1WBZA

Crystal structures of murine mhc class i h-2 db and kb molecules in complex with ctl epitopes from influenza a virus: implications for tcr repertoire selection and immunodominance
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
275
structure length
275
Chain Sequence
b'GPHSLRYFVTAVSRPGLGEPRYMEVGYVDDTEFVRFDSDAENPRYEPRARWMEQEGPEYWERETQKAKGNEQSFRVDLRTLLGYYNQSKGGSHTIQVISGCEVGSDGRLLRGYQQYAYDGCDYIALNEDLKTWTAADMAALITKHKWEQAGEAERLRAYLEGTCVEWLRRYLKNGNATLLRTDSPKAHVTHHSRPEDKVTLRCWALGFYPADITLTWQLNGEELIQDMELVETRPAGDGTFQKWASVVVPLGKEQYYTCHVYHQGLPEPLTLRWE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 CLASS I HISTOCOMPATIBILITY ANTIGEN, K-B ALPHA CHAIN PREC
publication title Crystal Structures of Murine Mhc Class I H-2 D(B) and K(B) Molecules in Complex with Ctl Epitopes from Influenza a Virus: Implications for Tcr Repertoire Selection and Immunodominance
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 71
structure length 275
sequence length 275
chains with identical sequence C
ec nomenclature
pdb deposition date 2004-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1wbzA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1wbzA01
4Z5RA 5HHQB 2NY4D 1L7TH 1UZ6E 4PRBA 3ARQA 4JY6A 1L7IL 4ZFZA 2VLJA 4Y4HA 5GSVA 4PJIA 2VQTA 4PJXF 4JFFE 2AKRA 3BGFB 2FJFA 4JFEB 4X7SH 1ZV5A 1V05A 1G9ML 3P0VL 3JV4B 1RZGA 2IC2A 4B50A 3H3BC 3OKEA 5I71C 1U8IB 1QR1B 3QXUA 2JJTA 1NUDA 3DMMA 4HIJB 2BY1A 1T7VA 3S36L 5EZIL 3KYOA 5KSBF 2V6HA 4PG9A 3CH1A 3QNZB 1KTLA 2JB5H 3MLRH 1XFPA 3GMNA 4Y4FB 2R1XA 4BUGA 5EIIA 4YAQB 4RDQF 5FGRA 2OYPA 2H32H 4IDJH 3BKJL 1XCTA 4NCC1 3BYYA 5HGHA 3CSPA 1IBGH 4WUUB 5T3XE 3EW3B 3WFZA 2LAAA 1MFNA 1RZ8B 3I2CL 4LCWA 4LVNC 3OL2A 4TNWF 5I9QC 4PV8A 2YD6A 5I6XC 3OF6A 1GGTA 3DJ9A 1W8OA 3QIBB 4KHXL 4HUMB 4F33B 4KZEL 3P30H 5C0JB 2VUYA 3RIAF 5FHBH 1CLOL 3ZDYF 5CMAA 3BHBA 3FN0L 5DRXB 1CE1L 3QUMB 3QH3B 2HT4D 1CL7H 4YR6B 4Q6IC 2XN9B 5J0BA 4F37K 3Q6FA 5TDOA 3VI4E 4NBXB 2IANB 1LWRA 2YPKB 2H9GB 5A40E 3VH8G 2RFXA 1A9BB 2BNQE 2B2XL 5EU3A 4RZCB 4BA8A 2NY3C 5JHDB 5CWSA 1D3CA 3OB8A 4KXZI 5T1DL 4PRID 3HMXL 4XPGL 3QXWA 3GBMH 1LO3L 2Q3AA 1OF2B 2JJVA 4MJ2A 4N0FA 4WFGD 5C0AA 4M6OH 2OJEB 3D3VB 4LVHC 1AQDB 5BOZG 3S6CA 4PP8C 4A6YB 4UIMB 3X3FL 5IHZB 5GRWA 3UAJD 5KVFH 2OJZH 5DEZA 1AR1C 3AFLA 3TNMB 1TTGA 1UJ3C 5E9DB 2H8PB 4OF8A 4U2YA 4NN6B 4GSDH 4Z5RB 5JPNA 3AAZA 1ZA6A 1A6UL 4YHPA 3CH8A 1FO0A 2JIXD 4PRBB 1L0XA 1BZ7B 2XZQH 3RPKA 4JY6B 1C1EH 1N5AA 3S3SA 4ZFZB 2VLJB 1UZ8A 3KVQA 4JJ5A 4PJIB 1ZLWH 3SKJL 4RX4D 2AKRB 4P5KB 2FJFB 2VDQH 1G1YA 3VXTB 1XF3B 1FNGA 1KYOK 4KJWC 4XVTL 4ZFOB 3O6FC 1RZGB 2E9WA 2ORBL 4TRPH 1S8DA 1KPUA 4KK5C 3OKEB 3CVHL 1ZVSA 3T0XA 4MSWA 4YLQT 1G9MC 3MV7E 1VCAA 4KRPD 5CIPH 4PJGA 4Z7UF 3PGCA 3MGTA 3P73A 1NCWH 1GZQB 3T2QA 1AP2B 4JFFD 4NCDA 4U6HA 1KTLB 4GS7B 5KJRH 2YUVA 5ALCL 1GJIA 1OT2A 2JCCF 4ONGL 4FTVD 3QULB 3VXSE 3DSFL 5DS8B 1CGYA 1XCTB 5K33A 1RFDH 3FTGA 4JGMA 3BRFA 4R4FH 3OGCA 3ZE2F 3P77B 1BGXL 4G80A 2B1HL 1JF1B 4E41A 2G75A 3MV01 4KV5F 1DUYB 4X8JA 4HFWA 1A7PH 3QO1A 1YNKH 1BECA 1MRCH 3BH9B 1RIVH 1WISA 1QO3B 4Z6AT 1RZKL 3B9KA 5FYLL 5HI3D 2C4XA 3WBDA 3BHBB 4TUOB 3OXRB 2DJUA 3UDWA 5T3XD 3KGRA 3A67L 1QNZL 4GXUM 5J6HB 4GQ9H 5FXCH 1HSAA 3CZFA 2ZKHH 3JSSA 3Q6FB 5TDOB 4LGPB 1K9TA 5FB8B 3HRZA 3UX9B 3ULVE 1EXUA 3LKPA 5C3LD 3NA4A 2P43B 2X89A 1QFWL 1DL7L 2JJUA 4C83A 4H20L 4F8TA 3GSNA 2X2YA 1JTTA 2EIDA 3OR6B 2IALA 1TVHB 2EKSB 4NO0D 1FE8L 4G6AD 2DQEH 1CGTA 3FRUA 4LIQL 5ESQA 4HPOL 4EVNA 5C0AB 3OKKA 5D5MF 5BOPA 3MYJA 2BNQD 1IAKA 3T04D 3U9PH 4ISVA 1GC1L 2X4NB 5JMRA 3U7WH 4J3OC 5JHLL 5EN2A 4F9PC 2RGSA 3OKYA 5C86A 5JW4R 3HZMA 1TETH 3QPXH 3N1PC 1YUHA 1RIUH 1YEGL 1DQML 1I3UA 1N5AB 2LAGB 5DMIL 3H3PL 1EGJL 1CDCA 3LD8B 3SGEH 1E6OH 1Q9KB 1JI1A 4JREB 1F4YL 3O8XC 5FYJE 4PPTA 4JZJC 4PRAA 4Z7QF 5I0DA 1KPUB 2LTQC 2W9LA 4HUUA 4W4OA 5CEZH 2AJXH 2PXYD 5GGVH 3O3DA 4GW4B 2E7LC 3PGCB 5D1ZB 3MGTB 3MRLA 4XTRD 4F7EB 4XNZC 3BPLB 4PGZA 4HV8A 2OZ4A 4P2OA 2DWDB 3TT1H 3O2WL 3N9GH 4ZOAA 4GRLD 1YEFL 2APXA 5GJSL 4ALAL 1ZLUH 5I2IB 3L6FA 5IV2A 3FQTB 4ZPTB 4PJFB 2VLKE 1ADQL 5C0IB 3SDAA 1IC7L 1MRFH 4OLYL 3QP3A 4E41B 2G75B 3SCMD 1JHTA 3MOAH 4X7CC 5GS0D 1XF4B 4ONOA 4HC1H 3VWJC 3VXUA 4PJ8D 5EOCH 3O0RH 4NZUL 5CJ8A 1J10A 3VXSD 3VCLA 2EDBA 2Y25A 3B9KB 1MUJA 4EN3C 1OGAE 4YE4L 2QLVB 4LDOB 5KSAD 2O61A 3ZDZF 5EBMA 3VFOB 1I3VA 5I15L 3MLYH 2FL5A 1K85A 3DV6A 3LKPB 3TN0C 5KS9F 3PWVB 4WU5B 5D7SL 2N7AA 3DOSA 2IALB 5D2NC 2V17H 1YEDA 1KLGB 1VA9A 3D48R 1A3LH 1WIOA 1FVCA 2NY2D 3FRUB 3ARFB 1LEIB 1A9EB 1MCHA 4KUCD 4HGWB 4HUXB 1OP5K 4EVNB 3ULVD 3CCHB 1IQDB 2DM4A 2BY3A 2NX5E 2XZCH 2EH7L 5CZKA 1XGRB 1MH5A 4K3JL 1NMAH 4ISVB 3HUJA 3I50H 4NO2A 3MA9H 1I9JL 3HZMB 4QWWC 1GC1C 2EO9A 5ANMA 4JFDB 1YUHB 4ONFL 4JVPA 5C09A 4BQBA 1J88A 5J12B 1Z0MA 1F4AA 2BVQA 2E7HA 1QG3A 2YZ1A 4M6AA 5E2VL 5DVNA 4PRAB 3FRPA 3QI9C 4BQ8A 2E6QA 3FQXB 5L2KB 4HUUB 4HH8A 3O3DB 3QUZA 1BBJA 1SQ2N 4I13B 4UILL 4UB0L 1MCJA 3LQMA 4WHYH 1HDMB 2MCPL 4JN1H 3SDXF 4IMLA 1X7QA 2X9XA 5FYJD 2ZG1A 5DRWB 3K1DA 3AB0C 3HCVB 1S3KH 3C6SA 3L3KB 3MUGA 1CXLA 1EO8L 1Q72H 4LLWB 4XMKL 5IV2B 5D6DC 4UV7L 3HC4H 1EO5A 3SDAB 3D2UA 1NL0H 1KJ2B 2JJWA 4XWGL 1I8KB 2WINB 1ZSDA 3SGJA 4XVJL 4G8GE 4JKMA 4OV6F 4LCUA 4MA7L 4PRIA 4ZAKA 2V2WA 4E5XA 2JJSA 3FHQA 1MHCB 4JRXA 3BWAA 4WW2B 2VLKD 4O51B 2C3VB 2GQHA 2O61B 1S7QA 2UVEA 2ZUQB 2NY7L 3HA0A 5DDHA 4KUCF 4Y16D 3VGFA 1BQHG 3F58H 2BNUB 1NEZA 4XX1G 2YZ8A 5J1AA 5C6TH 4F9LC 1F6LL 3WFEH 3L3OB 1LE9A 1DBBL 5IEKA 4GXVL 1OGAD 4HCRA 1N0XL 5GS3A 3W39B 5HVWA 1GZPB 2ZUSA 4QOKE 5J6GA 5IMKA 4JR9H 4TPRL 1VGKB 3FOLA 4JDVB 4YDJB 3IU4L 3N1FC 4QXTA 2V9TA 1JGEA 1T03H 4MMXC 2VUOA 2JKXA 3ZKND 2VQ1A 4CW1B 3KPMB 4W81A 1FZKA 3GMMA 4O2EA 4JFFA 1X3DA 1KT2B 3GHBL 3JBG7 1KPRA 3VFSB 5ITFA 2OI9B 4S0SD 2LVCA 1DVFD 1I3GL 5E2WL 2QQLL 1T0NA 2NX5D 1NC2A 2EXYD 4D0CB 4TNVK 4UAOB 3HE7A 4AJ0A 3P4MA 4GW1B 3BEWA 2ZNXA 32C2A 3P0GB 4G59A 3S9DB 2E8ZA 2F58H 2K7QA 1HOCB 1MCSA 5ESAA 4Z0BL 3QUZB 3PGDA 1FG9C 1P6FA 4Y5XB 3MRPA 3CD4A 1FDLL 4M4PA 5EZLB 1MFBH 4R6UA 2PUQT 3BVNA 4HEME 4IMLB 2VH5H 4KK9D 4YWGH 4PB0H 1JGDB 3MLUL 3MUGB 2C7UA 1GGIH 4OB5L 1L8JA 3FQWA 3TA3C 3G6JE 1MLBA 3L1OH 3D2UB 5AWNH 3NA9H 4M6ML 1A7RH 3ULSA 3KPOB 2PYFA 1CLZH 3IGAA 4EI6A 4TN9A 5E1AA 4LCUB 4NO0A 4ZAKB 2V2WB 4E5XB 1UJ3A 1PKQE 2DTSA 4NT6A 3BWAB 3V4PH 3T1FA 4U0RC 4XVSL 4NQEE 4I18C 4O9HL 1GAFH 2BERA 2BNQA 5EBLA 1IKNC 3IF1A 4JFPA 3UC0H 3KXFA 4DN4L 1YQ2A 3QUXC 5F96L 1CLYH 3QJHB 1R5IA 5DDHB 3ES6B 1CDBA 3QISA 3M1BB 2UUDK 1XH3A 4KTEL 2Z31A 3EJZC 3H6JA 5GJTL 4FQXC 1OWWA 3RY5A 4HUVA 3QIUC 3GFUA 5I71B 2IG2L 5JOFB 1TLKA 3BP4A 3QA3A 5IEKB 2C5DC 3L95A 3U0PA 1AFVH 1J0YA 2BVTA 4OZ4A 4P23A 2HMIC 4Y0GA 2VYRE 3EFFB 2GFBA 4ELKB 5GS1A 3SBWA 5IMKB 2PCPA 3MLXH 1FN4B 2HVKA 4GKOA 4PGCA 3PWNB 2AXFA 4GRMB 3TH3T 3U4BH 5MENB 3RJDA 3BIBX 4NQSB 5CUSL 4N5ED 5AD0A 4PJ9C 2CIKA 3GMMB 3LQZB 5BQ7A 3PQYD 2H41A 3EO9L 4XPHH 3EDJA 4O2EB 5EU7C 4XXDB 2NR6D 4QOKD 4LVNB 4UINL 1KPRB 2AJVH 5I9QB 5I6XB 1KTDB 2WUBL 4PLJC 2YMXL 2RR3A 1T0NB 3HI6H 5IMMB 2X4PA 1P4IH 2VOTA 1HN1A 1NMBH 5DMYA 2X1QA 3MV7A 2XWJB 3HE7B 1I1AD 4RBPK 3T0EE 5C2BL 4C54A 4MDIB 3QQ9D 5DZLA 1I7ZB 2AJSH 3O9WC 3SCMA 4Q6IB 3RWDB 4M62H 1VEOA 4JPWL 1NCBL 1BOGA 2CUIA 1J8KA 4PJ8A 5ESAB 1NSNH 5FUCC 5BXFA 4BZ2H 5MP6H 1MCPH 2VXSH 4CKVX 3LN5A 4HWBA 1LE5B 1A1MA 1N0LA 1I1FA 3BI9X 2NY3B 6FABH 2W92A 3QFJA 5DO2C 3WS6A 1NGPH 5FCUL 4ODVL 5FO7B 4R2GC 1D6EB 5ID1B 3FQWB 5CEZE 3I84A 4XP5H 1NANI 43CAA 1RIHH 5IFJA 1TZGL 4LVHB 4M5ZL 1MY7A 5ERWB 4TULH 3LN4A 3G5VB 4OGYH 3MOBH 4I48A 2PTVA 2J6EH 4EI6B 1VFAB 5E1AB 5IB5A 5F1NA 4HXAL 3S37L 1UJ3B 3QQ4A 4RRPA 5DHVH 4UTBH 3DVFA 4Q9CA 4CU6A 5ETUA 4AEIL 1TVBB 2FEEI 3Q6GH 4WEBH 2I27N 1JPTH 3M45A 4X6DB 3TO4D 2R4RH 5ADOH 3TV3H 1SEQH 2VABA 4JFPB 1YEKL 3B8SA 1K8DA 1BFVL 3KXFB 4IRZL 1R5IB 1TCMA 1WFOA 2ZUUA 1RJYA 5C2UB 3Q1SL 2H1PH 1IEAA 1DANT 2Z31B 3O8XA 3PP4H 1BM3L 1RSFA 2P45B 3O6FB 4WFED 4A2LA 5BRZB 5ISZD 1EMTH 2F5BH 3V4VL 4NGHL 3QA3B 5IB2A 3L95B 4NQED 5CP3A 2YBRB 3U0PB 2R0LH 4OZ4B 4XCCH 2VISB 3CVHA 2GFBB 2MFNA 3MBEA 1V3JA 4HIEA 1JZ7A 4M1GH 5BRZE 2AJYH 3UBXA 2PCPB 4OD2B 4IOIA 2AXFB 1T04B 2R0ZL 1GHFL 4LOUD 1IZJA 1LK3L 5I1GL 2H26B 4LDLB 3OJVC 2DI7A 4CJ1A 1W72H 4NC0B 2CDEA 1YPZF 3MRFA 2BRRH 2YK1H 3WFCL 4AL8L 5B39A 2VDRH 5CGYD 1LO2H 3QPQD 1ITBB 2C4FT 1J05A 5JXAL 3NIFF 1DEEB 3EFDH 4XBPA 4H26A 3WXWL 5CCKH 3B6SA 1JK8B 5EO9A 2DM3A 2X4PB 2NZ9D 5K9KB 2HFGH 5JORA 3MV7B 3GDBA 1QSFA 3ISWA 3PE9A 3E3QE 4G3YL 5DSCB 5IW6B 5BCAA 1WTLA 3ARZA 2Y36H 2YSSA 1P5UA 3BMVA 2DQHL 4Q9RH 5JW3H 3ROOA 3UTSB 3CU1A 5BXFB 2WZPD 3TN0A 3QEQE 4MD5A 3LN5B 3WFDL 4LSSH 1A1MB 3BD5A 4L8DA 4EJ1C 7CGTA 4G6JL 1YEIL 2X1XR 3T0ED 3HE6D 2CGRL 3QFJB 1T5WA 3DPBA 3C5ZD 4ZYKA 5GS2H 2MWCA 5T1LB 4YHMH 2HH0L 3V6BR 4OCYL 3TZVC 2I60H 3HI5L 2NY5H 1DQJA 3GB7A 2UVFA 5ILTL 4MXWH 4OKVA 4U2ZA 1WT5A 1E4KC 1NDMA 3G04A 1OGAA 4I48B 2IH1B 5IB5B 1I9IL 1FL6B 5F1NB 1OAYL 2DYPA 3WLWC 1MI5E 3QQ4B 1IEBA 4JQVA 1I9RL 1ED3A 4WCYH 4KK6C 3VGAC 4JM2D 4JO3H 1F6AB 4OGZA 4NQVA 2EKJA 5CEZD 5GQBA 3CVIL 3STLA 4WY7H 4D9RE 4GMTL 1ZLUK 5CSBA 5ALBL 4WV1A 2X4QA 1FFPB 4LL9A 1JGUL 4WI4A 4OM1H 4GOSA 1IEAB 1P4BL 3O8XB 4JZJB 3L5XL 1DVFA 2LTQB 2GCYA 3WNKA 1NAML 2WANA 3HMWH 2NX5A 1OP3K 3IFNL 1HHIB 1RZJL 5CEYA 3B2VH 3CVHB 1A7QH 1Q8MA 3MRMB 4XNZB 1BEYH 1HCFX 5CBEA 5IVZA 4IRSC 4IOIB 1I7UA 7FABL 1UM5L 1A0QL 4KRMB 2IBBA 3HRPA 4OFVA 3IETA 4MB5A 2CDEB 2ITDB 4POZC 1CFTB 4DGIH 1HHJB 5D6DA 3OSKA 1JNJA 1J05B 2UYLB 1EV2E 5GISL 4AENA 1JPFB 4XBPB 4H26B 4OUUB 3SDCD 3B6SB 3PDOB 1RMFH 3VWJB 4AYFA 3JVGC 1MSPA 4YFLF 5DFTA 5HYSG 2AEWA 3KWWA 1QSFB 4EN3B 1BAFL 1SY6L 2MKLC 3VFUA 2FBJH 4YGAB 5I16A 2FX8L 5JIIA 3ARDD 1OTTD 2ZNWA 4HKXA 4IOFC 3TN0B 3PJSB 1NJ9B 2HN7B 1WF5A 1CDHA 1J1PL 4YHKH 1FBIH 2BDNH 1YMHA 4MQ7B 4L8DB 3IS1X 4K7PH 2ZJSL 4ZSOA 3LS4L 1U41A 3WNNA 4PJ7E 1JBJA 1WSST 2XIDA 4ZYKB 3OZ9L 1EFXD 2OL3L 2BSSA 4N0YL 4G8GA 3OWEA 5F7EH 2BJML 2R69H 1LMKA 3MUHL 3V4UL 2AK4E 5HBBA 2HT2C 4ZDHA 5E6IC 1MFCH 1DQJB 3GB7B 3QEQD 4GUPB 4U1KA 1TENA 4LP5A 4OKVB 1FPTL 1QLRA 1DFBL 3K81A 3IKCB 1KACB 3SE9L 4HT1L 1WJ3A 1X5FA 3ZKMD 4OGAD 4MYWB 4RMSA 3QHTC 2DYPB 1IFHL 4K3DL 2C1PA 1IEBB 1IGFL 4HMEA 1HQ4B 2QADC 5HDBE 4L3AA 3NAAH 4NO5A 3QDHA 4MNQB 3H0TB 5F8RC 1QVOB 2APWA 5SWSB 4M6NH 4OZHB 3STLB 4OSUL 5ACZA 1G84A 1J5OL 2NY4C 2YPLA 4AMKH 1KCVL 4L4VA 3LQAL 2M1KA 4N5EA 3LDBC 3V5KA 3QWRD 1TJIH 2CPCA 2YD3A 1QBLL 3T2NH 1FORL 1QQDA 5T1KD 3UPAA 4CJ0A 1PVHA 4MXQD 3U4EB 3TF7C 1P5VA 1Q9LA 3FB8B 3QI9B 4PJ5B 1T2QL 3T65A 2GSGA 2X4TB 1RUMH 3Q2CA 3CIQA 1T0PB 2F15A 4L8CB 2CUHA 4NJ9H 2G9HB 4D9RD 4YFDB 5ITBH 5DD0H 3JXAA 5IFHH 1RZJC 1RVFH 5IVZB 2R2BB 3S35L 4JAMB 4TTDD 5E99H 1I7UB 2GY7B 3NFSL 4HH9B 1D6VL 4WTXA 4OZGA 2WBJA 1AGFA 3AB0B 1OTSD 1PG7W 3IETB 2A9ML 4LU5H 1NGQL 1CBVH 3JTCA 2BHZA 1WZ1L 3ZHKA 4MD0B 4NC1E 1SYVA 3THMH 4NYLA 1ZHNA 5EOQH 3PWPE 4X4YA 4K2UL 4MCZA 4RWYH 3O2DH 1OAUH 5DJCB 1MRDH 5C92A 4YEFA 4JVWA 5LGHH 1BFOB 5DR5L 1KCSH 3B9DA 4WI6A 4EEEA 4HKBA 5C07E 3O3BB 3QUKA 5IJVA 1GGCL 2F8VA 3BIKB 4I4WA 5DJ8B 2APBA 3I6KA 5SWZB 3KPPB 1KCRL 3BUYA 3KWWB 4R26H 5JQ6H 5B38G 3C6LC 1U2HA 3VFUB 1EUUA 2VAAB 4Z95H 3TIEA 4JRYE 4KKBD 2EXWD 1CFBA 1F13A 2VR9A 4HKXB 5ICZA 2Z91A 2KDGA 3WIFA 4BZ1H 1IAIM 3VFPB 4M1CD 3QIUA 3SDDC 1YMHB 3HAEG 4I8DA 2LV4A 5A3ID 3I9GL 4FOMA 4ZSOB 3G6JA 1E4JA 3NCMA 2FZ3A 4DFHA 4DJMA 1OQOA 5CIPA 1MF2L 3T09A 4HEPG 2BSSB 3FMGH 1G6VK 3HNTL 1EZVY 3LV3A 4ZDHB 1NBVL 1R0AL 1H3VA 1QFWI 4K23H 4U1KB 4JG0L 4PBXA 2AI0L 2YA0A 4NQEA 4NO3A 3FB7B 4OCWH 4PJ9A 4F7PA 3K4ZA 4ERSH 3MSPA 2C1PB 3ZYZA 1KXQE 3H42H 2H6PA 3O6ML 1F4WH 5JXED 3DX7A 2A83A 4XC3L 1MQKH 3U6RB 1SM3H 3BZEA 2YPLB 2DWEA 5B4MD 4L4VB 5M7QA 1T2XA 2CJUL 1SBSH 2NW2B 3EDEA 5EIQA 3F6LA 4JDTH 2ZOLA 4XCNA 3LQAC 2OSLA 3O9WA 3WXVL 4P3CL 5E5RB 4BJLA 2X7LA 2YXFA 3T0BA 2W0FB 1CXIA 2B1AH 4H5SA 5DLML 1KJVA 2Q87A 5HGBA 3PV6A 1Y0LB 3GEWB 5TH2B 2FDBP 4HXBL 4ZTOL 2K9UA 5J3HD 1A14L 4JFHE 5IVNA 5DJ2A 3C8KA 3ARBC 3JTSA 2BC4B 5D70L 2ZUWA 2AQ3A 1EJ6A 4WTZA 5F1IB 4OZGB 1M71A 3I6LD 4MAYA 1JF6A 2F8XC 1AGBB 3REVB 5EG6C 1VPOL 1VB9A 1BF2A 4UBDD 5DD1H 5C0BB 4CL7A 4YBQC 4DUXA 3TA3B 1OGTA 3UCRA 1WZLA 1KCGC 3RY4A 1LO0H 1UCTA 1ACYH 3HG1B 4BSJA 4MCZB 4MNGB 5IMLA 3HE6A 5JLZA 4NWUL 4FFZH 4LRNH 1QBML 3C5ZA 1FZJA 4PP1D 3LKRA 1QKZL 3U7YL 3WCYA 5IJVB 1TTUA 1YEHL 5IF0A 4I4WB 3I6KB 1BJMA 3MV8E 2IEPA 5H35A 3FZUD 2QSCL 4U0RB 4I18B 4FABL 4WI8A 5HI3C 1FLRL 3PWPD 3TIEB 3QUXB 3KPRB 4P9HH 2VZVA 4X9GA 4YHOH 4ZD3H 3RVXC 5ICZB 1U8QA 3LMJH 3WIFB 2I5YH 3KS0J 5I74B 4XNXH 4U6VH 5CILL 4FQXB 5F7DA 5C07D 2GHWB 5GZOD 3QIUB 3LZFH 1E27B 1OTUD 1X5ZA 4R96B 4P4RA 3EYSH 3LKQB 3T3ME 3MXWL 1MCLA 3DARA 3TBVB 1ETZA 1CGUA 1K4DA 2IQAA 4KK8D 1CXFA 4KPHL 1WQVT 4JRYD 4J7RA 5IEHA 4S1DD 2B5IB 5EORH 1DN0A 4LHQB 1DANU 1SMAA 1VGEH 4OZFA 1C08B 4GJTB 1OT1A 1A6PA 2PW1A 4FMFA 3DYPA 4NO3B 4NHCH 2OLDA 4L5FL 1DBJL 4ONHB 4PJ9B 3RDTC 4XCYA 3PWLA 3K8KA 3WUWB 2VSCA 1YYLH 5TE4L 5ADPH 1G9EA 4UTAL 5J9PA 3WO3B 3SO3C 1XIWD 4G9FA 3DX7B 2A83B 1DBAH 4Q9QL 1N5YH 2YRLA 4TUJA 1F90L 2ZSWA 5IT2L 1AD9A 1UKTA 1KC5L 2W9DH 5HD8D 3GKZA 5I1IL 5HDLA 4QHNB 1N59B 3B9AA 2C4FU 4M7LL 4K3EH 4YO0A 4H1LH 4ZUSA 3IU3A 4I2XE 2OSLB 5BRZA 3O9WB 4PJEF 2XWTB 4CAGA 2X7LB 4KMTH 1YEEL 2HKHH 5E4EC 1KJVB 5HGBB 4H8WL 3MXVH 4RMTA 4YK4C 1J8HE 4PYGA 3U0WL 2DLEA 1X4YA 5F9OH 5DJ2B 4AEEA 3D39B 1QSEE 12E8H 2HAZA 4N0CD 4ZOCA 5T3ZL 4ORGA 1FVEA 1K6QH 5FA4A 1DBMH 3PL6D 3ARDA 4M8QA 4R2GB 2HWZL 3ILQD 1FFRA 2CDFA 4OCRL 1OL0A 4WFFE 4GRLC 4ODWB 1JUFB 1IE5A 3RUGE 1PW3A 5CJQL 4QHMA 4NQCE 3X3GL 3L3HA 2Y06H 4JFHD 5HJ3A 3C2SA 4Y1AE 3VI3E 4L8BA 1HILA 5IMLB 3IRZA 3QIWC 5DK0A 4LCIH 5K9QI 1FZJB 2PR4L 4PD4K 5FUOH 1BJ8A 3CFKA 3DTXA 2W0LA 1ZS8A 5T5FL 5D7IF 4ZFFA 3FAXA 5I17A 4FFYH 2ICCA 2IBZY 3CFCL 5KOMC 4WUKH 2OP4L 3GMPA 4OLVH 3ZL4L 1SJXA 4KJQD 1BREA 4PJAF 1EEQA 1GH7A 3NABL 2ARWA 5IESH 4U3XA 1OP9A 2W9EL 2EDQA 3MV8D 4LQFH 1HZHL 4P4RB 2HJKA 3TH2T 4S1RL 1JN6A 1BIIB 1HINH 1K4DB 1QYGL 4RMWA 1WAAE 3JTTA 5TF1H 4MDJA 1INDH 4FNLL 5IEHB 1TQCC 1S7WB 1ZHLB 1DN0B 2Z92A 1J0KA 3GI8H 4OGXH 3EYUH 3R4DA 1MI5A 1UJTA 4OZFB 3CFDA 3G08B 1A6VL 2J4WL 2WIIA 3B2UD 2O5XL 5EBGA 4BQ9A 1YN6B 3HNVL 3OV6A 4XCYB 3MGAA 4HJJL 3ZKXC 5HDOA 4P49A 5J9PB 1CG9A 3RVUC 1YEJH 2ZG3A 4G9FB 3RKDC 3RWJB 3QEUB 1A64A 4KQ4L 4P59H 2Q7NA 2XKUA 2NY1C 4L4TE 1NLBH 4OCXH 2R15A 1KULA 2VB5A 4MS8A 4R90L 2BSRA 5E8OB 2Q7YA 3BSZL 3GHEH 4ZUSB 1VENA 3STZA 3IU3B 3X13A 4JE4B 1H3WM 1Q94A 2F9BT 4CUCA 3ROLA 3QDMA 2MMXA 4HIIB 1PLGH 2CLRA 4DGVL 2MCG1 4PGEA 4HF5H 5GS2D 2EEBA 4F7MA 3D0VA 2ZUYA 3S7GA 1U3ZA 5GIRA 3GUTA 1YECH 3M17A 3PHSA 2FNBA 4H8WC 4IIQA 2IGFH 3B9VA 5I1HH 2Y7QB 1QOKA 1HYSD 4BM7A 4ORGB 3LN9A 3MRIA 2C3WA 5FA4B 3WE6A 1MQ8A 1OPGH 3FCTA 3GKWH 2Z93A 3GRWH 2DKMA 4M8QB 3LPWA 1HH9A 3GJEA 2Y23A 3IDMA 4X83A 3TZVB 2CDFB 2FIKA 4G6ML 3WIIH 4OTXH 2DQFA 2PYEB 5HJ3B 5J89A 2NY0C 5E2UL 4LASH 5KVGL 4MLIA 1QSED 5DK0B 3UTQA 2YRZA 4X7SL 4LPYA 1ZANL 4QYOA 4XNMA 5HDQH 3V52H 5C08B 5T5NG 4UOW1 3R1GL 3CFKB 5E8DH 4LPCA 4RQQA 3VGAB 4KDTC 3V8OA 2HRPH 1FQ9C 3MFGB 4FQJH 3RA7H 5I17B 4WFFD 1P7QA 4B7LA 4NQCD 4J3WA 2F19L 4S1QH 4PJ7A 4KKNA 5A16A 4Y1AD 3H9HA 5CD3B 2JB5L 5IIEA 4D9QE 4TSBH 3MLRL 3N1MC 2I9TA 3LEXB 4NP4L 4Y16C 5D9SB 1KFAH 5JXEA 2VLLA 1C5DB 2AK4A 2RCSH 5L7XH 3T3MF 3BP7A 3BZ4B 1V7MH 5TE6L 1HHGA 1XGTB 4RMVA 1NAMA 3U4AA 3ZTJG 5A43C 2XA8H 2H2PC 2Z92B 1GCFA 1IJ9A 5D96C 3MFFB 1EEZB 1UVQB 3CFDB 4PJXB 4X9BA 1WFNA 3ARED 4PDCE 1VDGA 2V9QA 5HYIA 1AKJD 4KKAC 3VRLE 1CG9B 1LO5B 4QTHB 3OHXB 4M5YL 3G6DH 4P46A 5KVEL 5KSBB 2NTFA 1UM4L 5D2LE 1CQYA 1DBKL 5FV1L 1BBDL 1Y6MR 5D1XD 4NRXA 2F74B 1PG7L 3C6LA 3X13B 2JB6A 1Q94B 3TO2A 3ROLB 3QDMB 3NMEA 5SWQB 2CLRB 1FZOA 2NCMA 5DQDL 3GBML 1ND0A 4QHLB 3G5YA 3MACH 2APVA 4BSVA 3QXVA 5GGSY 2J8UE 3UEZA 3VDBA 4P2QD 4HJGA 4L4TD 3SDDA 4WFHE 2YUZA 4UMGA 2CXKA 1A7BA 1WLHA 2VDLL 2GSIA 5JDJA 2PN5A 3MRIB 4KTYA 1CGXA 3PWPA 4NRYA 3WE6B 3NH7H 2Z93B 3H9SB 4OQTH 3IDMB 4NZTH 4PJBF 2FIKB 5DD6B 5E6IB 5TQ0H 2DQFB 5F3HA 3C60C 4U1JB 1C1EL 4KTDH 1YYML 3KAAA 3PHQA 3WJLC 5EULV 4QYOB 4DGYH 5F70A 4JN2A 3LRSA 3BEVA 4QHKJ 1MHEA 3BKML 4ODUA 4U31A 1A7OL 2IPUK 2QADB 3EIFA 1LHZA 4NHUA 5DEFA 3S88L 3LB6D 1BVLB 1P7QB 2R1WA 4P5TD 3FT2A 4U3HA 2DLIA 4HKJB 4RFEA 4XAKE 5A16B 4K9EH 1F97A 3LDBB 4I0KA 3KJ6L 4HSQA 5KJRL 3V6OC 4FN0A 5DEGA 3K74B 1XIWA 4LSVL 1DR9A 5DTFA 5JDSA 2YEZB 4QF1A 4BKLA 5DK2A 2W1NA 3UJJH 1Q0XL 1HHGB 3CMOH 2AV7A 3OG6B 1WAAF 1ZT1B 3L5IA 4TSAL 1NAMB 1S7TB 2ICEB 4NQDA 1JZ4A 1UKSA 1FRGL 5BS0B 1V3MA 2MHAA 4M1DL 4D9QD 5EWIH 3DVNA 1N64L 3QO0B 3LHPH 3SGDI 3VXQB 5HGDA 3N85H 4GAYA 2O26U 4TSCL 3CJJA 5IFAL 1PX3A 4Z7VF 5DWUH 2LVEA 4LARL 4HBCL 3RBSA 2EIEA 5IWLC 4Y8AA 5DJ0A 5BZWA 3DX9A 3BPOB 2BVEA 1BQLL 4U49A 4AQ1B 4N0CA 3SJVE 1WWBX 3RX5A 2J6EA 4P46B 3AMLA 2NR6C 3FRPG 3T4AA 4Z7UB 1YN7A 3QG6A 1RUAH 1RZFL 5DHVA 4QXGL 1U8MA 2R1YA 1ZHBB 1H3UA 4OLWH 1Q0YH 3ILPB 1MEXL 1FV1A 3C6LB 3TNNB 2JB6B 5F3BA 3VRJA 1UM6L 1I1AC 1A6AA 1X5JA 2FD6H 1FGVH 1FZOB 4HWZA 2WY3A 2R29H 4V1DA 1FJ1A 3TYFB 4BH8A 2DQEL 1KENH 3G5YB 1RD6A 2GAZA 2P8MA 3SDYH 4OIIL 3RWGA 2OX5A 2P5EA 4HJGB 3OPZH 2X44D 3SDDB 4XMLL 1REIA 4JANA 1MPAH 2VDOH 1IILE 1Q38A 2GSIB 4YDKH 4J23A 5HHOE 2R4SL 3MRKA 1B2WH 5D72L 3WD5H 4MAUH 5FO8A 1A2YA 3QPXL 3VGDA 1J18A 1Q9OB 1L6ZA 1MFAL 2OL3B 1UWEH 4TUKH 1UA6L 3MV8A 2AQ1A 4WFHD 3PHQB 5HYJA 1NMCB 5E2TL 1AGEA 3KPLA 3LRSB 4ZXBD 2XPGA 3BEVB 4PRPE 1CF8H 1MHEB 3U1SH 5LXGH 5HHNB 1NEZG 3QEHA 4J3TA 4NHUB 4M93C 2ED7A 3F5WA 5ID0A 3P9MA 1T1WA 1M7DA 4RFEB 4FMKA 4ZNEA 4Q7DA 4G7VH 2EZ0C 1N6QL 5TDPB 3O11A 2MOVA 4L8SA 3G9VA 3OXSA 4LHJB 3IKKA 3N9GL 5FOBA 5JDSB 5DTFB 3WKNA 3QHFH 4QF1B 1FYHB 4MWFA 5DK2B 1T6WA 2BFVL 1V5JA 2AAVA 3QCTL 4JY4B 1TZHB 2AV7B 2JE8A 1U3HD 4NQDB 1PZUB 3GSXB 5IM7A 5DQJA 3SE3C 5BVJA 1KEMH 4K55A 3L3IB 1CS6A 1KG0A 3ARBB 2X4UB 3JWOL 1A5FH 4WW1A 2YD9A 4N8PA 1QFHA 3MPCA 3P40A 4XNUH 4HG4K 3O0RL 5D7JD 3QHZH 5MERA 4N8VA 3SKNA 3IDIB 4LNRB 3TWCL 1T89C 2PETA 3DX9B 1JPSH 4LSDA 5CGYC 4YDIL 5LCVL 3QPQC 35C8L 1CD1A 3U0TA 5JIKA 5IGXH 2GYSA 1YN7B 2QJDA 1JJUA 3FQUA 3QG6B 2P48B 1E4XL 1U8MB 1DLFH 1T80A 4P9MH 3IDXH 5I1EH 1J8HA 3F6IA 5FOJA 2Q8BH 3E8UH 2YHGA 5F3BB 1QFUH 3OB0H 1A6AB 3UYPA 4KJYA 4KROD 4ELME 5D93C 4V1DB 1FJ1B 4YHYC 3A6BH 4HMCA 3MRQA 5C0ND 2CLVB 1J1XL 5BVPH 3OGOE 3MROB 2P1YA 4PIRF 3VRIB 3CSBA 4PJDA 5ACLA 3RWGB 1MCCA 2P5EB 2XZCL 4HWEH 1ACZA 3K80A 2CMRH 2ICWA 3ELAT 2XYCA 3RUGA 1EH9A 3PNWB 4NQCA 3MRKB 4Y1AA 4F7TB 2O5ZH 4FQ2L 4I3RL 4U05A 3ARGC 3WL9A 3QUMH 5J11C 2D4DA 5SX5K 5AZEH 1L6XA 1TJGH 3TCLB 5M94B 4TVPL 4NKMA 5HYJB 2CIIA 4LGSB 4N9GA 5KS9B 1EVTC 1U6AL 3RDTB 3IFLH 2DQCH 5HHOD 3VFTB 3ZE0E 1P7KA 2VDPH 4LHUA 2R9HD 3SO3B 1EEYA 3GIZL 4CVXA 1DSFL 5ID0B 3PDGA 4AIXA 1E6JH 1M7DB 4J6RH 4W6YB 5E08H 1HYRC 4G6FB 1F2QA 3O11B 2WWKO 3VWKD 3RKPA 4XHJD 4U1LA 4DVRH 3OXSB 4K7FA 4PRPD 5FOBB 4FZ8H 4MJIA 2Y9RT 5HPMB 5IHUL 4A6YH 1KIRB 3K2UH 4MWFB 5I30L 1Q72L 1MCEA 5E4EB 3WDHA 3BMWA 4YK4B 4PJCF 3VXMB 5JMOC 1TMCA 1JV5A 1NL0L 5D1XA 1U8NA 4PJHE 5BVJB 4NM8H 2NXYC 2AEIT 2BNRE 1X4XA 5L8KB 2UWEA 4QRPB 5F9JA 4EIZC 3RZCA 3PWUA 5I1JL 4OM0L 1H3PH 2EYRB 3BXNB 3JWOC 4JY5H 1U93B 3SKNB 1AO7A 4U1SA 4R0LA 5HYQA 5I1KL 5F6HJ 2EYSA 4GAFB 4GRLB 3RWCA 4L4TA 3SE8H 1IM3A 3IAQA 4XP9H 4U1HB 3LIZH 1AY1H 4HJ0C 3MRRA 3QIWB 1CD1B 2GTWA 2IMMA 2DDQL 4GT7A 1TIUA 2FB4H 4LSRL 1P9MC 3L7FA 3F58L 1ERNA 1IKFL 3SDCC 1Y6KR 4CNIB 1BD2B 3SDXB 5EOTA 1MNUL 3D18B 5D1QD 4AEHL 4KJYB 2XZZA 1LP9E 1RURL 2VWEC 1PSKH 1JWMA 1U36A 3MRQB 2BY2A 4HS6A 3PHOA 4PJDB 1OTTC 2EYTB 1C7TA 1XF2B 2ESVD 4OF7A 1T03L 4OI9A 4Q6YA 5IROC 3VXRE 3A6CL 1ZHKA 3Q48A 1OB1B 2PTTB 4JHWL 5KANG 3RWFB 5INCA 2N1KA 15C8L 1B4JH 2DD8H 1O7VA 3HPJB 3NIGF 4HS8L 4FQHA 1S5HA 3GMOB 3NZHL 2RAMA 1AE6H 3QCUH 3WL9B 4DWHA 3TFKD 3BJLA 4JO1H 2DICA 3QG7L 1M05A 4GG8B 2DQGL 1QBAA 4NKMB 2A74A 1OOAA 2CIIB 4GMSH 1T0MB 5FGCE 3BE1H 4YHZL 1P7KB 3ZKXB 4LHUB 3MBXH 3O2DA 1AGCA 4OGAC 2YPVH 1D9KD 4UOW0 4XP1H 5D6CA 3BO8A 1EEYB 3EYOA 3R06A 5FDWB 2W59A 3W0WE 4HQQH 4CDHA 4OLUL 2VKWA 2NXZD 4RAUB 3GSUB 3CXDH 3BP6A 1D5IL 4QRQA 4N68A 4UT9H 2NY1B 5DHYA 3RX7A 5C8JA 1T1ZA 4NKOB 4XCEB 2HLFC 5A2IH 3UBXG 5IMOB 1HH6B 2FX9L 2PKDA 3MLWH 4K7FB 4KWUA 4KAQH 4MJIB 1A7NL 5F7MC 4MXQC 1GGIL 4S1SL 4KVNL 3AUVA 2AEPH 1CVRA 1TMCB 5B39G 1JV5B 5E5MA 3A6OA 1JMXA 4JFOB 5JW5A 5JIPA 1NCAH 1RULL 4P3DA 5HGAA 1IC4H 2UWEB 5F9JB 3RZCB 3H9ZA 4DAGH 4KHTH 1X9QA 1ZLVH 1AO7B 4U1SB 4R0LB 1S9WA 3V4PL 5HYQB 1NCCL 5D2LA 5L6YH 3MCLL 4KI5E 2LE9A 4EI5D 3C60A 1IM3B 1OAZH 3UC0L 4YBLB 1GIGH 2NY0B 2GITB 4XNYL 3C9NA 4H88H 3UZQA 4ZS6D 3L5JA 2BNRD 2GTWB 3MJ9H 3RPIA 3KR3H 3ZDXE 1E4WL 3BISA 3BRGC 1M7IA 3QDJE 5ENWA 1C5BH 4B5EA 5EOTB 1A6ZA 3TP4A 2J8UA 5EU5B 1S9YA 1FNSH 2CKBA 5DJXA 4ELMF 3GMRA 3LH2H 3BH8B 1BMGA 1YY8A 3R8QA 3UZEA 1MIEL 4I0PD 1AXIB 2X4SB 1KBGL 1JWMB 4ZXBA 2DB8A 2YWYA 3PHOB 2EXWC 1EDQA 4Y16B 1WCBA 3U4BL 4EDWH 3GI9L 2OQJA 3CLFH 1R3JB 1P2CB 1CU4H 4RGOH 4O00A 3GSRA 4XPHL 1WV7T 5A3IC 3EYQD 3UMTA 2KZWA 2AABL 5FM8A 2J8HA 4V3EB 1O0VA 1SEBB 4LSQH 1S5HB 3IVKA 1R3HA 1XGQA 3UPRA 2FATL 1X5HA 2OBGA 3DRTA 4Y2DC 1U8HA 4MX7B 3GSQB 2EDDA 3VFMB 4JO2H 4QRUA 4YXKH 1Z3GH 1P4IL 4XPTL 4HIHB 3MJ7B 3HLAB 1N4XH 1U3HA 2P42B 2EIBA 3IS0X 5D6CB 3BO8B 1MHHB 1RZ7H 3R06B 4JQXC 4L3EE 5SX4H 4GAJL 4YXLH 1NSNL 4QRQB 5DHYB 1T1ZB 4OI7A 1FFOA 1ZLSL 4WWKA 3KPNA 1P53A 1ZEAH 2NQCA 5B4MC 3PGFH 4IRJA 6FABL 1UWGH 1R5WB 3E2HC 4U1MB 1UQSA 4YHLH 5LAXB 4N0UA 3F7VA 1ITCA 1D5MB 4QXWA 3ZSSA 1MJ8H 3PF2A 2VQUA 4J1UA 1S9XA 1CFNA 4OI8A 4D9LH 1AHWC 5JW5B 3PWJB 4AIZA 5DJ6A 5HI5C 2DQIL 3NFPA 5LGJA 1HEZA 1NFDF 3SJVA 3EHBD 1FC1A 2UZYB 3FFDA 4X5XA 1MJJB 2V7NA 4CN4A 4K8RH 1S9WB 1OD9A 5F7WC 1UB5A 3DX8B 1QLEH 3C60B 4UBDC 4ZS7L 2A6KB 1UENA 1JHKH 3RPIB 3MRGA 2H1PL 1ZT4A 4ZUTA 3K0WA 5I66A 1M7IB 4WHCA 3VD3A 1LD9A 5DD5H 4PP1C 3DX6B 4LKXA 4MMZC 5IKCA 4JFEE 3CSYB 4JRWA 1GPOH 5GGSB 2X1PA 2VSDA 1MIMH 1HIMH 1S9YB 2CKBB 3K8MA 1J12A 4XCCL 5DJXB 3X14B 1MHPL 5DUPL 3GMRB 4NKIH 4Y2OA 1LP9F 2WW8A 1WEJH 1YY8B 3B4NA 4QRSA 5HHOA 3U2SA 2AK1H 4H1LA 1LDPH 1J7VR 3QNXA 2PF6A 1KJ2H 2VKXA 3QDJD 1F5WA 2KQMA 2OQJB 3VXPA 2ENYA 4NM4H 3P2TA 1BFTA 3QEGL 5GZOC 2D03L 3BDYL 2VDRL 3VFWA 4EXPX 3PUCA 4AY0A 1J0ZA 4R4BB 4ZO7A 4M48H 5BO1L 3FO9A 2DJ4A 3SE3A 5I1AB 2A9NL 2EICA 1MFDL 4NKDA 1R3HB 1XGQB 4KK8C 3NN8A 4DEPC 3DRTB 4PRPA 3HS0B 1RV6X 5IQ9A 1U8HB 2IQ9L 3FO2A 4WUUE 3NGBB 3MNVA 1FH5H 4JG1H 1W0VB 5JIHA 2R8SL 3DURB 3T77B 4JDZB 1BLNA 2F5AH 5TJWK 4O5LH 3DRQB 2ARJB 4FHBD 2DQTL 4RAHA 4S10A 2DKSA 3MLSH 3VD7A 5GRJL 4UDUA 4WWKB 2XN9E 3KPNB 4NNXA 4J3XA 5DVKA 4IMKA 3BQUD 4YPJA 4LMQE 3HB3C 3O6LH 3ULUD 4IRJB 2XQBH 2QQKH 2V2XA 1I1AB 1S78D 1UQSB 1AJ7H 1YPZB 4ZPVA 4I0CC 4YHML 3UXFA 1U58B 2LFGA 5C0EA 4N0UB 3F7VB 4L3ED 1H9VA 4L4JA 4QRRB 2XG4A 1J1OH 4WHTA 5JHDE 4J1UB 4MVBC 5DC0A 1CFNB 1NFKA 5F93C 1DQQA 2HJLB 4AIZB 1QSVA 4RNRB 2I9LA 3HTLX 4JKPL 4EUPB 3EJJX 1WBYB 3U83A 2OR9H 5KVDL 4JO3L 3PL6C 5I8CB 4YDVB 5GGTA 1XR8A 4NNPH 4JB9H 1AD0B 1EA9C 1KEGH 2P4AB 4D0DB 1CDJA 4NKQB 4X6CF 4G42A 2JELH 5I66B 4APQD 4PJIE 5EUOE 1N6UA 1LD9B 1NANH 2DAVA 4H0GA 5H2BA 5JUEH 2EIZA 3U79A 4LKXB 4PTUA 4M93B 5IKCB 1KIQA 3TFKA 3FO0H 3OKDA 3HMWL 2SEBA 2VE6A 4K3HA 4Z0XB 2DQJH 3V2AR 3KPSE 1YQVL 4HIXL 1BVKA 3TVMD 1GOFA 2AW2A 3LEYH 4QRSB 4MJ5A 3FFCB 3UJTH 1Q9WB 5FYKL 4KJQC 1D9KA 4LEXL 25C8H 5IBLC 5LBSH 3C8HA 5ISZB 1IQWH 4E42A 4MNHA 4AT6A 3P4LA 1PZ5B 3IRPX 4UT7H 4ZTPL 4L9DA 1ZKAA 3UO1H 3NN8B 4LSUL 5GPRA 3P9LB 4W6XB 3MNVB 3BYTA 3GRWA 1F3JA 5BV7L 5FECB 2Q8AH 2FEDD 2PO6C 1BLNB 3ULUF 3B2UC 1LEGB 4Y4FD 2Y07H 2EDNA 1P4LA 4KFZC 3TYGH 3QJFB 5F1SA 3WS3A 2GUOA 5B8CC 4HCRH 3HI1A 3DYMA 4WUUD 1MAMH 2GK2A 5LWYH 1QLFB 2BDNL 1JGLH 1KELH 4PGBA 2AXHA 4EI5A 4X98A 2D0GA 2WUCH 1VFOA 3L3JA 3M8OL 3QQ3A 3BPNC 4PJHA 3T8XA 4ZPVB 4LCYB 1CL7I 4G7YL 4ENED 4NBYB 4WTZG 2BNRA 5I19H 1K4CA 4YHYB 5F7EL 1UACL 3AROA 1ZGLB 4WHTB 2VXVH 1OAKL 2ZSVB 1I85C 2XN9D 1AIFB 2B8OT 3HHRB 3V6FA 2EE3A 2FSEA 4JEGB 4Z78A 1UXSA 2AS5M 4I77H 2IAND 4G8EB 5C0AE 3GK8H 3WFBH 4BFIA 2V2TB 4I0PA 5CINH 2EO1A 2V5TA 3CFBB 4I9WE 3DECA 1TZIB 5FHAH 5AG9A 2QTEA 4XGZB 2DBLH 1CTOA 3ARGB 3D9AH 5JHDD 4Y5VA 5J11B 4FQPA 4NQUA 3SKOB 3MRJB 4CBPA 1KN4H 2H45A 3KLAB 4WEUD 4AG4L 1AXTH 3D3VD 3Q5OA 1ES0A 2YN5A 4PTUB 4DUWA 1DQLL 1TJHH 5FKPB 2VE6B 1NCNA 4OZIA 5DD3H 3KYNB 2L0DA 5C70A 3VXRA 5E9DD 3DXAB 1LGVA 1S7SB 1LO4H 1FNLA 4C4KO 4JPVL 3OKOB 4MJ5B 3REWA 2B4CL 3MGOA 1G9NL 5CBAA 3CNKA 5IG7A 2VLJD 1EUTA 3FN9A 5KOVC 1FG2B 5DRZA 2F53B 4PV9A 4MNHB 1UCBH 4RWYL 5ELIA 2NXYB 2CH8A 4PJFE 1MELA 3S4SB 4P99A 2HT3D 2A6DA 1OAXL 4DW2L 4OQTA 3W0WA 4E41E 1GOGA 1L7IH 3SN6N 3QCVL 1HXYA 5BV7C 3AREC 4F15B 3HC3L 1CFSA 1MCWW 1P4LB 2MPAL 1T22B 1QFPA 3OQ3B 3IFOA 5SV4A 1H0DA 2GUOB 1G9MH 3QWQB 3IJYA 3HI1B 5GRYA 1IGMH 4XVUC 1UXWB 5F7YC 3VA2C 5DMKA 3MODH 5CZXC 2RJMA 5BJTA 3S36H 4PGBB 5EZIH 1Y18B 2EDTA 2AJZB 3P11L 4PRDA 4PREA 3L3JB 4X7EC 4RA3A 3T8XB 3ALPA 1T3FA 3FMGL 2HFTA 1K4CB 4FP8L 4KI1A 4Z77B 1FNHA 4M8VA 3SE4C 2W65A 3BKJH 2OXGA 4KRLB 3CK0L 5E2JA 4YGVA 5C0DA 3WHXA 3QNYA 2FSEB 1UXSB 3I2CH 4RGMC 1KUMA 1A6WL 4OD3L 4DOHB 3KYMB 4KHXH 4GO6B 4D0BA 4K94L 4UU9A 4KZEH 3SEPA 2V9RA 4DN3L 4BFGA 4Y2DA 3ZT6A 3QDJA 1MQKL 4JVUA 4Y5VB 5L2JA 4TYUA 3RRQA 1NGZB 4YFLI 3FN0H 3IYLW 4GG6F 4JFDE 3FO1A 5C0AD 2BHYA 4GKNA 4PJIF 1P6AB 1JWUB 5FM4A 4I9WD 4X6FA 3EO0A 2OTUA 4OKDA 2B2XH 3NCYS 4MA3A 4MHHG 4OZIB 4ODTL 5E7BA 2VXQL 1ZLVK 3HR5A 4OBRA 2AGJL 5I8KH 2VC2L 5L2KE 4P5TC 5T1DH 3HMXH 4WHYG 4XPGH 3REWB 1WTGT 2M26A 1IGIH 2P8PA 5ESVB 1CTNA 1MAJA 3PXHA 1IARB 3E2HA 5IG7B 4Y89A 2B4CC 4YFEA 1W0WB 1G9NC 3ZT7A 2Q3ZA 5MHSE 2XY1A 3X3FH 5F44A 4BQCA 2DTML 1LO0L 3E6FB 3G6AA 5JA9A 4H25A 1WBZB 1IAMA 4ZUUA 1B9ZA 1YDPB 2EEAA 4I5BA 4TQEL 3CDYA 1RUKL 1A6UH 3DO3A 2A6DB 5D1ZD 4L3EA 4LDEB 3RFZC 1DEDA 1D5XA 1EERB 1OP5H 4G6KL 5E0QA 1R3IH 5J13C 1CFSB 2COQA 4YPGA 3TBYA 1H0DB 2X1OA 4XVTH 2ORBH 1PYWA 3DV4A 3IJYB 5CP3H 3TGXA 4DCQA 4PG2C 3CVHH 5CD5C 1H8SA 2DM2A 4KQ3L 5DMKB 4LCCA 1G1CA 4E41D 2ZUXA 4F7CB 2EC8A 3N06B 5GHWL 1IC5L 1MVUB 4W70A 1I8MA 4PREB 1RK1A 3EDDA 5F97E 5ALCH 2X40A 1R3LB 1T3FB 1KF9B 3RL1A 4ONGH 3F7QA 4NC2B 5K9OB 3B9KD 3AU1A 3DSFH 4JFZL 3MX0A 5F7KC 5EOCJ 3VJ6A 4LLMA 5JQHC 4OLEA 5C0DB 1KSRA 3WHXB 4Q0XL 3LVEA 4M03A 4M7JL 3IJSB 1BGXH 2B1HH 3VE0B 4NJAL 4KJPD 4ZUVB 5IVXA 2X89D 4D0BB 5HHQA 4UU9B 1N8ZB 2GJJA 3NCYP 1U8KB 4Y2DB 4UT6H 1RZKH 4GBXC 4K94C 5FYLH 2MNUA 1RAMA 4FQIL 5KAQG 5M95B 1AH1A 4HDIA 4LPTA 3TBTB 4JFEA 2R0KL 3RL2A 3A67H 3ARFD 1QNZH 1TVDA 3ARPA 1VACA 1EHXA 1JYXA 2ZUTA 3QZWG 1U8IA 1F11A 3T0VA 5IHLB 1QR1A 2MQCA 1XEDA 3C08H 3DUSB 1NQBA 3EO0B 1QFWH 2FX7L 1DL7H 4MA3B 5DMGD 4H20H 1IL1A 4CMMA 3WNOA 2A73A 4HHAA 4K3GA 5F9OL 5C7XL 1KIUA 3DBXB 4Y4FA 2F54A 1JE6A 1FE8H 2ICES 1G6RL 4YAQA 3JWDL 3E2HB 2C26A 4PJGF 2A38A 4HPOH 1TPXB 3MLPA 2D31B 5A1AA 1XGYL 5HPOA 4K8RD 5B3NA 1UKQA 4EKXA 1RZ8A 5TE7L 3CC5B 3G6AB 4MVBA 1YZZA 4H25B 2Y5TA 1GC1H 4I5BB 5JHLH 5L2KD 3QIBA 4GRWB 4NPYB 1X5GA 4ETYA 4F33A 4LCIL 5DT1L 5C0JA 5FUOL 5HHVL 3ZE1E 2BRQA 1T6VN 3BWUC 1K5NB 5DMJB 1YEGH 4M7LT 1DQMH 4JFYB 5DMIH 5D7JC 3H3PH 1EGJH 5DRXA 3S3PA 3LPFA 3S5LG 5MHSD 4PJEB 4P2OD 3QH3A 4YR6A 2FYYB 5CP7A 2XN9A 4WUKL 1F4YH 3PV7A 1BJ1H 3HNSL 4LPVA 2WP3O 2YPKA 2DMKA 2H9GA 5DQ9B 1CICA 1A9BA 1A4KA 5IESL 3SDAD 4JCLA 2CDGB 2BOBB 4XXCC 5T5NF 2CRMA 2E9BA 3PABA 3WKML 4Y19A 4MXVE 5CJOL 4NIKB 3VXUD 4UUJB 4FFVC 2GK0B 4JFXA 2E5EA 3RL1B 5IBUB 1GGBL 2IFFL 3O2WH 1NLDL 1F4XH 4KROC 1YEFH 1AQDA 4ALAH 1K3IA 4QCIA 3TM6A 1CE6B 1DE4A 2VZOA 4A6YA 1L0QA 3BKYL 5C0NC 4EZMA 2NLJB 5F21B 1ADQH 1KPVA 1CWVA 1KNOB 1CIUA 2YKLL 1IC7H 3TNMA 4KY1L 4OLYH 2Z8SA 2H8PA 3JV6A 5IVXB 2WWMC 5MENE 1YEJL 4NZUH 1BZ7A 4ODXB 3U48A 3CDFA 4IOSD 4DEPB 5IW1A 4P59L 5EUOA 4HDIB 4PJAB 4YE4H 1V7NL 4P5KA 4OCXL 4QTIL 4MQXD 4R4NC 5TQ2L 3RL2B 3VXTA 1XF3A 3T0DA 2PO6A 3KPSA 5GGQL 1VACB 5AG8A 4ZFOA 2AJ3B 5I15H 4RGNC 1F11B 4ODHL 4KKCD 5CHNA 5JA8B 1NCUA 4WO4A 5D7SH 4XB8A 2R9HC 3O6KL 2IADA 1IL1B 4CMMB 1OWRM 2A73B 1MWAL 1GZQA 1AP2A 4HHAB 4LRIC 2E7CA 5IBTL 3TT3L 2ILLA 4D8PB 5BW7C 2F54B 2BXYA 2IPTH 2Z4QB 3QULA 1NCTA 5HVFB 4U1GC 5DS8A 4XBEL 4PLOB 2XZAL 5C09D 2O93L 1FVDB 4XHJC 4D3CL 3JWDC 4X4ZA 2EH7H 5JNYB 2UUDH 4K3JH 3P77A 3KLHD 3V0VA 1JF1A 3MNWB 2Y5TB 1DUYA 1OLZA 1TITA 3RIFK 1VFBB 1BZ9B 1KCKA 1S7RA 5DJYB 1HCVA 3BH9A 2ATPA 3QUZD 4ZQKA 2QR0A 1QO3A 3N1QC 2M2DA 1FCCA 4ONFH 4M43L 2XQYG 3DVGB 3OXRA 4TUOA 4U6YB 4Z7OF 4MB4A 3RA7L 3ZYIA 5J6HA 3DETC 4P4KA 5CP7B 2IPKB 5E2VH 5FB8A 1CICB 4X6DE 4TSBL 4NWTL 4RFOH 1IVLA 1A4KB 4LPWA 3U46B 3D2UD 3VH8B 3KXFE 1GGUA 3OR6A 5EU6A 4UILH 1TVHA 4UB0H 3PABB 4Y19B 1NC4B 2EKSA 2IJ0C 4P57B 4ZAKD 4PRNA 4JFXB 5HHMB 5F8QC 2MCPH 1XAUA 1U8LA 2P7TA 3E6HA 5D1QC 4RA0C 4JRXD 4RBPH 5FUZH 1EO8H 2W07A 1B0RB 3EZJB 4XMKH 4QCIB 1DE4B 3RY6C 1KPVB 4UV7H 4XH2B 4X80H 2X4NA 1IMHC 4YUEL 4XWGH 4NUGL 3QWOA 3JV6B 2V7HB 3V95A 4XVJH 3QUYC 4HWNA 3RHWK 1KN2L 4MA7H 5J4MA 1UH2A 2ATKA 3HUJF 5F88B 5IW1B 5EUOB 4F57L 1Q9KA 3CGTA 2Q6WA 2PO6B 3KPSB 4ZOEA 3U9UA 2NY7H 1N2RB 1KB9K 3AY4A 1HWHB 1CFQA 4GKSA 4WU7B 3C2AL 4ZFGH 3WNPA 4R7NB 1LEKB 5CHNB 2EE9A 5HVHC 2XI9A 3IDNB 4LAQL 3EAKA 1GSMA 3MJ9A 4O58H 4WO4B 4G9DB 1DBBH 2IADB 4GW4A 3MNZA 5D1ZA 1P1ZB 4F7EA 4GXVH 2NXZC 4FG6C 2GJ6A 2FRGP 2DWDA 3UTSE 3KDMB 5CJ5A 3QXTA 3BPNB 3ZLQC 2X4RB 1NC2D 3IU4H 5I2IA 1E0OB 3FQTA 4ZPTA 4PJFA 3HE7D 4O02L 4NZTL 5C0IA 4N8VG 5TQ0L 3V0VB 3QFJE 5ICXA 4JHAH 5D7LB 1XF4A 1KLFA 5C0FB 3IJHA 1RJCA 1MREL 1S7RB 1V8HA 2ATPB 4ZQKB 2QR0B 4HS3A 5E6ZA 5DA0B 1I3GH 5E2WH 4WI7A 4F37F 2WBWB 4H0HB 2NY3D 3AM8A 4DVBA 4XP4L 3VFOA 2D9QB 4P4KB 3WIHL 4KGJA 4BUHA 1YMMA 1CGSL 1CFVL 5FGBC 2NYYC 1S7VA 4JPKL 3PWVA 4RAVA 4WU5A 2CD0A 1MY5A 4Z0BH 1ZVYA 5EU6B 1KLGA 3UJJL 3TESA 5JOEA 1AR1D 1FDLH 2P8LA 4PRNB 3OAYH 3C09C 4PJBB 2P7TB 1U8LB 3ARFA 3E6HB 1T83C 1LEIA 1A9EA 4HGWA 1G7IB 4HUXA 3CCHA 1LVEA 3F65A 1IQDA 5E8EB 4NBZB 5H94A 4KVCL 5EWIL 5I1CL 4OB5H 1XGRA 2E7LE 3F12B 4I3SL 5F6IC 3KXFD 3V6ZB 4PUBH 2X42A 2H2SC 4M6MH 1EBPA 3QWOB 4Q97A 2UV3A 1XT5A 2Z31D 4UNTA 1T7YA 3PP3H 4LLUB 1QR4A 4KU1A 1MJUL 1UZ6F 4KK5D 2ATKB 4JFDA 4WI3A 4YXHH 5IVOA 1JNLL 3ZT5A 4P23D 5FK9B 4XVSH 4P2YA 1EX0A 4Y4KC 4O9HH 3BKCH 2Q6WB 3U9UB 4PLKC 4DN4H 5BV7B 1KB5A 5F96H 3AREB 4PR5A 3U30C 1CFQB 4GKSB 5C3TA 4JFQB 2D9CA 3FQXA 2FD6L 3VXNB 5L2KA 3FL7A 3WNLA 4KTEH 5FF6B 5GJTH 2YUXA 1QSFE 4Z7WA 1H5BC 5F71A 4Q9BA 3LKSA 5EO0A 3WNMA 2CKNA 2IG2H 4G8FB 3CFEA 3MNZB 5DVLA 5FYLE 1HDMA 4DKEL 4YX2L 2VXTH 2GJ6B 4ETQB 2X70B 3OAZK 2IFGA 3ULUL 1MPAL 5DRWA 4OZFH 4LF3B 3HCVA 3L3KA 4LLWA 3T08A 3WJJA 4Z7VB 4EIGB 3MV7D 2A77L 3GJFK 4UNVA 3DLQR 1KJ2A 5E94B 5CUSH 1I8KA 5ICXB 2VERN 2WINA 2VDNL 2GY5A 3EO9H 1JTPA 3CAFA 3IJHB 2LU3A 3UTSD 4RGMB 4UINH 3IDYB 1OP3H 4HS3B 3DIFB 3B43A 4QHUB 3MRHA 1B4RA 4LNVA 1MHCA 3BGMA 3GSWA 2YMXH 4WW2A 4BH7B 1CK0L 4O51A 2C3VA 4DVBB 4GBXA 3QFJD 2ADJB 5K93A 3VI4F 5T1LD 2J88L 4KC3B 1YMMB 1B6UA 4G5ZL 1S7VB 2BNUA 1JZ2A 3Q5TA 4MNQE 4RAVB 5SWSE 3L3OA 4OAWA 1NCBH 1CDYA 4OZHE 1BWWA 2X4OA 3QHFL 1NAKL 1XZ0B 3ZSTA 4X4XB 4ORZC 3W39A 5KSVA 1GZPA 2P8LB 2BX5A 5LQBL 4Z8FH 2CK0L 3BAEL 1VGKA 4PJ5E 5E8NB 4JDVA 3OKLA 4P5TB 4YDJA 4PLNC 1PQZA 5H94B 3V7MA 2OM5A 4CW1A 3KPMA 1C12A 4CU8A 1TZGH 4M5ZH 4NN5C 5DJDB 2XTJC 1QHPA 1T66D 4NQXA 3EOAB 4PBVC 3O8XD 1KT2A 1GGYA 4UV4H 3WEXA 3VFSA 4Y7MA 1YJDL 1JZ8A 2OI9A 4XPBL 4HXAH 3S37H 4LLAA 2AEQL 5IGXL 1UYWL 4N1CA 4AEIH 3UP1A 5MEOA 4D0CA 3MBED 4JKLA 1DLFL 3DVIA 4GW1A 2ICWJ 1CR9H 3WN5C 3MYZA 1BFVH 4WGVB 1KB5B 4IRZH 4PR5B 1LQSR 3E8UL 4UOJA 5J13B 3EO1B 2NMSA 1HOCA 3MJ6A 2AERT 5SWZE 3A6BL 4Z7WB 2CO6B 5EO0B 3LKSB 3SGDH 4Y5XA 2YN3A 3V4VH 3CFEB 2XWBA 4NGHH 1DCLA 4XI5C 4PY8J 5EZLA 4ZNCD 1QPPA 3U82B 2WK2A 4O2FA 3VMOA 1B0WA 3VWJD 3BFOA 1JGDA 2ZOKB 2GIYA 2HG5B 2VL5B 1MOEA 3ULUC 1GHFH 5IJKA 5I1GH 1LK3H 4ZSOE 2N4IA 2WWKT 2O5ZL 1QSFD 3RI5K 3EDKA 4EN3D 1G0YR 4PTTA 2DLGA 5DYOB 3KPOA 3WFCH 5FYLD 4AL8H 4FRWA 1CZ8L 4FQCL 2NNAA 5JXAH 1TQBC 3DGGA 4JHBA 3FT3B 2ZPKL 3TN0D 3FB6B 1X5KA 3MRHB 3WXWH 1C8PA 1JGVL 3BGMB 1BQSA 3GSWB 4PGDA 4KH2A 5L9DH 2OTPA 2YC1B 4GBXB 4BK4A 3QJHA 4JKKA 5HHXL 3ES6A 4WNQB 3ULVF 3EOYG 4G3YH 3M1BA 5EC1B 1I8LC 4RISL 1MCWM 2YRPA 4QT5B 1BQHB 4OAWB 5KZCB 4KUZH 3W2DL 2YD2A 2YPLE 3RGVC 5JOFA 1KXVC 1Z2KA 4P2RA 4L4VE 4DQOL 2X4OB 4L1DA 3OX8B 2UY7A 3WFDH 4APQC 3EFFA 4BSWB 2DYPD 4G6JH 5KSVB 1YEIH 4ELKA 1CXKA 4JM4H 2DBJA 3KHQA 1FN4A 4CU7A 4LRIA 2CGRH 3MUY1 4L9LC 1HSBB 4M9PA 3OKLB 3PWNA 1PQZB 4MNQD 4GRMA 3TVMC 1NCDL 2HH0H 3DI2B 5SWSD 1CYGA 3TJHC 5MENA 1HQRA 4OCYH 3UPCA 4NQSA 5EZJA 5GRXG 1C12B 3HI5H 4H0IA 4X99A 3LQZA 5ILTH 2IAMC 2C3XA 5K9JL 4XXDA 4NQXB 5JR1L 2OMNA 2HKFL 4OZGE 3WEXB 3BT2L 1KTDA 1I9IH 3QI9D 4PJ5D 5C0BE 1I9RH 4HFUH 5IMMA 1YJDC 4XNQA 2HFFB 3RP1A 4B41A 4FZEH 5MEOB 3HG1E 1QRKA 2XWJA 5GRUH 1HNFA 3CVIH 4MNGE 4MDIA 5ALBH 3CX5J 1EJOL 1I7ZA 5IK3A 1X5LA 2DQUH 2R39A 4Q6IA 3RWDA 1JGUH 2QHRL 1P4BH 2R2EA 3B5TA 1OSZB 1XGUB 2IF7A 4PJCB 4FXGB 3L5XH 3NACL 5K59E 2XWBB 1NAMH 1I8IB 1RZIA 3ZYOA 1LE5A 2A6IB 3IFNH 3KPRE 1RZJH 3KPTA 4O2FB 5CJXC 1G0XA 3RTQC 1INEH 5FO7A 3CXHJ 7FABH 1D6EA 1UM5H 1A0QH 5ID1A 4ZOBA 1H3TA 4KROB 3DO7B 2VDKH 1N26A 5ERWA 4PTTB 4JO1L 2VDML 5CLTA 3G5VA 4HUKB 3V0WL 2NNAB 5C0RL 1VFAA 4YEEA 1ZT7B 2GKIA 2DLFL 2WQ8A 3DGGB 2UZIL 2BSTA 3FJTA 1X5XA 1R3KB 1AQKH 1U91A 3QUYA 4R8WL 5L0QC 1TVBA 1OARL 1TNMA 2HLAB 4PGDB 4XP1L 3N1GC 4X6DA 5MEPB 1X6NA 4CVZB 5LVEA 1CIDA 1RI8A 5D71H 5EU7E 3ZYJA 4UT9L 3B8YA 3SQOL 5FO9A 2N56A 3PXJA 4G8GD 1S9VA 1SY6H 3CDGB 2FX8H 2IH3A 4U1NB 3O6FA 1M6OB 4DK3A 4RGNB 4OLZH 4H1LG 1PX4A 4P2RB 2HFEA 3FB5B 2GEEA 1O5DT 2YBRA 1J1PH 3MLVL 2VISA 3D87B 3QQNA 2BVOB 2AEPL 2ZJSH 3LS4H 3ESVF 4OD2A 1DQDL 4YQXL 1T04A 5AYUL 1FO0L 3OZ9H 2OL3H 5FUCE 3NPZB 4N0YH 4WVRA 2H26A 4U1GB 3VG9C 3G9AB 2BJMH 2YD8A 1HQRB 1JWSA 2YPLD 3V4UH 3ZTNH 5EZJB 4DAGL 1G6RB 4L4VD 5HVGB 4X99B 3D39E 4K07A 4Y4HC 1FPTH 2HVJA 1DFBH 1IGYA 1DEEA 5AUMB 3FONA 3SE9H 2E7BA 1URLA 1IFHH 1JK8A 4K3DH 4TNVF 1IGFH 4X5WB 4XNQB 5K9KA 4M4RA 4U7KA 2JJTC 3DMMC 4OSUH 3ARVA 4R97C 1J5OH 4HPYH 3L5HA 5DSCA 5IW6A 1HI6B 1KCVH 1QBBA 1CI5A 5IK3B 3LQAH 3KLDA 2WBJD 5TPWL 1QBLH 2R2EB 5DJAB 3UTSA 1WBXB 2Q76B 5C0BD 3TA3D 1T2QH 3O2VL 1RZIB 2R2CA 3HG1D 1WITA 5EA0H 3V7AE 2AJUL 2GI7A 4EDWL 5C9KA 4CADA 3GMLB 3GM8A 5T1LA 3S35H 3B3IA 1PY9A 3NFSH 1D6VH 1UEYA 3HMXA 1T1YB 5E56A 1WWCA 2NY6C 3EKCA 2NW3A 3LOWA 2XRAL 1NGQH 4YHIB 3NCJL 4YXKL 2IH1A 1WZ1H 3KPRD 4TVSa 4Z9KB 3LCYA 1FL6A 1II4E 3IDUA 2ESVB 4PRHA 4F9PA 4K2UH 2BSTB 4GW5A 2CXGA 4YJZL 3QUYB 1R24B 1U91B 5DR5H 1KTKE 3QIUD 1F6AA 1FL3B 1FHGA 1E28A 4RSVA 3GSNL 3LPGA 2HMID 2FGZA 1KCRH 1G7LA 5FO9B 1VFMA 1FFPA 1FZMA 1S9VB 3W5NA 4G9FE 1EHLL 5D7KE 2IH3B 3BESR 4JZJA 2J5LC 5J56B 2HFEB 1Q1JL 2P5WB 5IOPB 2ZP0T 4KZDL 4X7DC 1HHIA 2Y6SD 4PJ9D 3MRMA 2E7LA 3MRBB 3I9GH 2HTKD 1NH6A 1MCOL 1IM9B 1MF2H 3D85B 1MWAB 1HKLL 1D5BB 3QDGA 1JPST 2PTUA 3BP5B 1H3GA 2YA2A 3HNTH 2HYMA 1JWSB 3D6GA 5MEQA 3WUZA 1NBVH 2ITDA 1R0AH 1CFTA 4ODBD 1HHJA 4FQLL 4JG0H 4J4PC 3M07A 1IAOB 3CX2A 2AI0H 2HVJB 4GKZB 4OZGF 2UYLA 1IGYB 5FCSH 1CQKA 3FONB 1IAIL 4E9LA 1ZMYA 3UTTA 3O9WD 1JPFA 1N7MH 1NPUA 4OUUA 3PDOA 3W5MA 3VWJA 3VGBA 3OAYK 3UTZA 3O6MH 2WQRA 2XXMB 3ESUF 3S8WA 3D25A 3L3DA 5DURD 4EDXB 2B20A 2PYEE 4O4YL 4XC3H 4ZG1A 5DD5L 4EN3A 1ZGLP 1YNTA 1D7FA 2OZ4L 4LLVA 2CR3A 4Q2ZB 3W11C 1GPOL 2CJUH 5CAYB 5C08E 1FC2D 1YNLL 4MAYD 4R7DB 1WZKA 3QRGL 5DO2D 2D7TL 4R2GD 4FXKB 4AH2B 3PJSA 1NJ9A 2HN7A 3PP3K 4P3CH 4NRZA 4O2CB 1LDPL 4Z76B 3GJFB 3F7YA 1KIPB 4MQ7A 3B9EA 2NZIA 5D2NA 1NFDB 5C0GA 4ZTOH 1U8JB 4CADB 3QDAA 2OTWA 3FQNB 3B3IB 3ZO0A 3C09B 5D70H 3SOBL 4J12A 3G6JF 2B0SL 4DFIA 3CZJA 2C3HA 3GO1H 2NW3B 2QL1A 1VPOH 4GUPA 4WHDA 2J1KA 4U0QB 3IKCA 1S9KC 4X6CA 3UDWC 5AAWA 3CFJB 4PRHB 2F5AL 4GW5B 3G5XA 1HQ4A 4PJXE 4NWUH 1WWWX 1FGNL 4S2SB 4HUWB 1QBMH 4JQIL 3SPVB 4MNQA 3H0TA 1QKZH 1E28B 1QVOA 3U7YH 1MCDA 5SWSA 1YEHH 4OZHA 4POUB 5C71A 2QSCH 1RQ5A 2RBLA 5ABDE 3NTCL 1G7LB 4Y4KB 1FZMB 4FABH 1EGJA 3WHE1 1T7ZA 5EIVA 3WN5A 1FLRH 3U4EA 2X10A 1TCRA 3U30B 3FB8A 5KSBE 2IWGA 3QI9A 4PJ5A 2LABA 3VXOB 1AJ7L 4A2MA 2X4TA 4OF6A 4L8CA 1H5BB 2G9HA 3GNML 1BHGA 4DTGL 3QDME 2X9YA 1NKRA 2R2BA 5DMGC 4JAMA 3MXWH 4N1EA 4G9FD 4HH9A 4F3FB 1AI1L 1Z9OA 4KPHH 1RUPL 3QDGB 5T33H 3W9EB 2FR4A 3RVTC 5EO1B 4PS4L 5MEQB 1DLHB 3MJ8B 4IJ3C 4C56B 3RWIA 4HGMA 4MD0A 3S34L 5HTSA 3SGKC 4WTWA 5BRZD 3P0YL 1IGTA 1ADQA 4L5FH 1DBJH 1U9KA 4XC1L 5DJCA 3UTTB 1BFOA 3H9SE 1HHHA 2FGWL 3BPCB 3O3BA 3UTZB 3BIKA 5DJ8A 2I25N 3D25B 3L3DB 1QA9A 4W4OC 4Q9QH 3MMEB 5SWZA 3KPPA 3TPKA 3NVQA 1F90H 5IT2H 5JUEL 1FIGL 1YNTB 4LLVB 3HFML 1KC5H 2K1MA 2VAAA 3KYKL 2YD4A 4PY7B 1UB6B 2BVPB 5DUBB 1KCUL 4M7LH 4P2OC 3FAWA 3TZVD 4EOWL 4NRZB 3VFPA 4F9LA 5FM5M 1Z0NA 2VIRB 3F7YB 1YEEH 4H8WH 2PYED 3HAEA 5D2NB 5C0GB 3MA7B 3U0WH 2VL4A 1NBYA 5FDYA 2OTWB 3WLWD 4F58L 3LAFA 4JM2F 3O4LB 5T3ZH 2GJZB 5DUML 5C9JA 3IXTB 3IAPA 4I1NB 2VLRA 1RU9L 1A3RL 5IB3B 4OD1H 3O3EA 2HWZH 4OCRH 3AXLB 3FN3A 3FB7A 2Q8AL 2HJFB 5BS0E 4X6CB 5I8OL 4NN5B 3X3GH 2XTJB 2ZUQC 1JNHA 3EUUA 3G5XB 3ALWA 5KTEL 2YD1A 2PR4H 1KJ3H 1F8TL 3SKMB 3U6RA 5T5FH 3IFPA 2I24N 2LQRA 1CVSC 1I75A 2DM7A 2NW2A 3CFCH 1F00I 3AS3A 2R2HB 3QFDA 3WN5B 3ZL4H 1DDHA 5BZDB 3VW3L 1MI5D 1TCRB 4Z7UE 4MQXC 2VN7A 5D8JL 1XMWA 2W0FA 1H15A 2CQVA 1Y0LA 2W9EH 5TH2A 1HZHH 4S1RH 2VXVL 4QY8B 3RQ3A 3UROR 2BC4A 1QYGH 4EBQL 3VD5A 5F1IA 4AZ8A 2FR4B 2QQNL 4FNLH 1AGBA 3ZE2E 1VSCA 3GK8L 3REVA 3U36A 5C0BA 3JWNC 4KV5E 4C4KT 3TA3A 3LY6A 4MS8D 1A6VH 3RWIB 5H37H 4TNWK 3WO4C 2FJHB 2O5XH 3HG1A 3HNVH 1UG9A 5EB9A 4XPAL 3HC0B 4MNGA 1IGTB 3QDMD 3EYVB 1MJ7L 3RIAK 4IOFD 1TQBB 4OCMC 1HHHB 1QRNA 1QA9B 3VMPA 4KQ4H 3TBSB 1U3YA 3QUZC 4I18A 2J2ZA 5T3XL 4NDMA 1IKNA 1U92A 5DD3L 5B38B 4R90H 4OCSL 3QUXA 3KPRA 3BSZH 2KQNA 2A1WL 4LK4A 3H9SD 1YA5A 2HT4C 4NHUE 4DGVH 4DZ8B 4FQXA 4OV5A 2KUTA 3O45A 5E6ID 1E27A 5E8PB 3RGVB 4R96A 5I1LA 3RGHA 3LS5L 4JO4L 3HAEB 3LKQA 4PB9L 4APQB 1NBYB 3TBVA 2ERJC 2FLRT 4DK6A 3LEVL 3ARYA 1HE7A 2D2OA 1C7SA 3INUL 3MZTA 1UCBL 2LU7A 3SGJC 5C9JB 3QAZC 4L9LB 2QADD 2W60A 2JJSC 2VLRB 1C08A 4NZJA 3O3EB 1P7QD 4NQDE 4G6MH 4GG6A 4ONHA 3T4YB 2IAMB 3L3GB 3WUWA 1JNHB 3WSQL 4OCLC 5E2UH 3UAJC 5KVGH 1GOHA 3RVWD 1ZANH 1RJZB 3MREA 1OM3L 5KG9B 1PDKA 4FTVE 1NEUA 2AK4D 3R1GH 4Z7QE 1IGML 3KPQB 2CKBH 3IFPB 5D4QA 4ODSH 4U6TA 3MODL 5BS0D 4QHNA 1N59A 3FQRB 1R6VA 3QFDB 1DDHB 2F19H 1HHKA 4X4MA 4OFYA 2XWTA 2QV2A 4XAWL 5L88H 1H15B 5TF0A 4NP4H 4P2CG 4N9OB 4TOYL 4KRPC 3D39A 1AGDA 3VFNB 2CO7B 5TE6H 4V1DE 4GAGL 5JO5B 4P46D 2QKIA 1JHLL 4BQ6A 3RTQB 2P5EE 3U36B 2K7PA 2XKSA 1N3NA 3QBTB 2G2RA 3IXAA 1K8IA 3BX7C 1RK0A 4ODWA 1JUFA 4NOBA 4M61B 5CEXA 3C6LD 3HE7C 1JL8A 5GS0L 5IB4B 3GSVA 1QRNB 4NZRL 1FYTB 3ZDZE 4M5YH 4M7KL 3TJEH 5IQ7L 3D69B 5L0QB 4HWBL 3SDDD 5KVEH 1UM4H 2VR4A 1H3XA 5HYJE 5KS9E 2A6JB 3QXDB 1DBKH 4NDMB 4V2CB 1INQA 1U92B 4OLXL 1BBDH 1YY9D 3RU8L 1V3LA 2WBKA 1PG7H 5I8KL 1OQXA 1U8OB 2ZCKH 5KAQF 4OV5B 3F62A 5I1DB 3O45B 4F2MB 1IGIL 5DQDH 4D2NA 1OCWL 4JCMA 5I1LB 4PJ7F 1G7QA 1DUZA 2OCFD 2B39A 4ZNEE 5GRVL 1BIIA 3TPUB 1JNNL 2RQ8A 1EPFA 4EUPH 3MLZL 1ZHLA 1S7WA 2VDLH 1PD6A 4HMDA 1MFEL 5TFSH 4PGJA 2ENSA 3ULVL 4LFHG 1FAIL 1FL5B 2W60B 4G6AC 4LEOB 4E0RB 2OK0L 5TGBB 3X12A 3G08A 1ZTXL 5I76A 3VG9B 3VXME 2ED9A 4DKFL 1YN6A 5I75C 4GG6B 4J4PA 4Y4HB 5GSVB 1YYMH 4QRPE 5HDBF 1R3IL 4D94A 3GBNL 3MREB 3RWJA 3QEUA 2Z31C 2DOCA 3BKMH 3ZHDA 2FCBA 3DGCR 4BFEA 1A7OH 5B22A 1Y6NR 1U95A 3S88H 4NQDD 5J7CC 1UFUA 5E8OA 1G7PA 4UDTA 5F89A 3RBGA 3BUTA 1JFQL 3DMMB 4P23C 4R97B 1C5CL 4FQ1L 3ARBD 3MV9A 3SQBA 3KYOB 5CJBA 1HHKB 4V2BA 4PG9B 5GS1C 3SBWC 4UIKL 4HIIA 3CH1B 3KJ6H 4LQ1A 5SX5H 1UWXH 3GMNB 2R1XB 5EIIB 1BD2E 4YBQD 3SDXE 3OBAA 4LSVH 4B7IA 1NBZA 1OSPL 2WIMA 2PXYC 4XP6L 5HGHB 1AGDB 1JCKA 1Q0XH 2EEDA 2Y7QA 4ZO8A 2ZCLL 4TSAH 4QLRA 1IT9L 4XTRC 5FYJL 2QKIB 4LSTL 1FRGH 4LCWB 5HGGS 4PJDE 4PV8B 4MZ3A 4M1DH 3TZVA 1N3NB 4LVOC 2G2RB 3IXAB 1K8IB 1N64H 1RK0B 3NIDE 2NY6B 2DL2A 5CEXB 4TSCH 4UT6L 2PYEA 5KW9H 5IFAH 1E4KA 5CMAB 4LARH 2DL9A 4HBCH 4QXUL 3NBNA 1I9EA 4V1DD 1JYNA 2O5YL 3QYCA 3GSVB 3RVXD 5C08A 1BQLH 1OLLA 2QEJA 3SCMC 2E27L 5FEBA 5GS0C 1JVKA 2P5ED 4PJ8C 2BXZA 1OHQA 3C08L 1RZFH 4QXGH 2RFXB 1F4HA 1INQB 1F02I 5EU3B 2VTFA 3NFNA 1MEXH 1NGYA 5KSAC 1QTYT 5CD3A 2GTZA 5CGMA 1KGCE 5CWSB 1UM6H 4LMQI 3WS6C 3LEXA 5BMFH 5D9SA 4EQ2A 2J5LB 1G7QB 1C5DA 1DUZB 2DQDL 1JRHL 4N0FB 5HYJD 2WP3T 3BZ4A 4OIIH 3RDTD 1XGTA 4XMLH 4S0UC 2R23A 4OJFL 3I3DA 4MJIE 3P4NA 1I7RA 2WM0A 4IRSA 4OFKA 2R4SH 3MFFA 3BN9D 1EEZA 1UVQA 2NY2C 4PJXA 5D72H 3X12B 5GGTH 5I76B 5JPNB 3PIQA 3ULVC 3AAZB 1ZA6B 4YHPB 1FO0B 2EC9T 5ECJE 1MFAH 4G6FD 4HAGA 1UA6H 1UZ8B 4JJ5B 3SGKA 2UWEE 1LO5A 4QTHA 3JV5A 3O81A 5E2TH 2PNDA 1UT9A 3EOTL 3OHXA 1U2CA 4LSPL 5T3ZE 1T66C 1HK6A 1FNGB 1AO7E 5KSBA 4KMLB 1S8DB 3JVGA 1U95B 3VXMD 1ZVSB 4AIOA 5AZ2L 4MSWB 3WYRA 3BRDA 1G7PB 4UDTB 5F89B 3TCXA 2F74A 1S5IL 3MV9B 4PJGB 3MBEC 3P73B 5SWQA 3WHE0 1J0JA 2EDHA 4QRPD 1EHNA 4U6HB 2VXUL 1N6QH 2UY6A 4QHLA 2EDLA 3VG0L 4NQTA 1F4XL 1NBZB 2CRZA 4OIBA 3J7HA 3FTGB 2BFVH 2DRUA 4F8QA 3QCTH 4N8CH 2G60H 3QIWD 5EZOL 3OGCB 2EDKA 4G80B 2FHFA 3RNQA 3JWOH 3TIDA 3H9SA 4X8JB 1NGWA 4HFWB 3P3YA 3QO1B 3TC9A 1L7TL 1BD2D 5DD6A 5E6IA 1J8HD 4U1JA 3NCFB 2BK8A 3TWCH 1RZKC 3OJDA 4YDIH 5LCVH 5GRVK 5L8JB 1HSAB 35C8H 3CZFB 3ARXA 5C0CA 3HRZB 5J57B 1EXUB 1E4XH 1ZVHA 1BVLA 2QHLA 3NFNB 4C83B 4HKJA 5J8OA 5CFHA 3GSNB 1NGYB 4LBEA 3W9DA 1DN2A 2GTZB 4J3VA 4XCFH 3TF7A 2IPTL 3B83A 2YEZA 5ESQB 4IDJL 1J1XH 4RMUA 1BPVA 2CR6A 3OKKB 1IBGL 1NGXA 1FNFA 3MYJB 1ZT1A 1XF1A 1IAKB 1S7TA 1WT5C 2ICEA 2J12B 2R23B 4LHUD 5BS0A 5HI4D 3RVUD 3P4NB 1I7RB 4IRSB 5FYKU 1KGCD 5I73C 3RKDD 5EN2B 4XWOD 4JQVC 3P30L 3PIQB 3QO0A 3VXQA 2CUMA 5FHBL 2NY1D 4FQ2H 4I3RH 4IJ3B 3AS2A 3T3PE 2XICA 1NUNB 3ZKNC 4KKLD 3K4AA 4TVPH 3VFGH 4WV1C 1CL7L 1U6AH 4F80A 4MJID 1OD7A 2YD7A 3MR9A 2DS4A 4Z7UA 1DVFC 3W81A 3GIZH 4RFOL 1DSFH 3MUJA 2JCCA 1ZHBA 2EXYC 3ILPA 1ZK9A 3TNNA