1ZHBA

Crystal structure of the murine class i major histocompatibility complex of h-2db, b2-microglobulin, and a 9-residue peptide derived from rat dopamine beta-monooxigenase
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
273
structure length
273
Chain Sequence
PHSMRYFETAVSRPGLEEPRYISVGYVDNKEFVRFDSDAENPRYEPRAPWMEQEGPEYWERETQKAKGQEQWFRVSLRNLLGYYNQSAGGSHTLQQMSGCDLGSDWRLLRGYLQFAYEGRDYIALNEDLKTWTAADMAAQITRRKWEQSGAAEHYKAYLEGECVEWLHRYLKNGNATLLRTDSPKAHVTHHPRSKGEVTLRCWALGFYPADITLTWQLNGEELTQDMELVETRPAGDGTFQKWASVVVPLGKEQNYTCRVYHEGLPEPLTLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
publication title A structural basis for CD8+ T cell-dependent recognition of non-homologous peptide ligands: implications for molecular mimicry in autoreactivity
pubmed doi rcsb
source organism Mus musculus
total genus 63
structure length 273
sequence length 273
chains with identical sequence D, G, J
ec nomenclature
pdb deposition date 2005-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1zhbA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1zhbA01
3IDIA 3U6RA 4ERSL 1VKXA 4POYA 5DD1L 3T3MF 4NRXB 4GSDH 3QFDB 3DV4B 4YGVA 1YEKL 5KZCB 1KN2H 4TVPH 5J3HC 2GK0B 3P2TA 4XWGH 2J2ZA 1ODAA 3MJ6A 3RWCB 2RIKA 4YHZL 4GRMB 1P7QD 1FSKB 3MRQB 4MA8H 5JOPE 3DGGA 1EHAA 2Y7QA 1U8LA 4OM0H 1GGYA 3OHXB 5C6TH 5LG1A 1S7UA 3REWB 4K7FA 3KNBB 5IW6A 1RZFH 2YEZA 4JFXB 3U9PH 4NYLA 1G7QA 5D93C 3RL1A 5F96H 3S98A 5IWLA 2W92A 3QG6B 1YEDA 3G08B 1CYGA 1A6ZB 2CDFB 1DN0B 2EIZB 2XWJA 4F7EB 1CGSH 5FXCH 2I07B 2P8MB 1FG2A 3IGAB 3VCLA 5KS9E 2ATKA 3CPLA 3P0YH 1A7PL 5J0BA 1KCGC 1OLZA 1YNLH 1TTUA 3SE9H 1F5WA 2JIXD 2ITDB 4ODTH 4NO3A 4PGEB 5SX5H 1H8OA 4D9RE 2EECA 4JFDD 4XVTL 1KEML 2IADB 1RK1A 4I9WD 2BVOA 1IKNC 3MV7B 5T3ZL 1SMOA 1NAML 1Z9MA 5I17B 1RJLA 4QLRA 3DOSA 4FQIL 4S1RL 4JN2B 5C09A 4G6KH 4X9BA 4C83A 2X4QB 1JV5A 4J6RH 2VZUA 4FQXC 4HUVA 4OCNC 3GGWA 4UT9L 1H3PL 1X5LA 5HD8D 1GGCH 5EU6E 4D9QE 4CVUA 1OAQL 4MAYD 2VKXA 4OGXH 4F80A 2HTKD 1U2HA 3EYOA 1EPFA 3NFSH 1NCCH 5IVXE 1Z5LB 3LN5A 3UTSE 1OAZL 3RWJA 2V17H 4X7DC 1KTLA 4PLKD 1A3QA 3KPQB 1TQCC 4IRSD 5GIRB 4NRZB 3ULUD 4L4TB 1NDGB 4G5ZL 5DRZA 3G5VA 4M7JL 1XIWB 3NZHL 1OL0A 4P59L 1CE6B 4UV7H 5GSVB 4OIBA 4PLOB 4JRYE 4A6YH 4XTRD 5I1IL 4EUPG 4Y5YB 1C5DA 1FGVH 4PJFA 5IK3B 4HC1L 3QNZB 1MF2H 3MRFB 5HDLA 4OTXL 2P5WE 5DRXA 3HI5L 1HQ4B 4KAQL 4NT6B 3QB7C 1F11A 3PP4L 4NKOB 4TQEH 3S8WA 3QFJB 5JLZB 1QFHA 1I3VA 5ADOH 2C26A 4NJ9L 4HKZA 2XZQL 5JOFB 3DMMD 2HAZA 3ULSB 4WTZA 3MV8E 3UBXB 4DJMA 4I8DA 2HYMA 1SJEA 3MJ8B 2V5YA 3IJHB 1JYVA 1YUHB 5INCB 4BZYA 3W0WB 5IBLC 4NO5A 2YZ8A 3ZDYF 1QA9A 2M2DA 4JM2A 4NQVA 4NO2B 3GSRA 1JZ2A 5DRNA 4N8VA 4R96B 3I50L 5KSAB 1U2CA 1FNSH 4K07A 1RZ7L 2XV6B 3ARZA 4R8WH 3B2VL 4ZO6A 2GJZA 5I1KL 4G9FA 4KVNL 3P0GB 3VA6A 1MCOH 43C9A 1J8HA 4Y2DB 4R4ND 4QRQA 3QA3B 5HGHA 3O45B 3L7FB 1ZT7A 5C8JA 3LEVH 5E4EB 3F12B 3FMGL 1JHKH 4CVXA 3CFBA 2NY5H 5ALCH 4JVWA 3HAEG 3LPFA 4UV4L 5INDB 4QRPA 2PXYA 2VERN 5JXEC 1NGPH 4M43L 1MVUB 3KLHD 3V5HB 4LQ1A 4LLUA 3VFWA 1EEUA 3KPSE 1OW0C 1QBMH 5FOJA 1EJ6A 3PWVB 5J6HB 5C6WH 3SDDD 2FIKB 1Y6MR 3L3KB 4HAFA 1KEGL 2YPVL 4ERSH 4XPGL 2H6PA 5DD1H 3CC5B 2FO4B 3ARFC 5D72L 1YEKH 4J23A 5HHNA 1OB1B 4CU7A 4QF1A 4W6WB 3L3JA 3SE4C 4LSPL 3FO0L 3BH8A 1XGQA 3DBXB 1PAMA 2HLAB 1JRHH 5C0EA 3AFLA 2A74A 3U0TA 4L4JA 3OV6A 3MOAL 1PFCA 5C0AA 1LK2B 3ROLB 2YRPA 2J8UF 1UB6B 1CR9L 4YX2L 4LCUB 4MCYB 4AEEA 1WAAA 1WIOA 5J1TC 4ZPVB 3L5JA 5E8PB 3FO1B 1KTDB 1KCUL 4ODUA 3CLEH 2PNDA 5ETUB 2WWMC 1F45A 1ZANL 3GMNA 3L3GA 4NQUA 1A7PH 1I1YA 2OQJB 1UVQB 1XCTA 2E5EA 1EFXB 4LSSL 1PY9A 1QLRA 4P0DA 4KDVA 4WU5B 4MZ2A 3AS0A 2VC2L 1KEMH 4FZ8L 1I9RL 2XFXA 1IT9L 4KVCL 1CZ8L 1FZMA 5DMIL 1FDLL 5T3ZH 1K8IA 1ZTXL 2HVJA 4RDQG 1NAMH 3RY5A 3QJFB 3GIVA 2HWZL 1FFRA 3H9YA 5FKAB 2G75B 2XZAL 3D18A 4JY6B 4S1RH 5DJZB 3V6BR 1NKOA 3EZ8A 2C9AA 4EJ1C 4JKKA 2DWEA 2A6JA 2IEPA 5IB1A 1H3PH 3CVHA 3MLXL 1OAQH 5IW3A 5A16A 1S7TB 1ROWA 3C60A 1HOCA 4NQEB 1MAKA 2G2RA 3MGOB 4FTVE 3O41A 4R7DA 1PQZA 3QJHB 4Z7OE 4JE4B 1OAZH 2BNRD 4NQDA 4Y1AA 1J0JA 4NSKB 3MJ7B 3ZTJG 3FN3A 3FT3B 2WUCL 4HIEB 4JRXE 4UAOC 3KXFE 3M1BA 3MYJB 4G5ZH 1V7NH 4LIQH 3DHMA 4M7JH 4RGMC 3T77B 3NZHH 4JFYB 4P59H 5CEZD 4AENA 5E6ID 3ZDZF 3JZ7A 5I1IH 3SE3A 4N68A 2BY0A 1P1ZA 2F53B 1H3TA 5FF6B 2X1XR 5F88A 4PGCA 5ACLA 5JHDE 1RUPH 2RBLA 4NPYB 2Y5EA 4OTXH 3HI5H 5IFJA 3EYFA 4KAQH 4XNQB 1DJSA 5IB5A 3PP4H 1S9VA 4I18C 3HRPA 4M7KL 3SDXE 3TVMA 3UDWA 3MOQA 3VXSE 4LCWA 4UINL 1CDJA 2XZQH 3VXNA 4FQHA 3IDJB 3UTTE 1FCGA 2NXYB 5IMOB 3HE7B 5E5MA 5EULV 5ICZA 3FCTB 2VOTA 5KOMC 3CK0L 5F7UA 1JPGB 3TN0C 4JZNA 1JPTL 4ETQB 4JFPB 4XPTL 1P7QA 3WNOA 1VADA 4PJGE 5DHVH 4HGWB 5B38A 5KN5B 3JVGC 3I50H 4YDJA 3P9LA 3ET9F 2VXQL 1Q9LB 4PDCE 3JSSA 1M7XA 4FQLH 4DN4L 2B0SH 1RZ7H 1LNUB 2W0LA 4ZOEA 3TO4C 3B2VH 1RK0B 1BIHA 1RUQL 5I1KH 3D5OF 5TE6H 4KVNH 2X70A 3P77B 4WO4B 4Z6AT 4HUWA 4NN7B 3ARWA 3PDOB 1JNJA 1KT2A 4NQSA 3L6FB 3T08A 2CPCA 3EYSL 3FMGH 5J6GA 4B7LA 1A2YB 5FDWB 3RUGA 1KOAA 3S88L 1TJHL 1G6VK 2E8ZA 3GEWB 1CBVH 4UV4H 2JIXA 3RWFA 4HUMB 4AEHL 3BPOB 3GMQA 3PNWB 1EEZA 1UG9A 4F8QA 2FH8A 4JFDA 1AXSB 5HPMA 2MMXA 1U8OA 3QI9D 3VXUA 5I1LB 4GLRH 5DQDL 5GRVL 1KEGH 2GUOA 2YPVH 5DK0B 3RWIB 4WJ5B 4XPGH 5ID0A 4AEIL 3F7PC 4EN3B 5HY9A 4HX1B 5D72H 5C09E 4APQD 1UZ8B 3PGFL 3RPIB 3BP7B 3W39A 4FFYL 3GSOB 1YMMB 3F6IA 1HHKB 3D39B 4JFEB 1I7UA 1SYSA 3RY4A 3VFNB 2DQUL 3C8KB 3T0EB 2R1YA 3OKEA 3VXTB 4LK4A 4ZUSA 4R7NB 2B2XL 1KPVB 4HH9B 3VU2A 2F54B 2HFTA 3MOAH 1QSED 1IKFH 1OGTA 5F89B 1U8PA 5B8CC 1CR9H 1WWBX 4C56D 5SX4H 4IRSA 2JJSA 4Y7MA 4YX2H 3WN5C 4XCYB 5D1XC 3VE0A 2P8LB 3MREA 4KJQC 1KCUH 3TBTB 2XN9B 4JDVA 2FWOA 2P47B 1ZANH 3ESVF 4HS6A 3KYNB 2ED8A 3QXAB 2F58L 3L9RA 1A7BA 2BVQA 2VLKE 1BFSA 4R6UA 2VN4A 5TDPA 4LSSH 4L29A 3N0PB 4TPRL 1S8DA 4MVBD 3H9HA 2Y6SC 3GB7A 2IQ9L 2WBJA 2VC2H 4FZ8H 3SJVB 1I9RH 1IT9H 4KVCH 1CZ8H 2IFFL 3TO2B 1ZTXH 2P8PA 3DMMA 3GHEL 4XBGA 1Z9OA 2XZAH 3EDFA 5H8DA 4TRPL 4OF5A 4BK4A 3BJ91 2EDNA 4C54A 5DJ0B 5CD3A 3HCVA 2FECI 2P45B 3BZEB 1NUDA 3MLXH 2AEQL 3FKUS 2NY4B 1HXYA 4B41A 1J10A 4X6CE 4NM8L 4BFGA 4O4YL 5B39A 3CCHA 4NZDA 1WBZB 1R3LA 3U36A 2VN7A 4PS4L 5IQ9A 1I7RA 1X5YA 1OSZA 3QIUB 5E1HB 2GJ6D 4YDLB 4CNIB 4OUUA 1I8KB 2G9HA 3HZKA 4KKNA 2G5BA 2WUCH 2D31A 4J1UA 3KYOB 1J7VR 4OJFL 1IBGH 5JW4N 4G9FE 1B3JA 3CVIL 1J8HE 1NBZA 4PJDA 4UZGA 1LQVA 1ZOXA 2CIIB 5CBEB 1LK3L 5GRUL 3OKLB 1A9EB 1TVHA 2ADGB 3O8XD 3DTXA 3LVEA 1ZK9A 3NTCL 4JFQA 4OZGA 1YDPB 1ZLVH 3GMLB 5BRZD 1RJYB 3S34L 4MWFA 1ACZA 2XOTA 4QRPE 4G8IB 4Y16C 4LPYA 2APFA 1KJMB 2H2SD 4KJPC 3SDAD 3QCTH 4M7KH 4G43A 3QRFM 1OD9A 5IW1A 1RULL 4GAJL 1KC5L 4U1KA 3CXHK 2R1XA 1H3UA 4HMEA 3WFDL 3CK0H 1JPST 3FN0L 1JPTH 1DANT 4XPTH 2AABL 5HYJD 2DKSA 4UBDD 4G8GD 1E4XI 2NTSP 2J6EL 4M7ZB 5DWUL 2W07A 5CJXC 3GSUA 2YWZA 4ZXBC 4XAKE 2GITA 5E1AB 2VXQH 4N8PA 3JV4A 2VLRB 4DN4H 5KS9B 3GUTB 3NCBB 5C0AE 5LGJA 4RX4D 4QWWD 2MQ3A 5HDQH 2NZ9C 4S10A 1M7IA 4LBEA 4NN5B 1ND0A 2VLME 1U8HA 1WAAE 5IFHL 1YY8A 2WLZA 2YC1A 4M6NL 1U91B 3GJFB 3EYSH 4PREA 2DQTH 3FQXA 3D3VB 3S88H 1TJHH 3BGAA 3EYQD 1X5IA 4PBWD 1K4DA 4P3CL 3GI8L 3OXSB 2AXHA 4AEHH 2AQ3A 1P4BL 3LQZA 4PLJC 3FQWB 2AKRB 3LKPA 4H1LG 4AL8H 5KG9B 1P7KB 1IC5L 3VGHA 2NNAA 4ODXB 5DQDH 4FQ1L 3X3GL 2UVEA 1WK0A 1UB5B 1FN4A 3SKOA 5EO1A 5IVXB 3RKPA 4AEIH 5I8EB 3NFNA 3PGFH 4QCIA 4FFYH 1WT5A 3UTSB 2JJVA 1NBYA 4ZOBA 2JCCE 5D7JB 5A2IH 3DVGB 4P46A 2FYYA 2DQUH 4ELMA 4UTAL 5EOCL 2NY0B 1MCFA 2ARJA 1LP9F 2EC8A 3QULA 3EO1A 3Q6GL 3OL2A 1LD9A 1M6OB 2BNRA 3SKJL 2X4SB 1P6AB 4JRYB 2YN5A 5HGDA 2C3GA 3BI9X 4NQDE 1MLBB 2YWYA 3S5LB 1N8ZA 4J7RA 5JA9A 4U6TA 2P5WB 2NXZC 3HB3D 3CSYA 5GSRA 2ZUUA 3FRUB 3B9DA 5BVJB 3ARGC 5E6IA 5SWZD 2NTFB 3BZ4A 5IF0A 1CGTA 2O26U 1P9MC 3OB0K 4WDIB 3D48R 3QUXC 2F58H 3BKYL 3KPPA 4KKBD 5FYKL 3S4SA 1WZMA 3RGVB 3RRQA 3W11C 5DURB 4QRRD 2YA1A 1EO8L 1LEKA 1CLOL 4N0YL 1I3RA 4JPIB 3MV8B 3ES6B 3UYRL 3OXRB 4L8BA 1XF2A 1DUYA 3UTQB 2A6DA 4PTTA 1UEMA 1MFNA 2CK0L 4Y19D 5HJ3B 2IQ9H 3ARBB 5DA4A 3MNWB 1NCWL 2E6QA 3MRRB 2IFFH 1U9KA 2KQMA 1K4CA 3CX5K 1XR9A 4LCWE 1FL5B 1XF3B 1P4LA 2DLEA 1FNEB 4TRPH 2ICWI 5J11B 1VEPA 1XGUA 2QHRL 4H88H 4NKMA 5F44A 4NCDA 4KRPC 5ACZA 3DUSB 2CQVA 4Z7VA 2GFBA 2AEQH 1G6RA 3ULVL 4X99B 2XRAL 3O3DB 2Z0BA 2HT4C 3R0NA 4NM8H 3WE6A 1PY4A 1R3JB 4OZIF 4PS4H 2O61B 4KU1A 1TNNA 2EDXA 1JVKA 4R97C 4P2RD 4BQCA 4BUHA 3P3YA 4OCLC 4OJFH 4RFEA 3S96A 1Q72H 3CVIH 3DVNA 1AH1A 4N9GB 3TF7C 1SVZA 4IHOA 3RL2B 5E9DD 1MCWW 1LK3H 1ED3B 5T3XL 5GRUH 4Q9RL 4ZFOL 4QYOA 3IDMA 3O9WD 2Q6WB 4Z7UA 1EXUB 5SX5K 4LHUD 3NTCH 3RUGE 3NOIA 2GTWA 3IKCB 1CLYL 4WFFD 1CXKA 3S34H 5CJ8A 3BKML 1BJ8A 3QI9A 4HCRL 4H0GA 2FD6L 4O02L 4I9WE 4XNXL 1DANU 3QDMD 2V2WA 4HZLA 4QRSB 1YQVL 5LAXB 1T89A 1UJ3B 2NX5A 3VXUE 2OBGA 1RULH 4GAJH 3IFLL 1KC5H 4L8SB 2P49B 5CGYC 2I9LA 3T65B 4KMTL 2Y07L 2CLVB 3WFDH 2AV7B 4HHAB 5SV4A 4NKDB 3FN0H 3VMNA 2AABH 3MMEB 2G5RA 3CDYA 1VA9A 3QISA 2J6EH 5FO9A 1JYWA 3HPJB 5DWUH 1QSEA 4KTYA 2VR4A 4F37F 4K8RD 3IU3B 3RVWD 3VFTA 1BVLB 2CUIA 3SY0A 1GC1C 3AU1B 1OTUC 1NMBL 1DL7L 2FEEI 5JW4Q 3EOAA 4ZTOL 2EDWA 3G6JF 3ERYA 3RNQA 4G6JL 3DXAD 5IFHH 5DDHB 2LU3A 3VGAC 3CH8A 4M6NH 5IESL 4X8JA 4QY8A 4ONHA 5BMFL 1P6FA 1L8JA 5HDBF 3BEWB 1NGZB 3BWUC 3O6FD 3FB8B 4X6FB 3SDCD 1L4IA 2D03L 2XTJE 1FFQA 5J13B 5TH2B 5KTEL 1P4BH 4LKXB 3VH8B 5DMKB 3C87A 4FG6C 5ITBL 5D5MB 3AXLA 3AGVA 1A6WL 1IC5H 1JZ3A 4JY5H 2YZ1A 1C7TA 2LFGA 1G9ML 4NNXA 4Y4KD 1QQDA 3MR9A 3L3OA 3X3GH 5A2FA 2DN7A 2FCBA 5D7LD 3GBLA 5IWLC 5I1CL 4LRIA 1A6AB 3ZKQD 2HKFL 1U95A 4O2EB 4PGJA 5IB4A 3KXFB 4UTAH 5EOCH 1LO5B 3STBA 2R0WL 3G6AA 4I48A 4J4PD 2OZ4L 1QFWI 1L0QA 3Q6GH 5J56B 2XKUA 3RU8L 3WNPA 2GJ6A 3SKJH 1DQDL 2DTSA 5I9QB 1FNFA 2B8OT 5EBGA 4F7PB 3TP4A 4S1QL 3FONA 2GAZB 4KFZC 3N06B 35C8L 1KJVA 1WZ1L 3GMOA 2W9LA 2DQJL 1IGTA 1TQBC 2HKHL 1QSFB 1T6WA 4ODWA 4HT1L 4PJDE 1W72A 3O8XA 5FYKH 5BRZA 3V52L 4HUUA 1EO8H 2MHAB 3O0RL 3CFCL 3DUUA 4N0YH 2EDYA 1KLGA 5GGUA 1MY7A 3BRDA 3SDAA 2CK0H 1HILA 4XCEB 1NC2B 1A6VL 4HS3B 2NW2B 2W91A 1TMCA 1NCWH 4XX1G 4NHUA 1Q94B 4V1DD 4PJGB 1EEYA 4X7SH 4MDIB 5D96B 3SGEH 2OTUB 2ZG2A 3DGGB 2Y7QB 3ZT7A 1R0AL 3MYZA 1JGLH 2N1KA 2V5TA 3BPNB 2AJVL 2QHRH 1G7HA 5HYJA 2KPNA 1B0RB 3GRWL 5D2NB 2YD7A 5DJ2A 5IW6B 2YEZB 1F3JB 2B4CL 2XRAH 2VUYA 2O5XL 1BP3B 1WICA 1CLZL 4QHNB 2BY2A 4QHMB 3TNMB 4ZS7L 5CCKL 1YEDB 5D5MF 3P73B 5D7KD 4WI8A 4MA1B 4P49A 3CFEB 4GKSB 2XWJB 3MACL 1R3KB 1GCFA 4YH6A 3U83A 2X41A 1IEAA 5DTFB 1G7MA 1U3YA 4OZFB 4OD3H 1QZ1A 4JZJA 1V3LA 4P4RA 1NCBL 1WCQA 4WGVB 5I2IA 3V5KA 2MQ0A 2ZUQC 1AHWB 5ERWA 1HE7A 4PJ8B 1FGNH 5T3XH 4JO4L 5LKNA 4Q9RH 3SE8L 1OGAD 2BVOB 1N0XL 3CFJB 4AM0A 2IPKA 1CLYH 3MUJA 2EEBA 4R26L 5C09B 4L4VD 3ZKNC 4S2SA 4JM2C 4C83B 2FR4A 2PW1B 4BM7A 3MV9E 3BKMH 5LWYL 4UNUA 4HCRH 4YC2B 2FD6H 2W38A 4O02H 3RZCB 4XNXH 4P5MA 3PXJA 2V2TB 3OB8A 2C1PA 3LKSB 5I1AB 1YQVH 1WIPA 4TTDC 3L3DA 3IFLH 3O11A 5C0IB 2GSGB 2M1KA 5J12C 4YAQB 3GK8L 4AT6A 2R0LL 3TH4T 5FGSA 5GGVH 3HLAA 4U6VL 1SQ2N 4PFEA 1N26A 4XC3H 4HFWA 1BWWA 5EO9B 4P2QB 3UTPE 4FQQA 4JAMA 5I6XB 2LVCA 3NGBC 3V6OC 2A83A 2I60L 2NY6B 5DRZB 1FNGA 1RMFL 1PKQA 1X9QA 2PXYC 4YZFE 5HHQA 1HH6B 5FV1L 1UXSA 2BNRE 1NMBH 2VLKB 1DL7H 4DK3A 5JDJA 3IFOA 1VFAA 1KXQE 4TNVK 5I76A 4Z7WA 5ELIA 3HC0A 4ZTOH 3THML 5SWQB 3KJ4B 5FKPB 3V8OA 4G6JH 1A1MB 4KZEL 5SWZA 4WTZG 4KK6D 3RA7L 5E4IA 2VABB 5IESH 4NUJA 1MFDL 5CEZE 1KACB 4JFOB 1MCEA 5CSGA 1F3DH 4QTIL 3OKNA 3BP6B 1CDGA 3QXUA 4MQ7A 5BXFA 5GS1A 4N8VG 4Y19A 5KTEH 3P4MB 1ZGLP 5EBMA 2PYEB 3F62A 4WHCA 2A0LD 3VXMB 5EUOA 2DTML 1G9MH 2X4PA 2EYSA 5IFAH 4TUKL 4X6CB 2H9GB 2EYTB 3BRFA 2WMPA 1P84J 2W65B 4JREC 4CVZB 1QNZL 5I1CH 4Y5VB 4L3EA 4HK3N 2FHBA 5GGRB 3VI4F 1KJ2L 5F3BA 4IJ3B 3BYTA 2HKFH 5I15L 1U58B 3KS0J 3VWKD 5IHUL 4Y4FB 2GJZB 2FZ3A 5DJ8A 3T09A 4Z7VE 2R0WH 4GG6A 1OAYL 4PRIB 4FMFA 5MEPA 1J8HB 5I74B 3RX7A 4QRQB 4IMKA 4JFFB 4RCAA 2UWEB 1A02N 3RU8H 2VXSL 1H9VA 1TETL 3G9VA 2X44D 5CD5C 1FVDA 5GISL 1TCMA 2ICWB 3BXNB 1HDMB 4PRDB 2BOBA 4S1QH 2QBWA 4G6FD 3FQNA 4W68A 2XA8L 1BFVL 3HA0A 1K6QL 4MXQD 35C8H 2JTDA 1HKLL 1WZ1H 5E9DA 1T4KA 4OZ4A 3TC9A 4TTGA 3QO0A 4RQQB 3O9WA 4HT1H 3LV3B 3UEZA 2H3NA 5EZIL 3GSWA 3VFWB 5CMAA 2WIIB 4UOW0 3V52H 4U6XA 1JUFA 2VE6B 2BSRB 3O0RH 3CFCH 1A5FL 2H6PB 4MNQB 1MH5A 1P53A 3QDMA 1CGUA 3TNNB 2B1HL 1A6VH 2X42A 1KNOA 2XG4A 1IQDA 3X12A 3GI9H 3MZGB 3IXTA 1JFQL 4MQTB 2NX5E 3GKWL 1ZLWK 5C0EB 1REIA 5IOPA 1R0AH 2AJVH 4FFVD 4LCYB 5F7LB 1EBPA 1W0VA 1KIPA 3GRWH 1GL4B 3CGTA 4LLDA 3ILQC 2V6HA 5FA3B 2B4CH 1FV1B 2O5XH 2KUTA 1CLZH 3SE3C 4NFDA 4ODUB 5K9QI 5CCKH 4ZS7H 4WV1A 1QSEE 4R2GD 1BHGA 4CDGC 5HYQA 1D5BA 5GRYA 3MACH 1ES0A 1KV3A 5D2LA 2B5IC 3G04B 1FZOA 3T4YB 1N59A 1EEQA 1YY9C 1J1XL 1DTUA 3UDWC 4WFEE 1I1YB 2ICES 3IU4L 4XCNA 3RZWA 1NCBH 1T7XA 1NFIB 4J2XA 3MRPB 3B9KD 5DZOA 5F1SA 4TSAH 5GGSB 4JLRB 4PTUA 5IGXL 5JNYA 1CGWA 1KIQA 4JO4H 3SE8H 3O6FA 4PJ9B 2LAGB 2XXCB 1N0XH 5F7DA 3G6DL 4KI5D 4YWGL 4R26H 2UWEF 3LDBC 5CWSA 5LWYH 1T04B 1A22B 3H0TB 2JCCB 3X14A 5HHMA 4Y4KA 1FBIL 3QWOA 5IB1B 4MX7A 3U4BL 5HHPA 3V0VA 1BBJA 5IM7A 1F4AA 5D7LA 5A16B 1T1XB 2A38A 2FJFA 5L2JA 3KYMA 2H32H 5E6ZA 2VR5A 3I2CL 2R0LH 2QADB 3MUGB 1EVUA 4U6VH 1QBLH 3QEHA 2VZOA 4G7YH 3EO0B 4POZD 1QD0A 3BEVA 1LGVA 5DHXB 4MD0A 4D0DB 3OGCA 1IAOB 3NIFE 3MRKB 5FHAL 2HT2D 1T5XA 2I60H 2W60A 3RWDA 4E42A 1RMFH 4YO0A 2ADFH 2XG5A 1BZ7B 4WU7A 3ZE1E 3LZFL 3KPOA 5FO8B 5L9DL 1JI1A 1QVOB 3MUHL 3THMH 2UYLB 1P1ZB 2YHGA 3WO3B 4PGCB 1BWMA 1FH5L 3KR3H 5KAQG 4KZEH 3T2NL 3RA7H 3D2UB 1ZLVK 2F5BL 3X3FL 4AH2B 2CIKA 5F7NC 2VDKL 3HAEB 3OZ9L 5IUSA 2Z93B 2DMKA 3B5TA 3GMMB 5EC1A 2F19L 4KGLA 2QQQA 1S7RA 1UXWB 3TVMB 5GZOD 1NUNB 3M17B 4QTIH 5TE4L 4J12A 2SEBA 3PL6A 5ITFB 4MAYC 1SM3L 1JWSA 2HTKC 5K9OB 3PIQB 5B38G 1G0YR 4OZHA 3WLBA 1XGRA 4YXHL 1R3HA 5EBWA 3RBSA 5HGBA 4LPUA 3I02B 3BT2H 3QDJD 4V1DA 1XZ0B 4G8EA 4JZNB 2Z31B 3W9EA 4PLKC 3MLPA 2H41A 3FT2B 4CN6A 2PO6B 4NHUE 4IRSC 3KWWA 2JJSC 4TUKH 3ULUC 3D0VA 5AG8A 1QG3A 5H37H 1URLA 2CMRL 5I73B 1D9KD 4X9HA 1E28B 1KJ2H 5E08L 3UJJL 2DI7A 1BZ9B 5E5RB 5I15H 3I6LE 5ANMB 4XTRC 5IHUH 4K71B 3BW9A 5F71A 1MHHA 3BSZL 2R2EA 2AK4E 1IM9D 1BJ1J 1N4XH 2NY1D 4Q6IA 1D3CA 3OWEA 1A6TA 2VXSH 1TETH 4U0RB 5GISH 4UILL 2WANA 4GW1A 2ZZUT 5E0QA 3V6FA 1KB5L 2XA8H 3DROA 4Z78A 3VFOA 1K6QH 4HJJL 3DMMC 3TBYB 4QTHB 4ZTPL 2IPTL 5ESVB 3IDYC 3WYRA 4HIIB 5H2BA 2D4FA 4OGZA 1OGAA 4U1JB 4UQ2B 2A77L 4NO0B 5DHYB 5ACMA 4P5TA 1FLRL 5DMYA 3EYUH 1A5FH 2R4RL 2VISA 3HNVL 3SGDI 5CAYB 3SCMB 2VITB 5GRVK 4ISVA 5HY9B 3KGRA 3EHBD 5IB2B 4LDOB 5F1NA 1RSFA 4ZUWA 3QH3B 4M4PA 4M7LH 2B1HH 1AD9A 3BMWA 4OSUH 3SDYL 1M71B 4HIHB 3VD7A 3QEQD 3D1MC 2R1YB 3GHBL 4M5YL 1CICB 2FECL 4ZUSB 3GKWH 4KROD 4M1GL 1BX2B 1MFCL 3R06A 3MRIA 3DI3B 1AJ7L 1OGTB 5DUBB 4HWNA 1U8PB 2HJLB 2KZ1B 3EFFA 5JQ6L 3LKOB 3AAZB 1MFEL 4GKZA 3MBXL 1HHGB 1R5VB 4PJBE 2P5EE 1WBXA 3C09C 3MBEB 3QUML 1XGTA 4K94C 4R3SA 2FJGB 3MREB 1NFDA 3NN8B 5JIPA 4RNRB 4HWBA 1AGDA 4PRHE 3KLHC 3T3PE 2W59A 1VESA 5T1LB 4OCRH 1MWAH 1HCVA 5CIPB 3P4NA 4GBXB 1OAKL 3L9RB 2BVQB 3BUYB 2XTJB 1J1XH 3N9GL 2EO1A 4U1GC 2CXGA 4Z7WE 3IU4H 4QO1A 4R0LB 5KZCD 1ONQB 3JWOL 3Q6FA 2EE2A 5DC9B 1X5HA 5SWZE 2X1PA 5IGXH 2FBJL 2WBJB 1GJIA 4HC1A 5F7WC 1P2CA 3LRSA 1JNHA 3MNZB 3FB6B 4YWGH 5E00A 5B39G 1UCTA 3IDGB 2DQEH 1UA6L 3QNXB 4W4OA 3U4BH 2FX7L 3TM6A 3QRGL 4PJ7F 5FEBA 1Z9LA 1WLHA 1JGDB 3B5GA 4TVPE 4G6AC 1I1RA 3CCHB 1E4XL 1HH9B 1LO3L 2HG5B 3I2CH 4G42A 4QRUA 4U1LA 5DHVA 3WDIA 4F7TA 4L3EE 4CKVX 4MA3A 3FQUA 2D7TL 3QQ4A 2R4SL 1EUTA 3DWTA 3VGDA 3DIFB 4ZD3H 4X4XA 4MZ3A 4RDQF 1AFVL 4IEFB 1CTNA 1BQUA 2DQFA 2R2HB 5I0ZA 4LSUL 2EXWD 3LZFH 3MV7D 4MXQA 2PYFA 3DTXB 1FVCA 4L9LA 1FH5H 3CH1B 3T2NH 3CUPA 1PJ9A 2F5BH 4OCMC 2C7UB 2HMID 2VDKH 3OZ9H 4CW1A 1IL1B 1WT5C 4X5XB 5TE4H 4FXGB 4HEME 3RX8A 1SM3H 3ZDXE 1S78D 3WXVL 4P46C 4U1KB 1QYGL 5J3HD 1BFOA 1S7XB 2XIDA 4P3WA 3BN9C 4KUCD 1JPFA 1ZT1B 3SO5A 3SHSA 1E4JA 3GSQB 2AJ3A 1Q38A 2X05A 4L4TD 5EOTA 5A40E 1C16A 2X10A 2I26N 2CMRH 1UH4A 3DV6A 3UC0L 2FEDD 5IHZB 4FFZL 5D6DA 5DGQA 3HMXA 5E08H 3UJJH 4NKQB 5E6IC 4OLEA 4MXVF 3PABB 4NUGL 1OTSD 2ESVB 1B0GB 3U9UB 8FABB 3BSZH 4AK1A 4ONGH 3WHE0 2H26B 3NAAL 2R8SL 1YY8B 3X11B 1FE8L 4OFIA 3IB4A 1F00I 4QOKB 2XKNA 3EGSB 3QFJD 4S0UC 4JKLA 4XPBL 3DRTA 1F4YL 3QQ3B 4KQ4L 5D2LE 1KB5H 5EFIA 2J8HA 5TDNB 3B9KA 4HJJH 5KSVB 2D9QB 2XWBA 4ZTPH 4Z0BL 4NC1C 3MV9B 2UZXB 3DECA 5F3HB 3W0WD 4LLYB 2A77H 3IJYA 3C6LB 5IEHB 2NNAB 2AERT 1FLRH 4OQTL 3WS3A 3WNNA 3HUJF 2D0HA 5KSAD 4FXKA 2R4RH 3HNVH 3O4OC 1FN4B 4L8DB 3IF1B 4IIQA 1K2DA 1OWRM 1VGKB 2M26A 1MHCB 4PRBB 4HLZG 3B6SA 2Z91B 5KSBB 5MEOB 3LRHA 1JZ8A 3PWUA 4MQSB 4DCQB 5C71A 4P2OB 4X98B 2YUWA 5HHME 3U46B 3SDYH 3C5JA 5F1IA 5I1JL 3D69B 3GHBH 4X6DB 4M5YH 2LV4A 4WFHE 2BDNH 1MFCH 2IJ0C 2V5SA 2YPKA 1AJ7H 2D4DA 3P4LA 4HKJA 1LEIA 2LU4A 1RUML 3S4SG 1MFEH 3MBXH 5E8NB 1CS6A 3QUMH 5EU7E 1JK8B 3EOBA 2VDOL 1IGFL 4WW2B 3QDGA 1T1ZA 1OQOA 3E8UL 4OLWL 1M05A 1SEBA 2GYSA 3MLTA 5CHNA 1CQKA 3DX9A 3V8CA 2GK2A 2A9MH 2VL5A 4PJXE 3QI9C 5BZWA 3UXFA 1OAKH 1Z0NA 1QKZL 1XAUA 3LIZL 3N9GH 3LKQB 3WDHA 1INQB 4B7IA 3F8UB 4QHLA 1T89C 2DQIL 3JWOH 1VACA 4F7MA 2YUVA 5ILTL 1NCDL 3SKNB 3OR6A 4LLQB 4BSWB 5IG7B 2FBJH 2B20A 2BFVL 3CU7A 4JR9L 5CP7A 5L2KD 3CFKB 5DLML 4MMZC 3GM8A 4LNRB 5A1AA 1QO3A 1DEDA 5D8JL 5FV2A 2DWDB 4N90E 3QDJA 1KPRB 1LO0L 5C0JA 3TIEA 5E2VL 1SJHB 5MERB 1XGUB 4NKMB 1UA6H 2HJKB 2XY1A 1KG0A 5ACZB 2FX7H 4V1DE 1G7LB 1YC8A 2Z92B 2GFBB 4Z7VB 3QRGH 1G6RB 3U4AA 3PUCA 2VSDA 1ZLUH 4QNPE 5ABDE 3U7WL 3VD4A 1E4XH 3BP4B 1CFSA 4UIKL 5K9KB 1ZWIB 5DSCB 1CVRA 3VFPA 4XHQA 3ELAT 1SMAA 3ULVD 3L95A 5ENWA 4C58B 1CD9B 4EIZC 4TOYH 5JZ7D 2D7TH 1IM9A 1EFXD 2R4SH 1A21A 2VZVA 2DICA 2XICA 3TIDA 4CMHB 5IIEA 2YSSA 4XB8A 4EDXA 1FFNB 3WFBL 5KSBF 3A6CL 5C08B 1DZBA 4JQIL 4LSUH 1MIEL 3P11L 1EGJL 4X7CC 4Y5XB 5JXED 4X6DF 3A6BL 1MFAL 3WD5L 3FQTA 5JW4R 1FO0L 4WI2A 4OKDA 5FUCC 5F9JB 2J88L 4JHZA 4HKXA 4LRIC 4U1SB 1G7PA 5BS0E 3LH2H 4XCFL 4P5KA 2NX5B 4WW2F 4NQED 3WXVH 4G6ML 4GMSL 1QYGH 2CDEB 4PJCA 2V9QA 4P4KB 1SBBA 1YZZA 3OX8A 3LN4A 5T3ZE 1T0NB 4GS7B 1CK0L 3QEQA 5JR1H 3HI6L 2NR6D 4ORGB 3I75A 3BP5A 4EI5B 1U8NA 1LEGB 5ALBL 4LDLB 4X4YA 3UC0H 3FHQA 4JANA 4K7PL 4FFZH 3MLVL 1RJZB 4DFIA 3BQUA 1QFWL 3WL9B 2R2CA 3O8XC 1DQJA 2WWMD 4U7SA 1KSRA 4S0SD 4ZO7A 1N5YL 1ETZA 2Y72A 2DQCH 1X5FA 4PY8I 3QUKA 1UACL 5CLTA 1UADC 4PJHB 1FE8H 4KV5F 3P4OA 2H2SC 4LP4A 4UTBL 2AJSL 3SDAC 3QIBB 4XPBH 3NIDF 4HXBH 4E41E 4NRXA 2OR7A 3QFDA 3DV4A 1F4YH 1UWEL 2D2OA 3BUTA 2NXYD 5DO2D 3HE7D 4LIQE 1WZLA 2GK0A 4Z0BH 4YXLL 3H9ZA 1CGVA 3RWCA 4GRMA 3UROR 3GBMH 3MRQA 2GKIA 3TYFB 5DMJB 2VDPH 4OQTH 4NNXB 4UBDC 5JDSA 3OHXA 4I13B 4QHUB 1CDYA 4WWID 3REWA 3KNBA 4JFXA 1B6UA 2X9XA 4OQ1A 4QWWC 3IVKB 4U6YA 2CLRB 1MVFA 1J05B 4WO4D 3SN6N 3QG6A 2ADJB 3G08A 5I1JH 1UZ6E 1A6ZA 2AS5M 2CDFA 2EIZA 2D7MA 4F7EA 3G6AB 4ZUUB 2I07A 2P8MA 2Y23A 3CFDB 3F7RA 3IGAA 2BERA 4JZJC 4PJAB 1UWXH 3KYKL 3GIZL 4Z18A 2IWGA 5GPRA 1T20B 3JTTB 1RUMH 4U1HA 4YBHA 4K3EL 3EYQC 4L5FL 2ITDA 5GS0C 3KHOA 4KH2A 2CRZA 4PGEA 2X4OB 4X5WA 2AV1B 1DLFL 5DK3A 1KJVB 2VDOH 1IGFH 3MODL 2DLIA 2IADA 4OLWH 4RFNC 1IGTB 3LHPL 3MV7A 1G9NL 3O4LE 5DEFB 2YD2A 5I17A 4JN2A 2UZIL 2DKMA 1QKZH 2X4QA 2X40A 3QUXB 1XEDA 1A4JB 5T1KB 3WUWB 2DQIH 15C8L 3VFGL 2M8XA 1JRHI 1YMMD 1NCDH 3TEUA 3D39D 2BFVH 4JR9H 1KLFA 5GHWL 5IB3B 5H35A 3T0ED 3ZKMD 3BIKA 4WTXA 2CK2A 2DKUA 1Z5LA 3EDKA 5MEQB 2ILLA 5D8JH 3V4PL 2EEDA 1GPOL 3QAZB 2CDGB 5E2VH 3ZHLA 3KPQA 3HG1A 2HA1A 4NRZA 5GIRA 4L4TA 1NDGA 2ICEB 1X6LA 5DJ2B 4PGDA 2LVEA 1DCLA 2XN9D 1XIWA 1Q9OB 2AK4B 3HE6B 1FVEB 2XQYG 3PP3H 4ETYA 3HB3C 5DGRA 1CE6A 3U7WH 1IAIM 2VZ1A 5GSVA 4YBQC 4Y5YA 1HHIB 4G3YL 4UIKH 5IK3A 4OF7A 4N1EA 3MV01 3QNZA 3UPRB 4KKBC 3MRFA 3B9AA 1J11A 4ONOA 2QQLL 3QG7L 1HQ4A 4NT6A 4P2YA 3QFJA 1RY7B 5I2IB 1VERA 3WFBH 3A6CH 1B2WL 4XP5L 2OL3L 5JOFA 1MIEH 2OCFD 3P11H 1EGJH 1KBGL 3VFVA 3UBXA 4OKVA 1QR4A 1YEGL 3A6BH 1MFAH 1V3MA 3WD5H 3MJ8A 3IJHA 1YUHA 5INCA 4PJAF 1H8SA 4W81A 1FO0H 2A73B 4P9HC 4AQOA 2J88H 3P9MB 3R8QA 4NO2A 4WY7L 1FCCA 2VZ3A 2O93L 4PP2B 4R96A 1MCHA 4CUCA 5KSAA 2NY4D 3HN3A 1OSPH 3O6KL 4XCFH 1XT5A 4G6MH 4GMSH 2VDRL 4TN9A 2DL9A 5FB8B 3NCYP 3NA4A 2Q87A 4AT6B 4IMKC 3QIUD 3IKKA 3HLAB 2FL5A 1J0KA 4PJBB 4Y2DA 2P5EB 1EERB 3QA3A 4KKLC 3O45A 1QP1A 3L7FA 3HI6H 5IHBA 2XYCA 2IANE 1JYXA 4PRHB 3F12A 1AO7B 5ALBH 2H2PD 5E7BA 4ZSOB 1A47A 1AY1L 4K7PH 1F8TL 1FNGB 3RGHA 1FYTB 3MLVH 3K8MA 1NBVL 2V5MA 1L7TL 3HAEH 5INDA 3O9WC 3N1PC 1MVUA 3HC0B 1DQML 3V5HA 1XH3B 4YPGB 1KCVL 1TXKA 1N5YH 1TENA 5EIIB 4WI3A 2ZJSL 1UACH 2EDRA 3HS0B 1HI6B 3PWVA 3KPRE 4HJGB 3QDGE 3LPWA 5J6HA 1PG7L 3L3KA 4UTBH 2AJSH 1SYVB 5JOPD 3CC5A 3ZYJA 2FO4A 1UWEH 4KJYA 5GS1B 3RI5F 1YN7B 4WGWB 3UPCA 6CGTA 4BA8A 4YXLH 4HW6A 1CG9B 3FHAA 3J8F7 3BWAB 4MA7L 4I0PB 3DBXA 3FT4B 2FHFA 3WIFB 2CKBB 2HLAA 2DM4A 4LMQE 1YEJL 5E24E 1LO4L 1EA9C 4F3FB 1LK2A 3ROLA 2DMCA 2BHUA 1UB6A 5MENA 4K8RC 3RVWC 3RVUD 4LCUA 4L9DA 4MCYA 1Q0YL 4L3EB 5EORL 4WV1C 5E8PA 1RIVL 5F3BB 1KTDA 4ZO8A 4H5SB 5I75B 2D7NA 4RGNE 3K8LA 5ETUA 5E7FA 4DVRL 3T3ME 1I4FB 4Y88A 3ZYZA 3KYKH 1I7ZB 5FYLH 1IMHC 3WJJA 4LHUG 1ZE3C 3D3VD 1ZVHA 4Z76B 2OQJA 1UVQA 2FO1A 1EFXA 4K3EH 1T83A 3O6FC 4ZNEA 4WU5A 4FFWC 1DLFH 3H6JA 4GLRI 1F2XK 3T4AB 3MODH 3KVQA 2NMSA 3NPSC 3LHPH 1G9NH 2EO9A 2QV2A 3QJFA 4D9QD 1WBYB 5DJAB 1FPTL 3C9NA 2H3NB 2G75A 1NEZB 1A64A 2W0FB 2VZTA 5CMAB 5DJZA 5FKAA 4Y4KC 3WXWL 1J0HA 1W8OA 3UZQA 3MZTA 3VFMB 2BSSB 1N6QL 4KJPD 15C8H 3UTSD 3VFGH 4PG9B 1YECH 2O5ZL 3FFCB 4LF3B 3ECBA 5L88L 1S7TA 1XGPB 4PYHA 2NY0D 4JGMA 5GHWH 4HKBB 4XCCL 5SX4I 3MGOA 3LEYL 3X12B 2YA2A 3IXTB 3V4PH 3QJHA 2FRGP 1GPOH 4NSKA 3MJ7A 1RU9L 3FT3A 4JRYD 3ZTJH 1NCAL 4HIEA 2DL2A 2DLHA 1W0VB 4QEGA 3MYJA 4XNUL 2P5WD 1MJUL 1S9WB 4OT1L 3T77A 4JFYA 4N0UE 1TZHB 3FQRB 3REVB 5TE7L 4M61B 2NZ9D 4FRWA 4LP5A 4PYGA 3MLZL 3MQIA 2NY5C 4G3YH 4LGSB 3VRIB 3RGVD 2F53A 3OAZH 1ES0B 5FF6A 5DURD 4F37K 5DFVC 4NPYA 5ICYB 5D9SA 3MV8D 2Q20A 1CFNA 3QG7H 4XNQA 5I19L 3OSKA 2MKWA 2JJUA 4OGAD 1D5XB 4A6YB 3ARBD 1B2WH 5GJSL 1MPAL 2OL3H 3OJMB 3IDJA 4RMWA 3K8KA 3HE7A 3KG5A 1DQQB 3FCTA 2WV3A 1YEGH 1CDCA 2B1AL 4LNVA 3S35L 1JPGA 4MJ2A 2PTUA 4ETQA 4JFPA 1MI5E 4U2YA 3MLSL 5CWSB 1AP2B 2YD1A 3E3QC 5TDOB 3S97C 5HHMB 2UY7A 4WY7H 5I8KL 4HGWA 5KN5A 3Q2CA 1HZHL 1Q9LA 1BBJB 3WBDA 3O6KH 3HMWL 2IC2A 2VDRH 2JLLA 5TJWK 2APWA 4S11A 1RK0A 3PWNB 3P77A 4WO4A 3AB0C 4OFKA 3HZVA 3PDOA 3BPCB 2DQDL 3L6FA 4MD0B 1IRAY 3TZVB 1SVCP 5KVFL 3OGCB 4YHIB 2OMNA 1A2YA 4LMQI 5FDWA 4KRMB 1AY1H 1NAKL 1F8TH 5F6HI 2D0GA 4OFPA 1L7TH 3F7QA 3LPGA 4LPXA 4PJXB 3F5WA 1JTOA 3KPOB 2BC4B 2OX5A 3PNWA 5TQ0L 2OZ4A 1VENA 1DQMH 4GQ9L 1KCVH 1WTGT 3C5SB 4H26A 2ZJSH 5I1LA 1PG7H 1NUGA 5D4QA 5AUMB 5DK0A 3RWIA 4WJ5A 2ERJC 4EN3A 2NY2B 1UCBL 1JTTA 3TYGL 1MCWM 1UZ8A 3PL6B 3RPIA 3BP7A 5D7SL 1KTRL 1WEJL 4DGYH 3GSOA 1IAMA 4GRLB 1YMMA 2H1PL 3O81A 5DMGD 1HHKA 4LVNC 5HVHB 3D39A 4JFEA 5FO7B 5KANG 1AI1L 3VFNA 4MA7H 4PJFF 4POUB 4HK3J 3C8KA 3T0EA 1HNGA 4HIJB 4K55A 4MD4B 2WSKA 4F7CB 4HH9A 1KPVA 2F54A 3FOMB 5F89A 2BNQA 3STLB 4NN6C 5DEGB 5MI0B 4XCYA 1Q0YH 4N0FB 4DEPC 2P8LA 2R1WB 1LE5A 4FFEX 3TBTA 5ECJE 3HG1E 2NY7H 3OKDB 4DVRH 3BW9B 3H7LA 4I2XB 4X6BB 1MHHB 3KYNA 3QXAA 2XKSA 2CLZB 4KK6C 4YHPB 3GRWA 3L5WA 4Q6IB 3C5ZB 2VDNL 1A6TB 3A6OA 4NQTA 1SY6L 2BSTA 4Z5RB 3KAAA 3ILPB 3MLWL 3BIBX 1MRCL 1IGYB 2OJZL 3B4NA 2IF7A 4Z78B 2BVYA 2IALB 1IM3B 4CAGA 4ZODA 3SJVA 3GDBA 3TO2A 3WFZA 3W2DL 2J8UE 1OP3H 3QFJE 4NBYB 2A0LC 4JPWL 1FPTH 4YBLC 5MHSD 3S37L 5BS0B 2AEPL 4P5TB 4JFHE 4OV5B 3ZHDA 3IRPX 4W4OC 3P30L 5DJXB 4FTVD 2VJXA 5C0ND 3DX7B 1RZJC 3IFPA 3BZEA 1NAMB 2BSED 4JRXD 3JV5A 2VSCA 3KXFD 2E8YA 4PY7B 5CGYD 5CP3H 3QYCA 5M95B 2Q7YB 4NNPH 4XCCH 1WBZA 2J1KA 3LEYH 4O58L 1CU4L 5C07E 5LBSL 3QIUA 1P5VA 5C2UB 4CNIA 1G7IB 1I8KA 1RU9H 3EAKA 1NCAH 2YPLE 5GXBB 1UWGL 5JHDD 1F4WL 2H32A 4YHMH 2CIIA 3LQAC 5D1QB 1MJUH 4MXQC 4OT1H 5CBEA 1GGUA 4ZO9A 3OKLA 5C0FB 5LGKA 5HGAB 5DEZA 2ADGA 5TE7H 4L9LC 4IOIB 2Z8RA 4JPKH 1YDPA 3MLZH 1MRFL 4E41B 3GMLA 4OCXL 3MNVB 1J1PL 1LP9A 1YMHB 3UTTD 3G5ZB 3KLSA 4G8IA 3VD3A 4AJ0A 5I19H 1YN6B 3Q6FB 2LTQB 5L0QC 1NC2D 5I1HL 2IPUG 4HUXB 3MCKB 4Z0XB 5GJSH 3RWGB 1MPAH 4Y8DC 4ZFZB 3CX5J 3GMPB 3LRSB 1XFPA 4O2FB 2B1AH 5AZEL 1NMCB 3S35H 2WAHA 1T2QL 4YDIL 3MLSH 5FYKE 5I71C 4FFVC 5ADPL 3ZDZE 4DOHB 2GTZB 5MP6L 1GSMA 5D6DC 5I8KH 4P2CG 5EU5B 1HZHH 5E1AA 5IBUB 1BD2A 5EC2B 5BVPL 2VLRA 5KS9A 1IARB 3GUTA 3PHQB 3VW3L 4XGZA 5GS3A 4BFIB 3Q3GB 1E6JH 4R2GC 1ZGLA 3MJ9L 2E9JA 1ZLUK 1NUFA 5MENE 4WWKB 5DHVB 1G9EA 3UJIL 5FYJL 2DQDH 3K46A 1FNHA 4U33A 1U91A 2E9BA 3GJFA 5KVFH 3O4LB 5C0CE 3B9KC 1NAKH 3D3VA 3HC4L 1A1OB 2DQFB 3NVQA 3DX6B 1DBML 4KRNA 2IG2H 3OXSA 3DHJA 3ULVE 4CJ0A 1J0IA 3FQWA 5C09D 2AKRA 4GQ9H 1CVSC 2HRPL 3MROB 4ZNEE 2X9YA 4IBLT 5DZNA 4FQ2H 5KG9A 1OLLA 1P7KA 4H1LH 2Z9TA 4ODXA 1D5ZA 2R0KL 4IIQC 4M02A 3RZCD 4XBPB 4GXVL 1UB5A 4XNYL 1TIUA 4LVHC 4YFLF 3O3AA 4M93B 3UTSA 1KTKE 1WEJH 4WCYL 2H1PH 4XNZC 1JF6A 5D7JA 5T3XE 4J3SA 3DVGA 1AI1H 4XT1C 3SGDH 3WUZA 1ZVSB 1PEZA 5HHVL 1F90L 2EIDA 4V3DB 4POZC 1M6OA 1WTLA 3TCLB 4ZPTA 2X4SA 2HT2C 4JRYA 5KVDL 1JZ7A 3S36L 4XP6L 2ATPB 3GBNL 2QQNL 3ARDB 2VLKD 1MLBA 3S5LA 5FFLA 3MOBL 2C3VB 2JK5B 3C8HA 3FJTA 4M9OA 5BVJA 4MSWB 2NTFA 5LGHH 4WDIA 1RHFA 1BLNB 3RGVA 4NRYB 2F8VA 2VDNH 5FGBA 5HHOA 4NWUL 3RVVD 2CKBL 4JPIA 3MV8A 3ES6A 2AK1L 5GZOC 1OT1A 2F53E 2OJZH 2H45A 5JO5B 5HJ3A 5CJQL 4I3SL 4TUJB 3ARBA 4HUKB 2PYED 3MNWA 4NHCL 3MRRA 1QFPA 3W2DH 2VWEE 2J4WL 4EKXA 3IYLW 5B4MD 1FL5A 1XF3A 3IJYB 4RGNC 3S37H 3ZKND 2AEPH 4G80B 4PJEB 3SO3C 4JM2D 1ERNA 2V9TA 3P30H 4MJIE 2WZPD 5C6TL 3KYAA 5EIVA 3S3PA 4HBQA 4LSQH 1K2DB 3DUSA 3NCFB 4LRNL 3B6SB 4X99A 1BVKB 4Y4FD 3TJEL 2EKSB 3INUL 4G9FD 2IANB 2NLJB 2K3TA 3C5JB 1J8HD 4O58H 1ZHKB 1IAKB 2A6KB 1CU4H 4JFFD 1T7VA 4Q58C 2Q86B 2O61A 3MCG1 5LBSH 2CRMA 4HG4J 1MJJB 2NY1C 4I3RH 4IM8A 1HSAB 1IEHA 1UWXK 5HVWA 4MB5A 3CNKA 4I5BB 1F4WH 5KJRH 4JDZB 4BQBA 4N9GA 2ZOKB 4LVEA 3VXQB 4QRPD 3RL2A 2RGSA 1ED3A 4JKMA 3EOBB 3H8NA 3KPRB 2BY3A 3H3BC 2Q6WA 1EXUA 4LVOC 2MWCA 3MLTB 1MRFH 2C4FU 2PW2B 3CMOL 3IKCA 4OI7A 2GQHA 4OCXH 3NCMA 5KVGL 1TZIA 1ULVA 2QSTA 4HV8B 5J9PB 3LCYA 4RGOH 3I6KB 3SDDB 3ULUF 3SGEI 5I1HH 3EHBC 4F2MB 5LAXA 3RIAF 1UJ3A 4OGXL 4L8SA 1OAUL 1WIUA 3NFSL 3R1GL 3T65A 4XAKD 1NCCL 2CLVA 4YJZL 2AV7A 4HHAA 5AZEH 3ARVA 4NKDA 4KROC 4NZTL 4YDIH 4KQ3L 3MMEA 1YYLL 3C6SB 4QHKJ 3D39E 4JFEE 3UP1A 1XF4A 4KGJA 5E2WL 5ADPH 1OD7A 1SHMA 3HPJA 4JKPL 5MP6H 2VLMD 4KWUA 3BQUC 3IU3A 4GXUM 5BVPH 1AGCB 2F54E 3VW3H 3AU1A 1I1AA 3MRBB 2BNQE 4YFDB 4KK5D 1FQ9C 1QSVA 3MJ9H 3PP3K 4OF3A 1UT9A 4RBPK 4LSRL 4PJEF 4JDTH 3UJIH 3BYYA 2KL6A 5ENWB 5FYJH 4DKEH 1FNAA 3SPVB 3O2VL 1CXEA 1L6ZA 1WFUA 3C8DA 3BEWA 1NGZA 3HC4H 3FB8A 4PJ9D 4X6FA 4HGKC 3U0WL 1DBMH 1U8QB 2A6IB 1RZKC 5TH2A 1FSKC 5DMKA 3VH8A 2KBGA 4HH8A 5D5MA 3FQTB 4ESKA 2ZP0T 1JF1A 4JO2H 2R0KH 1XCQB 2VXVL 3VWJB 3SJVE 3M8OL 5IJVB 1MCRA 3NZ8B 3HRZB 4GXVH 1I9IH 5DJCB 4XNYH 1G7PB 1ZHLA 1FNSL 1OM3L 2P24B 3C60D 1A6AA 4WCYH 4J3TA 4O2EA 5M94B 4OZGF 2QADD 4G7VL 1F02I 3KXFA 4NZUL 1LO5A 3LN4B 5HHVH 1F90H 4OCSL 2XPGB 5T1DL 4UUJB 3IAQA 4H25B 1UKTA 5EZOL 2AXGB 4N0UB 3A67L 2VQUA 4ONFL 4F7PA 5A2JH 1NQBA 1QR1A 5IQ7L 3S36H 4XP6H 2GAZA 3GBNH 1HQRB 4H8WC 5F8RC 1AGFB 5DRWB 5B3NA 4X4ZA 3MOBH 4QKXB 5C9KA 4DKAA 1NGPL 1QSFA 4YHKL 3I9GL 5DXWA 4EVNB 5TF0A 1EHNA 1ADQL 3QUKB 3ZYIA 4HLJA 5CGMA 2HMIC 2MHAA 1BOYA 3TVMD 2EZ0C 4NWUH 2CKBH 4LCWD 4XRCB 2FLBT 2AK1H 2BZDA 3V6ZB 1LP9E 1S78C 3ESUF 3MX0A 5CJQH 4I3SH 4XCEA 1NC2A 3I3BA 4U3HA 5DI8B 1MI5B 4HS3A 2NW2A 4JVPA 3SKUD 4NHCH 1QBBA 2WWKT 2Q8BL 4RZCB 1Q94A 2J4WH 4PJGA 1R6VA 4MDIA 1JRHL 2OTUA 2PO6D 1F6LL 2OI9C 1HYRC 5JDSB 4GW5B 1XIWC 1B0RA 2FEDC 4OM1L 5D2NA 4HS8L 4WI9A 3A0OA 3U30C 1MCQA 4LRNH 1F3JA 1P4IL 2DF3A 4HDIB 4Y5YC 3TJEH 4U6YB 4QHNA 3INUH 1WGOA 3CLEL 4QHMA 1PG7W 4XNMB 3TNMA 5KSUB 1OTSC 3P73A 2CRIA 3MRLB 1CDHA 1CIDA 3CFEA 4GKSA 1JNNL 1BOGB 3FL7A 2E7LA 1BD2E 3MRMA 1R3KA 2VLRE 2APBA 1Q1JL 5DTFA 1L7IL 1I9EA 2E9WA 4OZFA 3DRQB 1J0ZA 25C8L 1QPPA 1DBJL 4U1HB 1AHWA 2F74B 3ROOA 4PJ8A 4X5WB 3CSPA 5FK9B 4ELMF 3CVHL 3CFJA 4NO0D 5C9JB 1K5NB 3D3VE 4JY4B 3TFKD 3CMOH 3VXUD 5KVGH 5DD5L 1J5OL 2PW1A 4OLYL 3SCMD 3T2QA 5KSAC 1CD1A 3DSFL 4JG1H 3R8BB 3RZCA 2V7HA 4KZDL 2E9IA 4OZIE 2V2TA 2YD9A 3LKSA 5I1AA 1HKFA 2Y06L 4XVUC 1JCKA 4APQB 1SEQH 5C0IA 1OAUH 4V2BA 2I27N 2GSGA 3R1GH 5H35B 4YAQA 2YR3A 3BIKB 3MO1B 4Y2DC 3V4VL 2FX8L 1B6DA 4NP4L 5BZDB 4NZTH 5E4EC 4KQ3H 1YYLH 1NGWB 3WMSA 5EO9A 1DE4B 4P2QA 2BVTA 5E2WH 3HG1B 4JKPH 3MBED 4MLSA 4JPVL 1WUNT 1V7NL 4PGDB 4C56B 5LJYH 4LIQL 1HH6A 4WFGD 1X5JA 3GJEB 2Q1EA 1MCSA 2VLKA 4Z77B 5T1LD 5K33A 1Q9KB 1U3HA 1GAFH 3O2DA 5SWQA 1CXLA 5FKPA 1A1MA 2XTJD 4LSRH 1RUPL 1K3ZA 2HLFD 3UBXG 1EAPB 2VABA 3OAZK 1J87A 5FM5O 1T7WA 3O2VH 4JFOA 2J8UB 5F9AC 2WBJD 3BP6A 5FYKU 5DZLA 3U0WH 4OLVL 5IMKB 1EAJA 5HHOE 3VFVB 3P4MA 4NFCA 4OKVB 2PYEA 4Q74A 1SJVA 1PVHA 2WINB 4GRWB 3VXMA 4ODSL 3PHOB 1VB9A 2IBZX 4BELD 1NLDH 4HK0B 1JN6B 2VXVH 2WWKO 5TFSL 3M8OH 5D70H 4X6CA 2H9GA 5EO0B 2EYTA 5GGTA 2W65A 1UM4L 4CBPA 3RWHB 4CVZA 3G6JE 5C07B 4Y5VA 1OM3H 4FQLL 5GGRA 2B0SL 4Z7UF 1U58A 4G7VH 4OQTA 4PP1D 1YEIL 4LCCB 1FYHB 2YPLB 4Y4FA 5HDBE 5EU3B 5LCVL 4NZUH 5TE6L 4UU9B 3MGTB 3KLDA 2MPAL 2FL5B 4PRIA 4HSQA 3WJJC 4OCSH 3ULVC 5T1DH 4JFFA 4ODVL 5JZ7C 2UWEA 5EZOH 1T83C 4BZ2L 3A67H 2ICWA 4ONFH 4QT5B 3BXNA 4JJ5B 1HDMA 2BX5A 4PRDA 5IQ7H 4RIRB 2Y9RT 3PWJB 4E0RA 1CBVL 4E5XB 4RAVA 4F33B 4CADB 2N56A 1QACA 3DO7B 2YD3A 43CAA 3LQMA 4PJIB 4YHKH 1T3FB 3I9GH 4RQQA 1HINL 2AJZA 3LV3A 5JIIA 1MCIA 1ADQH 2WIIA 4LSDA 4B53A 2VE6A 2BSRA 3BGMB 4CMMB 1CXFA 3P40A 2DDQL 1J9CT 4MNQA 2EYRB 4KJYB 3I3EA 2HJFB 3TNNA 4A2LA 1B90A 5HHXL 3HHRB 2YUXA 2Q8BH 3S3JA 3ULUL 1RJCA 2NR6C 1GZQB 1IKFL 1KIRB 4LCYA 5FM5M 1NSNL 5I16A 4MB3A 4G8GB 3NCEB 5MENB 1X4XA 4OM1H 5IHLB 4HS8H 5FA3A 1DVFB 1KGCD 1P4IH 1FV1A 3BPLB 2Q3AA 4YHYB 4Q97A 3DX8A 3UYPA 4G6AD 2D9CA 4GRWF 1R5IB 5C0CB 1JNNH 2FSEB 1J88A 3UAJD 3G04A 4QOKD 3T4YA 3OKKB 4LOUD 1Q1JH 4LEOA 1L7IH 3LKRB 4QXUL 25C8H 1OPGH 2IQAB 2GCYB 5IBTL 3CDFA 1NFIA 1DBJH 3MRPA 5GGSA 5BOPA 4JLRA 2NXYC 5DO2C 4D8PB 3HE7C 3MV9D 4YGAB 5J1AA 4JFZL 5F9DC 2VDML 4PJ9A 1TPXB 3VFUA 3WDJA 2D7QA 3CVHH 3RNKB 1C5CL 3C6LD 1ZLSL 5EBLB 4FN0A 3C9NB 3GZKA 1OP3K 3P0VL 5DD5H 4Y4HB 4NOFA 1J5OH 4OLYH 2MSPA 5FUZH 2OR9H 1T04A 4PPTA 3H0TA 2JCCA 3DSFH 1HYSD 3LKNB 4ZFOB 5D5ME 4DZBB 4KZDH 3TBVB 1F3RB 1MSPA 1A4KB 1MCCA 4YUEH 2AVGA 2Y06H 3ECBB 2QLVB 3UTPD 1T1XA 5MHSE 4P46D 4WO4C 4U1IB 4TSBH 3TH2T 1FO0A 4PJIF 3VRLF 4NN7C 3V4VH 2FX8H 2YN3A 3BN9D 1JP5A 2BVUA 3MUGA 4I4WB 4NP4H 2DRUA 5I8CB 3EO0A 4LHJB 4WI5A 4M3KB 5E94B 4D0DA 5IV2A 1IBGL 1IAOA 3MRKA 4JPVH 4J3UA 3BPOC 5CBAB 2YBRB 1EFQA 2JB6B 2OP4L 1BZ7A 1V7ML 5FO8A 4MAUH 1TZGL 1QVOA 4N8CH 3MFGB 4JO3L 2UYLA 1VPOH 3JXAA 3VG9B 4UQ3B 3QWQB 4PRPE 3D2UA 5DUML 5D9SB 4AH2A 4W4NA 1CFNB 4EN3C 4ZMAT 1BIIB 3HAEA 3U2SB 1QSFE 2Z93A 3LN9A 3GMMA 2V7NB 3QCTL 4PR5B 1UXWA 3LD8B 3M17A 3MA9L 4L3AA 2OTWB 3AREB 5ITFA 2EDJA 5K9OA 3PIQA 4OLVH 3T0EC 3ZKMC 1YEFL 4MJIB 1CDBA 3EJYD 3I02A 4ODSH 1XZ0A 4ZOAA 4MD5B 1BAFL 4H0IA 5J8OA 2Z31A 5DJYB 2VDLL 3FT2A 4I0CC 5TFSH 2PO6A 3V5DB 4YR6B 5ISZE 3PF2A 1JHLL 4U31A 2ADIB 3JWNC 1UM4H 2HH0L 1JZ4A 3D87B 4HUNB 4OCYL 4NGHL 1E28A 4M6MH 2OMBA 2FATH 4K3JL 1BZ9A 4M7LT 5ANMA 5HDQL 1YEIH 5LCVH 3L7EB 2BCKA 5D2NE 2ID5A 2EKJA 2MPAH 3HZVB 4OLZH 5BV7C 2BOCB 3WSQL 4DGVL 4ODVH 5D1ZB 5F6IB 2J3SA 1AE6L 4BZ2H 3VFRB 4P2RB 3FB5B 2DQTL 4NCC1 3WS6A 2E7LE 1Z2KA 4AEFA 4YHLH 2ZSVB 1UEYA 3U82B 1FFPB 3B3IA 3TBYA 3F5WB 4QTHA 3TJHD 5BJTB 5ESVA 4YK4B 2G60L 2VLLA 4XZUB 4HIIA 1HINH 4U1JA 2HFEB 4UQ2A 2IAMB 4AL8L 4NO0A 3BDBA 4X9IA 4H26B 5DHYA 4EXPX 3TFKA 3VI4E 5F70A 1UYWL 4X9GA 5C1MB 1MCLA 1X5KA 2DDQH 3SCMA 2NY4C 2NX5D 2VITA 4J3VA 5I8OL 7CGTA 5H94B 1EMTL 5IB2A 2HVKB 1NBQA 3QH3A 5HHXH 4Z7WF 4RAHA 5GS2D 2C3WA 1RZGB 1ZLWH 3ULUH 1M71A 4HIHA 3QIUC 4KY1L 5E8EB 1DLHB 4YDLC 2JELH 1JGEB 3SE4A 1CICA 4LFHD 2X1QA 1BX2A 5F93C 4EI5D 1I1FB 4YHOL 2A9NL 2J12B 1MEXL 4GAGH 5DUBA 2HJLA 2BNQB 3LKOA 1NSNH 2H2PC 2ED7A 2C3HA 1RFDL 3AAZA 1HHGA 1R5VA 2ITCB 3MBEA 3EDEA 5B22A 4ODBD 1AKJB 1U41A 1UQSB 4WFED 2FJGA 1LE5B 1AR1D 3NN8A 4P2QE 4RNRA 1GRWA 2IH3B 3B2UD 4JHBA 2K7QA 4UT6L 5EUOF 5T1LA 3ZYOA 5FA4B 5CIPA 3MGAA 4GBXA 2DBJA 3L5WB 3BUYA 3GFUA 1B4JL 3DXAB 3QIBD 4R4FL 4QXUH 5FOBB 2F5AL 5DS8A 2BSTB 5IBTH 4R0LA 1NJ9B 1ONQA 3G5XB 3VXRB 3GSNB 3T0XA 2GSIB 4JFZH 2FJHB 2VDMH 3SDCB 1S9YB 3IFNL 3C2AL 1C5CH 4U1NA 3VXOB 4GG6F 4K9EC 1W0YT 3MNZA 1ZLSH 3VGEA 5IT2H 2EH7H 3FB6A 1KENL 4OD2B 3P0VH 1VFBA 2XNAB 4M7ZC 3IDGA 3VFSB 3VG0H 1TNMA 2OL3A 5DQ9B 4H88L 2PYEE 3QNXA 5F8QC 3IFPB 3RVUC 3VXME 1WF5A 1OHQA 1CGXA 4AIZB 1P84K 1JGDA 4NN5C 2AQ2A 2DJUA 4IMLB 4U4BA 5EOCJ 1HH9A 2HG5A 2DLFL 3Q48A 3PGDB 1OP9A 1AR2A 5EZJB 1U8MB 4NOBA 1ZHNB 4KHTH 3HUJA 4L3CA 1MCKA 3DIFA 1Q72L 5C3LD 6FABH 4PRIE 2H32B 1MHPL 3EFDH 4JFFE 4XPFL 2OP4H 2R2HA 1V7MH 1ZHBB 2UWEE 1TZGH 2R69L 4JO3H 5EPMB 2AXFB 1T80A 2NYYC 1KCRL 2L7UA 3CH1A 5E8DL 4Z8FH 1LP9B 5T1KD 3TV3L 2C7UA 4U6HB 5DUMH 1WC7B 1EDQA 1OCWL 3MRGB 4R4BB 2E6PA 2X4UA 1IL1A 1UM5L 1T2XA 5IKCA 4JEGB 4X5XA 4FXGA 3MA9H 5D7JC 1W8NA 2NY0C 1YEFH 3TBSB 1S7XA 2FDBP 5ICXA 4P9MH 4KDTA 3RPKA 5IR1B 4MNQE 1ZT1A 4WI6A 3U0PB 5T1MB 3BIAX 1BAFH 2EDKA 3GSQA 3V4UH 3RI5K 3I6LD 2VDLH 3AVEA 5CS7A 1JHLH 1EJOL 1TLKA 3HE6D 2AK4D 1HIML 5IHZA 2HH0H 2YK1L 4OCYH 1N6UA 1BD2B 4MJ4A 2ZG3A 4TUOB 3LS5L 4NGHH 1T1YB 3JVGA 4PBXA 4K3JH 4XGZB 5TQ2L 3PABA 1ZGLB 1ZA3A 1V05A 2ESVA 1B0GA 1OVZA 3RGVC 3U9UA 8FABA 3X13B 1DP0A 2H26A 3MRDB 3WSQH 4DGVH 3X11A 4QOKA 3EGSA 1AE6H 1EH9A 1KJ2B 3IJSB 1HCFX 4OGAC 1MQ8A 4JQXA 1NEUA 4DK6A 3ARBC 3QQ3A 3IS1X 1T0PB 5GS0D 1KXTB 4LARH 5TDNA 5KSVA 1FORL 3TT1L 1XGYL 4ZDHB 2G60H 3MV9A 3BGFB 3LSOB 5F3HA 1MCBA 4LLYA 5J11C 3ZKXB 3E2HB 4OZIB 1F4XL 4EQ3A 1BQSA 5BQ7B 4JY5L 3C6LA 4Q2ZB 4D3CH 1MCDA 5IEHA 1D5ZB 4NZJA 1UYWH 1G7JA 2EC9T 4U7KA 3WFCL 4L8DA 3IF1A 1CT8B 1AXTL 4M4RA 4WEUD 5I8OH 4D0CB 1VGKA 1EMTH 1MHCA 4PRBA 3O3AB 1DBBL 2Z91A 3HC3L 3QNYB 4GW4A 5KSBA 5MEOA 3MRCB 4DCQA 2GEEA 4N5UA 1R5WA 4P2OA 4X98A 3U46A 3FTGB 5CZXC 3S5LG 2P5ED 4KY1H 3X17A 3D69A 4HEPG 4X6DA 3VMOA 3ZHKA 4XP9L 5EIQA 1CFVL 4PRHD 4YHOH 1ZSDA 2A9NH 1MEXH 4NQXA 1W72L 4ZPTB 4LLWA 2R2BB 4MHHI 1X44A 5DFWH 5CP3A 1RFDH 5E70A 5E8NA 3CIQA 2KQNA 3AMKA 1VEOA 4OZHF 1JK8A 3ARQA 4WW2A 3MLRH 2BHYA 1YNTB 1JWMB 4UT6H 4M1CC 4YBQD 5T5FL 4LPCA 1S7VB 3QEGL 1B4JH 4R4FH 4DZ8B 3LKQA 3FO9B 1INQA 2F5AH 5HHOB 4JRWA 5DK2A 4ZFFB 1F3DJ 1UJ3C 4P3DB 4L8SC 1TVBB 3SKNA 4LLQA 4BSWA 5IG7A 3O2WL 5DMGC 1WWCA 1MWAB 4I0PD 3CFKA 3IFNH 3C2AH 5CZVL 3B43A 3BN3B 2AJUL 3L5IA 4WUUE 4Z7QF 3B83A 4X7SL 4JG0L 4LNRA 1KENH 3G6JB 2DWDA 3UX9B 4TVPD 3QCUL 1KPRA 1SJHA 1JGLL 5GRXG 5MERA 3I3DA 2BRQA 1RVFL 1KUMA 2HJKA 2HN7B 4L3ED 1G7LA 4PLNC 3FOLB 2Z92A 4QXWA 3BZFB 1HWGB 1MFBL 5JOEA 1U0QA 4K7PX 5B3JF 3BP4A 1CTOA 1BFTA 2DLFH 5K9KA 1ZWIA 2E7HA 5DSCA 3VWKB 3WNLA 3BKCL 3QO1B 1Z0MA 1WITA 4KKLD 4I0KA 4K2UL 4OD3L 5ANME 1YA5A 3D25B 1T2JA 4XWOD 3NACH 2J5LB 5J13C 2V9RA 1MHPH 1FFNA 4IOSD 3QBTB 4XPFH 5C08A 5AYUL 1WFOA 1FGNL 3QIWB 2EDFA 5BO1L 1LILA 4Y5XA 4ZAKB 3WCYA 2R69H 1C8PA 3TJHA 1P7HL 1YPZB 1KCRH 3DARA 5C7XH 5JPNB 5E8DH 4PJ7E 4KDWA 1TZIB 3CSBA 3TV3H 5F9JA 3WHXA 1OCWH 5C0NC 1UM5H 3FFCD 2MCPL 3T04D 4U1SA 1DN2A 1NFDF 3NCYS 1RZIB 2CDEA 4P4KA 3K0WA 3ARRA 1CCZA 2AW2A 3TA3B 1T0NA 5GGVL 4NQCE 4HWUA 2P7TB 3QUYB 2WK2A 2P4AB 5I9QC 4XC3L 2AJXL 4UDUB 4ORGA 1XF4B 1EJOH 4EI5A 1CGYA 1LEGA 2FBOJ 4ZOCA 1GYAA 1HIMH 2YK1H 2ZSWB 3QUZB 2VKWA 3LS5H 4JZOA 4ZXBA 1RJZA 1ACYL 3WL9A 1I1AB 3VXPB 3PDDA 3IT8D 1T1WB 5TQ2H 2V5RA 4UT7H 1JHTB 1PEWA 1NGYA 5HXMA 1I9JH 3VH8G 3RTQB 2C3XA 3WIHA 2LU7A 4PJHA 1C1EL 3GO1H 4PG2A 4U3CA 5HBBA 4WFGE 4GRWH 3QIBA 1INDL 1U3ZA 5E2UL 1R24B 1PDKA 1SJXA 1UH3A 4FFWD 1FORH 2XACC 5T5NG 3TT1H 1XGYH 2EC9U 4GUPA 4P9HL 5D96C 2BVPB 1U3JA 2L0DA 1QHOA 3V95A 1SY6A 2QSVA 1PYWB 1U8IB 3BPNC 1F4XH 1JF1B 3TYFA 5FGRA 1KB5B 5HHMD 1WQVT 3PJSB 5IFAL 5D2NC 3V79C 1QRNB 1I8MB 1LE9A 2D0FA 4MXVE 1F6FB 4QHUA 3WFCH 4WFHD 1AXTH 1KJ3H 5DQJB 3EOTH 4F15B 1ZHLB 2HFFB 1UC6A 1DBBH 3HC3H 1PZUB 4MA1C 3IVKA 5C0BA 4I77L 2CLRA 4OFYD 1B4RA 2ZUSA 2E7LC 1Q8MA 1J05A 4KUZL 2ADJA 1YPZF 4ZUUA 3CFDA 5HYSB 4XP9H 2XWTB 4PJAA 3TZVD 1CFVH 3AM8A 4XMPL 5FIEA 4FQCL 1W72H 1AHWC 1EBAA 3QEUB 3NBNA 1T20A 3JTTA 3BAEL 4PJ8C 5DD3L 3S9DB 1F42A 3FZUD 1QR1B 3OAYH 3ZE0F 2X4OA 2AV1A 1INEL 2K7PA 5EG6C 4PRPB 3HUJE 2BXZA 1NH6A 1AQDA 5I66A 5DEFA 3DPBA 3T0AA 1X4ZA 3EYVB 5T5FH 4IRJB 5DFVD 4YC2C 3QEGH 3RZCC 3QUMB 4G8FB 4BH8B 3IXAB 2NY2D 1A4JA 3QUXA 5T1KA 3WUWA 4DFHA 3PL6D 3PWPE 1GIGL 4N90D 4GRLD 4E9LA 2DIJA 2V2XB 3HZMB 3O2WH 4OLUL 1H5BB 5IB3A 2PTTA 5ISZB 5CZVH 1EZVY 4Z7NF 4KTEL 2EDQA 4PRAB 2AJUH 3GI9L 5MEQA 4JG0H 4K8RL 5I6XC 3SOBH 3QCUH 2CDGA 3WO4B 2NY6C 4GKOA 3O3UN 1RVFH 1HHHB 1X4YA 4XXCA 2ICEA 4JCMA 4JB9L 4OZFG 3T0WA 1MFBH 1Q9OA 2AK4A 3HE6A 4DQOL 3EJJX 2H8PA 1FVEA 1D9KB 1S7QB 3KJ4C 3GKZA 1U8JB 1HHIA 3GSNL 3QT2A 4DKDC 3MRMB 3BKCH 3C5ZD 3UPRA 1W0WB 3PQYB 4KI5F 3NA9L 1KGCE 4BK5A 4ODHH 1J1OL 4K2UH 3RVVC 3EKCA 4XP1L 2P44B 1PG7X 2ESVE 4X7EC 4DUXA 2VQ1B 4BFEA 3MJ9A 4TSAL 4KI1A 1IGJB 3ROOB 5AYUH 5JORB 1BQHB 4QOKE 3OMZA 5BO1H 3QSKB 4P99A 2DJ4A 3DLQR 5CILL 3UTZA 4X9FA 5BS0D 5B4MC 2BNUB 2YXFA 3D9AL 4P5TD 2OXHA 2R23B 2A73A 1HEZB 1IC4L 3P9MA 1C08B 1CD1B 4WUKL 5T3ZD 2ENSA 1T0MA 4Y5VC 4PP2A 4GAYB 2V7HB 2MCPH 4IJ3C 2W9EL 5AAWA 4GO6B 3RDTB 2ZNWA 4Y4FC 5FB8A 5F9WB 1GXEA 5I74C 3T1WA 3PV6B 1QBLL 1D5IH 4PJBA 2P5EA 4JQVA 5KSBE 4WNQB 4LAQL 4G7YL 4RA0C 3MRJB 2YD8A 2AJXH 2Z8SA 1VFUA 3WLWD 4PRHA 2X1OA 1AO7A 4ZSOA 5DD6B 4X6DE 5CKAA 4NKIL 1OOAA 5EA0L 3PWLA 1FYTA 2ADFL 5AEAA 1ACYH 2EEAA 1MOEA 2GT9B 4E41D 1U3HB 5EUKA 4M1DL 1XH3A 4YPGA 1MLCB 3IDXL 4KJWD 5EIIA 3KR3L 3BRGC 3HS0A 1HI6A 4HJGA 2R29L 1C1EH 4UOJA 1Z6JT 1MHEB 1D5MB 4MNHB 1SYVA 1INDH 1TCRB 5E2UH 3U1SL 1YN7A 1UGNA 2IBBA 4HJ0C 2N4IA 4PB9L 4MS8A 1CG9A 4P9HH 1IGIL 1T22B 1HN1A 3BWAA 4I0PA 2NPLX 3FT4A 3WIFA 3QZWB 2CKBA 3BT2L 5C0GB 3OQ3B 3QPQD 3OJ2C 3R4DA 1CD0A 4KK9D 2VDQL 4F3FA 2BK8A 2GY7B 4LL9A 1ZS8A 4HMCA 1DR9A 3R0MA 1CWVA 2WM0A 3LEXB 4NNYB 4PJ5B 1XR8B 3RWEB 1RZ8A 3BH9B 4H5SA 4KV5E 4I77H 4AMKL 4KK5C 4WWKD 4KUZH 3N1QC 3NIDE 1I4FA 4FMKA 2ZOLB 3BX7C 2BJML 3H3KA 2NY3B 1N4XL 1I7ZA 5BOZG 4XMPH 2VLJE 3U7YL 4FQCH 4ZUTB 3O4LD 4JGJA 4GMTL 1JWUB 4Z76A 1BF2A 4MNGE 3BAEH 5DD3H 4PJ9C 5T33L 3BJLA 4PGBB 3W81A 4E0RB 3F7YB 1INEH 3L1OL 4PJCF 1L9MA 3T4AA 4RAVB 1GGTA 3OR7B 43CAB 4P23B 2BMKB 1WBYA 2AJZB 1IILE 5DJAA 3CJJA 3EJZC 3HNSL 1NEZA 2W0FA 5C08E 3OJDB 1WCBB 3S35X 4IS6B 4D0BB 1GZPB 3RP1A 3EYUL 4O5LH 1UM6L 4OIIH 2CUHA 3VFMA 1MQKL 2BSSA 4LAJH 4LASL 4O51B 4J3OC 5SWSB 3TT3L 5JXAL 4PG9A 1GIGH 4F9PA 3UZEA 3OTTA 4JO1L 3C60C 3FFCA 4LF3A 2YD6A 4XB7A 1AGBB 4M7LL 3OKOB 1XGPA 2QADC 4OLUH 2VR9A 4OSUL 3ZLQC 2XQBL 4HKBA 4KTEH 5IEKB 2HFGL 1JNLL 1Y6NR 4K8RH 3V0WL 4HWBL 5K59F 1T21B 1LQSR 3VJ6B 4U1MB 1JFMA 4PIRF 3RIAK 1RIUL 1PX3A 5HI3D 2FB4L 5I16B 3ARDD 5E8OB 1JGUL 2OI9B 4JB9H 1E27A 2X09A 1S9WA 4DQOH 3BD4A 3K4DA 4YLQT 2ZUTA 4BKLB 5E2TL 5F21B 2B7DT 3U30B 1H15B 1TZHA 3FQRA 3FAXA 3REVA 1ORSB 4M61A 3W9DB 1CLCA 5F72S 3DX8B 2DYPB 5D93B 3T2OA 2X9WA 5TGBB 3VRIA 3GSNH 4OCRL 1MWAL 3MA7B 3NA9H 5ICYA 2A2QT 4LEOB 4QGYA 3TVMC 1J1OH 4WHYG 4J8RB 4XP1H 4LPTA 1EUUA 3T8XB 3CZJA 1D5XA 4A6YA 3E6FB 5CEXB 1A1NB 3FB7B 1ZEAL 4EUPB 1U8KA 4PJHE 2IMNA 5J1AB 3VFUB 1T66D 2OJEB 4ZS6D 1DQQA 1PKOA 5CILH 4YHNB 5LQBL 2Z31C 1EHLL 1QOKA 1RD6A 1RZJL 3WEXB 3BD5A 3D9AH 5HSFA 2PO6C 5ID1B 2C4XA 2EH8L 1AP2A 4ZNCD 1IC4H 5I73C 5LXGL 2DQEL 4WUKH 1ZT4B 5TDOA 5TF1L 2IBZY 3QXVA 4FQXB 1ORQB 2W9EH 3EUUA 4PV9B 2IAND 4K71C 1KF9B 2ZUYA 1FO0B 3OPZL 1HSBA 3PWNA 4OFYA 3I6GA 1OF2B 3RVXD 4KKCD 4IOFD 3LQAL 1CFQB 4LAQH 4NBXB 4U0RC 5KW9L 1H3WM 3BPCA 4DW2L 3WS6C 5C0BE 5F7MC 4NDMB 1QFWM 4DWHA 1JJUA 3TZVA 5IV2B 4YHIA 4ZD3L 5I0DA 4YDVB 1TQCB 4NKIH 5EA0H 3KPRD 3QDGD 4PJAE 1ZAGA 3V6OA 2CXKA 1IEBA 4PJXA 5IJKA 2BC4A 3LOWA 3O3EB 4M1DH 3TFKC 5EU4B 4KUCF 1RHHB 3IDXH 4B0MM 3C5SA 2VH5L 1NGXA 2R29H 2MNUA 2VL4A 4X7TB 1NC4A 3S37X 3SCMC 4YNYB 1JYNA 1G9NC 5AUMA 4WUUB 3U1SH 1N5AB 5KBNC 4O2CB 4PB9H 4GRLA 4UOW1 1ADQA 1QEWB 7FABL 1IGIH 5FO7A 1CICC 1MIML 4YHZH 5L2KB 2R9HD 1Y0LB 3G5YB 3HMXL 3JV6B 3NCJL 5DYOB 4HIJA 4MD4A 1Q0XL 1KLUB 4RGND 4F7CA 5D6CB 3FOMA 2VDQH 4TYUA 2EXYD 5FECA 2XY2A 5JW4M 3MBEC 4FP8L 3STLA 4X4ME 5DEGA 1E6OL 2Q76B 4N0FA 4DN3L 4QGTA 2E27L 2R1WA 1I85A 4AMKH 1YJDC 3OKDA 4GBXC 2BCKB 4I2XA 4X6BA 2XTJC 4ONGL 2CLZA 4YHPA 2HLFC 2BJMH 4TNWF 2KZWA 4R0LC 3ZE2F 3C5ZA 3U7YH 4GMTH 4O9HL 4Z5RA 3ILPA 2WBJC 1A3LL 3H9SB 1IGYA 5T33H 1A9BA 2IALA 1DUZB 1IM3A 4HQQL 4PJ7B 1DDHB 3L1OH 3B3IB 4XVTH 2LABA 2VLLB 4UDTB 3ARXA 5CJOL 3CFIC 1QLFB 4MGXA 4RMSA 5KVEL 4FQIH 3HNSH 3VWJD 3AROA 4HXAL 5BS0A 4OV6F 4OV5A 1CE1L 4QXTB 4CU8A 5GGQL 3L3HA 5DJXA 5FYJE 1UM6H 2VIRA 5IMMB 1MQKH 2OSLB 4LASH 4UT9H 3DX7A 3TT3H 1RAMA 2VUOA 5JXAH 1I8IB 4NQCB 1NAMA 4JO1H 5K93A 3SGJA 1V5JA 3ARFB 4PY7A 2XQBH 4PP1C 2X5PA 2Q7YA 5JIHA 3NH7L 2HFGH 1JNLH 3V0WH 2BDNL 4X6EB 4HWBH 2X4TB 1G7IA 5D7IB 1RIUH 1KYOJ 1YEHL 4PD4K 2FB4H 1JGUH 3BQUD 5D1QA 1MCPL 2EDBA 5JPMB 5C0FA 5E2TH 2PN5A 5HGAA 5EZLB 4KXZH 1AO7E 4LQFL 4IOIA 4ZSOE 4RRPA 4E41A 4X0KB 3DGCR 1FYTE 4HC1H 3MNVA 1J86A 2A9ML 3Q5OA 4NJAL 1YMHA 3F6LA 3G5ZA 1IC1A 4MJ6B 3FFDB 5DS8B 5AD0B 1FP5A 1YN6A 1C7SA 4CDHA 1K85A 1MI5D 3DO3A 2DBLL 4HUXA 3MCKA 1ZEAH 4NJ9H 4Z0XA 3RWGA 4ZFZA 1PGRB 1OQXA 4KDTC 4PGZA 3GMPA 2FX9L 3CZFA 5CUSL 4U1NB 2GY5A 4O2FA 1UKQA 5LQBH 1EHLH 3CLFL 1RZJH 5F7YC 1T5WB 1VFBB 1CIUA 1C12B 3BOVA 2EH8H 3ULVF 5LXGH 2OL3B 1L9NA 2GTZA 5TF1H 1X3DA 4UIMA 5EU5A 1VFOA 3VDAA 2Y5TA 2JJTA 5EC2A 1X5XA 2ICWJ 3I85A 3S36X 3PHQA 3RKDD 2OYPA 1EVTC 4BFIA 1D7FA 3Q3GA 3ABZA 2F9BT 5E99L 5JQHC 3OPZH 2E3VA 4WWKA 4XX1E 3UAJC 3KPLB 3LQAH 4LOUC 5KW9H