1ZHBA

Crystal structure of the murine class i major histocompatibility complex of h-2db, b2-microglobulin, and a 9-residue peptide derived from rat dopamine beta-monooxigenase
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
273
structure length
273
Chain Sequence
PHSMRYFETAVSRPGLEEPRYISVGYVDNKEFVRFDSDAENPRYEPRAPWMEQEGPEYWERETQKAKGQEQWFRVSLRNLLGYYNQSAGGSHTLQQMSGCDLGSDWRLLRGYLQFAYEGRDYIALNEDLKTWTAADMAAQITRRKWEQSGAAEHYKAYLEGECVEWLHRYLKNGNATLLRTDSPKAHVTHHPRSKGEVTLRCWALGFYPADITLTWQLNGEELTQDMELVETRPAGDGTFQKWASVVVPLGKEQNYTCRVYHEGLPEPLTLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
publication title A structural basis for CD8+ T cell-dependent recognition of non-homologous peptide ligands: implications for molecular mimicry in autoreactivity
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 63
structure length 273
sequence length 273
chains with identical sequence D, G, J
ec nomenclature
pdb deposition date 2005-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1zhbA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1zhbA01
3CH8A 3UTOA 4S1RH 3ARDD 1JTTA 1CDBA 1FHGA 3ROLB 4ZUTA 1B0GA 4QRRA 1IC1A 5E9DA 4FQXA 3A6BH 1NANI 3TZVA 1QQDB 2J12B 4QXUH 5BO1H 3SBWA 5DO2D 4DWHA 1MCFA 2X4UA 3BAEL 5DUML 2EZ0C 4U0RC 1CL7H 1FFPB 1E4WL 1QNZL 3P9MA 3HC4H 2XQYG 5INCA 3TJEH 3ZKXC 5F8QC 3SCMA 4XNQA 5AUMB 1FJ1B 1NCDH 5SWSA 1H3XA 4AQ1B 1QD0A 2HVKB 1LEIB 1BQLL 3NN8A 2IBGA 1JNNL 1QYGH 2DJUA 2AJSH 1SHMA 2JB6B 4FHBD 2W0KA 3Q6FB 1CCZA 1RZ8A 5AZ2H 2LFGA 3QIWD 4KRNA 3JTTA 3GSUA 2YPKA 2VR9A 1KEML 5EBMA 3KXFA 3GK8H 4ZUTB 5CD5D 1B0GB 3U2SA 3V6ZB 3ZL4H 3ZT7A 1AGDB 1ZVHA 3TZVB 2I9LB 4N8VG 1K3ZA 2FJHA 3NA9H 5C0CD 1CF8L 5JLZB 4YHOH 1MJ8L 1HI6B 4I48B 4XPHH 3IFNL 1Q0YH 1CGSL 3TPKA 4DKDC 1RMFH 4PJ9A 1EMTL 1CTNA 4WI8A 2D9QB 4ZFGH 3ULVC 3T65B 4QOKE 1MCPH 4K71B 5HHNB 1CT8B 1PSKL 3ARGC 3T2QA 15C8L 3ARVA 5KBNC 2GITA 2XACC 3O3EA 5FGSA 3MACL 5SWSB 1NBVL 1K85A 2YPVH 3MNZB 3L3HA 3FQUA 1PZ5A 1U8KA 3ALXA 3NN8B 1C16A 3STBA 2EXYD 3UYPA 5C09D 2IADA 3VWJA 3VFWA 5IWLC 4PJFF 3JWOC 3GZKA 5DC4B 1RZKC 1B2WH 3S35H 3CFKA 1RZ8B 4WTWA 1WBZA 1FN4A 3DOSA 1T5XB 4G6JH 5JORA 1GZQB 3GBLA 2YPKB 4K3GA 1Q9LB 4YXKL 2NY6B 5EBMB 3KXFB 3EDKA 1BJMA 3CX2A 1Y6MR 4UNUA 1H0DA 1WLHA 4G9FE 4YDIH 2HT3C 1KPUB 4U1JA 5JIIA 4YO0A 4FZ8L 3B9AA 3ARBD 2FJHB 1I3GH 2XZZA 2FJFA 4N9GA 3W11C 3HNSL 1EUTA 1I4FA 2XA3A 3DGGA 5F89A 4PJ9B 4QGYA 4W4NA 5HHXH 5A3ID 4PG2A 1WZMA 4I4WA 2ED9A 1FE8H 2PYFA 2EC9T 2YD7A 4JFHE 5IQ9A 4WFEE 4OI9A 1GGYA 1GXEA 2I5YH 3O3EB 4KPHH 2K9UA 3RTQD 3QO1A 4JFDE 3L3HB 2KL6A 3FQUB 1U8KB 5D9SB 1MCIA 3EO0B 1ADQH 1TQBB 4MS8C 5BV7H 1N3NA 5KVGH 1WSST 3V6OE 5J6GA 4JPVH 3KLAB 3FO0H 3CFKB 3D18A 1WBZB 5JORB 5GRZA 1D9KA 2EO1A 1OQOA 2FWOA 3G6AB 3UTQB 3DMMC 1H0DB 4K7PH 5CIPH 2Y9RT 4U1JB 4YO0B 4BSJA 3ZTNH 4DGYL 4APQD 2FJFB 3MOQA 2AJXH 4L9DA 5F9DC 1I4FB 1UJ3C 4FQ1H 4YBHA 1NKOA 3DGGB 5F89B 5KSAD 4DN4H 5I8KL 4F7MA 4I4WB 3H9YA 2BVUA 2EC9U 2VO5A 3HZYA 5E24E 2PW1B 5IQ9B 4LCYA 5MEQA 3QUMH 4Z95L 4AYFA 4Q6IB 2VC2L 5I75B 4NFCA 4TUOA 5E4EC 3VG9B 4HIEA 3AM8C 4MAYD 1NJ9B 3M8OH 5F7KC 1NFDA 3BRDA 4TNWK 4DVRH 3C5JA 5FECA 3T0XA 1YY8B 4JFOA 4G9FA 5J0BA 1RJZA 5IBLC 4CVXB 4LLAA 1ZHNA 3QAZB 4NN7C 1KULA 2AGJL 3SEPA 1PEZA 1D9KB 1IC7L 3CLFL 2FBJL 3BFOA 4QOKB 4M5YL 2FWOB 3N9GL 2OZ4H 4NQDD 2KZ1B 1X9QA 3I6LD 3MFGB 4K2UH 1I1YA 3KYMA 1MY5A 2IFFH 4XMPL 1CGXA 3UBXG 3LN4A 5FCSH 3T08A 3S4SA 3P9LA 3BAEH 5DUMH 4JM2D 4YDLC 5J3HD 1Z0MA 4URTB 1QNZH 1OD7A 1FGNL 1YNKL 4JKKA 4P9HC 1NFDB 2KH2B 2FX7L 43C9A 3C5JB 1T0PB 3NOIA 4G9FB 3TBWA 2VZOA 4GXUM 4NQCA 1BQLH 4NJ9L 1OTSC 2VB5A 1ZHNB 4NN6B 3RDTA 4HJ0C 1JNNH 4MJ5B 3HAEH 5GJTL 2BOCB 5FYLL 3HR5A 2HMIC 2AQ3A 5ID1A 2EDEA 1W0YT 3MLXH 1CXLA 4YHPA 3VFVA 3KJ4C 1A5FL 4JDTH 4BFGA 1GYAA 4FRWA 1KEMH 4PY7B 1L0YA 1GRWA 4GBXC 5DMIL 4JFDB 3KYMB 2B0SL 1LWRA 5L8LB 3AY4A 3LN4B 2ICWB 3VXRD 1ULVA 3LS4L 1CF8H 1HH9B 3P9LB 1MJ8H 1BP3B 2BNUB 4HF5L 3IFNH 4WEBL 3FRUA 3KDMA 2R29L 1H3WM 5TJWK 2O5XL 1EMTH 4PBWD 1J0HA 5I6XC 3HS0A 1FVDA 4OLWH 4OI8A 2QQNL 1PSKH 3RZCD 2NYYC 1SQ2N 1IARB 4Z7OF 3VGEA 43C9B 1P2CA 3MACH 3IAQA 1NBVH 3TBWB 1JVKA 4WGVB 4YGVA 5JXAL 3TPUA 3GJFA 2VXSL 3RDTB 5K59F 1I7ZA 1QSEA 5F7EH 3FQRA 3RVUD 3HR5B 4LMQE 5ID1B 2DJ4A 4DK6A 1Y0LA 4OZGE 4YHPB 5C0BE 4HUXA 1LNUA 2IANA 5EBLA 3MV7D 5JHLL 3T0WA 3SDAA 2IEPA 4WEMB 1VGKB 1F42A 4O00A 3LEVH 4TUKL 3I3DA 2FGWL 4FZ8H 3S37L 4HAGA 2HH0L 5FHBL 1LILA 3HNSH 4HJJH 4LNVA 3VW3H 3QG7L 4D0DA 3FRUB 3KDMB 1I1AA 5CCKH 2EIDA 3IFOB 2XY1A 4PJXE 3C8KA 1KJMA 3CVHL 3EDFA 5JA8B 4XC3L 4QEGA 2QKIA 1FORL 4X4XB 5ESAA 3R0NA 3LQAC 3VFGH 4LHUA 4YGVB 5DHXB 3GJFB 2NY0B 2AKRA 5DUPL 1ZHBA 5DS8B 1VEOA 5I17A 3PQYE 4G8IA 1Y0LB 4ZUVA 2WWMC 3GSNL 2EDLA 4HUXB 4K3HA 1LNUB 4G6FD 1C5CL 4JQVA 2VXQL 5EBLB 5GSVA 4WVRA 1I1FB 3SDAB 3VFNA 3WO3B 4U0RB 4UILL 4G6KL 5ABDE 4MA1C 5AZEL 1P5VA 2DJSA 5DEZA 3MLWL 3LRSB 5FK9A 2AP2A 2CRZA 3CCHB 4I18C 4PRPA 5ETUA 3SHSA 4HWEL 4LVNB 4DGYH 1INQA 3D69A 1NMCC 4D0DB 5L8KB 2CLVA 5HYFA 1I1AB 3CX5J 4J3OC 3RWCA 5EOTB 4X9FA 1SBBA 5I8KH 2R2BA 3JV4A 3DXAD 4M6OL 2MMXA 4D9QE 2ICWI 3LEYL 2VC2H 5C0BA 5ESAB 1CD8A 3ARXA 5F88A 3LQMA 2C3GA 3T0EC 5ICYA 4Y0GA 4LHUB 5DJDA 3ARED 1LDPH 1ZHBB 2C3XA 4P3WA 1MFNA 4L9LA 5IJKA 2XFXB 3IU4L 1JGEA 1S7WB 5I17B 2P8MB 1G9NC 4ZUVB 4B5EA 1MWAL 4TSCL 5D7JA 2A74A 5EFIA 2X2YA 4OV6F 2AGJH 2HTKD 1A6VL 2BFVL 5GSVB 4F37K 3AFLA 5DMYA 1CQKA 3L3GB 3N9GH 1FL3A 3FN9A 3QXTA 5FK9B 4UIMA 1A7NL 1CD1B 4JO4H 4QLRA 2PO6A 3MXWL 3PJSA 1EO7A 3ARGB 5I0ZA 4L3CA 3T0VA 1V3LA 4I5BB 3P0VL 1INQB 1I9JL 2EYSA 3EAKA 3GM0A 2J88L 3A67L 3ISWA 3NACL 5B39B 3RWCB 5EO1A 3C87A 2H6PA 2DL9A 2R2BB 3LPFA 3JV4B 3EYSL 4OZGB 5C0BB 1KYOK 1P4BL 1I1CA 1YNKH 5DK3A 3CK0L 2FX7H 1EZVX 3OKMA 4KKAC 3O6FD 1KUMA 4M5ZL 1SEBB 5JZ7D 5F3HA 5CBAA 4NJ9H 1JGEB 3ZE1E 2GK0A 2FIRT 3OKOA 4NQVB 3L1OL 1BM3H 2A74B 4P59L 2N7BA 5FYLH 3VDCA 4PJXB 5JW4M 1A5FH 5L2JA 5CSZB 4G7VH 4PJ8A 2GFBB 5FDWB 3ZYJA 1A3QA 4UIMB 5CJXC 4LSSL 2PO6B 3PJSB 3QZWA 2XWTB 2EYSB 4PGJA 2OTWA 5IB5B 2F74A 3LS4H 5KG9A 4HS8L 5EO1B 1EEQA 3MLVL 2P5WD 2H6PB 4HF5H 8CGTA 2R1XA 2R29H 1S78C 2O5XH 3PQYB 3U83A 2JKXA 1B88A 4WFFD 5D2NC 5CD3B 1RZJC 2EKJA 1RZFL 2DYPB 2QQKL 2QQNH 2B1AL 4IMLA 5F1IA 1LGVA 1NFKA 4NRXB 5K33A 3D85A 3DLQR 1MJ7L 3OKMB 4HC1A 1NFDF 5GS0D 2B1HL 3QQ4A 2GJZA 2C1OB 5CBAB 2VXSH 3ULUC 3DMMB 1QP1A 2GK0B 3OKOB 1DQML 1I9RH 4RISL 2DQUH 1DUYA 2W60A 2W59A 1UZ8B 7FABL 4UQ2A 1SYVA 4NHCL 4QRSA 2VKXA 5L2JB 4PJ8B 4S0SD 3GSQA 5JHLH 5DJ8A 2F8OA 4M7ZB 4QXWA 1FAKT 3CZJA 1CDIA 3QZWB 1HXMA 4TUKH 5IK3B 3EOTL 2CKBL 4BSWA 2FGWH 3S37H 4LQFL 1MQ8A 2F74B 5IMLA 1KJ2L 4XAKD 5FHBH 5EZOL 3QWOB 4ZOEA 3QG7H 2R1XB 4R4BA 3CVHH 5EWIH 4RA0C 4X6BA 5ITBL 3JWDC 4XC3H 1JK8B 1PAMA 4IMLB 1FORH 4IS6B 4ZUWA 5SV4A 4Z7VE 3QUYD 3D85B 1RULL 2ADGA 5I1CL 3OF6A 4JB9L 2WY3A 2VXTL 3HNTL 1WTGT 3QQ4B 3QDHA 2GJZB 5A2IH 1TNNA 3UTTD 1KEGL 2APVA 3RL1B 3KPMB 4M4RA 5F97E 4N9OB 5B4MD 3S36L 1LK3L 2W0PA 1OSZA 4G43A 1JYXA 3WNKA 2F19L 2RCSH 1GAFL 2H26A 3GSNH 1MIMH 4M6AA 4UQ2B 1SYVB 4QRSB 2Z31D 4ZTOH 5I8CA 2IBBA 2VXQH 3TBYB 3EHBD 1F58L 3GSQB 3QDMD 2WWKT 5DJ8B 1MVUA 1KGCD 3TESA 4UILH 2UZXB 3QWRA 4NN5B 5CP3A 1HXMB 1MRCL 2IBZX 3MLWH 4BSWB 4HH9A 4PGBA 4UTBL 4HWEH 5IMLB 4N1EA 3VWKC 4DZ8B 3BHBA 2B39A 1QFWH 2VZUA 1K5NA 1BAFL 4WV1A 4ZS6C 5GQBA 3M1BB 4PJ5E 5CLTA 4IOFC 4M6OH 4MXVE 3LD8C 1U8OB 1VEPA 2CRYA 3LEYH 5J12C 32C2A 4YJZL 1M7XA 3T3ME 1DE4A 4CMMA 2VABA 1WK0A 1MCJA 3P40A 4BH8A 4LCWD 5GGQL 3V9FA 1KN4H 1OSZB 4E5XA 4JO1L 5MHSE 3WFDL 2K1MA 1CS6A 2H26B 1HHJA 3CFBA 3CH1A 4TSCH 5I8CB 1CZ8L 1A6VH 3ZYZA 2BFVH 1F11A 3MNVB 5DFVC 4I3GA 4OTXL 4HBCH 2FR4A 1TJHL 4OCYL 2Z8SA 5DA4A 4PGBB 4R3SA 4X9BA 3T04D 3MXWH 5HI5C 3BHBB 1KBGH 3P0VH 1BVLB 2J88H 3A67H 3DBXB 3X14A 4AENA 2VWEC 3NACH 1K5NB 1TITA 3C6LD 2FDBP 2X1PA 2AAVA 2DQIH 3HPJB 5FM5O 5TH2A 1P4BH 2DLEA 3MRLB 32C2B 3SPVB 3ZMRA 4JRYA 4PPTA 2NY3D 2IH1A 3K81A 3CK0H 2A83A 2VABB 1BPVA 1MCRA 1TCRA 4KZDH 4BH8B 3F7YA 2VZSA 3QFJA 4FABL 1HSBA 1CICD 5D1XB 4LL9A 5D8JL 2F53E 3CFBB 3L1OH 4N1HB 3ZKMD 5D7SL 2YD5A 3NZ8A 4PP1C 1F11B 3SGJC 1QFWM 1UA6L 4OZFH 5DD0L 5KJRL 2FR4B 2FEEI 3EZ8A 4OQTL 4Z7VB 2DRUA 3QPQC 2N1KA 4LSSH 4HX1A 4AENB 3X14B 2VLJD 1NCCL 4GRWE 1WF5A 3IJSA 2JF1A 3UO1L 3PWPE 5T3ZL 5TH2B 1RZFH 2QQKH 2X4SA 4OZGF 4OFYA 1FLRH 3LZFL 3RKDC 1T20A 3QA3B 1R5WA 2IH1B 4AG4H 3VDAA 4ZXBC 3GMLA 1MJ7H 1N0XH 5C6WH 2LQRA 2ADFL 1A6ZB 4K3JH 2B1HH 4XP9L 3F7YB 1HSBB 2R23A 4O2EA 1M7IA 1AY1L 2V5YA 1DQMH 4Q6YA 3HE6C 4RISH 1DDHB 4KTEL 2ZCKL 1ZAGA 4MMXC 3P0YL 4GRLA 3NZ8B 7FABH 3C5ZA 4JZJC 3JTCA 4PJ5B 4U33A 2DQCL 5F8RC 4QWWC 2BMKA 1NSNL 4NRYB 3EO1A 4Z0BL 5KVDL 2CKBH 4OSUH 4HX1B 4MNHA 4ZPTA 3QUKA 4LQFH 3O8XA 3VXME 5IJVA 3SY0A 2NY4B 4IRJA 1KJ2H 5EZOH 2VQTA 4FQJL 2L4OA 1PY4A 2PTTA 5HDBE 1YN7A 4OZFG 2F53A 5ITBH 4HG4K 4R2GC 5EBGA 3GMLB 4R96B 4N8VA 5I1CH 5JOPE 1ORSB 2VXTH 3HNTH 3BRGC 1ZOXA 4H8WC 2FHFA 4O2EB 3S36H 1F4YL 4DQOL 1DBBH 2HFTA 2E7MA 5FB8A 4M61A 3BUTA 2YZ8A 4JZOA 1GAFH 3DO3A 2CIIA 4ZFZB 4HKXA 3HRZB 4YUEL 5SWSD 4HV8B 2OSLA 1F58H 4LCCA 2BMKB 4TVPE 1K3IA 3EO1B 3TBVB 1FC1A 3IDMA 2J4WL 1B0WA 3N0PB 3WFBL 1IT9H 4MNHB 3QUKB 4H20L 3O8XB 4UTBH 5EU3B 4U1MB 3SY0B 5C86A 4IRJB 4KK5C 3E3QA 2ZUXA 2P47B 2PTTB 5EU4A 1QPPA 3BQUA 1BAFH 2NY6D 2F53B 5DWUL 4LQ1A 3KXFD 1RUKL 1TVBB 2VN7A 3CJJA 1FNLA 3MGOA 1A4KA 4PRBA 2BCKA 1FZKA 1S7VA 1OAUL 3K7UA 1AR1D 4LLUA 1GOHA 5DD5L 1LP9A 1IEAB 5JOFB 3LQZA 3RGVC 4X6CE 1EGJL 5GGQH 4KK9D 3LQAH 3FQNB 3X11A 3FO1B 4GRWB 1FZMA 1NH6A 4JO1H 1OP9A 1OAKL 2CIIB 1INDH 1ZGLM 4HAFA 5B3JE 4ZO7A 5T1KB 3MJ8B 4TVSa 1KCRL 3PWPB 3WFZA 3PHOA 3GIZL 3ILPA 4OTXH 3MA9L 1TJHH 2P24A 5EORL 5D93C 4OCNC 4NOBA 4XC1L 5HI4D 5DLML 4LCUA 2JCCE 4R7NA 1T7WA 5EU4B 4GAGL 3VFSB 1XIWA 1GGUA 3D3VE 2V9TA 4KRPD 4MXQC 3ZE1F 4KKBD 2VWEE 1A4KB 3N1FC 4PRBB 1S7VB 3OJVC 2FLBT 3OKNA 3MV11 3OGCA 3OBAA 4UUJB 1X5AA 3BZ4B 5I8EA 4M7KL 2ED7A 3LQZB 1I9EA 5D1ZC 4O58H 4FABH 1GGTA 3VXMB 3X11B 1R5IB 1FZMB 5D8JH 4U1KB 2E9IA 3SOBH 1BFSA 5E8PA 1KV3A 2ATKA 2G75A 4MCZB 2FX9L 5D7SH 3EYVA 4X7FC 5D1QA 2JJTA 1EHLL 4G6ML 4E0RB 3PHOB 1UA6H 5DD0H 1KSRA 1AQKL 5KJRH 1ODAA 2YK1L 4LP4A 4UQ3B 4H1LG 2P24B 4OQTH 1IBGH 3B2UC 1L7TL 3V8CA 1S9YA 3VH8G 1J9CT 5C2BL 2P4AB 1KLFA 2JELL 3AGVA 4YXLH 4ODVL 4XXCA 1NCCH 1XIWB 4AMKL 1U41A 3O0RL 4QOKD 4LSRL 1GGCL 1KCVL 1DVFA 4D2NA 5FOBA 5T3ZH 3OKNB 5GGVH 3ALPA 2SEBB 3HZKA 1T4KB 3OGCB 4UU9A 1CTOA 5JXED 3PL6B 4HEPG 3SKJL 1D5ZA 2PETA 3LZFH 1ADQA 3W82A 1HKFA 5I8EB 4KUCD 4H26A 1VCAA 2ADFH 4XP9H 1HWGB 3UAJD 4J4PC 2BVYA 3RY4A 5F3BA 2D7TL 5E8PB 2ATKB 4KTEH 4YFLI 4YC2C 2G75B 1KFAL 2ZCKH 1ZA3A 3EYVB 3OB0H 1LEKA 1MUJA 3D3VA 5CIPA 1A4JB 5C7XL 4JY6A 1PBYA 4G9FD 1TVDA 3CUPB 4KJWD 1KCSL 3H9HB 1KPVB 4HS3B 4U1LA 5IOPB 5IFAH 1S9YB 4JGJA 1I3RB 4Z7VF 3LRGA 3QUXA 5KVDH 2MHAA 5IV2A 3T0DA 5DUBB 3QIUC 1DBML 1XF3B 1LEGB 1UKSA 1FL5A 3QUMA 3MA7A 1NAML 4X6CB 4FQJH 4YGAB 4JFHD 3P0GB 1DVFB 5AAWA 5CEZL 2X4NB 4WFED 3IDUA 1CL7I 3IU3A 1F6LL 1X4ZA 4K7FA 1OAYL 4OF6A 1D5ZB 4OFIA 3F7QA 1KC5L 3P73A 2ZOKB 4JFDD 5I15L 4H26B 4NKDB 5BV7B 4X6EA 3JWNC 5TQ2H 1HYSC 4X5XB 4F9PA 1EEZA 5ICXB 4G5ZH 5D72L 2VAAA 4KJPC 4MSWB 4OLZL 5F3BB 3RY6A 2JCCB 1XGRA 1H15A 4ACPA 4PS4L 3ARFB 3D3VB 3BPNB 2OZ4A 4ELME 5CIPB 1JZ2A 1KJVA 2GJ6E 1BIIA 4YUEH 4KDWA 3L5IA 3GHEH 4BQ8A 3TVMC 2GUOA 1DQJB 4BUGA 4U1LB 4Y88A 4J3SA 2Q3ZA 1G84A 1OF2A 3RDTD 1CWVA 2J4WH 4HSQA 2MHAB 4Y4FC 3F7PC 5DEFA 3T3MF 3WFBH 4MA7L 2ITDB 5L0QC 4H20H 5CGYC 4YAQA 3QUMB 4NO0B 3RBSA 1FL5B 4KKCD 4J8RB 3LN5B 5J11B 1ZK9A 5T3XL 2JB5L 4N8CH 2X7LA 2F8VA 5DWUH 1RUKH 3DX7A 3OJDA 5MERA 5E6IB 1OAUH 5EU5B 3P73B 3VXTA 1I8IA 3VGAB 5DD5H 4P23D 1EEZB 1NEZB 4Y4HB 5A1AA 5EU7E 1Z9MA 1EGJH 2QQLH 5IW6A 1E28A 1NGQL 4PLJC 4X7DC 5CWSA 2Y06L 1OAKH 1BIIB 3MQIA 4PJGE 2VZ1A 5FFLA 1ZKAA 3TJHA 1KCRH 4DK3A 3MO1A 2C4FU 4OBSA 3GIZH 1VHPA 2VDLL 1OF2B 2NY0D 2R0WL 1CN4A 1EHXA 5EORH 4U6VL 3U46A 1FPTH 2XWBA 4XC1H 2D31B 3ROOB 4WWID 5DLMH 1AXSB 2BVPB 1H5BA 4GAGH 1R0AL 5E1AA 3SDAD 3TFKA 4M4PA 3WYRA 2EZ0D 1EH9A 3TA3C 1A3LL 2HJKA 5KSBE 2V9RA 1JHKL 1YC7A 3VGDA 3QDGA 4U1HA 3HMXL 1I8IB 5FYJH 1BJ8A 2DM7A 1A6TA 1MEXL 3FTGA 4XCYA 4M7KH 3HAEB 3DVNB 1JTOA 3MV8E 4HEME 5J06A 4YFLF 5C0RL 1I1AD 2IPKA 5IR1B 2AXHA 1TFHA 3LPWA 3WSQH 5KN5A 5GRVL 5TF0A 1E28B 4H5SA 3C60A 1HSAB 4LAJH 5JHDE 1E27A 1SBSL 2PYEA 2FX9H 4LOUD 1U6AL 2FD6L 1GHFL 3MO1B 1EHLH 1C08B 5ILTL 4LHUD 3RPKA 5LWYL 2IAMC 2YK1H 1A8JH 5IHZA 2DN7A 3S35X 3BZEA 3U46B 4FQCL 3BYYA 3VJ6B 1C12A 5C2BH 2XWJB 2JELH 5EZIL 2VL4A 4NYLA 4AIZA 3Q2CA 4ODVH 5F6IB 1H5BB 2CXGA 2J5LB 4UT7L 4AMKH 2ESVE 3O0RH 3AXLA 1GGCH 1KCVH 3RHWF 3ZDXE 2HJKB 4KHTL 4ELMB 4DEPC 2GJ6B 2OQJA 4PJGA 3RGHA 2LU7A 4U1HB 4C4KO 3RKPA 1A6TB 3SKJH 3TBTA 3ARGD 3FTGB 3RUGA 3V4UH 3VRLE 2W91A 1KNOA 2EIZB 4Z7NF 4ZDHB 3LRHA 3GRWA 1CDGA 3I6GB 4JEGB 2ZUUA 4MDIA 4H5SB 1A6AA 5ALCH 1YN6A 3C60B 2IALA 3FCTB 5C0BD 3H3PL 3E0GA 1AHWC 1CLCA 1KFAH 1CBVL 5C9KA 1JHTB 1AC0A 3FHQA 3PGFL 5HDBF 5TDPA 3FFDA 5KSBA 5IHZB 1KCSH 1P1ZA 1XGYH 2CLZA 5FGRA 5GISL 2AK4E 1ZLVH 3B83A 5CILL 5FYLE 1C12B 5DEGB 5DVLA 1WFTA 4HJGA 4NYLB 3EO9L 1QLRA 5HJ3A 4OLEA 4CADA 1P69B 3W11D 5CEXA 1NAMH 4WFHE 4KMQA 4YEEA 1CYGA 3HKFA 4BK4A 5JHDA 2OQJB 3VRJB 3ZSSA 4PJGB 2PO6D 3VD3A 4I9WE 1JYNA 1KC5H 2DTML 4TTDC 3BESR 3KPSA 1NMAH 4PV9A 3TLRA 1XMWA 2FO4A 5D72H 3OHXB 4OLZH 1A02N 3PQYD 3P4OA 4TOYL 2YWYA 1UJTA 2J8HA 1IGJA 4PS4H 2DYPD 4OZHE 4AEEA 3GI9L 5AAMA 2ESVA 1TMCA 2HWZL 3WS3B 1IGFL 5I71C 5HHQA 5TDPB 3DROB 4F33A 5KSBB 3LKSB 5CP7A 2DOCA 5IF0A 1S9WA 4MQ7A 2CIKA 2YHGA 3DMMD 3KGRA 1S5IL 1J8HE 1HHIA 4HJGB 4MA7H 3K80A 1QLRB 3MV8B 5HJ3B 4LARH 4CADB 4LSUL 3BVNA 4HK0B 1ZLUH 5FGBC 4FP8L 1FFNB 5J89A 4EUPG 2JB5H 4PJ8D 4X6CF 4D9QD 5JHDB 2BRRH 5AYQA 1KCUL 5C0AE 5H37G 5B3JF 1DL7L 2X10A 5CZXC 3BPLC 2Z9TA 43CAB 4TUJA 3ARTA 2AK4A 2FO4B 1KLUB 1P7KB 3C08L 3P77A 3LDBC 1JGVH 3PGCB 3P4OB 1A7QL 1S8DB 2YBRA 1JZ3A 3NCFB 2MQ0A 1NGQH 1NBYB 3QIBC 2M8XA 3SE3A 2ESVB 3WE6A 3D85D 3SDCC 5HHQB 4F33B 1Q9OA 3BIKA 4BELD 1S9WB 3VD9A 5IBUG 4ZFFA 2CIKB 3CSBA 2VDLH 2Y4SA 2R0WH 1HHIB 2ZUQC 4U6VH 4RZCB 5KOVC 3AVEA 4GO6B 1FFQA 1N0LA 1M1SA 3BVNB 3RJDA 3QJFA 5TE7L 3SE8L 3QRGL 4LLMA 1R0AH 4LKXA 3N1PC 4PGDB 1A3LH 4NGHL 1JWSB 4EXPX 1JHKH 5JW4Q 3DO7B 3E6FB 4MA3B 4PJAE 2ENSA 2QEJA 4LRNH 5LG1A 3T09A 2MQCA 3HMXH 4QGTA 1MEXH 5E0QA 5KZCB 5GS1C 2AK4B 2ZSWA 3P77B 5C0RH 3NVQA 1J8HA 4M1GL 4YX2L 5GHWL 5LGHL 3CIQA 3SE9L 3CFIC 3WE6B 5KW9L 4BSVA 3FMGL 5E56A 4IOSD 1SBSH 2HMID 1U6AH 2FD6H 4XNUL 4AEHL 5ILTH 4WUUE 1UM4L 4M9PA 2GAZB 4N0FA 3BGMA 3UYRH 2V2WB 2OBGA 1WIPA 4RCAA 3TO2B 2W9LA 2BSTA 3IKCB 4JQXA 3CPLA 4FQCH 4YIQA 1EVUA 2YS4A 1QLEL 2NW3A 4GBXD 4KDVA 1UWXK 5EIQA 5EZIH 2ZNWA 4RX4D 3CVHA 3QEQA 1BHGA 3RWEA 2HVJA 3D0LA 4Y2DA 4UT7H 4LLMB 1YJDL 4LKXB 4WHDA 4OZHB 4M7LL 2A2QT 3QWRD 4KHTH 3T1FA 3U9PH 4P2OB 4OIAA 1Z3GL 1OD9A 4NQEE 1BECA 1KCKA 1J8HB 3GSNA 4UBDD 4XBGB 1IAOB 4YWGL 3WLWD 4GT7A 3H3PH 4BSVB 5F9WC 2W0FA 5C92A 1A1MA 4OCRL 3WUWA 1CBVH 4BM7A 4ZMAT 5IWLA 4YHYC 1BGXH 4F9LC 3PGFH 1F13A 4N0FB 2BY2A 3WDHA 5C0AB 5IHLB 3BJ91 1XF5B 2VDRL 4P4KA 1OPGL 4Q58C 3CPLB 1LE5A 4PJAA 4CNIB 5DC0A 3RWFA 4MNGE 2YZ1A 2NW3B 5CILH 4FMFA 4S10A 1A7PL 5D1XD 4MD5B 3WIHA 4R26H 4ZOCA 3CVHB 5HYSG 3EO9H 3F58L 3RWEB 2BVQA 1I7RA 1MREL 3DI2B 3D0LB 2X4OA 4CUCA 3MRPB 3FAWA 1MHHA 2OK0H 2WNGA 4UOW1 1HEZA 1WJ3A 3T1FB 2FH8A 2VQ1A 3DVGA 3KPPB 3GHBH 1WZ1L 1WBXA 2JK5A 3MV9E 2DTMH 4NCC1 4QHMB 1KIUA 4L1HA 2E6PA 2M1KA 2LAAA 1CXKA 3GSNB 2DQEL 2X1WL 3RA7H 3V2AR 5IB4A 4GMSL 3DTXB 1MNUL 4LPYA 4QTHA 2OI9A 4TOYH 4JREC 1S7SA 3AU1B 4WI3A 5EN2B 3EFDL 3FO2B 3J8F7 4UDUB 3RIFF 1QA9A 4X80L 3GI9H 3WUWB 5DO2C 5GRWA 3WXWL 4ODWA 2HWZH 4I2XE 1IGFH 1IAKA 1TTFA 4J6RL 2X4QA 4P4KB 1JWMB 5DD1L 5JPMA 1L9NA 4M9OA 2APWA 4PJAB 3RWFB 3UMTA 4OGYL 5J56B 4OZIE 1S5IH 1EHAA 2EIBA 1I7RB 4POUB 5HYQB 2X9YA 3WDJA 2YSSA 5KSVB 4LSUH 5IP4A 4YHIA 1UJ3A 4YDKL 4PJ5D 4FP8H 3BT2H 1MHHB 3QCVH 1IM3A 1HN1A 1G7MB 1ACZA 2Q8BL 5TFSH 3DVGB 1BVZA 1CR9L 1KCUH 1A7RL 2W38A 5C0ND 1WBXB 2JK5B 5DHYA 4PJGF 3EJYC 2HN7A 4WUUB 1FVCB 1EFQA 3AUVA 2NY4D 2IMNA 5CD5C 4MNGA 4NC2B 1UWEH 1OGTB 2OI9B 4QTHB 5MHSD 1A7QH 1G1YA 2Y36L 5C07E 4OZFA 1QA9B 3V0WL 3W81A 4OJFL 4ODWB 4U6YA 3D25A 4HS6A 3BP4B 5DZLA 2YRPA 1S9KC 1ZT4A 1F4XL 5IVNA 5KSBF 5FYKH 5GS2D 5EOQL 3HUJE 4N0UA 4PRDA 4NQEB 4Y5XB 4NZUH 3SKMA 1HWHB 2YSSB 4LPXA 2UVEA 5C0JB 3FONA 3DUHA 5TE7H 3SE8H 1IM3B 3QRGH 3MJ6A 2EXYC 3CGTA 4IM8A 4NNPL 4NGHH 5FA3A 3PDOA 5DHYB 4LEOB 1YNLH 3B9KB 4Z7UA 4YXHL 3HA0A 4I2XA 3O8XD 4ZSOE 2IBZY 1FVEA 3I6KB 4U6HA 3GJEA 3WCYA 4MNGB 1TENA 4W70A 4YNYA 4OZIA 4OD2A 2CLRA 3MOBL 4M1GH 1CGWA 3FOLA 5K9OA 2F53D 3ARBC 3G5ZA 4GLRH 3JZ7A 5LGHH 3UDWC 4DUWA 4R7DA 3EDEA 1PG7L 1IC5L 2ILLA 3F7VB 1C8PA 5C0EB 2A6JA 2EE2A 5I2IB 5F9AC 3FMGH 3I2CL 4IDLA 3OG6B 5T5NG 5A3IC 4XNUH 3M45A 4XVUD 4AEHH 3ZDXF 2CKBA 1ZT4B 2PKDA 1UM4H 1ZGLA 1S3KL 3OTTA 3MV9B 1KJ2A 4B7IA 3OXSA 4FQ2L 5E2UL 3VRLF 2P8LA 3I3BA 1QLEH 3SKMB 3RTQC 2JIXA 3UPRA 4NNYA 1M4KA 4Z78B 5T1KD 1J1XL 4HLZH 1QFWI 3PWPD 4JKWA 1J11A 4JO2L 4W6WB 5C07A 1P5UA 4ALAH 5C71A 2GW5A 4WY7L 3W2DL 3GGWB 1CD0A 4QY8A 5K9QG 4I2XB 1A14H 2EDKA 2R4SH 1II4E 1L0XA 3DIFB 4O9HH 1IEBA 1Q0XH 1A3RH 1OM3H 4YNYB 4JRXE 2HRPL 4OZIB 3LKOB 1MQKH 2CLRB 2QTEA 3BI9X 5K9OB 3FOLB 4L8SC 5HSFA 3G5ZB 2FSEA 1WFOA 4R7DB 3S97C 5DJXA 4APQC 5DD3L 1MCCA 4PGCA 4YWGH 1Y6NR 2A6JB 4QXTA 5ERWA 5E7BA 3VCLA 4R4FL 1X7QA 4OCRH 3HI5L 4JY5L 2YEZB 5KSAC 1F45A 2ID5A 2CKBB 1ZGLB 3GMMB 3EJJX 5IM7B 4V3EB 4Y1AE 3O4OC 2VDRH 4K8RL 1KJ2B 1OPGH 4YDVB 4ZSOA 3VXMD 4MAYC 5IFHL 4CDGC 1A7PH 1RU9L 2JIXB 1TNMA 4HUWA 2VDPL 4JG0L 4NNYB 1ZA6A 3F58H 1P7QA 1MREH 3BPLB 3MV01 5CBEA 5JA9A 4EOWH 1KB5A 5F7NC 5C07B 4YQXL 1O5DT 5HGAA 5JNYA 4M62L 1CGUA 4WO4A 4QY8B 3V6FB 2F54D 1WZ1H 5AD0A 5JOPD 5I66A 3VH8A 5T1MA 1IEBB 3VFMA 1IGIL 4F7TA 1XIWD 3NIGE 1P4IL 3HUJB 1HDMB 5T3ZE 2FSEB 1ZT7A 3CDYA 5DJXB 4GMSH 3KG5A 3L3OA 1RJCA 1ZV5A 5ERWB 2AQ2A 3BYTA 3TNNA 3QNYA 5BS0E 3K8MA 1D7FA 4X80H 1XFPA 3PL6D 4WU5B 5I1DA 4Q9CA 1PVHA 1PYWA 1S9VB 4U3HA 5J3HC 2NW2B 4TVPD 3FT2B 3CXDH 4H0GA 5B21A 2R2CA 4J6RH 4Y8DC 3WS6C 5DD1H 4ZSOB 4IBLT 4C83A 4OGYH 4JPKL 5JQ6L 1WAAE 1ZA6B 1P7QB 4I18A 1T21A 1TQCB 4LDEB 4QXGL 1YMME 5KAQG 4J3WA 4NKQB 5HGAB 5JNYB 1F00I 2R15A 2Q8BH 4WO4B 1NBQA 1RUQL 1CR9H 1UACL 5F9JA 3STZA 5AD0B 5I66B 4D0CA 5T1MB 1XGQA 5JDSB 1E6OL 3VFMB 2GY7B 1BFOA 2G5BB 3G9AB 4Y1AA 4U1GC 3S96A 1BQUA 2G2RA 2AXFA 3OAZK 2GY5A 4TN9A 2PF6A 3T0EA 1GCFA 3IDJA 1ZWIB 1ZT7B 2AV7A 4ETQA 4Y5VC 1DVFD 5LAXB 5IB2B 3U1SL 4BZ2L 1Q94B 2ADJA 2J8OA 2CD0A 3MZTA 2XZQH 2EICA 4FFEX 5IIEB 4OJFH 3UC0H 1PYWB 3ZE0F 2MPAH 4BUHA 1JRHH 2AEIT 1JP5A 4LHQB 1WICA 1A0QL 4Z0XA 3LCYA 4BKLA 1HHKB 1F4XH 4QF1A 3QDJE 3QXAB 4OKVA 2ZKHL 5FV1L 3RZCC 1P9MA 1U8LB 5EOQH 4PJAF 2WIIA 4KY1L 4KI1A 1J8KA 4JRXB 1KOAA 2PXYC 2DQDH 3ARFD 3EDJA 5HI5D 3D3VD 3L7FA 3RY5A 3DX8A 4PLNC 1KB9J 3GJFK 5D7KE 4U1NA 5BQ7A 4I0PA 2MFNA 4NNPH 3RVUC 1EXUB 2P5EE 3STZB 4OBRA 4D0CB 1XGQB 5AG8A 1U3ZA 3DI3B 3IAGC 4YXHH 4FXGA 3IB4A 4Y1AB 1P84K 3S96B 1UVQB 2AXFB 1R5VA 3K74B 4NO0D 2BSED 3IDJB 1G0DA 3D0VA 4JVUA 2AV7B 3H7LA 1ONQA 3MOBH 1WAAA 2FX8L 1ES0B 4R9HA 1PG7H 3X17A 5E6ID 3ZO0A 1DP0A 2CGRH 1CXHA 1CE6B 1QBML 2WQ8A 4ZO8A 1VFMA 1UKTA 5B38A 4Z0XB 4KVNH 1AKJA 3FB6B 4RIRA 1S3KH 4JFXB 4AT6A 5C0FA 3FT3A 3RIAF 4Y4HD 2ZUTA 4E42A 2YA1A 4X6DA 3VXNA 5I1HL 4FQ2H 3I9GL 5E2UH 3BP5A 1BQHA 5JUEL 4AM0A 2OMNA 3ZTJH 5I16A 3L7FB 1J1XH 3CZFA 4U1NB 2RIKA 2NZIA 1PFCA 3R8QA 5BS0B 2VUOA 3QYCA 4I0PB 3LHPL 5IQ7L 4EBQH 5A43C 1LD9A 4F7EA 5GGRY 3QUZA 4F58L 1AD9A 3PXHA 4FXGB 3T0AA 3RKDD 4S11A 2UWEE 1X5IA 3D0VB 5IFJA 2LV4A 1CXEA 4UT9L 5DD3H 5BJTB 2VDML 4RFEA 3KYOA 4OF0A 1YMMB 3ZLQC 3HE6D 2YXMA 4R4FH 3UJTH 1HKLL 1DQTA 4JQIL 4JY5H 5IUSA 4S2SA 3S36X 3WBDA 5B22A 4HD9A 3L3IA 4RIRB 5ANME 3VU2A 4AT6B 3EOYG 1I3UA 3OZ9L 3G6JE 5GIRA 4K8RH 1FV1A 5E2WL 2A1WL 2BJML 3BP5B 1BQHB 3BEVA 4AM0B 1RU9H 5I16B 2B4CC 2VDPH 4JG0H 1T2XA 3PE9A 3B2VL 1LO4H 2BERA 3CZFB 4IJ3B 3TJHD 1X5YA 4ODHL 1UENA 3FL7A 4ZAKA 3W9DA 4YQXH 4KMLB 1UYWL 2YOCA 3CDGB 4JCLA 3ERYA 1LD9B 2OX5A 1QRKA 3IXAA 4JZNA 4M62H 4NFDA 4F7EB 1U95A 4EI5C 3QUZB 1AD9B 2HTKC 1YEEL 4WENB 5FV2A 4M8QB 5DJYB 3F5WA 3QDJB 3QQ9D 3B3IB 4EQ3A 3U9UB 3W0WE 5EUKA 1FAIL 5IFJB 1P4IH 2R39A 3TFKD 2BVTA 4LLWA 5EO0B 4OZIF 2EYTB 4HIHA 2GJ6D 4WI7A 1I7TB 3MR9A 5F6HJ 3MRDA 4S2SB 3DX9B 1QUNA 2OYPA 1YEJL 4LLYB 2P5EB 3IGAB 1H3PH 5D96C 5GIRB 4L3EA 1FV1B 4DN3L 3MUY1 5CUSH 1FDLL 3MROB 1BFVL 2VR5A 3P2TA 4JPKH 5HYEA 3C60D 3MLSH 5F7YC 3AMKA 3QFDB 4ESKA 8FABA 2UWEA 5HVHC 1NGZA 3O6KL 5IT2L 5FM4A 2P45B 4QXGH 4ZAKB 3KYKL 4KK5D 2HP4A 2XPGB 3Q48A 1HILA 2K7PA 2DQTL 3DYMA 4JKLA 5FUCE 4ZPVA 3VG0L 2H3NB 5I9QB 4U1IA 1EEYA 1UACH 2OM5A 3O3AB 2BVOA 1KTRL 4XBPB 3WIFA 3U7WL 2I9TB 1E6OH 5IBTL 5ANMA 2NY2B 4KTYA 5EUKB 3O4LE 3BKJL 2EDBA 2OTPA 1DN2A 3QHFL 3U0WH 5T5FH 4HIHB 4BZ2H 3H9SE 4LVHB 3GIVB 3VMPA 3V7AE 1X4YA 4EIGB 1DSFL 1B0RB 4HW6A 4MQSB 4LLVB 4NWTH 3BDYH 2IQAA 2H45A 1AGFA 4DKEL 5I73B 4X8JA 3VXUE 3MLZH 3WD5L 3ARSA 1ORQB 3MODL 5CJQL 4EDXA 1G9EA 4XP6L 5I8OL 3GMOA 3E6HB 4PJ7A 2NLJA 5E4IA 1MCBA 1N59A 2ZKHH 4BA8A 4KXZH 2NTFB 1QBAA 4XP1L 5LGKA 3MJ7A 1EERB 2YXFA 4Y4KA 4P2YA 2EEAA 8FABB 2AXJA 2UWEB 1PJ9A 3IDXL 4KY1H 3CC5B 5E70A 4HXAL 5GS0C 3NPSC 2FHCA 1UXSB 2BY0A 3MBXL 1ZMYA 1FCCA 3RWGB 3Q5TA 4PJEE 2CK2A 2XT1B 4IOIB 2ITCA 3PABB 4J3UA 1HILB 4UDTB 3U4AA 5DSCA 3QCUH 1EEYB 2E7BA 2BVOB 1NUFA 4H25A 3WIFB 1N7ML 5J1AA 5ANMB 4N5EC 3MV8D 2VE6B 1U8HA 3MBEA 3MRFB 3U36B 3F7RA 3GEWB 3UTZA 2CR6A 1J12A 5JHDD 4J12A 1AGFB 5GXBB 3BW9B 3BN3B 1QBMH 3BKYL 1SJEA 1KLGA 2LU3A 4R90H 1ZT1B 4EDXB 2H41A 4BFIB 2YA0A 1UXWA 3GMOB 1J7VR 1DQLL 1MJJA 4PUBL 3TIDB 1ERNA 4QHNA 5I1HH 4RFOL 4Y4KB 1NAMA 4KV5E 3I9GH 5M7QA 5JUEH 2ARJQ 3W0WB 3JTSA 4OCMC 3O4LA 3NPZB 4OLVL 5F7DA 2D9CA 3RZWA 1JUFA 3CXHJ 3PWUA 5L7XH 2WBJB 4GKSA 3H9SA 4N0RA 5B4MC 1IQDB 2UZIL 2EDWA 4HFWA 3LHPH 5DSCB 1WT5C 1MH5A 2V2TA 1QZ1A 1UT9A 2BK8A 2Z31C 3JV0A 4L4TE 4F58H 5BRZE 2OLDA 1FNEA 1MFDL 1N64L 5E5RB 5FXCH 1U8HB 3MBEB 1I8MA 1M05A 5CHNA 2FEEL 3OV6A 1G7LA 3T8XB 1CFQB 1D3CA 3D48R 4FG6C 4GRMB 3KVQA 1WWWX 4UT9H 2R1WA 1YNTB 2VDMH 2VH5H 2Y5TA 1EDQA 3LAFA 2X89D 1CDUA 4H88H 1KLGB 3O81A 1HKLH 1R3KA 1WFUA 1ETZA 4JQIH 4JZJA 1UXWB 4P49A 1F6AA 2C1PA 5KZCD 3MLYH 2AK4D 5FYLD 3HZMB 3OZ9H 1MJJB 4QHNB 4EVNB 2OMBA 3VRIA 1DBJL 4LU5L 1NAMB 4GAFB 3TN0C 4JLRA 2A1WH 2BJMH 2NY1C 2Y5EA 3QG6A 2I60L 3JTSB 3O4LB 3WXVH 5I1IL 1RZGA 4WFHD 3NIGF 3QIUD 2AW2A 4ODXB 3PWUB 1IQWH 3GKZA 4GKSB 3H9SB 4ODHH 5FKPA 5H94B 5CFHA 1N6QL 1UYWH 1U2HA 3BZFA 4HPYH 4I9WD 5GZND 1YJDC 4JG1L 2CK0L 4L4VE 4I77H 1FNEB 4OGXL 1I8MB 3F6IA 4ZUUB 1YEEH 5CGMA 5L2KE 1G7LB 5GZOD 2CDEB 2D0GA 4ERSH 4JGUA 2R1WB 3DJ9A 4KJPD 5GRUL 1WAAF 3FRPG 4ZS7L 2DQHL 4PJEB 4G80A 3MPCA 4P2OD 3O2VL 1IL1B 1R3KB 3C6LC 1YUHA 5LGJB 1P6FA 3D39A 4QHLB 3RX8A 4MHHI 1F6AB 4XNYL 2FEDD 2N56A 2IG2L 3GSXA 3MFFA 4LFHG 1S7QA 4LLDA 2EKSA 1J8HD 5H35B 1BQSA 2WV3A 4L4TA 5E8NA 4DN3H 4JLRB 4F2MB 4BK5A 3NABL 2HJFA 1FDLH 3QG6B 3F12A 4X6DF 2A73A 3FB8A 1BFVH 1X6NA 3QSKB 2Q7YA 5CGYD 1FH5L 3O6KH 3IETA 5IT2H 2ICEA 4U7KA 5FKPB 3KYKH 3GUTB 4KJYA 1YECH 1CICC 4MB4A 5FIEA 3HMXA 4G42A 5C0AD 4X98B 3WJJC 2VN4A 2ZOLA 3ZKMC 1O0VA 2KQMA 5FEBA 2YUXA 1L4IA 4LP5A 3BEWA 2Z0BA 4W4OA 5IBTH 2BRQA 5E94A 5HYSA 1KELL 1LO0L 1MF2L 2V7NA 3QHFH 2PR4H 3S9DB 3VFOA 3RGVA 1AJ7H 4I13B 1HXYA 4G80B 1DSFH 3KAAA 1KTLA 1YUHB 1RZ7L 4NKMB 4DKEH 3PV7A 1XH3A 4CJ0A 3WD5H 2IF7A 3O6LL 1INEL 5CJQH 3GSXB 3MODH 2GTWB 5F21B 1S7QB 4HGWA 1YQVL 2EKSB 5ACLA 1QLFA 4L4TB 5E8NB 5BRZB 4L4VA 2WW8A 4HT1L 1X5FA 2A73B 3FB8B 4GKOA 2ADIA 3MRMA 2Q7YB 1OGAE 3MNWB 4D0BA 5HY9B 5L2KA 3IDXH 4WHYH 5BZWA 3MRRA 1A1NA 2AV1B 4HXAH 4CJ1A 4TSAL 3MBXH 4RMUA 4Z8FL 2GKIA 4KJYB 3ARWA 3LKRA 3QI9B 1MHEA 3KYAA 2D7NA 4ENED 3H0TA 2LVEA 4XCEA 3NAAL 4MXQA 5HHOA 1RIUH 2E9WA 5EU6E 1T83C 1N7MH 1TIUA 3MLUL 3HE7A 1YDPA 2NY7L 3QQ3A 4S1DD 3TYFA 3OKDA 1SEQH 4NQSA 4WNQB 2GJJA 3WJLA 2XKNA 2YD4A 3VFOB 4ISVB 4BZ1L 1HXYB 4EN3A 5FO7A 5HYIA 2MQ3A 1LO5B 2NZ9C 5C6PB 4FQQA 1QRNE 2Y7QB 1XGTA 4PJFE 5TE6L 3BKYH 4WUUD 5IVZA 3RWJB 5EH1A 4HGMA 4HGWB 3ZYOA 5CGTA 1MLBA 4L4VB 4FQXC 2D4FA 3LOWA 2VSDA 4LF3A 3TZVC 2AABH 1QR1A 3BD4A 2D2OA 4RFOH 4D0BB 5L2KB 2DICA 1G9MC 5BZWB 1A1NB 4OLVH 2NXZB 2UWEF 1T1WA 4LIQL 3U7YL 4FTVE 1FIEA 1MHEB 2HG5A 3OKEB 3H0TB 3JSSA 2UZIH 2P49B 4KKLD 3X12A 3X3FL 5I19L 2W9EH 3P3YA 3RWHB 4OF7A 4P0DA 4M03A 5I1LA 1IJ9A 5HHMA 3HE7B 4NQED 3QQ3B 2VLLB 3OKDB 5E2TH 3NCMA 4NQSB 4FQLL 3O9WA 1OCWL 4NPYA 2ICES 4E9LA 5I18L 3U7AA 2J8UE 4EN3B 4AIOA 5FO7B 1S7UA 2CUHA 4FQQB 4JFQA 1T89C 2XI9A 1XGTB 2D03L 3B9KD 4XP4H 4BJLA 5IVZB 1IC4L 5FOJA 1HE7A 4G7YL 1A9EB 3BXNA 2NY6C 3GSOA 2KQNA 1Y18B 3TT3H 1MLBB 4TNVF 3WFCL 1QR1B 1DBJH 2AJ3B 4KJQD 3D87B 4XT1C 4FFYL 2I60H 5MP6L 1U8MA 4Z77A 2Z8WC 1K9TA 5F1KC 1T1WB 5CAYB 1QFPA 5I1IH 1OWRM 3CFDA 2GI7A 4PJ9C 4B50A 1FC2D 4U0QB 1MELA 5DVKA 1N6QH 1QRNA 2QJDA 3TT1H 3LKNA 3MV9D 3V52L 4P99A 3H9ZA 5I1LB 4JG1H 1IEHA 4JHZA 2GIYA 1G0XA 4OGXH 1VACA 3R4DA 1MHPL 3O9WB 4GAYA 2XICA 4NPYB 2EDQA 2FNBA 4HWBA 1TQBC 5J13C 2GT9A 5IROA 5GRUH 3QNZA 3DWTA 5HI4C 1RAMA 4JFQB 4RDQG 4ZS7H 2DQHH 1UGNA 5BO1L 4FTVA 4JFPB 3O2VH 2IPTL 1L7IL 3GSOB 4KKBC 3UTPE 4XNYH 5EU6B 2IG2H 4P46A 3TVMA 1HHHA 2VIRB 3ESVF 2X4RA 3MMEB 3NABH 3TJEL 3SDXE 2VLKA 1U8MB 4NQTA 4Z77B 3U48A 3BP7B 4JDVB 1NCDL 2DIJA 2NMSA 5GGTH 4EDWL 5DD6A 1FH5H 5AYUL 4PG2C 2J8UA 5I1GL 3SJVE 5ITFA 4HIIA 2J6EH 1QRNB 4Q6IC 4PJFB 5I75C 3BKCL 4J23A 3RVVD 5IG7A 5FF6A 3VG9C 3JVGA 4M1DL 5JPNA 2LVCA 1VACB 3TCLA 4MAUL 4GQ9L 4GAYB 5HPMB 3K0WA 4ZFOA 4O2CA 3GK8L 1JWUA 2HLFD 5C07D 2KUTA 3MJ9H 4OM1H 1LO0H 3QNZB 4BH7A 3QAZC 2RQ8A 4QCIB 1T6VN 3BE1L 3DV4A 3MYZA 3FKUS 4FZEL 3VD5A 4FTVB 2X9XA 1XF2A 1QBLL 1D9KC 1RZ7H 3O6LH 4P46B 5IESL 1YQVH 2R4RL 3JBG7 2H2PD 4UIKL 2X4RB 4BZYA 3TO4B 4GG8A 4HT1H 3W5NA 3HTLX 3QXDB 1CFTA 4P2RE 3THML 5DD6B 2QADB 2YPVL 4TSAH 4Z8FH 4IDJL 2J8UB 3LKQA 3UAJC 4HUVA 3T77A 5TE4L 1DTUA 5A2FA 1L9MA 1I8LA 3NAAH 3C09B 1CG9A 1WQVT 3OL2A 4PB0L 3TA3A 3G5XA 4N0CD 4HULB 2XNAA 5JPNB 1B2WL 2LE9A 1T0NA 3MLUH 4HWNA 4WHTA 1P7QD 2NY7H 5IVXE 1JNLH 4HFUL 4KJWC 4MD0B 3RWIA 1T0MB 1JWUB 1XCTA 1XGUB 1GC1L 4NN6C 3GDBA 5JTWA 3KNBB 4KV5F 2X1XR 1TJIL 4BZ1H 3TN0B 3DV4B 4WO4D 2OL3L 4PRHE 5B8CA 3R1GL 5TE6H 5HI3D 3SJVA 5FM5M 2XN9A 2C4XA 3UZQA 4U6XA 2QV2A 1OAXL 3OJMB 2BNRD 2IAMA 4P48A 4RGNE 5DRXB 1CFTB 4QRRE 4P5TA 5E9DE 2IC2A 3RPIA 1G7JA 2BC4A 1WIOA 1V05A 2VISA 2E7LA 4NO3B 4HUVB 3T77B 4LIQH 3U7YH 2QR0B 1ADQL 1TVHA 1X3DA 3V6OC 3D6GA 1AP2A 2UYLB 4K3DH 2XOTA 1N5AB 3G5XB 3X3FH 5I19H 3WEXA 1T0NB 1Z5LA 4WHTB 4NBXB 5DR5H 5LXGL 1E4XL 1MCQA 4FXKA 4JRXD 3V4VL 1WBYA 1OCWH 3TV3H 3WL9B 2XTJC 4K7PL 3RDTC 3SDXB 3KPTA 5TDNB 1OW0A 1HQ4A 5I18H 1U3HA 4P2RA 4PD4J 4HDIB 3PHQB 5B8CB 4KKCC 3RWDB 2QLVB 3LY6A 3SJVB 1AHWA 4MNQE 4RQQB 2XZAL 4J1UB 4XBEL 4Y1AD 4U6XB 1DCLA 4W81A 4WCYL 1QSVA 4CMHB 4WWKA 3DX6B 1DEDA 3QH3A 3IRZA 4RGOH 3U4EA 1WWAX 3BH9A 3F62A 2ZPKH 4FFYH 2DWEA 4P5TB 3M8OL 5MP6H 2BC4B 1BWWA 2VISB 3DV6A 3UP1A 1TVHB 1RUPH 1WGOA 4NM4L 1TZIB 4PRHA 1J88A 4K9EL 4G59A 4L1DA 5DTFA 5DJ6A 4MWFB 3WEXB 2FZ3B 2BNQD 3V52H 1Z5LB 2H32H 5C1MB 3WHE1 4LDLB 3HC0B 1WBYB 3MRIA 5T3ZD 1MHPH 4IMKC 3I50L 4QRUB 2L7JA 4E41D 2NY0C 2OZ4L 4JKMA 5GRXG 5F70A 1W0VB 4IHOA 4YHML 5BS0D 1U3HB 1ZE3C 4I0PD 4P2RB 4RGMB 1KXQE 1OHQA 3H42L 4K2UL 4GLRI 3AMLA 3I75B 5FAAA 2IFFL 1NCAL 2NR6C 3G08B 1BBDH 2HFEB 1KTKE 5EA0L 5SWZA 3RX5A 2IPTH 3SDAC 1L7IH 1T03H 2FGZA 3BD5A 4WWKB 5D7IE 4MZ2A 1Q1JL 1EV2E 3EZJB 3BH9B 3IDIA 2ZP0T 5IVXB 2DWEB 4LVNC 5D2LE 1RD6A 4LKCA 5EULV 4O02L 1U91B 1YMMD 5IEKA 6CGTA 1UH4A 1I1AC 1G7QA 1IRAY 1TLKA 4NUGL 4EDWH 4U1SB 5AYUH 4PY8J 5I1GH 2VSCA 2GCYA 4PRHB 1HINH 4KDTA 1TZHA 1K2DA 1J87A 3G5YA 3BKCH 4MNQA 4LOUC 1R24A 2WUBL 3WO4B 4M93B 3MLXL 1G7HA 3K8LA 4JFEA 1EHNA 4M1DH 5DI8B 3EJYD 4HMDA 1BD2E 4JDTL 1X5XA 2YN3A 4MAUH 4GQ9H 3OKYA 4MX7A 3L7EA 4RGNB 2NX5D 4Y19A 1N6UA 4ZYKA 2R0KH 4IHOB 5A2KH 4QRRB 1U3JA 5E9DB 1MRDL 4FQXB 4X83A 4HKJA 1MCSA 3BE1H 4FZEH 2YC1A 1M7DA 3NH7L 2AXGA 3AC0A 3QUZD 1KIRA 4JQVC 3QIBA 1D5BA 1QBLH 4X4YA 2X4UB 4BQ9A 4BQCA 3QDJD 3SDCA 4EIZC 5IESH 2OCFD 3P9MB 4JFFD 1UEYA 2R4RH 4OLWL 4UIKH 5INCB 4LKCB 3SCMB 4XNQB 5DJZA 3SO3B 1IM9A 5IEKB 1WCBA 1PD6A 3THMH 2IFGA 4M6ML 1G7QB 1IGCL 1RJYA 3VGBA 4PGEA 4IDJH 3WKNA 5TE4H 2Y1VA 1KPRA 1TZHB 2P5ED 3OXRA 4U2YA 4D9RE 1K2DB 3GKWL 2OTUA 5F7EL 3G5YB 4LFHD 4MNQB 4PB0H 5E00A 1A6PA 1NGYA 1P4LA 4GSDL 5D7IA 1CXIA 3GSUB 3JTTB 4MX7B 4YFDB 3L7EB 4HFUH 1CI5A 4ZYKB 1NFDE 4L9LC 5IJKC 4ZAKD 1BOGA 3U2SB 1GC1H 1UWXH 3LEVL 5D2LA 4NNXA 4HKJB 1TJIH 2OL3H 4ZNCD 1M7DB 2AXGB 4RNRA 1FSKC 4OV5A 1KIRB 2EDXA 3BDXA 3IDGA 4TRPL 1D5BB 4HJJL 3VW3L 4X4YB 5L6YH 3R1GH 3O3BA 4GKZA 4UT6L 5CCKL 3DYOA 2NY2D 4QT5A 1OAXH 1JF1A 1F90L 1OWWA 2PO6C 5SX5H 2KDGA 1VEMA 2GITB 1BD2A 1IM9B 1QBBA 3V6BR 1WCBB 4PGEB 3VFGL 4MGXA 1PZ5B 1LE9A 4F7PA 2J8UF 3DUUA 1C16B 3OXRB 1CFBA 4X7EC 2OTUB 2IADB 5J13B 3GRWL 1NL0H 3FB5A 5E00B 3VWJB 3VFWB 1NGYB 3C9NA 5HGDA 5JW5A 1JMXA 4IRSA 1FN4B 1YYLL 5D7IB 5LXGH 1E4XH 4XNXL 3VXQA 3V4VH 4M6NH 4KAQH 2NY5C 2VL5A 5D2LB 4P2QE 3IDYB 4PIRF 1I75A 4NQCE 4RNRB 2XTJE 3IDGB 4MJ4A 4N9GB 4R97B 4WIQA 1MSPA 1ZHKA 4GKZB 2XZAH 4Q74A 4XBEH 4PJ8C 1JRHI 5IMOA 3CU7A 4WCYH 2PYFB 3BD3A 4M7ZC 5EDXA 4EEEA 4CBPA 1DLFL 1SY6H 2MWCA 4XB8A 4Y5YA 2HLAA 4K23L 1BD2B 2X40A 4UZGA 3PWJA 1MCEA 2UZYB 1FBIL 3QO1B 3BIAX 1P84J 4F7PB 1LDPL 3DUUB 4NM4H 1NGWA 3UX9B 1L0QA 1IGML 4FQHA 4K9EH 1N3NB 3T4YA 3FB5B 2X70A 1ZTXH 3C9NB 5J6GB 3PIQA 2G5RA 3D18B 4Y4KD 1NGPH 3RU8L 1AD0A 4JE4B 5EZLA 3W0WD 3VXQB 1KG0A 3A0OA 4G8GA 1VA9A 3ZZ1A 4KFZC 3I50H 2VL5B 3ARDA 1AE6L 2WBJD 3QCTH 4YHMH 3TPUE 4JO4L 3SDXF 1AC6A 3H42H 4X4MA 1NCAH 1QSEE 3Q5YA 3EDDA 1ZHKB 4ZNEE 3FT4A 5EA0H 5KS9E 2R2HA 4F7MB 2N7AA 3BRFA 3QULA 3HZYB 5J8OA 5MEQB 4LCYB 2IANE 1HZHL 1Q1JH 1V7ML 2R56H 4NN5C 4DCQA 2CO6B 2ZUYA 4Y5YB 2HLAB 1H9VA 3MLRL 4TUOB 3PWJB 2J3SA 1UH2A 4HIEB 2ZZUT 4K94H 4O02H 4WW2A 2D0HA 2VXUL 4PGZA 2P8PA 5FECB 4RFNB 4JFOB 3ILQD 3SN6N 4MMZC 4P2QA 4NUGH 4C56E 5INDA 1XGPA 1NGWB 1I9IL 1RJZB 4S0UC 4FQHB 3HMWL 2X70B 3MCKA 3U79A 1BM3L 2B5IB 1AD0B 5IGXL 2WUBH 5GGSY 3GSRA 3OPZL 5CEZD 3O4LD 1KG0B 3UYOD 4U3CA 2APFA 3QIWA 4G7VL 2LU4A 3H9SD 4NSKA 4PJIE 4OAWA 1MRDH 2DQGH 2APXA 5HHVL 1I1YB 3QEGH 3VXUD 3NH7H 3FT4B 2O93L 5C0CA 2R2HB 1TJGL 3S4SB 4XGZA 3MUGA 3QULB 1EVTC 1PG7X 5FO8A 4NJAL 3AB0B 2CR3A 2OJEA 3ARRA 1TDQA 2XY2A 4TULL 1IMHC 4WW2B 1WWCA 1SJVA 3FRPA 5IVXF 1ACYL 4PRPE 1G0YR 5CEYA 4M6MH 1L6XA 4P2QB 1IGCH 1X5GA 2PXYD 5INDB 3BZDA 3OAYH 4UBDC 3R06A 4NQCB 3H3KA 4F37F 5HGBA 4F8QA 1XR9A 2XTJB 5HDOA 4ONHA 3WLWC 2P44B 1EIBA 1I9RL 3GKWH 2DQUL 3BUYA 4ZNEA 5KS9A 3GSRB 5T3XD 4OUOA 3VFVB 3V5HA 4GSDH 4HCRL 1J0YA 3QIWB 1CIUA 4GQPH 4A6YL 4NSKB 4OAWB 4LVEA 5DFTA 5D1XC 3BMWA 1G7IA 3O41A 2FL5A 4F57L 3DSFL 5JW4R 4RSVA 4C56A 4TRPH 1GSMA 4Z18A 3ALWA 4UT6H 4L5FL 2EEBA 5HPOA 3KPRE 5FO8B 1MRFL 1E4JA 1RVFH 1UCTA 5EWIL 2OJEB 2HKFL 1FVDB 3HS0B 1F90H 2F58L 3CMGA 4YBQD 4U7MA 1P2CB 1F3DJ 5CEYB 2YD1A 5T1LD 3ULVL 2YUVA 1JFQL 4PJIA 5ENWA 3TPUB 3UEZA 5HGBB 1XR9B 4XCCL 4ZOBA 4ONHB 2VLRD 5F72S 1I7ZB 1QSEB 5FGCE 1J0IA 5AG9A 3FQRB 4CU8A 4L4TD 3GRWH 3QO0A 5BRZD 3OKKA 4C59B 5KS9B 4AIXA 2RCSL 4ZTOL 1MIML 3V5HB 4FNLL 3KWWA 1YYLH 5K93A 5D70L 2IANB 4XNXH 3O11A 4KMTL 1QVOA 4JN1L 3QI9D 3QXVA 3JWOL 2E27L 2W65A 1RZKL 5HD8D 1J0JA 3O41B 4L8SA 1UM6L 2FL5B 2FLRT 5DQJA 3FFCE 2M2DA 4C56B 3PP4L 2X1QA 4M3JA 1QFWL 4YBLB 1A7BA 2A6DA 3WIHL 1JHLH 3C8KB 1KJMB 5KSAA 5IVOA 2QKIB 1C5BL 1DLFH 2V6HA 4XPTL 5C0NC 1RUMH 4K23H 3ZYIA 4KXZI 4LSPH 1UKQA 4A2MA 3MGAA 1FBIH 2C26A 5MENE 2NY4C 5KVEL 3IVKA 4PJIB 1TETH 5ENWB 1KXVC 5C0GA 3KPLA 2AKRB 3ARUA 5HDLA 2C9AA 1IGMH 1KN4L 2JTDA 4L4VD 3MRKA 3ETBF 3MRBA 4N1CA 5FHAL 4G8IB 3C2AL 5MEOA 1N5YL 4TTGA 3DUSA 4EI5D 3RU8H 4MB3A 4XVSL 5L2KD 3KPRA 3TNMA 3VFNB 2CUMA 5D7IF 2UUDK 3CX5K 2NXZD 3L5WA 1JPSL 1JPGA 4HIJA 4HBCL 3DRQA 1AE6H 4NQDA 2W65B 2W92A 2PUQT 5D2LF 4PRPB 5ETUB 1UZ6E 3CSPA 3MRNA 3NGBB 4GRLC 4YHZH 1KBGL 1Q38A 3D69B 1VGEL 1QSZA 3VXOA 2CLVB 4DUXA 2EDFA 2F8XC 3L3KA 2DQIL 4LCIH 4JM2A 4LNRA 2AJZA 4IEFB 2E6JA 5JMOC 1HZHH 1V7MH 4Y8AA 1GGIH 2EYRA 4LRIA 3MLRH 3WN5A 4EN3D 3O8XC 5F88B 3U0PA 3LPGA 1O7SA 5M94B 2X6MA 4IRJC 2PCPA 3WFHA 5ICYB 5LQBH 2VXUH 5DJDB 3OB8A 4KZDL 1NAKL 1S5HA 5DRZA 4L9LB 1I9IH 4R0LA 3FFCA 3HMWH 3MRKB 3MRBB 2YD8A 5I1KL 4OCXH 2X4PA 5D7JB 4JAMA 5EFIB 3DUSB 3HC3L 3SE4C 1FSKB 5IGXH 3KPRB 3NTCL 4IIQA 4M43L 3OPZH 3G9VA 4XVUC 3L5WB 1G6RA 1S9XA 4HIJB 3DRQB 1LK2A 1FL3B 5LVEA 3C2SA 5HHVH 2Q1EA 2HFFA 4L3CB 5MENA 4Q7DA 1EJOH 1NC4A 3VXOB 3S4SG 3VXRA 3LH2L 3U82B 2EIEA 1PLGH 1TJGH 5FGCB 3L3KB 4LCCC 4PLKD 4JM2B 4LNRB 4WU7A 5CJOH 1M71A 3O9WD 2HTLC 2O26U 2QL1A 4NJAH 5HVGB 3RNKA 4NWUH 3WLBA 5HDQH 1OGAD 3HHRB 3OKLA 3Q1SH 4PJBE 4XMKH 1FLRL 4TULH 3PV6A 4UV4H 5EIVA 2I25N 3WFHB 4AG4L 1ACYH 1N0XL 3P9WB 5DJ0A 3KPQA 5CKGA 4K3JL 5E8OA 1S5HB 5DRZB 4R0LB 5F3HB 4KGLA 2F9BT 3FFCB 5F93C 5EU6D 4P9HL 5TGBA 2BZDA 2X4PB 2MOVA 5ID0A 4CN4A 1B90A 4HCRH 4N5ED 2EH8H 4KGJA 3L5HA 3MV7A 1YEKL 4NRZA 1EPFA 1JPFA 4A6YH 5D6CA 1QRND 5MENB 4RA3A 4OSUL 5KANI 1JV5A 4F57H 2OTWB 1NC4B 3DSFH 1A2YA 1T1ZA 5KG9B 3S3JA 4WU7B 1M71B 4L5FH 5KTEL 5CS7A 1MRFH 1S7TA 3RNKB 3S7GA 3WLBB 2HKFH 3OKLB 1SJHA 4JN2A 3I02A 1NDGA 5F1IB 1G7PA 2F58H 4WI5A 1FZOA 3VGHA 1J0KA 2EE9A 3KPQB 4MA8L 1U58A 4WW2F 5E8OB 1XIWC 3ULVH 1K8IA 1JFQH 1ZEAL 4NZDA 4XCCH 3V0VA 4P46D 3RL2A 1DBBL 4AJ0A 1DUYB 2W60B 4KRMB 3TO4D 3PL6C 2ZCHH 2XXMB 4FNLH 2LTQB 4HWZA 4JRYE 5D70H 5C9JA 2Q76A 4NRZB 4KMTH 4PJBA 1IAIH 1NDMA 5GS3A 5D6CB 1TXKA 4JN1H 4OCLC 3ES6A 3W39A 3JWOH 2E27H 5KOMC 1RZKH 5F7HA 4FG6D 3QFJE 1IT9L 1UM6H 4HUUA 1JV5B 1NCTA 2OR7A 5BCAA 4X6FA 1A2YB 1T1ZB 3PP4H 2VZ3A 4NQXA 5DA0B 5D1QC 2JJTC 3MX0A 4Z76A 2E8YA 1LHZA 4R4BB 3WIHH 3EW3B 4MCYA 3O45A 4WFGE 1JJUA 4X6BB 3GMPA 1SJHB 1B4JL 3DXAA 3I02B 4Q9BA 1C5BH 1G7PB 1KB5L 1LO2L 3HLAA 5GGTA 1RHHA 4XPTH 3IRPX 3UPCA 4ZUWB 1FZOB 3TN0D 4XWOD 1I85A 2NY1D 2ADGB 4JR9L 2J6EA 1U58B 1GGBL 4LHUG 4QHUA 3V7MA 5KVEH 3NIFE 2X09A 3S5LA 3AREA 1DVFC 1U42A 3V0VB 2Q87A 1EO8L 5TPWH 2O61A 1ITCA 2X9WA 4JDZA 5JMRA 5EG6C 3LQAL 4G43B 1CK0L 1RURH 1N4XL 1GZPA 3MC0A 5FHAH 3N50A 3C2AH 1INDL 1N5YH 3IJYA 4YDJA 1DLHA 2DF3A 4MVBD 5KS9F 2IH3A 4HQQL 4XVSH 3TH3T 4HWZB 5BV7C 4PTUA 3MJ9A 4LIQE 4GOSA 2WWKO 5C8JA 3GMRA 2Q76B 4KRLB 4PJBB 1JPSH 1MVUB 4JJ5A 5EPMA 1J1OH 3W39B 3ES6B 5A16A 1T2QL 2VYRE 3CFEA 4HIXL 3CFJA 4HMCA 4P5MA 4HH9B 4HUUB 5FO9A 3DPBA 5F6HI 3EYOA 3ZT5A 1DQDL 3CLEL 4NQXB 3ARFC 2I27N 3BPNC 5B39G 2ZNXA 1VGEH 2RFXA 3UTPD 1PDKA 3FQWA 4WV1B 2Z91A 4MCYB 3O45B 3EOAA 3LB6C 4UOJA 1F3DH 3QUXC 1JZ7A 3QEHA 1DE4B 4CMMB 4QHUB 2A6IA 4POZD 1ZVYA 5J11C 1IGYA 3SJVD 1RI8A 3S5LB 3AREB 4O58L 5E1HB 1NAKH 3O6FA 4PJIF 1BOYA 1DFBH 2O61B 3OB0K 4TSBH 2A9ML 1IAIM 3JV5A 3P11L 2ZG1A 5E6IC 2BXZA 4E5XB 5I1KH 3SOBL 1HHJB 3CH1B 3IJYB 4YDJB 3HC3H 5J6HA 1RFDL 3NTCH 3WUZA 3VGAC 1IAMA 4KTDL 4M43H 3U0TA 3K1KC 4JJ5B 1JE6A 4LSTL 4JFYA 3W9EA 4Y4HC 3CFEB 1G9NL 3ZE2E 1IBGL 5IB1A 3EYOB 4R3SB 3SDDA 4J2XA 4K3EL 1UB5A 2Y07H 3IDNA 3GSVA 4YXLL 3CVIL 4YZFE 4ZQKA 3FQWB 3DETD 3LH2H 4OF8A 2P5WA 3EOAB 4Y89A 4ONOA 3B9DA 5FCUH 1IGTA 3K4ZA 2J7LA 4ODTL 1X5ZA 1ZHLA 3RVWC 3QDME 5GGVL 1XF4A 1U3HD 4JRYB 4P2RD 4WEUD 2P1YA 1JBJA 3NFNA 2A83B 3NMEA 1TCRB 1RIVL 4OFKA 3QFJB 3CD4A 2NPLX 2QHRL 3E3QE 4PJDE 2VR4A 4P9HH 2FBOJ 2HAZA 2DQFA 2AJUL 1HNFA 5J6HB 4XMLL 4PREA 1RY7B 3U0TB 3BSZL 3MZGB 3BKML 4Z7NE 3W9EB 5IB3A 1MFCH 2O5YH 5FUOL 1YEKH 1LP9E 5IB1B 5IFAL 3QZWG 4PRHD 5IW1A 4JANA 3SDDB 3IDNB 5J1SC 4JKPL 1FNHA 2NZ9D 3M17A 3SGDI 3TJHC 3IJSB 3E2HA 1IGTB 1LO3L 5KTEH 4AEFA 1ZHLB 1BZ9A 4JM2F 4RGND 3P4NA 1J1PH 5DMJB 4P57A 4ONFL 4QRRD 2X4SB 5E9DD 1RPQA 4FQXD 3WKML 4GMTL 1T20B 2XRAH 3NFNB 1R5WB 3PWLA 3TZVD 2CPCA 1NCNA 4GXVH 5C08E 3QUYA 3QQ9C 2BDNH 5TQ2L 1RV6X 5F6IC 1H5BC 1MCOL 4MA8H 5EBWA 2J5LC 2CDFA 3TFKC 4XCFL 1ZEAH 2H32A 4G5ZL 2R23B 1M7IB 4HHAA 2VQUA 2YD2A 4OT1L 3ABZA 1TTUA 1OB1A 1FFOA 1WT5A 4QRQA 4PREB 4GRLB 2EDDA 3QDAA 4XPGL 5JOEA 2DM2A 4NKIL 3C5ZB 2Y23A 3SCMD 1JYWA 2AERT 4NC0B 2Z31A 5DYOA 3GHEL 3ULUL 4P9MH 1S7RA 3QDMA 4XPAL 1BEYL 3MUHL 4Z7WE 1A22B 1VKXA 5KVFH 3EIFA 3C60C 4ZPTB 5DJAA 5IJVB 3M17B 3OJ2C 3E2HB 5T1DL 5I1JL 4FFVD 5DMGD 5DZOA 1EFXA 4PJDA 1B9ZA 4N8CL 1YN7B 4ODUA 3P4NB 1MHCA 4P57B 1B4JH 1LO2H 1KB5H 4M8VA 1QO3A 4JR9H 4N8VB 1GGBH 2CDFB 5EU7C 4H1LH 4Q2ZA 3JWDL 2H32B 1A6WH 2HA1A 5D71L 1BMGA 4PJ9D 3NCEB 3MGTA 1EO8H 4LCWA 1UZ6F 4LVOB 4Y16A 2QQLL 4JO3H 2RHEA 4AZ8A 5FB8B 4M61B 4QRQB 2H9GA 1CK0H 1N4XH 4JZOB 4LASH 4HKXB 5DYOB 1BBJA 3PXJA 3HCVA 4HQQH 5EC2A 2NNAA 2OSLB 3IFPA 3P4MA 2PTUA 3QDMB 4LCCB 3KJ6L 5BW7A 4TNVK 4M7LT 5DRNA 1T2QH 4HIXH 3IDMB 5LKNA 5C08A 5BMFL 1FPTL 3O2DL 1BLNA 3VWJD 3MREA 1DQDH 3CLEH 1IZJA 4PBXA 1MPAL 1VESA 1EFXB 4PJDB 3BQUB 4NKOA 3C6LA 4ODUB 3MGOB 2BCKB 1FZKB 3OR7A 4LPWA 2AI0H 3AROA 4MQXD 5KSUA 4YK4C 4LLUB 5FYJL 4D3CL 1ZS8A 2P46B 1LP9B 2CQVA 1T3FA 1TPXB 4Q2ZB 4Z7WA 2K7QA 1W0WA 4X9GA 2VOTA 3WSQL 3GBNH 1T7YA 3HI6L 4Y16B 2A9MH 2F5AL 4P3DA 3P11H 1XF1A 2H9GB 4NFBA 3WJJA 1CFSA 1BD2D 2BHUA 3FQTA 1RFDH 2Q20A 2NNAB 3P4MB 1ZLVK 4KTDH 1T04A 3UPAA 2OL3A 3ILPB 4LSDA 3P30L 4LSTH 2BSSA 5DRNB 1G9NH 4PJBF 2X05A 4QTIL 5C08B 1UADC 1SM3L 4WW1A 1ED3A 4K3EH 1E0OB 5E8EA 3MREB 1MI5E 2FYYA 4LCUB 3CVIH 4R7NB 4PLOB 5JW3H 2VLJA 3VE0A 3CSGA 1E4KA 1D9KD 1OP5H 2IGFH 4F15B 3LS5H 2R9HD 1TZGH 1XEDA 2Z93A 1T7VA 1X4XA 4ODTH 4NZJA 2CH8A 5ADOL 1V3MA 3EYUL 3V4UL 1QQDA 1T3FB 4Z7WB 3WNLA 1RIVH 3UBXA 4KQ4L 1IKFL 1W0WB 3H7BA 4D9RD 2A38A 2QBWA 2QHRH 2EH7H 2JJSC 5ALCL 5DFWH 3S3SA 1OTTD 2E7HA 2I26N 2X5PA 2AJUH 1QR4A 3NIDF 4XMLH 3WMSA 5L9DL 2QSVA 5D1QB 4Z7QE 3BSZH 2OL3B 3BKMH 1R3IL 1OSPL 5FUOH 1XGYL 1LEIA 4N0YL 2CJUL 1WZKA 5E8EB 3ARZA 3SE3C 4JKPH 2VRAA 2R8SH 4R6UA 1Z2KA 4GFTB 4EKXA 2JB6A 2VLJB 2YRLA 5F7LB 1SY6A 5H8DA 3V5DA 2WSKA 3O3UN 3Q6FA 2E8ZA 3IXTA 5I1AA 2VLME 5DGQA 3EFFA 1LO3H 4GRWH 5FOBB 5GZNC 3HZKB 4UU9B 4ONFH 3V6ZA 3WKMH 4GMTH 1AGDA 1HQRA 2I9LA 1NMAL 4UINL 1GPOL 2B8OT 1XZ0A 3UTSE 5GZOC 4C55A 1MCOH 3U4BL 3UBXB 5JLZA 1W72L 3H7BB 1R3JA 5E99H 4XCFH 1RZJH 1HI6A 4I48A 3EYFA 1MI5A 2AEWA 4OT1H 2YUWA 1F4WH 1MCKA 3T65A 4P2OC 4WUKH 5HHNA 1LEKB 1ZA3B 4XPGH 1CT8A 4NKIH 1MUJB 2JJWA 4JY6B 2FEDC 3ULUH 3QDGE 5D7LE 5F7UA 4P2QD 5JW4N 3MNZA 4KI5E 4XPAH 1BEYH 4NQCD 1QKZH 2XTJD 4JHBA 3QUXB 5E6YA 2W07A 3CFCL 5IV2B 2QHLA 4NP4L 5EZJA 1CE1L 1DANT 4LARL 3V5DB 1T89A 3MA7B 3NIFF 3MOAH 5T1DH 5I1JH 3IXTB 3LIZL 5I1AB 2PYEE 1T5XA 2BSRA 3EFFB 1GZQA 1N26A 1Q9LA 4HBQA 2BP3A 4JQXC 1WISA 3IU3B 2BRRL 4K7FB 1W8NA 1KPUA 2OJZL 3E1F1 3RX7A 1HQRB 2VJXA 1CXFA 2NQCA 4X6EB 1XZ0B 4Y2DC 5GRVK 1R3JB 4V2BA 3ME0A 3QJHA 3JWDH 3EYFB 2VAAB 1JGVL 5D71H 3UJIH 2EXWC 2FIKA 1MI5B 1XGRB 3VD7A 1H15B 1DBAH 3VA6A 5K9JL 1KJVB 4DUVA 4H8WL 1U8NA 1KTDA 2GUOB 2WP3T 3RUGE 3KJ6H 4YHLH 5D9SA 5LJYH 3IT8D 3EO0A 5DEFB 1QSED 5BMFH 1RIHL 3O2DH 4TVPH 3T2NL 2DLTA 7CGTA 2UY6A 1DANU 3UTSA 5EZJB 4YAQB 1WV7T 3FQXA 2NR6D 1AR2A 3KLAA 1MPAH 2BSRB 3MLPA 3SKOA 2IAND 4ENEC 1XT5A 2X7LB 1KN2H 4P4KC 2ZSVA 2JLLA 3DX7B 3G6AA 3OJDB 3UTQA 5MERB 1NLBL 3VXTB 4TPRH 4LRNL 3DURA 5D7LA 4CU7A 4D3CH 4S1DC 3VMOA 4C56D 3Q5OA 2ZUSA 2WZPD 3RI5F 1NLDH 3QJHB 3MUZ1 4WI9A 3ZE2F 3KHOA 2FIKB 4JHWL 5ACZA 3HI6H 4H0IA 5IW6B 2VTFA 2F5AH 2PW1A 4HH8A 4KK6D 5CWSB 4YZFF 3RVXC 4Q6IA 1FP5A 3EYQD 3UBXI 2DMKA 1U8NB 1YQ2A 2WP3O 1KTDB 1NJ9A 3R0MA 1E4XI 3KPSE 3UYRL 3P30H 1YY8A 3B5HA 5MI0B 2OI9C 4QTIH 1EEUA 2C3HA 4XAWH 5DK2A 2XWBB 1SM3H 5TF1H 4CVXA 3UTSB 1K4CA 4LSQH 4ONGL 3FQXB 1D6VL 3NCJH 1C7TA 4LLQA 3SKOB 1AQDA 5E1AB 4PJDF 4KRPB 2ZSVB 4QOKA 5DT1L 1SJXA 4KKLC 1F2QA 4CAGA 3KHQA 4XH2A 3U9PL 1T6WA 3DURB 3QDGB 5D7LB 4Y5XC 4PRPD 5ADOH 5JXEA 1FNAA 3EYUH 4XCYB 4OF5A 1ZANL 3REVA 5GPRA 3WDIA 6FABH 4FFWD 1LP9F 2IPKB 3IYLW 4KQ4H 1IKFH 4YFEA 5ACZB 3ZT6A 5KN5B 2PNDA 2V5MA 3B9KC 4MLSA 5CZVH 1E27B 1B6DA 2PYEB 5L9DH 5FUZH 4EUPH 1BGXL 2L0DA 4DAGH 1R3IH 1OSPH 3BZEB 1UEMA 2BY3A 4KJQC 5H37H 5DK2B 5CJ5A 1AXTL 5ELIA 4N0YH 2CJUH 1CU4L 3QQNA 4B0MM 1K4CB 4X7CC 4R26L 4AIZB 5D7JD 1X44A 2Z35A 4MJ5A 2YN5A 2BOCA 4KVCL 3ZKNC 4LLQB 1VADA 3KPRD 4K7PX 1AQDB 3AXLB 5C6TL 2OK0L 4P3CL 4G6AC 4PY7A 4XH2B 3GHBL 3TBTB 1AFVL 4GS7B 3RUGB 1U2CA 3RP1A 3V95A 1KNOB 4JFDA 3REVB 5D6DA 4UINH 5E03A 1GPOH 4M02A 3OSKA 2ICWA 3U4BH 5IW3A 1W72H 5BVPL 5AWNL 1HH9A 3MRQA 3OQ3B 3QXWA 4Z7WF 2BNUA 3RA7L 4MDIB 1A6AB 4RAUA 1YN6B 1E4WH 3V6OA 2IALB 4U2ZA 2WLYA 3ZDZE 2MKWA 1PKQE 4KK8C 4P5KA 3L6FA 4NOFA 1FZJA 4HKBA 3FFDB 1P1ZB 4KKNA 1QPXA 2MNUA 1M6OA 2CLZB 2BXYA 3FFCD 3WV0A 1RJLA 3AS3A 3CFCH 4YK4B 2Z35B 4BQ6A 4NP4H 1VADB 1CE1H 3RVTD 5CEXB 3PUCA 3LIZH 3BT2L 3QCVL 3ZHKA 2R1YA 3FN0L 4HKZA 5TFSL 3RVVC 1VGKA 2NXYB 3G5VA 5MEND 5DQ9A 1YY9D 5CKAA 2OJZH 2DKMA 3KPSB 4JVPA 4NC1C 1NC4D 4PV9B 2VKWA 3WFEL 2NCMA 1NEZG 3MRQB 2XG4A 2CRMA 3LN9A 2HLFC 4P23A 3QEQE 2XA8L 1CGSH 1UWEL 4XNZB 4RAUB 3IFOA 1JGLL 2ERJC 3BPOC 1IGJB 4HWBL 1U0QA 3MCLL 3OGOE 5K9JH 4X4XA 1TMCB 15C8H 4P5KB 3ULVE 3L6FB 3QHTC 4H8WH 1FZJB 2VERN 4HKBB 5CP7B 5IF0B 1T2JA 1TCMA 4MQ7B 1M6OB 2H2PC 4I0CC 1FFRA 5FYKL 4IMKA 4QO1A 1RJLB 5DVOA 5DS8A 1RIHH 3T2NH 2WQRA 4NZUL 3S88L 2EE3A 2BHYA 1F4HA 3ZE0E 3HG1E 2R1YB 3I85A 2XIDA 1GVIA 1I1FA 2X41A 4YXKH 4CN6A 5J9PA 4HKZB 1PKQA 2AEPL 2FRGP 4RAHA 3G5VB 4N0CC 5DQ9B 1YNLL 1NLBH 3PGDA 5CJBA 3LRSA 4RBPK 3NCYP 3CCHA 4IRZL 3HAEG 4PY8I 1TQCC 4TUJB 4XVJL 4P23B 1ROWA 4OCWL 4KROB 3SGKC 5EOTA 4JHWH 2YBRB 4WO4C 4HCRA 4ZFOL 2GK2A 1YEFL 3LSOA 3BX7C 5HI3C 1JYVA 2GQHA 4A6YA 1OTUC 1D5MA 2FH6A 3OF6D 1Q9OB 2WLZA 3BIKB 3S98A 4ZFFB 2XFXA 4PYHA 4P4RA 1S7WA 5C70A 1CDHA 2P8MA 4ONGH 3K1DA 2A0LD 3MSPA 3EJZC 3ZDYE 1D6VH 3QJFB 1J86A 1BJ1J 5DT1H 5J9PB 1PKQB 4ALAL 4Q9RL 1CLZL 3L3GA 2ICCA 5A2JH 2AJYL 3PGDB 1CD1A 1A14L 4Z7QF