3OX8A

Crystal structure of hla a*02:03 bound to hbv core 18-27
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
275
structure length
275
Chain Sequence
GSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDGETRKVKAHSQTHRVDLGTLRGYYNQSEAGSHTVQRMYGCDVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQTTKHKWETAHEAEQWRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHEATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRYTCHVQHEGLPKPLTLRWE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords MHC class I antigen
publication title Structural insights into the binding of hepatitis B virus core peptide to HLA-A2 alleles: Towards designing better vaccines.
pubmed doi rcsb
source organism Homo sapiens
total genus 77
structure length 275
sequence length 275
chains with identical sequence D
ec nomenclature
pdb deposition date 2010-09-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ox8A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3ox8A01
4B7LA 2EIZA 1I8IA 3OWEA 5DRZA 5BRZA 1I8LC 5T1KA 3DLQR 2H26B 2YPVH 3F58H 5DFWH 3L5IA 4EI5B 2YA1A 4KKLD 3U79A 5F1IA 3QXAB 5HYJD 1DN0B 4M3JA 3AS3A 4XZUB 5BCAA 2DL9A 2GW5A 1SHMA 3B6SB 3T4AB 1FC2D 4NWTH 1JPSL 1I4FB 2DLFH 1ONQB 5CWSA 3V4UH 4Z7VB 1MFNA 1K4DA 4WUKH 4GAJL 1DVFA 3ULUD 1LDSA 2BSRB 5K9OB 1U8QB 12E8L 2M1KA 4NN7C 5MEQA 3NA9L 3SE3C 4OGZA 2NY0C 4PJ9A 1T80A 1KCGC 5HHMD 3L3HA 3NCMA 4LQFH 1S7SA 2J5LC 2F58H 4G6JL 3MGTB 3ORJA 1KN2H 3M1BB 3VXSA 4IOIB 3SGJC 4CMHB 2ZSVB 2J8UA 4JO2L 3IRPX 5L2JA 4HPOH 1B6UA 3UTTD 3PUCA 1BZ9B 4F7EA 5EO9A 3VXTB 4PRDA 5AAMA 5GGQL 2Z92A 5CGYD 4ZTPH 2J8UF 3HI6L 1P2CA 1MREH 3VD9A 2EXYC 1NBZB 5D7LD 3NIDF 3KJ6L 1IGIH 2ZCLL 2XI9A 2X44D 4BFBD 1C5CL 3KGRA 4P5KB 4PUBH 3U30B 1CLCA 1TCMA 4O2FA 2AK4B 1LNUA 1F97A 3B83A 3R0MA 4HV8B 1MCOL 4UT7H 5EG6C 3BPOC 4KZDL 2ZOLA 4PJXA 4AMKL 2EZ0C 2GI7A 1EMTH 3KXFA 4JM4H 1S78C 1IKNC 3B9EA 5CJOH 3I02A 3CC5A 2VXTH 1I7RA 4PJXF 1VGKA 2IAMC 1QLEL 3F12A 3VFGH 1BVZA 2YD7A 4B0MM 3UP1A 2F53E 4LHUA 2UZIH 4LLVB 4FQXC 2E6PA 5E5MA 1JGEB 4YZFF 1K4CA 2ORBH 4MA3B 5E6ID 4P48A 4IRJA 5BRZE 1I7UA 3GHBH 2J88H 3BVNB 3PL6D 1N0XL 4Q9BA 4Y1AB 4HLZG 2C7UA 3F7QA 4GLRI 1FFNB 1BFTA 4NYLB 3RDTC 3DVGA 1JNLL 4MNQD 1ACYH 4ODUB 3QIUA 3VXRD 4YHOL 1IARB 4PGZA 3Q6FB 43C9B 3L3IB 4JDVA 4MS8C 5HI5D 3O6LL 4LSVH 2NY0B 3T65A 4MA8H 4FTVB 2BDNL 3ZHKA 4KXZI 2J5LB 3EBAA 5F9JA 3FN0L 4KKAC 3MJ7B 5LBSL 4NP4L 4YDVA 1D5BA 2W92A 1CD0A 5JPMB 5C2BL 5BO1L 3CFBB 3NIDE 5GJSH 3GZKA 1HI6B 3EOTH 1E0OB 4Z95L 4WY7H 1B0RA 1U93B 4WEUD 5F9AC 4IMLB 4PRPB 2VN4A 5AD0A 3BD5A 1ORQB 1RZIA 2CLZB 3BUTA 5DJ8A 1CGSH 4JZOA 5TH2A 1BFOB 5DJZB 4NO5A 3BPOB 5C0BA 5JQ6L 2HG5A 4JFFD 1LEKA 5E2UH 1FGVL 3V7AE 5MERB 3BDYH 1DVFC 4PJXE 2E3VA 3IKKA 3KXFE 5BJTB 2IAMB 5IHZA 4JPIB 4NO2A 3VDAA 2B1AL 4OZGA 4PJ9C 3FTGA 4YZFE 4FQXB 3OKMA 3VFMA 4P9HC 2VXVH 1UWEL 3QO0B 3BKJH 3O41B 4HZLA 4EVNB 4JGJA 1FDLH 3MLRH 3S36H 5BW7A 1M7IB 1U8JB 5LGHL 5I17A 4ZFOB 5CD3A 1NDGA 2DMKA 3O45B 3QO1B 4JFQA 3RVXD 4CDGC 3RDTB 4X4XA 4IMKA 2XY2A 3BX7C 1I9JH 5HSFA 4WHTB 2AI0L 3RVVC 1WTLA 5JW3H 5ALBL 3FQNB 1ZWIA 4LVNC 5L8LB 2F9BT 3GMMA 4G8GD 4XWGL 4C58B 1TDQA 5F1KC 1MOEA 2J8HA 3VA2C 1NCAH 2DQEL 4PBWD 4Y4KA 2M2DA 1D3CA 3MODL 3UPAA 4Y4FD 4JO4H 1V7NH 3H8NA 4ELKB 1IGML 1WEJH 2F53B 1KGCE 2A73B 5JOEA 1NAKH 4ZXBD 1HILB 4JKWA 2XKUA 3ULVC 4HH9A 3ZO0A 3KYNA 4PB9L 1CBVL 3BJLA 3C9NA 2CSPA 1F13A 2NYYC 2YR3A 4LSQL 1VACA 4XCEB 1FYTA 4IRJC 4F58H 4IRZL 4BQ9A 4JJ5A 1CG9A 4LLAA 1QNZL 5JOPE 4Z77A 4U0QB 5IQ9A 3L3DB 1BWMA 2Q76B 4LPYA 3WL9B 1MQ8A 4OZFG 5E03A 1KELH 1JYXA 1T83A 3BISA 3GIVB 5C0BE 2IBGA 3DSFH 4LF3B 1DLHB 3QIUC 4PLKD 3WDJA 1OWWA 4R2GB 2FR4A 3QCVH 4FFVD 1P4IH 4OGAC 2GUOB 3RTQA 1YZZA 4RAVB 5DK3A 3PQYA 2OTUB 3VD4A 2YD3A 4ZNCD 4UT9L 4UIMB 4PRIB 2OTWB 2VR4A 2IADB 5HYSB 1OAZL 3ZTNH 1SYVB 3VE0A 3OB0K 5DSCB 4WI9A 1HHJA 1VFOA 3DRQA 5GGVY 3P4NB 4N0FA 1C5BL 1S9XB 4WU7B 1RUAH 4N9GA 4TOYH 5IM7A 3IDXL 1N59B 1D6EB 1SJHA 2FJFB 2IAND 5J6GA 5I6XC 1JN6A 3K8LA 4K7PH 1YJDH 2D9QB 2DWEA 3IXAA 1U8OB 4AQOA 4PJIA 1QSFD 3LKQB 1UADC 4JZNB 4KK8D 4F37F 4JRWA 3WO4C 3LIZH 4NO0B 3S98A 5B8CA 4LVOC 4HCRH 1TJIL 5I18L 4KK9D 1T22B 4S11A 4GMTH 3TT1L 4PJIF 1TZHA 2R2BB 2CLRA 3PF2A 3QQ9D 4MXQA 4U31A 3WNLA 4OFIA 5CJQL 3H3PH 2OP4H 4HXBH 1NC4B 4H5SA 3WJJA 1OAKH 3C8KA 1ZLWK 3L3GB 4MA7L 2DKSA 2YPLB 4LSUH 4OCSH 1D9KB 4RWHA 4W70A 3UTQB 1XF4B 5C6TH 4NO3A 2P5EB 2Y07L 5JNYB 4J1UA 4MD4B 4J7RA 5BW7C 3GMLA 2SEBA 4BZ1H 1FYTE 4E5XB 1A2YB 4X80H 5DVMA 1CQKA 5KSAD 3UAJC 2VQUA 4XRCB 4UDTB 3TIEA 4QXTA 1JPTL 4FQHA 4XMKH 4FQLL 2ITCA 3P11H 2KQMA 5ECJE 2FGZA 1JI2A 3ARWA 5C9KA 3MCG1 4OSUH 5C0AB 3GMNB 3LV3A 3EOAB 4PJHA 4LNRB 4KMTH 4JAMA 3OHXA 3TF7C 1KJ2B 5KTEL 1AHWB 2AXFA 5KVEL 4WHCA 4YQXL 5JIIA 3PQYE 4BFEA 5I15H 4Y5XA 5GRZA 3JV0A 1CS6A 3O4OC 4PJHF 5T1MA 4QHLB 3MLYL 2QADC 5E9DA 2J1KA 2XZQL 4ERSL 1MI5E 2BOCA 3FAXA 2FECL 5DYOB 4K23H 3F7RA 5FYJD 1OF2A 4QRUB 4ENED 3HAEG 3S5LA 3EFDL 2XWJB 5D2NA 2FCBA 2FHFA 5I6XB 5K9QI 1ZTXH 5C0EB 5EU6A 1DR9A 1C1EL 1IGYB 3VWJA 3GKZA 1NKOA 3N0PB 3WO4B 4LVOB 5D1XD 3KR3L 4PJIE 4PRNB 3QH3B 2QHRH 4O2CB 1DQML 5IR1A 5DJXA 4P4RB 4KI5F 1QVOA 2B1HH 5CEZL 1BVLA 4K07A 1ZHLB 4CGTA 5D7IB 4TNWK 4UILH 5C0CD 4EXPX 3P73A 5TFSL 4GRMB 4F7CB 2DTSA 2QQNH 2JJWA 5EORH 5DK0B 4CBPA 4MZ2A 5MEOB 5GGRY 4UV7H 1MCNA 1URLA 3ARTA 4WRLA 5FO9A 3U7WH 5ICXA 4Z5RA 1H0DA 3NCJL 3W39A 1RURH 3VRIA 5HHQA 4K94C 4UT6H 1A7OL 4M7ZB 2O5XL 4X9IA 2GAZB 1MCDA 4ZD3L 1LO0H 2IFGA 4C54A 4I3SL 4K3DH 3CSPA 3CSYA 3KYMB 4LDLB 3D18B 2WBKA 4OAWB 2EE9A 1EFXA 3DRTB 4F7TB 1B4RA 3RWDA 4XP4H 3EOYG 4YC2C 3QAZC 1JGVH 1I1FB 1GOHA 1IAKA 1BQHA 1KPUA 1EEUA 1WC7A 5ISZD 2PW2B 3QUKA 3LMJL 5AWNH 1U95B 3O4OB 2OJZL 4UTAH 3NABL 5DVKA 4ZODA 2JB5H 4YIQB 2Q86B 5DUBA 3HPJA 5BVPL 5C9JA 3GSVB 4QRTB 15C8H 4GKSB 1N6VA 3DX8A 3QIWB 5DD6B 4PGCA 5E9DE 2W0FB 2PYEA 2BHYA 4KY1L 1YYML 1ORSB 3QEUB 1KUMA 2FH6A 1UKSA 2E7MA 1PBYA 2R0KL 5D2NE 5FAAA 3JWDH 3FONA 3K7UA 1QRNB 1XH3B 2P7TA 5LWYL 1HH9A 1UWXH 1H5BB 4KI5E 1T6VN 2YUXA 3DIFA 3BDXA 4JFEA 1HNGA 1NLBL 4BFIB 2AJSL 1XMWA 1NMCC 2DLEA 4J3SA 4UNVA 4OBSA 4FP8L 4WTXA 4P5MB 3X12B 3HKFA 1EIBA 4I48B 2NNAA 4M7KL 2FEEI 5IMKA 1DBKL 1I3RB 2HRLA 5FGSA 1AFVH 1ZXQA 4WV1A 4HWZB 4NQCD 5F9DC 1EJ6A 4DOHB 1MI5B 3S4SG 4Y5XC 1QBLL 5MEPB 3H9HA 2K7QA 4GAGL 3RX5A 3MFFA 1MHHB 5C2UB 2YXMA 3ULUH 4MJIA 1INQB 4FG6D 1NSNL 3AMKA 2Z93B 3DECA 1N5YH 1MCIA 5D1QD 1J5OH 3A6CL 1IM3B 5D2NC 4PIRF 2V7NB 1UGNA 4X99B 3FO9B 1G7HB 1RJYA 1OQOA 4OFPA 2NY3D 3CPLB 1NAMB 2XWTB 2VABB 4NC2B 2O93L 4YC2B 3QAZB 1OWRM 4U1LA 5EA0L 4KI5C 1JHKL 5FDWB 1BD2A 2XACC 2IWGA 2CIIA 1TJGL 5BS0A 3QRGL 3CVHA 3MNVA 3N1FC 5F88B 3D87B 4BSVA 2UYLB 3QCUH 1W8OA 1A7QL 3SKOA 3WFDH 4LBEB 4R96B 4NNPL 5DA0B 3WN5B 2IQ9L 1ZMYA 4MNGA 4YX2L 3WS3A 4W6WB 2JB6A 1U6AH 4XAKE 3PP3H 1W72L 3U4EA 2V2WB 4NKIH 1MAKA 1IGFH 3L3OB 5IMLA 1FPTL 3FB5A 4N8VG 3AMLA 3VGDA 2JJTA 5C0NC 1KJVB 4LCCB 1J05A 2ADFL 2F8VA 1CFQB 2CMRH 4R0LA 5FOJA 2H1PL 1BZQK 3LAFA 5I1KL 2P8PB 4XNYH 3T77A 2VZVA 1LILA 3PL6A 3VJ6B 4PJCE 4JFEE 4H1LG 2EDBA 5F21B 3LHPH 3QRFM 3HZKA 5IG7A 1H9VA 1T5XB 4RFEA 3VXRA 2HT3D 2P4AB 3IAQA 5C0JB 4PJFA 1DQQA 1KB5A 5DHVB 3RL2A 5J3HD 4UQ2B 4E0RB 3KLHD 5FUOH 2A1WL 4HUUA 3IFLL 4I77H 4PJFF 1GZQB 4LGSB 3RWHB 4MJIE 4OQTA 3VMPA 3CXDL 4XI5C 3CUPB 2WUBH 3SCMD 1B4JL 2VZUA 4HGWA 1XGPB 5F7LB 3EUUA 4PS4L 4FFWD 5ITFA 3D9AL 2YBRB 4FQIH 3WKML 3H42L 5J6HB 1DDHA 4B53A 5GJTL 3OJDB 4Q9QH 4KKCC 4XCCL 2AKRA 1IGCH 3BWAA 3VA6A 4R4BB 4HLZH 1MCPH 1IM9B 1DE4B 1BD2E 1L4IA 5BS0E 4WFED 3QWOA 2KZWA 3IS0X 3BSZH 1KV3A 4XVUC 4L4VD 1EEQA 1JNNH 4RQQA 5A40E 1FL3B 1PY4A 4UB0L 3FOLB 3E6FB 3B2VL 2DQUH 4YDLC 1BIHA 3QUZA 2EYSA 1F45A 4OGYL 5AUMB 1A1OB 8FABB 1QLRA 2NW2B 1ZAGA 1AO7D 2NTSP 1GL4B 3BP4B 1M05B 4NDMA 2HH0L 3D2UD 3PIQA 4X7TB 1CLZL 4FQJH 2ZUXA 2Y9RT 3I84A 1BQSA 1JGDA 1V3JA 4M6ML 5IB4A 1PGRB 3VXPB 2I07A 4PTTA 3MLWL 4MDJA 3VWKC 3WHE1 5F7WC 4D9LL 1AJ7L 1A0QL 3BEVB 2NLJA 1IEAA 1U3ZA 2BRRL 3B43A 2R4RL 1CLOH 1SYSB 1AY1H 3V6OC 1FNAA 4FFZH 1HEZB 3BI9X 5GHWL 5INCB 2CIKB 3R0NA 4JPKL 1QOKA 4NQSA 3VXOB 3MXWH 5DQJB 1NGZB 4KUZL 4YHLH 5E5UB 3UTPD 2O5ZH 1X44A 4IOSD 4JN2B 2F15A 1QFWM 4Z7WB 4LCUB 1YY9D 3HG1B 4PJFE 4OFKA 5TGBA 4HHAA 4Y4FA 1B3JA 1J0ZA 3SDCD 4MCYB 1YNLH 2CR6A 4XNMB 3S3SA 5JXED 5J12B 5DO2D 1HHIA 2P1YA 32C2B 4XPAL 2DL2A 3FO2A 3T3PF 5A2JH 2A38A 2Z35B 2OS7A 4JRYA 4ZXBA 4K9EL 3B5HA 3VFNB 1J1PH 2WMPA 2YA0A 4JHAL 4U6YA 3EYOB 1O0VA 2LQRA 4TPRL 3DTXB 2Q6WA 4HMCA 4L29B 2R9HD 1VKXA 2FL5A 4R0LC 3C6LD 4JHZA 4PJCB 1S9WB 2CXKA 5SX5H 4PD4J 2YD9A 2AJYL 3MUY1 4M6OH 1U8PA 4KPHH 3P9LA 3FO1B 4BZ2H 5C92A 3K80A 5TE7H 2R1WB 5ICZB 4NZTL 4PRAA 3U0WL 3HMWL 1E4XH 1EEZB 2BVQA 4XX1E 3UTZB 4DVRL 5J9PA 5EZIH 3S3JA 3HC4H 4JKLA 1YPZB 4TVPD 2ICWA 3QXTA 4PJEB 2Y5EA 4NOFA 2NPLX 5HPMB 4M7LT 2XQYG 4KJQD 4O5LH 3CZJA 2EDLA 3K4ZA 3OXSB 3S34H 3MLVL 2HN7A 2BNQA 1JBJA 1HSBA 4OCYH 1VFAA 1A02N 4I2XB 3E2HB 5FM8A 3VWKB 3DO7B 1Q9OB 1QYGH 5LCVH 3S9DB 2V5MA 3S96A 4HKZA 5ACMA 2NX5A 3MRDB 1OARL 1IEHA 4OFDA 4HJGB 2HT4D 1GGUA 3FT2B 2D4FA 3SDYH 1S7UB 5KBNC 5E8EA 2QSTA 1R3JB 1JWMA 1M7XA 2IMMA 2DTML 1MFCH 3OR6B 3KYAA 4AT6B 2ITDA 1SBSL 3OX8B 5E2TH 3TBWB 2ADGA 1ZK9A 1T7WA 2OL3H 4EXKA 3A67L 4OZFH 4MMXC 5HDQL 1AXTL 1BLNA 1K85A 4X8JA 2HFEB 1UXSB 2QJDA 1FNSH 1M1SA 2X7LA 1UB5B 3I6KB 3T3PE 4NC0B 5KSUA 5LQBH 5JHLH 4DEPB 2B7DT 5I30L 5I8CB 3TNMB 3B8YA 3RGVD 4ODVH 3EZ8A 3GB7B 5FUZL 4RZCB 3BP6B 4RIRB 1CT8A 4JRYE 3TVMC 5ANMA 4L8BA 5I19H 1JPST 3K4AA 3FO0L 1FFQA 1TTGA 5L88L 2XZAH 3RY4A 1U8KA 4YAQA 3ARGD 3ET9F 3WFBH 1MCLA 4KTEH 5IFJB 4G43A 4ZUTB 2UV3A 2H2PC 4HK0B 3UPRB 2FLBT 5K9KA 1T2QL 1A4KA 1PG7L 4D0DB 2MKWA 2UWEA 2FD6L 4PJ5D 2FATL 1R3LB 5FKAB 1G7IB 4TN9A 2MHAB 1KC5L 2DQJH 3CIQA 2UWEF 5JHDB 5IEHA 1MHCB 2X9XA 3GGWA 1F6LL 3V0WL 1L7TH 5D7JD 4LFHG 2VJXA 4ETYA 1MH5A 5F44A 1NEZA 3GEWB 2BNQE 2VLJD 4GH7B 4HS8H 1LK3L 1PLGH 5GRJL 3CK0H 4PLNC 4JKPL 1D5ZA 2NX5E 3L1OH 2A6DB 3V4PL 1MELA 1DBJH 1FO0H 4S1QL 5GGTH 2D7TL 1HIML 4LARL 3AXLB 3HR5B 3THMH 5GS0D 4P59L 1A6TA 5MP6H 4AEHL 1HHGA 4Z7UA 1NMAH 2I9LB 5FYJH 5BZWB 3VRLF 1NUFA 2G9HA 4JFHD 4R9HA 1WV7T 2XQBH 3MRPA 3DMMB 2OR9L 4OF5A 2IH1B 1I3GH 3K2UL 2CO6B 4Z7UF 1WWAX 4WGVB 3WFCH 4IBLT 1TJHH 1TMCB 1YYLL 5EB9A 3N9GH 5DMGD 5T1DH 2ZUSA 4U6XA 3ARRA 1RAMA 3C5SA 3SOBH 5J0BA 3TLRA 1LQSR 2XN9A 1Q94B 3TVMB 2HJKA 2E7LA 1KG0A 5EBLB 4IIQA 2GITB 1A7NL 2ZUUA 1CGUA 3FB6A 5ANME 1REIA 3S88H 4LSSH 2XRAL 4PTUA 3W5MA 1C16A 5FKPB 4U1JA 4GUPB 2BVPA 3L9RA 4HIEB 3FZUC 2EICA 2PR4H 3TPUB 1N8ZA 4JDZB 3AFLA 3RVWD 1OAQL 2UWEE 5H2BB 3MNZB 2X4RA 5JZ7C 1ZOXA 3I85A 4KH2A 5T3ZE 3ARFC 4WUUD 2MQ0A 2YK1H 4MJ2A 2HMID 5HXMA 2LU4A 4N90D 1KEGL 1A3RH 4LOUC 4X0KA 4P2OA 1S7TB 4O4YH 5D1ZB 2YD1A 1J1XH 1FVEA 4O58H 2B8OT 2W65A 1UWXK 1M7DA 3MGOB 1U8NB 3MMEB 3SDXB 1J7VR 1TENA 1F8TH 2PN5A 4Z8FL 5T1LB 3E1F1 3BP7A 4JO3L 4PLJC 4O02L 4BH8A 1KCRH 1VEOA 4OIAA 5E99L 2BNRB 4KJPC 5IGXL 3W2DL 5DEGA 1NUDA 3ROOA 1N3NB 4JFXA 2O61A 1GGIL 4CNIB 3M8OH 4GKNA 5I1AA 3F7VA 4Z7UE 3U9PH 2HYMA 5LGJB 3CU1A 1JZ7A 1DL7H 5CP7A 3GMRB 5E4EC 1FFOB 5HYEA 4WW2F 4HK3N 4U2ZA 2YOCA 3J8F7 3NACH 3DGGB 3HFML 1S9YA 3SHSA 4FQCH 4HFUH 2NY2D 2RB8A 2DYPD 4JFDD 2Z31D 3STZB 5K9QG 1DQLH 2W1NA 1NCDH 1P7KB 2F54D 1SJEB 4NN6C 4GBXA 1J8HA 1KPVB 1T1ZA 2XN9E 2E7LE 2GFBB 2EDFA 2X4QA 2GTZB 1IQWH 2H3NB 3K81A 4LPUA 4HXAH 5D6DC 4QTIL 1ACZA 1HQ4A 2CKBA 2JJSA 1IT9H 1WBZA 4D9QE 4XPFL 2VDKH 2FSEB 2Q8BL 5D1QA 3HRZB 3SDDA 5ADOL 3CFKA 1WCQA 4KKBD 2D03H 2NY4C 2NY1B 2DAVA 3ARDC 3BKCL 1RZJC 3NZHL 1ITBB 1K3ZA 3ARFB 4KK5C 5I66A 4NQDA 2VAJA 4QO1A 4UI2A 4M43H 4WVRA 4X4YB 1OAUH 3DX9B 3VXUA 3KPMA 4ODWB 4ZSOA 3D48R 2AJUH 2FEDD 1JGLL 3BD4A 5DFVD 2GJJA 3C8HA 1DBAH 4ONHB 4AENA 2AERT 2VIRB 1VFUA 3AVEA 5T33H 3MLXH 1L6XA 4GG6B 1WAAA 4OZ4A 4IIQC 1M71B 1T0PB 3FT3A 5DWUL 1WAAF 1IAOB 2NY5C 3IKCB 1INEH 1JWSA 3MREB 2LFGA 4CAGA 1IKFH 5T5NG 3CMOL 3AREA 5I8OH 3T2NH 4P3WA 2DQGL 4YHYB 5EUOB 1CZ8L 1MEXL 3VXMD 2CDGA 4C55A 2OR8A 5CILL 3X3GH 1LD9A 1MHPH 5CBEA 3BIKB 1F6AB 4NPYA 1MJUH 5HYSG 4IHOB 4NN6B 4OT1H 4MXWL 5J1SC 4LCIH 3HNTL 3WFHA 1KPRA 2K7PA 4OCXH 1I8KA 1WBYB 1J8HE 1KEMH 3ZE0F 4P2OC 3MGAA 4L1DA 2NY7H 1KCUL 2AEPL 4U0RC 5GGVH 1KB9K 4NM4L 3PHQA 4HAGA 2XTLA 1TQCC 2IGFH 4WI2A 1FFPB 1IAIH 2YMXH 5IW1B 2BOBA 5H35A 2NY4B 5DI8A 2JIXD 3ARDB 4F80A 2M8XA 2VDRH 3QEGL 1UEYA 2FX7L 3ARBC 4WW2C 1RZ7H 3MSPA 5E00A 3SJVD 1N26A 2OZ4L 3NA4A 4XPTL 4XVJL 1SY6A 2RAMA 4BKLA 1MVUB 1QSEA 5EC2A 3IETA 4XMLH 5EUKB 1OPGL 4NQDE 5CZVH 1GZPB 1KIRA 3KNBB 1IVLA 2GT9B 2A74A 5DURD 3RZCA 3V5DB 1SY6H 1UA6H 5DJAB 3VXUE 4P9ML 4ZSOE 2APTA 5IESL 4BH7B 1X5HA 4L4VA 3QUYA 5DHYA 4R3SB 5EH1A 4XTRD 3CFEB 1VCAA 4TTDD 3PDDA 1FZOB 4QHNB 4ZOCA 3GIZL 2GJZA 3MR9B 1WAAE 4Y5YA 1MFBH 1AO7A 2YPVL 4NGHL 3UC0H 1GC1H 3MBED 1F4HA 3LS5L 3PWUB 2JJSC 3UYOD 4HBCL 3HB3C 1A6AB 5BMFH 2Y06H 1TTFA 4CADB 1AD0A 3N1QC 2GK0A 4YFLI 1Q0YL 5IB3A 4FA8A 4LSTH 4M62H 4ZQKB 4KAQH 3X14B 5ID1B 1ITCA 4DUXA 3MRHA 4KRPD 3FOMA 2R2HA 4LMQE 4RAUB 3U6RA 3EHBC 1HCVA 5M94B 2X4OB 2P8LB 1I3UA 1J1OL 1R5IA 4M1GL 3U4AA 5LXGL 4NIKB 4PGBA 2RFXB 5CIPB 3DVIA 2BMKA 2E9JA 5EZOL 1TQCB 3U48A 2GJ6D 5FK9A 3IFNH 5EFIB 1A7PL 2H41A 3RJDA 1MAJA 5GZND 5E0QA 4KC3B 3QP3A 5FGBA 3ARBB 4XH2A 4YNYA 4WW2B 3TJEH 1NJ9A 3S97C 1T0NA 2ATKA 1AQDA 4LKXA 3G5ZB 1T5WB 4G7YL 3SQOL 4AIOA 3TO4B 1W0WB 3BPLC 1CDCA 2R56L 5D72H 4I3RH 3AREC 1A14H 2P5WD 1QSEE 1IC4H 4YGAB 2VXUL 3IJYB 4A6YA 4FMKA 4L3EB 5ICYB 5GGRA 4R7NA 4PRHA 5DRNB 5FYLE 4N0YH 4M02A 4YHNB 5TF1H 1FVCB 4RISH 3VFGL 4JANB 2DLHA 1J87A 3ARZA 1VADB 5C09D 3WE6A 4S1DC 2UZIL 1G9NH 2FLRT 1HXYB 1RUKH 2A9ML 4OCWH 4NKQB 4HQQH 3BD3A 3BH9B 2ORBL 3QG6A 4U1IA 5CBAA 1K5NB 2R69L 3ECBA 3GHBL 4K3EL 3SPVA 4JVPA 4N5UA 3PWLB 4TVPH 4TUOB 1EDQA 1ES0B 1T2XA 4K7FA 3V6ZA 5KN5B 3NGBC 2VLRA 4HIIB 4YHZH 4P5TC 5LG1A 4O00A 4Y4HA 2ZUWA 4U1GB 4HS3A 1T1WB 5F1IB 4EDWL 3MCLL 3ELAT 2DQCL 3CLFH 5CSZB 5IWLC 2FJHB 3NAAL 3R8QA 2AGJL 4Z0BH 2DWDA 4XMPH 4K3HA 5DJ2A 3V4VL 4MA8L 4EI6B 5SWZE 3MACH 3MA9L 1T1XB 4G5ZH 6FABH 4LEXH 3KPSD 1C12A 4NUGH 3QJHB 5HGHB 1FH5H 4U7SA 1ZVHA 4N0UA 1RJLB 3QISA 1RFDL 3LDBB 3QUYC 1KJ3H 4LL9A 3BQUC 1PKOA 5CAYB 3QPXH 3WIIH 4N68A 2XTJD 2AEQH 4Y5YC 5DEFA 3EYUH 5IMOA 5IBTH 2FWOA 1MF2L 3RGVA 3LRSB 1HH6B 3F62A 1WFUA 1F11A 3X3FH 3G5VB 3BPLB 4GQ9L 4U1KA 1KT2A 4QRPA 3IVKA 1P1ZB 1HHKB 2EO9A 4LDOB 3V0VA 3EO0A 3CVIL 3O3DB 4M4PA 1OW0A 5FGCB 1U3HA 3NPZB 1H3PH 2Z4QB 3BPCA 5GISH 5TE6H 4PJ8C 4PRHE 4IEFB 1NANH 3FCTA 3SE9H 3S37X 2OI9C 1OGAD 2HT2D 4PJ5A 5IF0A 2F74A 2VXVL 2A6KA 2YD6A 3UROR 1Y0LA 5HVGB 3S36L 1F5WA 3B3IA 1AGBA 1WF5A 4OZIA 5CGMA 2D0GA 4HUKB 3WXVL 3I9GH 4HPYL 3IFOA 4ONGL 4CMMB 5CEZD 3O8XA 3W11D 4P5TB 4MCZA 5INDB 2X70A 2JKXA 5EZLA 4OZIF 3T4YB 2FZ3A 1I9JL 3NPSC 3GSRB 2VLRE 4FQ2H 1RIVL 1TNMA 1A4JB 3I6GA 4QTHA 1BF8A 3SDAC 1A9EA 3S35H 3RWGA 3G6DH 4J6RL 2BSSB 2G5BB 4K71B 2DM7A 3PG2A 4H0HB 4GXVL 4PY8I 1J10A 1T0MB 4F8QA 1JYVA 1YEDA 3MV9D 3EYFB 4U6HA 1FNLA 4U1MB 4QXGH 1JIBA 4M6NL 2DQFA 3SGEI 2C1PB 5F7NC 1CXKA 1SEQL 1WEJL 5CHNB 4TRPL 2BY1A 5D8JH 4P4KC 4YDIL 4DGIH 2X5PA 3IDIA 1NAKL 2BSTB 2X4TA 3BQUB 1G9EA 1GPOL 4N0UE 1JZ5A 3FQXA 5MENE 5FB8A 4TULL 2AJ3B 3O4LA 3IU4L 3MJ9A 1I9IL 1MFDH 1NCNA 4ZDHA 1U92B 5DD5L 2FJGA 3CX5K 3P0VL 5IHBA 1CLYL 4NWUH 5GSRB 3VH8G 4NZRH 3K2MC 3SO3B 4NQEB 2E7CA 2MCPH 5F89B 5MHSE 3MV8A 1CD1B 3W9EB 3D5OF 4YK4C 4ODHL 2AJZB 5FYKL 4OD1H 2JK5B 5GPRA 5JUEH 1E6JL 4QRPE 4MQXC 2YUWA 4Y4HC 1WISA 4HUXA 1ZGLB 3QUXA 4EN3C 3VI4F 5DJ8B 4PV8A 2HVKB 4PJGB 4PJ8B 2VITA 3BKYH 5JW4R 4QT5A 5SWZB 1JCKA 2OI9B 4L4TA 1FG9C 3QCVL 1IEBA 4QHKJ 2DBJA 1DBBL 4PDCE 4MB5A 5L2KE 1HINL 3CDCA 4YHMH 2W0KA 5DDHA 4XP1H 4WUUA 2VR5A 1N7ML 1FV1A 4HX1A 1WTGT 4OZIE 3O2VH 1A1NA 3QNXA 5C6PB 1FL5A 2PNDA 3BT2H 1RU9L 4MWFB 1RUAL 2WBJB 3SDAB 2DD8L 1L0QA 1ZVSB 4QXUL 2ARJQ 3RIAF 3QUMA 4ACPA 2IFFH 3KDMA 2XPGB 3CXHK 2XWBA 3H9SE 5C3TA 4ESKA 3GSNA 2XKNA 3L3KA 3MRMB 3LIZL 4GAJH 4ZUVA 1OP3H 1IGJB 5L9DL 3DV6A 12E8H 1HOCB 4ZFZA 1GOFA 5IIEA 3NA9H 2F8OA 2CLVA 2DM3A 2R1YA 1OW0C 1U3HC 3JWOC 4P4KB 1YDPB 2X4PB 3QQ4B 3H3PL 2OP4L 5EPMA 1LO4L 3KPRB 1QO3B 1T66D 4JO2H 2YHGA 4K2UL 4PREA 1R24B 4LQ1A 1UH3A 2VZ1A 5HYQA 1FL6B 4OCSL 5CGTA 4KQ4L 5HD8C 5C6TL 1KTDB 5GGQH 3IGAB 4HIXL 3D0LB 3O4LE 3HI6H 1UJ3A 1A6PA 4P0DA 4KGJA 4NJ9L 1MCKA 3OXRB 4YK4B 5E8DL 1CWVA 2ZCLH 4X80L 2VLKD 4ONFL 1C5CH 3G5YB 4HUWA 5GGSA 3VI4E 4PJAA 4GRLD 3MV8E 4U1HA 4EN3B 3CH8A 4XMKL 2E7BA 1EO8L 3ZE1F 1MCOH 1OD7A 4BUGA 4PJAF 4KZDH 4AMKH 1D5XA 5T3XE 5JO5A 4KMTL 4L4TE 1WJ3A 3E3QC 1ZHBA 1A1MA 2BJML 2A0LC 4JFPA 4XP9L 1KLGA 4C56B 1Q0XL 1QLEH 5HI4C 4HJ0D 1YMMD 4L1HA 4D8PA 5J13B 5MENB 3TBTB 4POUB 2YN3A 4N5ED 3W9DA 4X6BB 1OTSC 4YBQD 2J2ZA 2WP3O 5HGAA 1GH7A 4XCFL 1N0XH 3QZWG 1R3KA 3GSUB 2X42A 3NCFB 3UPCA 1ZTXL 4MD0B 4PV9A 2PXYD 5IEKB 3KPLA 4I4WB 4P2QA 4NUJB 2C3VB 2Q20A 1G6RA 2AXGA 1BOGB 2GSIB 5DD3L 2R8SH 1Z5LB 4QLRA 1EBPA 4QCIA 1BVKA 5DRXA 2BY3A 5EU5B 2ZCHL 3KWWA 4X5XA 4H26A 4P99A 2BDNH 4OLVH 3GI8H 3MRCA 3RI5K 4P23C 4H0GA 2BY2A 1FVDB 3FN0H 4PRBB 4LPXA 5L2KB 1NC2A 4P46B 5LBSH 2DIAA 4NP4H 1NMBL 3LKSA 1KNOB 2EDWA 4L8DB 2DB8A 3G9AB 4P2CG 5C2BH 1KSRA 4LRNL 1B9ZA 3VXNA 5BO1H 2WP3T 5HJ3A 5C07B 1PZ5B 3QEHB 2A9NL 1H3VA 1RURL 2WY3A 2G75A 2AQ1A 2A6IA 4RNRA 5CJ8A 5BVJB 1YEHH 3CDFA 2BFVH 3ZE1E 4H8WL 2GQHA 1X7QA 2Y5TA 2YPKA 4PJAE 3H9SB 4WDIA 3G9VA 5GZOD 5EOCJ 5JQ6H 4U2YA 3D85D 4Y2DD 4NKMB 4WFHD 5IBUB 1FGVH 4XP4L 3TN0C 1JGVL 2ZOKA 5E95B 2BNUA 1B0WA 3QPQD 5HGDB 2KPNA 2JB5L 4PP1C 4G9FD 1UWEH 3QDJD 4JY4B 1RHFA 2WIMA 4HIHA 4XB8A 4JHBA 3IJSA 4P2RA 4WNQB 3BDBA 1QR1B 2I5YL 5BZDB 3M17B 4AJ0A 5EU7E 4J4PA 5DS8B 5F72S 5CD5C 3JBG7 3VFPB 4WJ5A 1F4YL 3TO2A 4AIXA 1FG2A 3Q3GB 4NC1C 3JWDC 5GGUB 1LQVA 2AI0H 1XGQB 3QDHA 3ILQC 4P2QE 5DJDB 5ALBH 4C83B 3OL2A 3WIFA 2P45B 3U7AA 1ZKAA 5EU6B 4G8FB 2EE6A 4XWGH 5KAQG 2ICEA 4P23B 3MBEA 1KACB 5CCKL 1LK2A 1Q9WA 3MCKB 3E0GA 3IF1B 1G7JA 3MODH 3EGSA 1T21A 1MQKH 1O7SA 4UAOC 1UB6A 2P47B 4KKLC 1AR1D 4NZDA 3RIFF 1CICA 1IGMH 3T2OA 4N0RA 1D5MB 4KGLA 4LGRB 4KROC 3D25B 2D2OA 5FEBA 4HBQA 4LLQA 3D39E 1D5IL 4PB9H 1CBVH 4PP2B 5FV2A 1B6DA 1N5YL 4IRZH 5FA3B 3QFJD 3U7YL 1QNZH 3RWJA 4HSQA 3HUJA 3UTSA 1RZGA 3C60B 3RRQA 3MRQB 3TN0B 2A2QT 4JKMA 2EYTA 4TNVK 2VDNL 3HUJF 4N1CA 5C08B 2BVOA 5I1EL 5EIVA 2C4FU 5SWSA 3QCUL 4MD5A 5CGYC 3BGFC 2APXA 2QR0B 5GSVA 5IOPA 2DJ4A 3W0WD 5FO8A 3OPZL 5KW9L 1BQLL 3MA7B 4NCC1 3QXDB 3RNKA 1HSAB 2CDFA 3CVHL 4UT9H 4F7MB 4XHJD 4NKIL 5E6YA 1MJJA 1OAZH 3QQ3B 4P2RE 5IW6A 2YEZB 1VEPA 1VDGA 1DFBL 1GGCL 4YDJA 3LY6A 2DQDL 3GBLA 1C5BH 5HVWA 4YFDB 5DR5L 3VMOA 5HVFB 5C09A 3EYVA 3IDXH 3WLBB 4RGNB 2V2XB 2Z91A 4YXKL 4HKXB 3ZKND 4OUUB 4F9PC 1T7VA 4CN4A 1CIUA 4X9HA 1T7XA 4YPJA 5J57B 5JW4N 1TJIH 3H6JA 4U33A 1UZ6F 3LHPL 3U36A 4RSVA 3WIHA 4UAOB 3EFFB 2QSCL 1C08B 1X5YA 2VTFA 4QYOB 5E6IC 1TETL 4TQEL 3GJEA 5HYJB 4YPGA 3EYSL 3R06A 3FB7B 4KROB 5CJQH 2XQYK 3PV6A 4XAWL 4ZPTA 1I1AC 5IMKB 1S7XB 3G04B 4JB9H 4MA7H 3C2AL 5AYQA 2CGRH 5F8QC 1I85C 5IJVA 2Y07H 3HCVA 1A3QA 2ESVE 4JRXA 2YZ1A 4JJHA 4YDKH 1JNHB 1PKQA 2UVFA 3WNKA 3IU3B 4J4PC 1OGTB 1W0VA 2HJFB 5HHMB 3OGCB 1QKZL 3REWA 2OLDA 1MCHA 3HC0A 2ADIB 1IBGL 4MSWA 3HUJE 3UTSE 1J9CT 3AGVA 4FQLH 4FQIL 3UTTB 1QUNA 4W81A 1WCBA 1IGCL 2R0WL 3VCLB 1ETZA 1MCPL 4PGEA 3BGFB 4OV5B 3RL1A 3P9WB 3B2UD 3I6LD 4MJ6B 1ULVA 3BIBX 3OJVC 2C1OB 5D7LB 5KTEH 5SWSE 4MDIB 3MYJB 3HLAA 4YQXH 5DRWB 1XCQB 3L5HA 1R3IL 2DQUL 1XGRA 1I9EA 1RUPH 3DXAD 3RVTD 3UBXB 1CICC 3MLYH 4L9LA 3RA7L 2XZQH 3D39B 3DX7A 4RBPK 4ERSH 4GMSL 1DUYB 4I0PA 5EOCL 2P8MA 3U1SL 1FZJB 1LHZA 4CVXB 1P69B 1LE9A 4EDXB 3EFDH 1WUNT 2I24N 5C09E 1KTLB 4X9GA 4L8SC 1C1EH 3QI9D 2GCYB 1DEEB 1MAML 2HVJA 4Q2ZA 1UZ6E 3U2SA 5I1JH 4X6DA 5ID0B 1A64A 3PJSB 3KR3H 1K2DA 2DJSA 4HFWB 1DQMH 4WFFE 4LVHC 4PG2A 4LLDB 1YQ2A 3ZYZA 5E6IB 1RHHB 5ITBH 5KJRL 4X6DF 1E27A 1DANU 2ATPB 4U3XA 5CEZH 2VN7A 3TEUA 1NGXA 2E8YA 5FOBA 4Z78A 1T4KA 1I1AB 5TFSH 1XGUB 3O2WL 1OB1A 3MV7D 5DK2A 4MNQB 4I8DA 3VXRB 2DBLL 3MV9A 1CFNA 4JPVL 1YNLL 2XIDA 4U1SB 1U41A 4M8QA 3KPOB 5BOPA 3NCJH 4JRXE 4DK3A 5EN2B 4ZAKD 3QXUA 1A7OH 2Y36L 4QHUA 1G7PB 3C5ZD 4ZD3H 3MRGA 3B9KD 5HGGS 3GJFA 1FE8L 2OMNA 4CU7A 1H15B 4I3SH 4JCMA 4RRPG 4U1NA 3RWEB 1CDHA 1WT5C 2PW1A 2V5SA 5AG8A 4N0CA 4QY8A 4HGWB 4KPHL 4HUNB 1PG7W 4WIQA 5E2VL 4F7PB 1RULL 2OYPA 1ZT4A 1QQDA 3LMJH 4PBVC 4AZ8A 4AH2A 2GK2A 2OJZH 3T2PA 3NABH 3HC4L 4NNXA 1DSFL 1IILE 4FXGB 1F4XL 5DJ0A 1EEYA 3P30H 5BVPH 3MRJB 1G6VK 5IMMA 4FXKB 3V6FA 4JFFB 2ESVB 4KY1H 1YYMH 2X4NB 2I27N 4X98B 1H3WM 1YECH 4P3DA 1AD9B 4L8SB 2R0KH 1A6ZA 1W0YT 3V5KA 3MRKA 4Y2OA 3LZFL 4WHYH 2X89D 3WCYA 5H8DA 1OP3K 3BXNA 3HE6A 4E41E 4QHKI 5LWYH 2APFA 4LVHB 1NFIB 5CINL 4X6DE 3HAEA 2MQCA 5CMAA 5F97E 4DZBA 5J7CC 1S5HB 2AJSH 3QA3A 1N5AB 4HGKC 4JQIL 4MNHB 2FYYB 1SM3L 4LEOB 4YR6B 3X11A 4M7KH 2KUTA 3V8OA 1DCLA 4ZO9A 5I1LA 4JY6A 3WHXB 4V2BA 2I25N 3AM8C 1RIUL 5HHOE 4KFZC 2CQVA 1RJZB 5EBMB 4HDIA 4WTZG 1AGDB 3T0AA 1QBLH 2E6QA 2GY5A 4G8GB 4F57H 1NCWL 4GAGH 4MAUL 1P7QB 1IMHC 3MV9E 1N4XL 1KOAA 3ROLB 1V3LA 2UUDH 4KK8C 4NFCA 5GRWA 1WSST 1NSNH 4ISVA 3D0VA 4I0PC 3NCYP 3AS0A 1F3DH 4JG1H 2P44B 1BBDH 1YMHA 2PCPA 1G7MA 3JTTB 5F7FA 2JF1A 3EKCA 3UXFA 1LP9A 4DN3L 3HS0B 2QKIB 2VLME 5M7QA 3OR7A 4OI9A 3TCXA 3AY4A 5IVXB 1I7ZB 3T1FA 2D7NA 1K8DB 5EA0H 4M00A 3TIDA 1U2HA 3CD4A 3B5TA 5H37G 1TJGH 5DF0A 1LP9F 3QRGH 4Q0XL 4L3AA 3SGKA 4PG2C 2V7HA 1JHTA 5F7KC 4HJJH 4F2MB 3O3AA 4NNPH 3JUYA 3RU8H 4HMDA 1RUQL 4NBZB 2IQ9H 2R15A 2VQ1A 4E41D 1ZHNA 3JV4A 1W72H 5KSAC 4KVCH 1B0GB 4GG8A 1FPTH 4S2SB 3UBXI 3BZDA 2BHUA 1PX4A 1Z3GL 5DQ9B 2N7BA 1RZKC 5BV7C 2ADFH 4AK1A 3CK0L 3L7FB 3SE4C 1LE5A 1FJ1B 3GM8A 3F5WA 2H1PH 3QXVA 2EIBA 1T1YA 4WEBL 4XBGA 1S78D 2H9GA 3G6JA 4PJBB 1T3FB 3RWIA 4ZTOL 2PXYA 1X5JA 5FF6A 3PWVA 5FYJL 2IAMD 3WO3B 2OL3B 5FA4A 4OZFB 3G6JF 1NEUA 1XR9A 5JTWA 4ENEC 3RY6A 3CJJA 3LEYL 2IH3B 2IANB 5ESVA 4LCYB 4Y19A 1WQVT 3VFRB 1QSFB 5T1DL 2DQHL 2A1WH 4GW5B 5GIRA 1RK0B 5D1XC 3DARA 1IAMA 2HA1A 2XV6B 3VFWA 1U8HB 1CGVA 4DCQB 3CZFA 3NN8B 3GBML 1R0AL 3CXDH 3LEXA 1NH6A 3L3JA 5HHNB 3S4SA 5TJWK 1B4JH 5IB2A 1G84A 4V1DA 4MS8D 1B2WL 1LEGB 4PS4H 3MRRB 4OKVB 3D9AH 4R4NC 3H42H 3HE6C 3PWJB 5GJTH 4XCCH 4HGMA 3T1WA 2NR6D 4DFIA 4G6AC 4KKAD 1RIHL 2R1XB 5IV2A 3BMWA 4S10A 2EXWC 1BX2A 4QEGA 3RWFB 1ZA6A 2EKSA 5HHOB 5D6CA 1QA9A 3H0TA 4UOJA 3NBNA 1GAFL 2F53D 4UB0H 5KSAB 1A4KB 6CGTA 4UUJA 5C7XH 3B2VH 4A2LA 5F96L 3VU2A 2MKLC 2OJEA 3GSWB 4OGYH 4ZYKB 1N2RB 5BRZD 1EVTC 3G6AA 5T1KD 3IFPA 1XR8A 3V6BR 5JPNA 1L0XA 2R23A 3DUUB 2HH0H 1J1XL 4O58L 1GXEA 3IS1X 3LEVL 1E28A 1CLZH 4WGWB 4NM8L 4M6MH 4W4OA 3MLWH 2MMXA 5I1DB 1OSZA 3RI5F 4D9LH 1FO0B 1AJ7H 1JZ6A 1A0QH 5F71A 3MXVL 4N8VA 2R4RH 4ZS7L 3PDGA 1DVFD 3NFNA 1A9BA 5GHWH 3G6JE 1OTUC 4M5YL 4PJ9D 4M03A 2HFTA 1LVEA 3O9WA 3DNKA 3WYRA 1UCBL 4KUZH 4G42B 1WBXB 3NACL 1ED3B 4HG4J 2R0LL 3CFJB 4ZUUA 2KKQA 2QL1A 4H1LA 3MUGA 4XGZB 5HY9A 1U9KA 4Y19E 4YUEH 1BFVL 4J8RA 5D1XB 2MTPA 3VXQB 4M9OA 1SEBB 3P0GB 4RGOL 2PO6A 5JDJA 3QULA 4LHUG 1NCDL 3BGMB 3BZ4A 4KDWA 3TCLB 3ZKMD 1PJ9A 4XPAH 4YHPA 3LN5B 1G7LB 4XXCC 4XT1C 5IK3B 1ZLSL 4K9EH 3TA3A 2OSLA 4JHAH 5C0CB 4V1DE 4TPRH 2FH8A 4QRQA 1CFSB 5JOFA 3QSKB 3ALXA 1CFTA 3IXTB 4G8IB 4UNTA 1EUUA 2AJYH 1INDL 2VDML 3QFJA 2Z8VC 1KIQA 3KXFD 2D03L 1EZVY 2CKBL 2HJLB 3BEWA 1U8MA 1WK0A 4X5WB 4NZTH 4I1NB 3U0WH 2EEBA 1S5IL 4DVRH 4FG6C 1E4XI 3PXJA 4M43L 3MRFB 3GRWA 5A16A 2MPAL 2B2XL 4ORGA 2CRZA 4IRJD 3CDGB 4GRWF 1AKJA 1KENL 4GRWH 3MLVH 3VDCA 1I1CA 3BZFB 3D3VA 4LAJH 2VERN 4X7FC 1T89C 5ISZB 5JLZA 1A47A 2XA3A 2QQKL 1OARH 2V9QA 1U3JA 3KYKL 4CVZA 3QIUD 5KZCD 1WZKA 1TZIB 5F3BB 3HZYB 2H8PB 1EHAA 2DTMH 4QWWC 4OGAD 4ZFFB 3FT4B 4RA0C 1T6WA 1DP0A 1IKFL 1SBSH 1UZ8B 1U42A 4ODXB 3WSQL 1EO7A 5FECA 3WS6C 1KGCD 4Z76B 5HDQH 3FRPG 1AR2A 1AXTH 4M4RA 5B38A 3JTSB 5GS1B 1LEIB 4NHUE 4FABL 3MO1B 4LLWA 3OAYK 4F33B 3LRGA 1P9MA 3BGAA 1BP3B 3CFDB 1SMAA 4OF8A 4UDUB 1K8IB 2YSSB 5I30H 1CXLA 5JOPD 4ETQA 5FUZH 4YHKL 2ZNWA 3EAKA 5F3HA 4NZJA 4HC1A 4W4OC 5HGBA 3P77A 5E1AA 3FO0H 1TVDA 5C0BD 4NQCB 5L88H 4BM7A 1IAIL 25C8L 3WEXA 3HHRB 4I5BB 1TNNA 2IEPA 3U0PB 3DUSA 2BC4B 1I1YA 1AE6L 2NTFA 2D7MA 3C6SB 5J3HC 2ZJSL 3JV6B 1M6OB 3GHEL 3TZVA 3TBVA 1BEYL 1RZ7L 3BESR 5D93B 4JKKA 1T2QH 4FMFA 1JP5A 1PG7H 1XCTB 4QOKE 2FATH 3UYPA 4GKZB 4NQVB 3H9YA 3FFDB 4M61A 1ZT7B 1QFWL 1KC5H 1RZ8A 3SCMC 4X7DC 3LB6D 4GS7B 3FN9A 3RKDD 1SY6L 3V0WH 2VYRE 5EBWB 5E8OB 2LTQC 4EUPA 3T0EA 2H6PA 1CTOA 3OGOE 1OTTC 5I71C 3PGDB 3UAJD 3D3VE 4G6FD 3WUWA 5GRJH 1ZHKB 4G59A 1JFQL 3PWPA 4EUPH 3VFSA 4JKPH 3V4PH 5GXBB 2AP2A 1Q9KA 3GMOB 3LKRA 3EDEA 3TA3C 4S1QH 4ZO8A 4KUCF 1HIMH 4LARH 4WO4A 3UCRA 1GC1C 4J3WA 4OCLC 5H94A 4P59H 4Y4KD 4AEHH 2ED8A 1MWAA 3MJ6A 1BBJB 4UBDC 5D7SL 3ULSA 4KI1A 2AV7B 2ZUVA 3BFOA 3L95B 4HKJB 2OR9H 4YFEA 3K2UH 2QADD 4M62L 3BP5A 5D70L 2XOTA 3SE8L 5JDSB 4RA3A 3OZ9H 1Z9OA 1KTKE 1YYLH 3MRLA 4RWYL 1J11A 5DLMH 1MHEB 8CGTA 3BW9A 5C0IA 1U58B 2CKNA 3DGCR 1FNFA 2E6JA 1FYTD 1G7QB 3KLSA 4RFNC 2F5BL 1A7NH 3V5HA 3BH8B 5EIIB 1UYWL 2VH5L 2X4SB 1JPFB 5KS9B 2X1OA 5F7HA 2H26A 2XRAH 4EI5A 4ZUWB 2WWMD 1SVZA 2G60L 1V7ML 1QBAA 3QXAA 1DN0A 3WFEL 3SGDH 1UXWB 5ACZB 4XZUA 3P40A 4MQ7B 3B6SA 2FRGP 3T4AA 3SDCC 3VMNA 1CFVL 1I4FA 1ONQA 3RTQD 1FQ9C 3PQYD 1OAQH 5AYUL 4Z7VA 3N50A 3SCMB 4KK6C 2CK0H 3EJZC 2BSRA 4S0SD 5K9OA 5SWQB 1U8QA 4JQVA 4NHUB 2LTQB 1FNGB 1MI5D 1IQDB 3IETB 4OZHB 4Z7VF 1Q9LB 4RMTA 1XF3B 5I71B 1KEGH 5HHXH 2R9HC 1YN7B 5TF1L 2BVTA 3MGTA 4RISL 3T0EE 3RPKA 3M1BA 4L8CB 4IOIA 2ZSVA 2XY1A 4LKCB 5E5RB 3PE9A 1BZ9A 3RPIB 3LQZB 4NCC2 2IBZY 3VXTA 3PWPE 2D4DA 4Z8FH 4JO3H 4CU8A 5LAXB 4O02H 4HUMB 5E99H 1NBZA 1HKLL 5IGXH 3W2DH 4YHZL 1GGIH 4LAQH 3IDMB 3U46B 4KJQC 3P4MB 4P5KA 3VFVB 3D2UB 4QOKB 5FGRA 3K1KC 3N85L 2HAZA 1IL1B 3RUGE 2AK4A 3ZDZF 1JZ2A 3FQWB 5ESAB 3HC3H 2LU7A 4XMPL 5CSBA 4HV8A 5F7UA 1A7BA 1FAIL 2UUDK 3BZEB 2VZOA 3HFMH 3VFOB 3KPPB 4WWKC 2ZG1A 4W4NA 2QTEA 2VRAA 1MIML 2H32H 2HT4C 2Z0BA 3Q1SL 5DEZA 3ZMRA 4LASL 4NUGL 2X1WL 4CJ1A 1FH5L 4DKEL 1CGWA 2VE6B 1MLCB 3T0EC 4DWHA 4MZ3A 4LLVA 4XWOC 2GSGB 3K1DA 1KJ3L 2YZ8A 1JGEA 3S5LG 4MA3A 3KPQB 4QTIH 3WIIL 2E27L 3LVEA 3MRBB 2AEQL 3BVNA 5LKNA 4Q6YA 4Y1AA 3QHZL 4FQQB 5A2FA 3E6HB 3SDCB 3X3FL 4WO4C 2CDEB 2NCMA 1FFNA 3VFTB 4NYLA 3IDYC 1XF5B 3NZHH 4ODUA 2ARJB 2C3WA 4Z7VE 43C9A 3SE3A 3Q6FA 3L3IA 2QBWA 3TT3L 4FTVA 5E9DD 4X6CB 1OCWL 5GISL 4YXLL 5TE6L 3C6LB 5IB1B 4GSDH 1PYWB 1JGLH 3SGJA 3MJ7A 1CN4A 2JCCB 1L9NA 3CAFA 3JWOL 5F8RC 3ARGC 5FO7B 3T0WA 1PZUB 5JPMA 1I7TB 4P57B 3I3DA 1QHOA 2VUOA 3VWJD 5JW5B 1T04B 3CFBA 1HI6A 5I74C 4KI5D 4HWUA 3JVGA 3JWNC 4KJYB 1U93A 3O81A 3QDGE 4IMLA 4PRPA 3MRNB 5DWUH 1ZS8B 1ORQA 4EI5C 1IM9D 2CLZA 3ZDZE 4J3XA 4Y16C 1JWUB 1QSZA 1F4AA 3CMOH 1BFOA 5DJZA 5KANG 2DQGH 2AK4E 1CZ8H 3G6DL 1MEXH 4WWKB 1IKNA 2XT1B 4OLYL 5MERA 5CILH 4PJDE 2XG5A 2AW2A 5BJTA 4EJ1C 3RNQB 2IAMA 5A3ID 4MXWH 4JPIA 4PB0L 1GHFL 3BRGC 4Q97A 2YA2A 1JZ3A 4FQXA 4HKBB 5GS0L 3QO0A 3O41A 4EVNA 4DK6A 4S1RL 1KCUH 2AEPH 2FNBA 2VC2L 4MHHI 5JA8B 4HUVB 4KZEL 1M7IA 1U8JA 1EFXD 5SV4A 4ZFOA 2P43B 4CVWA 1HHHB 2BCKB 3EJYC 3LN9A 3O45A 3QO1A 2Q87A 3KLAB 4I9WE 4Y1AE 5CEYB 1U91B 3RDTA 3QEGH 4V2CB 1T7ZA 2FX7H 5DMGC 4WHTA 2X6MA 1BIIB 3FQNA 2OZ4H 4XPTH 4OD1L 3RUGB 4XVJH 2ZZUT 5TDNB 1Y6MR 1FYHB 3QFDB 4XAKD 1HQRB 4JZJC 1OPGH 3BKYL 2F8XC 5E2JA 4FTVE 1JF6A 3O11B 4NFBA 4P9MH 3ARGB 4TSBL 4XI5D 2HTKD 3TH2T 4ELKA 1AIFB 5T3XL 2F53A 4NRYB 4YHML 1OOAA 2A73A 1HILA 2G2RB 3GIZH 4QRRE 1FNEB 3O2VL 4NGHH 3BT2L 3GKWL 5DD0L 4JFED 4MJ5B 4Y16B 3LS5H 4XCEA 5FFLA 5D7JB 4PRPE 4OFYA 4HBCH 1QFHA 2HMIC 1QFOA 4XVUD 1RI8A 3S3PA 4X6FB 3L3DA 4OB5L 2W9DL 3UO1L 5KVDH 2Q76A 5KG9B 2VLJB 1Q0YH 2IFFL 3WL9A 2LVEA 4EEEA 1NGQL 3GIVA 1BM3L 2I60L 4LF3A 4XP5L 1DLHA 1KTRL 1YY8B 4B50A 4YE4L 2D3VA 3A0OA 3UBXG 3QUML 4WI3A 2WZPD 3R1GH 4WFGE 2ZKHL 5JR1L 3GSNL 5CEXB 1J1OH 2GUOA 4RAVA 4M1GH 4MJID 3ES6B 2OTUA 4E9LA 5KSVB 5LXGH 4OQ1A 1UM6L 1BQUA 4AEIL 4UIMA 3DVNA 5EZOH 4PRIA 3DUHA 2OTWA 2WLZA 3SKMB 2IADA 1KYOJ 3LOWA 5HYSA 3OAZK 1SYVA 4UNUA 5DSCA 3RFZC 1EAPB 3IB4A 1C5DB 3QDGB 1A7PH 1ZLVH 1YNKL 3P4NA 1YNTB 1NGWB 3NFPB 2D31B 3ZDXF 3V7MA 1S9XA 3JVGC 4WU7A 1AP2B 1BD2D 5BS0D 1S7VB 2VL5B 4J23A 1GOGA 1N59A 1D6EA 2FJFA 5CLTA 1CXFA 3O2DA 2Z31C 4WWID 4U7KA 3UJJL 1U8OA 3L5WB 4JZJB 1EGJA 4G7YH 3SQOH 3LKQA 2R56H 4W6XB 4JZNA 5TPWH 4HEPG 4NO0A 2VXUH 3NTCL 4PJDB 2AV1B 4CW1B 1T22A 4Y5VB 4BSWB 2OBGA 3GBNL 1EGJH 2R2BA 1KXQE 3P4LA 1NC4A 5CSGA 3IDGB 3GSOB 3L3GA 5E24E 2A9MH 2YPLA 2EIEA 1D9KA 4JVWA 3UTQA 1XF4A 3V8CA 2P5EA 5JNYA 2R69H 1KJMB 3O3BB 2GYSA 3ULVF 3RX7A 4WUUB 4K3EH 4MD4A 3RAJL 1UWGL 4CU6A 4Z7NF 1NFDB 4E5XA 1A2YA 2P46B 5D5MB 2CO7B 5FHBL 4XNXH 4XRCA 4UDTA 1DBML 1G0XA 5E6ZA 4EDWH 5DFVC 2IC2A 3MCLH 4DVBB 3I75B 2R8SL 2DQCH 1JYNA 3ZSSA 4D0CB 3NAAH 1QEWB 4R7DB 2AGJH 1VESA 1NCCH 1WWCA 2B4CL 3DJ9A 3JV5A 1G6RL 1NCBL 4XX1G 3V4VH 4OLVL 3GI8L 5C0AA 1UKTA 3GMNA 4LLUB 5F1NB 3P9MB 3EOAA 3L3KB 1YA5A 5EDXA 4LNRA 3MA9H 1KJ2A 1AHWA 5D2LB 3OKEB 5FHAL 2EDEA 1VHPA 1RFDH 4QRRB 3TC9A 4QHLA 5IKCB 4F3FB 4PRIE 3K74B 4C59B 4LDEB 2Y1VA 3ZDXE 4N8CL 2F19H 5DYOA 5DJ6B 3W81A 5DXWA 1JTOA 2EDNA 4QRUA 2WIIB 3QDMB 3B9VA 2XWJA 3OKYA 1MF2H 2DYPB 1A3LL 4JFDB 2Z31B 4WTWA 2ZP0T 5C0EA 5HYFA 4PFEA 4O2EB 4KRLB 1OY3B 1YEHL 1IGYA 2BFVL 5EC1B 2F54B 4GQ9H 4C4KT 1IC1A 2VZ3A 4L3CB 4LHJB 5K93A 2I9TB 1VENA 1F02I 1EXUB 4GT7A 4J3TA 4Q9RH 4PRNA 3QH3A 3CVIH 4O2CA 2N4IA 3QUZD 2ZWLT 4ODSH 3HPLB 4P4RA 1FZMB 2A6JB 1CK0H 1ZHLA 4MX7B 4G9DB 4R2GC 1S7RB 1PEWA 5D7IA 5B4MC 5KOVC 1NANI 5K9JH 4HWBA 4GRMA 4F7CA 5C70A 1R6VA 4XP6L 3ULVE 3FRUB 1ZA3B 5DK0A 5MEOA 5D7IF 4Z7NE 2YPLE 4YBHA 1R5VB 2P5EE 3WXVH 4HPYH 4ONGH 5D7KE 1L8JA 2O26U 3HNSL 1MCQA 2GAZA 3Q5TA 1FRGL 1RIVH 2YD4A 3KYMA 3D18A 1FZKB 4OAWA 1TVHB 1MRDL 3DRTA 3ZSTA 1J18A 4APQC 4J6RH 5HBBA 5DTFB 2VDLH 1I1FA 3BE1H 3TF7A 4MQTB 4GXVH 5C0AE 4MYWB 3I3BA 4Q6IC 2PW2A 1MQKL 4M6NH 1U95A 3LSOB 2ENYA 3WV0A 4OF7A 1X6LA 4X4ZA 1SEQH 4TRPH 1MJ8L 4YIQA 4YDIH 2Q86A 3BYYA 2V5TA 4JRYD 5J11C 1GPOH 5IFHL 5HDLA 2YRLA 3GSVA 4QRTA 4GKSA 4U3CA 5HYIA 3QIWA 5DD6A 3UDWC 1QPPA 3VXMB 2W0FA 4TULH 2B0SL 3IU4H 1I9IH 3DX6B 5DD5H 1D9KC 1ORSA 3QEUA 3P0VH 1IZJA 1CLYH 2D0HA 1F00I 2Y7QB 1QRNA 1XH3A 4URTB 4ODHH 5FYKH 2EDRA 1E6JH 1H5BA 4F9LA 4R26L 5C3LD 2C3HA 5AZ2L 4BFIA 4PD4K 3IDJB 4JFOB 3X12A 3ARPA 4P5MA 3MLTB 5IJKC 4I48A 3VD5A 1XGYL 1DBBH 2CRMA 2JIXB 1AGFB 1I3RA 2BNQD 3GI9L 1HINH 5D7IE 1AHWC 4HWZA 5TQ2L 3BYTA 5FIEA 4HH8A 3SJVB 3PHOB 3OSKA 1WGOA 4LVEA 3FJTA 2NX5D 3FQUB 4PJ7B 1MI5A 1P4LB 1RPQA 1X5FA 4NNYB 4XPGL 1N7MH 1FCCA 2FBOJ 5MEPA 2ED7A 3VFUB 1HXMB 4RDQG 1MHHA 1KN4L 2ZUYA 3OTTA 5JORB 2H2SC 5JIPA 3WLWD 1S7WB 5DURB 4ZO7A 1INQA 1RU9H 2Z93A 3FZUD 1YEFL 2QQQA 4FNLL 2HP4A 3H9ZA 2DD8H 1IM3A 2V7NA 1QBBA 2HTLD 4X99A 5JZ7D 3FO9A 3WFZA 4APQB 4NJAL 1G7HA 3CPLA 4QXUH 1NAMA 3T8XB 1P5VA 2XWTA 2VABA 4CN1A 4JLRB 4YO0B 3RY5A 4Q6IB 5L9DH 5FDWA 4O51B 4LOUD 5FUCE 4EBQL 1F3DJ 1G9MC 1U8IB 5F88A 4XC3L 3G08B 2UYLA 3EO9L 1LDPL 5E70A 4LBEA 4OCRL 4R96A 3WN5A 5J11B 1LO4H 1BZ7B 1OM3L 3WIHL 3CCHB 4AG4L 4K2UH 4YEFA 4MXVF 1OP5H 1UB6B 4JB9L 2AJXH 2V2WA 4KQ4H 2CGRL 2C3XA 3L3OA 4HIXH 5CLWA 4KJPD 4YDKL 4LP5A 1KJVA 1J0YA 4LCCA 4EOWL 4NJ9H 5E8DH 4QF1B 4ONFH 1QRNE 5IP4A 4M7ZC 2PYFB 1CFQA 4LSPL 4ALAL 1J86A 2YD8A 4OFVA 4XBPA 4Z7OF 1UACL 3SKNB 4NHCL 5T3ZD 4PG9B 2P8PA 1WFTA 3S36X 1EO8H 2GJ6B 4GAYB 3VJ6A 3ERYA 1NBVL 5DUPL 2XZZA 4L4JA 4XNZC 5FUCC 1X5LA 4ORZC 2BJMH 2XTJC 5ETUB 2QHLA 1T5XA 4XP9H 2EC9T 1Q0XH 3ILPB 1A21A 5C0JA 3FB8B 1RUPL 5DHVA 2D7PA 4E0RA 4UQ2A 4DOHE 3WD5H 2P5WB 3TV3L 2IALB 3MRIB 3QIWC 1GZQA 3RWHA 4XCFH 1YEJH 3ARDD 3RVUC 3CUPA 1MUJB 4KK5D 3KHQA 1XGPA 2YXFA 5I1JL 5DD3H 4D9RE 2YBRA 4OGXL 5J6HA 3REVB 3OJDA 2HRPL 2ZCHH 3P4OB 4R4BA 1DN2A 3KVQA 1H5BC 5ITBL 1IM9A 4F9LC 1DE4A 3U9UB 2LAAA 4OLWL 3TFKC 3CH1B 4MXVE 1RK1B 4AM0B 3ZYOA 2YKLL 3OKNB 2XN9D 1FL3A 1NMBH 3L5XH 1ERNA 4G80B 2QEJA 3FOLA 3E6FA 3G5XB 4LRNH 4ZPVB 2VQTA 2ICES 2L7JA 5AUMA 1A1OA 3O6ML 8FABA 1S3KL 2NW2A 4D9QD 1EO5A 4LK4A 3UTOA 2A9NH 1FGNL 3U0TB 3GUTB 3BP4A 4FZEL 5F70A 2FO4B 4K8RC 4X7TA 1P84J 4Z7OE 4MGXA 1E4WH 3VXPA 1JHLL 3KPSB 4H8WH 3BEVA 1AGEA 1T2JA 1SYSA 1TZGL 5J4MA 1HEZA 1UVQB 2LV4A 4XNZB 4POYA 2CIKA 1I1RA 4POZD 1F58H 5F7YC 2XTJB 4D2NA 2CUHA 3VXOA 5DQJA 1NGZA 5F93C 4P2OD 5J1TC 4JN2A 4K7PX 3L6FB 4Z7WA 4LCUA 3BAEL 3WN5C 1UH2A 3HG1A 3P30L 5D9SB 2I5YH 5LVEA 5FM4A 4HULB 2EH7L 3KYOB 3L5JA 3QB7C 4MCYA 4TYUA 4Z7WF 1MCJA 1YECL 32C2A 3UYRH 1UQSB 4Q7DA 4DJMA 1F4YH 2Z35A 2NQCA 1OGAB 3AAZB 4LCCC 1W2KT 3MBXL 2DMBA 3VFNA 4NKDB 2EECA 4FHBD 3DBXB 4MQSB 1MJ7L 5DD1L 3EYOA 5F6HJ 1ZSDB 3DTXA 4L29A 4KMLB 4PJCA 3HI1B 1EFQA 1S9WA 5CCKH 1QR4A 2XG4A 4WW1B 3VGGA 3FO1A 4LPTA 4DGVL 2R1WA 5ICZA 4PJCF 5EO0B 1EEZA 4NRXB 4LLMB 3SBWA 3UTZA 1ADQA 4MMZC 4GBXD 1J8HD 4WENB 1YPZA 5E8PA 1ZLVK 1FHGA 3DROB 1CD9B 2XFXB 4PJEA 4KQ3L 5HPMA 2XICA 4F57L 5DVOA 4HWNA 3OXSA 1YPZF 1D5IH 2ZSWB 3HB3D 3LQAC 4J12A 5DMKB 1R3HB 4DGYL 4PJEF 2P24B 1PFCA 4I2XA 3SDDD 3VWKA 3DO7A 3E2HA 3U7YH 1JRHL 1Q9OA 3MLUL 5TDOB 4JG1L 4LRIC 1BBDL 3MRDA 5L0QB 3NIGF 4HJGA 3V6OA 3FT2A 1S7UA 1S8DB 5C0FB 1R3JA 1WWBX 4NQDD 3DOSA 3EHBD 4OD2B 1QHPA 1QLFB 2VDNH 3F6LA 1N64L 1F3JB 3OR6A 3VXUD 4AT6A 5LGKA 5I1EH 3OX8A 4JCLA 4BQ6A 3BN9C 3QIBC 4HJJL 3TBWA 3RU8L 5DUML 3QNZB 5KW9H 3OPZH 4MHHG 1BQLH 1KXVC 4R6UA 35C8L 2FHBA 3CVHH 4Z7WE 2CUIA 1UXSA 2HFEA 3HG1E 4KVCL 1UB5A 4GRLC 3I6KA 2FIKB 1DFBH 4H0IA 1GGCH 1JVKA 2DQDH 1CU4L 5I75C 3TNMA 5I8CA 5DR5H 1EV2E 5IMMB 5F9WC 3PABB 3GB7A 2CXGA 4JM2C 1A6VH 3UJIL 1XAUA 3BP6A 2YC1B 4RIRA 4RZCA 3ARED 4BA8A 5CP3A 1XGTB 2VOTA 4YXKH 3BO8B 4CUCA 5A2LH 5JA9A 1XF2B 3BWUC 3VH8B 1BOYA 4DW2H 5IFJA 3PWNB 4ZUTA 1PW3A 4HK0A 3KS0J 3UPRA 1J0JA 2QSCH 4D0DA 1TETH 4TQEH 4I3GA 5JXAH 4XVTL 4S1DD 3EYSH 1NUGA 5CS7A 1R3LA 4TUJB 5FKAA 1G7IA 2MHAA 1MSPA 1YPZE 2OQJB 3H3BC 3F7YB 4XAWH 4DAGL 5JHDA 1MHCA 4PJEE 2Y4SA 5GRYA 1IRAY 2KH2B 2Q1EA 3C2AH 3TBYB 5KAQF 3R8BB 2AJVH 4GQPH 4LSRL 3FFCE 2X05A 1KB5H 4P5TD 3NIGE 1OHQA 3HZVB 4OBRA 43CAB 3C8DA 3NZ8B 4I2XE 5J12C 1QKZH 2QV2A 5FM5O 5CFHA 2VLLB 1JZ8A 2IPUG 3AU1B 1IBGH 2A6DA 3V6OE 4U6VL 3LN4B 1Z6JT 1QSED 4OQTH 3ZLQC 1YEGH 5I1HL 1RMFL 3AXLA 3HR5A 5ERWB 2R0WH 4DTGL 4MB3A 1DTUA 3RZCD 3QIBB 5FYLD 4RMSA 1CDIA 2RQ8A 4BK4A 4MAYC 2I9LA 5BZWA 4JQXA 4HIJB 3DMMA 1FORH 2IH1A 2VLKB 3QUYD 5EU4B 3SBWC 1W72B 1R3IH 4GRLB 5C7XL 1HCFX 1J12A 2IQAB 1TMCA 1RUML 4WI4A 3RA7H 4XXDB 4GMSH 1ZANL 5EOCH 5I75B 1CF8L 5F9WB 3U1SH 3S8WA 2FECI 2ZNXA 1CR9L 4JM2B 4Y2DC 2DJUA 1Q94A 3TVMA 4HT1H 4TSCH 1X4YA 5EBLA 3L7EB 1IC7H 2GITA 2BP3A 3E2HC 3MROB 1JUFB 1NKRA 1MAMH 1R5WB 1YMMB 3DV4B 4FN0A 5J56B 4OF3A 3OKOB 3STLB 3TJHA 2YS4A 5FKPA 4NOBA 2VKWA 2IBBA 4QRSB 5SWZD 4GUPA 2VZTA 5KJRH 4HIEA 1M4KA 1RZFL 1JF5A 3O3EB 2QLVB 1BFSA 5GGSY 3TPUA 4JDZA 2EDKA 5H2BA 2R0ZL 3MNZA 1CL7L 3O2WH 4B5EA 2HWZL 4YUEL 1XR9B 5ESQB 5JHDE 2W0LA 2Q7NA 3SY0B 2DBLH 4JPVH 5L7XL 1FLTX 2R4SL 2Q8AL 1S7TA 5D1ZA 3SDAD 2MJWA 2Y36H 3MGOA 1NGYB 1U8NA 3MMEA 4DEPC 4QGYA 1FE8H 4YH6A 3SDXA 3H7BB 5IVZB 4K9EC 5T1LA 2XYCA 1J0HA 1A8JH 1JPGB 3SDXF 3QZWB 5F7DB 2YWZA 4MAYB 3V9FA 3MJGX 1N3NA 1MCCA 4PRHD 5E2VH 4CNIA 1RULH 5IHLB 3T0BA 2Y25A 3C2SA 5LGJA 3LD8B 4YFLF 3GMRA 3VGAC 4L9DA 1FFOA 4JREC 2VNCA 2AEIT 1DSFH 3EYQC 4JFYB 1NDMB 3V2AR 3DGGA 1F4XH 1Y6NR 2VB5A 1F2QA 3SKJL 3S7GA 4D3CL 3FFCB 1ZGLM 3D85B 2Q7YB 4Y2DB 3STZA 3GRWL 1P7KA 1X4ZA 1SJEA 3OKKB 2Y72A 1EUTA 1KPVA 5DJCB 2VLRD 5F9OL 3EO1B 3LZFH 2GFBA 3ZHDA 2OK0H 4MQXD 4Y4HD 1JK8B 2GTZA 4EN3D 2H3NA 1X5AA 4G9FB 5DVLA 3AROA 1MLBB 3QDJB 5CINH 2NY6D 4R8WL 2FSEA 3QHFH 4YGVB 1FLRL 3HRZA 2VAAB 2IBZX 4JQIH 1SM3H 4LLYB 1OP5K 1CE6B 3KG5A 2E9IA 3TPUE 4G6ML 3BRFA 1JFMA 3ARFA 2VISB 2AS5M 4JQXC 3HZMB 1RIUH 3DMMC 5MEND 4X4YA 3DX9A 5EOTB 4ODWA 5E94B 1NCWH 4ZUUB 4MAUH 1TVBB 5ALCH 3DURB 3ZKNC 1N4XH 3IJHB 4ONHA 2HKFL 1YQVH 2VIRA 5MHSD 1VFBB 3MUZ1 3SDXE 3UZQA 4GG6A 3C5JB 5KSBB 2WV3A 1M71A 4QRPD 5EZJB 2V17L 1RQ5A 4DN3H 1QP1A 3KHOA 2J6EA 2ZG2A 4GG6F 1IAOA 1U3HD 4UU9B 2BNRE 5DQDH 3TJHC 4HC1L 1J88A 3IKCA 3KPNB 3VGAB 3MREA 4Q0XH 4RRPA 4JREB 5DC0A 5L2KD 4D0BB 5F6IB 3OB0H 1EA9C 1Q8MA 1YN6B 1RUQH 5EUOA 2C3GA 3MOAL 4PGDB 5HD8D 1PSKL 4XHQA 4HMEA 4M6AA 2BVYA 1ODAA 3ARQA 3O6FC 3BIKA 1F6AA 5C07D 1FN4B 4BQBA 2GTWB 4IHOA 5EUOF 5E4IA 2A77H 4LCWE 2EH8L 5I0ZA 3O8XD 1WZMA 2HLAB 4WU5B 1Z3GH 3ZE2F 3BIAX 1WBYA 4BSJA 5BQ7B 5HVHC 4I18B 5D6DA 5D1ZC 5HHPB 4R97C 1X5GA 3B2UC 3W0WB 4NT6B 2ILLA 3H9SD 3E8UL 4XCYB 5DMJB 5I76B 1FFPA 3NFSL 2JJVA 4WEBH 3GSQB 3JZ7A 5IW1A 3F8UB 1GVIA 3ARDA 2PTVA 1KLUB 2A0LD 1BF2A 3ALWA 4ZTOH 3CFCL 1DUZB 5I16B 1MVUA 1CD8A 3LEYH 4LIQE 1A6WL 1OP9A 5EUKA 3K3QA 1MWAL 3QJFB 3B8SA 1GZPA 3KNBA 3OZ9L 4IRSC 1OTSD 4KV5F 4XCNB 2QSQA 2GT9A 2Z8WC 3QI9C 3V5DA 2DQHH 3CNKA 5DLML 3O4LD 5DJAA 2AAVA 4UQ3B 4BH7A 3GSXB 1YEIL 1LWRA 2DICA 3GBMH 1R0AH 3CFEA 1FZOA 4QHNA 3MV8D 4GG6E 3MR9A 2PTTB 4EKXA 5EO1B 2IPTL 3X13B 1B2WH 4AIZB 2A83B 1A5FH 2O5YL 3QUXD 3ALPA 2JELL 3PWUA 1JYWA 4NRZB 1A6AA 5T3XD 4L4TD 4CADA 4Y7MA 4MLSA 1UM5L 3MNWB 1RIHH 5BXFB 4NSKB 4XPBL 2EYRB 3IDNA 2NY5H 3B9DA 1TPXC 2NY1C 3H7LA 1GAFH 2CK0L 4ZQKA 5EUOE 3O6FB 3X14A 4DZ8B 3C5ZC 5ID1A 4OI8A 3INUL 4TUKL 5F96H 4RAUA 4AYFA 1XEDA 3ZE2E 4OLZL 1JV5B 3FQTB 2X4OA 2YUVA 2P8LA 4EZMA 5HHXL 4OM1L 5HVHB 5CIPA 2RFXA 3FQRB 1WWWX 3VRJB 4R97B 5C8JB 3LEVH 5J8OA 4NM8H 3GMQB 4YHIB 3HI5L 1MCWM 5EFIA 2MWCA 5C0GB 3MXVH 3TN0D 4ZS7H 3DXAB 3GMPB 4M7LL 5E8NB 4TNWF 3ARBA 5KVFL 4WW2A 2EE2A 3LKPB 3RKPA 5DA4A 4LAQL 4M5YH 5IUSA 5SV3A 2FBJL 3G5ZA 4NKOB 4KV5E 1T5WA 1N0LA 1L7IL 1JF1B 1W0WA 4IRSB 3TO4A 1UCBH 3HC3L 2R0LH 3IJYA 3QI9B 4L3EA 4YHYC 5ICYA 1BFVH 5DRNA 1Y18B 4LCWB 4RGOH 1H8NA 1IGTB 3PGCB 5DJYB 5B39B 4YHNA 4N8PA 1FVCA 4JANA 3PDOB 3ILQD 1VADA 1F90L 1CXHA 5I1CH 4I13B 3F6IA 1HXYA 1ZLSH 1XIWC 2Z8SA 3BH9A 1K5NA 5IB5B 3MV7B 1TCRB 1NGPL 3PWLA 4RMUA 4TUOA 1DQJB 4MVBC 3MLZH 1ES0A 3Q2CA 5KN5A 1TTUA 2R29L 1INDH 2VDMH 4HIIA 1TPXB 1BWWA 2CKBH 2WWKT 3BHBB 4UIKL 3PP3K 2WUCH 1T1WA 1IFHL 4ZAKB 3C5ZB 4KROD 5CSZA 3B9KB 2FJHA 1S5IH 5L8KB 5I8KH 3H2WA 3A6BL 2MPAH 2B2XH 4XPHH 4EI6A 5C0DB 2NW3B 3T3MF 3V52L 1KIPB 2AQ3A 4GSDL 5HI3C 1T1XA 1KENH 3HE7C 2XA8L 4PY7B 5I8EB 4R90L 3QJHA 4HS6B 3I50L 4KHTL 5HGHA 5I2IB 3RHWK 1RJLA 4P2QD 3UMTA 4ELMB 2QQKH 3WHE0 2VDPL 3LKNB 1C7TA 3KYKH 1MFEH 1YUHB 4JO1L 1I8MB 3MJ8B 5CUSL 1HDMB 5HHVL 3LRSA 1HH6A 3G5VA 1NBYB 4UV4L 3QEQE 3WSQH 4H25B 1FFRA 3TBSB 5IBLC 1NC2D 1P1ZA 1HHKA 2IPKB 3JSSA 3O3DA 3QNYB 2YD2A 4L3EE 2Z4QA 4P3CL 2H32B 3TH4T 4FABH 1LO5B 3D39D 1JTPA 2JLLA 1NLDL 3QG7L 4ZNEA 1HWGB 5TDPB 1SQ2N 1XIWB 1NFKA 1AGCB 4YHKH 1PQZB 3TYFB 2WBWB 2R2EB 1QBML 4CMMA 25C8H 1BHGA 4P5TA 1T03L 5INDA 1AE6H 1BJMA 3T4YA 1TQBC 1S9VB 2ZJSH 3GSRA 3GHEH 3OKLB 4HEME 5EU3B 1A4JA 5IWLA 1BEYH 4ZFOL 3T3ME 2DIJA 4H20H 1I1AD 3B9AA 1UM4H 3CFIC 3EOBB 2BSSA 2G5BA 4ZUSB 3TO4C 4DUWA 1QFWH 4PR5B 5DMYA 4P2RD 3OKDB 4OUOA 5JW4M 1T0MA 3HE7B 4NN7B 2VDQL 3RGHA 3EYFA 4J4PD 4U1MA 1U8LB 3I2CL 1V3MA 3ZYIA 2C1PA 1MNUH 2VXSL 5CHNA 4NQXB 2NR6C 4XVSL 5FYLH 2BSTA 3BQUA 5GRUL 2MFNA 1JFQH 2AJ3A 3RZWA 3VXSE 1FIGL 4KDTC 1F3RB 4E41B 1U92A 2J8UE 2JJUA 1XZ0B 3D69B 4IS6B 1N6QH 5GSRA 1SVCP 2WM0A 2VDOL 3QDAA 4NQEA 2Y6SC 4X6EB 5F89A 2CJUL 2BHZA 1CD1A 3W9EA 5D7SH 5KVDL 2AJZA 3MOQA 2JK5A 3T0DA 4U1GC 1CICD 3ZTJH 1ZGLA 5I1IH 5D70H 2HVKA 3SE8H 3TH3T 4PJGA 4PJ8A 5FCUL 2XKSA 5SWZA 5FGCE 2OI9A 4KWUA 3R1GL 4RWYH 2ESVD 1CDYA 4PJGF 3RWCB 4S0UC 1AXSB 2BSED 5JIKA 3FRPA 4ZNEE 1NL0L 5B21A 4KTDL 2F5BH 5SX5K 4P9HL 4H88L 3OG6B 4E42B 3UTSD 4XNQB 1UYWH 4CVUA 2VH5H 3LDBC 1TITA 2BK8A 3BUYB 2G60H 1TQBB 1V7MH 4NN5C 4OZGF 1T20B 4QHMB 4KU1A 4MWFA 2WBJA 3WFEH 3SDAA 4GW4B 3QEQB 5E7FA 3SGDI 5HDBF 1ZVSA 4Z0XB 3MX0A 4X8XA 5SWSD 3ZT6A 4KRNA 4ZOEA 5A2KH 1CFVH 2WK2A 4O9HL 5AYUH 2XPGA 4GO6B 5J1AB 3ZKMC 1ND0B 5TPWL 3MRMA 3QT2A 4J3UA 1F4WL 7CGTA 1IGJA 1HOCA 2HFFB 1QPXA 3O2DL 1EGJL 3LKOB 1RSFA 2ADJB 1P7QD 4P4KA 4X5LA 2V2TB 1Q72L 1YDPA 2BERA 2X4PA 3DETC 3QQ4A 4A6YH 2FEEL 3KPRA 4FZ8L 1QO3A 5KVMC 2WINB 3ZL4L 1R24A 2DQIL 2X4UB 1FL6A 3MUHL 2QQLH 5IVNA 1KTDA 5ENWB 3IGAA 3AC0A 1YEKH 3D0LA 3ULVL 3TNNB 4G8EB 2XNAB 5ADPL 1CIDA 4WFFD 2EIZB 1I8IB 2X10A 5DRZB 3OXRA 5BRZB 3BOVA 5T1KB 1HKLH 3KPTA 5HTSA 1CCZA 4NQEE 4XNXL 3G5YA 4YXHL 4K3JL 4EN3A 3N85H 1VPOL 4J3VA 1F42A 1AQKH 4HW6A 1NCCL 1CVRA 1S7QA 3LPGA 2EC8A 1FAIH 5CWSB 1D6VH 3EDKA 4PJGE 5GRVL 1K4DB 4K71C 1DVFB 1MIMH 3Q1SH 1X9QA 4AL8L 1OT1A 4JRXD 5MEQB 4LASH 4C56A 1O7VA 4PJ9B 4DKEH 2DDQL 2FDBP 3K46A 3L3HB 1S7SB 4Z18A 2UY7A 5SX4I 1KJ2L 2MSPA 5MENA 4OZGE 3TBTA 3VXSB 2DLIA 1II4E 1KCVH 4NN5B 2J8UB 2F19L 2N56A 4X6BA 2W9EH 3V95A 5L2JB 2E27H 3DVNB 4F7EB 1RD6A 5EO9B 5HDBE 4PRDB 3GSUA 4AEFA 3QHZH 5EBGA 2Z92B 1BJ1J 4MD0A 1B88A 5IEKA 4I4WA 4NUJA 1P2CB 2C3VA 4X7SL 3SO3C 1BOGA 2GSIA 5D71H 4LVNB 4Q9RL 1HKFA 1Z5LA 4HCRA 1XT5A 1MRFL 4UTBL 5EU5A 3TT3H 4ODSL 4PBXA 4O2FB 1LNUB 1OCWH 5E2WH 4YXLH 1KCLA 3T2QA 1CK0L 4I0PD 1FVDA 1WITA 4PRBA 2ZOLB 4PJXB 5L2KA 4P46A 1G9ML 2H45A 3KXFB 5K9JL 3JWOH 3Q0HA 1KNOA 3I02B 3KPRE 4RCAA 4L8DA 1GGBH 1CDJA 3CC5B 4L5FL 1I7RB 1VGKB 3F12B 5C07A 4HWBL 4LHUB 1PZ5A 3QEHA 2HFGL 5E5MB 4QKXB 1K4CB 4WI5A 5DMIL 5TQ0H 2WLYA 4IRJB 1I7UB 3LB6C 3RKDC 5BVJA 2WBJC 3K8KA 5FYKE 4M5ZH 4M3KB 2C7UB 3H9SA 2X9YA 5HHOD 1FNHA 1EPFA 2JE8A 1Z9SA 4IMKC 1ZEAH 3DVGB 4NKMA 5FV1L 3E3QA 4OLYH 2VDLL 3BE1L 2CD0A 3QIUB 1HYSC 5KZCB 4JDVB 4PB0H 3T65B 1GHFH 2FX8L 3CMGA 2RCSL 5HGDA 5GS0H 4F15C 4C56E 5D96C 5F9JB 4WHYG 4JY4A 2FHCA 4Y4KC 4S1RH 4ONOA 3HNVL 4WNQA 2VC2H 4YDVB 5BZDA 1QR1A 1PEZA 1D5BB 2AXJA 3M17A 2VLMD 4N0CD 4KZEH 3ARYA 5DS8A 4IDLA 3VFPA 3SKUD 3NH7L 3Q3GA 4RAHA 1B0RB 3MJ9H 4OIBA 3FHQA 5GGUA 1WFOA 1XGQA 1YC7A 5AD0B 5DJDA 1RZIB 4C83A 1UJTA 4G8FA 4P23A 2YN5A 4JZOB 1JNJA 5TH2B 3MCKA 4NO5B 3IF1A 3KJ4C 2MOVA 1A6UL 5C0BB 3RQ3A 4JGUA 4RFOL 1OLLA 2HG5B