2BCKA

Crystal structure of hla-a*2402 complexed with a telomerase peptide
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
286
structure length
286
Chain Sequence
b'GSHSMRYFSTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDEETGKVKAHSQTDRENLRIALRYYNQSEAGSHTLQMMFGCDVGSDGRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQITKRKWEAAHVAEQQRAYLEGTCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEPGSGGGLNDIF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, A-24 alpha chain
publication title Crystal structure of HLA-A*2402 complexed with a telomerase peptide.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 76
structure length 286
sequence length 286
chains with identical sequence D
ec nomenclature
pdb deposition date 2005-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2bckA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 2bckA01
1IGMH 5FM4A 1OPGL 3MRIA 3DO3A 4PJHB 5ADOH 4JRXD 4KPHH 3CLFL 4CRPA 1X4XA 2CUHA 4MNQE 4M6OH 4X6DF 3FRUB 2R0WL 1CGXA 1IMHC 1MCIA 3M07A 1HN1A 3IDUA 2A83A 1AXSB 2VZ3A 1MFCH 3NFSH 4XRCB 5DJ0A 3EYFB 3RNQB 1RZJC 2YSSB 4MZ2A 4F57L 2VOTA 5IHLB 3LEYL 3DIFB 4ZG1A 1J12A 4QHLB 1R6VA 1ZHBA 3PWVA 1UQSB 4QY8A 2R0LH 2ED8A 2HJLA 1CLZH 1G6VK 4H1LH 3ESVF 1U8OB 3Q6GH 1KELL 4OZGB 3V4UL 2YC1A 3IDGA 2ZG1A 5IK3A 1IEBA 4ONFH 5BQ7B 4OLZL 3G6DH 3U48A 4NWUL 5FYKU 5ISZB 1NLDL 3Q5TA 3L3IA 1NFIB 3ROOB 1FL6A 2A6KB 5SWZB 5C0FB 5D7LD 4UUJB 4O58H 2DM7A 3MCKA 3UTZA 3NN8B 3BP5B 4OZHE 4CDHA 2IMMA 5C08D 3QNYB 5FYKH 1CE6A 3TO2A 3KPSB 3ZKNC 4L5FL 1P4BH 4OF8A 5F6HJ 3B5HA 3M1BB 3MRPB 4F8TA 5I8KH 4CNIB 1IAKB 5E94A 1D5MB 4U1KB 1BJ1H 2V5RA 3WL9A 1JBJA 3R1GL 5EPMA 1BLNB 4KUZH 4N0UB 2DL2A 3MRHB 1ZWIB 3E0GA 2DQIH 2OXGA 3ILPA 5D1QA 3JWOL 35C8H 2FCBA 1YYMH 3V9FA 3X12A 1X6LA 3CDFA 1TLKA 4WRLA 1GZPB 3CK0H 3FAXA 2DWDB 3DMMA 3G5VA 4ELMA 4OCNC 3GMQA 3GMPA 4U6TA 3SKJL 2X4QA 3FAWA 5LGKA 1WIUA 1JRHI 4HUUB 2VC2L 4KXZI 1ZSDA 1HIMH 1WBZB 3G6JE 5CSGA 3UTSB 4HIXL 1T66C 3WS3B 5EZIL 4LOUD 1TVHB 4GRLB 4DGIL 3IJHB 4POZD 3O3AB 4FQ2L 3U4EB 2FATL 3MUY1 3P9MB 1LDPH 1FBIH 3ALWA 3JWDL 4XVTH 2QJDA 5IHZA 5FCUH 2PYEE 1IL1B 5E08L 4NHUE 1SYVA 4YR6A 3S36H 4KI5D 5F7EL 5B39A 4WU5B 4LSDA 4KDWA 1D5ZA 5A16B 5C0JB 2NW2A 1HCFX 5B3JF 3MA7B 2FIKB 3TV3H 1KPVA 4OKVB 1DL7H 4OFIA 4XCFL 3KS0J 3RVTC 1UM4L 3BPCA 4PUBH 5L88H 5LBSH 2OYPA 5SV4A 2X4SA 5MHSD 2AJ3A 3BH8A 4GRMB 2HMIC 4PJ8A 4D0BA 1WFNA 3GMMA 3QDME 1C08B 2X41A 4HUXA 4L4VA 1UVQB 3NIDE 4A6YH 1QBMH 1JNLL 4BH7B 1UKQA 1CIDA 5D1QD 5I1IH 4EI6B 4S0TD 1O0VA 1VGKB 4MNGA 2JK5B 4P5MA 4O02L 3STZB 3VFRB 3MXWH 1F3JA 3QDAA 4HULB 5JDSA 3LCYA 4RWYH 3T1FB 4LRIA 4CW1B 1LNUA 3PL6C 4KMTL 1VADA 5C70A 4FOMA 1FYTB 1IAOB 2W9DH 4ZFGH 1IGTB 1JN6B 4HGWB 4NCC1 4X7TB 2QQKH 3MYZA 4KY1L 4JFPB 3QT2A 3EJYD 3EOAB 4V1DB 3VDBA 2DQEH 3L5WB 1T5WB 3MRCA 4NNPH 1BP3B 1CZ8L 2AERT 3LPWA 4B50A 4D3CH 4OGYL 4M1GH 4D0CB 3T1WA 3E3QC 1XR8B 4YFLF 2R8SH 5TF1H 4NGHL 3TNNB 1K4DB 2Y5TA 4HWBA 4ODUA 1LP9F 1I7RA 1UCTA 3I6LE 5DLML 3ARBB 1PSKH 4K3DL 3OJDA 3WJLA 3THMH 3TPUE 5DJYA 2N4IA 5IBLC 5IFAL 1ERNA 3NCJL 1MHHA 5EZJA 1Q94B 2NTSP 4NO3B 3D39B 4LPXA 4XP4L 1M6OB 1ODAA 5L9DL 2P4AB 3O9WD 4Q0XL 2YUXA 4ZYKB 4NQDE 1N26A 3MYJB 3NACH 2Q8BH 1RU9L 2E6PA 2EDRA 2QQNL 5EOQH 5ITBH 4TVPE 1KJ2B 3G5ZA 1NKOA 1W72B 3DNKA 1VKXA 5INCB 5K9KB 4WCYL 5E24E 3JWOC 3ZDXF 1Q1JH 5BJTA 1BQHG 4KRLB 2VL5B 2XN9D 5CJOH 3QUZA 4OLUL 2XA8H 5D7SL 1NEUA 3DX6A 4PRBA 2R69L 1IEHA 3QEHA 5AEAA 4IRSA 2AXHA 3BYTA 3UJTL 1NGYB 3QI9A 3EUUA 3JV4B 3KYOB 1J8HD 5HYJB 1TJGH 1PGRB 1MCDA 4L8CB 3OPZL 4QXUH 3RUGB 3S96B 3VFNB 4F15C 3G6AA 4L8BA 3SQOH 5KN5B 3V0VA 3W0WB 4YHPA 1BZQK 4F9PA 2ATKB 1DUYA 1UM5H 3OKDB 1DVFA 2X4PB 3QCUL 2X4OB 4JN1H 5FFLA 2DLIA 5MEQB 5JUEL 1KIRA 4I3RH 4KVNH 4UIKL 5DTFB 5KSAA 3LKQB 5IMMB 3WHE0 2WLYA 2G75A 3JWDC 1AQKH 3N06B 1YY9C 1FFPB 2NY3C 3L3HB 3H9HA 3SDAA 2ADJB 1TETH 4JY6A 2H41A 4G8GA 5JQ6H 4JKPH 4PJFE 5LXGH 5IMOB 4C4KT 3F7VA 3GRWH 4XNQA 4LU5L 4ZPTB 3H7BA 2O5YH 2X5PA 5FCSH 4ZUWA 2O26U 1VESA 5IESL 5FYLH 4XPAH 3E3QE 5GGVL 4GAGL 1N3NB 1X5GA 1K9TA 4ONGH 4Y5YA 4F8QA 4CKVX 4JZOB 5E2TL 4LLQA 3ZYIA 4RFOL 4ZTPH 4BFEA 2DLTA 4WUKL 1NCDH 1KN4H 3GMLB 3TVMB 3DV6B 4LVEA 1RZ8A 2AP2A 2BOCA 2ICEA 4GAJH 5CMAA 4LMQI 2F74A 4R90L 4LASH 5C3TA 1JNHA 5J89A 5EN2A 1Q0XH 4X4ZA 1A4KA 3T3MF 5IT2H 3ES6A 4MSWB 1YC8A 2CK0L 1DBKH 1A21A 3QUZD 4Y4HB 5DD3H 5T1KA 3RIAF 1TVDA 2YA2A 4K71C 5EG6C 4N1HB 2V2TA 4IRSD 5HHMD 4PP2A 1WTGT 3GSVA 4Z5RB 2HKHL 4HMDA 4C58B 1KIQB 2D3VA 1SJHA 3EOYG 5DJXB 1EAJA 2EECA 3NABH 4JRYD 2D31A 4QYOA 2M1KA 5CBAA 4WFHE 1LD9B 4FXGB 4NN6B 4PR5A 2XRAL 3FZUD 4YFLI 5GGSB 4KRPB 2IPUG 1DVFD 3KYNB 4NNYB 5KSAD 5CHNA 3BDYL 3BRGC 3F7RA 4LCCC 2BXZA 1TQCC 2ADGB 1KCVH 2UZIH 2GSIA 3RU8L 4MB5A 4PRDA 4LAQL 4U0RB 3SDAD 4ENEC 1JE6A 4DK3A 1IARB 5T3ZD 4G8GD 1MAMH 4P5TD 1NCCL 5IV2B 2I07A 1MJ7L 2AV7A 5ACZA 5ID0A 5GRWA 4AEIL 4OV5A 2AV1B 5HHOE 5CSZB 1L6ZA 4D9RD 3AB0B 5IJVB 4AIZB 1MF2H 2RFXB 4P9ML 4ZUUA 4NHCH 4Z78A 2GHWB 1MREH 3T0EB 4U1NB 4MB3A 1X4ZA 3EYQC 3QCVL 3SPVB 3C2AH 1QSFA 5D1XA 1UZ6E 5HY9B 2UWEE 2GQHA 5F3HB 3P4LA 4WHTA 5HXMA 5IFJB 4PRAA 4LSTH 1CFNA 2Z8WC 3X11A 4RAVA 4NO5B 1J1OL 5JOPE 2DQTL 2PTVA 2DKUA 3DROB 4PJ7B 3C8KB 4OM1L 2VKXA 1A8JH 2X42A 4AT6B 1AIFA 1UM6L 2FLBT 3DV4A 5C09E 3OG6B 2FEEL 1LO4H 3CXHJ 5HI4C 2BERA 1A4JA 5DUBB 4KRMB 2BOBB 3MRQB 4X7DC 3BO8B 1I3GH 4GW1B 1OB1B 5IVXF 5EU3B 2P44B 3V6ZB 5EO1A 1A7RL 3QQ3A 4TOYH 5SWSB 2NY4C 4O5LH 2EYRA 3FO9B 1YEEL 5JIKA 1OVZA 3STLB 1G7QB 2NZ9C 4OTXH 4LNVA 3LQMA 4X7EC 2CIKA 1U2HA 5BZWA 3A67H 5J9PA 1T3FA 4NRYA 3RWEB 3LIZH 1A6TA 4NUGH 3FFCE 3DVNA 4L8SA 2FYYB 2DQHL 3CVHH 3T65B 4YHOH 1P53A 4IIQB 4EUPB 4FTVB 2AXJA 4G59A 4WI2A 3T77B 1XF1A 1H3PL 4X6EA 3ARFA 1JPSH 1P4LB 5E1HB 3S88H 3HAEG 4I4WB 4NBXB 3QXAA 3B8YA 1UKTA 5D93C 4DKEH 1FVDA 4HMCA 4ZQKA 1Q0YH 2IFFH 4WU7B 4UNUA 3U2SB 3ARGC 1QBLL 3VRJA 2UZXB 4OCYL 1FN4B 5IWLC 5GRJH 5E99L 3LD8C 1TITA 1KCKA 3BDXA 3QRGL 4LBEA 3U9PH 2F19H 1MUJA 4WV1A 1T1XB 4GXVH 5I8CB 3V7AE 4XBGB 5GGVY 4ZSOB 4JFOB 3PP4H 4D0DA 4MX7A 1M7IA 5AAMA 5EUKA 2AQ1A 3MTRA 4J1UB 3FB6B 1NBVH 4Y5XA 3QAZB 1J18A 4LLDB 1IGIH 4MHHI 3CCHB 2BNQB 1E4WH 2VWEE 3L7FB 2LAAA 3K2MC 4XP6H 4F37K 5ACMA 4KK6C 2VSCA 4PJHE 1HSBB 4UBDD 2P8MB 4Y1AB 5H8DA 1JNJA 3CU7A 3U1SH 1Z9MA 1ZVHA 2IH3B 3KPPB 4RAHA 1ZEAH 1CQYA 2FJHA 3BIKB 5LJYH 3R06B 4TSAH 3OSKA 3QXVA 1KPRB 3P4NB 5HD8C 4Y0GA 2A6JB 1G9ML 4NO0D 2NY5H 4X99A 4M48H 2GUOA 4GQPH 4F9LA 5E70A 1JZ7A 3MRKB 1YY8B 1QVOA 1UENA 4H1LG 4UILL 5KSUA 4JHAL 5E8EA 4M61B 2HP4A 3DI3B 3FHQA 2NNAB 1PBYA 4ZS6C 3P9WB 5DRWA 4CU6A 1M05B 4IOSD 5ITFB 3QIBC 3WHXA 1FGNL 2OTWA 4EN3C 1Q9OA 1A3LL 5DHVA 1S78C 3F58H 3VXUE 3CLEL 4DZBB 2O5XL 3VGGA 1WBYA 2QR0A 3KPMA 1WV7T 4QRUA 1NMBL 5J1AB 2D7TH 2Y36L 4I18A 4YDJA 5EBWA 1HHKA 2AEPH 4M7ZB 4Z7OF 5GRUL 1QG3A 2VR9A 2F53D 2IMNA 5EORL 3L5IA 2ZUQC 2JIXA 4XCNB 3VFTA 3BSZH 3BKYH 1AHWC 2VE6B 2J2ZA 5IQ9A 4MAYB 1MIEH 25C8H 5IVOA 3WD5H 4E41A 2VISB 4PTTB 3LKSB 5KVEH 4OLVH 1G7HB 5EWIH 4NQSA 5FB8B 4WI3A 3AS2A 4APQC 4X5XB 1I1AB 3FQNA 3BVNA 3H9SA 1U8LA 4PP1C 1C16B 5E9DE 1Y6KR 2IADB 1FHGA 3SO5A 1KSRA 2XQYG 4Z7WE 2R23B 4JHBA 1OT2A 3B9DA 4L9LB 2C3WA 2YHGA 4I3SL 3DHJA 4MXWL 3PGFH 5BRZB 2D03L 3G5XA 4L1HA 4RISH 5B22A 3WMSA 2IAMC 4YK4B 1J0IA 4JVWA 4PJDA 1HDMA 3PWJA 4R7DA 3GMNA 1G7IA 1KEGL 3RZWA 1WWBX 3I02B 2VZSA 4RGMC 1IGYB 4JANB 4XPBH 5DUPH 2EDBA 5FV2A 3ZE1F 1JGUL 3HNTH 1Y6MR 2B1AL 4N8VB 1BREA 4LSVL 1RMFH 3KYAA 4N0CA 1GHFH 1CFTA 1GH7A 1QR1A 1U8HB 5MI0C 2GYSA 4DJMA 1E6JL 5D7IB 4EJ1C 1UWEH 3RKDD 4CADB 1EHAA 2R2BA 1UH2A 3K8LA 4ODWB 3RWFA 3VW3H 2ZZUT 2CR6A 5FO9B 3MBED 4ZFOA 1T6WA 3IXAB 1OF2A 5EUOB 4W81A 2CLRB 4E41D 5K9OB 1AO7A 1F6FB 2D2OA 4NBYB 4UT7L 1N0XL 3SDYH 1MRDH 1UXWB 3ZTNH 1JGVL 4ZFZA 1VHPA 2RCSL 3HG1D 1J11A 3ZHLA 1YQVH 1OD9A 4PLKD 5E0QA 2OSLA 1F3DH 3KWWA 4UT6H 3SKNB 3V6BR 5DMYA 5I2IB 5E2VH 3H9SD 3CH1B 1U9KA 2D7MA 2V17L 2R1XB 1EO8L 1QA9B 4RAUA 5HHQB 2WUCH 4DUVA 2E7CA 2HTKD 4RDQF 4JG0L 2VXTL 2AK4B 2R1YA 4U2YA 3RWJB 1JZ4A 2BVQB 1XAUA 2B5IC 4JFYA 3TP4A 1CICB 1IKNC 3S9DB 4ZNCD 4YUEL 2Y07H 4Z7UF 1P5UA 2CXKA 2YPLA 4NZTL 5F9DC 5JOFB 1FYTE 1WZLA 3GSQB 4TPRH 2JJVA 3G04B 1NFDA 1B9ZA 4JFQB 4MA8L 3BFOA 5TDOB 4D2NA 1Z5LA 4BH8A 5LG1A 1EEZA 4HH9A 2HT2C 1KLUA 2NXYD 4JAMA 2NXZB 3SCMB 5TDPB 2IALB 2CKBA 4PGBA 4XPTH 5D6CA 5JHLH 4FQXA 4KZEH 2B2XH 1A7NL 3GO1H 4U6VL 4GG6F 3GJEA 4OAWB 1VFBA 1NCAH 4JM2B 3WIIL 3FMGH 4N0CD 1WWWX 1Y0LB 2ITCB 1PEWA 2IANE 3V4PH 3QFDA 1AGDB 5DFVD 4KHXH 3EHBD 2NYYC 5INDB 3RWHA 1BGXL 2MCPL 4U6YB 5MENB 5JO5A 1NSNH 5EH1A 1QBAA 1L0YA 3TA3B 4WW2B 4WO4B 2HYMA 1AY1H 1G7PB 1UZ8B 3TN0D 1HYSD 1AO7D 2I24N 2CSPA 3I75B 4KROD 3V5DA 3D39E 3MGOA 4CUCA 3DECA 5KVFH 1XH3A 2JELL 4F58L 1GZQB 5DK2B 1S3KL 3D9AL 3VXRE 3CFEB 4KMQA 4OUUB 3B2UD 5DQJA 2V5TA 1G6RB 1QHPA 2VLKB 4MNQA 2LQRA 2NLJA 5T3XL 3TFKD 3BH9A 2EDHA 3IJYB 5FK9B 3ULSB 3U7WH 4HWEL 3BQUA 1C5DA 2Q7NA 1UADC 2VTFA 3EO0A 1EXUB 2UVFA 1T80A 4JKMA 4UMGA 4YXKH 4R97C 3RVWD 3EOBB 3OX8A 2EIEA 3CDGA 4PRPD 2G5RA 3CDYA 1X7QA 3LB6C 3OGOE 5CZVH 5HI5D 1R5VB 2FHBA 3A6CL 4MLIA 4K3HA 4ORGB 1JHKH 1KULA 4KTEL 1KPUB 2J8UF 1VERA 5AZ2L 3NVQA 5BVJB 3OAZH 4JFFB 1R5IA 3I2CH 3U36A 3SN6N 4C4KO 3VRLE 2X9YA 1G0XA 2A77H 1NC2D 4OZHA 4XP9H 2B1HL 3I9GL 5CLWA 4P23B 5AYUH 2YWYA 4RA0C 2XA3A 4S0SD 1HI6B 4I48A 1EZVY 2HRPH 5IEHB 5T3ZH 2PO6A 1NUFA 3WNLA 3DTXB 2H2SD 3Q1SL 3OGCA 5C0CE 4QGYA 1BVZA 1EHNA 3X13A 2YK1L 3T3PF 5BMFL 1G9NL 3SGJA 5JW4Q 4IMKC 1HXYB 1T1ZB 1E4XH 1Z2KA 5HYSG 5CJXA 1J10A 5KTEL 3VD7A 4I3GA 3VFUA 4GKNA 4HJJL 5EU5A 4MNQD 3CVIH 1FNEA 1RD6A 4QRRE 2JB5L 3BQUD 1T22A 4MD4B 1JI2A 4CVWA 3FKUS 1ZLUH 1X5KA 4GKZA 1TQBC 1LMKA 2AEIT 3DETC 1AGEB 5DEGB 3L3DA 4AL8L 1EGJH 4HAGA 5K9QI 5I73C 4O2EA 5D8JH 3G6JA 2M8XA 1OWWA 4IEFB 2A38A 5JTWA 1E27B 5LAXA 4O4YL 5CILH 4JLRA 3QA3B 2C3VB 4C56B 2HFGH 4Y4FA 4NYLB 3TT1L 4OSUH 4GAYB 3BHBA 4ERSL 1GGUA 2D4DA 4ZXBC 2PYEA 3ZKXC 1I4FA 5I8OH 4NHUA 1KOAA 2DI8A 2E6JA 4X5LA 4JQVC 1VFMA 1A9EB 1T03L 3OL2A 4R9HA 3RNKB 4Z7QF 1PEZA 2VDQL 4NM4H 4F3FB 3AREB 4HMEA 3OKNB 2X4NA 1FJ1B 3O4LD 4XNXL 2ADFL 1KTKE 2E27H 4JN2B 3T2PA 1MHCB 1OL0A 1XMWA 4JKWA 3MV9D 4NZUL 1ZTXL 2FX8L 4OZIF 4KJPC 4OD2B 5D7JC 4ZD3L 4FRWA 2Q1EA 3QDMA 2BSSA 3OHXA 2VZOA 1FNGB 1KYOK 1CBVH 4P59L 2AKRA 5A2FA 3O41A 3GMOA 3S37X 3UDWA 4U1SB 2BVEA 1ORQA 4ONHB 4RFNB 3UYRH 4YHZL 2E5EA 4JFHD 5T1MA 4M93B 4P5KA 5FOJA 1DE4A 4YDLB 1NC4A 2VXSL 3QXTA 1A7OH 4QHNB 3RL1A 1HILA 2DQCH 4OQTL 3CZFB 2RGSA 3DGGA 1RK0A 1T7WA 3BW9A 4YDKH 2KKQA 1WSST 4JFZH 3ERYA 1MCPL 3QULB 2QSTA 3R8QA 3HTLX 3ARTA 5IG7B 3TCXA 3F12B 4K55A 1A5FH 1MWAA 3B9AA 3QUXB 1VEMA 3D2UB 4YFDB 4LVOC 4BUGA 4U4BA 1KCSL 1JGLL 1KNOB 2YBRB 2D7QA 4ESKA 4R7NB 4UDTA 4Y4FD 2DLFL 4YXLH 5ENWB 1AGCB 7FABH 3KNBB 4MXQD 3ZLQC 1QLEH 4OFYA 4PJXF 2IQAA 3EYSL 4MNHB 4GKOA 1VPOH 4P2QD 1A9BB 4OCWL 3GNMH 4F37F 3KLHC 3U46A 3PWNB 1JWMA 2OL3A 4X6DB 2Q6WA 3NAAH 3U7AA 5EO0B 1E6OH 1IGML 1JWSA 4YHYB 3GHBH 3TPUA 1X5LA 3S8WA 4YC2C 3RBSA 3QZWG 4E0RA 3TBSA 3OXRA 5CEXA 2ZSWA 5ADOL 2NY1B 1WWAX 5HBBA 2LU4A 3ME0A 4P4KB 3P4OB 3WN5A 4PG9B 4FQQA 2P45B 3MRFA 4R2GB 4TNVK 3MRRA 4M6OL 1MJ8H 4BQCA 4NQDA 1HINH 1U58A 1MFCL 3NFSL 1IAIH 4UU9B 1YQ2A 1D5BA 2PKDA 5FGBC 5F1IA 4HX1A 1G9NC 1WC7B 1OP3K 3BEVB 1CQKA 4LLMA 3VXPB 1A1MA 2WZPD 5EA0H 5FXCH 4FQCL 5GZOC 2OI9B 2R0LL 3EFFA 1CLZL 3Q6GL 1BWMA 1ADQH 1H3TA 5DA4A 4KK5D 3P4MB 4ZSOE 3L95A 1ZS8B 4ONFL 3QEQE 3G6DL 3L6FA 3BKML 4DCQA 4KV5F 2VZVA 1YEDA 4PJIF 3ARDD 1CGUA 4AEHH 4OFYD 4XXCC 4Y1AE 3T04D 1P7QD 1BD2B 2WUBH 4CN6A 4U7SA 2M26A 5DK0B 4ZOEA 3S5LG 1B4RA 3PL6A 2P7TB 2Q76B 3RVVD 3FONB 4JFDB 5FYKL 5T3XE 4G43A 2NW3B 1P4BL 5C9JB 3Q48A 4X98B 4OF6A 1QTYT 1R3HB 5I8KL 3BWAB 3FB7A 4AYFA 1ZT4B 2X44D 3IGAB 4J8RA 4H20H 4PJFA 4HG4J 1LK2B 3O6KH 5ESVB 4KUZL 4DZ8A 1KB5A 2FB4H 1NMAL 1HZHH 4LNRB 3FFDB 4XCYA 4K8RH 3HN3A 4V3DB 4KDVA 5E2JA 3IDYC 35C8L 1YYML 2DM2A 3MZGB 3Q6FA 3E3QA 3O3UN 1QHOA 2R2HA 4G9FB 4ORZC 2KUTA 4BSWA 3VRIB 3CK0L 3IDJB 3OF6D 1WQVT 3SDCC 4NQDD 1D7FA 4PLNC 1D6VH 4I0PB 1SJVA 1Z3GH 1YNTB 3NOIA 6CGTA 3QBTB 2L4OA 2Y7QA 4G8FA 4TVPD 4P3DA 1KXQE 1CLOH 1RZFH 1HIML 4Y4KB 2NY0C 1OAUH 5KVMC 5KJRH 4QXTA 3RAJH 3WFEH 5JPMB 3DHMA 5D4QA 1U8PA 1IC5H 4RFEA 2Y25A 5HGHA 2BNRB 3VI3E 1RJZA 1AP2B 1INQA 1LDPL 2BVPA 1FBIL 3BKCL 5CD3B 4XVTL 1BX2A 1II4E 5E2WH 5FCUL 3GSXA 4F2MB 3UP1A 4LSUH 3S36L 4PGJA 1M1SA 2BVUA 1WIPA 3HR6A 4NKOB 1CDBA 1UT9A 5DI8A 3TV3L 3WFBH 1FAIH 3CGTA 4R3SA 3PL6D 5GGQH 5I1GH 4PUBL 3VA6A 5L88L 4DN4H 5LBSL 2Z92B 4XMKL 4F7TA 1A6ZA 1TPXC 3ZT5A 3D0LA 4L3EB 1F5WA 2OBGA 1XCQB 1GL4B 2UUDK 3Q0HA 4LKCA 3KXFB 1KUMA 5L7XH 5HGBA 1QBML 3UBXI 5HHOA 3U0TA 5TE4H 3HB3C 5HPMB 4EOWH 2BP3A 5I1IL 1U3HB 12E8L 2FX7H 3VDCA 3AU1B 4NKQB 2OX5A 3OR6B 4FZEH 4XCEB 1XF3B 5J8OA 1NGPH 4Y19B 4R6UA 3TGXA 3MJ8A 1HSAB 2UWEA 4Y16C 5HJ3A 4RWYL 4UT9H 3EYOB 2HN7B 4M6NL 3FOMB 1AKJA 2YRLA 4MD5A 1KTDB 1CLCA 1FNLA 3UPAA 4LARH 1DN2A 3MRDA 3RWIB 3WYRA 3QWOA 4O2FB 3TJEH 3GB7A 4ZFGL 3H42L 3ARZA 3S35H 4OT1H 1ED3B 5I6XB 1JF1B 2QQKL 3AGVA 4OZ4A 2Q7YB 1LP9B 1U92A 2F9BT 5C09A 4YHKH 2WBJD 2VQ1B 5FECA 1MNUL 5GRVK 1EFXA 1QACA 2D7PA 2PTUA 3MLXL 4LCUA 4KQ3H 3HI1B 3RZCD 4DGVH 4M1GL 4HZLB 2R8SL 5TF1L 1JCKA 4WFHD 3RVUC 3C60B 1BMGA 1A7QH 2EIZA 1DQLH 3PWUA 5D7KE 3QIUC 1DN0A 3C6LC 3GSRA 1H15B 1PSKL 2ZKHH 3IFPB 3THML 3OJMB 3IFOA 5FM5O 3MRJB 5F7HA 4M00A 3FFCA 4OBSA 5FGRA 3MBXH 2W0FB 3CNKA 4X5WB 5MEPA 4HK0A 4PJ5E 4KJQD 3HC0B 4YBLC 5HHOD 4BM7A 1X3DA 5FV1L 1NEZA 1CE1H 3ULUF 3BZFB 4XH2A 2J3SA 3QHTC 3NACL 3O2WL 3QDGE 2CDGB 4ZPVB 3SJVB 1T0PB 1FORH 5EOQL 5ITBL 5KSVB 4KK8D 1PY4A 4LCCA 1FO0L 1U8QA 1I8KB 4IBLT 4ZAKA 1HQ4B 2K7QA 1XGRA 3FTGA 5FA4B 1YJDH 1C5BH 3EDEA 1DQMH 3Q3GB 2YXMA 5ETUB 5AAWA 3T0DA 1AKJD 1INEH 4LEOA 5CJOL 1RJLA 1GAFH 2XA8L 3U83A 1JPGB 4GBXD 3SGEH 1T5XB 4NQED 3C5ZC 3FN3A 2D7NA 1Q9KB 3O8XC 3QNZB 2XIDA 1FQ9C 5MENE 2CDFB 4Z7VB 3AFLA 1JZ3A 2DWEA 5C09D 4EVNA 2P5EE 1PKQB 2W59A 1NGXA 1TJGL 1EFXD 1FAKT 4CDGC 4QXUL 4P46C 4IRJA 3K74B 4YGAB 5EU6B 3ABZA 1QOKA 4XWOD 1UM5L 4G6AD 4JN1L 4H8WH 2YD1A 4I3RL 2ERJC 2P8LA 4PJHA 1I8MB 1ZOXA 3VE0B 2XTJE 3L1OH 1AQKL 1I7ZB 3WUWG 3CFIC 3S5LB 5I19H 1CGWA 5T33L 3FRUA 1TETL 4JKPL 4EEEA 5LXGL 2C4FU 4NDMB 4DKFH 1MCWW 3GRWL 1G7JB 4XXDA 4MLSA 4H0IA 2O5YL 3FFCD 3VXQA 1C1EH 4X4YB 2C7UA 2DDQH 2Z31D 5F1OB 4XPAL 3WLBA 3WLWC 4NBZB 4ONGL 1UQSA 3L3OB 1NCWH 4E42B 1URLA 1J7VR 4ZTPL 2BDNH 1U8OA 5HDBF 4Y2OA 5F7KC 3MV7B 4A2MA 4Z95L 1PKOA 5M7QA 2NY2B 4GAJL 2NPLX 1T89C 2HFFA 5IR1B 5E5MB 5BQ7A 3I3DA 2PTTB 3VXUA 1LO0H 4LASL 5IM7B 3QB7C 1Q0XL 4ZAKD 1T04B 4HS6A 4JFFE 3SY0A 4LVHB 1KEMH 1AGBA 4UUJA 4YIQA 3MUGB 5IT2L 3D85B 4ZODA 5FYKE 3BP5A 1F90L 2G9HA 5DD3L 5FGCB 2E9IA 4TULH 2ARJA 3RIFK 2IWGA 5JXEC 2YN5A 5LGJB 4FQHB 1IVLA 1I9EA 1MQKL 2EXYC 1S7SB 3NABL 4GMSH 3MRPA 2GAZB 3X3GL 4CNIA 1IAKA 4RMUA 3NPZB 3GHEH 2EEAA 3BE1H 4IRJD 1OAQH 3MLZH 4K9EH 1YMHA 2X40A 1BLNA 5F72S 2C5DC 3MLWL 1N4XH 3MRHA 3MRBB 1JGDB 3PWPB 1XIWC 5FDWB 4CBPA 5C6WH 1BOYA 5E9DA 2UZIL 1KCVL 2YKLL 3NPSC 4Z7WA 4DVBA 2DWDA 1MAML 5I9QC 4U3XA 1LWRA 4U1JB 3GJFH 1MPAL 5DO2D 4X0KB 4Q9QH 4I0KA 4KAQL 2MQ3A 4G6JH 4HUUA 5D2LE 3PJSB 2YD4A 5B4MD 4U1HB 5B38A 2XZZA 1MFEH 3DBXB 2VIRA 4NHCL 1WEJH 1PDKA 3VWJB 4HV8B 1IJ9A 3BKJL 1MREL 3WS3A 1TVHA 3FB8A 3IJHA 3VG9B 3C2AL 2GT9A 3GKWH 2ZCKL 4C56E 1KIUA 3T4YA 3ARVA 1U8IB 2PCPB 4ELMF 4FXKA 5TPWH 5IVXB 3EJJX 2DYPB 4OGZA 5ISZD 3MREB 5SWZD 1E0OB 3OKEB 2FL5A 4R26H 1QSEB 3OB0K 2MKWA 4WTZA 1FNFA 1G1YA 2VZUA 1RULH 4R4FL 1N6VA 1PQZA 3HI6H 3CC5A 3MA7A 4HIHA 1LO4L 5GJSH 2AI0H 1OAKH 4N5UA 1N64L 3T0BA 2OR8A 5ICZB 3QIBA 3C2SA 5IMLB 3KPSD 1LK3H 1I3GL 1XGPB 3MJ9A 1OTUC 4OF0A 1QQDA 1MI5B 3QIWC 1FV1A 3TZVC 1UVQA 2H9GA 2COQA 1U6AL 4OTXL 1MLCA 2WIIB 4U05A 4XNMB 2CIIB 1DQJB 4WNQA 5SWQB 2ICWJ 2O61B 3PP3H 4Z0XA 3CVHL 4TNVF 1UJ3A 5C0DB 5D9SA 5DD1H 2W9EL 4B7IA 4CW1A 3GMRB 4OLYH 2IH1A 4LAJH 5EOTB 5D96C 2D7OA 4OGAC 1C7SA 1FYTA 1O5DT 5DHYB 3UTSD 1IAOA 1NUDA 1MWAH 4KK6D 3VXMB 5JW4M 4HGWA 4APQA 1DANU 5CBEA 1F42A 1IGCH 5AD0B 1WJ3A 3QCTL 4DKEL 3EOAA 1Q0YL 2IFFL 3L5WA 3RBGA 3B9KC 3QPXH 4R4BB 3QH3B 1F13A 1N2RA 5GRJL 4S2SB 1BJ8A 1F3DJ 2DRUA 2F19L 2IAMA 4NFDA 1J1XH 2IANA 4YEFA 4X6DE 3RP1A 2OL3H 3C8DA 1KIPA 1EHLH 3ARBA 3QIBD 1HHHB 1HH9B 1WCBB 2B8OT 4O51A 1R3LA 1E4WL 3QPQD 4XHJC 4XP6L 5E4EB 3D39A 5EIVA 3U1SL 1BZ9B 2MFNA 2RIKA 4AH2B 1ZEAL 1JF5A 1SJEA 2SEBA 4XVJH 5F70A 2A0LC 2VRAA 3VXRA 3S4SB 2NY5L 4EQ3A 4M48L 2X6MA 4ETQB 5CP3A 3OKMA 1WUNT 5I66A 4JO4H 1I9JH 4TVPH 3GBNH 1W72A 5INCA 1KN2H 3GSNB 3V5HB 1CL7I 1F02I 4XPFH 3O6FB 5ESQA 4GH7B 3QXDA 3HE6A 1FYTD 3CU1A 1RPQA 2YPVL 1SJXA 3LAFA 3RL2A 3MLUL 4KMLB 4E5XA 4APQD 4Y5VB 3IXTB 1MHEA 1Q9WB 4LHUB 5DMGD 1HHIB 4ZDHA 3O2VH 2MOVA 4M9OA 4U0QB 3JV4A 3LEXA 5EBLB 3KYOA 3E6HB 1ZGLB 2D7TL 3LKPB 4L8CA 3VFNA 3VD9A 3S96A 3HRZB 4GFTB 5JPNA 1IKNA 4FNLH 3IU4L 5JZ7D 1PJ9A 1AE6H 5HGDA 1NH6A 3GIZH 4HS3B 3BSZL 2IAMD 3ELAT 5DUMH 3BKYL 1FZOB 5E5UB 5C92A 2PETA 1MIEL 25C8L 2GJ6B 3WD5L 4F7PB 3AM8A 3ARBD 3ILQD 4G9DB 1WK0A 1TZHA 2ADJA 5EO9B 3LV3B 1CL7L 3BPNC 3OZ9L 5DD6B 4D8PB 5FYLE 3MLVH 5KVEL 1UACH 4OLVL 1P69B 4ZPTA 5GS1B 5EWIL 1FGVH 5E6ZA 5C0CA 3BZEB 3OR7B 3D39D 5C6TH 4XI5D 3MRLA 3UTPE 4CU7A 5I17B 2C4FT 4XAWL 1FIGH 3KYKH 1TCRA 3GMLA 4P2OB 1YYLL 3A0OA 4HFWB 3RY5A 2ORBH 5CD5C 3IKCA 4PJEF 3PGFL 1A6AA 1K85A 4QRRA 1CFQA 2Z8VC 3DRQB 3P77A 5MP6H 4UIMA 2CMRH 1KLGB 3EOTH 1U8MB 3LS5H 4YXHH 3UCRA 5SX5K 1R24B 5DMIH 4MSWA 3HE6D 5B3JE 3IDNA 4JREB 4Y4HA 1KFAH 1E28A 3F7QA 4XPBL 2B4CL 4PGEB 5DUPL 5EDXA 1EV2E 4FS0A 4Z5RA 5I30L 1BOGA 5BZDA 4M5ZH 1S7TB 1F11B 4OM0H 5DJXA 2EE6A 4D9LH 2HJFB 1AGFB 3SE3C 4H5SA 1H0DB 1RMFL 3BT2L 3N1GC 4WENB 1L9MA 1WCQA 4QOKB 1D6EA 5GGSA 4GW4B 2BMKA 4TTDD 2GK0B 1LEKA 4CJ0A 3VW3L 2EE9A 3KYNA 4MDIB 1ZHKB 3HZVA 2X4UB 3BJLA 4YAQA 2OTPA 3SBWA 2FLRT 1OY3B 5IVZB 1GOGA 5DF0A 5EC1A 2FBJH 5FHAH 5J11C 3ULVF 4L3EE 4DOHE 4EXKA 3E8UL 3SDYL 1MRDL 5IV2A 1CLYH 3OQ3B 4PGCA 4KGJA 2MCG1 4UAOB 5IB2A 3VH8B 4Z7UB 1MEXH 3KXFE 4X8JB 5CIPB 3KJ4C 3BJ91 1NDGB 3QG7L 3PE9A 4UT6L 5FGSA 1ZLVK 5CJ8A 1DBMH 4MWFB 4U1GC 3PHSA 2DM4A 1LO3L 2RFXA 4NSKB 4LSSL 3BOVA 2G60H 2RHEA 2WUCL 4JFXB 3SPVA 4HKXB 5T5NF 5HY9A 2NY6B 1A6PA 3LN4B 4QRRD 5DJ2B 1YEGH 4RRPG 3X17A 4GG6B 3MXVH 3O2DH 1KGCE 4HPYH 2HWZH 4Y2DB 4MJ4A 4LQFH 3ZE2E 2NY5C 3VFPA 1NANI 3C8KA 4Q9CA 1LP9E 1DBAH 4Y4HD 3REVB 4AT6A 3V4VH 4KUCD 1A6UH 1J05B 3E6FB 3QWRA 3KPLB 4WW1B 4XPTL 2BOBA 3MRQA 4KZEL 2B2XL 3GO1L 1MCOH 4LOUC 2F8XC 1NCAL 4JRXE 2H45A 3V6ZA 1I9RH 4MJ5B 4FFEX 4POZC 5I71B 5FUCE 5EU7C 2IBGA 5DJZA 2ED7A 3V4PL 1HNFA 3SKOA 5T1DH 4KRPD 4TSCH 1RHHB 1TZIA 3KR3H 1G7QA 3ZDYF 1NPUA 1QLFB 3OAYK 3OKKB 4KI5C 3F7YB 1AY1L 1S7VB 2RJMA 3LB6D 4PRNA 5LWYH 2FYYA 3RGVB 2GY7B 5C0RL 3ZYZA 3EYUH 4R8WL 2V9TA 1HH6B 4NQVA 3JTSA 3JTCA 5KVFL 1YMMB 1T20B 4RMRA 3VFWB 1MJUH 1W0WB 3W39B 3OKLA 4M62L 1J0ZA 2D0GA 3AMKA 2YA0A 3O3BA 1S9WB 4JQVA 3SJVE 1I3RB 4I4WA 2QKIB 3U7WL 3JUYA 3CPLB 1FC1A 2XXMB 2ZUVA 4WU7A 5D1QC 2J8UB 5DDHA 4LP4A 1XGQB 4YXKL 2R0ZH 1AJ7H 3NFNB 5D7JA 3TYGH 3QO1A 5C0GB 4WI5A 2M2DA 5HTSA 1T1XA 5JORA 1IGJB 1NAMH 2QADC 3RDTB 3TPKA 4ZSOA 3V5KA 3NZ8A 3PP3K 3IB4A 4JKKA 3Q5OA 1JHKL 2Q3ZA 3QEQA 1B6UA 5AUMB 4J1UA 2IGFH 3LQAH 4OGXH 1K6QH 4LLDA 5DJ8B 3CCHA 2ESVB 1WZMA 2QSCH 3I2CL 3L7FA 1DDHA 4M03A 2E6QA 4NPYA 1NGQH 1RURH 2A77L 1HSBA 3EJYC 4KJYA 1T1WB 2P8MA 4Y1AA 4XP9L 1N8ZB 4X4XB 4K94L 2IH3A 3KPPA 4RBPH 2HRPL 3R06A 3CFKA 4GRWF 5T3ZL 1XGYL 2CUIA 3S34H 3TBYA 2F54B 4HK3N 4QRSB 4MDJB 2PXYB 4X83A 5B8CC 2HTLD 1KV3A 3GGWB 3MODH 3STBA 5JW5B 1UWXK 3KPTA 4K7PH 2R4RH 3MRKA 4YBLB 1FVEB 4NQCB 5F9AC 1YEKH 4PJCE 1S9YA 1BEYH 4HCRA 5JIIA 1D5IL 1L9NA 5DR5H 3T3ME 4NRXB 4FTVD 1NGWB 5EU7E 4JDVB 3TJHA 3WNMA 1EUUA 3K80A 4Q2ZB 5ITFA 3H0TA 4P2CG 2X05A 2V2XB 1XR9B 3BZ4A 4I1NB 3CVIL 5GPRA 3WXVL 1T2XA 4WY7L 1OGAB 3S7GA 2DS4A 3O9WC 2H6PB 3ROLA 2W9LA 4Q58C 2VDKH 4CVXB 1G7LA 5L8LB 1EGJL 1MCRA 3T4AA 3H9YA 3P9LB 5D8JL 2HVJB 3LN5B 5FOBA 3EGSB 3NCCB 1IEAA 2CGRH 3V0WL 2FECI 2E8YA 2C1PB 3MR9B 3WFCH 1CD8A 2VE6A 4PBWD 3LQZA 1U95A 4GW5B 4W4OC 5GS3A 5CEYA 3TNMB 4LRIC 2OP4H 3O6ML 1HHJB 5HHNB 2E3VA 4OSUL 5IB4B 5C0AB 4PTTA 5JQHC 4KU1A 4G80B 4OZIB 4X4ME 5I8OL 1L4IA 4F80A 3P11H 1S5IL 5BS0B 2UV3A 4JRWA 2MNUA 1MCSA 5FB8A 2KDGA 4Y1AD 4X5XA 1I1AA 3RHWK 3VWKB 4NM4L 2IADA 4GSDH 2YD9A 1EEUA 1RJYB 3EFDL 1JHLH 3UO1H 4PY8I 2R23A 2A74B 4ZOBA 1DFBH 5I0DA 3WFZA 3KDMB 5DVLA 3TYFA 5DJ6A 2FECL 4ZO9A 1P84K 4Y7MA 2L7UA 4HHAA 2ZJSH 5FM5M 2GFBB 1CBVL 5D1ZB 1SEBB 4XXCA 4CMHB 3TJHD 2QL1A 3B9EA 4NOBA 3EAKA 4JDTH 2OXHA 3DSFH 5E56A 1OW0C 2ADIA 2APWA 3BI9X 3MUZ1 2MJWA 4UDUA 1A7OL 1DQQA 4UB0H 1S8DB 3C08L 4M02A 5F1NB 3ZZ1A 1TTUA 2O93L 3IF1B 4MJ2A 1JVKA 4YDKL 1SYSB 1QSEE 4JFZL 1CR9H 3U6RB 2EH8H 1U8HA 5KZCB 2P5WB 3H6JA 3QFJB 5DYOA 5GSVA 2OR7A 3NCBB 1A5FL 4PJDF 4K3JH 1OM3H 3PF2A 5CP7B 4GG8B 3FT3B 4N0RA 3NCYP 2J7LA 3PIQB 5DWUL 5C07B 2VDOH 3DO7B 1FFOB 4G5ZH 4MAYD 4YXLL 3KJ6H 3QUZC 3VCLB 7FABL 3SDCA 1CDIA 3MROB 1IAII 3KPNB 5ESAA 4IRSC 3T0VA 2OLDA 3CX5K 3UBXB 1L8JA 1VPOL 3I85A 2X70B 3VXOB 2BSED 1I1AD 3CH1A 4K3EH 1PG7H 3IDIB 1QPPA 3GNML 2R1XA 5I9QB 3JTTA 4M4PA 5KVDH 5HHQA 1K3IA 4AM0A 1WITA 3NAAL 3FZUC 2IEPA 4PJ9B 5CWSB 2HVKB 3RWJA 1DVFC 5DQ9B 4ZS7L 3TIEB 1ZA3A 4MD0B 2XN9E 4OQTA 3C87A 4RQQB 4JG1H 5BRZD 1FZMB 3FCTB 4C59B 4K94C 2QSVA 4FN0A 4ZO6A 1KCGC 2XACC 4PJ5A 4FG6C 1SBBA 4PJGF 4EXPX 3OWEA 3SDAC 1BQUA 4P5TC 1X6NA 4M1CD 3G04A 5DS8B 1J8HE 1MJ8L 3BGFC 4KK9D 5TDOA 5J12B 3W9EB 1IAIL 1B0RA 4XNUL 2I60L 3QDGA 1QRNB 1H8NA 3HAEA 5DMJB 1S9VB 5IBUB 5FUOL 4Y5YC 2A2QT 4QTHA 4YHIB 4OAWA 1AXTH 5DZLA 2EYSB 4F7CA 4OCXL 1FO0B 2FSEB 1ADQL 2DJ4A 1BVKB 1I1YB 1AGDA 1F4XH 1S9XB 4JJHA 4U6YA 5MENA 4D94A 3AAZB 3KPQB 3D25A 3TA3A 4WW2A 1JK8A 3U7YL 2P5EA 1G7PA 4YHNA 1GC1H 3U0PB 3BP7B 5J3HD 4XMLH 4AEHL 1FNAA 2VLJB 1X5YA 3GM0A 1MCFA 4Y16A 1V5JA 4RGNB 4YBHA 3SE9L 1RUKH 2KQNA 5DK2A 3PUCA 1FG9C 1NBYB 2XWTA 1S7WB 1G7MB 1QFHA 2BFVH 4WWKB 5D7KD 3O3EA 3OKYA 3ARUA 2AK4D 2EH7H 4U6XA 1KJ2H 1PX3A 1W72H 4H20L 3KPRB 4NC1C 2NQCA 1CICD 2FB4L 1TTFA 1C12B 1HZHL 3QNXA 4MCZB 4Z7OE 3QUKB 3PABB 4GS7B 3VGDA 5IB3A 4H1LA 4PJ5D 5HHME 1H5BB 3QEGH 2VABA 3EOBA 5IOPB 5CJQH 2OZ4A 3K8KA 4RIRB 1NBQA 4HQQH 4JRYE 3QIUA 1FZJA 5KSBF 2B20A 3C6LA 1A3RH 4N0YH 2NXZD 4KQ4H 3SCMD 4LHQB 3MQIA 2FJFB 43C9B 1ETZB 1CLOL 1RZFL 2Q3AA 5BVJA 4S1QH 4TUKL 3I6KB 3JV0A 4JFFA 4JM2D 4XC3L 3RX7A 3BPOB 2OQJB 3P73A 1OAUL 3LHPH 3LMJH 1CDHA 3FOLB 5KJRL 2VZTA 3WFEL 2X4TA 4MA1B 2X4RA 4P23A 3V52H 3LPGA 4S1SH 5LCVH 1DQDH 1K8IB 5MEND 2L0DA 1N5AA 1WZKA 1GVIA 5E2WL 4D9RE 3TA3D 1ACYL 2LV4A 1FLTX 1YN7A 3B6SA 4JQIH 4WO4D 4LSUL 2BXYA 4BQBA 3IETA 2IG2H 3HLAA 3EO1A 2MWCA 4M3JA 5HVHC 1F6AA 1SVZA 2Y6SC 1BPVA 3C5JB 1HXYA 4JR9H 5DT1H 3WFBL 1FAIL 4ODTH 5GGQL 5GGUA 4YNYB 4YGVB 2XTJD 4NN7C 4OZHF 3C5ZA 3O8XA 3U4BH 5L2JB 1MIML 2VLKD 4UBDC 2X7LA 3ZE1E 1QRKA 2NX5B 2AXGB 2AGJH 1T0MB 3DXAB 5L7XL 4P46A 5KANI 5D2LA 4WHYH 4I2XB 5TE4L 2WK2A 3VFVA 2FX7L 2DQDH 4PV8B 4MQXD 5DFTA 5F1SA 3SE4A 4FZEL 3RTQB 3ECBB 5FIEA 1I85A 1NGPL 3AMLA 4Z76A 2NR6C 5HDOA 3UC0H 3C6LD 3IDMB 3QA3A 4C56A 1T0NB 2I26N 4X6FA 4NZRH 3VFGL 4UT9L 4X6BA 3TWCH 2GJJA 4EI5B 1CDCA 4PYGA 1A02N 4WI8A 4JFFD 3TJEL 3VD4A 3ETBF 4OT1L 2R39A 5FYJU 1A9EA 3RNKA 1V3JA 3W82A 4F3FA 3BPNB 2DLHA 4P23D 1KG0A 15C8H 4AK1A 4HDIB 3SDDB 5E6IC 4B5EA 1V7MH 3KLAA 4JN2A 5EZOH 3HUJB 4LLAA 1MHCA 3TBWB 4HKJA 4Z7UE 4Z8FL 3WDIA 5CCKH 4A6YA 1V3LA 1UCBL 2HLAB 1FG2B 1A7QL 1DQLL 1FNGA 4NKDB 1MCHA 1OD7A 4JGMA 4N5EC 5DRNB 2XWBA 1OAXH 3M45A 2BC4A 2ZKHL 4ONHA 3QUMB 4X9BA 3H3PL 4RNRB 3UTTE 3SGEI 3C5ZD 4EIZC 4JHWH 1UWGH 4JY4B 2A6DB 1SY6H 4YO0B 2X10A 2YN3A 3D3VB 4YWGH 1R5WA 2NMSA 3IYLW 2WWMD 4DAGL 1GGTA 4W6XB 4XPHH 5IW6B 4OB5H 3EBAA 2EYTB 4U7MA 3LEVH 1DP0A 3QUYA 4F9LC 1JPTH 5IG7A 1Z0NA 1MFDH 5GISH 3NIDF 4S1RH 1XIWA 3QUXA 1BM3H 1MQ8A 4J3UA 1O7VA 4F33B 3D69A 4K8RC 4R7NA 4C56D 4JZNB 1YJDL 5ENWA 4FFZH 1DUZA 3KNBA 1INEL 1GAFL 3I50H 4CVZB 1A9BA 1MH5B 5M94B 1BIIA 5TE6H 1EDQA 1P6AB 2PUQT 3F8UB 4X6DA 5C08B 4K2UH 2OM5A 4J3VA 1M7DB 3KJ4B 5EO0A 3U4AA 5EULV 1OTSC 3RKDC 4XAKD 1KCRH 3SKUD 1XCTB 2EKSA 4EUPH 4R4ND 5HYQB 1ZGLP 3MBEC 3EZJB 2VAAB 4X9HA 6FABH 3MRIB 4UQ2B 3P4OA 4WI4A 4H26A 2LFGA 2VSDA 4N90E 3MCLL 3O0RH 4JPIA 5F97E 4J2XA 4DKFL 4PLKC 4UU9A 3P0VH 4NT6B 3MOBH 1ZGLM 4G6FB 3MV01 4DEPB 2F53E 1C1EL 5DJ0B 3VXPA 1CXLA 4JO2H 2HTKC 1U93B 3RPKA 1NL0H 1NCWL 2A73A 4XMPL 1QFUL 1RV6X 3TZVA 3QUYD 4JZJB 1HEZA 1ZHBB 3PWVB 3P4MA 1HHGA 4QY8B 2WWKT 4BFBD 2HJLB 5JR1H 3BN9D 2HJKA 2W0PA 4DQOH 1X5FA 3QUXD 1MVUA 4Q6YA 1LO0L 4DN3H 2I5YL 3A6OA 1IEBB 1KEML 3IU3B 5F9WC 5IW1A 4N9GB 3I3EA 4MYWB 3NA9H 2NXYC 4NKIH 3L3IB 1FVCA 4TULL 1ES0A 4JO1L 43CAB 1J0YA 2Q76A 1TXKA 3T2NH 2F54E 2DB8A 3NZHH 4MQ7A 2B7DT 4N0CC 1FH5L 1R3HA 4GMSL 2VR4A 3RHWF 3BWAA 3SDXE 3GI8H 5DFVC 3RWCA 1CE6B 3TO2B 3EHBC 3GHEL 3DURB 1ZE3C 3MLZL 3RWGA 1YEHH 4U1LA 5ESVA 5E94B 4LNRA 2XQBH 3B9KA 2NY1D 3WL9B 3CFDA 5EPMB 1HYSC 3TN0C 4P4KD 3IVKB 2C3XA 3FT4B 4KROC 4PLJD 1WTLA 3VRIA 3IDJA 3ILPB 4FQLH 5HYSA 2Q20A 4JKLA 1CD9B 4Q9QL 4D9QD 4PRIB 3DMMB 3G5VB 5HHVH 4G6JL 4ELMB 3GMQB 3FQWA 4GXUN 3RKPA 2DF3A 3ZE0E 1MFEL 4YJZL 2X4QB 5GHWL 3TFKC 3GK8H 4Y4KA 4EDWH 1WEJL 5F7DB 3WFHA 1YECH 4Z7QE 5CZKA 3QP3A 1IKFH 3T8XA 5JPMA 3WEXB 4LL9A 2YD7A 4QXGH 5M95B 1Z9LA 2Y06H 5T1LA 5E1AB 2V7NB 3HG1E 1N59B 3VJ6B 2IJ0C 3VGAB 2ICES 5JW4R 5TPWL 1RZJL 4OZIE 3MFFA 4LLUB 5HI5C 3PDDA 5DJDA 3CAFA 1RULL 4HF5H 4NFBA 1SYVB 4YR6B 3ARRA 5IP4A 3QR2A 1Q38A 5B39B 5GJSL 2AI0L 1OAKL 4JFDD 1YJDC 3QJFB 1WFTA 3FT2A 3UYOD 3MOQA 2OTUA 2Z92A 1LK3L 1OSPL 1KPVB 5FA3A 4NN5C 5GSRA 3FN9A 1AFVH 4G8IB 3UZQA 4L3EA 4PIRF 3BPCB 2X4SB 5FYLD 2AJ3B 3GSUA 3KXFA 5FO8B 1FSKB 3B9KD 4PJ8B 3GMMB 4HUXB 4L4VB 2GTZB 4TSBH 2H2SC 3CX2A 2O5ZH 3UTPD 3DUSB 5E2UH 5E8DL 3KPOA 2BY0A 3OR6A 2K3TA 4OFPA 4M6MH 1C7TA 4H0GA 4H8WC 3U82B 3LDBC 4I0PD 5I75C 4PJXE 4ONOA 2D9QB 2HN7A 4G3YH 2BSRA 1F3JB 3RWIA 5JDSB 4Y4KD 1RJCA 1YEFH 1MWAL 3BQUC 1PD6A 3OJ2C 3BD3A 1O7SA 3MLRH 4NJAH 2Q7YA 1IGCL 1LP9A 4S11A 4BZYA 2VL4A 4H0HB 4IOIA 1EO7A 1BECA 2BNRD 2VQ1A 4MJIB 5BV7B 2UZYB 2OMBA 1F2XK 1MFNA 4XNZC 5J13C 4YEEA 4HIEA 2UWEF 4JRXA 5BOPA 1J1XL 2IF7A 3PWLA 4Z0BH 5E8NB 1XZ0A 2OL3L 3HZMA 1EHLL 1H15A 2Y5TB 4LIQH 4TUJB 4XBEH 4ODUB 1I7RB 2G5BA 2P1YA 3J7HA 3MRJA 4NM8H 4L3ED 1A47A 1BFOA 4A2LA 4FABL 2VXVH 4X5WA 1H3UA 4PRPE 2D9CA 5DJYB 1TENA 1BFTA 4GLRH 3SE3A 3HC0A 3KXFD 1KCUH 3CXHK 1MHHB 5EZJB 4AEEA 5ALBH 2BHUA 2IPTL 5K93A 2LE9A 1FDLH 1JP5A 1EJ6A 2OMNA 3MRGB 3BZFA 1IM3A 1QRNE 3SJVA 3S98A 4JO4L 3SGJC 5KSVA 1I9JL 1K8DA 3GBNL 4TVPL 1OQOA 1I8KA 4PJIE 1KN2L 2PR4H 3WO4C 2PYFB 4P57A 4XPFL 1VKXB 5IQ7H 2AW2A 1T83C 1NMCC 1KGCD 5JMOC 5JLZA 3HZKA 1ZMYA 4LSQH 5F7LB 2VLLA 4BKLA 5BJTB 4I77H 3QNZA 3V8CA 1JL8A 5TQ2H 4G7YL 2J4WH 3O2VL 1P7KB 2WIMA 3QEHB 4IRSB 4M7LL 2XZCH 1H3XA 3QI9B 4JM4H 3K7UA 5CD5D 1OGTB 3LKNB 4FNLL 3NGBC 5I74B 4X6CE 1QKZH 3P2TA 1AE6L 4M7JH 3GIZL 3KLSA 3G6AB 3C60D 4UINH 1OPGH 4Y4FC 1I8MA 1RZ7H 3V0VB 3WHE1 1DUYB 4MXQC 2VXQH 2DIJA 1KIRB 1G6RH 1RZGB 3S5LA 5KSAB 2YA1A 3IS1X 5AWNH 2G75B 2GSGB 3O6LL 4HFUH 3KPRE 4PY7B 3MLVL 2KQMA 4PJEB 1FCGA 4K3GA 1KB5L 1UACL 1I3UA 4JY6B 4L4TB 5LVEA 3I3BA 1FGVL 5KAQF 5J1SC 4X4YA 1NUNB 4HUWA 2C3HA 4MXVE 5C6TL 1GGCH 4XNQB 5BXFA 4PJCA 3N1QC 2VZ1A 3H7BB 4RGOH 4JO3L 4XC1L 5DVKA 4F57H 4XP1H 3INUL 3BPLC 3L3OA 4E42A 2XY2A 4P2RB 2OZ4H 3ALPA 1FIGL 2JJSA 3KYKL 4POYA 1BQLL 3MO1A 4F7MB 2OJEA 2ORBL 3SJVD 2P8PA 4LLQB 5E5MA 1K3ZA 3GEWB 3RFZC 1RZ8B 3Q5YA 2ICEB 5MP6L 5CMAB 3V4UH 4AZ8A 2EXWD 2CMRL 1IQDB 3UDWC 2VERN 2MSPA 4XGZA 2CJUH 3EOTL 3EYVB 3LS5L 1GRWA 4YXHL 4NWUH 3O4LE 5C7XL 3MUGA 5DMIL 1NLDH 4WEBL 2X1XR 1KFAL 1A4KB 3MV9E 3TO4A 3VXSE 2WINB 2X1WL 5T1KB 2W60B 3L3KB 3WFDH 5EOCJ 2V2TB 4OM0L 4EQ2A 4BFIB 4PP2B 2F5AH 1NLBH 3GSVB 4KK5C 3DUHA 2AQ3A 3DGCR 2XZAH 1SJHB 5EU6D 4HXBL 3H3KA 2D31B 4QWWD 4X4MA 4JFHE 1HWGB 2VO5A 4QYOB 3MRBA 1JGDA 5CBAB 4AMKL 5D2NC 5DD0H 4LLWB 2HLFD 1WGOA 5ICXA 3G08A 5F6IC 3ARDC 1CG9A 5FKAA 4MMZC 1B4JH 2FBJL 2MTPA 5FHAL 4WHYG 5HVGB 1I7TA 4U1JA 1X5JA 4PB9H 5L6YL 2GSIB 1MEXL 1D9KA 4PRDB 3RVVC 3DXAE 3LOWA 1OLLA 3RVXD 2I07B 2AV7B 4U1HA 5ID0B 2X1OA 3DBXA 3UTOA 3UPRA 3SKJH 4LPTA 2KPNA 2G60L 3FL7A 3AY4C 1KENH 4U6HA 3TH4T 2BVYA 2ICWA 4PGDB 3DOSA 4Q6IC 3MA9L 3RI5F 5BW7A 3ARSA 3LS4H 2NY2D 4ZUUB 4P99A 3BEWA 4Z78B 1X5AA 4ELKB 4Z7WF 4DGIH 2PCPA 1OSZA 1MFBH 1YEGL 3WN5C 4ACPA 3MXVL 1QSFB 4P2QE 5D1XB 5B8CA 2HWZL 4OJFH 2FATH 1AD9B 4LQFL 5IROC 1EAPA 2R0KL 3MREA 4G7VH 1QSEA 4G42B 4WHTB 4PRAB 1CFNB 4PJAE 3D85D 4UQ3A 2ZCHH 3VXNA 1FNSH 1DBAL 4RAVB 4DUXA 5CEZD 3PDOA 2P24B 4OIAA 2BVOB 5F7EH 3V4VL 3TO4D 1MJJA 1RSFA 1ROWA 5ICZA 5EZLA 1H3VA 1AIFB 2EEDA 3OKOA 1LO2L 3GSWB 1FPTH 1MCOL 4YBQD 1JJUA 4XCFH 1A4JB 1JRHH 1UM4H 4DVRH 4ZUSA 4KXZH 4TUOB 2OJZH 3O9WA 2BJMH 3HRPA 3PG2A 5DJAB 5EO1B 5T1DL 4IRZL 4TSCL 5C8JA 1BFVH 2EYRB 3VGBA 4CN4A 2F8VA 2CKNA 1OP9A 3C9NA 2ZPKH 2GI7A 1JNLH 5LWYL 1CD1A 1TZGH 2CIKB 5BZWB 2QADD 1OT1A 4W4OA 5F89A 3EYUL 1T3FB 4NRYB 5DXWA 2J5LB 3MX0A 3T2OA 4J3XA 5C0DA 1D9KD 2XN9A 1A6TB 4OCRL 4L8SB 3FO2A 4WEUD 4QHUA 1MJUL 2VKWA 4LVNC 2IPUK 2VDMH 5DHYA 5K59E 3VWJD 5D2NE 3QHZL 3VI4F 4AEFA 2EDTA 1J8HA 2DN7A 4M1DH 3W2DL 4WGVB 4KMTH 4X6EB 3ARFB 4JFEE 5C71A 5F6HI 4DKAA 5EIIB 3L7EB 1PW3A 4Q7DA 4Y8AA 4R4BA 3QH3A 4Z9KB 4LDEB 2DYPD 2R0ZL 4ZQKB 5FO7A 3VMNA 1AJ7L 1HQRA 1WT5C 4S2SA 1CZ8H 1JZ6A 1QSED 1AC0A 1PYWB 4W6YB 4PGZA 4GJTB 5A2JH 5F88A 4QT5B 1E4KA 4YPGA 1HKFA 2J6EA 4LBEB 4GRWB 1UEMA 4KFZC 2UYLB 2WY3A 4BQ6A 4EUPG 1MUJB 4WV1B 5AZEH 2IGFL 1CT8A 4OGXL 5KS9E 1OW0A 1WCBA 1S7XB 2QSCL 1M7IB 1QSZA 2AVGA 5EUKB 1OLZA 1MI5D 2APFA 4Y5XB 1NGQL 3HPLA 1RURL 1WISA 2LTQC 4P2YA 1M71A 2WBJC 1BZ9A 5C2UB 3NCJH 4R0LC 2YUWA 5HDBE 3RZCC 2EE3A 3HR5B 4XP4H 3S34L 3S4SA 1DSFL 1YA5A 3PXJA 3MODL 4ETQA 4Q0XH 2FJHB 3WUWA 2R4RL 3ISWA 3ZT7A 1JYXA 2WWKO 3DX8B 5FF6B 1N6UA 1YEKL 4X99B 2JJUA 1BEYL 1RU9H 5DR5L 5HI3C 1NFKA 3V5HA 4DK6A 5I1JL 4ZUTA 4GO6B 2IFGA 5ECJE 5ICYA 5IGXH 4WCYH 5HHMA 1ZT1B 2RQ8A 4W70A 1MY5A 5DD5H 3VXMD 4Y5VA 4JRYA 4KJQC 5KOMC 3WHXB 4LHUA 4B41A 4OLUH 2OTWB 1Q9OB 5DHVB 3SOBL 1SM3L 1ZGLA 2VDKL 3LKPA 4IJ3C 2ZSVA 2YD8A 1KTRL 1WBYB 2QR0B 4QRUB 3AS3A 1VSCA 5I1CH 2CQVA 2YUZA 3PNWA 3RGHA 4CGTA 4KK8C 4Z7VF 2CGRL 3L9RB 3OPZH 1V3KA 2V9RA 4I18B 1SVCP 1VFAA 1HHKB 4M7LT 3WFCL 2E9JA 1FZOA 4IOFD 3GDBA 4OIBA 2ZUXA 1U42A 4P5TA 4YE4H 4CN1A 1OAYH 2JIXB 4NKMB 2OP4L 3BAEL 5JUEH 3QDHA 1IGFL 4NQTA 5EO9A 1EK3A 2AXFB 4GBXC 4D8PA 3OMZA 3C09C 3P11L 2XFXA 1XFPA 4HKBA 1ZHNA 1EFQA 3BZEA 2FO4A 3OR7A 1OOAA 4LU5H 3FQUA 2HKFH 4J4PD 1B3JA 2Y4SA 3VRLF 3FQNB 1DFBL 3WNOA 4CMMA 4TNWK 4HFWA 4XWOC 4G6AC 5DSCA 3DYPA 1VACA 4GQ9H 1QO3A 1AI1H 3NIGF 1CDJA 1UB5A 1V05A 3B5TA 3DRQA 1EGJA 3ZDZF 2EDFA 4FXLA 3TCLA 2ZJSL 3DVGA 4JGJA 1AQDB 1R24A 4GMTL 5HGGS 1Y18A 1A7BA 4JDTL 3BMVA 2YXFA 3DSFL 4PJDB 4MAUH 4R7DB 2Z31C 2ZOKA 1G7IB 1Z9SA 4PGEA 4LHUD 1OTTD 4HEPG 4KI1A 5F7YC 3REWB 5IF0A 5A2IH 3K4DA 1TJIH 3PGDA 2HJFA 4FZ8L 1H0DA 3V8OA 2HKHH 1CR9L 5DQDL 3LKOB 2EH8L 1ZVSB 1RK1B 4QHKJ 4MJ6A 5I8EB 2ZUUA 5ANME 3DUUA 5FUZH 1OM3L 4ZAKC 1CFTB 4FG6D 1QR1B 4WTWA 3HS0B 2X4UA 1UFUA 2XRAH 1CXHA 4XVUC 3BN3B 3MJ9L 4G5ZL 5IVZA 5SX4I 1A2YA 2FEEI 3RWFB 3KJ6L 4NQXA 4LF3B 4N8PA 1OP5H 4ZFOB 2CK2A 1OF2B 2DM3A 3VH8A 3RU8H 4Z7UA 4X8JA 3ARYA 3O11A 3TBVA 3E2HC 5FKPA 1BJMA 4PJGB 1MJ7H 4ZFZB 4MWFA 4K3EL 1PG7L 4AEIH 5KVDL 2OSLB 1U3ZA 2N1KA 4IRJC 3KWWB 4N8VG 4P2OD 3PHOB 2VWEC 4P9MH 3UTTA 4HIJB 4JG1L 5I76A 2R1YB 3LN4A 2K1MA 4NQEE 5GS0D 1CU4H 1QD0A 1RHFA 1RAMA 1WICA 3A6BH 1JFMA 2YPLB 5T5FH 3HA0A 5DO2C 3KHQA 1JNNH 3REVA 3MNZB 2XQYK 1NFDB 5B4MC 3E6FA 4MJIE 1JV5A 1Z5LB 1LGVA 4BH8B 3K3QA 1UM6H 3ZTJH 4HH9B 2VMFA 1KLUB 3AVEA 4JAMB 1AXTL 2CKBB 4MJ5A 4PGBB 1TNMA 4AIOA 5D6CB 4FQXB 2P46B 3GJEB 3HE7B 3MACH 4QOKD 4UOW0 1F4XL 1MRCH 3DYOA 3F65A 3CUPB 2HH0H 3D0VB 4NO0A 5CKGA 3PXHA 5F93C 3QFDB 2PW1A 3ARXA 2I9TA 1J0KA 4HUMB 5IUSA 4EDXA 5JO5B 4XMLL 3HPJB 4XBPA 1J5OH 1HH6A 2VUOA 1CYGA 2H2PD 2DQHH 3U79A 1T20A 1W0WA 3MGOB 3C5SB 3SEPA 5KOVC 2EDQA 2BFVL 2R9HD 1JTTA 1RIUH 4JDZA 1XH3B 1I3RA 1R3IH 1CIUA 5JIPA 5KSBB 1KJ2L 1VCAA 1UA6H 1W72L 3GZKA 3UTTD 5DQJB 4LLVA 1N7ML 2NY6D 5E6IA 3ZSSA 5E5RB 2NLJB 5HPOA 5JNYB 1YN6B 5IB5A 2F53A 3ZKMC 5I16A 4DKDC 1ADQA 4Y2DD 2YD5A 3HCVA 4PD4J 3QEGL 3N9GH 1S7UA 3EO0B 3MSPA 4DTGH 5HVWA 1WAAE 1RY7B 2B0SL 5CJQL 1L0QA 1QBLH 1ZHLB 4HQQL 1A6WH 1YUHA 2Y6SD 4W68A 5H94B 1ZLWH 5E99H 3OX8B 2IBBA 4N5EA 4N0YL 4KQ4L 1X7QB 5J13B 3VFSB 3UX9B 5AUMA 3O81A 4S1QL 3CMOH 5I18H 3LSOA 1YDPB 3MLSL 1KT2B 3LHPL 3LMJL 4IHOB 1U8NA 5F7NC 1FRGH 5F21B 1T1WA 2Z93A 3LRSB 3CIQA 3TBTB 3U36B 1ZAGA 3CDCA 5I1LA 3V52L 4S1SL 5LCVL 1LDSA 2LABA 3GIVA 2FJGA 4OZHB 2HG5A 2F54A 1GSMA 2PXYA 1WZ1H 4LDOB 4I48B 5F3BB 4HGKC 3SDXA 5JW5A 2ZUWA 4L4TE 1EZVX 3RGVD 2NR6D 2PO6B 5GQBA 1FVEA 3IS0X 5DGQA 1G9MH 3F6LA 4HSQA 1RZIB 4NRXA 4OZGE 3OGCB 5DT1L 4MA7L 2ZNXA 4ODTL 4P2RE 4PTUA 1FLRH 3X13B 4Q2ZA 3B3IB 3QPQC 3N0PB 5E7FA 3UMTA 1PY9A 3U4BL 3VXTA 4LRNH 2V7HA 5ISZE 2V2XA 1XR9A 5D70L 5J56B 5SWZE 4N90D 1GGIH 1FGNH 3VFUB 4GKNB 1A3LH 1NBZA 4MQTB 5E6ID 2AGJL 4MA3B 3CLEH 4JY5H 3DJ9A 1T22B 5HDQL 5I15H 3NIFE 3P9LA 2DQDL 1F2QA 4GKZB 4F7EB 2HVJA 3KPSE 3LN5A 4NNXA 3RQ3A 5CEZH 3MBEA 3EGSA 3L3DB 1UJ3C 1IM9A 2GW5A 4GUPA 3RDTD 3UC0L 1GJIA 5EORH 3ULVE 4FMKA 2DLEA 4N5ED 1HHJA 3HG1A 4N0UE 5IB4A 4WI7A 3TWCL 2KZWA 1JFQL 2HA1A 3O3DA 1DJSA 2ESVD 4G80A 4OZIA 4KHTH 3BHBB 1ONQA 5DMGC 1HKLH 3VWKA 2PYEB 1I4FB 4U33A 4NHUB 2J8OA 1RJYA 1ULVA 15C8L 2H1PH 1X4YA 3L3JB 1V7ML 5GRYA 3QG6B 1YEJH 2F54D 5JZ7C 2PXYD 4UV4L 4LFHD 5CCKL 3LPFA 3H2WA 3BP6B 4U2ZA 3UTSE 1MAJA 5DVNA 5GS2D 3MOAH 3SGDI 4K8RD 4NQCD 4M9PA 4MVBD 5I1DB 3ARBC 3ILQC 1WF5A 3WNKA 3DX7A 4RZCA 2GFBA 2WMPA 4POUB 3JV6A 3QDMB 5IHBA 5CUSH 1EEYB 1RUPL 2AKRB 4JHWL 2B39A 3O41B 1KJ3L 3GMOB 4XI5C 4YWGL 4KRNA 5T1MB 1RUMH 4P5KB 4XPHL 3X14B 2LU3A 1DE4B 1Z6JT 4OB5L 1NC4B 1BVLA 3B43A 4O9HH 4LHJB 4HPOL 4PJXA 3RL1B 3K4AA 1HILB 1JGUH 1OTSD 3LEVL 2BCKA 2I25N 4J6RH 4OV6F 4RRPA 3PV6B 1JPTL 1VGEH 4I13B 2N7AA 2Y72A 1W0VA 1RK0B 3DRTB 1MFDL 3ZDYE 3BW9B 5GISL 3B8SA 5C1MB 1IM9D 4S1RL 3FT3A 4R96A 3TN0A 1BM3L 1KJVA 1E6JH 3CFBA 1BBJA 1FFOA 3DO7A 5C0IA 4PYHA 4FFZL 3HE6C 1HOCB 5C0AD 3VCLA 1C5CL 1U3JA 3QRFM 5ID1A 3BZDA 4UDTB 3OXSA 1OCWH 1NAKH 1EUTA 3DX9B 1RVFH 4UT7H 1N0XH 3ZKSD 2GY5A 2X70A 5TE6L 5F7MC 3VWKD 3TFKA 5FHBH 2VLRB 3BP4A 5GZND 4LPWA 4ODSH 5F44A 4OF7A 2V17H 4TTDC 5DQ9A 3U46B 5HVFB 3TIEA 3LKRA 1JWMB 1JMZA 4MD0A 2FO1A 1KCRL 4RQQA 4DFIA 3MV8B 3C6SB 1FZMA 3WXWL 6FABL 4PRPA 3TPUB 3U9UA 3AM8C 1A14L 4O00A 5D1ZD 3TIDA 3OAUH 4E0RB 4V1DE 1A6VL 3OXRB 3TBSB 2ZSWB 5F96H 3LY6A 3O0RL 1HXMB 1A1OB 4HC1A 4FQQB 1QR4A 5CINH 5C0BB 1QRNA 3B83A 1ORSA 1S9VA 3HNSH 1U58B 3EDJA 2XNAA 3HZYA 4JO2L 4PJIA 4YHIA 1D5BB 3FO0H 2GITA 1NC2A 5F1IB 3TT3H 3TVMC 5FAAA 1DBBH 2P5WD 5KZCD 1NJ9A 3QFJD 5JR1L 1RI8A 4GRWE 2J6EH 2PW2B 1S9KC 3WKMH 4G8EB 1MCNA 4RMVA 4PJBF 4DN3L 4ETYA 5C07D 2IBZY 4S10A 5IEKB 2OR9H 3L95B 1P6FA 2K9UA 2MCPH 3L6FB 3QDJB 4Y4HC 1CGVA 3P0YH 3NA9L 3HHRB 2FEDD 4G6MH 4X6CA 4NJ9H 1YPZF 3T2NL 4PV9A 3NZHL 1S7WA 1G7MA 1D3CA 2XICA 3PL6B 3GI8L 4NN6C 3D9AH 5F9JB 4PJ9D 2Z91A 4KRPC 5C0EB 3KPRA 1FIEA 1MLBA 4HCRL 1YEHL 3F5WA 5EC2A 3QJHB 1AD0A 3GSNH 3WIHH 3SBWC 1C12A 2MHAA 3MLTB 4FQ1L 2XQBL 3FB5B 3QUKA 4J8RB 3PABA 2DTMH 4U0RC 4DZ8B 5DRXA 5GGSY 3WIFA 3ZT6A 3G9VA 4XCYB 3UJIH 5IOPA 2YRZA 5HYJE 4RIRA 4FQLL 3Q6FB 5BO1H 3RUGE 2R2HB 2W1NA 1QRND 3W0WE 3AB0C 2JCCF 1ETZA 5K9JH 4TQEL 3T0EC 3I6KA 1IC4L 3GK8L 4M5YH 2Y7QB 4G8FB 1YECL 1JYNA 4FFWD 4EBQH 3O4LA 5D5MF 1DLHB 3IAGC 4QXGL 4JHZA 2Y06L 1FYHB 2XYCA 3KLDA 3MV9A 5ALCL 2ARWA 5GRZA 4OUOA 2X1QA 1ZVYA 3VXSA 1N5YH 2B1HH 3I9GH 2XWJA 4RFEB 5HGHB 1SBSL 1INQB 2BVPB 2XV6B 4U1IA 4IMLA 5C6PB 3GSXB 4HF5L 4RGND 3CFJA 5IJKC 3BESR 3QO0A 1HNGA 1T83A 1ZLWK 5HHXL 4NRZB 4YNYA 5BMFH 1G9NH 2DI9A 5DI8B 4WWKD 4KTYA 2QTEA 3GJFA 4R3SB 3MJ6A 5L2JA 1KJMB 3QQNA 3KVQA 1ZXQA 1LEGA 4FQJH 5KTEH 2DQFA 1T4KA 3KPRD 4F7TB 2NX5A 4J12A 5GS0H 4BZ1L 2AXGA 3D0LB 1T0MA 3DXAA 4NO2A 4W4NA 2Q86B 3IAPA 1S5HA 4BQ9A 2HTLC 4KTDH 4TSBL 1I8IA 2O5ZL 3CSYA 4JQXC 4ODBD 2APXA 2JKXA 4QGTA 5E2UL 5HGBB 1XGUA 5HHOB 4YPJA 4YHLH 4F15B 4IIQC 4M6ML 5IKCA 4MXQA 1UGNA 4ODVH 4ISVA 3ZL4H 4ZNEE 3EKCA 1Y6NR 4O4YH 4BJLA 4G3YL 3MJ8B 1BHGA 4P2QA 2NY3B 3LN9A 2UWEB 1U3YA 2NY7H 4ERSH 2R15A 1YEIL 3RIAK 1JPFB 3I6GB 3MLRL 4NJAL 5D2LF 2AK1H 4PJAA 2VITA 4GLRI 3MRDB 3QWOB 4HDIA 2CRIA 3M17B 3VXSD 1U92B 2EZ0D 4L3AA 2Z35A 3TBWA 4QRQB 4XNXH 4HS8L 5J7CC 5FECB 5CIPH 5LQBH 2AJSH 4LCUB 3IFLH 4PJGE 3H7LA 3T0EE 2J88H 1FG2A 1QNZH 5E8OB 1T7YA 1ZTXH 4YX2L 4Z0BL 1NUGA 3QAZC 4Q9BA 4ZD3H 5DRNA 2P48B 4PREA 1QFWM 1TJHL 4LIQL 4XBEL 2EIZB 5C86A 3PWUB 2DMCA 1B2WH 4UOJA 4WDIA 1JWUA 1F00I 4JY4A 2A6DA 3GSRB 2RB8A 1JYWA 3CFCL 4KKNA 5CLTA 2VXVL 3HMXH 4K71B 3IFOB 2NX5D 4PJ7E 5JW3L 5IW6A 1T1YA 1PLGL 4UV7L 2V5SA 1KCUL 2XTLA 3DXAD 3GUTB 4HK0B 5ALBL 5CS7A 1XF2A 1FDLL 1FL3B 1RUAH 2EDKA 4TN9A 3ZTJG 3FQXB 5D2NA 3RTQD 1MCPH 3ARDA 4XH2B 4F33A 4JFEA 5SWSE 3TJHC 4JZNA 1P7QA 3MMEA 2PR4L 4DW2H 5D71H 4LCCB 4M4RA 3WNPA 5IQ7L 1KCSH 1TQCB 1U8QB 2NTFA 2EC8A 1XGRB 3FTGB 3O45B 4LSQL 4PPTA 2IQ9H 1F58L 3SE8L 3QSKB 4LEOB 5TQ2L 2J4WL 1RJLB 3GI9H 1Z0MA 1TMCA 1BZ7A 1T2QH 1MCEA 3QHFH 3AY4A 1LEIA 3SDDD 4M7ZC 3WE6A 1M7DA 4Q6IA 2XZCL 4FTVE 3GSOA 4JM4L 2DWEB 4KGLA 3RPIA 1FZKA 4PB0H 2FGZA 5IHUH 4EVNB 5KS9A 2ZOLA 1NGXB 5JDJA 4KPHL 5HYQA 4M7JL 1L6XA 2LU7A 5EFIA 4L3CA 2VAAA 4MAYC 4UINL 2YR3A 4BSVA 2DBLH 2GEEA 1RZ7L 5GGRA 3OF6A 5IROA 4UQ2A 1CN4A 2VXQL 1GIGH 3FQTA 1G6RL 1NQBA 2P8LB 5KSBE 3ULUD 5AWNL 4XNYH 1IT9H 4HFUL 1EVUA 3MNVA 2W38A 2PF6A 4NT6A 3RRQA 1I1AC 3N1PC 2VDPH 3D3VD 4AY0A 3S37H 2DTSA 1GGCL 4XXDB 2V5YA 4RGOL 4L9LC 1U93A 4XP1L 3VXQB 5I1EH 2XT1B 4ZUVA 2C7UB 2VXUH 3MLPA 2OS7A 2OZ4L 4KKLD 3WLBB 4JZJA 2ZUSA 1QBBA 4FQCH 2GTWB 3S36X 2NY4B 1GPOH 2BNQE 4YK4C 2W65A 4O58L 3PV7A 4JFED 2HFFB 4M1CC 3JWNC 1K5NA 3IJSA 4KK9C 2CJUL 3IU3A 3VXUB 4N9GA 3BKMH 2DMKA 5MERB 3B5GA 1RUQH 4JPVH 5E95B 4HS6B 4LCYA 3SY0B 1NCBH 4IS6A 1AGBB 5ERWA 43CAA 4YIQB 2G9HB 1XGTB 3WFDL 2CO7B 4WUUB 5H35B 2ARJB 1J87A 1LO5A 4WVRA 1BF2A 3MRNB 2F5AL 4NUJA 1NLBL 2P49B 4FMFA 2XZAL 3DURA 2MQ0A 5GS2H 2DQIL 2FR4B 2XKNA 1TTGA 3N85H 1U2CA 2ITDA 5D93B 2R1WA 5DD0L 2EDNA 5IIEB 1A22B 1YMHB 1FFQA 4QKXB 3PHQA 1WT5A 4AJ0A 3IVKA 4MHHG 3ARGB 5J3HC 1NMAH 4TVSa 1B4JL 3FT4A 3LD8B 5E9DB 4PB9L 4P9HH 4DVBB 4Z7WB 4G6FD 4PRIA 2KL6A 4XHQA 2XOTA 1XEDA 4BSJA 3VA2C 2FH6A 1IE5A 1U8KB 5F1KC 1EIBA 1RFDH 5F7DA 1KENL 1P2CA 5B38B 2WBJA 1CICC 3S3SA 3WEXA 2VIRB 3LS4L 3UYPA 4R0LA 5E1AA 2Y5EA 3RZCA 2V7NA 1N59A 4P49A 3VJ6A 3FB8B 1B0GA 4P3WA 1MFBL 2GT9B 4JJ5B 5J6HA 4B0MM 1FNHA 4MCYA 4OJFL 3SKMA 3T4YB 4K07A 4LLUA 3BKCH 4G7VL 4FXKB 3U30C 1DL7L 5DGRA 2ZCHL 1FNSL 1VEPA 2NXZC 2YOCA 3SCMC 1WBXA 2UVEA 1I1FA 1L7IH 2FL5B 5ANMA 1I7UA 2BNUA 4YDVA 2FX9H 4H25A 5BRZE 1PQZB 3QJFA 4JM2C 3CC5B 3OAZK 3MGTA 5CGMA 2ATPA 1FPTL 2VYRE 4HIHB 1LE9A 2EIDA 1K2DB 1QZ1A 4G8IA 1JRHL 2PN5A 1P7HL 3QIBB 2C1OB 4N0FA 4A6YL 4DVRL 3BUYB 4TTGA 4EN3B 2OJZL 3CSGA 1PG7W 2BJML 4XMKH 1IQWH 1QQDB 5FO8A 1EBAA 1FV1B 1BFVL 3TA3C 4QTIH 4WW2C 4WO4C 3GKZA 2GTZA 2ARJQ 1QLRB 1QP1A 2H9GB 2ZPKL 3DUSA 4OZFB 4LLYA 3MXWL 1MLCB 1HCVA 1TZGL 4CU8A 12E8H 2ZUQB 3O2DA 4WNQB 2WQRA 1N6QH 3W9DA 1AHWB 4PRID 3DMMD 3UPCA 1U8JB 4Z0XB 3W5MA 2W9DL 2XTJC 3DARA 5D7IE 1PZ5B 5KW9H 4GBXA 1UJ3B 3HI5H 5E8PB 4NQEA 5D9SB 1DLFH 2VDML 4KKBD 3HFMH 1R3KA 4M6NH 4M1DL 2IH1B 2DQEL 5EUOE 2DQGH 4NNPL 1ZLUK 2WANA 4D3CL 3I84A 3H42H 2VDNH 1DEEA 3GFUA 4APQB 4MJIA 1D5XB 5CBEB 4MQXC 2JB6A 3PQYB 2CUMA 2BY1A 5B3NA 4QF1A 1MNUH 4KKCD 4NWTH 3MLXH 3BGAA 3WKNA 3EJZD 4P4RA 3B2VH 2AK4E 4KKAD 4LIQE 5HI3D 1N2RB 2VLRE 2YD3A 5E8NA 1QYGH 3ZE2F 3HUJF 5GIRA 4QCIA 2MQCA 2IAMB 5AZEL 2IANB 4TUJA 3BDBA 5DRZA 5TQ0H 2Z31A 1KIPB 3MV8E 2HAZA 4RGMB 1KB9J 5IBTH 1KXTB 4P23C 1F8TH 4O51B 3IRPX 3F6IA 1R3LB 1CCZA 2Q8BL 5E6YA 4PJ8D 4L4VD 4HC1H 1FFNB 3MRGA 4NCC2 5C0BE 1SJEB 4LCWB 2SEBB 4JPKH 4N68A 5MI0B 4QO1A 1Q1JL 3VXRB 3O2WH 1EO5A 3MNWA 3AXLA 3OKMB 5I66B 2H26A 1CFSA 2PYFA 5IMKA 4I0CC 1KF9B 4M7KH 5KVGH 1FO0H 5IGXL 3VMPA 2JJTA 2LVCA 1NAMA 3E2HA 1WAAA 5DD5L 2WWMC 1BF8A 3JSSA 5ESQB 3QXDB 3HE6B 4WEMB 2XI9A 1XT5A 2A6IB 4PRHB 1P7KA 3RL2B 4E5XB 4JGUA 3SQOL 4MJID 3W5NA 3QDJE 1MHEB 4ZDHB 2ZUTA 2X89A 3LEXB 1OGTA 3LKNA 4KVNL 5HHPB 3SE4C 5I1CL 3S4SG 1I85C 3AROA 4S1DD 2VLKE 2B5IB 5JPNB 5J6GB 4K23H 8CGTA 4YE4L 5JQ6L 1OAYL 5HGDB 1AXSA 4XRCA 3EYFA 3RNQA 1RZGA 2YSSA 1CXFA 2GSGA 5TE7H 3DIFA 4HWZB 4PY7A 4PJEA 5FYLL 3B4NA 4QHLA 5DMKB 5T33H 1TZHB 4L4TA 4HBQA 3AREC 5DEFB 1T7XA 1NCDL 1KN4L 2HT4D 4LHUG 2HKFL 4OZGA 2DQUH 5C0CB 3RWDB 4P2RA 4HUKB 3IDXH 3MRLB 4R4NC 4F7MA 4U7KA 3P30H 1GXEA 5ISZA 4GQ9L 1ZLSH 1NFIA 1TCRB 1IZKA 3ROOA 2A6KA 1KXVC 5SWZA 1AI1L 5C0FA 4Z95H 1XF4B 4XVUD 3NN8A 1IQDA 3IKCB 5GGTH 1DBKL 2Y9RT 4RFNC 1A6AB 4UI2A 3EYVA 4QRRB 2YEZB 2FD6H 4M93C 1CFQB 2LVEA 3P77B 4NZDA 4UIMB 4BZ2H 2BHZA 4YDLC 3QNYA 4WGWB 4PJCF 3KPSA 4MAUL 4P0DA 3M1BA 2WINA 4O2CB 1YNLH 3IDNB 2HFEB 1D5MA 1F90H 1QEWB 2W60A 3QXWA 3L3KA 4U1KA 1E28B 2R2EB 3QUYC 4BFIA 1TJIL 1CTNA 4N0UA 1GOHA 3QI9D 2X89D 1BOGB 5BZDB 4X7FC 4KI5F 1ZWIA 3BN9C 4BK5A 1MQKH 3QUXC 3X3GH 2XPGB 1CF8H 1B88A 4H5SB 5FUZL 3VD3A 2H8PB 1GZPA 1PVHA 4LLWA 1D6EB 3MLWH 2BMKB 1LEKB 2KBGA 4WFGE 3HZVB 4XZUB 4YAQB 4R97B 4OLWH 1HK6A 1IZJA 3K8MA 5EC1B 2YKLH 1MF2L 4L4TD 5A40E 1WBZA 3UTSA 3MCG1 2E9WA 4Z18A 4PGCB 5IB2B 1MPAH 4GRLA 4KAQH 2Z4QB 3O3AA 4P2RD 5MEOB 4YHYC 3U4EA 3JVGA 3P9MA 4PGDA 3V6OC 4DFHA 1X5ZA 4HEME 2EDOA 4UNTA 1A1NB 4LSTL 3BKJH 2NY1C 4X9IA 1KC5H 1IL1A 4ELKA 3N1FC </