3OX8A

Crystal structure of hla a*02:03 bound to hbv core 18-27
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
275
structure length
275
Chain Sequence
b'GSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDGETRKVKAHSQTHRVDLGTLRGYYNQSEAGSHTVQRMYGCDVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQTTKHKWETAHEAEQWRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHEATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRYTCHVQHEGLPKPLTLRWE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MHC class I antigen
molecule tags Immune system
source organism Homo sapiens
publication title Structural insights into the binding of hepatitis B virus core peptide to HLA-A2 alleles: Towards designing better vaccines.
pubmed doi rcsb
total genus 77
structure length 275
sequence length 275
chains with identical sequence D
ec nomenclature
pdb deposition date 2010-09-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ox8A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3ox8A01
3U46A 4XVUC 2ZJSH 3CFJB 1CXFA 5IM7B 5ESQA 3P2TA 5D7SH 3WO3B 2V7HA 4LLVA 5T1LA 3WSQH 3D5OF 3MZGB 4PJIE 5IFAL 5L2KA 3DMMB 4WI4A 4YHML 3LDBC 1GC1H 2R4RH 4U6VH 1DUYB 3B9KB 2NCMA 2XWTB 5I1CL 1AXTL 4KRNA 3VFOA 3CC5A 4KTEL 4HKBB 2BVOA 4PJDA 1MCRA 4TRPH 2A77L 1RMFH 5I73B 4A6YA 2A9MH 5HYSG 2AEPH 4P5KA 4HXBH 3HUJE 3Q6GH 3P0VL 4NBZB 1M71A 1CFTB 1T4KB 1PGRB 3T3MF 1G9NC 4ZOBA 1FL5A 4JCMA 1I7TA 4EXKA 2DTSA 3QDGE 4G9DA 4OQ1A 4WEUD 2BNQD 4LSQH 2YRZA 3MUGA 2Y7QB 1WBZB 5HHPA 3FO1B 4NQUA 5GGRB 2C26A 4PRPE 4YBLC 4XBGB 5J6GB 1RURL 3BFOA 2HVJA 3HI6L 1YEIL 5KN5B 3BWAB 3QQ3B 3Q48A 2EIDA 5EO1A 1JV5A 1TPXB 3MRGB 3CZJA 3MRCA 1P7HL 1F90H 3O2DL 3RKDC 4BQBA 3GM8A 3DUUA 3CFIC 4LCCB 1KPRA 5D7JA 3MLXL 4APQA 3FHAA 4XPFH 5SWSA 4MCZA 3ARZA 2ZUTA 1T04B 4FA8A 5C0AD 5D93C 4YNYB 1OP3H 4XC3L 2V17H 4FQIL 2Q3AA 3KPTA 2NNAB 3UTTB 4QRPD 2HKFH 4WGWB 4BH7A 1MCWM 5KAQG 3OF6D 4OBRA 1R3LA 4NKOB 4M6NL 3TT3L 5TDPB 1N5AB 2YA2A 3FN9A 5D96B 2WWKT 1NGQL 1KFAL 2OTUB 4OFYA 3SQOH 3RWEA 4DAGH 1VEMA 5D7LA 1IM9A 3B4NA 4H5SA 4UU9A 4Z8FL 3C5JA 1I85A 3SE8L 5D5MB 3W9DB 1SY6A 1L0XA 4WENB 1R3HA 2OTWA 3LRSA 1RJLA 4PGCA 3KLHD 2VR5A 2W0PA 1L0QA 3L9RB 1ZLSH 3GRWA 5TDOA 3T2NH 3CFDA 4I18C 4BK5A 4FFWD 2DQUL 3HN3A 4DFHA 1II4E 3JWDH 1S7SA 5I15H 3V4PL 5JXAL 4HXAL 4I13B 5MEOB 5B22A 4P9HC 3PIQA 1X5HA 1FPTL 5EORH 2Z8VC 3BO8A 4LQ1A 5JZ7C 3FTGA 1TJHL 4PG2C 1QBLH 1J1PL 4U6XB 4WNQA 1RZIB 4I77L 4GW4A 3NA9H 4X99B 4LHUB 1NAKL 4P46B 1ZA3A 1A4JA 2IANA 2Y4SA 5BV7B 1EJOL 1QP1A 3F62A 2E9IA 1UB6A 5D4QA 5E94A 3MLSL 2W9DL 3O3EA 5GRJL 1W2KT 1HHHB 3DHJA 4PP8C 5IOPB 7FABH 2BRQA 3D85A 5CUSL 5DUBB 2LVCA 2JELH 3KNBB 3C5SB 5HTSA 1U9KA 5BS0A 3KAAA 1CGTA 1G6RA 4S1SL 3CAFA 1A1OB 1R5WB 1XF5A 3OKNA 2YBRB 3P4LA 3HNSH 3QHFL 5MERB 3GMPA 4YLQT 3FQTA 3H9SE 3IKCA 4I9WD 3VFWB 1VFMA 5HVHB 4YIQB 2ZUWA 3FOMA 1JGVH 2YPLA 1JTTA 3PABA 3PUCA 5ID0A 2HT4C 1GSMA 3ARUA 4FQLH 1IC7L 1U6AH 4K23L 3DRQB 5KVMC 2DBLH 3EO9L 2P8PA 3FFDB 4GW5A 1S7TB 3RGVC 4DZ8A 1C12B 4YXHH 2BC4B 5T1MB 2XWBB 1HEZA 2AEQH 3ULVD 1F4YH 1WAAE 5EA0L 5I1IL 2NY2C 2AV1A 4GRLD 3HE6B 4HQQL 4P23D 4KAQL 4LARL 2VXQH 1P4LA 5CIPA 5TE7H 1Q1JH 4ONFH 5IEKB 5KSVA 1EXUB 3C2AH 1UG9A 4Y5XC 2CIIB 4RGOL 5K9QI 3QXDA 2CR3A 1F4HA 4G43A 4XMLL 4MQ7B 3UC0H 3V0WH 3BQUC 4JFZH 3MCLL 1JPTH 3WV0A 1W8OA 4N8CL 3ILPB 5J06A 2NTSP 1KB5B 1OGAD 1YEFH 3I2CL 1BFSA 1T6VN 2IPKB 4HKJB 3VCLB 1QHPA 4HV8A 1FGVH 4IRJB 1A7NL 5IK3B 5GZOC 5KVGH 3F7RA 4F9PC 3UTQA 4FS0A 1QO3A 4DCQB 3BUYA 1RD6A 1QHOA 4OI8A 4AJ0A 4GT7A 2GK0B 2XKNA 5JQHC 4M1DH 4L3AA 3AROA 1G7JB 4KQ4H 3J8F7 4U1NB 4XP1L 4QHUB 1ZVSB 5INDB 2MJWA 4M00A 5ADOL 3BZEB 2DDQH 4I8DA 1A7OH 4K3JL 4WU7A 2B1HL 2XT1B 4KPHH 3QWRA 1U3HA 2CKBA 3TO4C 3KYOA 3QUMB 1FGVL 2DIJA 3VD3A 3WD5H 5KSBF 2I9TA 2RFXB 4MDIA 1T83C 3S96A 4N5EA 5J12C 3H9SB 1F97A 3N1PC 5D71H 3SCMC 2CGRH 1BZ9B 4FQ2H 2VDOH 2OR9H 4JKPH 5KOMC 1MLBB 2G75B 2QSCL 4IOIB 5KJRL 3FJTA 4Y5VB 5D2LE 5IG7B 4RX4D 3PWNB 2DMBA 1CI5A 5BMFH 2A6KB 4HFUH 4D0BA 6FABL 4L8SC 4TVPH 4QF1B 3ZHLA 1IQWH 1RU9L 5I8OL 1MUJB 1AGCA 3M07A 5ISZA 2X7LB 4UIMA 3N06B 4UDTB 4F58L 5CP3A 4HD9A 3STLA 4F7TA 3IJHA 3MA9L 4NP4L 5D7LE 3V6OC 1HXYB 3M8OL 4PG9B 3RX7A 3QP3A 2X4QB 1NJ9A 3C8KA 3OAYK 4X4XB 3QJHA 5DD5H 3RWFA 1S7RB 3C2SA 4IMKA 3JBG7 3I6GA 1YN7B 1UH3A 3W39B 4H1LG 1ZGLB 3CLFH 1X6LA 4J3OC 3ZT5A 2P4AB 3RWFB 2E7CA 4ODSH 1JIBA 1P7QB 4G6KL 1ZHKB 1RUKH 4HIIA 2QSTA 4WV1B 2OJZH 2HKFL 4NFBA 1I85C 4Z7UA 1LP9A 3O9WB 3OAYH 3BAEH 3L7FA 1A9EA 5GRUH 4M7KL 2DICA 3KYKL 3UTSA 4F7TB 2D31B 1GOFA 1LDPH 1MAMH 2F15A 1G1CA 4NN5B 4NJAH 1HH6B 2X4UA 4M5YL 2J4WL 1AO7E 2G2RB 5ADPH 2ADIA 3QEQA 4R2GC 3VFSB 4GRMA 3HZYB 4Y2OA 4BSVA 2BVQA 5HI5C 1FORH 1OGAE 3IDMB 4F8TA 4FQXB 4LMQI 1RUKL 1KTKE 3AUVA 3EAKA 3SGKC 1HXMA 2P7TB 2NQCA 4GS7C 3L3GB 4X98A 3WLWD 4MAUH 2LU7A 5DVLA 3OKOB 3BAEL 4M7KH 2WV3A 4FABH 3GMMB 1AH1A 2NW3B 5IGXH 1QBLL 3PQYA 3UTPE 4X4MA 2GAZA 3PF2A 3W81A 4K71B 4Z78A 2H32B 1CXIA 1MIEL 3VFTA 1TMCB 4WDIB 3VH8B 4PBVC 1RPQA 2LTQC 3B3IB 5C08B 4CL7A 1GL4B 1AD0B 2XTJC 3CVHH 1LGVA 1CDIA 3VJ6A 2XZQH 3IFOB 3IB4A 4ALAL 1MFAL 5IQ7H 2YD4A 1NBVL 4PPTA 1B9ZA 4MMXC 1NUGA 4RFOH 5CUSH 5D2NB 2JELL 1SYSA 5C8JA 4PJHA 1JHTA 3H3KA 4G9FE 3GGWB 2WANA 2YS4A 3DUHA 4CMHB 4EJ1C 4G8GD 1DSFL 5HGBA 3FQXB 4X5WB 1HDMB 2NY2B 1FSKC 1K4CB 3JXAA 5IVZB 4ZFGL 1A3LH 3VXMB 4YXLH 4MQ7A 4G43B 5EB9A 3CK0L 4Y5XB 1IAOB 2XTJD 3ECBB 1NLDH 4U0QB 4HXAH 1GCFA 1FAKT 1L7TH 1J0JA 5A16B 3JV5A 2HRPH 4PJXE 5C08D 5AAMA 2E7HA 2XN9B 4TPRL 2FB4L 4U6HA 4K7PL 1FFOB 4R97C 2R15A 4L29A 2JB6B 3VGFA 2A9NL 3KJ4B 3IDNB 1XH3B 3H3PH 3S36X 5GXBB 4N0UE 2BCKA 2Y25A 4BH8A 1HYRC 3SGEH 1VA9A 3IS1X 2EZ0C 1T20A 3R0MA 4BZ1H 5D1XD 4JPVH 2HT3D 1MWAH 2J8UE 2HN7A 4D0DB 2HTKC 4JQIL 3CX5K 3TBTB 1JPSL 1G6VK 3QI9C 3S5LG 2C7UB 5KG9A 1YPZE 1AQKL 2FIKB 4R4NC 2YMXL 2EYSA 3GSNH 2NY5H 1Z0MA 4OI9A 4KI5E 4Y2DB 1RULH 3BMWA 4RMUA 3L3OB 2VMFA 3V9FA 4FZEL 5JIKA 4EN3C 3ORJA 4YBLB 3VRJB 4XP1H 2BSRB 3QXVA 1C1EL 2G9HB 3FN0L 2X4UB 3G5YB 5IBUG 3DUSB 4B5EA 2PO6A 4U6XA 4Y4HD 3AB0B 1NCDL 1NGWB 2L4OA 2APXA 2PW1A 1IAKA 1P7KA 2VLME 3PIQB 5C07E 3LCYA 2R0LL 1TVDA 2ZSVB 1MCDA 2VR9A 4YEEA 3HZKA 5EBMB 4MQTB 5E0QA 5HHQB 5F9WB 4OLVH 4LCCC 2YD3A 4JFZL 2MHAA 2FZ3A 5DFVD 2E8ZA 3O3BA 5IROC 1FLTX 4PRHD 1KN4H 1XAUA 1FFNB 4YPGA 2WINA 1IKFL 2WBKA 4NPYB 5I19L 4EI6A 4JZNB 3LKQA 2OZ4A 4PRHE 5ENWA 5I1DB 4QNPF 3WIFB 4L1DA 4DFIA 1Q72L 3BZDA 5FYLD 1BQUA 4FMKA 4PJEB 4LCWA 5TH2A 5JNYA 3PL6D 4KRPD 1A02N 2EDYA 4OLXL 3FKUS 4WHDA 4NP4H 4G7YL 3RBGA 3KPSB 1KCUL 2HFFB 1U8QB 5ENWB 1JPFB 1F3JA 5HPOA 1JWUB 1MRFL 3D3VD 4KUZL 3BP5A 4JY6B 4JO3H 2UY7A 5FEBA 4MSWB 4RMQA 4F2MB 1X5ZA 1INQA 4JY4B 1RZKH 3E3QA 5DMGC 2X4SA 2ERJB 4G80A 1SM3L 3FQUA 3QZWG 1RUAH 4XPAH 1CGSH 3O3DA 1MCOH 1EEYB 2FD6L 5T3ZD 2VIRA 4YHLL 4P4KA 1CVSC 3QUMA 2I9TB 3HRZA 3IDXH 1NGWA 1JNLH 3GMLA 3T3PE 1FZJA 5I1EL 2CK2A 1NCWL 3O2VL 4FQXD 4G8FA 2HH0H 3D9AL 3EOTL 3DIFA 4R7NB 4ODXB 3G5YA 2BY2A 1BQLH 2P5EA 3ZKXC 3FQRA 1V3KA 2FR4A 4UB0L 2R2BB 4JHZA 5I1CH 1TCMA 5GRVL 2I27N 4W70A 1BIIA 5BZWB 1RZFL 2VUYA 1SM3H 1TTGA 4MXQD 3FB6B 1BZ7A 3PWPA 2AK1H 4UIKL 2FD6H 4RNRA 4ZNEA 4RQQA 3EYSL 3NTCH 3SDAC 4MAUL 1Z9OA 4F8QA 1JI2A 3KJ4C 1R6VA 3O11B 2DBJA 1UWEL 4P23B 4OQTL 3X3FH 3KXFE 4JFYA 1AHWA 1EK3A 5C09B 1AKJB 5IVXA 2VXUH 3O9WC 3WE6B 5C6PB 1H3PH 1CDBA 4W4NA 3DWTA 2PR4H 1KLFA 3NFPB 3GB7B 1W0VA 3B9KD 3DHMA 4TVSa 4TSCL 3O2DH 4U1HB 4K2UH 1RFDL 2DKMA 1MI5B 4YHMH 1UM5H 4P2RE 3HE7C 1EBAA 2WBJD 4GJTB 3BVNA 3CFEB 5GGSB 2ESVA 3LDBB 2AERT 12E8H 1KELL 1HHKB 1HSAB 2K1MA 2EE9A 5A40E 4XNYH 1LNUB 5EBWB 4MJ4A 1CDHA 2ENSA 1ZLVH 4MD5B 4QXTA 3O0RL 1J18A 2FECI 35C8L 4NQCD 1NC2A 1DUZB 4ZO7A 1WQVT 1TZHA 5IHZA 2CUIA 4X5WA 2WIMA 1FRGH 4F37F 3RUGB 3ZL4L 4HBCL 4PRPD 2AXFA 4NKIL 4CVWA 1I1AC 4PR5A 4O5LH 1OGTB 3QHTC 5DQDL 3AS0A 5CEXA 3MSPA 1QUNA 4EOWH 5E8OA 4CU7A 3UP1A 3QWRD 2FR4B 3ARED 5AWNL 1R3IH 5IP4A 1BOGB 3PGDB 1A3RL 3WO4B 5B4MC 4N68A 1KGCD 4ZQKB 1ZA3B 4Z78B 1YY9D 3BN9D 1EFXA 3GMMA 1UYWL 3IXTA 1R0AL 4ELMA 1PG7W 2UZIH 3EFFB 3L95B 3UTSE 1DZBA 3MUHL 1T22B 3VXOB 4WNQB 3DJ9A 3G9AB 3L3KA 4OCSH 3GSQA 3NAAH 4XI5C 3QG6B 4CW1B 2Y1VA 3TYGL 5CILH 1CE6B 2ADFH 2FL5B 2Z91A 3QEQE 4MCYB 4PJ8D 3I85A 4FQXA 5DD0L 3UJIH 1MVUA 4QYOA 3K1DA 1EHLL 4AT6A 1ZHLA 2OL3A 2BVQB 5JXEA 4OT1L 1D5MA 3K0WA 3RVUC 1NGQH 1Y0LA 2ZUQB 4JAMA 5E8NB 5F88B 1IGML 4G5ZL 4GRWH 2NXZC 2OL3B 7FABL 4GKSA 3UPRA 2D31A 3SE8H 1DANT 5EBLA 2MPAL 2ZCKH 4Y4HA 3ZKQD 2E7LA 1P6AB 3HG1D 5F7EL 2W60B 1FJ1B 2ESVD 1MPAH 4LDOB 3WIFA 2ZSWB 4WEMB 1D6EA 4AL8H 4WUUD 1HQRA 2X9WA 2ESVE 2VR4A 4M1CD 2H26A 4TUJB 4YH6A 3BDYH 4NZTH 3OR6A 1PQZA 1TZIB 1DL7L 5EORL 3VXPA 5AUMB 2P8LA 1CTNA 4JQVC 2DM4A 4RZCB 2D2OA 1JGDA 4NNPH 5TQ2L 4OV5A 5DRWA 3BXNA 1M7IB 1M6OB 4JRWA 2KZWA 1KPUB 4QWWC 4D0CA 4NWTH 1QBML 4GMTL 4DW2L 2MNUA 5JDSA 2QQLH 4M8QA 4Q0XL 2ED8A 4N0CA 2YPKB 5AD0A 3VI3E 1S7WB 1Y6NR 1Z5LB 4PRDA 3MRCB 5DVNA 3C6LB 5FOBA 3CU7A 1EHXA 3C6SB 4UQ2A 4LL9A 2CKBH 1I3RB 3BE1L 5I6XB 4M3KB 3TA3D 5LWYL 5MENB 2HVJB 5GS1C 2YPVH 2IH1A 2KBGA 4JKKA 5F3BA 4HGWB 4I3SL 4N8VB 2RCSL 5EUKB 1ORQB 3PXHA 5GSRB 4UILH 1JPTL 4MNQE 5LGJB 2MMXA 1DQQA 4J12A 3I6LE 1MY7A 2AP2A 1DEEA 4RA3A 3FFCE 4LRNH 3N1MC 1WITA 2Y6SD 1ZS8A 3PWUA 3QR2A 2R0LH 1CICC 4NQDE 1A7NH 5C2UB 4XP6L 1AE6L 2DI7A 3AREB 4N0UA 5SV4A 1N5YL 1IGJA 2UYLA 5JOPE 4PRPA 5ICYB 3JSSA 2QSVA 1NCCL 4NO3A 4U1NA 5IW1B 3D69B 2HH0L 3D9AH 3OJVC 3DV4A 4PV8A 3TBSB 4HS3B 1FZKB 3QNYA 4OLZH 3O2WL 1YMHB 2OXGA 4IM8A 3BPCA 3VFUB 3O4LA 1F4YL 1GVIA 1SVZA 1F6AA 1VHPA 3ROLB 5D1XA 3U9PH 5F1IB 4MA7H 4NUGH 4DKFL 4J3SA 2QEJA 1OTUC 4NNYB 2EYTB 4L29B 3DV6B 5E7FA 4NC1C 4WI7A 2DLTA 2SEBB 3VCLA 5ESQB 4NGHH 1U93A 5CP7B 2G5BB 1UCBL 4CRPA 5BVJA 1B4JL 2DN7A 5A16A 4LHQB 4ODTL 4P9MH 2YD8A 1GIGH 4ZDHB 3VXSD 4B50A 3WLBB 4L4VB 1J05B 3FQNA 5E4IA 5B8CB 2X4OB 1MFDL 4RMRA 5FAAA 4JDZB 5I76B 1LK2A 2JJSC 3BJLA 3LKRB 3SGJA 4HIHB 4YDKH 1RU9H 5I8OH 2AJXH 4YHOH 3WN5C 5C0NC 4OKVB 1LE9A 3BEWA 1S7TA 4XAKD 5C07A 4DZ8B 2F5AL 5E2VH 4X9IA 5FM5O 5KS9F 3AGVA 1AR1C 1BREA 1KJ2A 1DP0A 4APQD 4Q9CA 5CS7A 1AQDA 4R4BB 1I8IA 1P7QD 1GOHA 4G80B 4LOUC 5E1HB 5DRXB 4MD0A 5AAWA 2ZCHH 3E6FB 4LQFH 4XPBH 1MEXH 4GRWF 3EKCA 5A2LH 4XPTH 1M05B 4XNYL 5DJXA 3IKCB 3SKOA 5C0BB 3NH7L 5FYJU 3C60C 3QUYA 4DGIH 2ILLA 4RMSA 1EUUA 2VAJA 3BPOC 4KHXL 3NGBC 2P1YA 4Z7WF 3PL6A 4RNRB 3MLXH 2DWDB 2XIDA 4TRPL 4PJEA 5TH2B 3VH8G 1CICA 5CEYA 4ORGA 2R4SH 3S34H 1HHHA 3H9ZA 3O3EB 3F7YA 4OZGE 4HH9B 4K7FA 3V5HA 4UOW0 4WI8A 3RL2A 5BS0E 3LQMA 1P69B 4U1MA 1KIRB 4PJ9C 2ZP0T 2EC9U 3MV8B 5EIIA 1TFHA 2R1YA 4HWBL 1X9QA 4R7NA 3FT2B 4LSQL 3GHBL 3T4AB 4NWUH 1VPOH 1JGUL 2BK8A 2AJSH 1MCEA 4K3EH 4O00A 1R0AH 5HYQB 4MXVE 1SY6H 2QKIB 4OD2A 5L6YL 5HXMA 1UZ6F 4Z7UB 5IHUH 4P49A 2DLGA 4BFIB 2FH6A 2A38A 3LRHA 3MV7A 4GRWE 1NCAL 1WVZA 5IUSA 4N9GA 4WWKD 4Z18A 3I6GB 3L9RA 4JJ5B 3AREC 2ZUVA 4CMMA 1MH5A 3WHE1 1NJ9B 1T89A 3MO1A 1ZWIA 2NMSA 3HFML 4I77H 3EGSB 5C0CB 1A7BA 4EDXB 3AFLA 3WJLC 4PJEE 1ND0A 2QQQA 4OGZA 4OGXH 2DWEB 2QTEA 1A6TA 4UQ2B 3NABH 5FOBB 3TBVB 1VCAA 1S7WA 1FNSL 1G7HB 4BZ2H 1NKRA 4G6JL 5FCUH 3SQBA 5I6XC 1LK3L 5FM5M 4PV9B 2VDPH 2F74B 3W0WA 4KKAD 1OAYL 3CVIH 1CN4A 1OD9A 4BH8B 3FRPG 2I07B 5BO1L 3VXTA 2Y36L 3EFDL 4TVPE 4P2RA 3IDNA 4TPRH 2BVPA 1UZ6E 3HPJA 3SCMA 3JWDL 1QBMH 4GMTH 5D7IF 4PD4J 4Y5VC 3RY4A 5SX4I 4G6FB 4LEXL 3GSRB 5E6YA 3WKMH 3VGAB 1ADQA 2W60A 3V5DB 1XCTB 3Q1SL 4YHYC 2DOCA 1AGDA 3MFFB 1HWHB 2V2XB 1ODAA 1CIDA 3TPKA 3RTQB 3PWPD 2YUVA 4XNUH 1YY8B 2N4IA 3GBNL 1WIPA 5F8QC 3CXDH 3IJSA 2NTFA 3EJYD 4MNQB 5T1LD 1U93B 5CP7A 1QLEH 3HC4H 3QWOA 3I02B 4EUPB 2B4CC 4AT6B 3DV6A 4D3CL 3MV7B 2EYTA 1SYSB 4X4ME 5C8JB 1UXSA 1A6PA 1FDLL 4CMHC 2OCFD 2J1KA 4HKBA 1IGFL 4L1HA 4H8WL 2DM2A 4MHHI 4PJGF 3MR9A 5DUMH 1A1MA 3A6OA 1ZMYA 3IAPA 4LSTH 3HCVA 3MXWL 5K9OA 5CIPB 5L2KB 2BX5A 3GBNH 1B88A 4N1EA 4HK0B 4JO4L 1N6QL 3HRPA 1JGVL 2CQVA 3BKCL 4I4WB 5M7QA 4ZG1A 4V3DB 1HKFA 4AH2A 2HJKA 4ODVH 3RL2B 4DEPC 5CBAB 2YOCA 3MOBH 4N0YH 1YEDB 2B4CH 4JR9L 4QY8B 3BE1H 1OGTA 4EIZC 1KIQA 2IGFL 4J1UB 3IXAA 2R0WH 2AVGA 5CLTA 3VXUD 3K4ZA 3QWQB 3TYFB 2PXYD 5T3ZH 4ZD3H 1IKNA 1V8HA 2AEQL 2B8OT 4LAJH 4H8WH 1K8IB 4KKBC 3BP7A 5SWZE 3RWJB 4E42A 3E6HA 3MRKA 4FFVC 3RWDB 2IH1B 5F3BB 1LP9E 3VXMA 4C56D 2B1HH 2MQ3A 2NXYD 1BHGA 1AQKH 2HAZA 1OP9A 1S7QB 2VLJD 5CMAA 4NRXA 1YJDH 5DVKA 4QXTB 3BP7B 4HUNB 3RWJA 5IQ9A 5DEFA 5C0BD 4U2YA 5H37H 4MLIA 4LBEB 5HHOB 4JR9H 3C5SA 3FRUA 1KIPA 1A64A 4KMTL 4QTIL 2ORBH 4ZFFB 3V8OA 5DVOA 3SKMA 5C0IB 3TH4T 3BVNB 5HYSB 2ZUQC 3VXPB 3FN0H 3GHEL 4Q6IB 4YAQA 4UBDD 5MEPA 4IHOA 5EUOF 3FO2B 3PHQB 1YEKH 5C0AB 4D9RD 1KPVB 3QDJD 3GIVB 2EDFA 1F42A 2WSKA 5ICXA 3X12A 5HY9B 3MBEA 2XRAH 3U7WL 1BJMA 2YN3A 5GJTL 1OOAA 4HIHA 5HDBF 2BOCB 3LSOA 1YJDL 3K4DA 4HULB 1R3KB 1GZQB 5L7XH 4M93B 1UEYA 4YGVB 1G7PA 1ZLUK 4NCDA 5BJTA 1XCQB 4RFEA 4F33A 4X8XA 4N1HB 3GI8H 2YA0A 4M4RA 2NZ9C 1XF2A 1EVUA 2W1NA 5IBTH 4OF7A 2P47B 2NY2D 4Y5YA 4LLYA 4NUJA 1YYLL 4YE4H 3Q3GA 5MHSD 3OJDA 2NY7H 3SE4C 5ACZA 4NNYA 4BM7A 1R3HB 1DEDA 1I1AA 2OTWB 3KYKH 4QRTA 5D7SL 3FB5A 4EBQL 3X3GL 4NQVB 3KGRA 3BRDA 4YFDB 1U36A 2R0ZH 2OMNA 3SBWC 1SBBA 4WWKB 3WXWL 1JK8B 1A6WL 2OTUA 2WUCH 4OF6A 3L7FB 4R26L 3LHPL 3MFFA 4JDVB 2RQ8A 2FX9H 1BBJB 4HF5H 4PJFE 3D69A 2A6JB 1IC5L 4AG4L 3QUZC 2IG2H 4F15C 1LO5A 4NC0B 5GQBA 5FF6B 2OJEB 5CEZE 1JNHA 3WNLA 2F54B 3PDOB 3CU1A 2IPTL 1G7QB 3TEUA 1ZVSA 5IROA 3MRJB 2R1WB 2H6PB 3V7AE 1IAIL 1EGJA 5MI0B 2AJYL 2UZYB 1KPRB 4LCCA 3FB5B 3X3GH 4TULL 4TQEL 5CJ8A 5DI8B 3PP3H 1IL1B 5DHYB 1AXIB 3IFLH 3G5ZB 3SE9H 1UWGL 2P5EE 1WGOA 5IGXL 4L3EA 5D7JC 4XCEB 1GGBL 3ULUF 3FHQA 3ZDXE 2O5YH 3MRHA 4OSUH 2W9LA 3P0YL 5E03A 1RK1A 3LHPH 1V3MA 2ZOKB 4LVOC 4NYLB 5EN2A 3MXVH 4U33A 3SPVA 1WZLA 4GSDL 4OGXL 3ZE0E 3N9GH 1PKQE 4MNGE 5HPMA 1T0NB 4WFED 1A22B 3G6DL 2OI9A 5E6ZA 5BJTB 1XGRB 1G7PB 2CDGB 2AABL 4OZIA 4P46D 1IL1A 4CJ0A 1ZANH 1ZWIB 5LGKA 4AIZB 3EGSA 3PWVB 4RFOL 1BZ9A 4NQED 4YK4B 4EDXA 3P40A 3SJVE 5C0CA 1PSKL 2FEDD 5IW3A 4JRXA 5E9DE 1EXUA 1PY4A 3X12B 4XMKL 2WWMD 4UTAL 1FFNA 4YDLC 2E7LE 4HUXB 1TZIA 3MGAA 5GRVK 1CFVL 3HZVB 3D18A 3PWLB 1LD9B 1BX2B 4P3DA 4OD1L 2KH2B 3V6ZB 1NCAH 3PGFL 3NFPA 4RIRB 3MTRA 1KIPB 1MHCB 5A43C 3CC5B 4UI2A 1RIHL 2OSLA 2IADB 5FHBH 2WQ8A 2YPLD 1DVFD 1HOCB 5B38G 1CS6A 5EU7E 3TO2A 1QFWM 3UDWC 2J12B 5IBLD 3QUYD 4OZGF 2A6DB 3MRQA 4LVHB 3T4AA 1HILA 3DVGA 4J3VA 4RAVB 4NRYA 2GHWB 4X9GA 3TPUB 12E8L 5E8NA 1Y0LB 4YHNB 4HH9A 3NA4A 4K7FB 2Y06H 1ZLSL 1K8IA 3OB8A 1BECA 2O5ZL 2P8MB 4L4VD 1G6RB 3UTTD 5D1ZD 3TYFA 2UUDK 4HIXL 2P43B 3RNQA 4OZGA 3KNBA 3ARYA 5F7KC 4NO5A 1BQSA 2GFBB 4C4KT 2OL3H 3ULUC 2R1XB 4DVBA 4WEBL 4J2XA 2HVKB 1FCGA 2DWDA 1G1YA 3BW9B 3HC0B 4JFFA 1UB6B 5LGHL 4OFPA 2FX8H 1D5BB 1FIEA 2VISB 3EDFA 1BBDL 3S7GA 3ILQC 4HWNA 3EW3B 1NAKH 2C1PB 4JVUA 2YMXH 3E2HC 5EWIL 1EGJL 1K6QL 5F7EH 5CJXA 1G9MH 1S5IH 4MA3A 3FFDA 2OR8A 4C59B 3WEXA 2FGWH 3QXAB 2NR6D 2NXZB 3OJMB 1X5LA 2VSDA 2VXSH 4DGVL 1S7SB 5JW4R 4K7PH 2YPLB 3HPLB 4ZTOH 4LSRH 3UPAA 5E99L 5HHOD 5TQ0H 4OM1H 4WW2A 2H41A 3IDUA 4NZUL 1ZA6B 1L7IL 5AYUL 4NNXA 5C0CE 1LEIA 4A2MA 2WIIA 2VNCA 4JRXB 1A1OA 4TUKH 1RUQL 3AS2A 3FMGH 1FFPB 3BD5A 1LK2B 3IDIB 1S7UB 2CUMA 3NIDE 2P5WA 4NBYB 4FXGA 4NQEB 4I0PB 2Q76A 5EU4A 4FQLL 4K7PY 5EU6E 4EN3A 4AEIL 3R06B 5CJQL 43C9A 3FB8B 4XTRD 3FQXA 2WINB 5CBAA 5HPMB 4QTIH 1FP5A 4GOSA 4YQXL 4Z76B 5DRZB 2C5DC 5HVGB 2MHAB 1G9NH 3TZVC 4JKMA 3MV8D 2XWJA 4NRYB 4P46A 4PJ5E 5ESAB 4BSWB 3PV6A 1W0VB 4ZMAT 3HCVB 4Y7MA 3RU8H 2XXMB 4MJ5B 2V5YA 5HDQH 1E4XL 3SDCC 5F1IA 4Y4KB 3IDYB 1YMHA 3PL6C 3ROLA 1BMGA 2NY5C 4MVBA 1FZKA 2MWCA 2WY3A 3FTGB 4RGOH 3RX8A 1X4YA 2A74B 2WAHA 3RPIB 4D2NA 5IVXB 4WFFE 4HUVA 4U31A 3C87A 3TBSA 4V2CB 5IHLB 1ZVHA 4RAUB 5FKAB 4HBQA 4M7LT 2VABA 3GI8L 5TFSH 1S9VB 5EU5A 4YQXH 2NY3D 1RUAL 3C5ZB 3PJSA 4XPAL 4ZS6D 3T3ME 1G0YR 4X7FC 1RI8A 1H3TA 1KCKA 4NKMA 1ZS8B 1I9EA 5LGJA 5C86A 5A2KH 4G9DB 15C8H 2H2SC 3O6KH 3RNKB 4KJQD 4GFTB 4X6CF 4YBQD 1NUNB 5EU5B 1XR9B 4YHKL 2IEPA 2ORBL 1NMBL 1RZ8A 2VDKH 2PW2A 3Q6FA 4UB0H 2C4FU 4UILL 3WJJC 4DOHE 5CIPH 4U05A 5HDBE 3QULA 5SX4H 3MJGX 1EO5A 3VGEA 4KKLD 5SWSB 1KCGC 4QRRE 1HZHH 2FH8A 2A73A 5EO0B 4XNMA 5EUOE 5F1KC 4S10A 1TJIL 1TQCC 2VITB 1M7IA 1NMCB 1C5CH 2OR9L 4JKPL 5DRZA 4OQTH 4NQXA 2BOBB 5FO9B 2XWJB 2AXGB 1ZGLA 3U36B 1UWGH 3NOIA 1CDCA 3R06A 2OJEA 2GY7B 3MRPB 3ARBA 3ZSSA 5KVFH 3TJHC 1DDHB 4TVPL 4PRNA 4G9FD 1S7UA 1NAMA 5D8JL 5CEYB 4LPUA 2Y72A 3D39D 4PJCB 4L9LC 2OQJA 2B20A 4PY7A 2Z8SA 4KI5F 3W2DL 4KZDH 4EI6B 3Q6GL 1JHKL 4KHXH 5I75C 2HMID 2XA3A 4X4YB 4LAQL 1S7QA 1RZ7L 2WBJC 4PJHB 4UQ3B 3ARDC 4FQQA 4WUUE 2FBOJ 3LMJH 3EJZC 1XF2B 1ACYH 5E70A 5EU6D 3F7QA 2ATPA 1AC0A 5T33L 2FBJH 1A6AA 2H1PL 5HYQA 3QG7L 1XGYH 1CWVA 1H15A 2CO7B 1U3HB 4J3WA 3X3FL 5E2VL 2HJKB 2BOCA 5F7UA 4YO0A 3N85H 5E08H 2C1PA 1IAIM 2BSRA 4JFXB 4PIRF 3NIGE 1SYVB 4KRMB 3L3OA 5MEPB 1QFUL 1HSBA 4MVBD 3HNTH 3OKOA 3MBED 3A0OA 4LEOB 1CDUA 3LB6D 4L4VA 5JW5B 1ZTXH 1IARB 1OAKH 4I0PD 1KYOJ 2AXFB 2AK4B 2YRPA 1KENH 1OT1A 1UA6H 3UTQB 3DX8A 3ULSA 1QTYT 1X4XA 4LU5H 4F57H 4IMKC 4HKJA 3QWOB 2W9EH 4ZUTA 4MQSB 3RWCA 4LSUH 5C0BA 4DAGL 3ILPA 3B9DA 1OAQH 1V3JA 4JRYD 3DVGB 4EI5C 1MIEH 1OGAA 4P2QB 2ESVB 4PJ8C 4XXDA 4WV1A 3U4BL 4RWYH 3I84A 2O93L 5C71A 3V6ZA 4PREA 4LLMB 4QTHA 4N9OB 3WIIL 2B2XH 3AVEA 5JLZB 1MI5E 2CK0H 4OCXL 2XKSA 4M6OH 3TESA 4HS8H 1I3GH 2D9QB 5KSUA 4L4TB 4X6BA 4LU5L 1NFIA 3FO9A 2BVPB 4HZLB 4O5LL 1PG7L 3BOVA 1I8MA 4L3EE 3BKML 5DGRA 3S37X 2YD2A 1AGFB 4NDMB 4CDHA 1CGXA 4OJFH 5FGBA 1J05A 4ETQB 3HR5A 4XZUB 4G6AD 1J0YA 4BQ9A 4NJ9L 1X7QB 3BGMB 3T04D 5ITBL 1MUJA 1WCQA 4MZ3A 1DTUA 1UXSB 3O4LE 1CFQA 4ODHL 1XF5B 3OKNB 5TQ2H 4EUPA 2BFVL 1H0DA 3ZO0A 4L3EB 4PRHA 2PYFB 5D2NA 1U41A 4AQ1B 4OM0H 4D0CB 2B0SH 4AEEA 1OQXA 1IGCH 3O4LB 1BIIB 5BZWA 1MIMH 1P4BL 4EXPX 4S1SH 1EHLH 4OCYL 4KH2A 4NHCH 4ISVB 3BXNB 3QNYB 4LEOA 5CKAA 4ONOA 4ZXBC 3GJFA 4H26B 2H9GB 4AMKH 1DVFB 3FQRB 3MRJA 3G08A 4GAGL 3W9EA 5ISZD 4J3XA 3FL7A 1TMCA 1UJ3B 4PJDF 5F96L 3RY6C 3V4PH 2XACC 5JXAH 4GRWB 1GAFH 1MF2L 1ZHNA 4ERSH 5GS1B 4JDVA 4DGYL 1UENA 5HSFA 4QHUA 4AK1A 4L9LB 2A6JA 1DVFA 5AYUH 1JPSH 2C3GA 1KF9B 4Y4HB 1I1AD 1JRHI 1MNUH 2J5LB 2VDQL 4HWUA 3RIFF 3HB3C 4U6TA 1MCKA 3M17A 1JF1B 1KLUA 2PTUA 3QSKB 4LEXH 4HLZG 5FO8A 5EU7C 3I3DA 2V5MA 3HZYA 5GGQL 1N2RA 4B53A 4ZTPL 1XGPA 1J7VR 3MRIB 3Q1SH 1NC2D 5JHDA 2FECL 4LLYB 1U8QA 3NCCB 4NUJB 3RWHA 2W0FB 2R56L 5GJSH 4J7RA 2LVEA 4NQEA 1N6VA 1SJVA 2HFFA 4ERSL 4BA8A 4CW1A 4LCYB 2YD1A 3QG6A 4MA7L 4NUGL 4FQ1L 2GITB 3OJ2C 4RAHA 3QI9B 1I3UA 4HMCA 4A2LA 4G6AC 5JIHA 1JFQL 2X4NA 4IEFB 2UVFA 5GGVH 3RVWC 2BP3A 3T77A 3S37H 4PJ7E 3WCYA 4OLEA 3P3YA 4OLVL 3HZMB 3O2DA 2BJMH 3VFGL 1QFWL 2APVA 3MLYL 5E2TH 4M1DL 5T1MA 4Y1AA 3DXAE 3FOLB 2W92A 4O2FB 1UJTA 4U7MA 3ZTJH 5HHQA 1Z0NA 4W6WB 1L6XA 1IKFH 2K7PA 1IAKB 1P7KB 1CDJA 1N64H 3CDFA 5KSBA 2A73B 5EO0A 3ZE1F 5KTEL 2RHEA 3D2UB 3MV9A 5C92A 4HMEA 4EEEA 5EBLB 1KTLB 1OT2A 4NC1E 4LVEA 4FQ1H 15C8L 3C6LC 8CGTA 1QEWB 3QQ3A 5J57B 1Q1JL 4ONFL 1DBBH 1MHHA 3RUGE 5JA9A 1LE9B 5C6TH 5CMAB 4OLZL 4N5UA 2YUWA 4CVUA 4U1KA 4Y5VA 4LAQH 3MV7E 5HYEA 4E41E 2GFBA 1LO0H 3VWJC 3I50L 5KJRH 5J13B 2HLFC 3U6RA 1MEXL 5LBSL 4XPTL 5D5MF 3LAFA 4G8EB 4TYUA 4ZO6A 3C09B 3FB7B 5GS2H 4P5KB 4HWEH 4HK0A 3CFKA 5TDNB 1J1OL 2NY4C 4XNXH 4XC1L 4TVPD 1QFPA 1OF2B 2OP4L 3CJJA 1ORSB 4FFVD 1QSED 4KMTH 5K9OB 1IEAA 4X9BA 3DGGB 2R4SL 2PXYA 5ALBL 4L8BA 1FBIL 2QHRH 4PR5B 1GYAA 5DD5L 3REWA 1A6AB 1HYSD 2EC8A 5DJ6A 1ZK9A 2R2EB 4J8RA 1ZT7A 2Y6SC 3I3BA 4P2QE 3LQAH 4XP4L 5TJWK 4JB9H 2X41A 5TDNA 4PRPB 5ICYA 4FQQB 3VDAA 3ET9F 2Z92A 3AREA 2CIKA 4MNQA 4RDQG 5C07B 3BPNC 3EYSH 3NTCL 3CFBA 1KENL 4M48L 4X6CB 1GC1L 2R4RL 2IPKA 4JPIA 3ZYOA 2HT2D 1SMOA 2Q76B 4UBDC 2NTFB 4ZAKC 2P5WB 3V95A 3IJSB 5DSCA 1IEBB 3QUZD 4KJYB 1PY9A 3LMJL 2HTLC 2W0LA 2OQJB 4PY7B 5SWZB 1OAQL 1BF2A 3TO4B 1JYWA 3P9LB 1RHFA 5DJ2A 3LEXA 4WW2F 1RK0B 5GISL 4MVBC 4FQIH 1H8NA 3L5HA 2VRAA 2NY7L 3GUTB 3HE6A 4M6NH 4MB5A 3UTTA 1I3RA 4XHQA 4UAOC 3HRZB 3BP6B 1FORL 1Z5LA 1DQDL 2NY3B 2XWBA 3T0EC 3GGWA 1NAMH 4HX1B 3GB7A 1EEYA 4L8SB 3IF1B 5AG9A 3EIFA 3MMEA 3ZKSD 5IR1B 3FQUB 1AD0A 4JG1L 2HLFD 1QFUH 3WS6C 4XMKH 3IFOA 1BGXL 1DQJB 3AXLB 3ISWA 3IS0X 1K9TA 2QV2A 2P8LB 1S9WB 2DQFA 3W0WB 2EO9A 1FNSH 2RR3A 3TBVA 3QXUA 2VZTA 1G7HA 3KPMB 5CGMA 3GKZA 4U6YB 4POZD 2HG5B 1EJ6A 4AENA 3FB7A 1HQRB 5ITBH 1G7IA 2V9TA 2W9EL 5J3HC 1VACA 3VGGA 4XPFL 3MV9D 5IQ7L 2E9JA 3ZL4H 4OD3L 1HYSC 4OGAD 2YA1A 2JCCE 4OZGB 5E2WL 2Z9TA 5ADPL 1TJGL 2DM7A 3V52H 4N8VA 5JHDB 4Q2ZB 1SJHB 4PJFA 5JW4Q 3O3UN 1K3ZA 4KZEL 4JFOA 4GW4B 2JJTA 1MHHB 1ONQB 4PJDB 3ERYA 1T21B 2ZSVA 5GGVY 2E3VA 3QDJE 4OKDA 1KC5H 1A4KB 1I7RB 5IMMA 3U79A 1A9EB 5KSAC 1JHLH 1YNKH 1T22A 3ZKXB 4XB7A 1BVLB 1ZT4B 3QDJB 4JFOB 3BYYA 1WCBA 4NJ9H 3CFDB 3V5HB 5EBGA 4WTWA 4PJFB 2CD0A 5GZND 3QBTB 2FX7H 3QUKA 4G8GB 3FAXA 5CD5D 1S7RA 1ADQH 3U83A 2YC1B 2PTVA 4X4XA 2Z31C 3C8KB 1J8HE 1QNZL 2FIKA 4LCWB 1N6UA 4UMGA 3STLB 2UUDH 3F58H 1O0VA 2ZCKL 1HXYA 4C55A 2G5RA 4NHCL 2J6EL 4PRHB 3U1SL 2NY4B 3GKWH 2FRGP 1LEGA 4IJ3C 3TBWB 1I9RH 4JQIH 3UPRB 2OS7A 2DQDH 4AENB 5EOTB 2D0GA 2HG5A 2KQNA 4MA8H 3OTTA 2NNAA 3MRIA 3OG6B 3SKOB 2X4PB 3V2AR 4M6MH 4LNVA 4NBXB 4E42B 1JYNA 1B3JA 4ELMF 1DQLH 1ULVA 3S98A 2VLKE 3CXDL 3HZKB 5DHYA 3VD5A 4MD0B 2X10A 3WEXB 3IAQA 4FXLA 3HNSL 2XV6B 3IFNH 5DK0B 3H9SA 1MNUL 5FM8A 4KK6C 2V7NA 3BKYH 1IGTA 3AMLA 4I3RH 4Z7VF 3BWAA 1EFXB 3TVMC 4LLMA 5KANG 3V4UL 3OKKA 5J6GA 1NCBL 1BBJA 4PJXB 4OFKA 2N56A 5GJSL 1C7SA 4KQ4L 5DUPH 4N0CC 3O6FB 5ACMA 3QIWC 4UZGA 1JMXA 5E99H 4OM1L 4MAYA 5L88H 1KN4L 2EDOA 4K8RH 4ZUTB 4JFYB 5DJ8B 1GGTA 3RQ3A 1JFMA 4R4ND 5IFHH 2SEBA 3AAZA 4U1IA 3O11A 1F3RB 3HG1E 2P46B 4PJIA 2B5IC 2BSTB 3UJJH 4U0RC 5F7DB 2EE3A 5F7WC 4Y4FA 1NC2B 2DQCH 3A67L 5CEZH 4N8CH 1XCQA 5D1XB 3RVXC 3JWDC 5C08A 5L8LB 3KPRD 2EKJA 2YD5A 4W6YB 1MRFH 2D9CA 2OSLB 1NH6A 3SBWA 4P9HH 4ZFOL 3QXDB 3FFCA 4R2GB 3EYFB 1ZLUH 4HZLA 2CIIA 4Y4HC 4RIRA 3R8BB 1NFIB 1U8IA 3U9PL 5IW1A 1NPUA 5F6HI 4HJ0C 3CFKB 3GJFK 1AC6A 3LQAL 4HZAA 4G8FB 2WP3T 1FC1A 3PWUB 4YK4C 4OIIH 3DRQA 4NCC1 1LILA 4X98B 4GW5B 2QLVB 4GAFB 3DECA 3TA3A 5FKPB 4K07A 5FYKU 2V2TB 5EUKA 5CEZL 1EV2E 4RGNE 2NY0B 3RAJL 2QL1A 5D1QD 1QBAA 3U4EA 3X14A 2P5WE 2CJUL 4G3YH 2GT9A 2C3XA 1BQHA 2VXTH 3BT2L 1FE8H 1JGEA 3C6LA 3OAZH 2J3SA 5K33A 1QOKA 2APTA 1EUTA 1PX3A 3MRDB 2BVTA 3L3IB 3IDGA 4KK8D 4MZ2A 4RQQB 3NCBB 4F37K 1CGVA 1FG2B 1LO4H 4PRBB 3D85B 1MAJA 2IAMD 1P5VA 4JG0H 5I1DA 2FHBA 3D3VA 2ZUXA 1L9NA 2J88H 5AUMA 3U4AA 4LQFL 1E6OH 1EEUA 4NQCB 3HZMA 4U0RB 4M3JA 2FZ3B 1TPXC 4TUJA 4DGIL 2Q8BL 4OTXH 2WNGA 2FBJL 5B8CC 2EDQA 3QG7H 1TIUA 4UV4L 5I18H 4BFGA 3QFJD 3MR9B 2P7TA 1A4KA 2OI9C 4P4KD 5E9DB 1MELA 1T21A 1MREL 3CPLA 3LKPA 3CLFL 1GPOL 3UCRA 2PO6B 2DRUA 1CGWA 1LDSA 2CRIA 4QXGL 4PRAA 2VLLA 1NMAL 1A7RL 5MENE 4IOFC 4IIQA 1RQ5A 1URLA 2PW2B 3ZKMD 3TIEB 4KTYA 1RZFH 4TQEH 2E27L 3EOAB 2XZQL 5CLWA 2Q8AH 1DVFC 1JHKH 3NCFB 1VACB 3JVGA 4UV4H 5F6IC 5I18L 1UWEH 1GZQA 4R0LC 4HIIB 4XBEL 5E00B 5L6YH 1DSFH 5H94B 1DBML 1P4IH 1ZHNB 1GGYA 1JRHL 1FYTE 3O9WD 3EFFA 4YPGB 4QGTA 5FO9A 3GRWH 4ODBD 4LDLB 5E8DL 5HJ3A 2BOBA 4RRPA 4JY5L 4M5ZH 5FUCC 2VITA 4X8JB 4P2RB 1MHEB 2Q7YA 4OIAA 5TE4H 3ME0A 4LKCA 3RGHA 3MJ9L 3LKSB 3FO0H 4GO6B 1BEYH 3CMOH 4EOWL 3SE4A 2EIZB 3WIIH 3OR7A 3GMRB 4GKNA 1A3RH 1ADQL 2VLJA 4TUOB 5IR1A 4Y4KD 3BD3A 1OTTD 5IHZB 3VMNA 1MFBL 3F58L 4PGBA 4U6HB 1CFQB 3V52L 1DUZA 1JNNL 4Q6YA 43C9B 3MRLB 5EFIB 2C3HA 3MJ7A 1TCRB 43CAB 5KSAD 5BOPA 1AXSA 4S0UC 4OCSL 4MD5A 3LEXB 4ZSOA 4KZEH 1X7QA 3B9KC 4QHLB 5BQ7A 5J1SC 3MQIA 3LKRA 4LSPL 2W65B 1MFEL 4JY5H 3MRMA 4KJYA 1CL7I 1TQCB 2R39A 4P4KC 5SWZA 3WLBA 3Q2CA 4BZ1L 4WHTB 5IEKA 1HHKA 1MWAL 4CMMB 4ODHH 5DD3H 1WWAX 4NFDA 2MOVA 3GZKA 1CIUA 4HEME 1TNNA 1UWXH 4OFIA 3TFKD 1JHTB 4HKXA 4KJPC 4U1HA 3QXAA 1A6UH 3GIZH 4K8RD 5CJOL 3BSZL 5IB5A 3B2UC 3DYOA 4AMKL 2CK0L 3DMMA 2H3NB 1YY9C 3QUML 1YNLH 1MJUH 4B0MM 3ELAT 1I3GL 5IB5B 2GK0A 3BPOB 1PAMA 2VC2H 4OZ4A 2HWZL 2QQKL 4ORZC 4CGTA 1OCWL 2HKHH 1KXQE 4U7KA 1ED3A 1C08B 1FFOA 3MREB 3KHQA 2X4TB 4G8EA 1PEWA 4G7VH 1DBAH 4KFZC 4CN1A 2VDQH 5DO2C 4MDJA 4OCMC 2JLLA 2AK4E 2R29H 4XH2A 2CSPA 3H9YA 5LAXB 5TQ0L 5IBLC 1IGMH 1CFBA 1KJVA 2CLVB 3BX7C 1XEDA 4RGNB 5I8KL 4QHLA 3ARGA 3QUMH 3MCG1 3ZYZA 4LIQL 3NIDF 4LSTL 3TPUA 1YEEH 4ODXA 1EHAA 4RAVA 4BK4A 4PLKC 5T1KA 5I19H 4P9HL 2PO6C 3MJ7B 2XPGA 3MX0A 4IRSD 4ZYKA 1HILB 5C0RH 4LFHG 4YO0B 2EICA 4JFFD 4KVNL 5E6IB 1E6JL 4OCYH 4P48A 1MHPL 5IF0B 1BQHG 3DETD 3MV9B 4I0CC 1HINL 2IJ0C 4GG6A 1L8JA 4DN4L 3ZTJG 4G7VL 3SDXE 4GAGH 4ZOAA 5KSBB 1YQ2A 5ID0B 5F1NA 5I30L 3FOLA 4O2FA 3RZCD 4MD4B 3T8XA 4N90E 4RZCA 3W82A 1UM6H 4GAYB 1EFQA 1MHEA 4MX7B 2Q7YB 4MSWA 4QOKB 3BEVA 2YR3A 3BP5B 4ZAKB 3RAJH 4MJIA 1INQB 1NCDH 4JY4A 1CT8B 4JEGB 3LRSB 4PGCB 5ABDE 1D5BA 2VISA 2VQUA 3GBMH 1D6EB 1HZHL 3KLSA 3FONB 2GITA 3HC3H 3C5JB 4KKLC 2D4DA 4X7SH 1ND0B 3CVHB 4LCYA 1WTGT 1UXWB 4S1RH 3RP1A 3FQNB 1J88A 1KV3A 5TDPA 3STBA 4S2SA 1DJSA 4DWHA 4UIMB 1T2JA 5EPMB 2FJFB 5KVFL 3O3BB 4NN6B 4BSVB 5FYKL 1OTSD 2DLEA 2FSEB 3VA6A 4DN3L 4EQ3A 2EYRA 1HI6B 5CKGA 4NQXB 5D8JH 1LEKB 1YEKL 2NY0C 4IIQB 4N1CA 1N2RB 4Z7NF 1MVUB 2DJUA 3JWOC 4AIOA 3D39B 1JFQH 5INCB 2GTZA 5I2IB 4AYFA 4QHKI 4OFYD 1ERNA 5HGDA 2VDKL 4OB5L 3UBXI 1AI1H 4KK8C 1ZEAL 3QULB 3MLYH 5E2TL 1J1OH 4ELMB 3MC0A 4NO3B 3RDTB 1V5JA 2QQNL 4X5LA 4LPTA 4LKXA 5F70A 5GGRA 2CXKA 5KTEH 3OQ3B 2O5XL 4POUB 4WWKA 3MNWB 4C56E 4HPYH 2IPUK 5J6HA 1QRNA 1B6DA 4YHLH 3D3VB 3UO1H 2ADJA 1NSNH 1CLZL 3SCMD 4AIXA 4XWOC 1NCWH 2ZUUA 3O2VH 3NH7H 1FVDA 2CDGA 3QNZB 1VEPA 3GMQB 3U0TA 4OLYH 2RGSA 3PL6B 5C2BH 4YFEA 5TE6L 2AJZB 2C7UA 4FP8L 4NKDA 2BVUA 2X7LA 2BRRL 3SPVB 5BXFB 4GUPA 3BGMA 3MLZH 3EOYG 4H88H 4HCRA 1UKSA 4PS4L 5C08E 1JGEB 4KVCL 5I74C 3KLAB 1RSFA 2EH8L 2CDFB 3G5ZA 3BDBA 5B38B 2AK1L 1BP3B 4I0PC 2H2SD 4KRLB 1IAIH 1LP9F 3BHBB 1TITA 1AQDB 3LRGA 2OBGA 4P5TD 3TA3B 2JB6A 1C16A 4F57L 4PJ9A 5D7IA 4L9DA 1CD9B 3SGKA 1KBGH 5CZKA 3VWJD 1DQDH 3RGVD 2XN9A 5CWSA 2DQTH 2HFEA 4XX1G 3EO1B 4RGNC 2VXUL 5C7XL 2BC4A 1UWXK 3BKJH 2P8PB 1Y6KR 1H3WM 1Y18A 1U3YA 1LVEA 4ENED 4JFQB 5D2LA 3PXJA 3MUGB 1WBYB 4CU8A 3DXAB 5DC0A 3AB0C 1YN6A 3LS4L 4NQVA 4N8PA 2CH8A 5C09A 1AR1D 2OR7A 3O6FC 1B90A 1A7QH 4YDIL 5IVZA 1UYWH 3VFWA 1OSPL 5FK9A 2R0KH 4IRJA 5T5NG 4FXKA 3DX7A 3BKMH 1KCRH 4S0SD 3PWPB 3KS0J 2LU4A 4UOJA 2VZOA 4OD1H 3VWKC 5HHVH 3VFOB 3ZYIA 2Z8RA 2XWTA 2WBWB 1HSBB 3QDMB 2PXYB 4GXUN 1I3VA 4OT1H 1I4FB 3NABL 4HJGA 2R2BA 2E7LC 4WJ5B 3CIQA 4ZAKD 1FRGL 4G6JH 5FCUL 2M8XA 2Y07H 1P4LB 2BNRD 3R8QA 3P4NB 1U3HD 3GIVA 1JGUH 1SEBA 3BJ91 1A7PL 1JPGB 1OAYH 3PHQA 3QCVL 4PY8J 3PQYB 4MJID 5C0JB 1JJUA 1KC5L 5C0EA 2APWA 2DYPB 3OKMB 2ATPB 5MEQB 3ALXA 1EO8H 1DEEB 4LGSB 4XC3H 2V17L 1MFEH 5E6ID 3T0ED 1RZGA 3JV4A 5J13C 2P8MA 2XZCL 2RAMA 4U1SB 3ZT7A 2VLRE 4F2MA 3TJEH 4YIQA 2VKXA 1U3HC 3QEQB 5FV2A 1IEHA 1JVKA 4OI7A 1QEWA 1BPVA 4WI9A 3ESVF 3MRQB 3W9DA 3FT3B 4NO0A 2FYYA 3VGDA 4JM2F 1TNMA 2FEEL 2BNUB 3MRFA 1NAMB 2QR0A 1X5XA 5D2LB 1DDHA 3FCTB 4JZNA 2CKBL 4AH2B 4M7ZC 3RZCA 5DK3A 1IC4L 5E56A 3V0VB 3PWLA 3TT1L 5H35B 4O58L 1WCBB 2BXYA 4XCFH 4QRPB 3LS5H 5DUML 5F7YC 3OHXB 5IMKA 5GGVL 3VFPB 2CDFA 1NDMB 3BQUA 2IAMB 5B38A 3G6AA 4JO4H 1DLFL 1AKJA 1KOAA 4F7CA 1NANI 2NLJA 4Z0BH 4KKAC 1N5YH 1A2YA 5EG6C 4KGJA 1QVOA 2JIXD 1WEJH 1JV5B 1OM3L 5KN5A 3L6FB 4LHUG 1XR9A 1RK1B 3RZCC 4DEPB 4M7LL 1IVLA 1MFCH 1MLBA 3Q6FB 1J8HD 4X6EA 1JF1A 4XNUL 1TVBB 1UH2A 4DW2H 1HN1A 5IG7A 4IOIA 1YPZA 1VADB 1CE6A 4FFWC 5DJYB 3UX9B 1C8PA 1QRNB 4PP1D 3GSQB 3HAEG 3NACL 5CD5C 5D7LD 3AMKA 2DD8L 3VGBA 1N4XL 1F5WA 5GGTA 5I30H 3PDOA 1NLBH 1B4JH 4YC2C 4NKOA 4NN5C 5I71C 1FSKB 4H20L 3VG9C 1QKZH 2WBJB 3RPIA 1LO3H 5EZOL 1VFAB 5DHXB 3EJYC 2DQFB 2LAGB 3WL9B 3GK8L 1GGCH 1OY3B 3MV01 4P5TA 1CR9H 3HA0A 4P2RD 4Y4KA 4HH8A 4ISVA 2VLRA 3MODH 1NUFA 1KXVC 3O3DB 4XP6H 3VG0L 3ZDZE 2M2DA 5FM4A 4Y5YC 3BIBX 2XKNB 5IB3B 1LEKA 3HAEH 4P2OD 2XRAL 3BUYB 2A0LC 3PDGA 3WUWG 3MRGA 1CTOA 1NMBH 3DROA 5AEAA 1KJ2H 4CBPA 3RI5F 2AEWA 4FP8H 4KKBD 3VXUE 3T0EE 3V79C 3IDIA 5F7FA 3F12A 3CH8A 3G9VA 5CD3A 1X3DA 3L3HB 4FXGB 2XYCA 5DJZB 3B9EA 1F90L 5F7MC 5JNYB 4KVCH 5JW4N 2A77H 1MCHA 3QIBA 2VWEE 1OW0A 2W59A 3LPWA 4WIQA 1ZEAH 1EH9A 5C0BE 2YHGA 2QQNH 2HT2C 4QOKA 3RTQD 3JTTB 1ACZA 1KYOK 2VLKB 5HYSA 4PREB 2X1OA 1L0YA 4MD4A 4CN6A 4FFEX 4J4PD 4OUUA 4KROD 4PRIE 4ZFFA 3WFZA 3OZ9H 4GKZB 2HTLD 4OLWL 3DYPA 1JGLL 1MOEA 3ALPA 2P48B 4MA3B 1MQ8A 5I66A 1YEIH 5IWLC 3QO1A 4XNXL 1FAIH 1NL0H 3MA7A 2VDLH 3WD5L 5I8EA 5EIIB 1OF2A 4X4ZA 2ICCA 4H0GA 3MV8A 3KDMA 3OKDB 2Q8BH 5DD6B 4QNPE 5HHME 3GHBH 5DD1H 2HT3C 3FQTB 1T3FB 2HP4A 4JCLA 4PJCE 4YDIH 3GDBA 3P4OB 3QA3A 4DK3A 3GO1H 5FDWA 4E0RB 3BGFB 4JDZA 5I76A 3DO7A 3MROB 1BZ7B 2R1XA 3VDCA 3BH8B 3RNQB 5JW5A 3GM0A 2VL4A 4HW6A 3MJ6A 3HUJA 3D0LB 1HK6A 5EIVA 5KG9B 4HPOH 1YEDA 4X7EC 2X42A 3ABZA 1J8HA 3SDAD 4F58H 4ZNEE 2ICWA 4LHUA 5C1MB 1F6FB 4ELME 3EYVA 1RZIA 4EN3D 2PNDA 3QDGA 3N85L 3QB7C 3LQZB 3VXRA 5JUEH 1ZANL 2EXYC 3GJEA 1A6WH 1FO0L 2NX5E 2WUCL 2WUBL 3AM8C 5GISH 4OGAC 1AHWC 4AG4H 3EYUL 4X7CC 2ED7A 2Z31A 3DV4B 1KT2A 1HHJB 4HLJA 1JRHH 5EC2B 1MJJB 2EDJA 2VLKA 3VWKD 3QCUL 5CEZD 2B39A 4XP9L 2XG4A 5FOJA 5E24E 1D5XB 4K3DL 2W0KA 3WFEL 4JVPA 4Z7UE 3WFDL 5E7BA 2A1WH 4MNHA 1CD8A 3V6BR 2EDRA 4GG6F 2IQAB 4YC2B 3QJHB 3L3JB 3PWVA 2P5ED 2X4QA 1KCRL 4QCIA 1D5IH 2EDDA 4JANA 4MLSA 1S7XA 4PG9A 2V2WB 4C83B 1YNKL 1CL7H 1KB9J 1A7RH 2DQHH 1OARH 3BN3B 3MJ8B 3IJHB 2Z0BA 4ZDHA 2CKNA 3LOWA 1R3LB 4JFEE 4FQHA 3RVVC 4LHUD 5HI5D 2EDTA 1IFHL 2QBWA 4HSQA 1KFAH 1HHGA 2O5ZH 4EIGB 4KKCD 3BESR 3WS3A 4S1DC 2C3WA 5FO8B 3CD4A 3E1F1 3OR7B 1F6AB 2Z31D 5JOPD 1KG0B 5EBMA 1T66D 2OMBA 3QFDA 1VDGA 2VXQL 5TE7L 3GKWL 3SE3A 5BRZE 1FYTA 5DRWB 2XN9E 2B7DT 5HVHC 2KL6A 4YPJA 4YR6B 4MA8L 4IRSB 5EO1B 4P59L 4XBPB 4FQJH 3VH8A 1N0LA 3SDXA 3UC0L 1GGIL 2H26B 3V0WL 5B4MD 2XZCH 1QSFB 5IJKC 4N0UB 3V6FB 4OZFG 2UV3A 5GS0D 5A3IC 5J0BA 2AEIT 4WO4C 3G08B 3W9EB 5C3TA 3D25B 3C8HA 1QYGH 4NOBA 5KVGL 1B6UA 1JK8A 2CDEB 4XX1E 4O02H 3BI9X 1FL5B 1FH5H 1U8LB 4UNTA 4H0HB 2HKHL 2WP3O 4P4RB 3PJSB 3C5ZA 2R2CA 3LD8B 1N0XL 5IT2H 3DVNB 4GG8B 1AP2B 4HQQH 1UJ3C 4S0TD 4ODVL 5CZXC 1D5MB 1FL6B 1X5GA 1H5BB 4UINL 3C6SA 4TUKL 3P77B 1S7VB 3HE6C 2BNQE 1FO0A 1SJEB 2F5BL 4K9EL 4KK5D 1J5OL 1D9KB 4ZD3L 1S9YA 1OVZA 3CPLB 5FDYA 2YUZA 1FCCA 3B43A 1NBZA 4DK6A 3U7YH 4JFPB 3NMEA 3MBXL 3GK8H 4XCYA 3TIDB 1YEEL 5DJAB 1VKXA 4WFGD 3RL1B 5HD8C 5B3JE 3GBLA 3LV3B 2AAVA 1G9NL 3OR6B 1MCIA 3PGDA 2VDOL 1S5IL 4KV5F 5IT2L 1A6ZB 3RU8L 4J4PA 4N5ED 1C12A 3Q5TA 4U2ZA 5DZOA 1V3LA 4Q6IA 1AD9A 1RZJH 3CXHJ 3IETB 3MXWH 5LXGH 2BY3A 1UM6L 3QIUC 5T1DH 5C09D 3X13A 5AZ2L 2FYYB 3MV11 2FJGB 3BKCH 4LGPB 5FUZL 1ZLWH 32C2A 4K8RC 3M8OH 4NNXB 1LEIB 1AGCB 3V4UH 1NCBH 3UAJD 4PJAA 1XZ0A 4X7SL 1KEGH 3MLWH 4QYOB 2VAAA 2A0LD 5I17B 4J1UA 1QLFA 5I8KH 2V2TA 4OUOA 1J12A 3LN9A 3KXFD 3BPLB 4YWGL 2CMRH 4ZPTA 4ELKA 1RZJL 1OW0C 1KIQB 1BIHA 2RFXA 3WN5A 1T0MB 4YHZH 3S4SG 5AZ2H 4QRUA 3MUZ1 1T1WA 3ROOA 5DO2D 3RA7L 3IXTB 1KEMH 1SYVA 3QIBC 3WHE0 5D9SB 5KAQF 4OKVA 4FQCH 1NL0L 3JZ7A 1CD1A 4XHJC 1GZPB 5CHNA 1CE1H 2CUHA 1HHIA 3EYFA 3L3DB 2EH7H 4JG0L 4OCWH 3ULVL 3CXHK 5I9QC 1INDH 4NO5B 4FZ8L 4Y2DD 3I9GH 1YECH 3QRFM 3L3GA 1LO0L 1FFQA 2J88L 5I17A 2RB8A 3ZE0F 1F8TH 1E6OL 4ZS6C 5EULV 3ARXA 4P23A 5BVJB 3DX7B 1QO3B 4DCQA 1SHMA 4OIIL 4GRLA 1T5WA 3NN8A 4WRLA 1UACH 5DMIL 3EZJB 3HLAB 3AM8A 3WDHA 4X4YA 4NFCA 1OP5K 5KZCB 5F72S 2J2ZA 4PJBF 4NQDD 1GRWA 3X13B 3LH2L 4WI2A 3ARWA 1IAMA 3VMOA 4G3YL 3UTSB 1XR8B 4Y4FD 1U8JB 1AY1H 4FNLL 1MCQA 4PUBH 1W72L 4NOFA 3LKNB 4JO1H 1JGLH 4QGYA 3K3QA 4IRJD 2BRRH 1XCTA 1G7LB 2EEAA 3ES6B 3ZE2F 2P5EB 4PY8I 3ZKMC 4ZPVA 4UOW1 1OP5H 5D1ZA 1CCZA 3LPGA 4JQXC 4IIQC 4PP2B 3U36A 2MKWA 2Q8AL 4ZOEA 3WNMA 1BD2A 4MA1B 5JTWA 3HMXH 3OX8A 3RL1A 5DMIH 1QLRA 3HPJB 3SCMB 3UTPD 3RVTC 3WFDH 4JFPA 3K8KA 4Q9RH 3IDXL 3VWKB 1DLHB 1JZ6A 4UTAH 1UT9A 1FL3A 1BWWA 5GSRA 4R96B 1NLDL 3D1MC 4E41D 1IGIL 2DQJL 4JY6A 2P24B 2X9YA 3QEHB 3JWOL 4U1GC 1L7TL 3HKFA 3S35H 2PYEE 4NKDB 5GRUL 2AJUH 2YPKA 5AD0B 4ZXBA 3PV7A 2Y7QA 1U8LA 5FO7B 5HI3C 5BZDA 4JQVA 2PYEB 2WK2A 5DUBA 3INUL 1NC4A 3NCMA 1G0XA 1MFBH 3MRRB 4JG1H 2HJFA 3UMTA 5B39G 3NIFF 3OXSB 4LLAA 1EZVX 2IANE 3PP4L 3DSFL 4PRIB 3KPOB 3UEZA 2ARJB 2E27H 5EZLB 5ANME 2VABB 5K9JH 1HH9B 3H8NA 4K3DH 5ALCL 1ITCA 4XXCA 3H42H 3QIUB 5I71B 2A1WL 2MCG1 5INDA 4I0KA 5KBNC 1OAXL 3DGCR 2ERJC 1G7JA 4Y88A 1KLGA 4OD2B 2QKIA 4Q9QL 3HE7D 2FX8L 2I60L 4KHTH 2K3TA 2ZOLA 1PYWA 2HFGL 3AS3A 4MJ2A 2XQYK 4RISH 1R24A 3RIFK 4Z77A 4LLDA 1T7WA 2V7HB 4XAWH 4DKAA 2J8HA 5K93A 1WF5A 4KJPD 3QJFA 4X6DA 5GRYA 1N7MH 2FJFA 4WY7L 5FHBL 4P5TC 3BDXA 1JWUA 4I48A 3ZDYE 3PNWA 1NBVH 4OJFL 2EECA 3CUPB 5H2BA 4LGRB 1C1EH 1W72A 3QT2A 4K9EH 5IVNA 3RWEB 3ZHKA 2QQKH 3VXNB 1FN4A 4M93C 1QPXA 3VXOA 3DOSA 2VJXA 4R0LA 3MBEB 4PYHA 1WFNA 1JHLL 3MBXH 3VXRD 4LLWB 4KU1A 5DJ0B 2EEBA 1BOGA 3IAGC 4H1LH 3OAUH 4RWYL 1VFBA 1JN6B 5M95B 2Y23A 3AXLA 1FZOB 1NCUA 4APQB 3ARBD 2R2HB 3QIWA 1KJ3H 5CSZB 3UTZA 4QHKJ 4Z7VE 1VFOA 4C4KO 5DT1H 4U4BA 3GJEB 5T3XD 4ZNCD 5IQ9B 4RGMB 1KJ2B 3QCVH 4I5BB 4LHJB 3KJ6L 4JRXD 4OLXH 5FCSH 3VRJA 4ONHB 3HAEB 3BSZH 1UH4A 1WIUA 2Y9RT 3HR6A 4XWGH 2YBRA 3BW9A 3HMXA 5CP3H 1H8SA 1WBZA 2VQTA 1AO7D 4DUWA 5IV2A 3IXAB 1J5OH 5DSCB 5DRNB 1IC1A 2NXZD 2PYED 1HDMA 4ODWA 1AFVH 5GGSA 4D9QD 2G5BA 3DX6B 1EDQA 3ZDZF 1GHFL 2H45A 1MI5A 3SGEI 3V5KB 4CVXB 3ARFC 2NXYB 4ZO8A 2HN7B 4YHNA 2ZG3A 4D9QE 1P5UA 2LE9A 1JPST 3B2VL 3OB0H 5E4EC 1KEML 4QHNB 1MPAL 3BPCB 3L7EB 3ZDYF 4J8RB 1BQLL 1A1MB 1IRAY 4RFNB 2HT4D 3K8MA 3MGOA 2AI0H 3U0PA 4PV8B 5C3LD 3B3IA 4L8BB 5D1QB 4CJ1A 2UZXB 3GSNA 1GAFL 1QFWH 2GAZB 4KVNH 4M61A 1E6JH 1MHPH 3D48R 2VQ1B 5L88L 4NQTA 1H3VA 1UKTA 4HLZH 1F8TL 4GRLC 3SO3B 4P23C 1AGBB 4WWKC 1LE5A 4L4TD 1NFDB 1MCOL 1BM3L 5E2UL 3B2UD 1DLFH 3UJJL 4HKZB 5D5MA 5BW7C 1ORQA 4RWHA 3D3VE 4ZTPH 3L3HA 2NY1C 1VGEL 3C08L 5JHDE 3R1GL 4KKNA 4K71C 5MENA 4WCYL 1MFCL 1K2DA 4OGYL 4X6FA 3KLHC 3SJVD 2OXHA 2QJDA 3T4YB 2JF1A 3PWJB 1FZJB 4HPYL 5E8EA 1KB5H 5F7NC 1FYTD 3L5WA 4Z95H 5BS0D 4M1CC 1FGNL 3QXWA 5JDSB 4YHKH 3WFHA 3VXRE 4KUZH 3MCKB 4DOHB 5J1TC 5I1KH 3DUUB 4HWEL 5EOCJ 1T1XB 2F74A 3BIKB 4HIEB 4OF8A 1JP5A 1D7FA 4XC1H 4WDIA 4MAYC 4KXZH 1JWMA 4PS4H 2CJUH 4IRSC 4WCYH 1G0DA 3P4MB 5SX5H 5DTFB 3W11D 4FMFA 2NW3A 5FF6A 4GAJH 35C8H 3RJDA 5F97E 3OKLA 2X4NB 3V6OE 4AM0A 2BNRB 2P45B 4DKEL 3JWOH 1CXHA 3QUZB 4X80L 2LABA 2WZPD 1C5CL 2FHCA 1VADA 4JRXE 2X9XA 1H3UA 1JUFB 4NM8H 3TFKA 1IJ9A 3OGCA 3SKNA 3RVTD 2GJ6D 3ZKNC 4NKIH 3T0EA 4GRMB 1K4DB 3OJDB 1KCSH 4J4PC 2A6KA 5EU6B 2VH5L 5F1SA 4PTUB 4Y5YB 3HNTL 3UO1L 3UJTH 5IIEA 2G75A 1D6VH 4BFIA 3TF7A 4JO2H 1WISA 3O41A 5CCKL 2DLFL 4XT1C 2FATL 4LVHC 4BELD 4RGMC 1FVEB 3U48A 4X80H 4MHHG 4PGDA 3NAAL 3DUSA 1RJYA 5BV7H 2F53A 2BSSB 4V1DB 4Q9QH 3L95A 2Q1EA 5HDOA 5JUEL 4Y19B 3ULVC 2EIBA 1I75A 3W39A 2DB8A 2WUBH 4XRCB 4Q9BA 4NN7B 5CEXB 4Z0XB 1G7LA 4YBHA 4ESKA 3BPLC 3O3AB 5E8OB 5KW9H 1WAAF 4Y19E 4ORGB 4XP4H 3I6KB 1CICB 4JB9L 2VZ3A 1HE7A 1RFDH 1JZ3A 4X6CE 1Z9MA 3WFEH 5GGTH 4RMTA 2MPAH 3NCEB 3H9HA 3O4OC 4KROC 3IU3A 3SN6N 1TLKA 4MAYD 2NYYC 2ITCA 2B1AH 2F19L 1MRCH 1WFTA 4R2GD 4D0BB 4IMLA 4UNVA 4LPVA 1OPGH 1GOGA 4G6MH 4TNWK 2PN5A 3EO0A 3KPQB 4IS6A 3LS4H 4OD3H 2EEDA 1J10A 1A47A 1FIGH 3ETBF 4XWOD 1NDGB 3CSYA 1LNUA 5EBWA 4MA1C 4LK4A 1DBKH 3CFEA 3VD7A 5DC9B 2BVYA 5LQBH 2VERN 3U0WL 4XVJH 4KHTL 2NYYD 4EKXA 3P30L 2R23B 1OWRM 4LASH 1P2CB 4TTDC 1MIML 3WN5B 5FYLH 1EIBA 1QA9A 3RVVD 1L9MA 4OZFH 2IBGA 4P2YA 2B2XL 3QUXA 2DQEH 5IB4A 5TF1H 4HS8L 4JGMA 1MCCA 4R4FL 3TT1H 4O2CB 5IMOB 4O58H 2BSTA 1BVKB 1U8OB 2FX7L 5IK3A 4OZIE 4PJAB 5DD3L 4G9FA 3LS5L 2OX5A 2XY1A 2HJLA 3IFPA 1AE6H 1S78C 1FYHB 2H2PD 3CCHB 1F58L 2PUQT 4LPCA 3QO0B 4CU6A 4F7PB 1FV1B 3FB6A 1NCCH 2XXCB 5CBEB 2AJ3A 4F9LA 3TJEL 4PDCE 1JI1A 2DTMH 4WHYH 4MWFB 5J3HD 3QEUA 3BZFB 4NZDA 5J11C 4YHYB 1MJUL 3DSNA 4DZBB 2YPVL 4O4YH 1PZ5B 3AY4C 3IGAA 2KQMA 3R0NA 4JFHD 5K59E 1Z6JT 2FDBP 4MS8A 1H15B 2HA1A 4JVWA 2Z4QA 1NDGA 4LRNL 4FTVD 4O9HL 1DBAL 4FQJL 4YX2L 5AG8A 4GQ9H 3P9MA 3TZVB 2C4FT 2Z35A 1B2WH 2X4SB 5EH1A 4HGWA 3QYCA 2BJML 3KPNB 3VFGH 2GCYA 4UQ3A 1ETZB 4KTDH 2R9HD 4CVZB 1QYGL 3GMPB 5F89B 2XZAH 2HTKD 2XA8H 3S4SB 4O02L 4KRPB 4P4RA 4URTB 3MODL 3UPCA 4KUCF 1K5NA 2Z93A 4Y16B 3VGHA 3CDGA 4Q0XH 5D2NE 5HHMA 5JA8B 2F5AH 3DTXB 3G6JB 1KPUA 1UGNA 4PJCA 4GXVH 1WEJL 1OSZA 2GTWA 5FYKD 4E9LA 2NX5D 3BPNB 2AI0L 4OV5B 2YKLH 4G8GA 3QUKB 1ZHKA 2G60L 5E8PB 2MSPA 1PQZB 2EDBA 2BERA 2KPNA 4RDQF 5I1KL 2C1OA 1X6NA 2IANB 4N9GB 2ZCHL 4NSKB 4TTGA 1Z9SA 4HGKC 1FLRL 1G7MB 2ZSWA 3DI3B 2EDEA 3S35X 3IFNL 4F3FB 3QQ9C 1X5KA 5CZXD 1UEMA 5KS9A 1Q9WB 4XNMB 1CK0H 3Q0HA 2PW1B 3VE0A 1E4WL 1Q9KB 3O41B 3HE6D 1XGUA 4JREB 2APFA 1F3DJ 2C9AA 5GHWH 4GKSB 1JNJA 3UTSD 1G7MA 1F00I 2FIRT 2BHZA 5DFWH 1NFKA 3D0VA 4NSKA 4QF1A 5CGYD 4PLNC 5F3HB 5HYJD 4TN9A 1AR2A 3QI9D 4UAOB 3SY0B 2DKUA 1XFPA 4U1MB 1A3QA 3SHSA 2VDNL 1KCSL 1RJLB 3VG0H 1FBIH 2QHRL 3KYNA 1X5YA 3CLEH 1IZJA 4ZUUA 1KB5L 3RNKA 2ZG2A 1CFNB 4ZUWB 4M43L 1LO2L 4OIBA 1E4JA 1T5XB 3K2UH 2VXTL 3BT2H 1KTRL 2AKRB 3FONA 3L3JA 1E4WH 4PLOB 1N5AA 4X6DF 5DTFA 3F65A 2I9LB 4XVSL 3S4SA 3NIFE 4MNHB 4ODTH 4P9ML 1IE5A 3IU4L 3O8XC 4XCCH 4R7DA 3JV6B 4ZFOB 5CGYC 3KPLB 3DVFA 2ATKB 1D5XA 3BEVB 2X1PA 1MI5D 3VFVB 1NCTA 1N8ZA 4GW1B 1EAPB 5DJXB 25C8H 4HDIA 1S8DB 4WU5A 5GRWA 4HJJH 4Z5RB 4YHOL 2EO1A 2NY6C 2BCKB 2LAAA 3PV6B 1U2CA 5H8DA 3KYMB 4LSSH 2OP4H 1MY5A 1ZE3C 5TGBA 1T0PB 4FTVE 4MQXC 4HV8B 5F93C 5ALBH 3BEWB 5B39B 1UADC 4K7PX 3OAZK 4I1NB 3FB8A 3HG1A 1FZMB 1QZ1A 4XBGA 1SY6L 4JN1L 3WDJA 2V9QA 4NCC2 4Y5XA 3RWGB 1XF4A 5F9WC 3RKPA 5BVPL 4MDJB 5D72L 2FATH 2NZIA 3MLUL 1NFDA 5ERWB 4C57C 1O5DT 1KCLA 2NY6D 2WIIB 5KSVB 2A83A 4F80A 1F2QA 2HMIC 1TJHH 2ZNXA 4EBQH 4UT9H 3S8WA 2CIKB 4KI1A 4KDVA 5A2FA 4M62H 2CLRB 3QRGH 1C5DA 5D70H 1RVFH 3UZEA 1S3KL 3EHBC 1E27B 4JPKH 2Y5TB 2R2EA 2FX9L 3GSOA 3MRBB 4HPOL 2CRMA 4P0DA 1P1ZA 5IVOA 5ID1B 1JTOA 2W9DH 4KXZI 3S5LB 1VGKB 3TO4D 1E27A 3PABB 4KV5E 1MJ8L 5FGRA 4HWBH 3GRWL 4LLVB 4NO2A 5E8DH 1DE4B 1NEZB 4PD4K 1C5DB 1XIWA 3F7VB 4QRQA 5MERA 3CFJA 1IGJB 2UYLB 2BMKA 3UXFA 2W38A 3U46B 1X5JA 3QFJE 2JJWA 3HC0A 2GJZA 4TULH 1BEYL 2HVKA 3CMOL 4P2OA 2O61A 1YYML 1BGXH 4PJIF 1U0QA 1OTUD 4K94H 3QDME 1OPGL 3TGXA 3QCUH 1YNTA 4RISL 2GJ6A 3MRMB 3MXVL 1RAMA 5MEND 1FDLH 1FIGL 3DYMA 3SDDA 3OXRB 1QD0A 3WNKA 1FZMA 3VFNB 2JB5H 2BNQB 1E4XI 2AJUL 5B39A 1JTPA 5E94B 3RHWK 3WO4C 1DBJH 1WLHA 4IDJH 1B0GA 1IQDA 3HS0B 1A4JB 2VZSA 2PCPB 5EO9A 3U0WH 1RUPH 3ULVF 1D5IL 2DJSA 3GMLB 1IGYA 2IH3B 4LASL 2DQHL 2E8YA 2WWMC 3G5VB 1KTLA 3LZFH 3ALWA 4I9WE 1HOCA 3U1SH 3OPZH 4K94C 1VEOA 4I2XB 1U8KB 4O9HH 4GH7B 4X8JA 1HCFX 4Z0XA 5BRZD 1B4RA 4E5XB 1LK3H 1P7QA 2GW5A 3MCLH 4P57B 4YFLF 5TDOB 4ZOCA 1SBSL 2W91A 3HNVH 3PHOA 1YEFL 3I2CH 4N90D 3ZTNH 3W5MA 4FFYH 4Y8DC 5E00A 1F11A 2A6IA 1YEHL 5J4MA 3UZQA 4JDTH 1OWWA 5K9QG 4FN0A 1QSEA 5L2JB 4P59H 2FO4B 3KR3L 3T65B 5F9JB 4Z7WB 1MCLA 3SDCA 1GJIA 3A6CL 1OCWH 2L0DA 4PJFF 5DMKB 3O8XB 4MYWB 1A9BA 2Y06L 3QZWB 4NPYA 2DTML 4BH7B 3SY0A 5I16A 2G60H 4LLDB 3NZ8A 1FNGA 4U1JB 4UDUB 3TH2T 3P9WB 4XCEA 1ZHLB 1KN2L 5BRZB 1NDMA 3ARDA 3EJZD 3LKPB 4OLUH 3SDCB 5DI8A 4M9OA 5IB2B 3ZYJA 1JYVA 3NPSB 4ZO9A 1FLRH 4F7EA 1S9XA 3TV3L 1NGZA 4UINH 2FWOB 1QSZA 4QRPA 3RKDD 3WUWB 5D6CB 3UAJC 3EUUA 3A6BH 2C1OB 3OAUL 1NGYA 4JZOB 4KTEH 4KGLA 1XGQB 1UJ3A 5FYJH 1HINH 3QUYC 3C60A 4KK9C 4HFUL 3ZZ1A 4QEGA 2FJHB 5JOEA 3JV0A 1ZVYA 3TJHA 5DT1L 3M1BB 3P0VH 1IQWL 5T3XE 4OF0A 2KZ1B 3O81A 1VB9A 4PLJC 5J9PB 5DHVA 2IQ9H 4PRBA 4XPHH 3RA7H 4PJEF 5I1IH 2X1QA 1I1AB 4QRTB 3QFJB 1FNHA 1DN0A 3VRIA 5EU3B 5I1LA 3B9VA 4FQCL 3V7AG 5KSAA 1IGYB 3E2HA 1H0DB 4QXWA 3DMMC 3X17A 3UBXB 3T4YA 4WUUA 3KPNA 4A6YB 1M1SA 3VFRA 2F8XC 4OCWL 3ULVH 2IG2L 2BNQA 2QHLA 1AGEB 3QH3A 3SGJC 3WJJA 2JJSA 4EZMA 3RY5A 1JMZA 4YGVA 3P11L 1U8NA 1J0IA 1R3KA 1I8MB 5DURB 4DN3H 3ZSTA 1R3JB 2IQ9L 3WKNA 1HNGA 2J7LA 4YZFE 2ICWJ 1DFBH 4KDTA 3VWJA 2DQIH 4IHOB 4H25A 6FABH 2NY1D 1EMTH 3TC9A 2E9WA 3GI9H 3SKMB 3MJ9A 5GSVB 2DJ4A 3ZMRA 3WXWH 1U8NB 3F5WA 1VGKA 4MWFA 1PG7X 4JO1L 3ECBA 4BFEA 5J7CC 3I75B 2Y5TA 3L7EA 3MV9E 4Y4FB 2QADC 1EFXD 1DR9A 3L1OL 1IZKA 2ITDA 3CCHA 3RWCB 1BVKA 1U8OA 3I3EA 1HCVA 4OTXL 3RVUD 3V5KA 2CRZA 4JFED 5FECA 2D7QA 3JWNC 5FHAH 1RIVL 4BFBD 4DVRL 4FQ2L 1EO7A 3F6LA 3E6HB 1CFVH 1CLOH 4NKQB 1Q9LA 4CKVX 1MCBA 2DQIL 3KPPA 4AY0A 1FHGA 5JHDD 5CJBA 3GI9L 4HG4K 4J23A 5DS8A 5J89A 3Q5OA 1A14H 1VENA 4JPKL 1J11A 3W0WE 1AIFB 4PJXA 4HJJL 1H5BC 4NM4L 1D5ZA 3MYZA 5KVEL 3VFTB 4ALAH 4MXWH 4JRYB 5D6DA 4Z95L 3DX9A 3G6DH 5C0ND 3THMH 2EH8H 2VZ1A 3VXQB 2NY4D 3BWUC 4D8PB 5KS9E 3DIFB 4KJWC 4WFFD 1XGTB 5I9QB 3QCTL 1CYGA 3WYRA 5IEHA 2E6PA 1KXTB 1QLFB 3GO1L 2GYSA 1HXMB 2XZZA 4Z7UF 3TN0A 4WW2C 4QWWD 3T1FA 1FNEB 1DCLA 1S8DA 5BV7L 2DAVA 4N0RA 1EAPA 5BVPH 1WZ1H 2C4XA 4GAJL 1OD7A 1MWAB 4WHCA 4IOSD 3C60D 3NCJH 1R5IA 2ITCB 4FABL 3HI5L 2IALA 4H1LA 3TNNA 2NX5B 5TE4L 4O51B 2N7BA 4MXWL 2PXYC 2UY6A 4GBXD 1RIHH 4X9HA 5E5MB 1DBJL 2VLRD 1JPFA 4JHWH 1JZ5A 3H9HB 1NUDA 4C58B 5DQ9A 5FUOL 4JN2B 4Y16D 2V2XA 1WFOA 5C0GA 2OK0H 5DMGD 1BLNA 4L4VE 4QT5A 3N9GL 1W0WA 3BZ4B 5DJCB 3LKQB 4X83A 1EBPA 4WY7H 2F54E 4LKXB 4EUPH 5DMYA 1IC7H 3RVWD 4B7LA 1ACYL 2ZUYA 1BFVH 4G6ML 5HHNB 2D7OA 4H8WC 1H8OA 2IAND 1F4WH 4HFWA 4H0IA 4YNYA 3SJVA 5DJAA 3SGDI 4JPVL 1T04A 3F7PC 3QDAA 2Z8WC 3BD4A 2YEZB 2EDNA 4XBEH 2VL5A 2D03L 2X6MA 2X70B 5IKCB 2UWEF 5JQ6L 3T08A 4Q74A 4CUCA 2YD6A 2AQ2A 5I74B 3TJHD 2EDLA 4NHUB 4QRPE 4R8WL 5EZJB 2J8OA 1RUQH 1PZUB 3KPRA 4R3SB 3B5GA 1QQDB 3NCYS 5GIRB 2JB5L 4OV6F 4GBXA 3T0EB 1YMMB 1U91A 3TA3C 1G9ML 2HRPL 1RZ8B 2XI9A 4KJWD 5EU6A 1ZTXL 3H7BB 5IFJA 5JOFB 5GGUB 4JJHA 3MNZB 1F4WL 3WIHA 2GI7A 2A9NH 3FO1A 4DGVH 5HHPB 4JM2D 4Z7WA 3ARDD 3MO1B 4LSRL 3LZFL 1Q9OA 3LEYH 5HDLA 3N1GC 5T3XH 1PBYA 5E95B 5IFJB 2OZ4L