4HS3A

Crystal structure of h-2kb with a disulfide stabilized f pocket in complex with the lcmv derived peptide gp34
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
276
structure length
276
Chain Sequence
GPHSLRYFVTAVSRPGLGEPRYMEVGYVDDTEFVRFDSDAENPRYEPRARWMEQEGPEYWERETQKAKGNEQSFRVDLRTLLGCYNQSKGGSHTIQVISGCEVGSDGRLLRGYQQYAYDGCDYIALNEDLKTWTAADMCALITKHKWEQAGEAERLRAYLEGTCVEWLRRYLKNGNATLLRTDSPKAHVTHHSRPEDKVTLRCWALGFYPADITLTWQLNGEELIQDMELVETRPAGDGTFQKWASVVVPLGKEQYYTCHVYHQGLPEPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords H-2 class I histocompatibility antigen, K-B alpha chain
publication title Peptide-independent stabilization of MHC class I molecules breaches cellular quality control.
pubmed doi rcsb
source organism Mus musculus
total genus 77
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2012-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hs3A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4hs3A01
1X4ZA 3PHOB 1NBVH 3QCVL 1NFDF 3VMNA 4AENB 1TPXB 4O51B 5DHYB 5FO8A 4RIRB 4XPTL 4URTB 3VI3E 3O3AB 4G9FD 2XIDA 5CILL 2B0SH 3QDGA 2X4TB 2VE6B 3B3IA 5HI3C 4BQ6A 4YEEA 1MCNA 1DEEB 1FFPB 3T3MF 3SGKA 2DLHA 4Z76A 1CVSC 1MWAA 3ESVF 4JDZB 1JYNA 3MNVB 5F3BB 4QOKE 1AC0A 1CDBA 3KR3H 3C2AL 1PDKA 3D3VB 3OG6B 3SDYL 1OOAA 4WNQB 4HUMB 5I6XC 1UADC 4IMLB 3V0VB 3HCVA 5TQ2L 2FBJH 5EUOB 3KAAA 1MLBB 1NCCH 4H1LH 3QJHB 2SEBA 3DMMD 3RL2A 3H9SD 3MRKA 3QCTH 4P4RB 4XNQA 4MA7L 4OQTA 5CJBA 3LS5H 4FMKA 1XF4B 4F7TA 2OX5A 4Y4KA 5ID1A 1OB1A 1UWGH 5GS2H 1QHPA 4DJMA 1NGZB 4HHAB 3F7YB 4F9LC 5E2TH 3VFVB 4JHZA 5GGVL 1G7JB 1IEAA 2Z0BA 3QDMA 3VH8B 4XXDA 3ULVL 2XFXA 1P7KB 4MQSB 1QR1A 4L9LB 5F6IB 5DS8A 3BGMB 4QOKD 4HX1B 2YPVL 5T3ZL 4PJHF 3FB7A 2L4OA 4HWEH 3WS6C 5CSZB 1HQRA 3F62A 3MV8B 2YC1A 3QO1B 4U2YA 4WI6A 5D7KE 2V9QA 3FTGA 3CSYA 4Y2DA 4LASL 5IHUL 3P4MA 1S7UB 2XWBA 2VAAB 1KB9K 5JQ6L 1HXMA 3QXAB 4DFIA 5MP6H 4FQIH 4S1QL 5D7SL 3IXTB 3TBWB 2D9CA 4P4KA 3T4YB 4LLYA 4BSVB 3AFLA 3T4AA 4PJ8A 1GAFH 1S78C 4G6KL 5CJXC 4H8WH 4NUJB 4Q58C 1KOAA 4X7SH 2CDGA 4LQFH 1KB5A 4F8QA 3MRGA 3UDWA 3KPOB 3ZKQD 2K3TA 3EYSH 2QQLL 3I6KA 5D7KD 3BHBA 2GCYA 5DQDH 3V4PH 5C71A 5I1HL 3CMGA 3K3QA 3OPZH 1RK1A 1R3KA 4NWTL 3WN5B 4KRPC 4P46C 1KIUA 1H3XA 1I1YB 5C86A 3ULSA 3VDCA 3FZUC 4PRDA 1A14L 15C8H 4PJXA 3WFHB 5LVEA 3BYTA 3VGBA 1FZMA 4RAHA 2OXGA 4ZQKA 4FQHA 3AREB 1ORSA 5HGBB 1YEFL 1IARB 3SE9L 1DANU 5DK2B 1T1ZB 4F7EA 1D9KC 1MJUL 4P5MB 5BCAA 1UGNA 3EYFA 5EUOF 4L4TA 2HJFA 5DRZB 4U6VL 5F7LB 3BRDA 1EH9A 5JW4M 4BH7A 1BBJB 5DC4B 1AKJB 4M43H 1IEHA 1EEQA 1RJYA 3D39E 1MFEH 1B0GA 1T7WA 3D87B 4UINL 4P9HH 2AKRB 3GMNA 1T1YB 3KLAB 2A6KA 4ODSH 5SX4I 4WGVB 5ESQA 4IJ3B 1LO5B 3OB0H 3TA3B 1JGLH 1OTTC 5H35B 1ORQB 3HAEA 5DK0B 3K80A 1SYSB 5I71B 1HINH 4OF0A 2J12B 4QHUB 3SDAB 3BH9B 5D2LA 3WIFB 3PL6B 1GYAA 2KZ1B 3GMQA 1RHHA 4JJ5A 4YGVB 3FCTA 5AZEL 4JO2L 3NABL 1K4DA 2CSPA 1JMZA 1JHKL 4IMKC 5ESVA 1U41A 4JQIL 1LEIA 4EQ2A 4HFWA 3E8UL 1F90L 2DQIL 1MH5A 1T3FB 1QBLH 2V17L 2DI9A 2CR3A 3RX8A 4X5WB 3IETA 4PRID 3CFEB 1RFDH 1X9QA 3EOBA 1M1SA 2DKMA 2GUOA 4JPWL 2APWA 3QFJA 3WIHL 1BFOA 3ULUL 3HB3D 3RWCA 1U95A 3MUJA 2FX8H 3INUL 3VGEA 3TNMA 3WFDL 1T1WB 2PYFA 1JHLL 3FO0L 2N56A 3MV7D 4FTVB 1I7UA 3EHBC 3ARDC 1JZ8A 3C6SA 4KQ4L 4OTXH 2AGJL 1MHEA 3MRNA 3MGAA 4D9QE 4JO3H 4GAGH 2BVQA 2E7LE 2X70A 5IB5A 5KVGL 2YD2A 2EKSA 2W0FB 4FFYL 2HVKB 1JZ5A 1UQSB 2BXZA 4B50A 4WRLA 4MWFA 5IEHA 3EDDA 5GZOD 3BKJH 1BBDL 4XCYB 2IBGA 2A0LC 4F7PA 3MX0A 4J3OC 4JHAL 3BKML 4CU7A 2NQCA 3HZMB 4RAUB 2NY1C 2GSIB 5GS0C 1IL1B 5E9DE 2NY4C 4G6ML 2VDQH 2FCBA 4YK4B 1FO0A 3V5DA 1EVUA 1BVLB 4HS6A 4NNPH 3N1MC 1AGEB 3I6GB 1DL7H 1GIGH 5EH1A 4NOFA 3MA7A 3O6KL 4L4VE 1FLRH 2MHAA 3MLWH 3MOBH 1QHOA 2X10A 4GT7A 5KS9F 1YMHA 3SCMC 1VKXA 2OYPA 3RIAK 4EN3A 4V1DA 4XBGB 1BMGA 4JQXC 5IWLA 4D9QD 4NQCD 3O6FA 3KLSA 1F4YL 1NANI 3D85A 4JO1H 5CP7B 3OJ2C 2D2OA 3VGAB 5F21B 3PGCB 1NUGA 4CN4A 4LCYA 1JGDB 4DVBB 4FNLL 4MA3A 5HYIA 3VXOB 1AY1L 2G5BA 1XF2A 3LD8B 3V6OA 3IAPA 5HHMD 4J4PC 3CZFA 5E9DD 5IK3A 4N5ED 3JUZA 3CFBB 2CJUH 2F74A 4ZS6C 2C1PA 1HKLL 3Q3GA 1HXYA 3NFSH 2F53E 4P2QB 25C8H 4WW2A 3HC0B 1H3UA 4L4VD 2AXGA 3MRLB 3VGHA 2NY3B 4N9GA 1DLFL 2JCCB 2VISA 5I1GL 4JFFB 4F37F 1FZKA 4UAOB 2EC9T 3O11A 1NL0H 3SDXE 4Y5VC 1Z0NA 4OZFA 1NCTA 3B2VH 4KDTC 5EU3B 1MI5D 3NFNA 4KJQD 1S7WB 3T77B 5JA8B 2DIAA 4M7JH 1I1AB 1UCTA 3CMOH 4Q9QL 2GTZB 3GSXA 2X4OA 3KJ6L 5CZXD 4GKOA 1OGAA 4LNVA 1UJ3B 1CF8L 3UX9B 3UTSE 4GKZA 1YECL 2R9HD 1T1XB 3F7PC 5DJXB 1VERA 2IGFL 4JGMA 5IB3B 1W8NA 2FJFA 2F53D 1IAIH 4Y1AA 4LLWA 5D8JH 4GBXA 1E6OL 2CLZA 1JFMA 1LP9A 1BOYA 4OCRL 3ZDZF 4PPTA 3GUTA 2P5EE 3G04B 3JV5A 1B3JA 4X6DA 5B3NA 3ARBA 4QKXB 3VFPA 1Z3GL 4GRWF 3LN9A 3SDCA 2UWEA 2LQRA 4IRSB 4XCCH 1OAYH 1ZTXH 2FJGB 1WWAX 1A1OA 3TJEH 2DQHH 1GGCH 4LHQB 4DGVL 1KV3A 1JYWA 3GSRB 5ENWA 1A2YB 2W9LA 3P77A 5CMAB 2FBOJ 2DS4A 1FFRA 4OF6A 2FLRT 3O2DH 1FC1A 1U8PB 2O5ZL 1YN6A 1NDGA 1A7BA 4EBQH 1FL5A 4PR5B 4ZSOB 3CD4A 2P8MB 1KGCD 3TN0B 5F3HA 4C56B 4N0CA 3VXSA 1U8MB 4GRMA 4LPXA 1HILB 4PRBA 4QRTB 1AHWA 5CWSA 2R0KH 4AIOA 4OAWB 1FVEB 4Z7QE 4P9MH 1FFOA 1ACZA 2ITDB 1OL0A 3EIFA 5TDPB 1FHGA 5I75B 3KWWA 4XAKE 3FT2A 2XQYG 1E28A 5A2JH 2X41A 2P5ED 5D6DA 3VXUB 4JO4L 1YEHL 2IEPA 4OBRA 5DMGC 3QIWA 4QRQB 3RWDB 3PE9A 3KYOB 3TV3H 4KUCF 2O93L 4JREC 3RPIB 3T0EE 1LK2A 1I3RB 5ITBL 2FYYB 2IANB 4NO0B 3FFCE 4DWHA 4UILH 1TVHB 1ZVSA 4IS6B 3L3JB 3VXNB 1EHNA 1X5ZA 4NQDA 2XA8H 1PAMA 3VXQA 4H25B 1QSEB 1FNEB 1JNNL 2Q76A 2AK1L 4F9PC 4KKBC 3T0DA 2BOCA 3MRBB 5F8RC 4TPRH 6CGTA 3CPLA 1XF5A 2NY0B 2BSSA 3SDDD 4K9EC 3STZB 3VFSB 3HRPA 3ZSTA 5D7JC 5DQ9B 3LKSA 3MJ9L 4MAYD 1IC7L 4JJHA 3SJVD 1A7QH 2VABA 4JFEB 5E2VL 1H3TA 3IFLL 4NRZB 5A2IH 3OGCB 5DRNA 4K71B 4MJ4A 4GRWH 3RA7L 3R06A 1YA5A 4OFIA 3EZ8A 3N50A 3NPSC 4X7EC 5GISH 4EDXB 1KJ2A 4BSWA 2WQRA 1SEBB 5IB1A 5T1KA 3T0ED 4KC3B 3RX5A 2LAGB 1OAUL 1B88A 2OTWA 5FYLH 4AIXA 1EBPA 3X12B 5E5MA 4YBQC 1SM3H 1F2QA 4Y16B 3L5HA 4GQ9L 4L8SB 2EIZB 3KPSB 2G9HA 4XMPL 1S7RA 2ZPKL 1MJJB 3BMVA 2VUOA 4G8IB 4G42B 4D0DA 5D2NA 3PP3K 2ZUXA 4A6YB 4JY5L 1JGVL 4PJGA 5CHNA 5TE6L 5KZCD 4UV4L 1YNLL 3S35H 3WNMA 2A9ML 1NFDE 4FABH 5BMFL 5KSBB 5JHDA 3E6FA 1I4FB 1A3RH 1BGXH 4N8CL 3EO1A 4OCWH 4TSAH 3DXAB 4GO6B 3JWOH 2Z31A 3HPLA 1MRDL 2UVFA 3LMJL 2VQTA 3LQAH 4M8QA 5LKNA 2YD6A 3DVNB 3G6AB 4X80L 4WV1A 3LEYL 3OKDB 5TDOB 5AYQA 3T3ME 4S1DD 2WLZA 3FB6B 4FXGB 1IBGL 2E8ZA 5M94B 2H26B 1ADQH 4KRNA 4X6CA 3G9AB 1YNKH 2ZJSH 4AYFA 3GB7B 4NT6A 2A83B 3C9NA 3GJFK 5K93A 2V17H 2HTKD 5L8KB 5ETUB 5HHOD 5FKPA 3V4VH 4NFCA 1NFIA 5I17B 3BIKB 3QNZA 1U3HA 5F7HA 4KVCL 3OF6A 1YEGH 4LRNL 2DQGH 3WL9A 3IDNB 1IE5A 3VG9B 3TPUE 3PWNB 4WUKH 2PW2A 4IRJD 3HUJA 4FQ1L 2DLFH 4MHHG 1G84A 2NX5B 4C4KO 4J2XA 3HI6L 3QQ9C 1BQLH 3O0RL 2G60H 1DBKL 1YNTA 1MAML 3VXRE 3QDGB 5D72H 3T2QA 1H0DA 3B3IB 4H1LG 4U7MA 1T66C 1JYXA 2GJ6E 2BJMH 3GIVB 3JWDH 4IBLT 4R4FH 5T3XH 3MR9A 1KTDB 4PTTA 4YDJA 3K4ZA 1MWAB 2EYSA 4LOUC 1MFDH 1NUFA 1FIGH 3KHQA 3HCVB 3QDJA 2NNAA 1AE6H 4PRPA 2R4SH 5I2IA 2XPGB 2DIJA 3BW9A 3RL2B 1AXTH 1NSNH 3DV4A 3MRKB 1NEZA 2AK4A 4YWGH 1SBBA 3OKLA 2RCSL 3MLRL 1I7ZB 3RRQA 3S35X 1WZ1L 5D1XA 4ZS7L 4YIQA 4Y4KB 3U4BH 3IF1A 4E41E 5E6ID 6FABL 5ID1B 5L8JB 5IFJB 1N5YL 5I1DA 5KVFH 1NC2A 5CKAA 3O4LE 4N0RA 2ZCHL 2ZUYA 3ZTJH 5L2KB 2C3VB 4JANA 5KSBF 4HPYH 1RJCA 4Y4HD 3HI1A 2GJ6D 3PWPD 2BY0A 2XFXB 1EV2E 4ZOAA 5C9JA 4KFZC 4NN6B 1QR1B 3P0VH 4JKWA 3QPXH 2FL5A 4NGHL 4PJIA 32C2A 3RFZC 2GK2A 1GZPA 4TOYL 3BT2H 4OT1H 4KI5C 5ALBH 1KACB 1XGUA 1BIIA 4DK6A 4WI5A 3FAWA 2HKFH 1NMBL 3D3VE 4Y2DB 4X9HA 1PGRB 3IJSA 5I1IL 3P4MB 1RURH 5E08H 2P5WA 3MBEA 5HGHA 2X4RA 5EUOE 3VXTA 5HSFA 1LGVA 1HDMA 4UTAL 2XOTA 2H2PC 4PJ7A 1HXMB 4P59L 1FAIL 1BPVA 1MCIA 1Q9LB 4ZMAT 4XZUA 3REWA 5C2BL 4M9OA 3H9HA 3OHXB 4RX4A 3L5JA 4P4KB 4LLYB 3T4AB 4HIXL 2BVUA 4X7FC 4I18A 4P2RE 3U4AA 4QRRB 2CDGB 2FIKA 1EDQA 1TZGL 1KB5B 3G08B 2AJYH 2K7PA 3KJ6H 3MRGB 5DT1H 1DBMH 1N6UA 4PYHA 3TM6A 2M26A 3QXVA 1B4JH 4EEEA 2NY2B 2YS4A 4YHML 1CLYH 3I6KB 3NGBC 3BHBB 2GCYB 3N06B 3UAJC 1Q72L 2VXTL 3D3VD 3OR6A 5I1CL 1NMAH 5DO2D 3CXDL 1RK1B 5HYJD 3MV8E 5EORH 1MCHA 4BZYA 4OM0L 4NHCH 2VLKD 5C3LD 1QKZL 4FQ2L 1WEJL 1UKSA 4A6YH 2CDFA 3UTPE 1FZMB 2E27H 3BQUC 5E8EA 2HJKA 5DJAB 4EVNA 2CMRH 5J11C 4DW2L 2P4AB 1XR9A 4ELMA 4M7LT 1QSFB 2JLLA 4S1SH 5HD8D 3HE7C 4GMTH 4WDIA 2ICEB 4N1CA 4TUJA 4F7EB 5D70H 2IF7A 5C1MB 3I02A 4P2RD 2C3WA 3S3SA 4ZAKC 5GIRA 2EDXA 3HZYA 2F5AL 4LSUL 1U58A 4C54A 5C2UB 2WBWB 1RJYB 1BJ8A 2J6EL 4AM0B 1NMCB 2IH1B 4OLXH 5KVEL 3LQMA 1BZ7B 2A6KB 4ONFH 4XB7A 4UQ2A 5EWIL 2AEQL 4LSPL 3BN3B 3AM8C 2RJMA 3MV8D 5ESQB 3P4NB 2QR0A 4ZPVA 2YXFA 4YR6A 3T2PA 1J8KA 3UTPD 1UH2A 1H15A 2EECA 3N85L 5JXAH 1QFUL 5I9QB 5D2LB 1U0QA 2Q8BH 4HMEA 2XXMB 4RGNC 4BQ8A 3GMQB 1RHHB 1DBJH 1DUYB 3FCTB 5FM5M 4QEGA 2DLIA 1K4DB 2FDBP 2GKIA 3FN3A 4M7LL 4PGDA 1QOKA 5HI5D 3IGAA 5ESVB 4BK4A 4ONGH 1CCZA 2VLJD 1LO0H 4N1EA 1DCLA 3GJEB 4KGLA 1MH5B 1WCQA 1AO7A 4NN7C 2E7MA 1CL7H 5EDXA 4YNYA 4NO2B 4MNQD 3IETB 4NPYB 1FGNL 1JZ3A 3EOBB 5TPWH 2GUOB 2R0ZL 5FO9B 3RP1A 4WHYG 3QFJB 1K85A 1BFOB 3MUY1 1LDPH 3RWCB 1ZGLB 2D7TL 1U95B 2FO4A 2ARJQ 4UIKL 4Z95H 3TIEB 4M7KH 4MMZC 1CZ8L 4I0PC 3T1FA 1VEOA 1U36A 4PJFA 3VFUB 5F96H 5E6ZA 2ZUSA 3ARED 3VWJD 4Z0BL 4O5LL 5B38A 2NY5L 1A6WL 1JZ2A 1MHEB 1PYWA 2RIKA 4M61A 1JYVA 3FRPG 2LAAA 2BVQB 2OXHA 5C09A 2X70B 3PWLA 4PTUA 5IB5B 3WKMH 4AMKL 3C87A 4O2EB 1N6QH 5CSGA 4OLWL 4R4NC 3BKCH 2VXUH 3WEXB 1GGIL 3ZDYF 1MAKA 1OTSC 4KHTL 4MZ2A 1HI6A 4MWFB 5IEHB 1AKJD 4M4PA 1RD6A 2ZZUT 3G5XA 4F7PB 1R24A 3H7BB 1GGBL 2E9BA 3MLVL 4LKCB 4KXZH 1EA9C 4QHMA 1OM3H 5I1AA 3HZKB 3VWKA 1FO0B 3GI9H 3V5DB 3QUZD 4FQLL 4HS6B 3EO0A 3BDYL 5KJRL 3TA3D 4HZAA 3MA7B 3ARZA 4LVNB 4U3HA 1YMHB 1N4XH 3QUMB 1VKXB 2O5YL 5DRWB 1INEH 5HY9A 3WIIL 4V1DB 3TVMD 1EHLH 4FTVE 3PL6D 4POZC 4MVBC 3D85B 4JQVA 3RTQA 4AK1A 5GRXG 4KTYA 3MCLL 4LLUA 3H8NA 3RVUC 5T3ZD 3GFUA 3H0TA 4YFDB 1GPOL 1IGCH 4LCYB 3OXSA 1WZLA 1IGFL 4MA3B 2G5BB 3QCUH 1FL6A 4PLJD 5C0CD 1XF2B 4DCQA 1JF5A 3CZFB 5IK3B 1QR4A 3D0VA 2F74B 1EVTC 1S7QA 5HHXH 1KB5H 2C1PB 4HK0A 3LAFA 3VFOA 1HXYB 1JN6A 3IKKA 4XWOD 4G5ZL 4OD2A 2EXWC 2AXGB 1AC6A 3OAUL 4PG9B 3E2HA 4N9GB 4OLVL 1NGPL 1YEEH 2VISB 3B9DA 3HKFA 4P23A 3W9DA 4M93B 3VD4A 1FZKB 5ICYA 2X2YA 3LDBC 2AXHA 3WO4B 5FYLE 3WHE1 1YJDL 5C6TH 1R3JA 3LS4H 3RQ3A 3EYQD 4OZFB 4KV5F 2X9YA 2OK0H 3A6BL 3O3EA 3UCRA 1T7XA 3GSXB 2X4OB 4NP4H 3CU7A 3O9WD 2ZUWA 3OB8A 3BZFA 3V0AC 3T08A 2XNAB 3WDIA 5BVPH 3HFMH 4XCFH 4Z0XA 4GKZB 4NKIH 2JELH 2HN7A 4L3CB 4MMXC 1RPQA 2J8UA 3T09A 2D03L 2YUXA 4Y1AB 2XG4A 3MJGX 4LLWB 2R2HB 4LKXB 2CLZB 5TE7L 4HBCH 4NJAL 5EOQL 1H8NA 1LP9B 4AL8H 4P2QE 3GUTB 5FYLD 4HF5L 4QGYA 4X6DB 3ARBB 4G6FB 3VFPB 1VFBA 5GGVY 2RB8A 2JCCE 5F72S 1QYGH 3SDCB 3GSVA 2E7BA 4MA8H 6FABH 1A1OB 2LTQB 1DEDA 2YBRB 1KB9J 2E9IA 5ENWB 4KAQH 4Q74A 2B4CH 3IDXL 3P77B 4YZFF 3CVIL 1P7QD 4U1NB 3BESR 4QXGH 2FJHA 3K81A 5DXWA 3DX9A 1MCWW 1YN6B 1NDGB 1G7QA 1IEBA 4X6EA 5JNYA 4HQQL 5F3HB 2VDRL 3VXSB 4GRMB 3GNML 4PP1D 5DD0L 3W11C 1WIPA 1QLRB 2L0DA 2YMXH 2D7MA 4KUCD 1EO8H 2QADD 3HS0B 2V5MA 1H9VA 1UKTA 3PHQA 5DZNA 5IQ9B 4Y8DC 4FFVD 3KWWB 1HK6A 3SEPA 5I30H 4S1RH 1E28B 1OW0A 4BH8A 4TQEH 2NY3D 4WI4A 4HIIA 4JHBA 3QIWB 2AEPL 1Z2KA 4LCUB 2Z9TA 4MNGE 5C2BH 4PJEF 5T3XE 1LK2B 4OCLC 5I1JL 3LOWA 2X44D 1KCRH 1EEYA 2A73B 2VL5A 4ISVA 5ISZD 4N68A 1CTNA 1ZVSB 1I1AD 1RIHL 1WSST 1YEIH 4NQDB 4XMLH 5HYSA 5KSAD 3IAGC 2VWEC 2R2EA 1BWMA 3FB8A 3UYOD 2BOCB 3PV7A 5DVOA 3DRQB 3HI5L 5AYUH 1Y18A 4OKDA 1U6AL 4ETQB 5DLML 2WMPA 3KPTA 4AEIL 4S0TD 3VMPA 4ZSOE 4ZFGL 4Q9RL 1DBBH 4K3DH 2A9NL 3JVGC 3LKSB 4C56E 5I71C 1RMFH 4M03A 3WE6A 4ZTOL 1I9RH 2X4PA 3SDAC 4Q6IC 3ARXA 5L7XL 2PXYC 4OM0H 1FNHA 3HNSL 4N8PA 4FQ2H 4A2LA 3R06B 2K9UA 4YUEH 1D6VH 3RPKA 1M05A 1N64L 4LU5L 1VGKB 1KJ2B 3MJ9A 3VXUE 5T3XD 4BSWB 5T1KB 4UBDC 4OIAA 1SJHA 2ATPB 5F71A 1ITBB 4QT5A 4WJ5A 2Z8SA 5E5MB 1I1FB 1S9XA 3QUXD 3QUMH 4C59B 2IANE 5KOMC 1M6OA 1CG9A 2IMNA 1S7RB 5GS3A 1WGOA 4QRSB 4M7ZB 1MCOL 4D0DB 1QSEE 5D2NB 3I2CL 1RI8A 3VW3H 4UT9L 4WTWA 1UM5L 2RAMA 2LU3A 4RQQB 5D1ZC 3MUHL 1WBZB 5EZJB 1K5NB 4UB0H 4XNXH 2VDLH 1WC7A 2Z31B 5ESAA 3P0YL 5CZVH 5CAYB 5BOPA 4LARL 3D69A 1MELA 4WV1B 3N85H 1SY6H 5LGKA 4NQXA 1MVFA 2F8XC 2P24A 4JRYA 4Y5YA 3RJQB 2V5YA 2I27N 4PJDA 2YZ8A 1G0DA 1U8JA 4X6CB 4M7LH 3DVIA 4R7NA 5I19H 3B5HA 5IBLD 4JM2A 1GC1H 4NO0D 3HNVL 4NT6B 3BO8A 1MFAL 3C9NB 1AXSA 5HPMB 3BFOA 4KZDL 4KUZH 4OZFH 3C5SA 4KTDH 3KPSE 4ZFZA 1EJ6A 2YD7A 4YK4C 5F97E 1MF2H 1F97A 5D1QC 1T5WA 1UM4H 5FKPB 4JPIA 3IDYC 2RFXA 3IU3A 4FFWC 3CDYA 3TJHC 2VDMH 2Y1VA 3U30C 5AD0A 3QNZB 1U3HB 3BEVB 3SPVB 4BZ1H 1K6QH 5KSBE 2P46B 2Q20A 4TSCH 2PW2B 1OARH 2OR8A 3DXAE 5E99L 1FN4A 2R2BA 3HUJB 2F54B 1XGRA 1DR9A 2HLFC 2WM0A 2YPKA 5FK9A 1SJEA 1IJ9A 2VXSL 4Z0BH 2BNQB 2FX9H 3VGAC 1A5FH 5GRVL 1AJ7H 4BKLB 1Y6MR 4MB3A 2Y5TA 2B5IB 1YNTB 4OCYL 1UB5A 3IFNL 1UWXK 1H0DB 2EDOA 1P4BH 4XPGL 3LD8C 1ULVA 2GSGA 4OLWH 2I60H 3MR9B 3CUPA 4YDJB 2AAVA 2EH7H 3LKQA 3MRQA 2W92A 1PKOA 5F1SA 2QV2A 4YHZH 4OKVA 3U9UA 3GZKA 1L0YA 3P9LA 5GRJH 3QDJB 1PY9A 1S5HA 5B22A 5IBUB 4PRPB 1TQBC 2DMCA 5I2IB 3AXLB 4XCNB 4LIQH 4UAOC 3ZTJG 3O6LH 3RY4A 3BRGC 1KC5L 2E6PA 3HC4L 5IBTL 3NIGF 2DQUL 1BWWA 2YEZB 4WEUD 4ZD3H 1NEZB 1QBML 2AK4B 2D31A 4NNYA 4XP1H 4GAYB 4GAFB 4HFUH 5TF0A 1HSAA 3VG0H 1ZHNA 5H37G 3L1OH 1CXIA 1FH5L 3CNKA 5C0AA 2XN9D 5LCVH 2H41A 1TTFA 3SGEI 1HHGA 4RFOL 5JXEC 2NX5E 2AJUH 4LF3A 3ZKMC 1SVCP 4JANB 1S7SA 3TBTA 2FEEI 3AAZA 3L6FA 1U3ZA 3HI1B 3QIUA 2H8PA 1N0XL 5C9JB 2OP4L 3QDGE 1HCVA 5TQ0H 2FL5B 3B9KC 4PJIB 5ANMA 3E0GA 3TO4A 4FP8H 1J1XH 1I3GL 1GZPB 4KDWA 2XY2A 3SE3A 3VJ6A 4ZFOL 1K8IB 2VLRD 1XGUB 1BIIB 3MNZB 3NCYP 2WNGA 3F5WB 3QH3A 4FZEL 4OZHA 3FO1A 4HLZH 4X6CF 4WGWB 2JJUA 1BVKA 3MBEB 1J86A 3QNXA 2X4RB 4R4BB 4IRSC 3U1SH 2ADJA 1HDMB 4U6HA 2ERJB 4Z7NE 2B8OT 2IWGA 4Q2ZA 12E8H 2Z8WC 1ZT4A 1FGVL 5F70A 4UOW0 5MENA 5LGHH 2NX5D 5D6CA 2H32B 4TRPL 4HGMA 4DKFH 4K94H 4HWBH 5GZND 4I18B 3PXHA 2V2WB 3BZDA 1N7ML 5L2KE 2FIKB 1TJHL 4XC3H 1OT2A 4LVHC 4M00A 4Z7UA 1MCBA 1BOGA 4BM7A 4HUXA 2D0HA 4GJTB 3LH2H 1KENH 3NVQA 1ZHLA 4K3JL 3OR6B 3SKJL 2HMIC 3TIDA 3WLBA 1JHTA 1P84K 5F7EH 2YKLL 1MY5A 1Q0XL 5A2FA 5KSUA 3QRGH 1FAKT 2CDFB 5TH2A 5E8EB 2HJKB 5IEKB 4EVNB 1KPVA 2VDPL 4HF5H 4ELMB 3IJYB 1FL3A 2BVEA 1DE4B 4WDIB 2WW8A 4TUJB 5IP4A 1NCWL 5FF6A 4WFGE 3RNQA 3I02B 3WNNA 4JLRA 4NUGL 3NBNA 4WTZA 5L2KD 2R69L 3WFBL 4X7CC 5GIRB 2QSTA 5EU7C 2W1NA 3A67H 4GW1B 5KAQG 1WCBA 2W65A 1U58B 1MFCH 2NY0C 4TULH 4QRRE 3AGVA 3C08H 1XEDA 4YDIH 4MJIB 3LKRA 3V6ZA 3B2UC 4PB9H 4UQ2B 3MRDB 3HMXL 5DD0H 4RWHA 2XRAH 5BV7H 4PJ9B 5TE4H 2IAMD 2QR0B 4AQOA 3ZTNL 4R3SA 4ZPVB 4YR6B 2KDGA 5INCA 1IM9A 1VCAA 1KFAL 1CGSH 1H15B 2J6EA 3OX8B 4AG4L 1B6DA 1ZOXA 2C3XA 4HUKB 4JZNA 3ZDYE 2HT3C 5JORA 2Y9RT 4OJFL 1CFQA 1SQ2N 4OGYL 4Y16C 1DQDH 1RQ5A 4OLYH 3IT8D 1QSFE 1VFOA 3K2UH 5I1EH 5C7XL 1RUAL 3IGAB 3LKPA 3QIBC 4FN0A 1YY8B 4EI5D 4GRLB 4QRRD 5EU6A 3OXRA 3GSNL 4WI3A 5EBWA 1AO7B 4YNYB 3HZVA 2NY2D 3DETD 1QLEH 4GXUM 2ADIB 1QA9A 4PRHD 2BERA 4K3EL 4K23H 3D2UA 2FO4B 3D18B 5I1KH 5C0JB 3QG7L 5JR1L 4CVUA 4GS7B 5L0QC 1RU9L 4NQSA 1T83A 4PJFB 1RZIB 2X4UA 4XWGL 2X7LA 1CD9B 4MCZA 5B38B 2CK0L 1QSFD 4QYOA 5I18H 1PYWB 5D2LE 1WIUA 5C09B 3MRJA 3PWLB 4PTUB 4UNUA 1RV6X 3PJSB 4LLAA 4NO3A 4K7PL 3UTTD 2A6JA 3WUWA 3PQYA 1KCUH 4ERSL 4Q9BA 1HI6B 2OMBA 3G5XB 4RISL 1R24B 5FHAH 1RZJC 4CUCA 4ELMF 3DGGA 4H88L 3T8XA 4LCWD 3VG9C 4QHMB 1LE5A 5GGRB 3RL1A 1L7IH 1UXWB 3QFJE 4OF7A 3M17B 1G7PA 3JTSA 4M6MH 2H2SD 3LSOB 3CVHB 3GRWH 5F7WC 1NJ9A 2DD8L 4Q0XH 4EXPX 1G7LB 2B1AH 5HY9B 4MCYA 3MLSL 4W81A 3HB3C 4HS8H 2DWDA 2HWZH 5JW3L 2Q6WA 3RTQB 3SGKC 5IMOA 2H1PH 2APBA 4LLUB 1CGTA 2L7JA 3WCYA 3H0TB 4PYGA 2R1XA 3S98A 3DX7A 1CGWA 3GK8L 2H32H 4XP6L 5EA0H 4KZDH 2MPAL 1W72A 3DLQR 1T2JA 2W60B 4O02L 1FL6B 4I3RH 4APQD 3LEXA 3VFTB 3O3UN 4Y4FB 4WFHD 5AG9A 4QNPE 1QSZA 4HKXA 4HK0B 3VFOB 1QACA 3L3IB 1JN6B 5BZWB 1DVFA 5J06A 3RKPA 1R5IB 1CQYA 1CE6A 3NAAL 2N7BA 4OGAC 1HNGA 3RGVD 3W9DB 5F9WC 4P23B 5ICYB 2FEEL 3BAEH 1BAFL 5CSBA 2FEDD 5DMKA 5GGTA 1UWEL 3U0WL 4L1HA 3RWHA 1CLOL 3BWAA 5EC1A 2W9DH 4V1DE 2DIBA 3O3EB 3FRUA 1MHCA 2QQNH 3Q48A 2R29L 4JG1L 5LQBH 3RWJA 3BZFB 1OTUC 3SCMA 3VFRB 4ENED 2A1WH 1VFAA 3CK0H 4HIJA 5DUPH 2HN7B 1NCDH 1B0WA 1EGJL 3KLHD 5GRZA 1MJ8H 1XIWB 1ODAA 1JPGA 4O58H 3V6OE 2D0GA 1F02I 3VGGA 3VXMA 5DK3A 3HAEG 2VDKL 4P4KC 4I8DA 5IG7A 3O41A 4PJ8C 4H5SA 1VFBB 2E9WA 2XTJB 3MGTA 1G9NH 2DWEA 3GSVB 4N5EC 4RBPK 5HHPA 4GW4B 3BUYB 4XHJD 3S88H 3BE1L 1KXVC 4MD0A 3UDWC 4G3YL 3D85D 4S0UC 2XQBH 3J8F7 2XWTB 2BSTB 3RGHA 5DD6A 1KLFA 2ARJA 4NKOA 4CDHA 2FJHB 3P11H 4KTEH 2BRQA 5JNYB 4OSUH 4LVOC 2D7QA 2ADGB 5DJ8A 5GGSB 2A6DA 4NKDA 5F88A 3PV6B 1NBZA 4BA8A 3CJJA 1A7PL 3PHQB 1IQDA 5CZXC 4ZUTB 2B2XL 4GXVL 4JPVH 2LE9A 3MGOB 1C1EH 1GZQA 1LO4L 4Y1AE 4PB0H 4XMKL 4GSDH 1W0YT 2R9HC 4BH8B 4I4WA 4HIIB 3PIQA 1LP9E 3RJDA 4GMSH 1SBSH 3R1GL 4X6DE 2HG5A 2V7HA 4P2OA 4DKAA 4OZIA 4LCCC 3MQIA 3V0WL 1EEYB 2VL5B 2DLEA 1NMCC 4GAJL 1NGQL 1N7MH 5HYSB 4U1MB 2DQCH 1H5BA 3VD9A 2R2EB 4F58L 3FB8B 5F9JB 1Y18B 3L7FB 4LIQE 1CE1L 4YEFA 2B1HH 3CGTA 3VXSE 3S5LA 3O3BA 2AQ1A 3TZVA 2X4PB 3UYPA 1KN4L 5E1HB 4PUBH 4KJPC 3BH8A 3RVXC 5CCKL 1H8OA 3U9PL 3STBA 3ZDXE 1DSFL 1KN2H 1M05B 1OWRM 1NLBH 4N1HB 3RI5F 3T04D 2IPUG 5GGQH 5E8NA 2R1WA 5LWYH 3KYKH 3IXAA 5DEGA 5J6GA 3CVHH 2FECI 4QT5B 1OP5K 4NUGH 1NC4A 1S9XB 1FYTB 5A40E 1DQML 3IFOA 2EDKA 5IGXH 1M6OB 1CG9B 3LRHA 1R3HA 4NQDE 2GW5A 3LN4A 4O2CA 4N90D 4QXTB 2ESVA 3NIFF 2Y6SD 3VXSD 4NFDA 4XH2A 3WD5H 1TQCC 1V7NH 3HMXH 2GFBB 2F19L 4HXBL 3G6DL 5JOEA 3S6CA 5C0BA 3N0PB 5ESAB 3WXVL 4WHTB 4B7IA 5A2LH 5JDJA 1NAMA 2C3HA 5JW5A 4KJYB 5C08B 2VC2L 1DBAL 2XV6B 1OVZA 5E00B 1KIRA 4JFXA 2CKBL 4OZFG 4NQXB 4NJ9L 2RBLA 1YYML 1KJVA 4JRYB 1Q9KA 4Y5YB 2QJDA 1IGMH 3TYFA 3EJZC 4PJDB 4TUKH 3MRRA 1U8JB 1P2CA 3X3GL 3PG2A 4R7NB 5AG8A 4JM2B 1QPPA 4RWYH 4HK3J 1XGYH 3GIZH 3TWCL 2AERT 4IHOB 3NIGE 2C9AA 3SKMB 5DQJA 1AH1A 4XPBH 3C5SB 4ZFZB 1X5IA 4YXKL 4QRUA 4HPOL 2XA3A 3THML 3EKCA 4JPIB 1WF5A 2RFXB 1MPAL 1DTUA 2YK1H 5D2NE 3W5NA 3UTQA 1WITA 5K59F 5AD0B 2FX7L 5GSRA 3H3PH 4EI6B 5FECA 2X4QA 3T0WA 3GKWL 4EN3C 2Z92A 1ES0B 2Y07H 3O6FC 1FN4B 5FUCE 1U3YA 5LXGH 1LO2H 1INDH 1XGRB 1CICA 5F44A 2YPKB 5FK9B 1A7OL 1RULL 1SJEB 3MBXL 4CW1A 5J56B 3OKEA 5E94A 1F5WA 2CPCA 1A7NH 2V5TA 1AP2A 3BP4A 3RNKB 1BQUA 4X6CE 3V6OC 4HJJH 2GSGB 4LPYA 3C8DA 4LEXH 3CUPB 4YGAB 3LKQB 3MRQB 4J3VA 1D5XA 3LY6A 4K3GA 4J3SA 4WW2C 4YHPA 3P9LB 1IFHH 1S5HB 2QL1A 2CGRH 1MCSA 5C07A 3FQWA 2D31B 3CFCH 3WV0A 1UYWH 4MSWA 1ZLWH 4EOWL 1HSAB 2EH8H 2I9TA 3UYRH 4OI9A 4TNWF 4D9LL 2DJ4A 1D5IH 2EEDA 3HUJE 2F54E 4GG6F 4WW1A 4TVSa 4LF3B 3S34H 3WSQL 4JG0L 1S7SB 3BXNA 2BNQE 3TBTB 4QXUH 3L6FB 1BM3H 1Z9LA 2H8PB 2JIXB 3GHBL 4D3CL 4ZNEE 5ANMB 2XZQL 3TO4B 1QLFB 3BUTA 4PJ5D 4H20L 1T03H 4WU7A 4GBXC 3VJ6B 1FPTH 5IVNA 1WIOA 2BX5A 5T33H 5CEZH 4OZHB 1AI1H 4PJDF 3FO1B 3MMEB 3QDJE 4OZGF 3QNXB 5CD3A 5HHQA 4JM2F 3SDCC 3OKMB 3LRSA 1MNUL 3BVNA 1NBYB 2AK4E 5ILTH 1KG0B 4Q2ZB 4ZFOA 5I6XB 2QEJA 1ZT4B 2F54D 4PJCA 5MENB 3WFCL 1T20A 5D6CB 5E95B 1VESA 2BNQD 2BHZA 1ED3B 4XPAL 5SX5K 1A22B 5ID0B 1H3WM 2FZ3B 2ZKHH 1OPGL 1EBAA 3H42H 4N0CC 4ODVH 5FYJL 2VN4A 4QTIH 4Z7UB 2KBGA 1AHWC 1BOGB 4HUXB 1JGEB 3UTOA 2CIIB 2YPLD 3L3HA 4FMFA 3LVEA 1LHZA 1JPST 4OD3H 4PJIE 3NMEA 5FA4A 3B43A 4KWUA 5D6DC 5JPMA 3TIDB 3HE6D 1J0YA 3WLBB 1JHTB 4M5ZH 2WUBL 4JRXD 3QIWC 5GJTH 3IKCB 5KSUB 5EZOL 5DTFA 4JFZL 5TH2B 1D5BA 4IRZH 5MHSD 1HSBA 3GI8L 5GRYA 1FL3B 2UUDH 1G9EA 3VA6A 3IDMA 5IQ7H 4UU9A 2VZ1A 1AQDA 3RNQB 4ALAH 1IAMA 1HN1A 5DUMH 3I9GH 4JLRB 4JKPH 3MLXH 3BSZH 1EXUA 2YRZA 5F8QC 1ACYL 1WCBB 4MQ7A 4HUNB 5SV4A 5EU5A 1G7IA 4Z8FH 4AT6A 1P53A 4XVJH 7FABL 4F57L 1UENA 2Y06H 3LKRB 4U1KB 2YUZA 5CBAA 3VRJB 3VFGH 4NM4H 4BQCA 3ZMRA 4PGZA 2YA0A 4R3SB 1FNSH 1KNOA 5E8PA 5INCB 1RZFH 4L9DA 1IM9B 1ETZA 4HH8A 4XCEA 3MV9D 1E6JL 2X09A 2PUQT 1QG3A 1RAMA 4LGPB 2FECL 2DI7A 1DQLH 4JZNB 3M1BA 4LCIH 3ZL4H 3E6HA 5JMRA 4MD4A 2Q86A 5IROC 3T1WA 4XC1L 4KRPB 1W0WB 3DV6A 4NRYB 2OL3B 5JIIA 2NYYD 1MREH 4ELME 3C60D 1FLTX 3ZYZA 5IB2B 1PSKL 5D71L 1PLGH 3GGWA 4M7ZC 3LKPB 5LBSL 5D2NC 3DJ9A 3W2DL 3BQUA 1IQWL 2CDEA 2GI7A 3CZJA 3GSUA 1QRNA 5F93C 5EU6B 1MCWM 3RVVC 1KTKE 1G9MC 4O2FA 5EBWB 1MRFL 1FFQA 5HD8C 3FMGH 5FUZH 3OAYK 1D9KB 1JI1A 3HZVB 4NWUL 5IBUG 1WV7T 2Z31C 5FUCC 5IT2H 4ZAKA 1LE9A 1QA9B 4F37K 4MJIE 3BEWA 3AS3A 1FRGH 2AXFA 4OM1H 3CC5A 3D2UB 3KYNB 1R5VA 1L7TH 1NEZG 1T2QL 2GY7B 4PBVC 1RZ7H 5L2JA 2HTLD 2HP4A 3GSNA 5IJVA 3DUUA 2C7UA 1KN4H 4F2MB 1EUUA 4M1DL 4LDLB 3X3FL 4NQSB 1WFOA 4QCIA 2X4UB 4LPVA 2EZ0C 3QRFM 2X7LB 3AY4A 4HKBB 1GXEA 5ECJE 2ZUUA 2NXYD 3UC0H 3QPQD 1JNLH 4MQTB 4OIIH 1I9JL 3TH2T 4YHOH 1EMTL 5D4QA 2A6JB 4FOMA 4U7KA 4TN9A 1FZJA 1SYVA 4XNYL 1I7TA 3HNTH 3E3QA 5BO1H 1EJOH 5L9DH 1AO7E 1R5WB 4LEOA 4MJID 3ARGD 2PF6A 3DGGB 5T1LA 2I9LA 4OD1L 5HI5C 2ZOLA 1LE5B 4FQQA 3RL1B 4PJBF 2UZIL 1GGYA 3S37H 4PJ9D 5D7LA 3DSFL 1VFMA 1G7PB 4H26B 5L88L 3MRCB 3VCLA 4HKZB 4G8FA 3I85A 1JGUH 2PR4L 1NJ9B 4HIHA 5F1NA 2DBJA 3I3DA 1TJIL 1LNUA 3X14B 4I77H 3VD5A 5FIEA 1Y0LA 2WLYA 1BQHA 1J88A 2DWDB 3C2SA 2R56L 2Q6WB 3ARFA 4EUPA 2A77H 3T2NH 3VU2A 1IZKA 4OB5H 5TGBA 2BNRA 2R1XB 3DX7B 5C09E 1CDYA 5BRZA 1FBIH 5BS0D 1IMHC 1YEJL 4GRLD 1RUKL 3VWJC 1L6ZA 1W72B 1F11A 4DAGH 1M7DB 1YN7A 4P5TA 2PO6A 5DDHA 2M1KA 5D1XC 5JIHA 2LV4A 4ORGB 5CEXA 5J1AB 5JZ7C 3N9GH 1DVFB 2NW2A 4MHHI 1CE6B 2DQTL 4NSKA 3UO1H 3MZTA 4F33A 4C58B 2W59A 2EIEA 3FO2B 2D4FA 2WUCL 5DMKB 2BVOA 2NY4B 3V5HA 3F7VA 1LD9B 5DJDA 5DSCB 2MCPL 3RWHB 3BWAB 3WKNA 1XF1A 1MHCB 4NCC2 5C09D 2AVGA 1YPZF 1FSKC 2Z91B 4HT1H 3RWJB 3SCMB 2XTLA 3LEVL 1VFAB 1IC4H 4XVTH 4I3SL 4M1GL 4JFDA 4NQVA 2MQ3A 3TVMC 3ULVC 1RZKL 1GL4B 1FNAA 3MBEC 1P4IL 3C5ZA 1QVOA 2MOVA 1QFWM 4Y19B 4ZXBA 2ERJC 1LK3L 3RDTD 3VXMB 2LU7A 3L9RA 3H3KA 3U2SB 4LRIA 3OKKA 1YEDA 2OZ4L 3DRTA 4DKDC 5IG7B 3O41B 2CIKA 1ZT1A 4WIQA 4UT6H 1EGJA 3S37X 5IW6A 2DWEB 3IU4H 5FM8A 5EBMA 3V79C 4PD4J 3V4UH 2BSRA 2DDQL 3QXDA 4MD0B 4R90L 4WI8A 5EC2B 1U8NB 1AR2A 1MY7A 3H2WA 5DD6B 3PWUA 3RVWD 1WZKA 2ARJB 1L9MA 2EDYA 4G6JH 3CFIC 2OL3H 5EIVA 2ZUVA 4NKQB 3L5WA 4UT7H 3BPCB 3RWGB 5J89A 4JM4H 5E2WL 2VR4A 1F00I 4Z7WA 3ZO0A 2C3GA 4NKDB 5F88B 5I66A 4Y4FD 1IQDB 3EZJB 2V7NA 5AUMB 3VI3F 1GRWA 1KJ3L 4ELKB 2I07A 1GZQB 2R39A 3BP5A 4YXLL 4KMTL 5J3HC 1WFNA 4I4WB 4Y7MA 4DUXA 3SOBH 3UJJH 5B38G 4P23D 1Q9WA 1T22B 1D5ZA 3KPNA 3PWJA 4MXWL 4KKCC 4OGXH 1P84J 2HG5B 3O2WH 3NIFE 2XTJE 3KS0J 4UUJA 3MLYL 1WAAA 2HFEB 4DZBA 4XVUD 3BGFC 1A64A 1CGUA 4WY7L 5FYJH 4YDVB 1MCRA 5K9OA 3H9ZA 4C83A 1KCSH 1WVZA 2MQCA 4KU1A 3UROR 2OSLB 1A7RH 1NCBL 3WO3B 5IFHH 3GBML 4YX2L 4LDEB 3S5LB 1XIWD 1I8KB 2V6HA 5ACLA 2BZDA 1S9WA 3V52L 1F4WL 1FQ9C 1OSZA 2ZP0T 4K8RL 2JB5L 4WEBH 2O5XL 5DR5H 8FABA 2G75A 1TNNA 1JFQL 3V9FA 2VNCA 5E8NB 3ARPA 1BFVH 5DEGB 3IXAB 1E4WH 1DN0A 1NC4B 1X7QA 4N0YH 4XPFH 1YDPB 3QISA 3C6LD 3HPJB 3IFOB 1AQKL 3DUHA 4U1SA 4NC2B 4MS8A 3O8XA 1R3HB 5CEZE 1AGDA 3LN4B 3NCMA 4DKEL 1YZZA 4JREB 3RKDD 4UOW1 5CZKA 1CN4A 4GS7C 5B39A 5I73C 2X5PA 1JPSH 5C0RL 5KSAC 2PKDA 5C0BB 1OQOA 1W72H 3DNKA 4LFHG 3ULUC 4HXAL 3BDXA 1NAMB 3PXJA 4F15C 5JW5B 5A2KH 1HHKA 1AR1D 4GXUN 4YDLC 5JHLL 3PNWA 5L6YL 4IOFC 3DX8B 4XC1H 4K7FA 4BUHA 5JOPE 1KJVB 3PGDA 2PXYA 4WI9A 5DD5H 5ADPH 4XAWH 1BF8A 1TTUA 4UQ3B 1FJ1A 2GK0A 3A6CH 2GTWB 5GS0H 1C5BH 5GGTH 1CLCA 3RY6A 3NPSB 5CEZD 1I8LA 4M6OH 1FYTE 5DQJB 2CKBA 3VWKC 1MUJA 1ZLSH 1IKFH 4NZDA 4QRUB 4CL7A 1YYLH 4UI2A 2X9XA 3FFDA 4AH2A 4KK6D 3CSGA 4HH9A 2HJLA 1N8ZA 4LLQA 2AJXH 3QUXC 4P57A 2OJZL 4U31A 5FECB 2X4QB 3PABB 4FFZL 2AJSL 4JN1L 2Z92B 4KI1A 4JQVC 3RTQC 2D4DA 5K9QI 1CICB 5DVLA 1N6VA 5JOPD 2HFTA 5C08E 2WZPD 3GMRB 5IFAL 5D1ZA 2UY6A 4K7PY 1G7HA 4U0QB 4CW1B 1NBVL 4P49A 5E94B 5FYKH 2Y7QA 1KELH 4JRYE 5C9KA 4PJDE 1FYTD 4R7DA 2B0SL 4P0DA 5FDWB 1UC6A 4YDKH 1D5XB 1OCWH 1TETH 4MJ6A 4YHPB 1NCNA 1M7IA 3KR3L 3E2HC 4DUVA 1OT1A 3MROB 4XP4H 5ICXA 5MEOA 2EXYC 5IR1A 2FBJL 3Q6GH 1ZHBA 4N0UA 1NCCL 2FO1A 4MSWB 3K74B 3QCTL 4NQEA 2PYEA 3AU1A 4O9HH 2I9TB 3LS5L 2P49B 4FQXD 5C08D 4BUGA 2F15A 4BFIA 3T0AA 5D7IB 3V7AG 1SMOA 3W0WA 1C08A 3ETBF 4WW1B 1UWGL 3RWFA 3HHRB 1UACH 4LSQH 5CGMA 5HYSG 1AFVH 1PBYA 5E2TL 3MCKB 4UDTB 3MOAH 4UV7H 3J7HA 4JM2D 4LHUA 1T0NB 3QUYA 1NLDH 1XGQA 5B8CA 1J8HA 4V2BA 3RZCD 2HFGH 4NDMB 3K0WA 2J4WH 4WU7B 1WTLA 4ODHH 3GHEL 1BECA 1C16A 5F7FA 2EDRA 4HWEL 3TPKA 2HT2D 4R97C 3ZT7A 3D5OF 3TO2B 4BZ2H 5CD3B 5HHQB 4ESKA 3OJDA 4NZTH 1HZHH 1A4KA 1YUHB 2KH2B 2WINA 1VPOH 5L8LB 2AXJA 5H2BB 3LRSB 1VACB 3BVNB 5J13B 4LK4A 1N3NA 4BFBD 1F3DJ 3PGFH 5FB8A 3QEQA 4PJCB 1IAII 1T20B 2DM7A 5MP6L 3ZYJA 4FQIL 4PV8A 4PRAA 4LLMA 1U8LA 4WTXA 3FN9A 1RVFL 1DQQA 4P5KA 1GAFL 3WXWH 4H8WL 4QF1B 5FCUH 4X7SL 5M95B 3OKNA 3X17A 4M3JA 3PP4H 5HGDA 3L3HB 3H7LA 4LQFL 1FDLH 3UEZA 2NXZC 2BCKA 3NCJH 4HUUA 5ANME 3EYSL 5CJQH 5FA4B 2NLJA 2WBJD 5JPMB 2X89A 1IC5H 3EJYD 5DQDL 3V4PL 4NKMA 3OPZL 3ZLQC 4OZHE 5CD5C 5SV3A 4MXQD 2OZ4H 1D5BB 5DZOA 1BD2D 15C8L 1LQSR 1HSBB 4G9FA 5IMMB 4UU9B 4QO1A 3VE0B 3MUGA 1AQDB 4QRPB 2M8XA 4TTDC 2ZCKH 3HG1B 3TGXA 5MENE 1NAMH 3L5XH 5CUSH 1EXUB 4L8DA 1F3RB 4JY4B 4X8JA 4K9EH 1HHIB 5EU5B 1G7IB 4MDJB 2JIXD 4AT6B 5GRUH 4M43L 4Z7UE 1RUMH 1A1MA 3BPLC 3DMMA 3UTZA 3H9SA 5D7IF 3QJFA 1MFEL 3CAFA 5CBAB 1CU4H 3PWVA 4P9HL 5A16A 4ODSL 2C1OA 1S9YA 1TTGA 4LAQH 1JWMA 5E8PB 3REVA 2ILLA 5F9DC 4F7CA 4PGBA 1JGLL 5CBEA 4ZUSA 1MIEH 4LSTL 3M1BB 4XNMB 1S3KH 4ZO7A 1QBBA 4MD4B 2IFGA 1HINL 2EDTA 4JB9H 1OSPH 3BMWA 2IH3B 3GJFB 3DV6B 2FRGP 1EHAA 5CP3A 2VDNH 3ZT6A 5I8KH 2GT9A 5JIPA 4FZ8H 3NOIA 2KPNA 1KJMA 3BQUB 2CDEB 3A0OA 4PBWD 3OWEA 3GSUB 1J05B 1QRNB 4WU5B 3SHSA 4L3ED 3LHPH 2QSQA 1U8IA 4O2FB 4WY7H 4ETYA 3HE7B 4F7MA 5C0EA 9CGTA 5LGJA 5D5MA 5ERWA 1YC8A 5EIQA 3RWIB 1QBLL 2HA1A 1NBQA 4AIZA 1UB6A 4ZAKB 1GHFH 5DI8A 3BEWB 1RFDL 2X6MA 4MQXC 1BZQK 1NH6A 2AXFB 1SEQH 3VD3A 3CC5B 1R5VB 1FE8H 5I15H 5BZDB 2I5YH 5L2JB 5IVXA 1I8MA 5SWZB 3DUUB 2C7UB 1DLHA 2FX8L 3AUVA 1GGUA 5DMYA 1XCTB 4QCIB 1OP9A 1WFUA 2FWOA 3VMOA 3FJTA 3ECBB 5EBGA 5DVMA 3ARUA 1UH3A 1B9ZA 4OTXL 3QWOA 1T0MB 2WP3T 1F4AA 4JO3L 4GAGL 5C0DA 3FT3A 2MKWA 4HCRH 4XP9H 4FXLA 2IADA 5DA4A 4HW6A 1FZJB 4RGNB 4KI5F 1I7TB 2V2TB 5JO5A 5EU6E 1G0XA 1CDCA 1F4XL 3JV0A 4CGTA 3X11A 4PP2A 4LEOB 4OFKA 1MCEA 4M48H 3BKJL 5T1LB 1JK8A 5CEYA 4WO4D 2ZOLB 43CAA 5C0GB 4YE4L 4U1IB 4JCLA 5TJWK 1F6AA 4NN7B 4XVSH 2VDQL 5GJSH 3VCLB 4G8FB 4GG8A 4MGXA 2VDOH 3NTCH 2E7HA 4NNPL 2MTPA 1HYRC 2HRPH 4HIHB 1DL7L 2OM5A 2CRIA 3EGSA 5F1NB 1GSMA 1LNUB 1FLRL 2R4RH 3MOBL 3QO0A 1Y0LB 4KKNA 5KTEH 2AV1A 3CFJB 4EUPB 1L0QA 3ARFB 4P46D 4QTHA 2ZUTA 3EO9H 4W70A 1J12A 2LU4A 3S96A 5TGBB 4NBYB 3FZUD 2BNRB 4JO1L 5BRZB 2X9WA 3MSPA 5BQ7A 5HHNA 1F11B 1IGIH 5IMLA 4DUWA 4G8GE 1D9KD 1YN7B 4YHNA 2FH8A 2VTFA 5CEXB 3QHZL 1BQSA 1ZV5A 2CJUL 4PV9A 2NMSA 5FM5O 5DC0A 1CDJA 2NW2B 2OJZH 3NFSL 3QQ4A 3KLDA 4JN1H 25C8L 3SE8H 3ILQD 2VLMD 1UEYA 2UZXB 2BVOB 3B5TA 3QIUC 5IHZA 5FYJD 4WTZG 1NL0L 1IGYA 5HDBF 3PHSA 4R96A 3TO4C 1KIPA 2Q8AH 1OTTD 3B2VL 4X99B 2H2SC 3C8HA 3U6RA 4AJ0A 4PRIA 1MCJA 2DJUA 3SE3C 4M7JL 3CMOL 4IEFB 3WJJC 1K3IA 5IIEB 3AMLA 2RR3A 3ALXA 4JFDB 3V5KA 4G8GD 4Z7VF 4KROB 1QVOB 5E7FA 1YMMD 4N8VA 2YOCA 4ZUUB 3MV7A 5IVOA 1IAIL 5J6HB 3NA9H 5E2UH 2HFFA 3OKKB 1YEDB 4OLUH 2YZ1A 5D8JL 1UZ8B 5A43C 4I0CC 4Z7OE 3RU8H 3DRTB 3F7RA 1F45A 1G6RA 3MFGB 2E5EA 2CIKB 2FSEA 3IDUA 4WUUB 4HMDA 4APQC 4ODXA 5IW6B 4HBQA 3QXDB 4XCCL 1OAYL 1ZTXL 1A9BA 2P8LA 4Q97A 3TJEL 2DQHL 1GGCL 5KVDH 1B4RA 5F1OB 3PWUB 2DYPB 3CCHA 3LDBB 4D9RE 3GJFH 1KCGC 2FEDC 4HGWB 2P7TA 1ZA6B 3O2DL 3EHBD 3ARDD 5FUOH 3L5WB 1N0LA 2ZG1A 3P30H 4H0HB 4EBQL 1ZLUK 2ATKA 2IQAA 5E4EB 3G6JB 3D0LB 3LKOB 4Z7WB 3GHEH 3V8CA 1KLGA 2O61A 2R0KL 1KXQE 2V7NB 5DURD 4Y19E 1B0RA 4ENEC 4P9ML 1NUNB 2I07B 3U48A 3SO3C 2AP2A 3BP5B 4NQCA 1TCMA 1RZ8A 2A0LD 2E7LA 5FYKE 1KPUA 4OIBA 5EO0B 2VERN 1Q9WB 2NY1D 1T7VA 4N0FA 5GS0D 1J0HA 2NY4D 4QHLA 1EFXB 2Z8RA 3QYCA 4UUJB 4Y88A 1TZHB 3TV3L 1T04A 2XKNA 3WUWG 1H3PH 4D9RD 2VXVH 1RVFH 5HHMA 4Y89A 4KH2A 4UILL 4L29A 5E9DA 2W0LA 5ADOH 4N5EA 2XA8L 4C83B 5IKCA 1LILA 4HAGA 4LLVA 2W38A 4DVRH 3RHWK 3NCCB 1KYOJ 5KN5A 4TPRL 1U8HA 3AC0A 4L4VA 1WTGT 5MERB 1LDSA 4Y19D 1CIUA 1S9WB 2ORBH 1OGTB 1IVLA 4ZO9A 5F7DB 4U33A 1A7QL 2DRUA 5FYKD 1OF2A 2AW2A 4XNZB 1OSZB 1F58H 1MI5A 1VADA 2FB4H 2F5BH 3QFDB 1U3JA 4J4PD 3S3PA 4NFBA 1GH7A 2G75B 5DC9B 4ZS6D 5GISL 1EHXA 5HI4D 5CIPA 3ZKNC 4I2XA 4HJGB 3B9AA 1DN0B 1T89A 1X7QB 4PGJA 5FYLL 2Z8VC 4U1SB 1SM3L 1XZ0A 1AGDB 2F53A 2NR6C 3MJ8A 3BKYH 4EUPH 3WS3B 4LCCA 1U42A 4V3EB 5B39B 1JTTA 1T83C 5DGRA 3S35L 3KXFE 3U4EB 4FABL 3B6SA 2WWMC 1A3RL 3SDXA 2JJSA 1BGXL 5IW1B 1PX4A 4JFPA 4OCWL 4TSAL 3IVKA 3JWOL 4KKAC 5EOCH 1RZGA 1UA6H 1HHKB 1Y6KR 3LQAL 4X7TA 2JE8A 4LSTH 2DQJH 2WIIA 5JIKA 5MI0B 1VA9A 3GEWB 4JKKA 4Q6IB 3G6JF 4XP5H 1JTOA 1MRCH 3CLEH 4M5YH 5F7UA 4NQUA 2YD1A 3PGDB 4HSQA 2PXYB 1CXEA 3TH4T 1ADQL 1F3JA 2NY5C 2GK0B 3VGDA 1YNKL 3W39B 2ZJSL 4Q7DA 4I48A 1PZUB 1CXLA 4ODUB 2CKBB 1JI2A 4HS3A 1X5AA 3TFKD 2DQDH 3D39D 1F2XK 3FFDB 1NFKA 4S11A 4AH2B 2MFNA 3V4VL 2HJLB 2P5EA 3KXFD 5AZ2H 5F9OH 1N8ZB 5T5FL 3SKUD 4LLQB 5JOFA 2DMBA 4P57B 2IQ9H 5ITFA 1NDMA 5DJ2A 5IM7B 1GJIA 4IIQA 1YEGL 2DQGL 1XH3B 3QA3A 2YA2A 5JUEH 5C0BE 2EDWA 4WUKL 3O2VH 4W6YB 3MRPA 4HMCA 4KXZI 2YN3A 3CXHK 4KKLC 5D1ZB 2DLFL 1G7HB 4HEPG 5FCSH 4MJ5A 4J8RA 1TLKA 1VHPA 5DJYA 2Y7QB 4DTGH 4WHYH 1BQLL 2G60L 3S4SA 1CR9H 2BDNH 2APXA 3FO9A 3SDDA 5D72L 2XZCH 4ACPA 5DMGD 3JWDL 2BJML 4MAYA 4R4FL 5T3XL 3QEUB 1QO3A 4KK8C 5IMKA 1F4XH 3SJVA 1DVFC 3W5MA 4XNUH 4MJ6B 2OTUA 1T4KA 4X6FB 3LV3A 1KCVH 1HH6A 1MFDL 1FIGL 1NKOA 4YE4H 5MEQB 1LO3H 1A6ZA 1AE6L 2R4SL 4CVXB 1ZHBB 4KKBD 1CXFA 4E9LA 1AXTL 1NSNL 5D1QB 4YWGL 3IDYB 3AU1B 1JUFA 4BQ9A 3U30B 2AJVH 3RUGA 3L3OB 5D7JD 3W0WB 3GM8A 3U4BL 1C08B 4RGMC 3RWFB 5DD1H 1JZ7A 5KVFL 2VUYA 2DI8A 4X4YB 1YJDC 5FV2A 3WDHA 3UJIH 4LHUB 4HPYL 3QUYB 5EOTA 3TT1H 2AQ3A 5HYQA 3RVTC 3P0VL 1A1NA 3QPXL 3MNWB 4G8EA 3A6OA 4NBZB 1U8KA 3S5LG 3BT2L 4OT1L 1C16B 5ALBL 2MKLC 1XAUA 4YBQD 5CINH 4QXWA 2HKFL 3QHZH 2Y25A 2DBLH 3OJDB 4KQ3H 5E1AA 2YUWA 1A4KB 5E08L 1RURL 1I85A 2WINB 4HZLA 2OLDA 1Q0YH 3AS1A 3I3EA 2HYMA 2DL2A 1GOHA 1TQBB 3KPRA 1D5MB 1PFCA 2ZG2A 3JBG7 1KSRA 3KG5A 4PV8B 4PRAB 5D7IE 1U8LB 1EERB 4CBPA 1S9KC 4XRCB 1KT2A 2VZSA 3JV4B 2GQHA 1DQQB 2E9JA 3M07A 4P5KB 4DFHA 5CGYC 3MLZH 2APVA 5EO9A 5HHOA 1NFDA 3DYPA 5HGDB 4BJLA 1CBVH 2AJYL 1N59B 5DT1L 1DBML 1UG9A 5FYJU 1B4JL 4HUUB 1IKNA 1QQDB 1CLYL 4NRXA 5INDA 4IRJA 3KYMA 3MXVH 4K8RD 1CIDA 2EEAA 2OTPA 1NMAL 3B9KB 4NKMB 4E5XA 3TBYA 4MAUH 5EORL 1TXKA 1IGJA 2NZ9C 4P2OC 1K8DB 4NHCL 2PTUA 4PS4H 4A6YL 5GRVK 2E27L 2P44B 2CMRL 4JPKH 1XT5A 3MUGB 4S1SL 1H5BC 4GMTL 4L8CB 4PJCE 4HC1H 3AS2A 3JXAA 5D70L 4L8DB 3VRIA 3CIQA 1I3VA 1TZIA 5FHBH 2YSSA 2G2RA 4YBHA 4JZJC 3TZVC 1Q94A 4YQXH 2J88H 2PTVA 3QQ9D 3TPUA 3UTSD 3UTZB 3H9SB 1JRHH 4OCXH 4OLXL 1WFTA 1R3IH 3BPOB 5J1SC 4ONFL 4LVHB 2C1OB 1BEYL 1S9YB 4P3DA 1JWMB 1RUQH 2IC2A 5E6IA 3REVB 4PJHA 4WFEE 5CBEB 4LOUD 3DURA 4ZUSB 2XKUA 5C6WH 4X4MA 2X1OA 2NW3A 3NZ8B 4KI5E 5JXAL 1W0VA 4Y4HA 2GJ6A 3KJ4B 5B4MC 3S8WA 3PWPA 5LAXA 2Q8BL 4YFLF 4DQOH 4XBPA 1DBJL 4XT1C 1BZ9A 2D3VA 4QRPE 3BI9X 4ZUVA 2HAZA 1EZVY 3HG1E 1AD0A 1M71A 1OAQH 3VFMA 4ONGL 1U8IB 3BD4A 3VA2C 4F7MB 1MJ7H 1KLUA 1LO0L 2N4IA 5LGJB 5D5MB 3L3KA 5ERWB 4X98B 4OZ4A 5J12B 1CL7L 3I75A 4AIZB 2JCCF 1ZGLP 4G43B 5DI8B 4CJ1A 4WFFE 3IYLW 4OBSA 5TPWL 4WWKD 3U36A 5EUKB 3HLAB 3VD7A 3RIFF 4R0LA 5IVXB 3HC3H 4ZOBA 3MREA 1LDPL 1EAPA 4WFED 1DQJA 2QQKH 4Z95L 4HUVA 3PHOA 4M7KL 4XAKD 3I6LE 2HKHH 4AENA 4W4OA 4O51A 4KI5D 2FWOB 1R3LA 3FT4A 3O3AA 5F96L 4KPHH 4ONHA 1NPUA 2ADFL 5KW9H 2MCG1 3DHMA 4QRPD 3QWOB 3HG1D 1INQB 3FN0H 5C0DB 5FYKU 5F9AC 4X6BA 5EN2A 3WKML 2H2PD 3FFCD 4JDZA 1WWWX 1N6QL 4YH6A 5IROA 2IADB 3MRHB 4U1HB 3UP1A 1IZJA 3BKCL 1QRNE 2EDEA 2VXUL 4IMLA 5JO5B 3L3GA 5HYJA 2COQA 3X11B 3OAZK 5EUOA 3C60C 1MLBA 4WFFD 1JK8B 5CEYB 3QJHA 2VLKA 3QIBB 2FNBA 4TSBH 1PY4A 2MWCA 43CAB 4KZEH 1OAXH 1AGBB 1CICC 5HDBE 1OM3L 1F6AB 1ZK9A 2A6IA 5ACZA 3GI9L 3KDMA 3I6LD 4GG8B 3ARWA 5SWZE 2NY7L 5GS2D 3QEHA 3EGSB 4P2RA 1FNFA 2GITA 2OBGA 3ES6A 3QO0B 3UAJD 1CDIA 1N4XL 3VH8A 2AV1B 1INEL 4E0RB 4Z7VE 2HTLC 4QTHB 3S96B 1EHLL 1J1PH 4L9LA 5L0QB 4IM8A 5DHXB 3QQ3B 1WJ3A 3QI9D 4KY1H 4DN3H 5BQ7B 2VSCA 3MV8A 5HHNB 3EYOA 4G80A 3TP4A 1IGCL 3HE7D 2NZIA 5IMLB 3QPQC 1ZVHA 4RGNE 5DMIH 3VI4E 1AD9A 2Y4SA 3B9EA 3QCUL 1DUZB 3OJMB 5T5FH 1P5VA 2YRPA 5HHXL 1KB5L 5HBBA 1CGVA 4KK9C 4I5BA 4NM8H 3QQ4B 5DVNA 5SWZD 1JNJA 1ZA3B 3QG6A 1CDHA 3IXTA 3NN8A 1QTYT 2VN7A 3ARGC 5D5MF 4BSVA 1YEEL 5D9SB 1MHPH 2VLJA 4L5FH 5EBLA 5IHZB 5JLZA 1IGYB 5C6TL 3LS4L 4R96B 1KIPB 2DTSA 2ZSVA 1J5OH 4MNQA 3KPOA 4PRIB 2NY6C 1ZEAH 5FO8B 3TYGH 2OK0L 5HDLA 1UCBH 2XXCB 4NP4L 5C70A 3W81A 2WP3O 3DIFA 4RGND 3V5KB 5BRZE 3RAJH 5IF0A 5BVPL 2MNUA 3P40A 3HFML 4XCFL 4NKIL 2JELL 4Z76B 2UVEA 4J6RH 4N8VB 5J13C 3WFHA 3MV7B 3RI5K 4DGYH 5HVHB 5I0DA 1BX2A 3AREA 3VWJA 4KHXH 1MCQA 1BHGA 2OQJA 2SEBB 4HBCL 1G6RB 4XNQB 5I76A 3CFDA 3LIZH 3WFZA 4AL8L 5A3IC 4ODXB 4CVWA 4F7TB 1EIBA 1BBJA 1QYGL 4MA8L 3CSBA 1OB1B 3KPQA 2P8LB 4U1GC 1X44A 4J3UA 1AKJA 4I0PD 4OF5A 5F9WB 1E4XH 4KAQL 5KS9A 1A3LH 3CCHB 2B4CL 3VXRD 4FQJH 1T21A 3QEGH 1IEAB 3QDMB 3CFKA 2IG2H 2AKRA 3BOVA 3Q2CA 4XXDB 2P7TB 3KLAA 4QXGL 3QWRD 5CP3H 4XXCA 2ATKB 5H37H 3QUZA 2FGWH 2B39A 5DS8B 3Q6FA 3V7MA 3TA3A 3FB7B 3U7WH 1HQRB 2YMXL 2YC1B 3OG4B 1EO8L 1B0RB 4NHUA 3FTGB 3CSYB 3TVMA 1JF1A 3O2DA 4NQCB 3PL6A 5I30L 2D7NA 4NCC1 4S1RL 1KPUB 2XWBB 1HWGB 2VYRE 2LVEA 4TQEL 3VFNA 5KAQF 4WUUE 5BW7A 4E41D 4QHLB 3WLWC 4AZ8A 3RDTC 2ZOKA 1JPFA 4R6UA 1QFWL 1YQVH 3GBNH 3O4LD 5EZIH 1UWXH 1T04B 5H94A 1T3FA 3EOTH 5C0CA 1KCRL 4PJ8B 5HHMB 1A0QH 5K9JH 3SN6N 3BYYA 1YEIL 4XMLL 4LLVB 4R2GC 4POZD 5AYUL 4MVBD 1U8HB 4L4VB 4U1LA 2ICWI 4M8VA 4DEPB 1T1WA 3EDKA 1HHJA 3G6JE 8CGTA 1DBBL 4Z7WE 4K3DL 1RMFL 2CD0A 1R3KB 1I9RL 1MSPA 3UZQA 5CJOH 4BFGA 4ORZC 2R23A 3ULSB 4LVOB 3LZFL 2IMMA 3BP7A 4PRDB 1MI5B 1VADB 4OFYD 1BQHG 4LSVH 4PJXB 1S8DA 4WUUD 1LMKA 4ZQKB 4YUEL 4EUPG 1D6VL 4FQHB 4HKJA 3O9WA 1ORSB 1D6EA 1ZLVK 4OV5A 2R0LH 1J87A 4I2XB 4LGSB 2EXWD 4X9BA 4XBEH 3EYFB 1BVZA 4L4TB 2EEBA 2HJFB 2DYPD 3JWNC 4OLZH 4AQ1B 4BQBA 1TNMA 4BH7B 1WAAE 3HZMA 3QUML 4Z7NF 5BVJA 2GSIA 4JAMA 4FHBD 2UY7A 4LCCB 1A4JA 4OUUA 4HD9A 2Q3AA 3ERYA 4ZDHA 3VW3L 1B0GB 4TNWK 3GMNB 4ODTH 1R0AH 1REIA 1CK0H 1MEXH 3B6SB 1BEYH 3AY4C 4JFPB 1QBAA 4UB0L 4XNXL 2VDLL 3IVKB 2EIDA 1RJLA 4XBGA 5CZVL 4UIMA 1ND0A 4X7TB 4RA0C 3HAEB 4ZPTA 2WIIB 3MLUH 4M62H 4DGIH 3DYOA 3BRFA 1JVKA 1SY6L 5FXCH 1P7QA 2XWJA 5IHLB 1TJGH 1EFXD 3BN9C 4M02A 3E3QC 1RZJH 3PGCA 4JJ5B 3ZE2F 2Q87A 1F3JB 4ZFFA 1X5KA 1CFVH 3T0VA 3RY5A 5I19L 4TTGA 2AEWA 5CJ5A 1GC1L 3IAQA 3U0PA 4DN4L 4HS3B 1LEIB 2W07A 4HFWB 5GS1A 3TCLA 2DQFA 3Q0HA 4KUZL 1S7TA 4KTDL 4MNHA 4CKVX 1MF2L 4XX1E 2FATH 1UM4L 2OMNA 1ADQA 4X0KA 3NZHH 2VDML 5JOFB 1D7FA 5ITFB 1NDMB 5DJ2B 5IW3A 1AXIB 4OCSH 4PBXA 3QNYA 4KMQA 1TFHA 2VWEE 4BZ1L 3QA3B 1K6QL 4N9OB 1MWAH 3ARFC 4TSCL 1Q1JH 3TNMB 3IRZA 1OARL 2R2CA 3GSQA 3MRPB 5ISZA 2PYFB 1TQCB 5EU3A 3MV01 1Q9OA 3W11D 1I1AA 5ABDE 2IPTH 5KSAA 4MJ5B 4J8RB 1I7UB 1MHHA 5DJYB 1ITCA 2ADFH 2FX9L 3C6SB 1A5FL 3WIHA 1AJ7L 1UJ3A 3MRNB 2MJWA 1G6RH 3S4SB 1QRKA 2JTDA 3FOMA 4OQTH 3FO9B 3L95A 1T1XA 5C8JA 4P5TC 2Z93A 1J9CT 2PO6C 1P4BL 5IB3A 2EKSB 4MAYB 2I60L 4UTBH 1QO3B 2CO7B 4Q6YA 5IMKB 3TT3H 2C4FU 2XZAH 4PJXF 3SJVB 1MFBH 2EH7L 3LRGA 1FZOA 1J1OH 2VJXA 4YHLH 3ZKXC 2OTUB 1T4KB 3ZHKA 4YHZL 5C0NC 1HIMH 3LV3B 1QZ1A 1HH6B 1OQXA 5GRJL 1HYSD 4RDQG 1A6ZB 1UM6H 4LIQL 4MNGA 1BLNA 3O6LL 3GDBA 4ZD3L 4XP1L 2NY7H 1H3GA 4HFUL 1QFHA 2LABA 2MHAB 3RUGB 5I16A 3VG0L 2CO6B 3DO7A 4B7LA 3L1OL 2YHGA 3QUXA 4IDJH 4FS0A 5LCVL 3OMZA 4EN3B 1ZAGA 3SDAD 4HJ0D 1U8PA 2AJUL 2KQMA 2PXYD 3O6FB 4Y2OA 4KROC 3C5ZC 5KZCB 5EOTB 4ZXBC 2DQEH 1B90A 4QRTA 3S36H 5TQ0L 4U1JA 3IDGA 1KIQA 3S9DB 4G8EB 4FP8L 1J1XL 2BK8A 4S10A 2VL4A 5KVMC 3CH8A 4LRIC 5TDPA 3BGAA 5D2LF 4G6AC 2VXQH 3EBAA 5F6HI 5TFSH 3GMMA 2DICA 3SGDH 1LVEA 1YEKH 3Q3GB 2F8VA 2VR5A 2E3VA 3RWDA 1H3VA 2CRZA 4WCYH 4PLKC 1KEMH 1JPTH 4WW2B 2V2XA 3U1SL 4UMGA 3MRMA 4PG2A 4P3CL 3KPRB 12E8L 1I3RA 3PDDA 5H8DA 4NO0A 3O11B 4IS6A 4JDTH 1WZMA 5LGHL 4FTVD 1I1RA 1GOGA 3I3BA 1KT2B 4DKFL 4WEMB 4K94L 4HWBL 5EO9B 5HHOB 3NFNB 3O6MH 4NQTA 5E4EC 3NH7H 3GKZA 4XX1G 4XC3L 2EE2A 5JDSA 3EOYG 1OGAB 1EO7A 3ABZA 4K3HA 3SKOA 5B39G 4NRXB 5INDB 4IRJB 1QNZH 4KVNH 3LH2L 1XCQA 3OGCA 4YXHH 1KENL 3KYMB 3QHFH 1OWWA 3TBYB 3ZSSA 2FJFB 2MQ0A 4R9HA 3RZCC 4O00A 5F7EL 2WBKA 4GBXB 1DDHA 3ZYIA 4G7VH 3QRGL 5D1QD 4HIEA 3GMPA 1T7ZA 4FFWD 3TJHD 1OP3K 1A6VH 3U7YH 2EE6A 4BFEA 4L8SA 2UWEB 4JFFE 4QNPF 1KEGH 1PJ9A 3VRIB 3U46A 3FQXA 1CLZH 4G42A 3HAEH 2QSVA 1OAKH 3CDFA 1TZIB 1WICA 4MA1B 1KTRL 3A67L 2HLFD 2EIBA 4NC1C 1MFCL 2G2RB 4TULL 2ENSA 1Q94B 3DECA 4FQCH 5KSBA 3BISA 3C08L 4YDIL 1FL5B 1J0KA 2FD6H 5HYEA 4KK5C 4PB9L 3AVEA 4XNZC 4PRBB 4QLRA 1AHWB 2XRAL 3DVNA 3G6AA 4P3DB 5CWSB 5BV7L 3S36X 5TE4L 2EKJA 2XN9A 2HH0H 1T0PB 4PJHB 1FFOB 4XPHH 2BNUA 1CGSL 2BXYA 4LPTA 3FT2B 4YJZL 4P2QD 2NW3B 1A6UH 1IT9H 2HVJA 1W0VB 3PWPB 5GPRA 1JV5A 4JFFD 4MS8C 3KPPA 3O8XC 4CRPA 1DQDL 3FHQA 4OLYL 1BZ9B 1QFWH 3K2UL 5I1EL 5J8OA 5TF1H 3VFMB 2VLRA 3FQRA 5E24E 4RMSA 1KLUB 4WW2F 1MLCA 3BIKA 1I8IA 5I17A 3VXQB 2FH6A 1EZVX 2Q76B 5JXED 4NZUH 4D0CA 2OI9C 1UVQA 3U82B 1RIUH 3CPLB 3IDNA 1QLEL 1F3DH 2VH5H 3PWNA 3H9SE 3U36B 1XF5B 2BSSB 4XTRC 4K23L 2ZUQC 3MREB 3LPGA 3UJTH 5DF0A 3B9KD 5I1KL 5MI0C 4WVRA 2NX5A 4HUVB 1RY7B 1XR8A 2VABB 5LJYH 3QT2A 5DRNB 3LZFH 5DD3H 1R3LB 3FT4B 4PGEA 4RBPH 2OR9H 5FDYA 4JHWH 4ONHB 3RY6C 3PF2A 1I8LC 3GIVA 5I18L 1FO0H 4WWID 1KTDA 4LHUG 3EDFA 5IB1B 4IRSD 1P4LA 2EDQA 4X6BB 5EN2B 2OTWB 3T65A 4RGOH 3IDIA 2AV7A 2ICWJ 1DFBH 2GAZA 3L3GB 5HYJB 2G9HB 1KCUL 3Q5OA 4OCMC 1LP9F 4LMQI 2XPGA 4UDUA 5D5ME 2H9GA 1OHQA 2VLKB 4KJWC 5FHAL 4X6DF 4JVWA 2N7AA 3EFFA 4WHCA 3TN0D 4PJGB 5CHNB 2UWEF 5E2JA 1I7ZA 3P73A 4C56D 5EU7E 3NPZB 2A6IB 5JHDB 3E6FB 4MLIA 5ACZB 3KDMB 4JGUA 1L7IL 3EO1B 5IB4A 5IVXE 1C5CH 4XI5C 5IFJA 3HPLB 3QEHB 4M6ML 4P2RB 5JW4R 2GITB 1ONQA 3GRWL 4M8QB 5L2KA 3ES6B 2C3VA 4JFEE 4Q0XL 3O45A 1NGYA 2GJZA 1L9NA 2UYLA 2HMID 1UEMA 2B1AL 1Z0MA 3ROLA 3QSKB 3VXUD 4R8WH 2XI9A 4HS8L 1C8PA 2HWZL 5HHVH 4J3WA 2H1PL 3CXHJ 2R0WH 4LNRA 2IAND 3EYOB 4G80B 4DN4H 3ZDXF 2IAMA 5HJ3A 4HEME 1AD9B 1QSED 3DO3A 5EA0L 1V7MH 4JEGB 4I3RL 35C8H 3HMWH 3S97C 1NFIB 1UT9A 1NCAH 2NY0D 5E8DH 4I5BB 4LSSL 1Q9LA 4QWWC 3UBXI 3DX6A 1P5UA 3D9AH 3QG6B 4G7YL 4TYUA 4RRPA 3WL9B 2AABH 3OHXA 3NN8B 4JFED 3B2UD 2EDFA 2ED9A 2VLJB 3BAEL 4WO4C 5EBLB 1PG7H 2YD4A 4EI5A 5JLZB 4QRRA 3QUYC 1SJXA 5B8CC 3G08A 4NZRH 5DWUH 1OP5H 2ZSVB 2W9DL 2APTA 4MNQB 2H3NA 3F58H 2QQNL 4PRHA 2HT3D 3Q1SH 5LQBL 2I24N 3DIFB 1J18A 5GSVA 4M3KB 3WMSA 4Y16D 2A1WL 4YAQA 3BX7C 1PQZA 3CK0L 3D25A 5IF0B 2PN5A 4PTTB 3KPSD 5DUPL 1CWVA 2QQQA 2EYSB 1NCDL 3QIBD 4Z77A 3QDAA 1MJ8L 2R8SH 4O58L 4MXVF 2Y36H 1BX2B 2NNAB 5FV1L 5I74C 3VWJB 5DJAA 5J0BA 1MCPH 2DL9A 1MQKH 4TVPH 1QSFA 3WFEH 2OQJB 3BW9B 1ZXQA 3DV4B 2ICEA 5I76B 3DXAD 3CFDB 1ERNA 3OKLB 1VGEH 5D1XB 3UTTA 5IESH 1GOFA 3TBSA 4YIQB 1G9NL 3IF1B 3SQBA 3KPQB 4I1NB 4NNXA 3S88L 5I1DB 4PJGF 1NC2B 3LPWA 2E8YA 1KBGH 4FG6C 3OZ9H 4F8TA 4M1CC 1I9IH 1DP0A 4M6NH 5KS9B 4AM0A 3TBVA 4PY8I 3ILQC 2XQBL 2IH1A 4LCWA 1T21B 3CFKB 4PRIE 1BZ7A 5DFVC 3P11L 4KTEL 3QUZB 3P4NA 32C2B 3Q6FB 5SWSA 1W8OA 1WQVT 1CD1A 1KTLA 4HG4J 1SVZA 4OSUL 1FSKB 2Z4QA 3MFFA 2QHRH 3WJJA 1NAKH 5JW4Q 1BF2A 4NHUB 4CMMA 3TVMB 3MV7E 1JF1B 1PKQA 4JPVL 3IJSB 1C1EL 2P5WB 1I7RA 4PB0L 5T1DH 1DUYA 4PD4K 4GSDL 5HGHB 5T5NG 3BJLA 3VXTB 5GHWH 3GM0A 4Y0GA 4PJ7B 4P3CH 3VFNB 3ESUF 2BY3A 4LSRL 2ZOKB 1JCKA 4RSVA 4GMSL 1SBSL 1JPFB 4XZUB 3REWB 3GJEA 3H9HB 2J5LC 3T3PF 1XGTA 5H94B 3F12A 3C09B 5C0CB 3DMMC 4NO2A 4APQA 4PP8C 4NPYA 1PG7X 4RFNB 2UZYB 3BPOC 5FO9A 2DQCL 3MA9H 3QDGD 3LPFA 5F6HJ 1QP1A 3FQNA 3EFDH 3QDME 1B2WH 4U4BA 1KJ2H 4LLDA 1ZGLA 4XGZA 3HUJF 3TIEA 4U1LB 3EOAA 5KANG 3RGVA 1PG7W 2B1HL 1HHJB 4DOHB 3MXWH 2BRRH 5I8EA 5I8OH 3EYUH 2ZCLH 5ALCH 3VFUA 3ZE2E 1TIUA 3KJ4C 1HWHB 1JWSA 2R23B 4JR9H 4PUBL 3P9WB 2BVTA 2F58H 4AEHH 3EW3B 2QSCH 3BP7B 4NQCE 1S8DB 3SQOH 1G9MH 4HKJB 3O9WB 4O2EA 1KN2L 1D6EB 1NLBL 1XR9B 4OV5B 4Y4KD 5GGQL 3WEXA 5KBNC 5LWYL 4TUOA 4P48A 3KYKL 3CVHL 3MJ7A 4OGAD 5HDQH 5J12C 3MODH 4ZYKA 3H7BA 4GRWB 3HZYB 2YN5A 4LKCA 5BVJB 5IGXL 4O4YH 3QDMD 4NN5C 4K2UH 5HHME 4Y5XA 4JAMB 3HZKA 1A9EA 4ONOA 1A4JB 3FOLA 4OUUB 4YHKH 3T0BA 5D96C 4ZDHB 3IS1X 1MIMH 4WENB 4ZTPH 3BGFB 3PUCA 3WD5L 1V7NL 3ARRA 1OTUD 2W9EH 4D2NA 2ZWLT 3QUMA 2AI0H 5DRWA 1RJLB 4Y2DD 4HWUA 4UIMB 1ND0B 4X83A 3MACH 4L8BA 4I3GA 1WLHA 4ZPTB 3UZEA 5AWNH 2EDDA 2YXMA 3U0TA 2X1XR 4PJIF 1MI5E 1P7QB 4PJXE 3MO1A 2XWJB 4P3WA 3I50L 5SX5H 4WFGD 4YHYC 1J0IA 2IFFH 3I84A 1IGML 4I9WE 4TUKL 1R6VA 4ZFFB 3KPLA 2BC4A 4PGDB 4P4KD 2KZWA 4I2XE 4OI8A 4PJ8D 3ULVF 4RWYL 3MTRA 1XGYL 3GIZL 3S7GA 3U0PB 4PJEA 2QADB 4LP5A 5GS1B 4L4TE 1SY6A 2NPLX 3TCLB 2DQFB 1S7TB 5GGUA 4XPBL 4MNHB 4PJ7F 4RMVA 4N8VG 5HI4C 1GCFA 4XB8A 4RMTA 2A74A 2DTMH 2YK1L 2X05A 2AJZA 4X0KB 2JF1A 4PG9A 3GO1H 2Z35A 3QNYB 3H3PL 2N1KA 4MD5A 3QCVH 4NC0B 1CD8A 4RMWA 2Y07L 3T1FB 3GSQB 5ISZB 1EFQA 5I73B 3ARSA 3LCYA 1Q9OB 5LXGL 1LO2L 4XPTH 5E4IA 1INDL 5ACMA 1S9VA 5KSAB 5CILH 4ZO8A 1MHHB 4I9WD 1U8OA 4OFDA 4F15B 2XNAA 2XQYK 3MYZA 4M61B 1A7NL 3FOMB 3T2OA 4JDVA 4NOBA 1S7VA 4L3CA 3L95B 4BELD 4BYHA 4YDLB 5C8JB 2Z93B 1KGCE 3SDYH 3C2AH 4L4TD 4HJJL 4LEXL 5TQ2H 1FZOB 2R2HA 4U0RC 4LKXA 4NIKB 5D93C 1B6UA 4MA7H 1IFHL 4U2ZA 4JKMA 1JWUA 1P6AB 2CGRL 5I1AB 2Q7YA 5HDOA 3VWKB 4MNGB 1BLNB 1WT5A 4AEEA 2IBZY 2VRAA 4W6WB 3CFCL 3EO0B 3TFKC 1UYWL 2XKSA 2YBRA 1IAKA 2EH8L 5I16B 4JFQA 3UYRL 1T80A