2BCKA

Crystal structure of hla-a*2402 complexed with a telomerase peptide
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
286
structure length
286
Chain Sequence
GSHSMRYFSTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDEETGKVKAHSQTDRENLRIALRYYNQSEAGSHTLQMMFGCDVGSDGRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQITKRKWEAAHVAEQQRAYLEGTCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEPGSGGGLNDIF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, A-24 alpha chain
publication title Crystal structure of HLA-A*2402 complexed with a telomerase peptide.
pubmed doi rcsb
source organism Homo sapiens
total genus 76
structure length 286
sequence length 286
chains with identical sequence D
ec nomenclature
pdb deposition date 2005-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2bckA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 2bckA01
1JNLL 3RTQB 4AQ1B 4X6FA 3CZJA 2HN7A 5CKGA 5I8CB 1C5CH 2P5ED 1F4WL 2D03L 3AY4C 5HI5C 3W0WD 2YC1B 2VZVA 4QKXB 4TQEL 4X4ZA 1KCGC 4KROB 3UPRA 5CEXB 5MEPB 2FGWH 1MCHA 4BUGA 1CZ8L 1ZA6B 1QFWI 1DCLA 2QSVA 1DP0A 1BWMA 3MRFA 3PP3H 2WQRA 3IJHA 4LRNL 4OZIF 3WHE1 1UB5A 5IIEA 1A6PA 1U8MA 2X1QA 4JQVC 5I8KH 3O2WL 1U8IB 3GK8H 4LMQE 4RFOL 1KEGH 4HLZH 4MZ3A 1VFOA 3HMXA 3KYMB 5CINH 4PJGE 2EIZB 2WBJB 3QEUB 4OCLC 4WW1A 4W70A 3CFCH 3FCTB 4JFPA 1K8DB 1ADQH 2D9QB 4D9LH 1IC5H 3EO0A 4FQHB 2DIJA 5FGBC 3FQWA 3KPLA 4O2EB 2R29H 3SKMB 5F1KC 1MUJB 5MP6H 4MA8H 3ZDYF 3H9SA 3O41B 4AM0B 3O6FA 4NQCA 1PG7H 3KYKL 4G5ZH 4JFED 2IADA 1T7ZA 4PRHE 3FO9A 1AJ7L 4LKCA 2I25N 2VL4A 4MXQD 5E2WL 5LJYH 1QFWL 1HYSD 1C08B 1LO0L 1P5UA 3GJFA 3TN0D 5C0GA 2RQ8A 2EIDA 2HFGL 2VRAA 4WU5B 3CDGB 4U0RB 1TVDA 4QT5A 3IDNA 4R97C 3ARED 3U7WH 4NQDD 5FM5O 1YNTB 3DETC 3BGMB 4OD3L 4YFDB 3HAEH 1WZMA 4HUXA 4Y5XC 3FOLB 1AI1L 3GBMH 2DM2A 3DROB 5D7JC 5GRVL 3Q5OA 1PDKA 1QHOA 1MHPH 1OAQH 1BX2B 1CGWA 1RUPL 2DS4A 3T09A 4LFHG 3AU1A 4FTVA 2VLRA 1AXSA 2UZXB 4PJCA 4HG4J 2ED7A 4K7FA 5ADOH 1RHFA 4LSRH 2HVKB 4LU5L 5C70A 5D7LA 2GSGA 4XB8A 4XGZB 4R4FH 3B9KA 2F5BL 3HNTL 1QSEE 4Y4FB 3V0WL 4OCRH 1LEKB 3FQUA 1OP9A 2WINA 4MB3A 2QR0A 4KTEH 1KB9J 4EI6B 3CFBA 3KLDA 5EU7E 3RJQB 2EXWD 1FRGH 5HHNB 3TIEB 5IFAH 3LEYL 3QCVL 4JEGB 1D5XB 5C0NC 1LO2L 3VFSB 3LQAC 2CLRB 4HHAB 3HI5L 1WTGT 1B90A 5H94B 2ED9A 3Q1SL 1OLZA 1EJOL 4YHYC 1D5ZA 3KXFD 2OL3B 4XC3H 5I19H 1FYTA 1NFDB 3CFDB 4FQIL 5J1AB 4I9WD 3SN6N 1YEDB 4PY8J 4HWEL 1UM4H 1Q0YL 4AIZB 5E70A 1XF4A 2I24N 3TJEH 2MPAL 2MKWA 3OAUH 2X7LB 3TYGL 4WI6A 3IJSA 5I1KL 1OVZA 2WLZA 3T4AA 3BVNA 3PL6B 3BD4A 3MRPA 4F33A 1RHHA 4OCYL 5IVNA 3EDDA 2BNRD 5BRZB 3ARWA 4UV4H 1KCLA 4PREB 1JRHL 5GHWL 5BCAA 3CZFA 2DIAA 4Q6YA 5DJYA 1WT5A 1YMMB 3WKNA 1LO3L 3BP5B 4J23A 3RNKB 1ZHLA 4GSDL 3WN5C 1EXUA 5HYEA 2DLFH 4YFLI 1RZ7L 4D0BA 1J5OH 3RPKA 4LLDA 1NGYB 3OJVC 4U1GB 4P2RB 4QOKB 1ZGLB 3HMXL 3MLVL 1IC1A 1HXMB 2VDPL 1TJGL 5IBLC 4OTXH 1KJ3H 5AYUH 3MGTB 1W8OA 2DQUH 3VRIA 4PB9L 2A77L 3T8XB 5ID0A 2FNBA 3OB0H 3BMVA 4ERSH 3FFCA 5DJ6A 4DKAA 5D7IB 4O2CA 4EOWL 1T5XB 3C60B 5C6WH 1SBSH 5C08E 1DN0B 3G9VA 1S7SA 3S6CA 1CD1B 4WFED 4G6KH 4PTTB 1FZOB 3WE6B 5J06A 3LKOB 4GXVL 1TTGA 2V9QA 2ZKHL 1D6EA 4S1SH 3VE0B 3L9RA 3FRPA 3ZDXF 1A64A 3RKPA 4EI5C 1IEAA 32C2B 4X5WA 4XC1L 2HJKB 1FC2D 3P0VL 4HKBA 5DA4A 1KBGH 3U2SA 3TT3L 2AXFA 5I8OL 4XXCC 2XY2A 1IAIM 4W4NA 1MAML 4RGND 1YEJL 4PJFF 1GZPB 1HH9A 1NAMA 2FD6H 2X41A 5EPMA 2VLJD 5D1XC 2XKUA 4D94A 1I75A 2J6EA 5ABDE 3CSYA 3QPXH 2GK2A 3SQOH 3BKCL 5A3IC 1FNSL 3FKUS 6FABL 2F19H 1P69B 3NFPA 4F7PB 1KT2B 2KKQA 1HHJA 3GM8A 1P4LA 1P7QB 3O0RH 4LRIC 4N9GA 3LKPA 4MNQA 2VMFA 4WY7H 1G7PA 1QRNB 1XGQB 1JGLH 3JWDH 4KDWA 1WBYB 1TVHA 2PXYA 4G42A 4JFHD 5HYSG 4CNIB 4P4KC 5I1GH 2GI7A 4L3EA 4PGCB 4GRLC 1JF1B 2WSKA 3E3QC 4Y16B 3JWOC 2VH5H 5GRUL 4Y4HB 4X6EB 5BMFH 1AXIB 2CIIB 2NY3C 2YWYA 4WHTB 5LCVL 3PV6A 4JLRB 2XZZA 4DZ8A 3PGCB 1N5AA 1DVFA 2ZSVA 1HYRC 2ZOLB 1Z6JT 2OTPA 1AHWA 3S96A 1WC7A 1T2QL 1JFMA 2K9UA 2AV7A 5GGSB 5CGYC 3I2CH 5AZ2L 1S9WB 3TNNB 2GAZB 1HH6A 1WEJL 1NFDE 2XQBH 4MAUL 5J56B 3BPLB 3S7GA 5IB2A 4AK1A 1U42A 2PW2B 1NLBH 4C58B 3UTQB 4Z7NF 1K85A 5HTSA 4LQFH 2R69H 3BAEL 3ZKXC 2E27H 4FQXD 1J10A 2LU7A 2X4OA 3WFEH 3WDJA 5J6GB 2W92A 3UBXB 2VKXA 4TRPH 1FAKT 3RVXD 4R0LC 4CN6A 1A1OB 3QUMB 4WNQB 1A7NL 4GG8B 3HZVA 3WNOA 5KSAC 2F53D 2HP4A 1YMME 2MQ3A 3T0EB 2X9WA 5KW9H 1NGPL 2Q87A 2IJ0C 4X0KA 5I1AA 3KPNB 3TEUA 5IFHH 4OV5A 3VFMB 4BH8B 4P23A 3UO1L 3RHWF 4P2RE 4W81A 4XZUA 4QOKE 4F58H 2P5EB 3E2HC 4PJDB 3MJ9A 3ERYA 1MY5A 1A4JB 4JFXA 3W0WB 4XHJD 2LU4A 1SYSA 2K7PA 4XCFL 4HUMB 3LMJL 4HIJB 3QIUA 2YR3A 3HB3C 1F4HA 3RGHA 4HQQH 1T7XA 2UZIL 5D93B 4PRIA 1F42A 5D7IE 1T2JA 2VSCA 1V3JA 3QWOB 4JREC 1AY1L 3OPZH 2AJZA 5CCKL 1UM6H 2DWDA 5SWSD 2VLMD 4JDZB 2NY0D 3LQAH 1KG0B 4IRJC 1G7QB 1CLCA 4K3DL 4WO4C 3KPQB 4JY4A 1IAKB 2X4RB 2B4CL 4EUPH 1BQHG 3MUY1 5EB9A 4PJ8D 5IR1A 4EIGB 1BD2A 1RUQL 5IVXA 3ALWA 2A9ML 1YYML 4M43H 3JTSB 1GPOH 1K9TA 1MSPA 2WANA 5FM5M 5TDNA 3S4SG 3FONB 4GXUN 2YPLB 1YY8A 5FYKU 3EOBA 2J6EL 1TFHA 3BWAA 4IHOA 3X3FH 4I1NB 2QQKL 1KN2H 4LCCA 4MJ2A 1F2QA 1YN6B 2AS5M 1MLCB 1JTTA 1IM3B 4Y2DD 1YQVH 4YIQA 1I7TB 3LOWA 3TN0B 4J4PC 3ZKMD 3SJVA 5FHBH 2EDWA 4YHZH 1MCBA 1MPAL 4KKLD 3RIAF 4B53A 4RNRB 4W4OA 3KLAB 5IVZB 2BVYA 3VXRB 4MJ5A 2BRRL 2J88L 3CLFH 1G84A 5EFIB 2XWJA 1IC7L 3V4PH 3WXVH 5KG9B 1OAZL 1KTKE 4JDVB 1HSAA 3J7HA 1J9CT 1YNLH 5DFVD 3AMLA 4IRSC 4MX7A 1NDMB 3U0TA 2D0HA 4WTZG 3U1SH 3IDYC 1VFMA 4ELMF 1OOAA 2MCPL 1DBAH 3X13B 5E00A 5ANMA 2XN9B 1Q9LA 3MLSH 3MV9D 2LAAA 2CIKA 5L88L 3F58L 2X05A 3H9HB 2EYRA 5JW5A 1GGCL 5DRWA 1PYWB 3O3DB 5EC2A 4UQ3A 3QSKB 5HHMD 1MF2L 1ZVYA 1X5KA 4RWYH 5ALBH 5F6HI 3WNLA 1II4E 4RX4D 1RUAH 4PJXF 5CSGA 4PG2C 1MIML 1B6DA 3KXFB 1XR9B 3RQ3A 4JGJA 3ZKSD 2BMKA 4V1DA 1R5IB 3Q0HA 3T0EE 4NKMB 2HMIC 4Q6IA 4K71C 4G6FB 3MRLB 1BFVL 4MXVE 2AGJL 4RISL 2YOCA 3I3DA 3OGOE 1QOKA 2RR3A 4HIEB 3RWHB 5K9OB 2CUHA 4NPYA 4YDIH 1WJ3A 4NQSA 5CBAA 1RIUL 1ZV5A 4TUJA 2W60A 4YR6A 4C83B 3MJ9L 4ENEC 2P5EE 4PJDE 5IK3A 1NGZB 1T0MA 1KCRL 2HKHL 5HYQA 3W0WE 3BW9A 2DIBA 2HFFA 2CR6A 4LNRA 2VABB 5L7XL 2BNRB 1A6TA 5DD3L 3PGFL 3ARPA 3S35X 4NN7B 1EX0A 1FIEA 1T1YB 1C1EH 5I76B 1JPGB 3A6CL 2W0FB 3HE6D 1MFAH 4JFDE 3JWOH 1T1XA 5DRNA 5KSVA 5GRXG 4NO0A 4CVZB 5KS9B 2J8HA 1BIIA 1CF8H 1H9VA 4X6DA 2R1YB 3QH3A 3CPLA 4M48H 1Y0LB 1R24A 4FN0A 3D3VD 2CK2A 3OF6D 2GITB 3EOAA 5ALCH 5GRVK 3WIFA 4OI7A 1AH1A 4ZAKA 2YN5A 1XF5B 1BP3B 3RY6C 1M71A 2VXUL 3TJHA 3ULSA 5HY9B 3TF7A 2PTTA 5KOVC 1P4BH 4WUUB 4DQOL 1JYXA 4UNVA 4J3WA 2DJUA 1N6QL 5CEZL 2YPLE 3VI3E 3MODL 4ONFH 2FJHA 1A7PH 3D6GA 4JM2B 4NWTH 2BY3A 1UWGL 3ARFB 2AP2A 3VXPA 3IDIB 3ES6A 5E7FA 2GCYB 4CN4A 5C07B 2RIKA 4NUJA 4GW4B 1I1AC 3VXRE 2HT3D 3UYRH 3MRQA 4X4XA 1A1MB 3QUYA 4RGNB 2MHAB 5IMMA 3DYOA 5IB3A 5EU7C 1AGFA 1ORQB 2VLJB 4BFIB 4OM1L 4ZDHB 3DO7A 1A9BA 4M1CD 5C6TH 4X8JA 4Q9BA 3WJLA 2O5YH 3MOBL 4P5TA 1FLTX 1W0YT 2UVEA 2ADIA 2JJTC 3SGDH 4QHMA 1URLA 3IETB 4ZQKA 2FX9H 2OQJB 5T3ZL 1F13A 5HYSB 2CO6B 4WW2B 2VXVH 4F3FA 3S5LA 3I50L 4D3CH 3SKOA 1F8TH 2XN9E 3RTQC 1UKSA 2NCMA 1RPQA 2IMNA 1GGBL 3V4VH 2XXCB 4MD0A 4ZUTA 1D6VH 2EC9U 2FZ3A 4I48A 3MLYH 2OJZH 4QTHA 1A4KA 5D5MF 4HUNB 4RAUB 3VCLB 25C8L 3C5ZA 3U6RA 3H9SD 3O6FD 4KROC 4NQCD 2AXGB 2AKRA 2P8LA 3V79C 2GY7B 4XNUL 4KQ4L 3BDXA 5DFTA 3UXFA 4RMVA 3PHSA 4KMLB 2AABH 2XZAH 4OZHB 3CH1A 2A6KA 4I9WE 4OKVB 3MXWH 1BQUA 2C3VA 3RVVC 4LSPL 2WBJC 3KPPB 4ZNEA 3MA7A 4FQXB 5GQBA 5GZOC 4OFDA 4PLJD 2I27N 4NM4L 5FECB 4P3DA 2CRZA 3VDBA 4ZUSA 4JPKL 2ED8A 3ZTNH 2C5DC 2BNRE 3GJFK 4N8CL 2IF7A 4Y5VC 1DJSA 1L9MA 5TQ2H 1KTLA 2F53B 1LO5B 3SDYH 3L7FA 2J4WL 1KYOJ 1S7XB 3IYLW 3MLXL 3QQ3A 5KS9E 1KC5H 3IKKA 3KLSA 2VJXA 4FTVD 2VLRD 4J3UA 4XBPB 3WO3B 1UACL 1OTTD 2JF1A 5I15L 3ARDA 2OZ4H 3MRDA 4U0RC 1OQOA 4NYLB 5D7LD 3MRMB 3B9KD 1MCKA 1ZA3B 2R4RL 3F6IA 3NFSH 5F7EH 1E6JL 2VL5A 2OS7A 4BQCA 1RUMH 5C0JA 3RU8H 4QRPB 1NFIB 4WUUE 3SDCA 4F9LC 3RWCB 3PDGA 3HZYB 5TJWK 5TF1L 3ZSSA 4Y19A 4ODTH 5JPNB 4H0HB 4XVTH 1ETZB 1J1PH 3SGKA 3WBDA 4XTRC 3RWJA 2VC2H 4XCNB 3QP3A 4XBEH 4M6OL 1Q9WA 1FYTD 4XP1L 1RZGB 4ZFOA 2NLJB 1INEH 3QQ9D 4UV7L 4X80L 4PJ8B 3LS5H 5C07E 2EH7H 4M62L 3QHZL 5DJXB 3S4SB 1KB5H 1OGAA 4R8WH 4CGTA 1X7QB 1FIGH 1GZQA 5FCSH 4MXWL 2Y6SD 4RGNE 1NC4A 1JZ8A 3U0WH 3RVTC 5DMYA 1X5AA 1OL0A 2OM5A 5ICYB 1YEGL 1U8OB 1SM3L 2GYSA 1XR8A 5DJAA 1VESA 5J89A 4MCZA 1NCDL 3GI9L 1UQSB 1A21A 2NTSP 1DUZB 3WUZA 1F3JB 5EUOA 4Y2DB 4YDVA 4LPWA 3SE9L 4H88L 1A9EA 3V52H 1FNAA 3IKCB 4HBCH 4TPRH 5DJ8A 3WLWD 2FIKA 2V7HA 3QO0A 4KTDL 4OLVH 2B1AH 1YEHL 1AGCB 2DTMH 3GEWB 4U1SB 3VRJA 2M2DA 1KLUA 4HXAH 1GHFL 4G6ML 2EDBA 4S0SD 4XBGA 3TP4A 3AAZA 5DT1L 1C5BL 1WGOA 3BP6B 4AJ0A 4K9EC 4ZUVA 4KJYB 4JKMA 2J8UB 4KUZL 5D7KE 4XNMB 1N5YL 4F7CA 4HPOL 3FFCD 1CFQB 1QVOA 3PP4L 5IWLC 1BQLL 4O58H 1T3FA 4X98A 4HC1A 5HHVL 1I9RH 2X1WL 2UWEA 1UADC 3QG6A 3GSVA 2Z91B 4OZHE 4LCUB 1QQDA 1FNGB 4ODUA 2XKNA 1O7SA 3QT2A 5HVWA 1KGCD 3M8OL 2YA2A 4HS3B 4ZUUA 5TE7H 2QKIB 1JGVL 1CI5A 1Z5LA 4GRWE 2EH8L 1I8KA 1DEEB 3EGSA 3W39B 3BP4A 4LDEB 1H8OA 3VXUB 2FLRT 4IRZH 2YXMA 4PJ7B 4KZEH 3NH7H 5E56A 4PGDA 3QXAB 1A6WH 2QSTA 3QJFA 4NC1E 3C60C 4LSUH 3NBNA 2F53E 3T0BA 3T0VA 4U1MB 2Y07H 2YXFA 4PG9B 3NIFE 3QO1B 1W0WA 5SWQA 5L8LB 5CIPH 3RWIB 1IT9H 1U3HB 4NZRH 4U0QB 5D70L 4MNQD 3RPIB 3DWTA 3TV3H 4PJ9A 2O93L 1I3GL 4AH2B 1OTUC 2PXYD 2B8OT 4M5ZH 3V6FB 4IMLA 4XWOD 2CMRL 4L3ED 1KXTB 3V0AC 5HVGB 4RFNC 3LV3A 4N90D 5GGQL 1ZLVH 1KXQE 2A6IB 1OGTA 4QRPE 5IM7B 5HJ3A 1MI5A 4UT7H 1B4JH 4WI3A 5F3HB 4F57H 3VMNA 4AT6A 5CJQL 5BV7C 1DVFD 1R5VA 4I77L 1H3XA 2G5RA 1LQVA 3RVWD 4YDKL 1YYLL 3H0TB 3EHBD 1R5WB 3H9ZA 3T2OA 1ZWIA 3GDBA 4TUOA 3D3VB 2DBLL 3PGDB 4ZFOL 1X44A 1DBJH 1JPTL 4MCYB 1XZ0B 4LSSH 2AJVH 5F1SA 2VLKA 3EYFB 5I66B 3OKMA 5KVEH 3MNWA 4Z7VF 3GKZA 2FX7L 2Q86B 4A6YA 1NBVL 2JJUA 1IGTA 3MBEC 1M7IA 2VE6A 5HSFA 3UMTA 4LP5A 4Y4HC 1Y18A 2HJFA 1DN2A 3TT1H 4L8SA 3CXHJ 2VYRE 2AXHA 3DI3B 4U6YB 4J6RL 1NEUA 2K1MA 3OJMB 4PS4L 1EVTC 1S7VB 2ZNWA 3DHMA 5TE4H 5DQJB 1FO0A 3MC0A 3MUHL 1IGCH 4GW1B 3GMQB 5MI0B 3I02B 3BPLC 4I0PA 1I9IL 4P23D 1T83C 1KJVB 1ODAA 4XMPL 3QDME 3D69A 4LAJH 5GGRY 1NJ9A 5DVLA 2E9JA 1Q72L 3UJTL 4DKFH 3L5HA 3MJ8B 4GT7A 3BOVA 2ESVE 3SE3C 4FQCH 3QIUD 2R2BA 2DQCH 2DJ4A 5LGJA 3UPRB 2IFGA 1JFQH 1N0XL 1JL8A 2IBZY 3BKYL 2B0SH 4PRID 4QXGH 1A3LL 2A9NH 4PJGF 5EIIA 3MRFB 4ZYKA 3IJHB 4HC1L 4UTBH 1UB5B 3T0EC 5IIEB 3SOBL 4L4TB 1U8MB 5KVGL 5K9KA 1FORH 3V7AG 1Z9SA 4HEME 5JXEC 5JOFA 3VFWA 4WHCA 2GJ6E 4KGJA 4RZCA 5D72L 4HXBH 3QA3A 5HHPA 2IAMA 3T08A 3Q6GH 3EO0B 1DQLH 3ESVF 3FQWB 1TZIA 3PWNB 4K8RL 5CBEB 1BD2D 3MLRL 4P46A 2FRGP 2P47B 3H9SB 1O5DT 3O6FB 5EBWA 3VXUE 4P2QA 5A40E 4NQCB 4PJ7E 5DMIL 1A6VL 4X99A 3S3JA 5KSUA 5CEZD 3Q3GA 2BY0A 4ZTPH 4YDLB 5E99H 1DQJA 4LKCB 3SY0A 1HIML 1MCPH 5EN2B 4PP8C 3GJFB 3VMPA 5C0GB 3H42L 1J0YA 3SJVD 5FO9A 3SBWC 5C1MB 4QRSB 5DZOA 1L0QA 3LKRA 3ZO0A 4S1RH 2ZPKL 4POYA 2OL3H 1QBLH 1G9NC 4HUXB 3GBLA 2Z8VC 4LEXH 4OLZL 4P59H 4RGOL 3D9AL 5JA9A 3VW3H 1JMZA 2ARJA 5D7SH 4PGJA 3DVFA 1U8PA 4HBQA 5D9SA 4GS7B 4K9EH 1NUNB 1DBBH 2A1WL 2ERJB 4JO4L 3REWB 3P3YA 4MXQC 5CJOL 4FTVB 1AXSB 1UENA 4PJCB 3TN0C 2DQIL 1GGYA 2C3WA 4K7FB 5JW3H 4H25A 5E8DL 5T3ZD 3D3VE 3G5YA 5D7LB 2GSGB 5ITBL 3MO1A 4HS6A 2DQGL 3AREC 1PZUB 4FFYH 5F7NC 4JKPL 1Y6MR 5F6IB 1BVKA 2WINB 4NHUA 3CFBB 3SKUD 3IFOA 3G5VB 4M7KH 3CDCA 4NZUH 2OP4L 3LN9A 2EE9A 5AG9A 3I84A 3VFOA 4YFEA 4CU8A 1VENA 2E3VA 4Y1AA 3TO4B 1UEYA 2RCSH 2HFTA 3BSZL 3C08H 4OF0A 1D5ZB 4KPHH 3RL2B 4DOHB 1FO0L 4V1DD 4ZO7A 2ZP0T 3OKOB 5KSBA 1RIVH 2P8PA 1JZ5A 4OLUL 1NCNA 5EZIH 2ZCHL 5E2UL 3UJJL 1FVEB 2YMXL 1XF4B 5E9DA 4XXDA 1UB6A 3IJSB 2EXWC 1YQ2A 3T4AB 4EVNA 1EO8L 4M93B 4RMRA 1H0DA 5CP3H 4F33B 3OAZH 4MJIB 4WFFE 4L29A 1JPSL 2W1NA 3EJZD 5JDSB 5FIEA 3EUUA 1I1RA 5DJYB 2VWEC 1RD6A 1IJ9A 4JN2B 2YD2A 4GO6B 5CZVL 1ZHLB 5HHOA 1EXUB 4DW2H 4NO0D 1UWXK 4OT1H 4D0BB 1Q94A 2FBJH 4LLDB 2KZ1B 4WCYH 3WFHB 4L4TE 4YDJA 1M05A 5AWNL 5D6DA 5BV7H 3VDCA 1U8JB 4MGXA 4PFEA 4ACPA 4TSAH 5J11B 1Q1JL 2P4AB 3BMWA 4FFVD 4JFZH 3WL9A 4AL8L 4ZAKD 2NY5H 1J0JA 2H26B 1AGDA 4YQXL 5DVNA 5L6YL 2H32A 2VDRH 5ICXA 1R3LA 3TJHD 1RZJH 3MPCA 4N68A 5ID0B 5TPWL 3KPRB 4O2CB 3H9SE 4NN7C 1X4YA 3BGAA 4NQCE 4F15C 4EDWH 5KAQF 3CK0H 5GGTA 2M26A 2DQTH 4EBQH 1D6EB 4E41D 2V2TA 5L2KA 3U0PA 2O5ZL 2B39A 5CD5D 2JJSC 3FZUD 4X5WB 2FYYB 1P7HL 2EDNA 1A3RH 4OAWA 3N85H 3U2SB 3C2AL 1INDL 1UT9A 1OAKL 1S9YB 7CGTA 3QUYD 4FQ2L 1TJHL 3OAYK 1HH9B 1CL7H 1NAMB 1VFAB 4JVWA 4WRLA 5EPMB 1HI6A 3ELAT 3V7MA 1HINL 1ACYL 4FQ1L 4F7MB 2Z8RA 4P57B 4NUGL 4YX2H 4P5TD 3NFPB 5CILH 2CRMA 3RUGE 4NJ9H 1FVDB 1HHJB 4FTVE 4GH7B 5C8JB 4N9GB 5T1DL 4MNQB 1X5GA 1G7PB 1A7RL 1KF9B 1TVHB 2PXYB 5D7LE 1WZ1L 2C3GA 1LNUA 1XCQA 2BY1A 4L3EB 1LQSR 3S5LG 4AEHH 5EOQH 5EZOH 4OUOA 4RGNC 2GHWB 5DHVH 4M3JA 4OFVA 4NQUA 3K3QA 2WAHA 3QCUH 2A6DA 3PV6B 1RK0A 3DUHA 3G04B 4DZ8B 1N5AB 3C5ZD 2ZSVB 1WFNA 5CLWA 2PETA 4HULB 4C56B 1I7UB 3S96B 1WC7B 1HCVA 2AV7B 4FQLH 5CJXA 1CLYH 3IB4A 3UYPA 4DOHE 3KPSE 4CVWA 5F97E 4UQ2A 5IB2B 1N7MH 4WW2C 4XPBH 3NPZB 3GJEB 1RJYB 4KAQL 3DXAA 4U1LA 4BKLA 2R0WH 1CD9B 4UINL 3ARGD 2X4OB 3P30L 4A2MA 4NCC1 4Z78A 35C8H 4MJIE 1G6RL 1HILA 3F7QA 4BSVA 2VISB 1CQYA 1G9NH 3LZFH 5LXGL 1OHQA 3HZVB 5ENWB 3K4AA 2YPKA 5KZCD 4X0KB 4OV5B 3P4LA 4L8BB 4Y0GA 3DX7A 4GXUM 3QUZA 4XZUB 4OLXL 3MNVA 3ARDD 1RI8A 1IAMA 5D7IF 3GO1H 4F8QA 3I6GA 4FQXC 2E6PA 3MACH 3QIUB 5KVFH 2DLTA 3RVXC 1ZS8A 2LV4A 4PRIB 3SDCD 2X4SA 1KJ2L 5FYKL 3KPRE 5CGTA 3UJIL 1UH2A 5GGTL 1W0VB 2DWDB 3ULVL 4YXHL 3IJYB 3N1QC 2F54A 3L3IA 3DV6A 3NZ8B 4G8IA 1LK3L 2X42A 4JY4B 4JG1H 3NZHH 1IQDA 2DQHL 5C0EA 5IR1B 4OIIH 1BD2B 1PD6A 2X70A 5IVXB 1OGAD 5F7LB 1YEKL 3P73A 4Z5RA 1NC4D 3CVHL 1ACZA 4E42B 4DUVA 3EOBB 4IHOB 4YHPA 1ITCA 5GRZA 4PRAA 5C6PB 3BEWA 3ISWA 4LCCB 3C2SA 4IBLT 5DUMH 2AEQH 2WUBL 2IPUG 2CLVA 2NY0C 4LSVH 3M07A 3D85A 3MXVL 4M8QB 3SJVB 4W6YB 2OJEA 4XAKD 4G8EA 2QLVB 3GUTA 1HNFA 1AQKH 2RJMA 2IQAA 1GC1L 4MNQE 2YUWA 4I18B 2CGRH 3DYMA 5DUBA 3FAXA 3DECA 2F58H 3CMGA 4JB9H 4TNVK 1JPFA 4GMTL 4PJ8C 4F9PA 2HRPH 4L3EE 4OB5H 3RWFB 4Z8FL 4HIHA 1GCFA 4HCRA 5B39A 2XWJB 3QEQA 1PGRB 3A6BL 3WJJC 2ICWA 3OR7A 1IKFL 5ESAA 1EHAA 1WZLA 1I8LA 4DN3H 1HSAB 2EYTA 4UDUB 4FA8A 3NA9H 3U0TB 3C8DA 5C0CA 4Y2DC 3CU1A 1JJUA 4H0IA 4C56E 4Z7UA 3ZKMC 1YNKL 4KKLC 1N4XL 5E8NA 3SE8L 2Y06H 1J88A 1FLRL 1IC4L 5T5NF 5ANMB 5I17A 2LFGA 1AC0A 1MEXL 2CIKB 1BFSA 4X7TA 5E94B 4HFWA 3P4OA 3BE1H 3BPCB 2EYRB 5JW5B 5DRWB 2ORBH 2DMKA 4UQ3B 5JQ6H 1KNOA 3B5GA 4X4MA 4K07A 3QDGB 1ZXQA 4K8RD 1RZFH 2SEBA 5I9QB 1C7TA 4MXVF 5DFVC 2BP3A 3LKNB 3ZMRA 3TA3A 2OXHA 4NC2B 1IGML 2BMKB 1PBYA 4V1DB 4Q6IB 4YHKH 1P2CA 4PJDF 1FV1B 3TWCH 3FB8A 3ARZA 4R4ND 4OZFG 5BVPL 1EUTA 1KCSL 2DQJH 3H3BC 4NQSB 5EORL 5CBAB 4PJ9D 4TUJB 2W60B 4YR6B 4RA0C 5IK3B 1T0MB 1YEFH 4JR9L 4RQQA 2WUCH 3BW9B 4N0FA 2HFFB 4LNRB 1K4CA 2Z31A 1T21A 2XV6B 2JJVA 1R0AL 3VGBA 2R4SL 4NKDA 5F7FA 4PRIE 3EFDH 1MI5D 1MHCA 4ZTOL 3NPSC 3S37L 4DVBA 5DRNB 1KCUL 2BOBA 2YA0A 5KSVB 4BQ6A 4IDLA 4TTGA 3F12A 5GS1A 1Z3GL 3QH3B 3CPLB 2AVGA 2X2YA 1R24B 5DQ9A 1CXFA 1MOEA 1UFUA 1K4DB 3X17A 4UT9H 4HK0B 5F7UA 2ZG1A 1M71B 2AJUH 2ICWI 5D6CA 5EO0B 3VI3F 3ULSB 4HX1A 1OT2A 5IW3A 2XIDA 2Z93B 2EC8A 2PTTB 5HI3D 2CUIA 5IBTH 5ID1B 2Q8AL 3TPUA 4YH6A 1Q9OA 4BQ9A 5C92A 4JDTH 1TPXB 1UG9A 3MJ7B 2FJHB 3FQXA 3UZQA 1GGTA 5AD0B 3VXPB 5DSCB 4YE4H 1D7FA 3ES6B 4NP4H 3GB7A 5EOCL 3WD5H 1MRDH 1FGNL 4J3XA 2ZCKH 1AQDA 4I0PD 3GHEH 4NUJB 2CKNA 3MRQB 4FP8L 4KGLA 3B2VL 4LIQE 1PSKL 3QUYB 4OIBA 2D9CA 3BKMH 4HCRL 5IMMB 3ILQD 5KANI 4V2BA 5IB3B 3KJ4B 1AGFB 3P11L 3CMOH 2NXYD 2DN7A 4LCWA 3KYNB 4DKEH 5GJSL 3OHXA 1VGEH 2EE2A 4X8JB 3WHXA 2GQHA 5DS8A 4EN3A 1EMTL 3FMGL 2X4UA 2HJLA 4XNXL 4P5TB 5E2VL 4HLZG 2ADIB 4O5LL 2R2HA 3ARBB 1JYNA 1NSNH 1FBIH 4F3FB 2VXQL 5DD1H 3S5LB 5FOJA 5MI0C 3KLHD 1EEZA 1U93B 5ANME 3SKOB 2XA8H 3BX7C 3LKSA 4NFBA 2YA1A 4NFDA 2HT3C 4H8WC 4X9FA 3WS3A 2C3HA 1NBZB 5J6HA 3DNKA 4MD0B 3U4BL 1OP5K 2IAMD 3HCVA 5J57B 3SDXA 4I48B 4AZ8A 2W0PA 3ROLB 4P46D 2XICA 3QDGE 4YHMH 1HXYA 2FJGB 5DURD 3U6RB 1OARH 4H20H 4M1CC 5AAMA 1A7QL 4JZOA 2PYEA 4P2QD 1KCVL 3V5KA 3D2UA 2P8LB 2Q7NA 2CKBL 2XY1A 1CFBA 3DX8B 5SX4H 4K3GA 1S5HA 2NY6D 4PJIE 4ODHH 2A6KB 4UDTA 3QAZB 3HAEG 5I1LA 2Q1EA 4RDQG 1T03L 2GKIA 4DKDC 3HE7A 1M4KA 3DGGA 4S1DC 4ZODA 4HGWA 3MA7B 4FHBD 4KVNL 5JW4M 4CMMA 2R2EB 3F7VA 2BHZA 2AK1L 5GISH 1DQDH 4KRNA 4N8VA 4X6CB 3ZL4L 3O45A 2Z4QA 2M1KA 3DO3A 4P3DB 1VDGA 3VGHA 4YHOH 3X3GH 1OAUH 3IFLL 4M00A 3O6FC 5E2TH 1FQ9C 1F4AA 4Y5YA 5CEYA 1BVZA 3CFEB 1MVFA 4ZFZA 1JK8A 1KIPA 3L7FB 1Z0NA 5KZCB 1QFOA 1YECH 2NW3A 4YWGL 3H3PL 2PKDA 4YDLC 3MTRA 1JZ7A 4N0UA 1TETH 1QLFB 2FJFA 3HUJA 4GKNA 4S10A 3ARDB 2BC4A 4NKOA 3O6KH 4YC2C 5ITFA 3T0WA 5DO2D 5IHLB 3OG6B 3OJDA 3B2UD 1SYVB 5JNYA 5EC1A 1RMFL 2VL5B 4P3CL 4CL7A 5C0JB 4HPYL 4N0YH 4Q9QL 4TNWK 1LILA 3SO3B 1ZTXH 3WFCH 3SDCB 1TJIL 1MRFL 1QLRA 4JM2F 4XPAH 1JNLH 2ITDA 5C09B 4ODBD 1WBZA 4U6XA 4Y19B 4LCYA 4GS7C 1UZ6F 4FG6D 2ADFH 4Y1AD 2R23A 1F4WH 2D03H 2ERJC 4N5EA 2P46B 1ZANL 2HA1A 3RWJB 1SEQL 3ULUL 3MCKB 4TQEH 2JELL 1PFCA 2CDGA 4NJAL 1Q9WB 1OTTC 4YZFE 5F21B 2AJYH 2VKWA 3WV0A 4DAGL 2EDDA 4JY6A 3RI5F 3ZE1E 5DMJB 4S1QL 4XP4H 4PBWD 4LRNH 4Z0BH 2EKSA 4M3KB 5F1NA 1OGAB 1HWGB 2OTWA 5MEOA 5E9DD 4GAYB 4RFOH 2YEZA 3R0MA 4NNXA 2DM3A 2BCKA 2BVUA 1CT8B 1BZ9A 2ADJA 4MCZB 4M7LH 3HNSH 2GK0A 4QXUL 3P9MA 2YD9A 5EUOB 4YDVB 3TO4C 4WW2F 1JV5B 1A9EB 5I73C 5GGSY 3V9FA 1LK2A 2XA3A 5DJ8B 2FIKB 5HHOD 2V7HB 4XMKL 3QO0B 5CZXD 4HH8A 4PRBA 3QQ9C 2W9EH 3PF2A 3GMRA 3VRJB 1CYGA 1KLUB 4L4VD 3WIHL 3DV4A 4PJEE 3AAZB 1AJ7H 4XCCL 5C3TA 5E2WH 1QFWH 4KC3B 2Y6SC 1S8DB 3ARUA 2GT9A 4ZD3L 1J87A 3GKWL 5HD8D 1CDGA 1LEGA 4L8CA 5K33A 2D7TL 3TZVB 3PHQA 4OZHF 4CW1A 15C8H 5CWSB 1QVOB 1RZ8B 3OKNB 4KJPD 4RMWA 1WT5C 2D4FA 4F37K 1T3FB 4FXGB 4X98B 1AI1H 3RA7L 3WLWC 4N9OB 3IS1X 2CSPA 4GRWF 5IMOA 3QG6B 3GSVB 1QQDB 5L2KD 3IFPA 4HS8L 2F5AH 4ZO8A 1JHLL 4ODUB 3AC0A 3WFDL 1MCDA 2XKNB 2YPVL 1AGEA 3TBSA 5J11C 1ORSA 3ECBA 4I3RH 3ZHLA 5FKPA 4ZUUB 2RBLA 4PJAF 5KVDL 3IDJB 3MRHA 1F6LL 1I8KB 4LDOB 3EGSB 3BP4B 5IJVB 1WCBA 4LU5H 4X6CE 5IB5A 2BNQE 3NIFF 4GOSA 1BPVA 3VI4E 1EGJA 1TZHA 3HNTH 3V0WH 3QJFB 1I9EA 4NQVA 1IAOA 1F6AA 3R1GL 4WTWA 1WICA 3GSXB 3HS0A 3VH8G 1DANU 1AR1D 1G9MC 4XHQA 3LEYH 4HK3N 1RVFH 1W0WB 1MFDL 1LO2H 3EDJA 1T22A 1UGNA 5SWQB 5IMLA 3AFLA 3HI5H 5F7HA 1FG9C 4BZ1H 3Q1SH 3QDAA 1AFVL 4JO2L 1EJOH 1ZVSA 2QL1A 3CSGA 1CCZA 4IMLB 4HIIA 4FQIH 5DWUL 3LV3B 1DSFL 3HKFA 3C9NB 1OGTB 3OKDA 4JY5L 4OZIA 4H8WH 1MI5B 4HWEH 3VGFA 1Q0YH 1T1WB 5FYJU 5C09E 3WKML 4AT6B 2EDKA 1UWEL 2MPAH 3O4OC 4Y19E 3TYGH 1VADA 4UIMB 5I1KH 2W65A 4OGYH 4TUOB 3BN3B 3RX7A 1FZMA 3C6SA 1JRHH 5GHWH 3IGAA 1LO3H 2PXYC 4FZEL 1RY7B 2VLKB 3M1BA 3GSNA 4QO1A 4GSDH 4Z77A 4E5XB 4XWOC 4NO2A 1RZ7H 3LPFA 3DXAD 4A6YB 5BXFA 3QG7L 4NQXA 1M7IB 1EHXA 2VE6B 3HMXH 4LARL 1HNGA 3B83A 3JV4A 5I75C 5K9QI 1Y18B 2HJFB 2OBGA 3OXRB 1WIOA 1XAUA 1MLBA 4OKDA 1DVFC 1EHLH 3E1F1 2EYSB 4JKWA 4PB9H 3RVWC 3RZCB 4HFUL 4OV6F 2NMSA 1AHWC 3EHBC 1HKFA 4LK4A 1FO0B 4LPCA 2BSSA 5FYLL 1TTUA 2IGFH 2UVFA 4Y7MA 5HGDA 4NT6A 3QUZD 5INDA 1FN4B 4GXVH 4BYHA 5C0FA 2ZKHH 3BO8B 3D69B 1CGTA 4R3SB 4NWUL 3L5XH 1JUFB 3GJFH 3K2MC 2H9GB 3NIDE 3G9AB 2AAVA 4K94L 5LGJB 2R2BB 1NMCB 4P5KA 3CC5A 3O2VL 1NFKA 2VIRA 4UNUA 3MGAA 1Y6NR 3RX8A 5I8OH 4U31A 1J05B 4DUWA 4ZYKB 3OQ3B 5BOZG 1YEJH 5JTWA 3SEPA 2E9IA 4CN1A 5K9KB 4GAGL 4EUPG 2F54D 1GIGL 1TZGH 4YNYB 4KWUA 5JOFB 2IBBA 1WK0A 3QWQB 2XTJD 1MJJA 1QFUL 3V8CA 4P23C 2DQDL 3BKCH 3TFKA 1FNSH 3FO2A 6FABH 4LNVA 4PJ7F 2IAMB 2MNUA 4UTAL 3L95A 4E0RA 4QXTA 1C8PA 2VXSL 1TZIB 5T33L 1KTRL 4P46B 1CFTA 2OR9H 3LSOA 5DURB 3W2DH 1J1XL 3U82B 3QIUC 5EBWB 4P2QB 1EGJL 3NN8B 3BN9D 3VFRB 5KSUB 4GKOA 3O11A 5DLMH 5JUEL 1OAXL 4G3YL 2APFA 3HAEB 1RSFA 5I6XB 2ZUYA 3SY0B 5IW6A 4D9QD 3LKQA 2B20A 5CJ8A 3D85D 1B2WL 3JWNC 4X7CC 4Y4KA 5GRJL 3ETBF 3BIKA 1WWAX 4OCXH 5CMAA 3LKRB 4BUHA 3VG9B 3RAJL 2HG5B 1H3VA 5AZ2H 4X7SL 1X5FA 2DBJA 3EO9L 4UU9A 1WEJH 4ZG1A 2IPTL 1FL3A 1LE5A 3QEQD 3C6LA 3GIZL 3BIAX 1U8PB 4GKZB 4LAQL 1MI5E 4KMTL 3L5JA 3NACL 1KELL 2X4PB 2YD1A 4LCCC 5D1QB 4TVPE 4Q9RL 1VKXB 5C0CD 1QRKA 4KRMB 1NCAL 4KQ3H 1YJDL 3BWUC 4D0CA 5DJZA 3G5YB 3MO1B 4HS6B 4W4OC 5F6HJ 4I18C 4KXZI 1NGPH 3G6DL 1BVKB 1FNFA 2VLKE 1YA5A 1QLEL 5HDQL 4U05A 4OBSA 4L3CA 1IAII 5FUOH 3UO1H 3IFOB 3S37X 2ZUQC 3T2NL 1T04A 3DUSA 4QCIA 4XB7A 4R9HA 2QQLL 3FT3A 3VFOB 2NYYD 4Y1AB 3VWKA 1KFAH 1AXTH 3IF1A 4RSVA 5KANG 3TA3D 3LMJH 6CGTA 5FV1L 2YN3A 2BK8A 4XNQA 2ZJSL 4OFKA 5KSBB 1XGRB 2P8PB 4HJ0D 3HNVL 1RFDL 3EKCA 1AY1H 2DI8A 5CCKH 4HF5H 2DWEA 1G9MH 1L7TL 2AJ3A 2VUOA 3RBGA 3V5DA 5E9DB 4CDHA 1S7RA 4XVJL 5E6YA 3DUUA 3GZKA 3T4YB 3UZVB 4EVNB 4NN5B 1OPGL 4U3XA 3VGEA 3O2DA 1T1ZA 1S7UA 4K3DH 2G60L 5I9QC 4L29B 4JKKA 2B4CH 1CXLA 2Q76B 3GNML 4MD4A 3QWRA 3PQYA 5FA3A 4KRLB 2A9MH 2IQ9L 3FB6A 1YYMH 2D0GA 5HHOB 2EDFA 1N2RB 2XZQL 3UTPD 1BQSA 1NAMH 1Q94B 4Q6IC 5H37G 1M05B 4KJQD 2J6EH 1R6VA 3S36L 2IH1A 3FT4B 1IGJA 1U41A 5TQ0L 4PRPA 4JZJA 4K7PH 3WL9B 1CE1L 2DTSA 1AGDB 1QG3A 5FB8A 5ICXB 3MRRA 4RAHA 1MPAH 1EZVX 2BDNL 1CXIA 5B38G 1D9KA 2IH3B 3FFDA 3SO5A 4MDIA 2BRRH 3EJZC 2J88H 4OZGE 1EVUA 2MSPA 4ZXBA 5HHXH 2Z92A 4N0RA 4YFLF 1MCLA 4G6JL 3FHQA 4U7SA 1T6VN 4HJJH 2V2TB 5L2KB 3TBTB 4YXKL 4DGYH 3ULUD 3ULVF 4Z7WB 3M17A 4QTIH 3U9PH 4FFVC 4OAWB 3AS1A 1FCCA 3VA6A 3U4AA 2MCPH 3TJHC 4RMSA 4R90L 3TF7C 4CJ0A 2HLAA 3BYYA 4K3EL 3RUGF 1HI6B 4WUKL 1NLDL 3K1DA 3VH8B 3REVA 4LCWD 5GS2H 3F58H 3KYOB 3IAPA 3F6LA 4LLQA 4HKJA 4HK3J 1GGCH 4EN3D 3LIZL 5EWIL 1TPXC 3CDFA 3ARYA 3BQUA 4TSCL 3TLRA 1MF2H 1LD9A 4D0DB 1BM3H 4M6NL 5CD5C 1JPST 3FZUC 3ARRA 1UJ3A 2APBA 2YD4A 1MIMH 1LNUB 1XCQB 1IL1A 1G7HA 1IVLA 4M9OA 2H2PD 1MCSA 1CGYA 2A73A 1BFVH 1C5CL 4QY8A 3QUYC 2AGJH 3KJ4C 3NOIA 3BXNA 3GHBL 2D7OA 1PX3A 3VXQA 2A6DB 1RK0B 1H15A 1VSCA 3MBXH 2Q8BL 1RIUH 1N26A 3BHBB 3MJ9H 4K55A 2PYED 3D2UD 5L2JA 1KCRH 2HKHH 3ALXA 4P5TC 1VB9A 3UTOA 2V7NA 5L7XH 3DARA 5DD3H 3PGFH 3L3JB 4HSQA 3UZEA 1SJHA 2WMPA 5B3JF 4AIXA 5KSBE 1BOGA 2EEBA 4M1DL 4U6VH 3A6CH 4PGBA 5CINL 3WEXA 4MNHA 3L5WA 1QSFE 5IQ9B 3DXAB 3HE7D 4U1LB 5EU6A 4BKLB 3VMOA 4DK6A 1WLHA 3IDMA 2IBGA 1RJZA 3RBSA 1UXSB 3VFUA 4L3AA 1XF2A 1U58A 3RGVA 4N8VG 2P5WB 1HILB 4BSVB 2VXUH 3NIGE 2YHGA 2BNUB 3OGCA 2XZCH 3ILPA 4TOYL 1O7VA 4DQOH 2VDML 2YPKB 4PJBA 2QADD 3P0GB 3AB0B 1HEZA 5HHOE 1JF6A 4MSWA 4NGHL 4LHUG 1N6QH 1HCFX 3L3DB 3ZLQC 5CEZH 3MODH 3QAZC 4KK6D 1U8KB 1X4XA 3L6FA 3MNVB 4MA7L 4CVXB 2UZYB 3ZE2E 1UWGH 1PY9A 3QZWA 3T3ME 2X44D 3BH9B 3ZKND 4JHBA 4ZS7L 3P77A 4ELMA 2X4SB 8FABA 1MY7A 4FOMA 5EBMA 4DZBA 3AY4A 3QRFM 3LDBB 4WJ5A 5FO7A 4PRNB 1QSZA 3UTTE 5HI4D 1BLNA 2F54B 4N5ED 4OM1H 4U6HA 2D7PA 3DV6B 2A0LD 5F7WC 2CD0A 5L2KE 3C8HA 4LSRL 4WFGD 3VWJA 2D3VA 5DJ2A 7FABL 4Z7WE 3CX5K 3ARDC 3MOBH 5GGVH 3R4DA 1VHPA 2AJXH 1IQDB 5C0EB 4OCRL 4PLKD 2X70B 2X9XA 3IU4L 5T3ZH 4QHLA 4PJXA 4IEFB 2BVQB 1EERB 3CFJA 3I50H 3OKLA 3P73B 4Z5RB 3SO3C 4EDXA 3SDCC 1CLOL 4HWUA 1J7VR 1GGBH 3SKJL 3IAQA 1EEYB 2CLVB 2YD3A 1RU9L 1A7OH 3SGKC 25C8H 4KH2A 4XC3L 5I19L 5DQDL 3GUTB 2IQAB 1TENA 12E8H 5DUBB 3U30C 1JN6A 4XNUH 4KQ4H 1JPFB 1A22B 5CJBA 3TJEL 1T6WA 3OAUL 4HIHB 1UVQB 4F8TA 5B39B 2N7BA 2EIEA 5F7KC 2ICWB 3MV8A 2B7DT 3OR7B 2NTFA 5ESAB 4LSPH 1NEZA 1CFNA 1FGVL 4MLSA 1W8NA 4QHNB 2EYTB 5FDWA 1UWXH 2ARWA 1FDLH 4I8DA 2RHEA 4NM4H 5C0CB 1B6UA 1I3RA 4Z7UB 4WENB 4JPKH 2V9RA 3MRJA 4O51A 4N8CH 5I2IA 1HDMA 5E8NB 5C0AB 3ZTJH 4F2MA 4MAYA 2O26U 5I17B 2Y5EA 3I6LE 4JRXE 3QIBB 3RWGA 3ESUF 4X7TB 1HOCA 3MLXH 2H2SD 2XQYG 4HFWB 3O4LA 1CGVA 3ARQA 4OTXL 1CTOA 1X5YA 3KJ6L 1EBAA 1KNOB 3KDMB 1UACH 4R7DA 4PR5B 5I15H 2DQEL 2HT4D 2SEBB 1JWUA 2NW2B 2EO9A 1SBSL 3O3UN 2P5WE 3RFZC 2R4RH 4GRMA 5IEHA 3TA3B 3WFZA 5HBBA 3PWVA 1TNNA 5C2BL 1P2CB 3L3GA 1KXVC 1C5DB 4LHJB 4GRLB 2WLYA 3OR6A 5IESL 1CD0A 5BZWA 2EDQA 1LEIB 3OAYH 2NY3B 3ARTA 4M6OH 4RQQB 5J3HC 4N0FB 3SDDA 4K8RC 3TCXA 2Z35A 1K4CB 3QHFH 5FK9A 2Z31B 1NMAL 4UV7H 2AJSH 4X80H 4PGEA 1D5BA 1MRCH 3SKNA 2JE8A 1SY6A 4M62H 1MHCB 3QHZH 4JAMA 43CAA 2R1XA 3SQOL 4MXWH 3VXOA 2F19L 1JGDB 4OSUH 3CLEL 3KG5A 4MWFA 1SM3H 2F54E 4DFIA 5IOPA 4G6AD 3HRZA 3O0RL 3DURA 4U3HA 4OJFL 5F72S 3GI9H 4LKXA 4R4NC 5C86A 4AMKH 3FQTA 4H88H 5D5MA 5DA0B 4DN4H 5ESVA 5D6CB 3FRUB 1UCBL 4HH9A 3PWLB 1YEHH 4Y89A 1AD9A 4P9HC 4G6MH 1BGXH 3CNKA 3BEVA 1C5BH 5DT1H 1Q9OB 2DMCA 4AENA 1WWCA 3FN0L 1OF2B 3IVKB 5I30L 3FQXB 4KUZH 2X4QA 4POUB 1N5YH 3GB7B 4L9LA 2C4FU 3E2HB 1EFXA 5H8DA 3PP4H 3AGVA 4YBHA 5ETUA 4XX1G 1BQLH 3MLWL 3O8XD 1GAFL 2R69L 5HI3C 4JANA 1J12A 4ZSOB 4ZOEA 1BBJB 2HTLC 3WUWA 4JREB 4ZS6D 3K2UL 3F65A 4TRPL 3OHXB 1JYVA 3M8OH 5ESQA 4EN3B 1JGVH 1V8HA 4WWKA 4BZYA 2EH8H 1ZLUK 1F90L 2DICA 4G9DB 5JQHC 4ODWB 5C0CE 3RZCC 5KW9L 3STZB 5A2KH 4Z7UE 2R2HB 1BZ7A 1REIA 1OW0C 4WO4B 3Q2CA 4M03A 1QTYT 2G5BB 5C0AE 1DDHB 1PZ5A 1EEZB 1G0XA 3NABL 5FM4A 1TITA 4EJ1C 3LKSB 3MNZA 4I0PC 1ZHKB 4JFFA 5I1HL 1I4FB 3WS3B 1L0YA 3CX2A 5J6HB 3TFKD 3WIIL 1U92A 1CLZH 2V2XA 4S2SA 3ILQC 2G9HA 4LRIA 4DCQA 1JYWA 2QSQA 2C9AA 3STLA 2NXYC 2WIIA 3SGJA 3MRGA 5D70H 4PJIF 1HXYB 1I3GH 1DUYA 4JZOB 1NMCC 3D2UB 2BJMH 4Q0XH 1UM6L 5DJCA 1U8LA 1Y6KR 2ATKB 3HPLB 5GGQH 1S5HB 4DGVH 4LPVA 1BMGA 1E4WL 3QRGH 3C5SA 1T66C 1E4XI 4MB5A 4OQTA 2ZUXA 3KLHC 1ZLSH 5CJQH 4I77H 3SDAA 2DJSA 3F8UB 1V7ML 4Y4KD 3DGGB 5DEZA 2UUDK 4HGWB 1YYLH 3E3QE 4CMMB 2IAMC 3F7VB 1FFOA 1JBJA 4N8VB 2DBLH 2Z4QB 3QEHA 4WU7A 3IFNH 4P46C 5FF6B 2BOCA 2ICEB 1JPTH 3QUKA 3V5HB 3GSRB 3C6LD 2YRZA 1Q9KA 3AUVA 4Y5YB 5CEYB 1SY6L 4ZFZB 1JK8B 1KN2L 2A2QT 1KIPB 2FX7H 5C2UB 3CCHA 2QADB 4KK5D 3D39A 2NY6C 2EC9T 2NW3B 3UTPE 4N0UB 5JOPD 3WS6A 3EDFA 4R2GD 2FJFB 3HHRB 5FHBL 3HUJB 2DL2A 4HZAA 4JM4L 1Q0XH 4NKOB 4JG0H 4P48A 4UAOC 5TH2A 4PS4H 5ITFB 4ALAL 3VG9C 1E4XL 3OJDB 2XI9A 4QRUA 4WEMB 3W5NA 4XPTL 5JNYB 5EC1B 2A6JA 3OKKB 3FHAA 3CD4A 4FZ8H 3V4PL 4QYOA 2FHBA 2KQNA 5E6IA 3PWPA 3WXVL 1S7TB 5E5UB 5IFJA 4OBRA 5DDHA 2ITDB 2PUQT 1SJVA 4XMPH 4U6XB 2XFXA 4YZFF 2ZUSA 4LCYB 4R6UA 3JTTA 3UJTH 1L7IL 3VWKD 4K7PY 5IHUL 5KVMC 3CFKB 4JRYA 1CXHA 3NCBB 5HGBA 3S36X 4WI2A 2D31B 4WI7A 2Y5TB 4LLUA 5K93A 3D0LB 1N0XH 4B0MM 5JLZA 5MENA 1A5FH 2MFNA 4KDTA 4LPUA 3V95A 1A3LH 4JY6B 1EPFA 4ZPTA 5DO2C 1WIPA 5H35A 3B2UC 4WDIA 2EKSB 4HC1H 2YRLA 3V6ZA 3MMEA 4IOSD 1DQMH 5MEOB 5IB4A 1S9XA 3SGEI 4D8PA 1I85A 5JMRA 1UXWB 1ZGLP 2V5YA 4NNXB 4ZSOE 5DRZB 2WQ8A 5ALBL 5J8OA 3LRSA 2FDBP 1BZ9B 3PDOA 3HC3H 1RUAL 2GK0B 5TFSH 5BJTA 4FG6C 3P9MB 2H1PL 1XCTB 2V17L 4K8RH 4PJEF 3MLRH 5DJDA 1B0GA 1LK2B 3QWRD 4Q97A 3PQYD 2MTPA 3RWEA 2OI9A 3ROOB 3T77A 2DOCA 5DD0L 3BFOA 3TYFB 4XNZB 5DMIH 3GMRB 5IT2L 1J8HA 3DV4B 4YDIL 3P9LA 3D0VA 2ZWLT 3SPVB 1FL5B 4PRPD 3MFFA 3H42H 3GRWA 5EUKA 1IGFL 5IB1A 3TC9A 1LEGB 4B7LA 3MROA 4L8CB 3N1GC 1D9KD 3PHQB 3MLTB 3ZSTA 1YEIL 4CW1B 5E24E 4U1NA 3V2AR 2ZPKH 1MFAL 4KI1A 3HI1A 4DWHA 4OLZH 4RGOH 1DBML 3D9AH 4ZXBD 5DMKA 1PVHA 4XVSH 1OSPL 2YD8A 1QO3A 5CZXC 4F7EB 1G7LB 3IFPB 2Z0BA 1I1AB 5D6DC 4X6CF 4ESKA 2A1WH 5HDOA 1U6AL 4UT6L 4BA8A 5ALCL 4JO4H 1AGEB 3TBSB 3ECBB 3VI4F 4M61A 1DLFL 5CJOH 3C5JA 5F88B 4JFYA 3TBYB 4X4YA 2E7MA 1DE4A 2NY2D 3VU2A 5J12C 4UI2A 5E8DH 1P4BL 1KPRA 5HD8C 1WCBB 4QHKI 3EYOA 4KRPD 1BZQK 1A14H 4GUPA 5IB5B 2DQGH 5CIPB 1BAFH 4JKPH 1F4YL 1KJMA 1TZHB 1T2XA 5FYJL 2WV3A 4NQVB 3T1WA 5E5MA 5CUSL 1F6AB 3N06B 4KJPC 3QIWA 1KPUB 5I1JL 5KTEL 3HS0B 4A6YH 1DBKH 5DR5L 1N6VA 3THML 3G6AA 2NNAA 2CLZA 3BQUD 5JMOC 2OP4H 3NCJH 1H3PH 1T22B 1IFHL 3AROA 1R3KA 1OCWL 1TIUA 2IPKA 5IMLB 2FO4A 5CAYB 3DJ9A 1NGQH 1U8HA 3LQZA 2AQ1A 3KPTA 5F7DA 4IDJH 1ZVSB 3FOMA 5HVHB 4G9FA 2Q6WA 4HIIB 1FO0H 2FL5A 3RHWK 3IXAA 3UROR 4PJGA 1TVBB 4K2UL 2ZCHH 4Z18A 3OKDB 5E2UH 4G80B 3UJJH 2HRLA 3JWDC 2FR4A 2O5YL 1E4KA 1FYHB 1VADB 2Z8WC 1AR1C 1QYGL 3DRTA 4WHYH 3QULA 1IM9A 2FX9L 1JPSH 1MWAA 2EDJA 4WFGE 1FZMB 2BSTA 2PO6A 4I13B 3C6SB 5DD5H 4YBQD 1NCUA 4D3CL 1SBBA 2P24A 3IGAB 1GC1C 3F5WA 1OP5H 3GSNB 3M1BB 4Z77B 2R15A 4QXWA 4HUWA 2EDYA 4NO2B 3RDTA 2JKXA 4J3SA 1MCNA 3MLUH 4NO5B 5EU6D 1A1NB 1W72A 4HUUA 4NQXB 4Y5VB 3DMMD 1Q1JH 5A2LH 3FT2B 1MLBB 1S78D 1JHTA 4QWWD 3RGVD 1AO7A 5GGVY 1OT1A 5L6YH 3BPNB 3HR6A 2E6QA 5CJXC 5TPWH 1PEZA 5F8RC 4HDIA 3JV5A 2BSSB 3NIDF 3QEGL 4WV1A 5HGDB 4NT6B 2VITA 1TMCA 4PB0L 5C0DA 3KWWA 3ZYZA 2MMXA 4J1UA 3RIAK 3V8OA 3E8UH 2O5ZH 3GRWL 1WBXB 4FNLH 2FX8H 3RRQA 3ZTNL 5EBGA 1QSEA 5IGXL 4P5KB 1H8NA 3H7BA 4ZOAA 1EO5A 3ARSA 5TQ2L 2ZUTA 4H1LA 4OGXL 1INDH 3VGGA 2WW8A 5AZEL 3RNQA 1E27B 1TJHH 3GSWA 1MVUA 3JV6A 3AB0C 4RFEB 1WF5A 4FQ1H 2ENSA 2YZ8A 1MJJB 4OCSH 4LMQI 4JJHA 5CD3B 2OZ4L 3VWJD 4NUGH 4JHAL 2VZOA 5A1AA 2EECA 1U3ZA 1HZHL 2AQ3A 3IXTA 3L95B 3NFSL 4E0RB 4QXTB 1JRHI 2PF6A 4PJ5A 1IGIL 4BQBA 1RUML 1CFTB 4BZ2L 3SE4A 3OMZA 1A7RH 4BK4A 1J0ZA 1P1ZB 4Z6AT 1BHGA 4OLWH 2HYMA 1CDHA 3RTQA 2C1PA 2XXMB 4ZO6A 1U3JA 5I8CA 1ZEAH 2X4TA 4HMDA 3KAAA 1L0XA 5JR1L 1JE6A 5E8PA 4XVTL 3T2PA 3LDBC 5IW6B 4YUEL 3U46B 1KEML 3LKQB 5FUZL 4ETQB 2XTJC 4Y4KB 3H3KA 5JZ7C 5CMAB 3CXDH 2DD8H 3W5MA 3LS5L 1FP5A 5GPRA 1KB5L 4R8WL 4N1CA 4UU9B 3JSSA 3U0WL 1LE5B 3C6LB 3QDJA 4NCC2 2EIZA 3QEUA 3MV8D 5A2FA 3EYQD 2A83B 3BN9C 3FCTA 3MV7A 4KAQH 4X9HA 3VFTB 3QXDB 4UINH 3CJJA 5SX5K 1SVZA 3OKEA 3DETD 1FZJB 3SKMA 1MUJA 2EE6A 3V52L 4R2GB 1N8ZA 5JPMA 3O41A 1I8IA 1KB9K 3MSPA 1MWAL 3O9WA 5D7JD 5C08A 5DJZB 2PR4L 4Z95L 2HKFL 3OB8A 4KI5F 5LXGH 5DRXB 1CTNA 4MAYD 1F6FB 1X5IA 3ZDYE 5K9JL 5M7QA 1A6UL 4F9PC 4L3CB 3O4LD 1F3DJ 1C08A 1W72L 5FA4A 1YPZB 3G5ZA 4WU5A 2EDLA 3CDGA 4OLXH 1T04B 4QCIB 1CU4L 3P4NA 3FT3B 1I8LC 3VWKB 1P4IL 2IANA 2XOTA 3T0DA 3BGMA 2JK5B 2H32H 2FWOB 4G7YL 4O58L 1T0NA 1WQVT 4XP5H 4XNQB 3UTSB 1INQA 4LSQL 5FYKH 4XX1E 5C0RL 1SJEB 5GGTH 4I0KA 2DWEB 2AJ3B 3QIBC 5FO8A 4RFNB 4YXHH 3V5DB 1P9MA 1S7RB 3VRLE 1NANI 3K7UA 4LDLB 3AM8C 2NY4D 1WAAE 2VDQH 1S7UB 5EU5B 5T3XD 3SDDD 5BV7B 4IRZL 4DUXA 2NYYC 1A6WL 4Y4FA 1DLHB 1CDUA 3IDXL 4MD4B 5F89A 3TA3C 2ICWJ 3W81A 5HHNA 4J3OC 4JJ5B 1ZHNB 4OF8A 1V7NL 1TQCB 3MRCA 1A6ZA 2F74B 1JZ2A 2JB5H 2IH1B 4OUUA 4NZRL 3TV3L 1C16A 1NCBL 2DYPA 1XH3B 2WUBH 4JZJB 3CGTA 4PRPB 4OZGF 4M5ZL 3MBEB 3MXVH 9CGTA 5FB8B 2APTA 3MRRB 3U36A 5BW7A 3WFBL 1PQZA 1YEDA 1GC1H 1D9KB 3QXTA 2Z31C 4U1IA 2DQFA 4RDQF 3HC4L 1NL0H 4GMTH 4M1GH 1N64L 5M95B 4Z8FH 3VGAB 2Z92B 4OLEA 5A16B 3A6BH 1UZ8A 5E6ZA 3PL6A 4POZD 4U1KA 3S3PA 4GW5A 3P40A 1OTSD 4PREA 3VFVA 1QNZH 5IWLA 3BP5A 1QR1A 4LSSL 1EFXD 2Q3ZA 1FZKA 1YNKH 3M45A 3SE8H 3QNYA 1FLRH 1ES0A 3BT2L 4NQEA 4YHIA 1WIUA 4QOKA 4OD2A 3TGXA 5BRZE 1MEXH 5D71L 3REVB 1SMAA 3AS3A 3TT1L 2IWGA 2WBWB 4LLQB 4HKJB 3PIQA 4CDGC 4RWHA 5MHSD 3MGTA 3G5XA 3T8XA 4WWKD 3U9UA 3U79A 2ZUWA 3RZWA 3OX8A 4F80A 1NMBL 2OMNA 5DHVB 1I3UA 5D7IA 3ULUC 2JCCF 2YBRA 1IGCL 1T5XA 1UJ3B 2FO1A 3D87B 1CD1A 2APWA 5FGCB 3WO4B 5HXMA 1IL1B 1G7HB 4JFFD 4OIAA 3BZ4A 2A73B 4LQ1A 4QY8B 1P84K 5K59E 3EJYD 2CDFB 1SQ2N 4LVOC 3VXQB 1YPZE 5BVPH 4GFTB 1H15B 2X1XR 1T89C 2HJKA 5EORH 1N59A 4C57C 1JFQL 1I1YA 5KSBF 4PD4J 2AEWA 4EN3C 1P5VA 4JR9H 5L2JB 2FATL 2YD6A 2IBZX 1R0AH 1SJHB 3UTSE 2R4SH 4LF3B 1BOGB 3K8MA 3WEXB 1KCUH 4ZUWB 3QISA 3SDAD 1JWSA 2H2PC 4JFOA 1Z3GH 3NIGF 5EU6B 2APXA 4JPWL 1JHKL 5ICZB 1DQLL 1F3DH 5DZLA 1P7QA 5DTFA 1CE6A 4HLJA 1XGQA 4JFEB 4LLYB 5IQ7H 4CNIA 5A43C 1M7DB 4PGCA 2AI0L 3OGCB 5FYJD 5IHZA 3ILPB 3O6LL 4Y16A 5BVJB 1BF2A 4P9ML 4LCIH 4PJBB 2V5TA 3ZE2F 4LGSB 3I3BA 2Q8AH 3D39D 4PV9A 3AREB 4LSTH 1ZT4A 1T7VA 4NQDB 3LHPH 1QRNE 3T3MF 3NCFB 1CIDA 3P2TA 3HE7C 5E8EB 5GGSA 5CLTA 4PRPE 3LQMA 4J8RB 4UBDD 4P59L 5FV2A 2GAZA 2Y36L 4KV5E 1OLLA 5EOCH 4J3TA 4HMEA 2P44B 1FGNH 5D7SL 4EQ2A 1UYWL 5E6ID 3PWPD 4L9DA 4MDJB 4ELMB 8FABB 5GRYA 1FPTH 5FHAL 3HMWH 4K9EL 4MA3A 4FP8H 4Y5YC 4BQ8A 5LAXB 5EBMB 3B2VH 1PSKH 4DZBB 4Z7WF 4HCRH 2XTLA 3EDEA 3HTLX 4WJ5B 5SV4A 2QADC 4TSBL 3P11H 3A0OA 4JRYD 4U6HB 3CVIL 3V6BR 2ICES 2J8OA 5GSRB 5JW3L 4KK6C 3VWJB 1EMTH 4XNXH 4FFYL 1H3UA 4GG8A 5MEND 3K8LA 4GMSL 4KHXL 4O5LH 5DF0A 3KPNA 3IDGB 2EKJA 3CFJB 1ZE3C 1EH9A 2ZOKA 3VFMA 3ZKNC 4BH8A 2VXQH 4ONGL 5MERA 3OKLB 4M7KL 4EDXB 5ADPL 3PABB 2DLIA 3FTGB 1VPOH 3FL7A 4AG4H 3U4BH 1A4JA 3X11B 2RCSL 3MREB 1Z2KA 5HI4C 3WCYA 2IG2L 4XAWL 3K80A 4HMCA 1A47A 4N5EC 1FFPA 1XGYL 2A0LC 3I9GH 1A7QH 3DX6A 1KCVH 4JFDA 2VNCA 3QWOA 1LVEA 3JVGA 1U8NA 3FO1A 2FECL 5FGCE 2IMMA 1J8HD 2Q7YB 5HGHA 2XPGA 4PLKC 4D9RD 4JO3L 4NN6B 2VQ1B 3DSFL 3SBWA 3MV8B 3G6JA 1KG0A 4DVRL 1X6NA 2E5EA 3HRPA 4F15B 1NEZB 1MCQA 4M6MH 1CFNB 3UP1A 1IAKA 5EO1B 1FFNB 2VB5A 4KVNH 4HAFA 5FDWB 2AK1H 2VDOH 3ZL4H 3MCG1 3NCEB 1I3RB 3MRJB 3CX5J 3FONA 2FBJL 5I2IB 1PLGL 1HDMB 2YPLA 4F2MB 4XNZC 1V5JA 1MREL 4LPTA 2N56A 5H37H 3RWGB 2PYFA 1M6OA 1OP3K 1HOCB 5MEQB 4YWGH 3O4LB 3H3PH 1F02I 1J0IA 1I7TA 2V5RA 5I18L 1KULA 5EU6E 5I1EL 1SEBB 5BO1L 5C0IA 5L9DL 3QDHA 1JMXA 4R7DB 4RNRA 3KLAA 5IVZA 1JWUB 3QXUA 4OM0L 3VXRA 3T1FA 3D18A 4JFEE 4PRDB 4K94C 1QFHA 4DK3A 5EFIA 5B21A 4E41A 4P3CH 4AEIL 5GJTH 3PWVB 4HPYH 3QIWD 5I1DA 2DQTL 4Q9QH 4PUBH 5IG7A 2R39A 1TJIH 1MRFH 5FFLA 4PJBE 2PW1A 3L3GB 1V3LA 2Z8SA 3LEXA 4NQDE 1IGYB 1B4RA 3MRNA 3NCMA 1PW3A 5F9JA 2H2SC 4DEPC 5BZWB 3ULUH 5E1HB 2JELH 4G9FD 5F1OB 4NJAH 3S98A 3SDDB 2HT4C 2BVPA 4DAGH 2Z35B 2YK1L 2DI7A 5DUPL 5FK9B 4XI5D 2XN9A 4S1QH 3NFNA 4J2XA 3SKNB 43CAB 1AE6L 4JAMB 3O3DA 1ED3B 2QQNH 4MWFB 5JIHA 2KUTA 3DURB 1IM9D 5FKAA 4JHWL 4LKXB 3QUML 3DX9A 2PO6D 3FQTB 5D5MB 1MHHA 3KPMA 5JXAL 2YD7A 5ESVB 5HVHC 5IROC 4XMKH 3RDTD 1QBML 3E6HA 1AD9B 1SJXA 5TDOB 3HPJB 2FSEA 2NY1D 3HI6L 4HIXH 3BEVB 1WFOA 1ZVHA 2VWEE 5C9JA 2OSLB 4AENB 4C83A 3KXFE 4D2NA 1AO7D 4Q74A 3KPOA 3GKWH 4FQLL 4I2XB 5EDXA 4KJWC 2L7JA 1NQBA 2OXGA 4G6AC 4ZPVB 2D7TH 1OWRM 3TBVA 5E2JA 1T1YA 4L9LB 1CGSL 5I76A 1BJMA 2EICA 1EFXB 3ARGA 4XPBL 4H0GA 2VAAA 4UUJA 5DMGD 2VDNL 4YAQB 3PE9A 3HLAA 5DEGB 4JANB 1MQ8A 4HS8H 3WUWB 4MVBA 1I9JH 3GMLB 5IUSA 2GITA 3RIFK 2YPVH 1JGUL 3Q5TA 4Z7UF 1RUKL 35C8L 1QSED 4XMLH 5ESQB 4MNGB 4WWKB 1G9NL 3LZFL 3V0VA 3IU3A 5HY9A 3KYAA 4X5XA 3QNXA 3BPNC 1NGXA 3ZE0E 4H1LG 3TH4T 1K6QH 1K3IA 3LS4H 4EIZC 1MCOL 1P6FA 1PZ5B 5ILTL 3MYZA 3MNZB 1EV2E 4JFFB 1AGBA 2GTWA 2CDEA 2G2RA 4JM2A 3GO1L 1GVIA 5I16B 2V2XB 4S2SB 3ARFA 1MFDH 3O4LE 5IVOA 4DCQB 1G6VK 1F4XL 3STLB 1G7IB 1UM5L 4PJ5D 2WIIB 2DAVA 2GCYA 1MFBH 3MRGB 4XPHH 5KVFL 4JO2H 1AFVH 3OZ9H 5C07A 1Z9LA 1DUYB 4WFEE 4YGAB 5SWSB 3RTQD 4XCEA 2NY0B 5DFWH 4B7IA 5DWUH 4WI4A 5C9KA 5DI8A 1U95A 3N0PB 4BFIA 3C5SB 5DYOB 5HDBE 2RFXA 4UB0L 2CK0H 4W68A 2AEIT 3WKMH 1UWEH 3K8KA 3DIFA 5J1TC 3TFKC 3BKJH 1FFOB 1HQ4B 2OQJA 1FJ1A 4PY7B 5HYSA 3EYSL 2VLJE 4WU7B 4HV8A 5T3XE 5F9OL 2WBKA 2BOCB 1KIRB 3QUKB 3TNMA 4FZEH 1UA6L 2CH8A 5FGRA 1Q9KB 1KACB 3QDJD 3OSKA 1KIQB 3MV7D 5B8CA 5HGAA 5DUML 3D39B 3QG7H 4LARH 3EYUH 3E6FB 3VFGL 4TULH 4LLWA 2F9BT 1MFEH 4JFHE 3O9WD 5C08D 5TH2B 2KBGA 4O4YL 4Y4KC 2CGRL 4HFUH 2F58L 3BESR 2I60L 4JB9L 4QRUB 4ONHB 4P5MA 2I9TB 4OB5L 2A6JB 5DD6A 4QYOB 4U1HB 5E6IB 5GGUB 2QHRL 5IFJB 1GGUA 2JIXA 3C6LC 4G8FA 4LVEA 5DDHB 2VLLA 1NH6A 3FB7B 4RMUA 4YHLL 3JTTB 2WP3O 1YC7A 1CDCA 2CRYA 2APVA 2IAND 4KK5C 5B22A 4JRYB 3QFJA 3HZMA 4TUKL 5HGBB 4XP6L 1LGVA 4R2GC 3MV9B 4I2XE 4K94H 4LLUB 4PJAA 2VAJA 3FJTA 3O2VH 2Y06L 4P2OA 2D0FA 3EZ8A 5JLZB 5MENB 1CN4A 3FRPG 4IIQA 4ZPTB 2VQTA 5H35B 5HHMB 4C54A 5EBLA 3QXVA 4IJ3B 3V6ZB 5EZJB 4BFEA 3KGRA 4S0UC 1S9XB 5JQ6L 4D8PB 1QFUH 2A74B 3MR9A 2DQDH 4PJHA 3NPSB 2C1OA 4NYLA 3C8KB 1KIUA 2NPLX 3PDOB 1DTUA 3Q5YA 1MELA 2ZG3A 4YXLL 2GFBB 5BJTB 3T65A 2R0LL 5MHSE 1BEYH 4Y4FD 4MNGE 3VWKC 2VXSH 2CQVA 5T33H 1MCEA 5DJDB 1B0GB 1YZZA 3LN4A 4QRPA 1J1XH 3RWEB 2OI9B 3T77B 3HZYA 1EGJH 1EO7A 1L6ZA 4NSKA 3D25B 2HLFC 1T4KA 1PJ9A 5JUEH 2J1KA 1J8HB 3P9LB 5LQBH 4JFFE 4NO3A 1FL6B 5BQ7B 2DYPD 1R3JA 1DL7L 3B5TA 3MFFB 1GGIL 3NTCL 4MD5A 2ATPA 3TIDA 1BQHA 3BGFB 1B2WH 4XWGL 5DHYA 5EUKB 2NLJA 3HE6B 5GRJH 1YN7A 3KVQA 1EK3A 3EO1B 2JTDA 4XPFH 4U1NB 3EFDL 2H41A 3INUL 3K46A 5DJXA 5SWSE 4X7SH 2VLME 3S4SA 1IRAY 3HI1B 2IPTH 2NY5C 1JI1A 5DMKB 3GIZH 4MJ6A 3HC0A 1U8OA 1RZJC 3KHOA 3PL6D 1TQCC 4LAQH 4ODSL 4KMTH 2LVCA 2QSCH 1F3JA 1CDIA 3NACH 4UT9L 1KELH 1MCFA 4M61B 5GS2D 4Q9RH 4JZJC 3C5JB 4JFYB 1NCAH 5HHQA 1DE4B 1I7ZA 1KPRB 3RWDA 4N0CA 3EYOB 2NX5A 1LWRA 4U1SA 4NQED 5ERWB 2P49B 3O3AA 1D9KC 2EDTA 4QOKD 1KJMB 2V6HA 3GSNH 3QDMA 3MYJA 1YUHB 2OX5A 1QD0A 3G6DH 4X83A 5E5MB 1QLEH 5INCA 3BRGC 3QIWB 1G7MA 3VGAC 3NGBC 3G6AB 2ESVA 4XNMA 2NNAB 2CLZB 3T2NH 1OAYH 4WTZA 4JPVH 5J7CC 3B9DA 2FO4B 4X6FB 2B5IC 1MRDL 5ECJE 2HN7B 1U8HB 5ACMA 5F7DB 2HT2D 1ONQA 3FOMB 5B4MD 5TGBA 4KUCF 4G9FB 2Q6WB 2J8UE 1W2KT 2NY2C 5C7XH 2FL5B 2ZJSH 3IXAB 2Z91A 4KRPC 3MCLL 4LCUA 3VD9A 1H3GA 2GJ6A 4U2ZA 1B9ZA 1ZLUH 4PBXA 1I3VA 1H5BA 1L7TH 4DKEL 1AKJA 1VGEL 3OTTA 1NGWA 1KN4H 1U3YA 3GMPA 3FO0L 4IOFD 1OPGH 4KXZH 1HK6A 3BQUC 4JRYE 5T1KA 3VXUA 1IM9B 2G60H 1YEEL 5CSBA 3QXAA 3MV9E 1IAIH 2BSTB 4WW1B 2PO6B 5KBNC 5DD1L 2H8PA 3GNMH 2P24B 4JFPB 1UJ3C 3F5WB 1PG7W 2XA8L 1VACA 2IQ9H 4RCAA 3MLZH 1S9VA 3WO4C 3KPLB 4HUWB 5HHME 1DANT 2XZQH 4U1MA 3RDTB 3UC0H 2DDQL 1W72B 3MGOA 4HUUB 4LBEA 2LABA 4MB4A 1TQBB 1P7QD 2I5YL 1MJ7L 2NY1B 2J12B 1U3HA 3RPIA 4Z76A 4H20L 2XRAH 2XNAA 2IADB 1JHTB 1KTDA 1CE1H 3V6FA 1AO7B 2FLBT 3FO9B 5I0ZA 4UILL 4I5BA 2Q3AA 1MNUH 3O3EA 4Y16D 2P1YA 4GBXA 4ODHL 5F9AC 4HDIB 4QT5B 3IDNB 4YC2B 4YPGA 2UUDH 3PWJA 4YBQC 1UJTA 1TMCB 4WV1B 3VXNA 2VITB 4BK5A 4G6JH 1J8HE 5C0DB 3E0GA 4P2CG 4D9RE 4J1UB 2OR8A 1B88A 3DOSA 1CS6A 4YJZL 3QCTH 1XZ0A 2FHFA 4OQ1A 1IKNA 3EYFA 4QWWC 3RGVC 3JZ7A 1N6UA 5I66A 5FUCE 2GTZA 4H1LB 1BREA 3AU1B 2VLRB 3DSNA 1HYSC 4R90H 3DI2B 3RNQB 3GSWB 1MVUB 3JV6B 2HH0L 3R06A 4K3EH 1Q8MA 3ORJA 4WUKH 1TETL 3U7YL 3B9KB 1HQRA 2W0LA 4ZFFA 1LO4H 3FQUB 1JVKA 5C0BA 3ZZ1A 2LVEA 3LIZH 2QR0B 2BHYA 1I7RA 3VJ6A 1ZT7A 3IXTB 3T0ED 5TF0A 3B6SA 4O02L 4PJ5B 5FAAA 4N5UA 4GW1A 1R3IH 1CR9H 2EXYD 1ZTXL 1WV7T 3DPBA 4QEGA 1KJVA 2AV1A 2R8SL 2C1PB 5I73B 3MOQA 3TVMA 1FNEA 2R9HD 2X4TB 3MA9H 4M7JL 1IE5A 1X5HA 2ADFL 4CKVX 5E8PB 1FYTB 1P53A 5GIRA 3AXLA 1P7KA 3GHBH 3MJ8A 1FC1A 5EA0H 4LGRB 4QNPE 5F96L 2Q8BH 1RQ5A 4K23L 2VUYA 2AJYL 3VWJC 3HN3A 4P99A 5J13B 4JFDD 4PLNC 5DZNA 2ICCA 2VERN 4XP4L 4Z0BL 1NCWL 4U3CA 4L4TA 1ULVA 3BVNB 4G9FE 3MRPB 1RHHB 3MOAH 5F44A 4M1DH 4JZNA 1IEHA 1SHMA 1G6RA 3QDJB 1QA9A 2OTUA 4ODVL 3CZFB 3MV7B 4LP4A 2YKLL 4M7LL 5AAWA 1LE9A 2V9TA 3HNSL 3OKEB 4IMKA 4RBPK 3ZTJG 1IQWL 3PWNA 5CBEA 2D2OA 4L1HA 2WWMD 3O2DH 1N8ZB 5JPMB 5I1CL 3V4UL 1I8IB 4JVPA 4L4VA 4ZMAT 3BJ91 3O9WB 1MCRA 2EEDA 5C08B 3LD8B 4OZ4A 2YPLD 2W9EL 3CAFA 3OV6A 4JCLA 1OSZA 3CIQA 3G08A 4TOYH 2R0ZH 3VRIB 2K3TA 2VDMH 3KR3H 3PUCA 4NGHH 4YLQT 5EN2A 3FFCB 5DJ6B 5FA4B 3G5ZB 4OI9A 4NN6C 1CXEA 1KJ2A 1MJUL 2CJUL 1GL4B 3EYQC 4QRSA 4MA7H 5I71B 3P4NB 1S7SB 1T0PB 5JIPA 3VXRD 15C8L 2KQMA 2IANB 4MA1C 4CADA 3L5IA 1AO7E 3L9RB 1T0NB 4ZS7H 4NFCA 1INQB 4HWBA 3VRLF 1IEAB 4M4RA 1WAAF 2F5AL 5GRWA 2BFVL 4HKBB 4LFHD 4MAYC 4KK9D 1CFVH 2AXFB 2E7LA 3REWA 4I3RL 2EIBA 5FO8B 3RUGA 3SQBA 4UIKL 3CVHA 1HHIA 7FABH 5IJKC 3R0NA 3CSYB 3O4OB 1X5XA 2XN9D 2WZPD 4HZLA 4MQTB 2O5XH 3IU4H 5F89B 1P4LB 2VLRE 1BVLA 1E6OL 3LKPB 3G5VA 4PJCE 3MRCB 1RVFL 3C09B 1CLOH 1A6ZB 4G42B 1N0LA 1KLGA 4OUUB 3SKJH 3TO4A 1C16B 4BZ1L 1E0OB 4FQJL 2DYPB 1A0QL 4NKIL 5EU3A 4KY1H 1RU9H 3TBWA 4IM8A 3RJDA 3RL2A 2NY4C 2ZCLL 3KPSA 5I75B 3OKOA 3LCYA 3U36B 5DQDH 4HWZA 4G6FD 2NR6D 1QPXA 3SCMA 1PQZB 4PJ5E 3SDDC 1BIHA 1DVFB 1NFDF 4NM8H 4H8WL 4U1IB 3FAWA 2DQFB 3ZYOA 1FVEA 1AHWB 3AS2A 3BP7A 3K0WA 1JNNH 1SMOA 3W11D 4ZOBA 1UZ8B 2WP3T 1T7WA 2A38A 1KCKA 1HH6B 1FYTE 4YK4B 4OGYL 4MJIA 4U1KB 1DZBA 1FGVH 5AUMA 3I75A 3ARVA 4GW5B 5JDSA 2M8XA 3VFVB 2CRIA 3UTZA 2PTUA 3V6OA 4IS6A 4JN2A 1QR1B 4JN1H 3MRBA 4OCWL 3MZGB 4OLYL 1FZKB 3A6OA 3WFHA 3QNYB 4KKCD 4Q2ZA 1ES0B 4NQEB 4YHIB 5TDPA 4OD2B 1U8JA 3ARXA 4MVBD 1XGTA 3QDJE 4YO0A 4YGVA 3MV7E 1EHLL 3B43A 3PIQB 4M9PA 3KJ6H 3WYRA 2H26A 2EEAA 3G5XB 3GSUA 3U9UB 2BRQA 1KOAA 5I1AB 4M5YH 4POZC 2DQEH 3OX8B 4WUUD 4P23B 3KPRA 2HWZL 4JQXA 2YBRB 5K59F 1OTSC 2V5SA 4L9LC 2IGFL 1IILE 1YPZF 1GOGA 4JFXB 3GIVA 1SYSB 5C2BH 3BZ4B 4JM2D 3NCYP 3L5XL 3ARFD 3AS0A 5KJRH 3FFCE 4OGAD 3BIBX 3QI9A 2FYYA 4XNYH 5IESH 1N59B 1ZT1A 2AJZB 3MUZ1 5C07D 1I1YB 4FQQA 1J1OL 3UAJD 4QRRA 2IANE 1S9YA 3ABZA 4WWKC 4GLRI 1IEBA 5F70A 1CQKA 4OD1H 1VFAA 1NMAH 4HWBL 3TCLA 2FCBA 4XP9H 3HG1A 1TZGL 4F7MA 5LWYL 1KGCE 1MIEL 4KTYA 4P57A 3HZKA 2N4IA 4XHJC 5J0BA 1JWSB 2ENYA 4JFOB 3CLEH 2DKSA 4M8VA 1FVDA 3MX0A 5C8JA 5DTFB 5TDNB 1TCMA 1CE6B 3FN3A 3EJYC 4OJFH 3RI5K 2OR9L 1YY8B 4HKXA 3W2DL 3BWAB 4ZFGH 3SGJC 2VDKL 3BRDA 1KV3A 3BUTA 1UCBH 4MJ4A 3BDYH 4YIQB 5IHZB 5DLML 5I8EA 2FEEI 1FH5L 5D7KD 2X1PA 4PV9B 1ZT4B 1RIHL 3G04A 2YUZA 3BDBA 2FB4L 4KV5F 4MJ5B 4CRPA 4FABL 3FN0H 5I30H 3K81A 4OCXL 3SDAC 1P84J 1XIWA 4C56A 1I7UA 3BJLA 2EDEA 3BZEA 2ZUQB 4N90E 1OD7A 5L8JB 4ELKA 5LBSL 1MCWM 5SX5H 2VZSA 4MX7B 4XH2A 3S9DB 5F3BA 3GJEA 3MLWH 1RJYA 2JIXD 2R1WA 1GAFH 4MA3B 2E9BA 4WEBL 4CUCA 5E00B 5CP7A 3QFJD 3K2UH 5IBUG 2B2XL 4KQ3L 3WS6C 1Q9LB 1DFBH 2FEEL 2VISA 2DKUA 1QKZL 4P2OD 1ZGLM 1F90H 5ENWA 4QLRA 1RULL 5EC2B 3I6KA 3WXWL 4UBDC 2XKSA 4KZDH 4U33A 2FH6A 3VFNA 2ZOKB 4L8BA 5FUOL 5MERB 4NDMA 4NQEE 5E6IC 3NABH 5JHLL 1VFBA 5I1HH 3RL1A 3GFUA 2CKBA 2R0KL 1EA9C 3WIIH 3UX9B 3MFGB 1KFAL 1XF3A 1AXTL 1F00I 1EJ6A 1UCTA 1YY9D 2X9YA 3GI8H 1FFPB 2R56H 1NPUA 4U49A 4QRPD 1A7BA 4JQIL 3DX6B 4NPYB 4JFDB 4DFHA 5LGHL 1U0QA 4KDTC 1U8NB 3FO1B 4HF5L 1W0VA 3O81A 1G9ML 3D48R 4NZTL 3WNMA 5HGHB 2XPGB 3IJYA 5HYQB 3LEVL 1NKRA 4IJ3C 1E4WH 3NZ8A 1A6TB 2DI9A 3G6JB 1I85C 1S7WA 5D2LA 2VDLL 2YD5A 3K74B 1V7MH 4HJGA 1T1XB 1WISA 4NO0B 1CFSA 1MHEA 2J5LB 1BIIB 1PKOA 2P8MA 3EOTH 5T3XH 4X6DB 1FAIL 3T3PE 1NAML 3P0YL 4FFZH 2OI9C 4E42A 3EOAB 1SY6H 3WIFB 4QHKJ 1BBDL 3OWEA 4ZAKB 1CBVH 5CS7A 4B5EA 3MZTA 4BELD 1DEDA 2PYFB