 4XWGH 1JCKA 1UM6H 3RBGA 4DZBB 4J8RB 4OCMC 3TVMA 3QCVH 5EIQA 3IFLL 2IH1A 3NA4A 4YK4B 3D48R 3TIEB 1JFMA 4NYLB 1DE4A 1J87A 3S96A 3LS4H 3ARBB 2E7CA 3W11C 2VABA 3MRPA 5LBSL 1D5ZB 5KSBB 4JZNB 3V0AC 3SE4A 4OAWA 1UGNA 3WNPA 5A2LH 3HG1A 4P2RB 3VGBA 5FKAB 4G9FB 4D9LH 4MJIE 2X44D 1ZVSB 3RWCB 3EUUA 3TP4A 1HHHA 4NDMA 4O02L 4FQXC 3LAFA 2PYFA 2FJFB 5HYJA 3MRJA 2LQRA 3JVGA 5DDHA 3CGTA 2BCKB 1RU9H 4N1EA 1K4DA 4IRJB 1BVKB 2OI9B 3BP5A 2EC9T 4PS4H 2JB6B 1BD2D 1FCGA 2B0SH 4Z76B 3Q3GA 3L5JA 4QYOB 4FNLH 1NMCC 5ENWB 4FFVD 2X5PA 5KS9A 4FFWD 4OCRH 3DMMC 1J1OL 1E28B 4WFED 4CN6A 3OXSB 3PUCA 2Z8WC 2E5EA 4NJ9H 4WEBH 3CDYA 4OFDA 2Y5TB 3CLEH 1WWBX 2R56L 2J6EA 3QFJE 1CDYA 4M61B 2CO7B 3LEXB 3WN5A 1JZ2A 4MA8H 4Y4KD 5EU6A 3KYKH 3VXQB 1N5YL 4N0RA 3FB6A 2HLAB 4KTEL 3B5TA 5KANG 3SCMC 1GGIH 1KEMH 4MAUL 2WM0A 1LEGB 4HS6A 5DD3H 3VXOA 4MX7B 4JQVC 3MBED 3WFBL 1RZIA 3DV6B 3OPZH 2AABH 2XFXA 1EHLL 3HFMH 1MCPL 3WBDA 4ZFFB 3QEHB 3QH3B 4GXUM 1CR9L 3O41A 3F6LA 4OLUH 4IDJH 3UJTH 1UADC 4XZUB 2P8PB 4AH2A 1A47A 1YEFH 1RZJL 3PE9A 1J18A 5F8QC 4MMZC 1I1AD 1LVEA 1OWWA 4R2GC 1PQZA 3REWA 5HD8C 2ED7A 5KSAB 4PJHE 3MLPA 3BQUC 1IKFH 4D0DB 3BDYL 3RWEA 2R1XB 4XVJH 3PHQA 2HVKA 1W2KT 1XGQA 4UU9B 5D70L 2E6QA 4RCAA 5I6XB 1AGFB 3O6FC 1DUYA 2YD8A 5DUPH 1KSRA 4I77H 2C4FT 5DA4A 5C0RL 3DUUA 1L4IA 3S9DB 2OQJA 1JWUB 4U1SB 1T83A 5JORB 2HLFC 4O58H 3RGHA 2Q86A 1OGTA 2GITB 4DAGH 4DGIL 5JW4Q 2ZCHH 4F57L 2R29H 3HC3H 4KTDH 1CGSH 1FL3B 4FG6D 3SKOB 3MACL 3B83A 2VH5H 1ZHBB 2D0FA 1A7RH 4NM8H 1OM3H 4FQJH 4UOW1 4FQ2H 1OPGL 2FRGP 3IVKA 4LBEA 3NCJH 5GRJH 3C08H 4N90E 4PJHF 1CTNA 1U8NB 3PXJA 2M8XA 3IU4L 1A21A 1NCTA 1JK8B 1XEDA 4OZGB 4QRRD 4RGNB 1BF2A 2Z8RA 3JUYA 4O51B 5HHPB 3FRUA 5B8CA 1KB5B 5FGRA 1NMBL 3RUGB 1BQHB 3E6HB 1ONQB 3LN5A 4IOIA 3BYTA 2VDNL 1FC1A 2BRRL 3O6ML 4I3SL 5DJCA 4N8CL 1C7SA 5JO5B 1CF8L 1MVUA 1CYGA 4I0PA 4KDTC 4I2XE 1JRHL 4QOKB 4KROC 3H3PH 4HGWB 4UTBL 5M95B 1CD0A 4BH7A 4D0BA 3LVEA 4LCIH 4F7MB 2VR5A 2APXA 3RIAK 1HEZB 3EYQD 3BPNC 3C6LD 4HIEB 1FG2B 2NQCA 3D0LB 4IMKC 3JTTB 5HI3D 3VXSE 4IRZL 1NH6A 2E9JA 3BZ4A 3B5GA 5F6IB 1SHMA 8CGTA 1PG7W 3WNKA 4ZDHA 3SN6N 4KPHL 4NO2A 1HDMB 4HS3B 4Z7UA 4XPHL 5GXBB 5KW9H 4J3SA 4CBPA 3FJTA 2F54D 3QEQB 4TQEL 3VXRB 5TQ2H 4MD5A 3DGGA 4F3FB 1AIFA 3JWOH 3MRKA 1TZIB 4HG4J 4M6AA 2BFVL 4PTUA 2ADFH 2EDXA 5HY9A 3TPUB 1ZHKB 1MJUH 2XN9B 3MODL 3C2AH 4OGAC 3O45B 4X6BB 3O8XB 1CIUA 2KH2B 1U93B 3BKJL 2ZCLH 2G75B 4HSQA 4BFIA 1FVEA 1LK2B 1J1XH 1FYTD 3RZWA 3WHXA 4C56D 4L8BA 5F7EH 3JV6A 5CEXA 5GPRA 3VMPA 3MCKB 3NABL 4K3EL 4Y5YB 4YFDB 4OLWH 2Q76B 4GW4A 4U1LB 5TQ0H 5F9JB 5LGJB 2HJLA 2YN5A 1G1YA 4H0IA 3ESUF 2F53D 4UI2A 2EIZA 4KHTH 1N59B 4MCYA 4L4TD 2BVEA 3RPIB 1K4CA 5CS7A 5I16A 3NMEA 4R4FH 1SYSB 3QWRA 5D7LA 4MDIA 5DGRA 3QI9A 2VQTA 3D1MC 1AY1H 3UPCA 2BNRA 2X40A 4OD2B 2EYSB 5L2KB 3ULUD 1XF3A 3CLFL 5J13C 1CFSA 3SHSA 2A6JA 4PB9L 4Z7WE 4CDGC 3EHBC 2NXYB 3RVXD 1YQVL 5FUCC 4U1NA 4E41A 4NO5B 4JFFD 2R0WH 3A6OA 1T1WB 1U8KA 4JAMB 4AIZB 4RNRA 2FYYA 1O7SA 4L3CB 3GHEL 3RY4A 1NCAL 3U9PL 1LP9A 4O5LH 5T3ZE 3TFKA 2I9LA 2APBA 4LP5A 2EYTA 4R26L 4M43L 3P0VH 4S1SH 2FBOJ 1QKZH 5I0ZA 3TJEH 5GRVL 3V2AR 1ADQA 5DK2A 2EDHA 4NQVB 1GGBH 1JZ4A 3FONB 4MVBD 4KRNA 3TBSB 3FHAA 2WBWB 3N1QC 1M6OA 2VTFA 3RNKB 1ZLSL 1EZVY 3FT4B 3TN0D 4ZAKD 5F7DA 1VCAA 2GJZB 5C0AE 3RZCD 3TESA 1N8ZA 4NC1E 4ZUWB 3ZKXC 2AP2A 4F7TB 4ZFGH 3FB5A 1JGLH 1PGRB 1Q94A 2M26A 3DO3A 3ZSTA 1KYOJ 3L3JA 4IS6A 1MI5D 3IJSA 4HFUL 2NR6C 5MEPA 4Z7WF 1WLHA 1YY9D 1S78C 2FX9L 4ODBD 5CZVL 4PLOB 1OAZH 1RZJC 3QHZL 1D9KD 4URTB 4W4OA 3MRNB 1K2DA 2K3TA 2HJKA 2X7LB 3C60A 4HWZA 1GAFL 2WANA 1XZ0A 4OF6A 2EDQA 2B1AH 1FIEA 2WIMA 2QJDA 3T04D 3WHE1 3D3VA 3BE1L 4I48B 3W39A 1AQDA 4NN7C 1A8JH 2B2XL 2DB8A 3NA9H 3LSOA 1GGUA 3AMKA 3P3YA 5D1QB 2I25N 4H25B 3NTCL 2AKRB 5I8OH 1DBAH 4HS8H 4KI1A 1FBIH 1G7HB 4CMMA 1IE5A 3WO3B 1GHFH 3TZVC 2WIIA 1IQDB 1AKJB 4CVZB 43C9A 1AGBA 4U1GB 3QUZA 4ELKB 5K33A 3TA3B 3HI5H 2R0KH 4K8RL 2P8LB 1KCUL 3X11B 1BQLH 4X80H 2XWBA 1B0WA 3QIUA 1MLCA 3PV6B 1IAMA 3AXLB 5C0DB 2H6PB 2Z31D 3QIWA 3ERYA 1Q1JL 3IFPA 3LEYH 3H9SA 4LSDA 2AERT 1G7MA 4EOWH 3GSQB 3RWGB 1U8IA 3KPOB 4HWUA 4FFWC 1C5CH 4OKDA 2F5AH 4PJ9D 4MNQD 5F89B 3M1BB 4UT6H 1WITA 1PSKH 2NY4D 4GSDH 5B3NA 4GRWE 3VCLA 2BNQD 4LVEA 2LAGB 4HBCL 2VE6B 1TMCB 4QRSB 1H0DB 3OKMB 1R5VB 4NZRL 5DJ2B 3K2UL 3NGBC 3DVFA 4OZFB 1H3VA 5EU3A 4Y4KC 5SWSB 5T3ZH 1NFDF 3PXHA 2VLKB 3H42L 5FDYA 4P49A 4DEPC 4OI8A 3MCG1 1YMME 3PIQA 5ISZE 4HGKC 1OP3K 3Q6FA 4FQXB 4WTXA 1FO0B 1HHGA 3BSZL 4R3SA 4FTVB 3DV4B 5I1KH 4OIBA 3WYRA 4P46C 4NKDB 1NMCB 4DFHA 4DKFL 2QQLH 4P2CG 1XF4B 2X1WL 1YY8A 5IB2B 5D9SB 1RUMH 3K3QA 3DMMB 4GRWF 5I1DB 5D2NA 1ORSB 4FFZL 2HKFL 3HS0A 5C9JB 1V3KA 3L7FA 3HUJB 1JMXA 3GNMH 2Q1EA 4ZFZB 4OLYL 1EFXA 1WIUA 3A0OA 2KBGA 2QHRL 4DKEL 4U1MA 4QRPD 1FZOB 5L6YL 1FH5H 2DI9A 4OV5B 2O93L 3LN9A 4G3YH 5JA9A 3HA0A 4XVTH 2JB5L 4MJIA 4K7PL 3QDGB 4GW5A 3RWFB 1FZJA 5CGMA 3AC0A 4QXWA 4PRAB 4OQTH 3SDAC 1JI1A 3CFJB 4CU8A 3ECBB 3BD4A 1IC4L 1WZKA 3WMSA 2CDGA 4LCWA 2XKSA 3V7MA 3THMH 2YUWA 2CUHA 4OF5A 2VO5A 1BVLA 4O2FB 2DM2A 3KPSB 1QHPA 2QSCL 3C5SA 1G7LA 2VSCA 1MY5A 5HHVL 4HWNA 5LQBL 3QUMH 1DTUA 4WUKL 4R2GB 5KVGH 1NANH 4Y1AA 2YSSA 3U7WL 4HUVA 1K6QL 3MJ7A 1Q0XL 1YEKH 3GMRA 3FQNB 3T0VA 3U9UA 5J1AB 2WY3A 2E27L 4GRWH 1ADQL 4PV8B 5E8PA 1V3MA 3QFJA 3TJHA 4YGVB 3UPRA 2EDBA 4JZJA 3STLB 4HV8A 1I8LC 5L7XH 4CKVX 5HVWA 4YXKL 1MCQA 3S3PA 1P9MC 3GHBL 3X12B 1YN7A 3V6ZB 4PLJD 4R97C 2BY1A 2EDTA 3FQUA 4NPYA 4U31A 4OIIH 3IDGB 2ATKA 3VFTA 1AE6H 4UINL 4H26A 1A6UH 1YYLH 3UAJD 5HI3C 4FHBD 5MP6L 4PJBB 1OSPH 1PD6A 3K46A 3WE6A 5GGSB 1W0YT 4TOYH 1A1MB 4D0CA 2FECI 5DVOA 4ZUVB 2AJYL 6FABH 2EIBA 3CIQA 4KFZC 4ONFH 1MUJA 3ARWA 2BZDA 2QQNH 3D85D 2OSLA 4YX2L 2FCBA 4PJHA 3LKSB 3ARDD 2HJFB 5TF1L 3CFCH 1TVHA 2DLEA 3QULA 2V5MA 3ROLB 1I8KB 3DBXA 3I6KA 2O5XL 4OZ4A 4XCEA 3ARUA 3QPQC 4APQA 4JFDB 1LILA 4KROB 5L8KB 4WHDA 3W0WA 1D7FA 5DYOA 3MRDB 2P7TB 4WW2A 3EDKA 4DGYH 2VISA 4GW1A 1PZ5B 4N1HB 5I2IB 4UB0H 2YK1L 1UQSB 1L0QA 3BPNB 2YEZB 4OV6F 4WDIB 1JGEB 4JVWA 4UTAH 1EPFA 2Z91B 2OL3B 2WINB 1JN6A 1TNMA 5BMFH 3AM8C 4KUZH 4HUWA 3RU8H 5F3HB 2FLRT 4DUXA 3LD8C 4NKIH 1NC4D 3T65A 4F7PB 1W72A 4QTHA 4BM7A 4JHZA 4K8RC 3QO0A 4JFEA 1TZHB 1UXSB 3WO4C 1SJHB 1PKOA 4K2UH 1EAJA 4JFXA 1CG9A 5LWYL 4YHLL 3ULUC 3A6CH 2EEBA 3GMLA 4EXKA 1IAKB 2AXGB 1QACA 4XX1G 2PO6A 3GJFH 2A83B 2J12B 4I4WA 1UC6A 1I9JH 1MQ8A 2FIKA 4WY7H 4X0KA 4HJJL 3MXVH 4MAYD 3RWJA 3VFUB 5DLML 4KKBD 3H9YA 2W9DL 3HTLX 2CKBL 5T1DH 3W9EB 1HQRB 2FATH 5CP3H 3WIIL 4AENA 1OSZB 2Q8BL 4OIAA 4PJ7E 5I1GL 3CFBA 3MO1B 4Y2DD 3OX8B 1UWEH 3B4NA 3OB0H 4MVBC 2HMIC 4M1CD 1QSEE 4Z5RB 3SGDH 3FHQA 1KACB 3RY6C 1JWSA 1QBMH 3RAJH 1U95A 2UZYB 1I7RB 2IAND 1NUGA 4J2XA 3PNWB 5EBLB 3G6DL 3NPZB 3RZCC 3T0DA 1UM4L 4XX1E 4Y19B 3RKDC 4MQXD 3VXUA 3C9NA 2YA2A 1P4BH 3FO9A 2DDQH 3EFDL 3JV4A 2YOCA 5T1KD 5J13B 1BHGA 1GOFA 4U1IB 1JV5A 1D9KC 1KIQA 3ZKQD 4U6VH 1L0YA 4QGTA 5DEFB 2RGSA 3IS1X 2Q20A 3TPKA 1CWVA 5GS1A 4GKSB 3EIFA 4UIMA 4LLMB 3HI1B 1LWRA 2YBRA 3N1FC 3T0EE 4AZ8A 3MRQB 4PJ7F 2B20A 3U36A 2X4PB 1WT5A 4XHJD 3V7AG 3TM6A 1HIML 3O3AA 2DICA 3A67H 3MGAA 4TSCL 2J4WH 3LKNB 1ZV5A 3K4AA 2VZSA 3RDTD 5F3BA 1EGJH 2DLTA 3V6OA 3KXFB 3DX7B 5F88B 5E1AB 2BX5A 1PKQE 5C09E 1A9BB 3QNYB 2AQ1A 4UILH 4KK9D 4NP4L 2AK4B 3T2NH 3TWCH 3ZKXB 3V5KA 8FABA 1P4IH 2C26A 3IKCB 5DFVD 3SGKA 3TO2B 4PY8J 1NSNH 5E08H 1UA6H 4DK6A 2P5WB 2HRPL 3FO1A 1MJ7H 2FX8H 4UDUB 1R3LA 4GBXD 3QG7L 5BV7H 4UT7H 1AC0A 1ZHNA 1TTFA 1NGWB 5TDOB 2VLJB 3V7AE 3QXDA 1AP2A 2NTSP 2F8XC 5C6TL 5TF0A 1RFDH 4V1DD 2P5EE 1UCBH 2VDRL 2JF1A 3OKLB 1FAIL 4NN7B 4HIIB 4YHOH 1XR8B 3GSWB 5DI8A 1EAPB 1F58H 3HPLB 4WUUA 5FYJL 3STZA 5EWIL 1MAML 3FO0H 1KNOB 1AHWC 1OD7A 2VLLB 4FABL 1NGZB 3MQIA 1PVHA 5I8CA 1JPFB 1QBBA 3TT1L 3BO8B 3RKPA 3TZVB 2DRUA 3MXWH 3T8XB 4PJFB 5CD3A 3DUSB 1LO5B 4HEPG 3AS1A 4HKBA 3UBXB 4NGHH 3TBWA 4EN3A 5A1AA 4NWUL 2FEEL 4GH7B 5FK9B 4BSWB 3WJJA 3PWPB 1RI8A 3LY6A 1WWAX 4G9DA 3C87A 3VXNA 4PJGB 2IH3B 4YHPA 5BCAA 1OVZA 2HFGH 1UENA 4XNMA 4DKAA 1IT9H 5HYEA 2AJVH 1I7UB 2FWOB 4YJZL 3MGOB 3WFEH 3UZVB 5IMMB 5IOPB 1MRCH 3UCRA 4NM4L 1QVOB 4G7VH 1WF5A 3TF7C 5J11C 1VFMA 1VHPA 5ILTH 2YUZA 2X89D 3NGBB 1M4KA 2XRAH 1MCOL 3G08B 1B2WH 1ZWIB 5I76A 3NAAH 5FDWB 5C86A 1FN4A 2VLME 1MQKH 5FUZH 3UZQA 4ZQKA 1I7TB 4DZ8A 3VWJA 5GRXG 1W72L 1NFDA 5C9KA 4PJAB 1CFQB 4LEXH 5HGDA 1AFVH 4YBHA 4C59B 2ICEA 4MJ4A 5ANME 4WFFE 4WTWA 4ZXBC 4TNVK 5I8KL 1WBZB 4CW1B 3IETB 3VMNA 2YA0A 2ZOLB 2MKLC 4X6DE 2A6IB 4P46B 4XPTH 3MNWA 2ZUSA 2YPLB 1I3GL 4ODWB 2NXZC 4Z95H 4M5ZH 1BWMA 3QUMA 3B43A 4O4YL 2E7BA 5C08B 1MHEA 1ZS8A 4NN6C 4J4PD 2HFTA 3O6LL 1BM3H 3PQYE 3W2DL 1MAKA 3EOBA 2AGJL 4QHUA 1DE4B 1VGEL 4CVXB 5FOJA 3PP4H 3PJSB 1X3DA 5TE4L 4FFYL 2ENSA 5HDQL 3HG1B 2FJHB 1GGCH 2CIIA 3J8F7 4YE4L 4YHYC 2C1PA 2R0ZL 1ETZB 2PYFB 5LGHL 4PLJC 4NQDE 3MRJB 1TDQA 4QT5A 5ISZA 7FABL 2IAMA 3P9LA 5HDOA 5IROC 2YRZA 4MHHI 4QF1A 3SDAB 3U79A 3BFOA 5SWZD 1TCRA 5EOTA 3QUXD 4X6DF 5IW6A 5A2JH 1X4ZA 4NRYB 4X99A 1VKXA 5H35B 2DQIH 1S3KL 1I4FB 1A0QL 3WS3A 1KYOK 5INCA 1EEUA 2R15A 3IFOA 4JPVH 1SM3L 4MJ6A 5FYJU 3FQXB 3WL9A 2KQNA 4ONOA 1U8PB 4NRXA 3BPLB 1R5IB 2ICES 3QCUL 5T1LB 3BD3A 1C5DA 4HUUA 3WN5B 4XP9L 1U2CA 4LLYB 4D9RE 1MCBA 3ARDC 5TE6L 3NACL 5TE7L 4ELMB 2HH0H 1FE8H 3DRQA 4YPJA 5FHBH 2HRLA 1H15A 3K7UA 1H5BB 2DQUH 4PR5A 4R97B 3I02A 1I3UA 2ZJSH 4U6TA 4HWBA 3D18A 4ZUUB 4BZ1H 2YWYA 1OY3B 2OK0H 1A7PL 4DQOL 5HHOD 3ES6B 4KMTH 4F7EA 5KJRL 1SEBA 3CXDH 5DF0A 2I26N 4AH2B 4FP8L 1T2QH 3EJJX 3HNSL 4DGVH 2PYED 4PIRF 2ZNWA 2OJZH 1CGXA 2EICA 4G8EA 5GGUA 2CPCA 4PJDB 2RAMA 3MZTA 1FFNA 3SQOH 1MRFL 3RWEB 4JPWL 3UDWA 3FQTA 2D31A 4QWWD 2F54B 2P49B 2DYPA 2EIEA 4NQXB 2HG5A 1AI1H 3UTOA 1UEMA 2F74A 5C0EB 1SJEA 4UAOC 1JYWA 5DRZA 3ULVL 3ARFA 3BJLA 3GJFA 4X5XB 1DVFC 1U9KA 3DUUB 2A73A 1OAQL 1DUZA 2APFA 2XTJD 4D9QE 2R2CA 1XGTA 1I1YA 3VGGA 1FYTB 1AH1A 5I1JL 5CMAA 5HYSB 5E7FA 5CJBA 1KB9J 2IADB 4KVNH 4ODVL 5IMOA 1MFNA 5CP3A 4PRIB 4LEOA 1FRGH 3D39D 4KK6D 3VA6A 3DYMA 5IW1A 1J0IA 1D5IH 2NY0D 3SE8H 3PABB 1BFVL 1P7KA 5DT1H 2F53B 3R1GH 2C4XA 3SDDD 3GI8H 2APVA 3MFFA 1N6VA 5F1NA 4EDXB 4XNUL 1QO3B 4WI8A 3EO1A 4OI9A 5AZEL 4NUJA 4MQXC 4I9WD 5C0BE 3SDCD 3KJ4C 3WO4B 1A7NL 1A3QA 4GQPH 1QFHA 5IWLC 2CLZA 5DJCB 1W8NA 3PWNA 4JDTL 4IOSD 5CJ8A 4RFOL 3F6IA 1RVFH 1GC1C 1CLYH 4HXAL 1Y18A 3SKMA 4CADA 4UT9L 4G5ZL 5E8DL 2C7UB 2JK5A 5IB5B 5KSUB 1TJHL 1I7ZA 3MLVH 1P1ZA 1C1EL 2H32A 3C8KB 3OAYK 4D3CH 4JRXE 3OR7A 2DQEL 4OFYA 5CHNA 1DCLA 4XHJC 3MV8A 2JJUA 3SY0A 5MENB 5L8LB 3BZ4B 3R06A 2BHZA 4YLQT 2GSIA 3DIFA 5KOMC 3D9AL 4H8WH 5E0QA 4XRCB 3NCYS 1KT2B 3MRFA 1EGJA 2MPAL 3RDTC 3TH3T 3F12B 3RZCB 1N4XL 4KK9C 4PJCE 4XPFH 4F9LA 4LF3A 1AIFB 1FYHB 5AAWA 3L5XL 5DD0H 1QFUL 4JFPA 4NUGL 1A4KB 3HZVA 4HK3N 4J1UB 4Y4HC 3F7QA 5T33H 3L3IB 2EECA 3P11H 4D94A 1HWGB 2FD6H 1WWCA 3O2WH 1D9KB 2VLRB 3F7YA 1UH3A 3T0WA 4WFGD 4R6UA 2Y06H 2YD4A 1DSFL 5GGTL 2GFBB 2BJMH 4ZFOA 1UYWL 4LSQH 5GISL 1UT9A 3GMPB 2AI0H 1OT1A 1UB5A 3C5JA 3FAXA 4NHUB 4YXLH 5JUEH 3O2DA 5HDBE 4K7PX 1I9EA 2NX5E 5CINL 4OSUH 5C0CE 3R8BB 3PWVA 3N50A 2FL5B 4LQFH 2XZQL 2QQKL 5KVEH 5D4QA 5CEYB 5IMLA 5FGSA 3CH1B 4PJCF 3QI9B 1FLTX 5D71H 2YKLH 4K94L 1NL0L 2NMSA 3SDYH 3TT3L 3NCCB 4P5TD 1BJ8A 5EUKA 1HWHB 1XF3B 2VZUA 1MFDL 3VXME 2BXYA 5DWUH 3UTTE 4U1NB 1KXVC 1U8JA 1JIBA 2OR9L 3QA3B 5E2WH 2DOCA 3TVMD 5B38G 4OZIB 5IT2L 2B1HH 2FNBA 1RUAH 4YEEA 1H8OA 4AIXA 5BO1L 4HWBL 3O0RL 2D9CA 3FMGH 2BNQB 2H1PL 3FB8B 4UDTB 2A1WH 1DFBH 1R3IH 1U0QA 5HDBF 1S7XA 1T4KA 4YDIL 1J0YA 2CGRH 2X4QA 3ABZA 3T0EA 2FZ3B 2P48B 4Q6IA 1G7JA 4OCYH 4KTYA 2GJ6D 1AHWB 3IDNB 1M6OB 4R96A 3RA7L 4LK4A 3S88L 3SE3C 1R3HB 3GIVA 5FUOL 1E6OH 4NCC1 5HYJD 1JGDA 1N8ZB 3PWJA 4LCCC 5F9WC 3RL2A 4U0QB 3KPRE 5CAYB 4HMDA 2QQQA 3FB5B 5CILL 2MQCA 5C09A 1JGUH 3KDMA 1B6UA 1HNGA 4O00A 2EH7H 1I85C 1T04A 2F5BL 1W0WA 2Y23A 3QXAB 4BUGA 4U49A 3VE0A 5FYLL 3Q1SL 4IDLA 2F58H 4H1LG 1MRDL 5FF6B 3RTQA 5CLTA 5CSGA 5ESVA 3BEWA 3IXAB 4PGDA 2FO4A 2SEBB 3MV7B 1CS6A 4HJGB 4J4PC 5DS8B 2PW2B 2ESVA 5IGXL 2QBWA 5ID0A 5DHYA 1XGPA 5J11B 4QRRE 1X5FA 2FB4L 2P5EA 3AS2A 3VFMB 5L2JA 3ULVC 3H8NA 4AEHH 4F7CA 5D1XA 2Z35B 1P53A 4XGZB 4M6NL 2CRZA 4PV9A 4C54A 2W65A 4BUHA 3TBWB 4UUJB 4G43B 5D7KD 1HHIB 2J88L 2BVYA 4JDVA 1CXIA 3D0VB 3HNVH 4KY1H 4YWGH 1GPOH 3MV9E 5CCKL 2AJSH 4FQCH 1D6VH 1MLCB 5DD1H 4ZXBB 3QUXC 3ARZA 4AT6B 2GAZA 1YJDC 5I1AB 5HHMA 2OZ4H 5F1IA 4OZHE 5BS0A 2R9HC 1HILA 5EO1B 2NY3C 3NCBB 3IJYB 1V7NH 2NXZB 1WIPA 1FL6B 4NZUH 4PJ5E 1S9VA 4KKLD 5CEZL 1IMHC 5JOFA 1RIHH 2DLHA 4NN6B 1YEGH 4L4VA 4PRNA 3DX8B 4YC2B 5DTFB 3ZE0F 4NHCL 3PGDB 1FNFA 5IVNA 5DRXB 1HSBB 1LDPH 2J8UF 3MLRH 3MRMA 1IAOA 1KBGH 2ITCB 2DF3A 2XZCH 4YHYB 4M9PA 4HZLB 2HFFB 1QHOA 3QIBA 1Z0NA 5GSRA 4CU7A 1CZ8H 3CFDB 5HHXH 2JJSC 4G7YH 5F70A 1MHCB 2E9WA 4RMTA 4RMQA 2CKBB 5GHWL 4LVHC 4M7LL 3UC0H 4DCQB 3OAUH 1NFKA 4LKCA 3CMOH 2IFFL 3GSOB 4OZHF 4JO3H 2IALA 3LKQB 3OKYA 5ANMA 1UG9A 4OLXH 4RQQA 5ICYA 3X14B 5DQJA 1WWWX 4OCSL 3Q5YA 5I74C 5JQ6L 2VXTL 1KPRB 3EO9H 2HKHL 1UXWA 4MDJB 2ATPB 3ARED 4N5EA 2CQVA 4ZFOL 2V5RA 3EJYD 3MCLH 4HK0B 2VXSH 4HX1B 4S10A 4CDHA 1IC7H 4LCYB 1KPUA 2A9MH 2YXMA 2AEIT 5A40E 4NBXB 3O2DL 5FYKD 4MD0B 1CK0L 3MV01 4NNXB 1KCVL 3BIBX 2LVCA 4ZS6D 4D2NA 4V3EB 2GTZA 5DR5L 3BKYL 5TGBA 2DBLH 4HKZA 2XTJC 3VRIA 5CIPH 1S7WB 4EDWH 5FA3A 4ZTPL 4YDKL 1WC7B 2DQFB 4NGHL 1WFTA 3QCTH 4NQDA 1SQ2N 3NZ8A 2Z4QA 2KQMA 5F9OL 1WAAE 3L9RA 5T3XE 1FLRH 3MNVB 4NZTL 2EDFA 3GSNL 5CBAA 1CDHA 1AQKH 4HWEL 1HINL 4P2RE 4KJWC 4G9FE 5I30L 4NNYB 3QQ9C 3QFDB 1T7XA 1IAIL 3FOLB 2AJUL 3SDDC 4QY8A 3P0YH 4H5SA 4U7MA 5I73C 3QRGL 3UEZA 4XWOD 5F96H 4X5WA 5K59E 4F58H 3GMRB 4Y5VC 3O6KL 3MRRA 1JF5A 2V9RA 3RX5A 4LSTL 3SDCC 3FQWB 3Q0HA 4GMSL 5KVFL 2LTQC 3FZUD 3FN0L 4XI5C 4Q9RL 4RGOH 4UAOB 35C8H 1N2RB 4YR6B 1X4YA 1HH9B 4MB4A 4Y4FA 3GRWH 3VXPA 4DK3A 1DVFB 1D3CA 4JG1H 4F37F 5DJ8B 1MFCL 4BKLB 1X7QA 3HKFA 2FHFA 4HUKB 4CU6A 4XMKL 3RL1A 5HYQA 3RGVD 3CK0H 3VFTB 1YEJL 4JRWA 4HW6A 1WAAF 2V7HA 4UV4H 3MRIB 1FNHA 2DQGH 4JVUA 5KSBF 5JXEA 3V9FA 1MSPA 1F45A 1YNTA 5C0JA 4E42A 1I1FA 3VJ6B 1G6RH 4M5ZL 3WE6B 3IDXL 3ZYZA 1WV7T 1A6VH 1BOYA 1SEQH 2DM7A 3ARPA 1C16A 2CXKA 3CXHK 4OM0L 1KCSL 4YAQB 2IPUK 3QWRD 5D7LD 1T0MB 1Y6NR 5K59F 2ZCKL 2VC2L 1Y6KR 4AMKH 4G6MH 3SQBA 1QA9B 4WWKA 1CT8A 1TNNA 2MTPA 3EYSL 1MNUH 5E03A 5GS0H 2OSLB 4JO4L 2BNRD 4N0YH 4FQ1H 5DVLA 3KJ4B 3MR9A 1FIGL 1BZ7B 4E0RB 3QJHB 3FN9A 1CN4A 5C2BH 1TVHB 3QXVA 1G7PB 2XA8L 3N1PC 4AQOA 5D8JL 2JIXA 3NCMA 2PW1A 5EZIL 3ZT5A 2D03H 5K93A 4JR9L 2DI8A 4JLRA 1ZLUH 5KAQF 4ZODA 1LO2L 4XH2A 1F4WH 2VISB 5SX5K 4YXHH 4XNYH 3RVUC 3TFKD 1ACYL 3RIFF 4LFHG 2Z0BA 5F21B 2GUOA 2IWGA 1FJ1A 2X4SB 3ELAT 4LNVA 3PGCA 4ODTH 4U6HB 4NQCD 5FO7B 1QSFA 2WWKT 5T3XH 2C3HA 4YHIA 3BWAB 4I1NB 3T65B 2ICWA 4L8CB 1W72B 1EJOL 4KVCH 1BQHG 1KN4L 4JCMA 3GKZA 3IYLW 1CGYA 3UTSD 4P5TC 4LRIC 4U1KB 4Q2ZB 3VFSB 3GMLB 4GAJL 4Y4HB 3NFNB 2PN5A 4M6OL 2JTDA 4DVBA 4GG6A 4HFWA 2FIKB 3TVMC 3C60D 3G6AB 3CCHB 5I1EL 1KG0B 3I3BA 1IEBB 3DXAE 1EXUB 2PUQT 5D6CB 1AC6A 3EDFA 3SDXB 3D3VD 3ZT7A 5DD6B 4V1DB 3TEUA 4XCCH 4M5YH 1R5WB 4OZGE 4X6EA 4RGNE 4X9FA 1M7IA 3MREA 1MIEH 2IEPA 3GBNH 2NW2B 4UV7L 1DDHA 4WO4D 32C2B 4QGYA 1T6WA 1FL5A 1IEAA 1JWSB 5IHUH 2AJXH 3ZZ1A 5HHQB 4QOKE 5AYUH 1RHHB 5IEHA 3CVHL 3VXUB 2AQ2A 4EBQL 3LQZA 5CFHA 3QIUD 5C71A 4P9ML 3T4AA 1CQKA 2ZUQC 3QIWD 4G6AC 4JM2C 1JTOA 1U8HB 4Q9QH 4UQ3B 1KIQB 4RMVA 4XBPB 1EO5A 4ETQB 3ZO0A 1TETL 3MJ9L 2X1QA 1TJGH 3UTPE 1LNUB 2FJGB 4MWFA 4PRBA 4H20H 4OZGF 1R0AL 3QEQE 1EVTC 1UJ3C 3VXRE 4AM0B 1QYGL 2NNAB 1YNKH 1BFTA 3RUGF 3KPTA 3U46A 1E27A 2PXYC 3FFCD 3TPUE 2E9BA 5GRUH 1M05B 2R69H 4TSAL 1OAUH 4NZDA 5EU7E 3QQ3B 5C0CA 1KENH 1T5WA 1NMAL 5I19L 4R90L 1CXHA 4PUBL 3QEGH 2GT9B 5ITBL 3ILPB 3BKMH 4K23L 3MRGB 3CDCA 2BVOB 3SJVB 3DI2B 2BOCA 1KOAA 2VDQL 4HAFA 1WBXA 4QRQA 4XC3L 1ZE3C 2XOTA 4PB0H 2ID5A 3K1DA 3DX6A 1OQOA 1Z9OA 3RI5K 3VXMA 3U4AA 1ZHNB 1LO3H 5E8EA 4YPGA 1YPZB 4KKLC 3H9HA 3X13B 1KIPB 2ADGA 4GKZA 3QXDB 2E3VA 1UM5L 2Y4SA 5LKNA 3LKOB 2CSPA 5CP7A 5FGCB 4YHKH 2Y1VA 3BUYA 4GMTL 4NCDA 1A4JA 5DK0A 1EMTH 4R4ND 5JR1L 1T5XA 5D1ZC 3QWOB 1KB5H 4P3CH 2PNDA 4JO1L 4KRPD 4MJID 1IGJA 4X8JB 4HIXH 4ZNEE 3F8UB 1T22A 1P7HL 4LGPB 3UBXI 5E5MB 5IFAH 5SV4A 4L4JA 5SWZB 3BHBA 3ARGD 1S9YA 3VFRA 4LCWD 2GJJA 3KPRA 5IJKA 1GOHA 2ILLA 2XQBL 3QUXB 5DJYA 2OJEB 3KWWB 3QG6A 5C0GB 1VFBB 3HC0B 5B38A 4Q58C 3V5HB 5AZ2L 5DUBA 2NY3B 4K7FA 1XIWD 4YHPB 3LV3B 3U4BL 1IJ9A 4FMFA 1A7OL 1FDLH 4RISH 2F15A 3AREC 3NFSL 1UEYA 3EJYC 1O5DT 2WBJA 3RX7A 4FQLH 3QFJD 3ZHLA 4KJYB 4MS8A 1MF2L 3F7RA 3LRHA 1MEXH 5I76B 3WFCH 1WCBA 5IKCB 3BGMB 4CL7A 4NSKA 3KR3L 1IGTA 5JHDE 3KPMB 1DLHA 2J8UA 2FX7H 1DBMH 1Q9KA 3FCTA 1J11A 3V0VA 3BESR 2EXYD 5K9KB 1UACL 3CVIH 1PAMA 5FO8A 3WNLA 1IARB 3BT2H 1QFWL 4LVHB 5HHOB 1D6EA 3HE6A 2XA3A 3MV9A 5HVFB 3I6GB 2B4CC 4JJ5A 1J0HA 3QUKA 3MMEA 2W60B 1JPGA 4H1LA 1N6QL 5J9PA 2D7TL 4DFIA 3HZKA 5E95B 4UOW0 2XPGB 5I74B 1IBGL 2FH8A 1A14L 4TSBL 2R23A 5I1LA 4XWOC 4PJ5A 2FECL 4YNYA 3LMJL 3OHXA 3B9KA 4J3TA 1A2YA 1CLOH 3EGSA 3VU2A 3ZE1E 2CO6B 4QXUL 4N0UA 3ROOA 4BSVA 4DN3H 2PR4L 3JWNC 4NWTH 1EZVX 4KJQD 4XP6H 1KJMA 5IV2A 1I8MA 3MZGB 2E7LA 1ED3A 3D5OF 1MCCA 1P7QA 1CICA 3UTQB 4APQD 5E6IA 2O61A 2WNGA 3VW3L 4RIRB 4HDIB 1QRNB 5K9QI 4ZOCA 4QF1B 2VXQH 3RGVC 1KCRL 1QEWB 2ADIA 4XAWH 2C1OB 2NLJA 2F9BT 3LS5L 4PGBA 4QLRA 3L1OL 5SWSE 1G6RA 3IDIA 5DURB 4JCLA 4ZSOA 4AEIH 4CVUA 3L7EB 1AGCB 2Z93B 3BIKB 4KV5F 3WXWH 3ESVF 3MOBL 5JOPE 3MA9L 1NC2A 3T2QA 5E9DB 5I73B 1YYMH 3B9VA 3RWHA 1K8IA 4IRSA 4N90D 1Z6JT 3ZE1F 5AEAA 4FTVE 4L8SC 2XT1B 4NRXB 4Y5VB 2NY5H 3NH7H 4HUUB 4OQ1A 5D7JA 2BDNL 2NY7L 5J6GA 4YIQB 4OFIA 3H7LA 2LTQB 4I5BA 1A1OA 2UUDK 3DVGB 3QDJA 4N1CA 2PO6D 4X9IA 4ZD3H 1BGXH 4Z77A 2CJUH 4LPYA 3PGFL 5CJQH 1NLBL 4DZBA 4LLQB 2X70B 4PR5B 3I02B 2EDYA 5ADPH 3OL2A 5DD1L 4Y16C 1Q9LB 1JNLL 4NJAL 4JB9H 3TFKC 4YDVB 3HUJE 1RAMA 1SEBB 1T0NB 4ZUTA 3TIEA 1RJZB 1A5FH 4NYLA 4Y89A 2OMNA 5HSFA 3ARBA 4Q9BA 4ZS7H 4YO0B 4G6FD 1WAAA 4QEGA 1DJSA 3MLZL 1D5ZA 4FQHB 3HMXH 3I75B 4G6KL 3VXSD 5KSBA 1X4XA 1KN2L 4P2RA 1FFNB 5FKAA 1ZHLB