3OX8A

Crystal structure of hla a*02:03 bound to hbv core 18-27
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
275
structure length
275
Chain Sequence
GSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDGETRKVKAHSQTHRVDLGTLRGYYNQSEAGSHTVQRMYGCDVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQTTKHKWETAHEAEQWRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHEATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRYTCHVQHEGLPKPLTLRWE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into the binding of hepatitis B virus core peptide to HLA-A2 alleles: Towards designing better vaccines.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords MHC class I antigen
total genus 77
structure length 275
sequence length 275
chains with identical sequence D
ec nomenclature
pdb deposition date 2010-09-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ox8A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3ox8A01
4YO0A 2OMNA 4X9HA 4Y16B 3WV0A 5JIIA 1AE6H 4Z7OE 3UEZA 3V8CA 5DD3L 1NCDH 1TFHA 1KLGA 4LGPB 3O4LA 4U1IB 5D1QD 3MOBL 1BLNB 4RFEA 4DOHE 5AG8A 2AV1A 4JHAH 4L8SA 4YUEH 2CLVA 4FFVD 2R2EA 3D0VB 3MJ7B 1CE1L 1GGCH 4XMKL 5IT2L 4Z0XA 4J6RH 2PO6B 2FYYA 3G04A 3MBED 5IB5A 3L3OB 3GDBA 2HYMA 4FG6C 4Y1AD 4IRZH 3V5HB 3TZVD 4XVSL 4YXHH 1S7UA 5HYIA 4G8GA 4DVBB 3QUMH 1P7KA 5E4IA 4DAGH 4KROC 1LHZA 2IANB 4PRPB 5ITFA 1JF1B 1KGCD 1N64L 2DQEH 2VLKE 4XCEA 4LEOA 1J1OH 5E8EA 4ZUVB 3BYYA 1B2WL 3DHMA 4M5YH 3FCTA 4N1CA 1RI8A 3BYTA 4GW4B 5F7NC 5HHQA 5DSCB 2EDRA 3FB7A 4X6BB 2YMXL 4WCYL 4E41D 5C0AB 4JFDE 4ZMAT 3JXAA 1W0VA 4NO0D 5IM7B 2AXJA 1YEEH 1Y6MR 1AD9B 3P4LA 1YEEL 1FG2A 3VXNB 5F7YC 1WGOA 4WENB 3IDYC 4WEBL 1ZVSA 1YNKH 3MOBH 4JFEE 3FAWA 2CMRH 5I9QC 3U2SA 2BSTB 2OTWA 5DGQA 4LIQE 3WLBA 4LSRH 2XY1A 1KTDA 4M48H 4GRLD 2AKRA 3S96A 1NLBH 4FQXC 5GS0H 1B0WA 4ZDHA 5FHBL 4YXHL 3HG1A 3QWQB 2VSDA 3ROOA 3QUML 1EA9C 2PETA 5HYSB 5T3XH 3OAZK 3C6LD 5GS0C 4G8IB 1S9YB 4JFED 4U05A 5D1ZC 4YHLH 1LO4L 3S3SA 1S7QA 3HNVH 3LS5L 4KU1A 1P4BL 4UT6L 4RA0C 1AIFB 1KENL 4YQXH 1HHHB 2CKNA 3HE7D 5KVEL 4J3TA 5A2IH 5I17A 3G04B 5IB5B 4GMSH 2BFVH 4RZCB 3DVNA 3ESVF 3O0RH 1YPZE 3RPIA 1JNLH 4NN5B 2IPKA 4NQEE 1U6AL 1Q0XH 3VRJB 1F4WH 3HG1D 4Y5YA 5CEXB 5J56B 4G7YL 4X6DE 5E6YA 3VWJA 4MSWA 4R0LB 5ICXA 3RJDA 3WDJA 2CKBH 4YNYB 1XF5A 2CKBL 1I9JL 4XCCL 3V95A 4EI5A 3ARWA 4PRNA 5C07B 2R15A 4K3JL 2ZCLL 2UVEA 1X5JA 4KRNA 2A0LC 3WDHA 3BP6A 2EDKA 1JGUH 1FLTX 1VFAA 1FVDA 4F58L 5JHLL 2BY2A 5IKCA 3TO2B 4ZPVA 3CFEB 5IF0B 3CGTA 2R29H 3GHEL 4PJIF 1UB5A 3QG7L 2VLKA 1EO8L 5JOPD 1TCMA 1RURH 4LAJH 4JFHD 3CPLB 2XYCA 4FTVE 5FOJA 4LSSL 2YPLB 1CLYL 1MQ8A 4H8WL 5FYLE 1C7TA 1OHQA 1N6QL 2A83A 4XVSH 4TSBL 4I9WD 2UZIH 4PJ5A 5EZIH 3MCLH 3ZDYF 4JM4L 5ICYA 1BQHA 4C56A 4PJEB 2OL3H 2OP4H 5K59F 2QQLH 1HYSD 1I9IL 4QY8B 3UYOD 1AXIB 1RZ7H 2HVJA 5D71L 2YUXA 2YPVL 4HXBL 2DTML 3O9WC 1LEKA 4BFBD 5C0CD 1JI2A 3RTQA 4JANB 5HDBE 4NNXB 5E24E 5J4MA 4XNUL 3DTXA 3RPKA 3MRDB 1X5LA 3QQ4B 2IAMB 3VRJA 1BREA 4KJPC 5JO5B 3RWIB 5E08H 3DROA 2JJUA 1P1ZB 4MCZA 3MXWH 3UTTD 1UJ3B 2NR6D 4JM2B 3STLB 1QSEE 2V7NB 2F58H 3GO1H 3ZO0A 1RFDL 3O8XA 4NQCA 2AGJL 4K8RC 2FX9H 5F3HB 2WIMA 2LVEA 1YJDH 4J23A 4PJ7A 4EN3B 3T0AA 4QRUA 3AB0C 1CF8H 4HEME 2H32B 3N1QC 1PEWA 3NGBC 3BRDA 4HCRH 2QADD 1MWAA 2C4FT 3UTSB 1AH1A 4QRRE 2B4CL 3PP4L 2NY4C 2BP3A 3HLAB 4NHUA 1JFQL 2QR0B 2B5IC 4I0PD 3BGMB 1PY4A 4WCYH 5A2FA 1GL4B 4R97B 2XTJD 1KIPB 3QI9D 5C0AE 4HHAA 1VFMA 1NSNH 4EDWH 4XNUH 3QCUH 5D70H 5I2IA 4DN3L 1A5FL 4LKCB 1CL7H 5E4EB 1S78C 4DGIH 3C8HA 4OKDA 4PJEA 4FQXA 4AIOA 3U36B 3RGHA 3CC5A 4Y1AA 2OTPA 4ZAKA 3BQUB 1ZV5A 2PYED 4N8CH 4XMLH 4CVZB 4Z7QE 5I1KL 2F58L 4Q0XH 1RFDH 3GSXB 4K3JH 5DFWH 3M17A 5I18L 1T66C 4G43A 3KG5A 4Y2DA 1F4YL 4M8VA 3BEWA 5E2UH 5DRZB 4RNRA 4NKIH 2UY6A 2X4PA 4XPBH 1JGDB 1TVBB 3QUYB 3BSZL 3V5DA 4P2OD 4P5MB 1SQ2N 4W6YB 3G6JA 2FB4H 2QLVB 1F6AB 4OQTL 4HBQA 5GGSY 3QEUB 4DKDC 2D4DA 3QP3A 1K9TA 1WZKA 4KVCH 3JV4B 3D18A 5KVEH 5MI0C 4I0PA 4P4KA 2Z8RA 5FV1L 4O4YL 5AD0B 2CDEB 3NTCL 1D6EB 4PTUA 2LU7A 4KK6D 1LE9B 4GW5B 2OK0L 1J1XL 3V52H 4O2FA 4E0RA 1MAML 5K9QI 1A3LL 5FA3B 5FAAA 3MRIB 4JPKH 5C0BE 1FFNB 1D6VH 4I3SL 5D7KD 2NY5L 1T04A 1C8PA 2R0WL 5EPMB 2UUDK 3ELAT 1QLRA 2CQVA 4NFDA 3FL7A 4U6TA 3BZEB 4Q9CA 1J18A 4YBQD 1VPOH 3UDWC 1KPUA 1I1YB 4GRWH 3HCVB 1INDH 3LKQB 3BFOA 4JZJA 3LRSA 2C3GA 3HAEH 5DJ6B 4JJHA 4FFZL 5LCVH 5D6CB 4N0CA 1U8JB 1CN4A 1S7WA 1PG7W 5D1XA 4K2UL 1W2KT 5C6TL 4QHLA 1FO0B 3H3KA 3MRQA 5HGHA 1C1EL 2Y06H 4LRIA 3FTGA 4Q58C 3S6CA 1JGLH 1X44A 1P84J 5DVNA 3QEQD 3WBDA 4OSUL 2EKSB 5L9DL 4N0UB 2BXYA 3N9GL 2R39A 5I73C 2GKIA 2APFA 1AHWB 1V05A 1CGXA 4Y19B 1E28A 1A64A 2DQIH 5E94B 3KYNA 4MD0B 2FO4A 4YGVA 3U4EB 4X98B 5GSVA 3VFVB 1FPTH 3VXPA 1A7NH 4KKCD 1Q9OA 1RMFL 2P5EE 1SMOA 2VISA 4P23C 1F4XL 1DTUA 4LQFL 3HMWL 1NAML 2GYSA 3WSQH 1CIUA 1IAOA 3VFUB 1D6VL 2ZCKH 4KKBD 4JVWA 5IMLB 3PQYE 3SDDA 1CFVH 2BNRB 2J8HA 1HHGA 3Q5TA 2J8UF 1REIA 4TVSa 4U1SA 5CIPB 1NBQA 3TA3D 1FYTD 2CIIB 5JOFA 1KOAA 3VXRD 4CW1B 1S7RB 1UB6B 3OKLB 4Z0BL 3UBXB 3HNTH 5D2NB 1MIEH 1L6XA 4XPTH 1T5WA 1BQLL 2GSIB 4XXCC 4FS0A 3F7YA 1BQLH 1F6LL 4F7PA 2V7HA 4PG2C 2COQA 4NO3B 2NXZD 3STZB 1KPUB 3HCVA 3LKQA 5GRZA 1R5IB 4UV4H 2VOTA 1GC1C 4WUUA 1TJIL 2YPKB 2CDGA 1P4LA 4PP2B 2GCYA 1XGTB 4AY0A 3KLAA 5SX4I 4MAYD 3HNSH 3DXAE 3WLWC 3MR9A 1MCWM 1HKFA 3UTSE 2Y07L 1G7IB 2V6HA 4K3EH 1R5VB 5C0RL 3T4AB 3QDMB 2AJUH 1RJLA 5C0RH 3OKOA 4Y19A 5KVGH 4KJWC 3A6CL 2C3VA 1WEJL 4JY5H 3K1DA 1YY9C 4GQ9H 5IVOA 1E4XH 2MKLC 3BD4A 2IGFL 4BQ8A 1P7HL 1NCWL 3QAZB 4NO2B 4PS4H 4NPYB 4Z77B 1UT9A 3PL6C 1MCIA 4I1NB 4OJFH 2VKWA 3S96B 4X6FB 4OF5A 4Y5XB 4RX4A 1SVCP 5C0DB 4KQ3H 1JPGA 2XN9B 1DQJB 4LP4A 5IBUG 3TZVB 5DUBA 2ZJSL 4BUHA 4M9OA 2A77L 4U1SB 3O2DH 3EO9L 5I1HL 3V0WH 2WQRA 4HG4K 3V6ZA 2AABH 1JZ6A 1WJ3A 4OFKA 1T1YB 1T22A 3FQUB 1G6RB 3BPLC 3QUMA 3V2AR 3OAYK 2YRZA 1CWVA 5FYJE 4FQJL 5EU6D 4ZQKA 4BSVB 3ULVF 5GZOC 4OZGF 2RR3A 3VG0L 5C2BH 2VLJB 2C1PB 4MA7H 5CJXC 3BW9B 2CK2A 3EBAA 3INUH 3QFJD 4EI6B 4I0PC 2A74B 4QLRA 1ORQB 4P4KC 3P11L 3E6HB 5LGHL 5LGKA 3NIGF 4AQOA 1DUYA 5I1IH 2YXMA 1UFUA 3KNBA 4GLRI 4XH2B 5TQ2H 4LLQB 5BJTA 1EEYB 1U8KB 1VFAB 3TO4A 5IIEB 4GW1B 5DQ9A 2DMKA 4B53A 3RI5K 4HFUL 1YECH 3EW3B 5FOBA 3SDYL 3TBTA 3RVWD 3X13A 4OD2B 3LPWA 3DXAA 2KQMA 4OI7A 5KSVA 4HV8A 3AMLA 3QUKB 4ZUUB 5LQBH 1DBJH 1Z9MA 5JZ7C 2ATKA 2F5BH 2DI9A 1H3PL 4PPTA 4Z77A 4ZAKC 3T09A 2JCCB 4PJFB 3MRFB 4JRXD 5EOQH 1VHPA 2YUZA 4HKZB 3RWGB 4KJPD 1R6VA 1G9ML 4L4VE 2ZUXA 3B4NA 2UWEF 3I6KA 5C0DA 4LSTH 3H9SE 4NCDA 3FQWA 5I1CL 5L88H 2R1YA 3VFMB 4X4XB 2DQEL 5DMJB 4UMGA 4CGTA 5HHQB 3C09B 4PRHB 1GC1H 3E1F1 1KT2B 4ZO9A 1ODAA 4JY4A 3WIFA 3MV8A 4MX7B 3ZDXF 5B4MC 3D3VB 3QCTH 4LLMA 1T03L 1G6RA 1PJ9A 1HEZA 2X70A 5HI5D 5EBWA 4HCRA 4HKBA 4R0LC 3GI8H 4O58H 1TJHH 5FKPB 3GSWB 1QLFB 2VUOA 3RL1A 5CAYB 5M7QA 5C0BB 2R1WB 2PTTB 4HXAH 4AH2B 2YD7A 3WJJC 1E4KA 1WEJH 3ARQA 1I9IH 3T4YB 1QBMH 1RZ8B 3BN9D 1FO0L 4K71B 4ZD3L 1AR1C 1YZZA 1F4AA 2LV4A 3B5HA 1Y6KR 4N0YH 3UTPE 1FGNH 1IQDA 2EH7H 4XH2A 1I1FA 3V7MA 3L9RB 4OGAC 4KKAC 3MV11 3BH9A 3IYLW 3OHXA 1BVZA 3TVMD 4IRSD 2NW3A 2MWCA 5F1SA 1TJGL 3F6IA 5BW7C 4M4PA 4RBPK 1WVZA 4LCWA 5KW9H 3QEQB 4UIKH 5ADOL 4C56E 2GJ6D 3AXLB 2C7UA 1AQDB 2X4TA 3CAFA 4KTEL 3GSNB 3MCLL 3OB0K 5L2JA 3OTTA 1SJXA 3IB4A 3O3AA 2E6PA 5I8EB 1DLHA 1FZJB 2A6IB 2IBBA 2G5BB 5KSUA 3QUZB 1JPSH 4QXWA 5FYKL 2D7TH 5J0BA 1EMTH 1FGNL 1TETH 3QJHB 4Y4FA 5B38G 1DFBH 1MF2H 4L3CB 4H1LH 5C86A 4UOW1 1R0AL 1HI6A 4WFGE 4JQVC 5TQ0H 1R3HA 1MF2L 3B83A 4OFVA 3U0WL 1I8LA 3PXJA 4NC0B 3OX8A 4P5MA 5IQ7L 5DO2D 1KTLB 2O61A 1J88A 1JPTH 4QF1A 3BMWA 5SWSB 4PJ5E 1N5YH 2ATPA 1NGYB 4PREA 3SJVE 1PZ5A 1JK8B 1GGCL 2D0HA 3HAEA 1QPPA 5CD3B 4ONGH 4LLWB 2DQCH 1J5OH 2BCKA 2DQCL 2PO6C 4Y4FD 1N6QH 3VFPB 4C83A 1IARB 5IMOA 1CD9B 3LHPL 3TH4T 1EXUB 2FJGB 4KK8C 2B0SH 1RIHL 4PV9B 4MZ3A 5I1CH 4F3FA 2VH5L 2V2WA 4YDIL 3IS1X 2FIKA 1UCTA 1VB9A 1G0DA 4OCXL 4D3CH 2NY6C 2EDYA 1CZ8L 3IU4L 4S1DD 1KTRL 5ICZA 5JXEA 1CQYA 4TNWK 2P5ED 1S9WA 4IDJL 3G5YA 5HPMA 4JDVB 1OAXH 1A0QL 1MHCA 3CSPA 1TETL 4YDVA 5E8DL 3KPQA 2KUTA 4QRPA 4U1NB 3RNQB 3C5JA 5BMFL 1ZGLP 5H37H 4G59A 5D7SL 3TYFB 4HC1L 3GMRB 4D0CB 4UT9H 2AQ2A 4JHZA 1OGAB 3EKCA 2AXFB 3CH1B 3WHXA 3OKMB 2GJ6E 3GUTB 4JM2A 1RD6A 4JFXA 2VUYA 4CDGC 1CFQB 2V7NA 3GHBL 2IPUK 3ARDB 4XMLL 3PWJB 5JMOC 1HH6B 1E6JL 4I2XB 3BD3A 5HSFA 4P2RD 3QFJA 1RZGB 1EEZA 4DW2H 4F58H 4Z7WB 5JHLH 4DWHA 3PJSA 3BH8B 1WTGT 3QB7C 3TC9A 3L95A 5EZJA 1F13A 1NFDE 5ITBL 4JCMA 4AM0A 4J8RA 2D03H 4XPBL 1JZ4A 4UTAH 1ZLWH 2GTZA 3RAJH 5CD5C 3V9FA 1OSPL 5L8LB 4K3DH 3MODH 3MLRH 3VD3A 4BH8A 2F5AH 1F5WA 4R7DB 3D6GA 1MCEA 3IFNL 4Z9KB 4BSWA 2P8LB 5DD6A 1Y18A 4APQA 3MV01 1M7DA 1KIPA 4HHAB 1PYWB 3D39A 4OZFG 5KVFL 1U6AH 2QHLA 4JO1H 2QBWA 1AGFB 4XC3H 5IOPB 1OM3H 3AY4A 3MJ8A 5KS9B 2J8UA 5DK2A 3CC5B 4HKXB 2D4FA 1MAMH 2BNUB 4TQEH 4HWZA 2XZCL 4JFEA 3EHBC 1WC7B 5FFLA 3BPOB 3T65A 2EICA 3L3KA 4Q0XL 4JFOA 4TUKL 3OKKA 4XRCA 1T0NB 1L0YA 1QPXA 4LMQI 1OT2A 1OARH 4L8SC 4YHZH 1U41A 3IS0X 2YWYA 4BH7B 1NAKL 5D4QA 1IM9B 1QSEA 4NN6C 2FO1A 2HG5A 3RUGA 5CWSB 1VSCA 2FD6H 2GITA 2IMMA 4XP9L 4ZSOB 3PNWA 3VWJD 2DLHA 4RX4D 2HJLB 5ADOH 3T4AA 2XRAL 3B9VA 3HPLB 5FYLH 1IGJA 2BOBB 1HIMH 4Q6YA 3VG0H 3QSKB 1HZHL 4NUGL 1HIML 3EYQD 2EYRB 3GB7A 1FNEB 1I1AB 5F7DB 4PJ8B 1MFAL 4GXVL 3C08L 1LDPH 5FA3A 4JZNB 2IPTL 2V2XA 4NRZB 4LOUD 1MHHA 3O3BB 1AD0B 3QQNA 4PJ9B 1S7VA 4ZO7A 1VADA 2FJHA 3QFJE 1N4XH 1WBZB 3W0WE 1NCTA 4H26B 5HYQB 4NJ9H 3TZVA 1EGJH 2AJUL 2LE9A 3FFCA 2HN7A 1Q9WB 1SJVA 3B9KC 4KVNH 3S5LA 3HZVB 1HINH 1T6VN 4OZHE 5D7SH 1KCLA 4MNQA 5L8JB 1Z6JT 5IVZB 5GS0D 1IGYA 4P4RA 1FCCA 1LDSA 4M43L 1HNFA 3NFSL 1NCWH 3WHE0 2ZZUT 5A16B 1IC1A 4GRLC 5HGGS 3RX8A 1XCQA 3C2SA 2UYLB 3MV7D 4JFOB 3F7RA 1NPUA 1QTYT 2HRPH 2FX9L 5FHBH 1KELH 4X98A 3JVGC 2BVQB 4JPIB 5IFAH 2GSGB 3B2UD 1A1MA 3CDGA 1YEFH 4NBXB 1ZAGA 4Z7QF 1F3DH 2Y5TA 1A7NL 4UBDC 3ARBC 3MFGB 3MGTA 1F2XK 3L3DA 3HPJA 1NUGA 3HI1B 1M71B 4XNYL 1ZTXH 1SJHA 4FTVD 4ODWA 3PL6D 5SWZB 4LLQA 4M3JA 4JJ5B 5BJTB 4MA1C 2FHBA 4U1MB 2G5RA 3CLEL 3TO4B 2WUCL 1UKSA 3OV6A 3U4BH 1DN0B 3LKNB 4H8WC 2IQ9L 4W4OA 4Y88A 4APQC 1UH4A 3ZYJA 4Z7UE 2H8PA 1I1AA 5F7DA 4NQTA 1IC4L 3AS0A 3PDGA 4QXTB 5DUML 2HKFL 1ZLVK 2DWDA 4ELKA 5CD5D 5FGCE 3GHBH 4F7PB 3FB6B 4LSVL 1QYGL 1ZA6A 4J3VA 3V4UH 2F9BT 5MEOA 4HUKB 4YHZL 3IF1B 1JPFB 3ZT5A 3T77B 1IAIH 1A21A 2ILLA 5T3ZL 5SX4H 5FB8A 2Z91A 1S9XA 3K7UA 4MD4B 1M7XA 5FDWA 5IG7B 1QHOA 5JIPA 4QTHA 5HYEA 2FX7H 1P5UA 4W6XB 4GUPA 2AV7B 4MLSA 1LO5A 5DHVB 5IB2B 1CFTB 5A16A 3V0VB 1U3JA 1ERNA 1QNZL 1QBLL 1MHPL 4MB3A 2RAMA 2NX5D 3MNZB 1FYTB 2Y6SC 3HI5L 2PTTA 2DQFA 4JM4H 1FPTL 5JQ6H 1CLOH 3QNYA 5EBGA 2WIIA 4MZ2A 5IBTL 4KZDH 2UUDH 3INUL 4U0QB 3DJ9A 2Z93A 1A3LH 2XFXA 1YEJH 3EGSB 1WFOA 3KYAA 3MGTB 4D9RE 5IB3B 3B3IB 4OM0H 3EOBA 2X40A 3RBSA 5JORA 4ZNEE 4H0IA 1J87A 2BXZA 1JUFB 4Y16A 1UEYA 5I1LA 3I75A 1JPGB 3H9SA 1HCVA 1EZVY 3VFSB 2A6JA 3S34L 9CGTA 2QQQA 4JKMA 2HP4A 1WFNA 1HINL 4POZC 3U0WH 4N0FA 5E5RB 2R56H 3CXDL 4JLRB 1DLFH 1XR8B 4PYHA 2OTUA 4DVRL 4JY6B 4D9RD 4X5LA 3CFCH 4HPOL 4IM8A 4XPTL 1BX2A 1JCKA 1T1YA 1CU4L 1U8QA 1KCVL 3VMOA 5BVPL 1AQDA 2X4TB 4PD4J 2ZUTA 4YLQT 1U0QA 4LVHC 2DQDH 5DJXA 2EH7L 4GKNA 4QOKA 1K3IA 5C7XL 3IDIA 1U3HD 4BQBA 2VDLH 4G6KL 4OT1L 3RP1A 1N26A 2FHCA 4MJ5B 4QKXB 5FA4B 3DVGB 3VFRA 1G7PA 4J4PC 3PGFL 3I6GB 2A74A 3DURA 1DEEB 1YEIL 1G9NC 3P11H 1RHHA 3FB7B 4QTHB 3QDGA 3TBSB 1LWRA 3NBNA 4RGMC 5J1AA 3V6OC 2NXYB 1RVFL 2P8PB 4QHKJ 3ARRA 1N4XL 1BWWA 5HVGB 1T03H 1HI6B 1ED3B 4ZTOL 2NXYD 2I9LA 4JO4H 4L4TE 4ETQB 2XXMB 3VFNA 1WV7T 1DUZA 2BVYA 5F6HI 4EUPA 3WS3A 4Y4KB 5B8CB 4G7YH 1LGVA 3PWPB 2R0KL 3QQ9D 4PLJC 1D5IL 5JNYA 5GSRA 4HPOH 3S35X 2BDNL 5CZVH 4F2MB 2J5LB 4P5TB 2AAVA 5DI8B 4NT6B 5DXWA 4NQDB 1HDMA 5EOQL 4HG4J 2XA8L 2N7AA 3GMPB 3QIBD 4NZTH 1FH5H 3HFML 1FE8H 1MCWW 4OT1H 1XEDA 3B9EA 1XF3B 1KJVB 3JSSA 4X4XA 2EYTB 3CXHK 4XB7A 4WY7L 1V5JA 2KH2B 3RWHA 1ZHNA 1MJ7H 2IMNA 3T0EA 1IE5A 5T3ZD 1VGEL 3NCJH 2DYPB 1OPGH 3Q6GH 2WBJB 4L9LB 1BX2B 5I1AA 4MJIE 2HTLD 3B2VL 5HHMB 3EYFA 3KPQB 3EHBD 2KL6A 5DK0B 5H35B 2XQYG 3GSWA 3T0WA 5FF6A 3T1FA 3GMRA 5CILH 3GSRB 5DHXB 5F1IB 2DQHH 1NDMB 4JFXB 4MXQC 4QCIA 4C4KO 5LG1A 3H8NA 2P5EA 3GJEA 2HTKD 1P4IL 3UPAA 4EI5B 2FH8A 4OM0L 3PWJA 3UYRH 1NCCH 4Y19D 1IGMH 1X3DA 5HHNA 3RNKA 4OCWL 4PJEF 1I1AC 1MCPL 5HI4C 1KC5L 4JFFA 2ZOLA 5TDNA 4S0UC 4W81A 2W65B 1BZ9B 7FABH 1WQVT 5IKCB 4UNVA 3UZVB 3EYQC 3I84A 4I3RH 4P46D 5KANG 1DLFL 3G6AB 3S37L 1RZKC 4PJBB 2CXKA 5HHXH 3D0VA 3WD5H 3SDCD 1NC2A 1U8OA 3X14A 1BZ7B 3VXQB 3BRFA 1NBYA 1BEYL 3ARGA 5DEFB 5C0CA 3FO2B 4L3EB 5J6GB 4XI5D 3H3PH 1HDMB 4CVUA 1U93B 3GSNA 2NY3C 2VZ3A 4P46B 4H0GA 3KLDA 5IVXB 4HJJL 2X4UA 4MNGA 1GC1L 2MPAH 5GGVY 3WSQL 1S7XA 1Z9LA 3L5XL 4LBEA 1I4FB 5EULV 3TO4C 5C08A 4FQCH 1QFOA 3MLTA 2OJZL 3L5IA 5GGTH 3GGWA 1S5IL 1EZVX 4Z76A 5DK0A 3KJ4B 4N9OB 4HK0A 2B5IB 2IALB 4G7VL 4HUVA 1X6NA 3MZTA 3NAAL 3VXUE 1NGYA 3C9NA 1HHKA 3BN3B 4O02H 4RDQG 4ZFOA 4FFWD 1WCBA 2RCSL 1SY6H 3B43A 3L3HA 1U8HA 5MENE 3HPLA 2B1HH 1BOGA 3NGBB 4CVXB 1RZIA 4U3HA 4JN2A 1DL7L 1S3KL 5C0EB 1YY8B 4LEXL 3ZKXC 5C0NC 4OI8A 5CEYA 1CD1A 2CUHA 5GHWH 4CU8A 4OD3H 4LSTL 4JFHE 4K7PL 3MRGA 3T0BA 4HJJH 4YH6A 5EG6C 5CLWA 2A6KA 1HH9B 3VU2A 2FJHB 1KB5L 2W0KA 1XGPB 4I9WE 2UY7A 5IK3B 2IF7A 4AEFA 1BFTA 5AWNL 5I8CB 2FR4A 3KPNA 3BP5A 1CXEA 2WUCH 1BMGA 4YAQB 4KFZC 5C0IB 3G08B 3PWLB 2ADFL 2R4SH 2HVKA 3UTSD 5C8JB 3SJVD 3F7VB 4ORGB 1MY7A 4U6XA 3ILPA 4WO4C 1J8HE 5FYKE 4P2QB 1XF5B 2A1WH 5JIHA 4CVZA 1D5IH 3RWCB 4OD1L 2Q7YA 4X6EA 4ZD3H 4HWBH 4DTGL 5I76A 1WIOA 4X6CE 4E5XA 4LVNC 3UAJC 3VWKC 5EU3A 4YPGB 5D6DA 1OW0A 3I50H 3MLZH 4QXGL 3BZFA 5GS1C 2DM7A 3HI6H 2VR5A 1B3JA 2NW2B 3IDGB 3VFTA 4PRIB 4FQXD 4MB4A 2HFEB 4FFWC 4YHPA 3LQMA 1NGQL 2WLYA 5FEBA 4Y2OA 3OG6B 3RGVA 1WCBB 1WBXA 5CBEA 5H37G 4G9FE 1A6UL 5DD6B 3BIAX 1BFSA 4MXVE 1Z5LB 2YRLA 1PG7L 3VJ6B 2DKSA 2OCFD 3HE6A 1MEXL 2UZIL 4X99B 5EZIL 4BKLA 3ZKNC 1DQQB 3QIBA 3T2NH 3UXFA 5KS9A 2DQGH 3ARZA 2AQ1A 3LDBC 1I8KB 1EJOH 4V2BA 3FQXA 1OAYH 1URLA 1OD9A 3KPOB 4QRPE 4K7FA 2BHUA 3UYPA 3IF1A 1MVUB 4LVOC 2Y25A 4MJIB 1RUQL 2PXYD 4Y1AE 3BEVA 1MH5A 4X9BA 4ZFOL 4TPRH 2VAAB 5DVLA 3DGCR 3H7BB 3GBNH 3OR7A 5HY9A 1Y0LA 1KGCE 2E8YA 3L6FA 1CCZA 1NGQH 2P5WD 4U2YA 4XHJC 4PGZA 3O2DA 3KPSB 4KHTL 4LQ1A 1TDQA 2CGRH 2CRIA 2DQFB 5E94A 5JUEL 2MJWA 2B4CC 1A7OH 4J3UA 5IMMA 3EJZC 4JZNA 5A2LH 2BVOA 1HWHB 4WWKA 3IAQA 1IAOB 4NO0A 1NC4A 4OTXL 1SYVA 1WLHA 4XC1L 1JYVA 1G7LB 1W8NA 5GGTA 4NZRH 4L8DA 4LVOB 5IFJA 1RIVH 4LKXA 1MCNA 5GRWA 5FM5O 4IOIB 1EHLH 4OUUA 1TZIB 3VD9A 3NIFE 4G80A 4CW1A 2VDRH 5SX5K 5JR1H 1J0YA 2OL3A 3LDBB 1ETZA 2JB6B 4UU9B 1HOCA 2ICWA 2XQBH 2XZCH 5DUMH 1JJUA 3O6ML 5DFTA 2HKHH 4F9PA 3IU3B 1EK3A 2AXGA 3KPOA 4ONFH 1BBJA 4JFYA 3LOWA 1A7RH 3MNVA 1ZMYA 2D0GA 4OCMC 4QXGH 5GRVK 2BY0A 3U0PB 2W60B 4L4JA 2YD2A 4GLRH 1IEBB 4LIQL 4Y4KD 3BKMH 3O45B 4LIQH 4X9IA 1QSFB 3KWWB 5EO0A 4FOMA 4GOSA 2FEDC 1OSPH 1EVTC 1H15B 4Z7NE 3NH7H 5IR1B 1TTUA 1KXTB 3D0LA 4GBXB 4HK3J 4S2SB 5FO9B 4YDKL 1QBLH 3KPSA 3X3FH 3TNMB 4UILL 4DUWA 3M8OL 1EUTA 2MQ3A 4XX1E 3RY4A 1R24A 3MV8E 3KLHD 1KENH 3TA3B 5IP4A 4NQXB 3C5ZA 4DCQB 2FBOJ 1U8PB 3MV7E 2YA0A 1DBKL 2YK1L 2X4SB 4EI5C 5EORH 4KRPD 5EWIH 5D9SB 3QIUA 5AZ2H 1B9ZA 5E5MA 5KG9A 2QQKH 4LCYA 2FECL 4OF6A 1KBGH 2O26U 3B6SB 4KC3B 3VXMA 4PJXA 4PJIE 1N2RB 1M7IB 2Z91B 4UT7H 3G5ZA 3O2WH 3C6SB 2X4QA 5FO7B 3BPLB 3HZKB 4K3HA 4JHWL 3T2QA 3WFEL 4M4RA 1MREL 3VXSB 5I6XC 3DO7A 1PKQA 4L9LC 3WFEH 1KCUL 3GMOB 1T21A 2PXYC 5EUKA 1FNHA 3KPTA 1FL6A 3K2MC 1TLKA 4OFIA 4HJ0D 2OJEB 1XAUA 2DQIL 2IFFL 5GSVB 1GCFA 3ULVL 3RVVC 2VO5A 1WITA 4DN4H 5GJSH 3WIHA 3UTPD 3HMWH 3TCXA 5IFHH 5I1DA 1Q8MA 1QSFA 2YD1A 2XOTA 3LQAC 5DTFB 4ZO6A 5I74B 5I1LB 2PF6A 3O9WA 4CMMA 2CSPA 2PW2A 5ALCH 4M00A 1ZT7A 3C09C 5D5MB 5E7BA 4GAFB 1S7SB 2ED9A 4N0FB 3MJ9H 5DDHA 3AUVA 5JOPE 5KSVB 5IHUH 4ORZC 4HUUB 4PJCE 5I16B 2NXYC 1ROWA 5IMKB 1U8OB 4GO6B 4DCQA 1A6AB 3D2UA 3UROR 1I9JH 2R9HC 5F96H 1BD2B 2ZCHL 3P4OB 4Y2DC 3QUXA 2WAHA 3P0YH 1P84K 4OV5B 3B6SA 2X1OA 4HH8A 2V9QA 2X4UB 1ZEAL 5IFAL 2CDGB 3AS3A 4XNQB 1YNTA 4PRHA 4PJ7F 1A7OL 1F90H 3C6SA 1QRNB 4MA3B 4LLVA 3RI5F 5ENWA 2P42B 3MMEA 4PR5B 3BQUD 5H2BB 4L3AA 1RJYA 1T5XA 3WNPA 1YYMH 4NWUH 5HVFB 4U31A 2DL2A 1UACH 4F9PC 1FLRH 4M02A 1EHLL 4P3WA 4FTVB 5ID0A 4KK6C 3RY6C 3O6LH 2H3NA 4HF5L 5EOTA 1FSKC 5LKNA 3BWUC 2HKFH 4RISL 1KIRB 2Q3ZA 3EO1A 5EU6B 2M1KA 3KVQA 1VGKB 4NQEB 4L8CB 1A02N 5GGSB 2QL1A 1WWAX 2XV6B 2NPLX 4JPWL 1XF3A 2NW3B 2CRYA 2DKMA 3PL6A 3VXRE 2MNUA 4MWFB 1QFPA 4N8CL 2VL4A 4RWHA 3D9AL 3RZCA 4MNHB 3P0VH 1YN7A 5EBLA 3BKJH 2BVUA 1NLDL 1AKJB 1UXSB 1KCVH 1CE6A 1RQ5A 4OM1L 1DVFC 1MRDH 5FXCH 3TCLA 5KAQG 2H2PD 1QSFE 1MRDL 3T3MF 2ZP0T 1L4IA 5J12B 1CDGA 5E00B 4HS6A 3TN0D 4PJHF 5F7KC 5JIKA 4P2OA 4LEOB 1LDPL 4IRSA 4YHOL 2CLZA 2FJFA 3FCTB 1TCRA 3I85A 1MJUH 3DSFH 4ZS7L 1J7VR 3HG1E 4M62H 2NY3D 1C08A 4YPGA 4M7KH 4RGMB 4M8QA 3E8UL 2NY3B 4PJ5D 5EN2B 4XAKD 1CICB 4JFZH 3RVTC 2EC9U 5C0GB 2PR4H 4P23A 5D70L 4G6MH 1ZHLB 3TN0A 1KTLA 4WTZA 1KUMA 4HGWA 4HW6A 2PYFA 4OUOA 2V5SA 1DANT 1PLGL 4LLYA 3VXTB 3BGAA 3FFDB 2PCPA 5DMGC 1NGPH 4F37F 2VWEE 3SKUD 4HPYL 4U6VH 4WU7A 1YQVH 3HC0B 5C07E 2Z4QB 2DLIA 4C55A 4G3YL 4LVHB 3MV9E 3PQYD 3MLZL 3MUY1 3ROOB 3CCHA 4HIJB 4P46A 1EPFA 1IGTB 4P2QD 2RQ8A 3BAEH 4X6DB 1DE4B 4OCXH 3P73A 4B0MM 5IESL 1F3DJ 1XGQA 4S1QL 4RMSA 3F12B 3NN8B 5EBLB 5E6ZA 3LPFA 3E3QA 2EDWA 4IS6B 4XNMA 4ZFGL 1OP5H 5KS9F 5GISH 5TH2A 3DHJA 1M6OA 3DVNB 2AK1H 5T5NG 1N3NB 5HVHB 2ADFH 2VLRA 4P2QE 5GRVL 2FSEA 3HR5A 3OQ3B 3GKWL 5HY9B 4RWYL 1C5DA 4MSWB 4R0LA 5TDPA 1N8ZB 3GBLA 4YXLH 5HHOB 3ALWA 1TIUA 1QBML 5IEHB 4UNUA 4K7PY 3LD8C 3CFJA 4B50A 2Q8AL 1ORSA 4LPYA 3CSYA 4YK4C 3L1OH 3WFHB 1DL7H 1S3KH 4M8QB 5DQJB 1M1SA 3Q48A 1MIEL 1IZJA 5GJTL 1UENA 1SHMA 3CFEA 3O4LB 3P0VL 4ZAKD 4DGVL 1H8NA 3MLRL 2XZQL 4IRJB 2XICA 2OSLA 1JNHB 2FNBA 2BHZA 3GIZL 2CGRL 5BRZE 1MHPH 4NN6B 4H5SB 3LS4L 1L7IH 1IC5L 2W9DH 3IFOB 4KTDL 3RRQA 5KVFH 2WZPD 1IKFH 7CGTA 5E95B 1NGXA 3MRNA 5SWSD 4X7DC 5T33L 1VFOA 5EU5A 5I8EA 1DQML 1HSBB 1U91A 3R0NA 5MI0B 1TQBB 1CS6A 2O5ZH 4LCCB 4FFYL 2SEBA 5K9OB 1BOYA 4X6BA 4M3KB 1EAPB 4MD5A 4RGND 1NCNA 3ETBF 5KZCD 4HLJA 1KCRL 2P4AB 4HMDA 3U0PA 1NGZA 3T0ED 1DR9A 4QHKI 5FV2A 2R56L 2AJYL 3CXDH 4G7VH 2ERJB 4P49A 2EDJA 2O61B 5DD0L 2G2RA 2OX5A 4LPWA 4ETYA 3STLA 1WCQA 1OT1A 2GJ6B 4JQVA 5HHXL 3VH8G 2YPLD 4LARH 1Q9LA 1INEH 4LLWA 1BQUA 4JGUA 1OQOA 3VJ6A 2VDLL 3RVUD 4GRWB 1A1NA 4LF3B 4FXGA 1ORSB 5FYKD 2HT2C 3W0WD 4NQXA 1OB1A 1MCOH 4X7CC 3G6JB 4LSQH 3C08H 3X17A 3W9EA 3VWKD 2DI8A 2WW8A 5I30L 4TVPE 2CR6A 1AD0A 5BS0D 2X4SA 1JHKL 5HDQL 5I1GL 3PP4H 4K7FB 5KSBA 4DAGL 4IDJH 2WWMD 5IB4B 3T3PF 5I1EL 2P8MA 3IDXL 5M94B 3M8OH 4RZCA 1WAAA 3X11A 5I1EH 1JMZA 3BISA 4UDTA 1OD7A 4DN3H 3NPSC 2PR4L 3TYGH 2X1PA 2BSRA 1MFDL 2ICEB 3CFBB 4Y5VA 2VXSH 1X5FA 3FOLA 1I1YA 3TBYA 1KNOA 2Q76A 3P9LA 4LCCA 2OZ4A 3U79A 5L0QC 2EDTA 1I3VA 2P1YA 5I18H 4M7ZC 4JM2C 4G43B 2NTFA 1I7TA 2NY6D 2VR4A 2AP2A 2Z31B 5EC1B 1RZGA 3DXAD 2DQJL 2VB5A 4EZMA 4MJ2A 1JVKA 4O00A 1MI5D 1MQKL 4RNRB 3EFFB 4NC1C 2GIYA 1F42A 3GJFB 2VERN 3K0WA 5DHYA 3L3DB 2J7LA 3HB3C 1CDJA 4CMHB 4J2XA 3BKYH 5I1GH 1YNLH 4U1MA 3ARYA 1FC2D 3O9WB 2ZPKL 4CMMB 4D0BA 5B39B 6CGTA 1AP2B 4PGBA 2IANE 3CLEH 4OI9A 3U9PH 1U3HA 1UM4H 1ZT7B 3RWJB 4NGHL 4APQB 2DI7A 1IAKB 3MV7A 2IFFH 4PJ5B 3VFGL 3O11A 4LF3A 3LQAH 3ZHLA 3E3QC 4OZGE 5C92A 5HYJE 2BRRL 3ZE1E 4Y5YC 4HF5H 4HWEH 5LBSH 5B4MD 2AEIT 1B0GA 3F58L 4YFDB 1BD2A 2WNGA 4HMCA 2L4OA 1XMWA 1T04B 4NBYB 4U1HB 1B0RB 2XNAB 3LB6C 2MQCA 5CCKH 1KLUB 2AS5M 3KS0H 1A7BA 3OKKB 3RVVD 2WM0A 3RKDD 4JRXB 4WHTB 5HHOE 1CIDA 4JZJB 5GS1A 1INDL 3T77A 3W5MA 1KCRH 4QTIL 4YHMH 4UOW0 2ICCA 1FO0A 3MRQB 1PBYA 2XY2A 4LRNL 1GSMA 1C1EH 2Q6WB 3ZZ1A 4GUPB 4EKXA 3T0XA 4MXVF 4XXDA 3CFCL 4PY8J 3QEHA 1UJ3A 1YC7A 3K4DA 2P47B 4QRTB 1U8NB 2V5TA 5E99L 5INCB 3P0YL 4NQED 2JE8A 2XPGA 4JHBA 5JW4Q 2KDGA 3GB7B 1F2QA 3MLVL 1YPZA 1EHNA 5ACZB 2CUIA 5KW9L 2BSED 1A3RH 1GGIH 2DJSA 2VN7A 2YZ8A 4WFGD 2X42A 1I3RB 2AJ3A 5HDQH 1UVQB 3MACL 4OZGA 3TIEB 3QO0B 4TSBH 1HHIA 1EJOL 2QKIA 1HN1A 5FIEA 5C3LD 1CDIA 5JXAL 2VSCA 4L8CA 3I75B 2AW2A 3BN9C 4D94A 4Z7VF 1MFEL 4PJXB 5CIPA 4YHML 3ZHKA 1YMMB 5IJVB 3UTZB 3O41A 5I2IB 2JCCE 2EDOA 1VFBB 5KTEH 1LE5B 3BPCB 3HZKA 4HXBH 5CSGA 5B39G 3J8F7 1GGBL 4K23L 3BI9X 1KN2L 4ELME 5HI5C 4WI5A 1SY6L 4XX1G 3QH3B 2HMID 5TDOA 2XN9A 5DR5H 2FWOA 2Y5EA 2V7HB 5C1MB 3SHSA 1B0RA 4PGCA 4NO3A 1L0XA 4WUKL 4DUVA 3RVXC 3V79C 3QXTA 1CD8A 1NMCB 2CLVB 3RVXD 5FCUH 3U46A 3QIBC 3ULVH 2DBLL 4YR6A 1DQLH 4MQXD 3QJFB 3AREA 1MOEA 2KQNA 5J11C 1NFDB 5TPWL 3FB5B 1BPVA 1XGTA 3JV6B 3QZWB 5DD1L 4JREC 3ARFC 5IFHL 1MLBB 2NX5E 5C0FA 1Q38A 1IM3B 4KPHH 4QGTA 3FB8A 5EO1A 2I9LB 4ETQA 4QRTA 4FQIL 2GJJA 3QXUA 3LKRB 3MC0A 1JYWA 4YDJA 4KMTH 5D7LA 1C5CH 4FQ1H 3QRFM 5IV2A 2OI9A 2VDRL 4IOFC 5GSRB 4XXCA 1ONQB 4K23H 5D2LA 5DQDH 5D7LE 4HS3B 1FFNA 3CFKB 5JW3L 4XMPL 1IZKA 5DMIH 5J6HA 4KXZI 4RRPG 5FYJU 4JM2F 1IC7H 4YX2H 3X13B 3BWAB 3FQRA 5MP6L 1VCAA 5CEZL 1P5VA 4PYGA 1HE7A 1SMAA 1ZT1B 4U3XA 1RZFL 5EO9B 3F7PC 2A77H 5L0QB 3UTZA 1TTFA 5IG7A 3LEYH 4G6FD 5LWYH 5HGDA 2GEEA 1L7TH 4DZBA 5H2BA 1AGDB 1L7TL 3QHZH 1YQVL 1AGBA 3SE4A 3QHFL 3LY6A 4QWWD 1OAKL 2BNRD 3O2VL 3UBXG 2VITB 3MUGA 2MHAA 4NZUH 1AR2A 2V2TB 5D96B 4JY4B 3RKDC 2VH5H 5CEZD 3UCRA 4I5BA 1X5XA 4N9GA 1F97A 4PJ7E 1AXTL 4OLZL 1FL3A 5L7XH 4I77L 4C54A 3KPMA 3REWA 4M7KL 1EFXA 1BM3H 2OP4L 4X4MA 1N59A 1J8HA 4D0DB 1NUFA 3UDWA 3TM6A 3T4YA 3WN5C 4QTIH 5IHUL 2XTLA 5BXFB 3K8KA 5KSAC 1BECA 1E4XI 4HV8B 4WV1A 3IT8D 2NY1C 2VDKH 3GFUA 3V6FB 3O6FA 3QDME 3B9DA 1KEML 1NL0H 2BVPB 2QEJA 3WNMA 2B1AH 3EO0B 1V3MA 4GJTB 1KJ2A 1JFMA 1EEQA 3T3ME 4PBVC 1G9MH 4HFWB 5F9WB 5E08L 4P2OB 5FCUL 1FYHB 4OSUH 3WXWL 2UZXB 1FCGA 3TBVA 2ESVB 1DEEA 1D5BA 1TITA 1IL1B 1LK3H 4H0HB 5TF0A 3SKJH 4P0DA 4Q9RH 4QHUB 5I1JL 1T83C 1XGUB 3V5HA 4ZUTB 4HD9A 4N8VA 1MHEA 5E5UB 3LS4H 4PTTB 1F4XH 2W59A 4GAJH 3DMMD 2F53B 1DBML 2NY7H 4HGWB 5FGSA 4QRRB 2G5BA 2WINA 4MAUH 2IQAB 1GPOL 3HKFA 3S4SG 1XGYH 3GSNL 4S11A 1IKNA 5BS0B 4KZEL 4OLUL 4RMTA 1I7RB 2B1AL 2WSKA 3OXSB 3IRPX 4HWUA 4KXZH 4OGAD 2OZ4L 3D39D 1QOKA 4FN0A 4H20H 2ARJQ 1LMKA 4OLVL 4KK8D 3UZQA 1OWWA 4XWGH 4GAYB 3FRUB 5F1OB 2CK0L 3NFNA 4X4ME 4Z0XB 4BK5A 4Y5XC 3SBWA 3PV6B 1J0KA 2H32A 3SOBL 3NFPB 1ZANL 3G5VB 5T3XL 5GIRA 2R0LH 3SOBH 3PDOB 2DJUA 2V2WB 3T0EC 2ARJB 1YUHB 1T2JA 1FNGB 1KJ2B 3GRWA 4P57A 4W4OC 3F7VA 1A6ZB 1HSAA 3QUXD 3MRCA 1H3WM 5AYUL 4KMTL 3GRWH 1D9KB 1JHTB 4YHOH 5T33H 3LMJL 5IVXE 4M7LL 5IEHA 1GOHA 3OSKA 3DPBA 1D5BB 4AG4L 2HJFA 3AFLA 3C87A 3GSQB 5JHDE 5ELIA 3ZT7A 4J1UA 5DQDL 3CZFA 4AG4H 5DEGB 5KANI 3ALPA 3K74B 3QJHA 1BAFL 1KXQE 1CGSL 1EAJA 1OSZA 4Y4HD 3ZE1F 4U49A 1AD9A 3GJFA 1U8MA 4X8XA 1ADQA 2AXFA 3CH1A 4LLDB 4O2EB 7FABL 4K8RD 4X9FA 4BZ1L 3OL2A 5D1XD 4PRIA 5J8OA 4I3SH 5D7IE 4PJAB 1DBBH 3O4OB 1PLGH 2VABA 4PJBA 1P7QB 3OZ9H 43CAB 1AO7E 5FHAL 5C07A 2OSLB 2ARWA 3FT3A 1MRCH 2CK0H 3ILQD 4XVTH 3ZYZA 3QDGE 4G6AC 4JVUA 2OS7A 3BP6B 4RGNE 3Q1SL 1KTDB 4C4KT 1IAKA 5I19L 2CLRA 4LPTA 1C12A 3HC3H 3S98A 3IVKB 4JGMA 3HE6B 3AAZB 4ELMB 2FEEL 3IETB 5E8NB 4PBXA 3S35L 1UZ6E 3P4NB 4UQ2B 3FQWB 5BW7A 3VI4F 1LK3L 1XIWA 3W81A 1KT2A 5KOMC 4P4KB 3QHTC 3VI3F 4OZFH 3IJYA 1AXTH 2DIJA 1XCTA 4LHUA 2KBGA 4NGHH 5C09A 1ES0A 1CLOL 3ZE0F 2YD9A 2A73A 3DUUA 4M5YL 4RGNC 1AGFA 3FQTA 4KJQC 1YUHA 1DBMH 4YHNB 3GJFH 1KV3A 4TPRL 3QDJE 3GMNB 1KPVA 4WI4A 1AQKL 2YS4A 4XPHL 3M1BA 5I0ZA 3QA3A 1CDYA 1MCSA 1YEDB 5DT1H 3NACL 5DJDB 3HMXL 3BVNB 5CINL 1RU9H 4YK4B 3MSPA 1K85A 5JW4R 3RHWK 3DTXB 3BRGC 3LZFH 2HWZL 1U95B 4JKLA 2JCCF 4WEUD 3KR3H 1MCBA 5KVMC 4LAQH 5DJ2A 5EZLB 4WGWB 3RWIA 3BH8A 5K9JL 1FVDB 5CSBA 3FONA 4K3GA 4HIIA 3DLQR 4PJAA 3MRLA 3ECBA 3VRLE 3SGDH 3VH8A 2BOBA 3V4PH 4AL8H 12E8H 4NP4H 3UTQA 2ADJB 5FK9A 1S5HB 4HX1A 1K8IB 4NWUL 3PGFH 4IIQB 5F93C 2A83B 3IXAB 4UT6H 1ZLSL 1M05A 1MRFL 3FT2B 1H9VA 3CDFA 3LQAL 1NEZB 4UI2A 4HUWB 3JUYA 4GKSB 4MAYA 2H45A 3SPVA 4CN1A 1OAZH 3N1PC 4KAQL 5BZWA 4HWBL 4F33B 4PGDA 4WU5B 1MCLA 4Y4FB 3ESUF 1XCTB 4LHUB 5C09B 4ONFL 2VXVH 2Q8AH 1WFTA 2FRGP 1LO3L 4UIMA 2CMRL 3NIDF 3CH8A 4XNZC 3TESA 3CX5J 3VGHA 2GSIA 4X7SL 4AIZA 4JRYB 3BQUA 5C71A 2ICWI 2V9RA 4QF1B 2I24N 3RTQD 4RAVB 1JZ5A 3MBEB 3QHZL 1GOFA 1FE8L 4HLZH 2I07B 4M6OH 1QSED 3NIGE 1A1OB 4N90D 3MRJB 2AJVL 5JHDB 2X4PB 4YDLB 5GXBB 3DX6B 2I27N 2Q8BH 3H6JA 5IV2B 1TVBA 3WIIL 3HZMB 3O3UN 1SJHB 3F62A 3EDFA 3DO3A 1BFVH 4PJEE 1MJ8L 1LK2A 1XGRB 4GMSL 3ARBB 1D9KC 2GAZA 1DN0A 2E7LC 1XT5A 1S9WB 3I2CH 1VA9A 1KULA 4RSVA 2N4IA 5D2LF 5IWLC 1CGSH 5A2KH 4NIKB 1S9VB 2Z35B 3IGAB 3T0EE 4YIQB 2KZWA 3TBWB 4MMZC 2Q6WA 3TPUE 3WE6A 4CJ1A 4PLKD 1AGDA 1I9RH 4Q6IA 1T3FA 3V8OA 3MRHA 2XG5A 3DGGB 4OV6F 1NL0L 1U2CA 4OLWL 5D8JH 3VRIB 2UYLA 3MLXH 4Y16D 3I3BA 1QSVA 4OGYL 2DICA 2GSGA 2M2DA 3CSGA 3SKOA 4PV8B 4JR9H 4TUOA 5D2LE 2F5BL 4EOWL 1T22B 2R9HD 4ODXB 3HI1A 4UB0L 4LSUH 1D5ZA 3QO1B 5ESAA 5GS2H 3KPRE 3IDNB 4KUCD 3ZKSD 1O5DT 2MCG1 3U82B 4OCYH 4S1RH 1P2CB 1SM3L 4R4FH 3QCVH 1SYSA 3BIKB 2FO4B 4YGVB 2ENYA 2H6PB 2E9BA 3TA3C 4OUUB 1WT5C 4QNPF 5ISZB 3WL9A 2ESVE 1VFBA 1LE5A 4Q2ZA 1BFOB 5D71H 2NY2B 2PW1A 1UWXH 3ZYOA 3C2AH 5CKAA 5L2KE 1T20A 4MNGE 4ELKB 5TJWK 3VWKA 3OAYH 3EIFA 4NWTL 2R2HA 2OQJA 1FORH 3W0WA 3HMXH 4P23D 4NUJA 4NC2B 5T3ZE 1IGIH 3DXAB 4HJ0C 3K8MA 5TGBB 4F7TB 1SY6A 4XNQA 1S9XB 1MFBH 1ZEAH 4G8EA 3CJJA 2ATKB 5ALBH 4QRSA 2HFTA 2ENSA 5FDWB 3PWVA 4MQTB 3S37H 1FZKB 3GO1L 2VXTH 4PJFA 2P43B 1FNSL 5IGXL 3STBA 2Y23A 35C8L 3IDIB 2DWEA 3I02B 3LPGA 4ELMF 1OWRM 1O0VA 1T5XB 3MRHB 3OKEA 4OLYH 3NIDE 4OCYL 4M6OL 4AEHH 3D2UD 3AROA 3ET9F 3RDTA 2FEEI 2VDNH 3VW3H 4M93B 2D03L 4NQVB 1WIUA 1NMBL 3IXTB 3KYNB 3LEXB 1FFPB 4NM4L 1EO8H 4R97C 1A3RL 2ITDB 2H3NB 3VFVA 2P7TB 3N0PB 2VLKD 1A6WL 1X5GA 2F54A 4PV8A 3VGEA 5FGBA 3C2AL 3OAUH 4NQUA 2Z93B 4BA8A 2E8ZA 4L4TD 1UH2A 2GTWB 2GHWB 4P4KD 5J6HB 1E27B 1GIGL 3LIZH 1R5VA 4JPVL 4P9HL 4Z8FH 3EOTH 2PXYB 4KAQH 4U6YA 4HKJB 2VKXA 2VIRA 2BNRA 3ARUA 3GMQB 1BM3L 3OGOE 4FQ2L 3WS3B 4J12A 2I9TA 5F3BA 3HZVA 2JELH 1RULL 2AXHA 3QIUC 2CIIA 3KXFA 4KK5C 1LEIA 3PHQB 3RWFA 2DDQH 1UXSA 2XWJB 1A7QH 4O02L 4NT6A 4MDIA 4NBZB 4I3GA 4L4TA 2VLLB 2HT2D 2VXUH 1MY5A 4FMFA 3GMOA 4U6VL 3ZDZE 3OJ2C 3RY5A 4ONOA 4HGMA 4NSKA 3FFCE 3BO8A 5GGUA 3MYZA 4IMLA 1OTTD 4F7EA 3H0TA 4OFYD 4L8SB 1PY9A 1BVLB 4NM4H 3S5LG 4MQ7B 4EOWH 2H2SD 3QEQA 5AZEH 1MWAL 4Z7UA 1T1ZA 3I3EA 3PWVB 3HPJB 3QDGB 1DN2A 1J5OL 4CDHA 1K3ZA 1RUML 4IRZL 3KYOA 1G7HA 4GRMB 2DQUH 3T1FB 3P9WB 4Q74A 1UZ6F 1ACZA 5D72H 4RDQF 4PRPA 4IHOB 4FQHA 2Z31D 1QEWB 4GAJL 4LHUG 3VFNB 4EDXB 3ZMRA 1FZJA 2A6IA 4XP4L 1WUNT 3WFDH 3UJJL 1FFPA 5I8KL 4XP5L 43CAA 4F37K 3V5KA 4XP5H 1VEPA 2BNQD 3V6OA 4G9FD 3V6FA 1W0VB 2A1WL 4JFFE 5L8KB 2W1NA 3A67H 2VXUL 4NWTH 3TEUA 4L3CA 1NEZG 5JA8B 1X4XA 4KZEH 3QI9A 3K3QA 1FAIH 5DYOB 1ZS8B 3QXDA 5E8NA 3DRQB 4BFIB 1JPFA 1PVHA 4PREB 3D69A 4X80L 1CK0L 1LP9B 4ZUSB 3GIVB 1INQA 4XCYB 3KXFB 1FGVH 1HXYA 5FUOH 4G8GB 5C3TA 2HRPL 4G8GD 4V1DE 5IHZA 1CTNA 3H42L 1QZ1A 2F19H 3D85B 3KHQA 1VEOA 5E1HB 4S0SD 4G8IA 3SN6N 1N5AB 2Y36L 5F7EL 1NANH 4BZ2L 5IHBA 3T0DA 4X7FC 4RA3A 1G7MA 1QO3A 1BVKB 4WUUE 4P3CH 5F9OH 5IROA 5HYJD 4JG0H 1ORQA 4JFQA 1QFWL 4YDVB 3VXNA 1DUYB 3R0MA 2AVGA 1G7HB 5LGJA 3WFHA 1G0YR 3BUYA 2RBLA 3VXUD 5IIEA 8FABA 3BP7A 2W65A 4HUVB 3HE6D 3VWJB 4HK3N 3MRRA 1QQDA 3DV6A 1CFQA 4KKLC 1RZ8A 4OD2A 4QXUL 4NJAH 5E1AA 2M8XA 2XIDA 4ZUWA 3REVA 3ZYIA 4JKWA 4EVNB 1QR4A 1IQWH 4IJ3C 5FHAH 3IJSA 2H1PH 3HB3D 1K8IA 4MGXA 1A8JH 2OR9L 4ZXBA 1H3VA 2YOCA 3GM0A 5FGCB 5C0CB 1WIPA 5FECA 4KK9D 4J8RB 2AABL 1Z3GH 1E0OB 4P59L 4YHIB 3V6OE 1X5HA 5JDSB 4HH9B 3FZUD 3QUZD 3DBXA 2MPAL 3LV3B 2FYYB 4AT6A 2L7UA 2MMXA 2EXWD 5JXAH 3K2UH 4Y5YB 2ITCB 5HHVH 2BZDA 3GK8H 3UJIH 4MA7L 5T1LD 5GRJL 4OLXL 4JDTH 3SJVB 1HEZB 1X7QB 2X70B 3GGWB 4KZDL 2AJXL 1PX3A 3OXRA 4YE4L 5SV4A 1U36A 2XZZA 4Q9BA 4EQ3A 2NTSP 4XPAH 1G7MB 1QKZH 3QUZA 2XI9A 2C3WA 1QA9B 5EU3B 1AE6L 2I07A 3SDAB 3TN0C 5DJAB 3QUXC 4F7CA 2X1WL 1I1CA 1FBIH 1QLEL 2E9IA 1DEDA 4RCAA 3MCG1 3X3GH 5HYSG 1Q9KB 4WI8A 2PO6D 4WEBH 2GUOA 3VGFA 4BFEA 4G3YH 5JDJA 4B7LA 8FABB 3MBXH 4WI9A 2DQTL 1U8IB 3WLBB 4XPFH 1YPZF 1K4DA 2R69L 3F12A 5DC4B 5EBMB 5AUMB 4ODUA 2ZUQB 5HJ3B 3TJEL 2DYPA 2LQRA 1NLBL 5GS0L 2AKRB 2VXQL 1ES0B 3HRZB 3DETC 1X5YA 2FX8H 4C56D 4LNRA 4GMTH 2CDFB 4GMTL 1TZHB 4CNIB 3TBWA 5CEZE 1S9YA 3PHSA 3WIIH 4QRRD 1V7NH 5KSBF 4PRAB 3O3DA 2BC4B 4R7NB 2F8OA 4RQQA 5FKAA 4M5ZH 1YEDA 1R3KA 2P5EB 4PP8C 5FGBC 1AXSB 4ZTOH 4TRPH 3ZL4H 3MRDA 1DBKH 2YK1H 1FFRA 3FFCB 4MJIA 4HSQA 3MRPB 2EDBA 2O5XL 3MJ9L 4OLUH 5LVEA 2MCPL 1FNFA 5IBLC 3TYFA 4N0RA 5FDYA 1R3LA 3THML 5ABDE 1IGCL 1BZ9A 3FO0H 4U0RB 1NCAL 1YYLH 2JB5L 3R1GL 5DS8B 4UQ3B 1HQ4A 2GJZB 3MJGX 2DMBA 4X7TA 5JZ7D 5F9JB 5K9QG 3ECBB 4QHNA 3M17B 1ZWIB 1U3HB 5C0ND 5CD3A 4U6HB 5IEKA 3JWDH 4YC2B 4X83A 4XNZB 3KS0J 4KK9C 2UWEE 5DJZB 2EIZA 3IFOA 1U2HA 4PV9A 3FT2A 4JQIL 1ZLSH 4IRSC 3S35H 3ZTJG 4NO0B 3RIFF 3MRNB 2V9TA 2VQ1B 1AR1D 3LKOA 1UB5B 3D25B 3U4AA 2R2BB 1CGTA 2B7DT 1HHJB 4I2XE 4EBQH 2F53E 5BZWB 3MRMA 4KKLD 2GT9A 1I4FA 3CIQA 1IVLA 5BO1L 4JRXA 4Z8FL 1A9EA 4F7TA 1N64H 4P5KA 4L29B 4G80B 4XVUC 1LE9A 1OGAE 5FCSH 4MA8L 1RZ7L 4QXTA 2AEQH 4PUBL 4HZLB 4TTDD 5DK2B 1A14L 1IFHL 3KDMA 4HK0B 4QY8A 4PRAA 5DJ8B 5FYLD 1YA5A 4L1DA 4TUKH 1A7QL 4Z7VB 3T65B 2ZCLH 4GFTB 4PJXF 3VXSD 3NACH 4EXPX 3NA9H 2GY7B 4XCNB 1MCCA 3IJHB 4J3OC 5DGRA 1KB5B 1T80A 3Q1SH 1YDPA 2X9YA 3MLXL 4X4YB 1IEBA 3ARGC 2YKLL 3O6KL 3RWEA 1R3LB 5JO5A 3WKNA 4V3EB 2YKLH 4QT5A 1OB1B 4OM1H 4NZJA 4K8RL 3SDCC 4KRPB 4UINH 2R0ZL 3RBGA 1RSFA 4ZG1A 2HJLA 4KWUA 3F5WB 4Q9RL 2ZNWA 1L6ZA 3EYVB 1AHWA 4JCLA 2FR4B 4CU6A 4KJWD 5F72S 1OP3K 4I48A 3O8XC 2VC2H 1AY1L 3HUJF 1NMBH 5IEKB 1LO4H 1AGCA 1DQDH 1TNMA 1UADC 3SY0B 1ZK9A 2HVKB 25C8H 1VKXB 1MJJB 3QXAA 4KRPC 4Z18A 2X4RA 2AEQL 4TNVK 4YIQA 5C8JA 3DV4A 4YBHA 3B3IA 4LK4A 1NFIB 4KJYA 1CL7I 3ZTJH 1S7VB 4D8PA 1VACA 4F57H 3MGOB 4B41A 5IMLA 1NH6A 3KLHC 5D6CA 3GI8L 2JLLA 1K8DB 4RBPH 4JFZL 4DEPB 3VRIA 2A9MH 3RL2B 3MRMB 1QSFD 2Q86A 5BVJA 3OB8A 2B39A 2IADA 3DRTA 4KTYA 4JLRA 5J1TC 1XIWD 5IUSA 4EIZC 4YR6B 1AO7B 2HT4C 3EYOB 1N5YL 4M43H 1QR1A 2MFNA 5GZOD 5L2KD 4Y4KC 1AO7D 3MBXL 3LN4A 3VFTB 4MS8A 3O6FD 3S97C 4LSRL 4KK5D 1H5BB 5I1KH 2XZAL 4IMKC 3LN5A 2DJ4A 3VD4A 4R4ND 2H2SC 1AP2A 4KPHL 1OOAA 1MNUH 2G75B 4YGAB 2QSTA 1ZVYA 3BIKA 1JV5B 3G5XA 5GHWL 4BQCA 4OCRL 5GRXG 4WGVB 2APTA 4YDKH 4YDIH 4XCNA 5EOCL 2FX8L 2Y5TB 2Q8BL 4CJ0A 4YHLL 1G9EA 5T1KA 1QUNA 4XT1C 1CFSA 3QUYA 4JN1L 3UZEA 1TVDA 3C5ZB 1XH3A 2ICWJ 3BP4A 3E2HC 4HWNA 3QPQC 3QI9B 5E8DH 5D9SA 4K94H 5DHVH 1CT8A 2QSVA 4RMWA 1B4JL 5K33A 3D1MC 3VXMB 2JJSC 1B4JH 4N68A 4PTUB 3X12A 1SJEB 2NY5C 3FO9A 4I18B 5J89A 3UJJH 3R06B 4MAYC 2NX5A 4HLZG 3WLWD 2XKUA 3HA0A 4MNQB 1NAMB 2W9EL 4NO2A 1FYTE 5DI8A 1VPOL 3R1GH 1YYLL 2JB5H 4DQOH 1Y0LB 1WWCA 1JNNH 3B5GA 2DDQL 1R5IA 3GMPA 2BOCA 4PRBB 4KDTC 4RAUA 5EUKB 3MX0A 1XCQB 5D1QC 2VDML 5J1SC 1RZKH 4FXKA 5DURB 4PJFF 4IDLA 5ITBH 1WZLA 4NKOA 1CE1H 3T0EB 2XTJE 1DVFD 3B9KB 4L9LA 5HHPA 3S88H 2NXZC 5DFVD 1JN6A 5FUOL 1FL3B 2G9HA 3NOIA 4JB9L 1GGYA 2YC1B 4PJHA 4O51B 4UV7L 3BZ4B 4Z95H 3WMSA 3SDCA 3S3PA 4AYFA 4ZQKB 4HBCL 3BUYB 4AJ0A 3GSRA 3GMQA 5F6IC 3QNXB 4PRDA 2RB8A 4L1HA 4YXKH 1TXKA 1UGNA 4CU7A 4CAGA 1CFNA 2ZCKL 1G1YA 1ZVHA 4P3CL 3WUWA 2GY5A 3BPCA 5KTEL 2FBJH 4URTB 5EIVA 3L3IB 5HHNB 3QRGL 4DKFH 2VLMD 3PP3H 4HDIA 4MDIB 5DRNB 4PLOB 3RUGE 3IDUA 1A6AA 4H25A 5E56A 4C57C 2YD3A 2ZNXA 2F74A 3Q3GB 5BZDB 5IQ9A 4PGCB 2R2EB 3TNNA 1MAJA 3QWRD 1QFUL 4JRYE 3MNWA 1RV6X 4PRID 5EZOL 1BBJB 3NFSH 2Q7NA 3CVHL 1DBJL 2C3HA 3VDBA 4M7JH 2F54D 1CE6B 4X80H 4XMKH 2CO6B 4OZIF 5BRZB 3HS0A 3FB5A 2CO7B 4YZFE 3DX9A 1BZ7A 2IG2L 2CH8A 4MJ4A 2DQDL 5JPNB 3T2OA 5DFVC 5EFIB 2X05A 3V4PL 2VLJA 2EO1A 1U93A 1WAAE 3V0VA 4K07A 4IMKA 2WBKA 4FZEL 2WLZA 1NEUA 4NN7C 5IVXA 3RVWC 3MNZA 3JWOL 1D9KD 1T7VA 3RWDB 1IKFL 32C2A 3UPRA 5I8KH 4GKZB 5IM7A 3QYCA 3TBSA 3EDDA 4WJ5B 1AJ7H 1GAFH 2HLAA 5CZXD 5LXGL 2KKQA 4LL9A 1ZVSB 4BYHA 3QEGL 5EU6A 3OXSA 3D85D 3BKCL 4MVBA 3BE1H 2FGWH 2BSSB 3QWOA 3CFDB 4GQ9L 1C16B 1LO3H 4PDCE 3WJJA 4JAMB 4WW1A 2VDOL 1HKLH 3G5ZB 1CLCA 2D31A 3VRLF 4QXUH 5EBMA 5AUMA 4ODUB 2NZ9D 3L5WB 3HC0A 1AKJA 4HDIB 5HGAB 5BOPA 4ZTPH 2EIDA 1JGUL 2EYSB 2ZJSH 5F71A 1KJ3L 1Q1JL 4I4WB 2H1PL 3B2UC 3SQOH 4PJAF 3RA7H 4FZ8L 1FNGA 3WHE1 1CDUA 4DK3A 2JJTC 3MRGB 1AIFA 3JTSB 4MJ6B 4N5UA 4JHAL 1JRHI 3T04D 1D9KA 1JHTA 4ERSH 1LD9B 4H8WH 1MJ8H 1U8LA 5BRZA 3FQUA 5MEPA 3HI5H 5JPNA 4RMVA 1X4ZA 4PP1D 1I9EA 5HXMA 3BESR 2P8PA 4XNXL 1FN4B 1V3LA 3HR5B 1ZT4B 1T2QL 1RIUL 2DLFH 2JTDA 1N59B 4X7EC 1S78D 5F89A 3ILPB 4ENEC 4QCIB 2IPTH 3SGEI 4BZ1H 1ZHLA 3SDAC 3TN0B 4ZUVA 2EH8L 4EQ2A 5EORL 5EWIL 43C9A 5F9JA 3WFBL 3TYGL 5A1AA 5HYJA 1W72L 1TENA 4HUXB 3ZL4L 3KNBB 2QADC 3K46A 1NGWB 4GG8B 4NYLB 1DP0A 1QVOB 5TQ0L 1NCDL 5T1KD 5I19H 1WFUA 3MCKB 3ULSB 3LN9A 4PJAE 3O4LD 5EUOF 4LSPH 1LEGB 3OB0H 4GG6B 1JTTA 3CFDA 3HNTL 1V3KA 3F6LA 3GHEH 5A3ID 3QG6A 3MUHL 1YNTB 3FHAA 2JJWA 2E7HA 1G9MC 2DB8A 5E2VH 3P30L 4G5ZL 1CBVH 3RWHB 1T1XB 3KXFD 3SKJL 2I26N 2NY0B 3KYKH 4XBEL 3MRFA 2VDPH 2ZSVA 4P5KB 3ORJA 4JFDA 3SE9L 4JDTL 4G6FB 4F7MB 3QIBB 4R3SA 5CMAB 3OXRB 1RIUH 2DLFL 1AFVH 4HZLA 4PJBE 4AEIH 1BHGA 2L0DA 4NN5C 4R4BB 2X2YA 3OKNA 4Q7DA 2HTKC 5IW3A 5SWZE 3EOAA 5K9OA 1WAAF 1N8ZA 3PUCA 5HPMB 1S8DA 3BVNA 5BS0A 3BZDA 4UTBL 4N0UE 4QRPB 2PN5A 4U1NA 4X4YA 3H9HA 5GQBA 2X09A 3U2SB 3H7BA 5C0BA 3U0TA 4OB5L 4GAGL 3L3GB 1IRAY 1I7ZB 5CUSH 2EE9A 3SCMD 1WWBX 2XA8H 4JZOB 1E4KC 3P30H 3C60D 2EDFA 1HH6A 4NOBA 1XZ0A 3NFNB 3WNOA 2LU4A 3L9RA 5L88L 1VKXA 5D7JB 1PX4A 1CD1B 3Q5YA 2AJVH 1Z3GL 4O9HL 5D1QA 5CZXC 4FP8H 3NCJL 4KTDH 4PJGE 1A6ZA 1HSAB 2ADIA 3CVIL 4D8PB 3G5YB 1LEGA 1X9QA 3FQNA 4AIXA 4ERSL 2E7BA 4YQXL 4UINL 3BIBX 4LSSH 2CLZB 4HMEA 1UA6H 3AU1B 3ZSSA 2C9AA 1M7DB 4O4YH 3X11B 4M6AA 3VGAC 5I66B 4PGDB 1OP9A 3NTCH 3FMGH 1EO7A 2F8XC 3WO4C 3QDJA 2Y7QB 4JO1L 4Y4HC 1T2QH 4XC3L 4WNQB 3O81A 5EB9A 2VE6B 1D5MA 2QQLL 3ME0A 2HH0L 4OB5H 3GSXA 5FYKH 1HQRB 3MBEC 1QKZL 3U48A 1JWMB 3RWCA 3VXTA 3ZDXE 3ZHDA 4XRCB 2B2XH 1OARL 4OIAA 4JANA 3U7WL 3MRJA 4CVXA 3TPUA 5DJZA 2NLJA 2IAMA 4ODTL 4Y4FC 5DHYB 2ZSWB 2P5WA 2VLKB 5IQ7H 3HZMA 1G1CA 5D6DC 3O45A 4YUEL 5CEYB 5HVWA 3FO1A 2HFEA 5BQ7B 1LNUB 4A6YB 3D18B 4UIKL 4X6DA 3L3GA 1PZ5B 2CPCA 5HDBF 4NCC2 1OAKH 1PYWA 2A6KB 3CZJA 2ORBH 4XPGH 3RWJA 1D6EA 2XN9D 4CMHC 1JP5A 2E7MA 3MOQA 2HLFC 4PJ7B 5TH2B 2EEDA 1OF2A 4ZDHB 1B90A 2ZOKA 3I9GL 3HG1B 4IIQC 1FNEA 5L2KB 4AEIL 2NX5B 3I9GH 1MWAB 3GEWB 1OP3H 3V52L 1CG9A 1T0MB 3IKCA 1SBBA 2VLRB 4JN1H 2D0FA 1KJMB 1ZGLM 3DYMA 5DJ8A 1MCRA 1NCBH 3FQXB 1NCCL 3IAGC 2XNAA 3MREA 1T3FB 4Z7VA 1LEKB 2DTMH 4WDIA 5KG9B 2BNRE 5DT1L 1L9NA 3NCFB 4X6EB 1MCKA 5JW3H 3QQ4A 1R0AH 5IROC 2KZ1B 5E03A 3CMOH 1Q9WA 2DM2A 1IM9A 1QSEB 5KVDL 2Y4SA 2D9CA 5MENB 4FG6D 2Z31A 3DROB 4POYA 1BJMA 3QR2A 4ODTH 2BMKA 2E7LE 2JF1A 4HS8H 4HZAA 5E9DB 1NCAH 2ADGA 3GKZA 5ECJE 5F9AC 3NA4A 3BMVA 4HIIB 5F1KC 1E28B 2WMPA 1H3GA 4R26H 4QRUB 5IGXH 1WBXB 5CBEB 5J3HD 1MI5B 4PB9L 4HCRL 4NN7B 1DCLA 2LU3A 1MJJA 2R29L 1TZGL 3TPUB 3CU1A 5CKGA 1VADB 5AAMA 1AFVL 3L3IA 3MRBB 4KRMB 4GS7C 4OIIL 1NAMH 5SX5H 4XBGB 4WI3A 3UTTA 4YDLC 5LBSL 3I6LD 4GKSA 4MAYB 4H25B 5I0DA 4V1DA 4APQD 1MCJA 1JZ3A 4LPCA 1S7SA 1UACL 4IOIA 4WU5A 2ERJC 4UTBH 1S7RA 1UB6A 3HE6C 3OKLA 3UBXA 5ADPL 1Q72H 1X5ZA 3CUPA 2NZIA 1H5BC 4HS8L 1YMME 1ZKAA 3E2HB 4E0RB 15C8H 2YEZA 4IEFB 4BZYA 1D5XA 4NJAL 4TYUA 2VL5B 5ACMA 1L9MA 5CGTA 2E7CA 2NY2C 4WIQA 4LCCC 4XGZA 2X44D 2Z0BA 1A6VH 1FZOB 3DVIA 5BV7B 1LO2L 2BVTA 5E99H 4DEPC 1E4WL 3TT1L 1UWEH 5J9PA 8CGTA 3RWDA 2YSSB 4AK1A 2WUBL 4S1SH 3JV0A 4M1GL 5DD5H 3UPRB 1KIUA 3WXVH 2VZVA 1CFSB 3MLVH 4FXLA 3CVIH 4LDEB 1P1ZA 1JL8A 1CFTA 5GGQL 4TNVF 3UJTL 1II4E 5F7FA 3O8XB 4OCNC 3SDAD 4JPVH 1UEMA 2C3VB 5IB4A 1BP3B 3QFDB 1I1AD 3R06A 4MLIA 1MJUL 15C8L 3MYJA 1ZA6B 1E6OL 3OKYA 2R0WH 1OAXL 4Y5VB 4X5XB 1XGYL 3BWAA 1OTUC 3GSNH 5GGSA 1R3JA 2WWKT 1FL5B 4HFUH 1FBIL 1QLEH 1JF5A 5D7IF 4KVNL 1W0YT 5DMKB 1M7IA 1H3TA 3V6ZB 3GBNL 4P2RA 1SVZA 4G9DB 2X7LA 3ULUH 5E2WH 3QXVA 5CJQL 3B9KA 3QJFA 1OAQH 5K9KB 3QUYD 2HTLC 1JHLH 5JW5B 1U8LB 5B8CC 2AJZA 4BQ6A 3FRPA 4LSUL 2X4NB 4IRJD 2XKNB 4G6KH 4NUGH 3LHPH 2APXA 2VTFA 4KUZH 3RIAF 3PQYA 1SYSB 5AEAA 4HULB 3KXFE 4J7RA 4N0CD 1OTUD 4DN4L 4XNYH 2Z92B 3QIWA 2F8VA 4NZDA 3I6GA 3MA9L 1GRWA 4PP2A 5DRZA 5KN5A 3MV7B 2K3TA 4XZUB 5HYJB 5EIIB 3GMMB 1U92B 2FZ3B 3KLAB 3G6JE 4S0TD 4DKFL 1T20B 3GSUB 5DMGD 5ANMB 1OLLA 2Y07H 1A4JB 5T1LA 3CD4A 5FOBB 2EEBA 4LPUA 4YC2C 1NBVL 5C0GA 5F7MC 1XR8A 3O4OC 1FAIL 5BMFH 1RJLB 3QEQE 3DYOA 4JY6A 4BFIA 2P44B 3QPXH 3CVHH 4LLUB 5I75C 3GIVA 1NJ9B 1T0PB 3VI3E 1INQB 3F7YB 2JCCA 3MLYH 4O2FB 3WFBH 2VDQL 2X4QB 3DX9B 1FQ9C 3BPNB 3JVGA 3LVEA 3LEYL 5LWYL 2GK0B 2RIKA 4LCIH 4NPYA 3SE3A 2IEPA 4M48L 4WFEE 4UDUA 3NCCB 1KFAH 4FFVC 3MLUH 4WUUB 3EDKA 3D85A 1FL5A 5IVNA 3VDCA 3MLUL 4LASH 4AEEA 1FL6B 4WRLA 3IDMA 3P4MB 2FECI 4HEPG 5J12C 32C2B 1MJ7L 3NCMA 3NN8A 3RAJL 5E6IA 2RHEA 5ACZA 3HNSL 3M07A 3VCLA 3MODL 4M7LT 1A6WH 3U9PL 4J6RL 5K9KA 5KZCB 1P9MA 6FABH 4N8VB 5IVXF 5FUCC 4XBEH 2APVA 4N0UA 3DMMB 4GXUM 3A6CH 5JQ6L 4YJZL 5JNYB 3BW9A 1J1OL 3SDDC 1RK0B 4KGLA 2HH0H 3O41B 1IGFH 4LPVA 1J05A 4TULH 3RY6A 4LNVA 1GHFH 5EU6E 5IJKC 4K55A 4ISVB 1JUFA 1S7TA 4FQLH 2NYYC 3CSYB 1IEHA 5IWLA 5FUCE 1UJ3C 2IAMC 3QUXB 2IH1B 1LO2H 2K9UA 1E4WH 3TT1H 1F8TH 1FIGL 3RZCB 4OV5A 1OAQL 3WD5L 4PJCB 3A6BH 2VAJA 1JHLL 5GZNC 2FD6L 3AREB 4G6JH 1NJ9A 2WWKO 1KIQB 1I7UA 1H3PH 1UKQA 3G5VA 5GGQH 1F11A 5J6GA 3DIFA 1KSRA 2IANA 3BPOC 3OAZH 1GZPA 3C8KB 2NNAA 5TE4H 4WUUD 3STZA 1TNNA 5DJCA 5F89B 4FP8L 1OCWL 4YE4H 3MACH 4YXKL 3NIFF 5DUPH 1U91B 3Q6FA 4S10A 4FTVA 1BIIA 5ID0B 4OGXL 4LBEB 4J1UB 4JRXE 1NC4D 3N50A 1C08B 5TDNB 1BD2E 5J11B 2BFVL 3MR9B 3OWEA 4ZNEA 1F4HA 3S34H 1BBDH 1FRGL 1ZHBA 2OR7A 1DFBL 3MCKA 1A5FH 2NLJB 4G9FB 1R3IL 3P0GB 5KSAB 3WO4B 1WT5A 2ATPB 1DUZB 2IALA 2BDNH 3PF2A 5CZVL 1BJ8A 2YR3A 5LQBL 2R0KH 3D3VD 3TV3H 3C60C 3BT2H 4KY1L 3OJVC 4TSAL 3VXQA 5H94B 4JKPL 1Q94A 3VWJC 1RPQA 5HGDB 4HKZA 3RWGA 3BDYL 4KQ3L 1WZ1L 2R8SH 2Z4QA 1UQSA 5T3XE 2VDPL 3IVKA 1UH3A 4X6DF 2FIKB 5C0EA 4JR9L 3DECA 3H3BC 3V0WL 2VITA 4Z78B 5ESVB 5C9JB 3TT3L 5DUBB 4JQXC 2EYTA 1OQXA 3WDIA 1I75A 4RFEB 4D3CL 2ZUQC 3D3VA 4M6ML 1U9KA 5KJRL 3PE9A 3HUJA 4OGXH 4X8JA 1RK1A 1TMCA 3BJ91 4TOYH 3EYSL 4N9GB 6FABL 3AM8C 5D1ZA 2BERA 3C5JB 3GSQA 4J3XA 3PWPD 4EN3C 1QFWH 2C7UB 4KDWA 1IBGH 2YD6A 1KLFA 3QISA 1QHPA 1EX0A 3EDJA 2ICEA 2N1KA 2XG4A 5DRWA 3CX2A 1FO0H 1IC4H 4KI1A 2NY4D 5F1NA 5ETUB 2PYFB 3NCBB 5DJYB 4EI5D 1IKNC 4NOFA 3MO1A 5SWQB 2E6JA 5C0AA 3PJSB 1MRCL 5MEND 1CXLA 1KFAL 3IDYB 1RZKL 2ZOLB 4ZPVB 2C3XA 1C12B 5T3ZH 3S9DB 4ELMA 4M9PA 2EDDA 3BKJL 2X6MA 4HIJA 4HH9A 2PNDA 4XP9H 3D25A 4V1DB 2YD8A 1CLYH 1WSST 5CS7A 3MQIA 3HAEB 4R2GD 2JIXA 5JPMA 1QNZH 1BEYH 4KTEH 5FYJD 4PJFE 4JREB 3K2UL 5DEZA 4X6CA 5IMOB 4ZUTA 1RZJC 2W0LA 3SJVA 3VD7A 1MPAL 4YFLF 4BKLB 1NUDA 1D5MB 3S37X 4F3FB 4JFPA 1T89C 5EDXA 4YHNA 2V5YA 2OL3L 1BWMA 5ESVA 1ZLWK 3TFKC 2X4OA 4CN4A 4JDZA 4HIEA 3JWOC 1PQZB 3ALXA 4KQ4L 2NY5H 1GH7A 3HUJB 1FNAA 4OQ1A 1JGVL 3VDAA 1GHFL 3FHQA 1MHCB 2JIXD 1OL0A 4FQ2H 5DJAA 5GGTL 4F9LC 4TTGA 5D1ZD 4ACPA 2WQ8A 5DWUH 2VZSA 3RNQA 1NGZB 1QRND 5KVDH 1A9BA 4C59B 4M7ZB 5FKPA 1JPTL 1NAKH 2GUOB 3O6KH 4Z0BH 2Y06L 3MUJA 2X89A 3IDJB 4YFEA 1DBAH 3W82A 2B1HL 4NQCB 2RCSH 5E2JA 3JV5A 4U2ZA 5D93C 2BCKB 3WS6A 1WZ1H 5MERA 1KB9J 2X1XR 2B0SL 3OR6A 4WHYH 3UTQB 3DX6A 3U30C 3WXWH 4JFFD 3GSVB 1G6RL 4KI5C 1AGCB 4LCWE 3SY0A 4B7IA 3MROA 2DLGA 2OR8A 3A6OA 2E9WA 4H26A 3MRCB 4ZFGH 2QR0A 3BJLA 4RQQB 5FKAB 3SGKA 5I8CA 4ENED 3E8UH 5IFJB 3O0RL 2HJFB 3FFCD 1MFCL 4PJDA 4XP4H 3RQ3A 3AM8A 5CEXA 5MENA 1CL7L 1IGYB 4NO5B 1C5CL 2IWGA 3HZYB 2BMKB 1MVFA 3DETD 4Y1AB 1Q72L 5IOPA 5L2JB 4WTXA 5D5ME 1BF8A 2ICWB 5ANME 3TV3L 3V4VH 4RISH 4F15B 1CXHA 2BK8A 3OBAA 1A1MB 4OBSA 2IH3A 1A7RL 1KELL 3MJ6A 3EO9H 3RGVC 4PJCF 3TWCH 5I1HH 3QBTB 4XWGL 1RJZB 4ODWB 1KEGH 2GTZB 2YD4A 3P3YA 1TZGH 2FX7L 2V17H 5E8OA 3MRBA 4M1GH 5DD5L 4WY7H 5E0QA 3GSUA 1HILB 2J1KA 5F7UA 3Q2CA 4YHPB 1VEMA 5EC2A 2HFFA 2YRPA 1NBZB 3B2VH 1DZBA 4JB9H 5FO9A 3VA2C 5F44A 4AQ1B 3WNNA 2H8PB 1BQHB 4C56B 3OR6B 4L29A 4YWGL 3MPCA 1GJIA 2BNUA 4YWGH 1K4CB 3DUSA 5D2LB 1D5XB 4YZFF 1FZMB 5IB1A 3VWKB 4LHUD 3O3EA 5C09D 4EJ1C 2VMFA 5CGYC 1JGVH 4XGZB 1H0DA 1W72A 4NNXA 4JDVA 1DANU 4WO4B 4PJ8D 4Y16C 3GMLB 1TQCC 3I50L 4UT7L 4OFPA 4PY7A 4LP5A 5LAXA 3QDMD 3KWWA 5EC1A 4OLEA 2BY3A 1RJCA 5FYKU 1NGPL 3OR7B 2Y72A 1CXIA 5D7JD 3RDTB 1T21B 1T1WB 2VN4A 4R96A 1TVHB 1MIMH 5GRUL 3ES6B 2GFBA 2JK5A 1MCOL 2OJEA 1LP9E 4PJDE 5DLML 1G6RH 4OZIB 1MFAH 4GXVH 4M93C 4YBQC 3QFDA 3UTSA 4GG6E 1CDHA 3AMKA 3QXAB 2X4RB 3VFUA 3C60B 1OAYL 4Q2ZB 4U3CA 1J11A 1YEJL 4ISVA 1VACB 1FG9C 4OZIE 1H3XA 2LTQC 3PWUB 4XCFL 1B0GB 4Y19E 1JWSB 5ALCL 3E3QE 4HKJA 5IQ9B 4D0DA 5DMKA 3KPSE 5DWUL 4P4RB 2XTJB 2FATH 1ZA3A 1U8QB 2GI7A 5D2NA 1JI1A 5TFSL 5HI3C 1JZ7A 4WI2A 4Z7NF 3V4VL 3HAEG 1FZKA 5D7IA 2HKHL 1FZMA 3SCMB 1F11B 3O3EB 3IU3A 4UBDD 1QD0A 1IQWL 4WUKH 1KTKE 2E6QA 3RGVD 2PYEB 4NSKB 5A3IC 3OF6D 2QQNH 1H0DB 1W72B 1YN6A 1PFCA 4UV4L 1IMHC 1JGDA 1KEGL 4BH7A 3V7AE 5LAXB 3IKKA 5EIIA 1PEZA 3ARTA 5GS3A 4OQTH 3BX7C 2HG5B 2N7BA 1N0XL 4QHUA 3OGCB 4QOKD 5CP7A 4MJID 5EO0B 4IOFD 4U4BA 2EDLA 3P9MA 3QCTL 4I0PB 4PTTA 5CGMA 3KPRA 3B8YA 3MTRA 4R90L 1YJDC 4JO4L 4OIBA 3ES6A 3LQZA 3U7YH 4NHCH 4CVWA 4QRRA 1VERA 4MD0A 2OK0H 2X5PA 1NMAL 3U7YL 3TIDB 2CUMA 5EOTB 1P4IH 4Q9QH 5CCKL 2E7LA 4UUJB 4WWKD 4RAHA 5IB3A 1MHHB 3O3BA 4RMUA 3ZSTA 2AEWA 3MV9A 2VLLA 3NPSB 5DZNA 5DJ6A 5E5MB 1QBAA 4Y8AA 4PJBF 4QHLB 2J6EH 5HYFA 2RGSA 4MWFA 5INDA 3IDMB 3P4MA 1F02I 3QAZC 1QFWI 1BVLA 1LO5B