3WLBA

Hla-a24 in complex with hiv-1 nef126-10(8t10f)
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
274
structure length
274
Chain Sequence
GSHSMRYFSTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDEETGKVKAHSQTDRENLRIALRYYNQSEAGSHTLQMMFGCDVGSDGRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQITKRKWEAAHVAEQQRAYLEGTCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, A-24 alpha chain
publication title Switching and emergence of CTL epitopes in HIV-1 infection
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 77
structure length 274
sequence length 274
ec nomenclature
pdb deposition date 2013-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3wlbA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3wlbA01
5DD5L 4KFZC 1S9YA 3AS2A 1EHLL 4L9LC 4GQ9H 3V0WH 3GSRA 4E41E 5BO1L 2VDQH 5IJVA 1ULVA 1FC2D 1LK3L 1KJVB 3MNVA 3P0YL 1DEEA 3K1DA 4M4RA 2CO6B 4LSSL 1UT9A 5MENE 5IK3B 1IAIL 3MLZL 1HHHA 3ZDXF 4PJCB 4HUXA 5F6HI 3ZO0A 5C07A 4PRDB 4N0UE 3RL2A 3GJFK 1UWXK 4WTZG 2VLJB 2CXKA 2AK4E 4NO3B 3VXOA 1RQ5A 5I1GL 3D3VB 4XNZB 4YHIA 5GXBB 3FAXA 1JL8A 1OCWL 1MOEA 2V7HB 4RZCA 5FYKD 1S78D 4OFIA 2X89D 4GW5A 5ID1B 5F1KC 4E5XA 3U83A 1E6OH 1KEML 4D0BA 1ZV5A 3MLXL 2D31B 5GSVB 1DBAH 5HDQL 3BKYH 5GGQH 2X4RB 2QL1A 3ZYIA 2FATH 1T1ZA 3VXSA 3GSXB 3QDGD 4YAQB 3BJLA 1E4KA 4Y4KD 4RAVB 4Z0BL 1ZHLA 4I0PA 4RGND 5TE7H 2PW2A 1PY9A 1F2XK 1LO0L 1SM3H 2DOCA 2IEPA 4LHJB 4X99A 3L3JA 1Z9SA 2R2EA 4NO5A 1YEIL 4NO2B 1IAIM 3V4VL 4X4YB 2CIIA 4YHNA 1H3TA 4IJ3B 4X4XA 3ROOA 4EQ3A 3BKMH 4W6YB 2APBA 3O2DH 5F7MC 1OQXA 5GGUA 2XTJB 2PUQT 3WHE0 3QJHA 2P42B 3C2AH 5D2NB 3RDTA 2QKIA 3WKNA 4MHHI 4U31A 5AWNL 5C0JB 2CMRH 2AXGA 2SEBB 1MLBA 1S78C 1JGLL 4LIQE 3DGGA 4FQXB 5IQ9B 4OF5A 5IWLC 1ZVYA 2HFGH 3CSGA 3U0PB 4JFFA 1UJ3B 4ZUWB 1EA9C 4PJ5B 4NQXA 4JPIA 4H20L 1W72A 2AGJL 5T33L 3MRIA 4QOKA 3EO0B 3NPSB 1GOFA 4Y4KC 1WQVT 3M1BA 4UBDD 4AM0A 1A4KA 2HTKD 4GLRI 4GKSB 5IK3A 1EHNA 2ZJSL 4ODXB 4YIQB 2COQA 1G7JB 3FB8B 3TCLB 4XVJH 3GMPA 4S0UC 5D1ZD 3QG7H 1S9XB 2G9HA 4GAFB 2A6JA 1IGML 1L9NA 4LASH 4S11A 5LAXB 1ZEAH 1TJGL 3KYMA 3S98A 4WTXA 2FWOB 4BZ1L 5HY9B 1M1SA 4Y19D 1VENA 3PWNA 5F21B 5IG7A 1N4XL 2MCPL 4Y8DC 4JQIH 4D9QD 4TUOA 5IHLB 1MCPH 1A6ZA 1PLGL 3KPRE 3UDWA 1NANI 4NNPH 3H9HA 4OJFL 2VB5A 4NNXB 1R0AL 5EULV 4U6VH 1MRDL 4GSDH 2V17H 1BZ7B 4Y1AA 4YNYA 4O58L 3U30B 3ARGB 3E2HB 1WF5A 4G6ML 1RJYB 1KUMA 4TSBH 1BOGB 5C0RL 3QRFM 1M71B 5C0IB 4QHMA 3OZ9H 4NHCL 1Y18B 3UZEA 1P84K 1FZJB 2P8LB 5I1KL 3N1FC 2HKFH 5C3TA 4M5ZL 1F90H 2VQ1B 3ZTNL 3NZ8A 1IC7H 3QIUB 1QRNE 3LEXA 3TN0A 1HK6A 2X5PA 1FO0L 1WISA 4HS6A 4XVSH 1JPTH 2J8UF 2W9LA 5E7BA 4KK5D 3MUY1 1MREL 4DOHE 4EOWH 4P4KD 3O8XC 1HHGA 3BP5B 2XWJB 3UTSE 1JWMA 1DQDH 4RIRB 1QRKA 1MI5A 2HTLC 1U6AL 1VEPA 2UY6A 4KAQL 3WLWD 4U2YA 2XQYG 1MCDA 1CL7H 4PJ9B 4HF5H 4NZTH 3VXRB 3IU3B 4HFUL 5DO2C 3QUMB 3RWGB 3V4UL 5JR1H 4WGVB 2XXMB 1T5WA 3L3HB 1OSPH 4GQPH 1V7MH 2IFFL 3ZYOA 2VZ1A 3AREB 2EDYA 2BC4B 3PWPD 4X6FB 5EU6B 1W8OA 5DGQA 4FFZH 1R5VB 1YYLL 4BSJA 4JN2B 1UQSB 1G7JA 3QCTL 4QXGH 1ADQL 2GSIA 4IRJB 4LRIA 4DGVL 1MHEA 2NY4D 1G6RB 1RUQH 4I18B 4X6DB 2X70A 1B88A 4P57B 2R0KH 3RWEA 4OKDA 1BD2A 3RWJA 4DQOL 3IVKA 3BYYA 3FN3A 3MA7A 4UV7H 3V95A 4FQHB 4JVUA 5CJQH 5T5FH 1XR9B 5D71H 3CDFA 2WIIB 2P7TA 3WLWC 1SJHA 2BNQA 4XP4H 3ULUC 4PJEF 3HUJF 1G9NL 2DQHH 4D8PB 2GJZA 4B0MM 2NXYB 4WNQA 2ATKB 2VXTH 1CFNA 2NY6C 4LLQB 5F7UA 4LBEB 4KH2A 3QIBA 4OF0A 5FGCE 1NMCB 4MXQA 1S5HB 1KGCD 5IEHA 1BWMA 1KFAH 1F13A 2VZUA 4YHZH 3T08A 5CIPB 4OGAD 3O9WD 3I3DA 1RD6A 2AEQL 2H1PH 1F4XL 1L4IA 4Y2DB 2ZCLH 1ZT1B 2NTSP 2UZYB 4JVPA 3L3KA 4AJ0A 4FTVA 2ADGA 1K85A 1IBGH 3F6LA 3GI9L 2Z92B 4NM8H 5E5RB 5GGSA 2BSTB 1C5CH 1IC5H 5IT2H 3QRGL 2G5BB 4V1DE 5I1IH 1IE5A 4ZFOB 4GBXD 3RWGA 1ZLVK 2HP4A 5I76A 4KDTA 3G9VA 2OR9L 1VFMA 4YXHL 4O02H 5GGRY 3V0VB 1FDLL 4Y4HC 3AREA 5B39G 3FZUD 1MJUL 4M6OL 4AMKL 4PR5A 4UT7H 3B9KC 2FHCA 2VDML 2VISA 1A3RL 1R5VA 3MV7E 1PEWA 5TDOA 3QB7C 1RK1A 2CDGA 3BGMA 4XNYL 3OR6A 3IETA 4V3EB 2CK2A 3LS5H 1U8QB 2JJWA 4X6DA 1LK2A 4FQQA 4ZUUB 1QFOA 1Z0MA 2A6KA 4OGAC 5C0ND 3O9WC 5IV2A 3FO1A 3BD3A 1WUNT 5JIPA 2ORBH 3L3OB 4JFED 4WU5A 4ZTOH 2OR8A 4LLMB 3EYSH 3VGDA 3OGCA 5CHNB 1AGDA 2GIYA 4XBGA 1RVFL 3GSVB 2AJVH 5CBAB 5T1LD 1I7RB 5CGTA 4QLRA 4MMZC 1NDGA 5JXAL 2CLVA 5GJSL 3CK0L 4NOBA 4K3EH 3BZFA 1IGTB 5KTEL 1YJDH 3QG6B 4Y8AA 4LBEA 1V3JA 3VCLB 2FB4L 2GY7B 5C09D 3N0PB 3L7FB 1J1OL 1P1ZB 3VGAC 5J6HA 1FG2B 4PJAE 4LDOB 2R56H 3EFFB 3IXAA 1HHIB 2NW2B 4AENB 2FX8H 5E8EA 1GPOL 3HS0B 2W9DH 4Z7QF 4GT7A 1N6QH 3VFPA 2J2ZA 3TVMD 3LS4H 3CFDB 4F7MB 1WZLA 1YYML 4H0HB 5GRUH 1BFVL 2BSRB 3QNYA 1SYVA 3FL7A 1JF1B 1QBBA 2VXSL 3P77B 2C7UB 4U1NA 5EBMA 2HJKB 2BHUA 4N0FB 5D1XB 1R24A 2J5LC 3QCVH 4HD9A 4O51B 5FO9A 1PSKH 3CFIC 4G9FD 1U8MB 2GJ6D 1H8NA 1N64L 5CSBA 1CXEA 1VACB 2Y36L 1MJ7L 1NKRA 1YY8B 2P1YA 2JK5A 3QPXH 1XGUA 3WYRA 3CX5K 4LAQL 1CE6A 3IFOB 3WIHH 1NCTA 4C57C 3RHWK 5HJ3A 4OLWL 5E03A 2R9HD 2F74A 5BS0B 5I30L 1HHJA 1XF3A 2ZOKA 4I48A 2D7TL 3B2VH 5KBNC 1YDPB 3VRJA 1OAKH 1ITBB 3PWVB 3FONA 2B0SL 3BDXA 4YLQT 1NKOA 5I8OL 4EN3C 3WFBL 1QLEH 2DLTA 1KYOJ 1IKFL 2GT9B 5HHOA 1HXMB 1M7IA 5CP3H 1DQQB 4PS4L 3Q0HA 1WCBA 4OAWB 2X10A 4ODVH 5T3ZE 5FHAL 5HHQB 4LDEB 1HSAB 3BIBX 1NSNL 3S37L 4LSVH 5DS8A 1T3FA 3PP3H 1N6VA 1W0VB 2JB5H 1T0NA 3L7FA 1G9MH 2ZCHH 5J1SC 2X9WA 4WHTA 5DURB 4FFVC 4PUBL 2HVJA 1UG9A 4M48H 1P4LA 4AENA 1XZ0B 5DWUL 4N9GB 3SGDH 5F3BA 2EDQA 4YBQD 2FR4B 4P5KA 2J6EL 3SE4C 2GTWA 4QRSA 3T1FB 3H3KA 1EHAA 1H5BA 1DVFC 1QA9A 3SKMA 2BSRA 3CH1B 2OI9C 1RJCA 4OLUL 1M05B 1QFHA 4IMKA 4OZIA 2LVCA 1PKQB 2HJKA 4UOW1 5E4EB 4O51A 4JZOB 3BKCH 4KKBC 1CU4H 4I9WE 3U0TB 2C4FU 3VFRB 4M62H 4QXTA 4BQ6A 1M6OB 2YHGA 4OV5B 1U8MA 3OTTA 3K81A 1I9RH 3IJYB 4Y5XC 1E6JH 4MAYA 5ELIA 3OX8B 3FO9A 3P4NB 4X6BB 3OKYA 5KANI 4NNYB 3S4SG 4ONHB 5ISZA 2IPUG 3BN9C 3MV8D 1LP9F 1CIUA 4BKLB 2F8XC 5TE4L 2BRRH 1R3HA 2XOTA 3KPMB 1FFPB 2WBJC 5I18L 4KI5C 4A6YA 1LE9A 1ZSDA 2EZ0D 4JRXA 1G7PB 3RL1B 1I3RB 1IKNA 3MRPB 4LLUB 4NUGL 5INDA 1JI1A 3VA2C 4ODBD 2RBLA 4HH9A 1HXMA 1NCAH 1OTSD 1DQQA 3K2UH 5GJTL 1ZT7A 3BPOC 1BVLA 1RUMH 3DURB 1IAKA 4HPYL 3U4BH 1VPOH 5C6TH 5IUSA 4RMWA 4XPHL 4UAOC 3P0VL 25C8H 4NQDA 4KJYA 5B39B 2QBWA 4JFDE 2CJUL 3WN5B 1MCOH 4Z7UA 1Q0XH 5IBTL 5DK2B 3PHSA 2JJUA 3HG1E 2DTMH 4Q2ZA 4MZ3A 1ZHBA 4HKJA 5DZOA 5CEZH 1MCQA 3O4LD 5FYJU 4Z6AT 5FXCH 1CG9A 4HJ0C 3HZYA 5JW5B 1FO0A 5GGVY 2P8PA 1RZ8B 1E4XH 1IGJA 2H2SC 2IBZX 4Z78A 1D5IL 5F9OH 1F2QA 3QYCA 2EYTA 1OAYL 4MNHA 1WICA 1WLHA 4Z7VE 2A6DB 2WIMA 3D48R 3CLFL 4DGYL 3BGAA 5HVHC 5I0DA 1T6WA 4PJDE 3SDYL 2I07B 4ISVB 3PGFH 4OD1H 5AAMA 4LPYA 4MXVE 1XF5B 2FO1A 3QSKB 3I6GA 3OKNA 4GKNA 3FQUB 3MACL 5EORL 1WZ1L 4ZMAT 4ETQB 3V5DB 3BW9A 4PRPE 5E56A 3LV3B 1KENH 3N85H 4ZUTB 3B5TA 4PB9H 5IB4B 4F3FA 2PYEE 3I2CL 2EDOA 5KS9B 5C08A 2FIKB 3FCTA 4JFXB 4NUJB 4PJFF 4ZPTB 5IGXH 5JNYA 1KCRH 3GMNA 3AU1B 1ZWIB 3MRQA 4KJWD 5K9QG 4CN1A 3MRPA 4LLUA 1UA6H 1L0XA 2Z9TA 3QZWG 4MA8H 4RDQF 4G9DA 1LMKA 4ODHH 1EBPA 5A16A 4PJIB 4HGWB 3UC0H 5JUEL 2OQJB 2LQRA 1OAZH 1NC4A 1MIMH 2JIXB 3LCYA 3FT2B 3ULUF 5C0BB 3QHZL 3DI2B 4JN1L 3SDCA 1Q9WA 2J88H 5CEYA 1BBJB 5AZ2H 5FA4B 4JPKL 4XPTH 2Y7QB 5L8JB 1KB5H 4M02A 1TCMA 3QI9A 2F19L 4P5TB 1W2KT 3BVNA 2DLEA 1KEGH 3VFUA 1I1AA 3CXHJ 1D5BB 3UPRA 4GLRH 4RISH 3SDDB 5DUMH 3VI3E 5DJAA 3WN5A 1MCFA 1KTDA 4LKCA 3O2VL 1XIWC 4C4KT 4IHOB 3TJEH 5MHSD 5T1KB 4HDIA 5DD6A 3TBVA 3GSNH 3O3DA 4H1LH 5FV2A 4BH8B 5EUOF 3CMOL 3BXNB 2UWEE 4NBXB 1QPPA 1MY7A 3TFKC 3FMGL 4CNIA 4RGMB 4RWYH 1D5MB 2DM7A 3D2UB 3JWOL 4MB3A 2EIZB 4NJAH 1QACA 2AJUL 3WL9B 1NANH 5E99H 1MHHB 3F58L 5HSFA 2HLFD 3WNOA 1RZKH 2BDNH 4P2QD 4XAWL 2NY0D 2QHLA 5IW6B 3E6HA 1UC6A 5FYKE 4OLZH 5ITFA 3UBXI 4AT6B 2ICWI 3MRGA 2I07A 2UVEA 1CFSB 2VL4A 1CLZH 4HJJH 3SPVA 3QR2A 4C54A 2QQKL 4N5EA 2QADB 4Z7NF 5JQ6H 3LMJL 3WIIL 4WUUE 3QO1B 3K4ZA 5ICXA 3QDGE 3JVGC 1AJ7L 1E0OB 2PO6C 3NGBC 3QXWA 3MXVL 5JHDB 1NFDA 4RGNE 4Q6YA 4RMSA 1R5WB 2IAND 3L7EA 4NO0B 2RR3A 1S8DB 2NY3B 4J1UB 1MCIA 2VRAA 4F33A 3M07A 1LK3H 1AGEB 1CLYL 4NZDA 1HYSC 1IM9B 5DQJA 3I9GL 4KHTL 1CDJA 3MC0A 3FKUS 3JV4B 4FQIL 5TH2A 1A7QL 5FYJH 4FFEX 3NVQA 1SYSA 3MRHB 3HB3D 1JNHA 2R1WB 4OCYH 2YPVH 2W9EL 1H0DA 4M1DL 1Q9OB 3G9AB 2O93L 2GUOA 4IDJL 4JFQB 3ZT7A 5CJ8A 4HHAB 3MJ8A 5KVEL 2HLAB 3S4SB 1KJ2L 1VFBA 3VD5A 3T2NH 3GIVB 2VDKH 1EZVY 2AJ3A 3MLXH 1TJIH 5FGSA 3QJFA 1UEYA 2EDKA 3GB7B 5JMOC 1MFEL 4OIAA 3BXNA 4FA8A 5I2IB 2BSSA 5E2WL 4CGTA 2R1YB 4JM2C 5JW3H 1U8NB 3GRWH 5AD0B 2DQEL 4E0RA 1KSRA 3QUZD 5H37H 4Y16B 4PJ8B 3LEVL 3GJFH 1F11A 2XFXB 1CFTA 2PETA 2VXQH 5DMYA 1UWXH 3I50H 5KSBE 3ARFB 4Y19E 4JPVL 1MRCH 3DV4B 4DK6A 5C0AD 1YEJL 2PTVA 2MPAL 3ULVH 1QZ1A 4D9QE 4XP5H 1A0QH 4NHUA 4Z7WE 3KLSA 2VQUA 1MAML 3WS3B 1CFBA 5FB8B 4LEXH 5MI0C 1T7VA 4N0YL 1V7NL 2VERN 5KAQF 3S88L 5D72L 4ONFH 1Q0YL 1S8DA 3CCHB 3LZFL 4G8IB 3B3IB 1S7RA 3RZCD 4NN7B 1EMTL 5A2LH 3CDGB 4KU1A 3KPQA 4HG4J 5B38G 1MFDL 2WY3A 2OX5A 4ZFGL 4IM8A 2UZIH 4UTBH 1HKLL 3QUZC 4H25B 3IRZA 5CSZA 1VADA 2A73A 4LSDA 2IAMC 1M7XA 3NACL 4DKFH 1Q9OA 4BM7A 1YPZB 4AIOA 1RHHB 1LEGB 2CKNA 4X6EB 3BIAX 4M6AA 2DDQL 3EO9H 3MRFB 3N06B 4U7MA 5BOZG 2C3WA 4OJFH 5DDHA 1WK0A 3LSOB 3PWPE 3CH8A 1PQZA 1R3LA 1FJ1B 1YEKL 5D70L 1MEXH 4Q0XL 5I2IA 1H15B 4O58H 5C0GA 4JFOB 3QZWB 2OS7A 4GG8A 5C0RH 3RZCC 1AR1C 4NHCH 4Y16A 4HUWB 4GW1B 1AO7A 1OTTC 4Z77A 4OZGA 1BFSA 4M5ZH 3DUUA 3C60C 4MAUL 2ESVB 3C6LC 4BFGA 4DKDC 2O5ZL 5KSAD 3S5LA 2DQTH 5M7QA 5EIIB 1XGYH 5I15L 5J12C 1ZA6B 3U36A 1ZGLB 1EJOL 4L3CB 4HEME 3QIWD 1U92B 2X41A 3D25B 3REVB 4F9LC 5IIEB 4Q58C 4TULH 3T0BA 1S7XA 3RUGE 1WFNA 1CR9L 5AUMA 4KI5F 2GSGB 4Q9QL 4KAQH 1BJMA 4A2MA 1Q9KB 1X6LA 3RVVD 4LDLB 4U1KB 1CD1B 1MHPL 2VZSA 4L8SB 3U7WH 1BLNA 4HFUH 4HIEA 3V4UH 1G84A 2Q6WB 4O00A 1ND0B 1TCRB 5IHZA 1KGCE 1HNGA 4JZJB 1TIUA 4YX2H 2P49B 3BP7B 2IFFH 3AMLA 4L3EA 4JRYB 4OLXH 3AROA 3QWRA 1AGCB 3AS0A 3BHBA 1Y6MR 2FBJH 5ANME 1CI5A 4IIQB 2CSPA 4H25A 1ADQH 2FYYA 4J4PD 4ERSL 3O6FA 5CJXA 3O81A 3PQYD 2HJLA 3PHQA 3SY0A 3U4EA 3MV9A 4YHOL 3WXVH 1OARL 1DQML 1MIEL 2VL5B 4JZNA 1CYGA 3TA3C 1T0MA 1D3CA 4XXDA 4OTXH 1OGTA 3MRFA 2GW5A 1CF8L 4PRIA 4QO1A 2FO4A 4EI5A 4F57L 4N0UA 2OSLA 5A2KH 2HT2C 4PJHE 3VWJC 1FAKT 2YD6A 2W0FB 1LO5B 5HGHA 5ALBH 1GGTA 3T8XA 5F7DB 4BFIB 1K2DB 3CFCH 3BMWA 4UT6H 1JFQH 3VXUD 5BV7L 4Q9BA 3DUSA 4G43A 4OM1H 1AIFB 1GC1H 2P45B 3PWLB 2OJZH 3QEGL 4AEIH 1QLRB 5SX4I 3BDYL 1P6FA 3ES6B 4F7PB 1HWGB 5JZ7C 4LAJH 1N0XL 4LCCC 4PB0L 4G6AC 1F4YH 4JFEE 1ZANH 3GK8H 3WNMA 4J4PC 1JUFB 1F3DJ 1VEOA 5GS2H 3MLTB 1MQ8A 4L3CA 3JSSA 4F58L 3RA7L 2MJWA 3ARPA 5IIEA 4M7JL 4BSVB 3X12B 3GI9H 4XWOC 1AQKL 3QFDB 1OP5K 4HMCA 5F1NB 5BW7A 4W4NA 3EJYC 4U1KA 4Z95L 2VC2H 2YXMA 3JUZA 3BUYB 3QNXA 5C09E 4ZOAA 2FECI 1ZE3C 1T7YA 3INUH 3C5JB 3IDMB 5HHMB 2OR9H 2YWYA 3BPLC 4Z8FH 2YC1A 2Z91B 3DNKA 3WJLC 1FDLH 1JGEA 1MJUH 2IG2H 4M6OH 5FGRA 1K6QH 1NGYA 4O5LL 5HYSA 1WGOA 2VDMH 1T0PB 4MNQA 3OG4B 4RAHA 2YSSA 3EDDA 3ARDB 5K33A 2HAZA 1FZMB 1UB6B 2XI9A 5I71C 3HE7B 2DJUA 4L9DA 4ODWB 5D4QA 1J8HD 4P3CL 4YXLH 3QQ4B 1T80A 3H42L 4H1LG 5JA8B 3EJZC 2JKXA 3LN4A 4HPOL 1I7UA 2W07A 5TF1H 4G9FE 1KCSH 5D93B 4D0DA 3QBTB 2GJ6E 2VJXA 3IGAB 2EDFA 5ILTL 4R2GD 5ALCH 3QXTA 4QHNA 1BAFH 3O3BA 4BQ8A 4JHAH 4URTB 3MODH 3CK0H 1NBYA 4LU5L 5I9QB 3FFCB 5C07D 5B38B 3VXNA 5KTEH 2XN9B 2WWMD 4GRLA 4NQSB 4Z0XB 2J7LA 3LD8C 1J1OH 5HYJA 3RU8L 3HZKA 3NCBB 3P11L 3QFJB 2ED7A 1A2YB 3WIFB 2Y25A 2YKLL 4TPRH 5I16B 3GI8L 4MSWA 4HZLB 4QXUH 5D1QA 5TE6L 5I75B 5IROA 1D5ZB 1A5FH 3CVHL 3D0LB 3OXRB 4PJ7E 4XHJD 4K94H 5CCKL 4PJBB 1YYMH 3PV7A 2DLHA 3VXSD 1BFVH 1PYWB 2H2PC 4Q6IA 5D5MA 5L8LB 3RIFK 1K3ZA 2E7LE 4I0PD 4IS6A 1QFWI 5FECA 4K8RC 5HVWA 2EIDA 1NMAH 5J4MA 2DMBA 3TPUB 2V2XB 2BHYA 4MCYA 4R2GC 5E6IA 4NBYB 4LSPH 2Y36H 4YO0B 1MJ7H 4KJPD 3I84A 4NQVB 4GXUM 4KJQD 1AR2A 2VLMD 3GBNH 3MZGB 1BJ8A 1AQDB 3QUYC 4H8WC 5EN2A 4KKAD 3VWKC 1MQKL 3WHE1 3V6ZA 5CGMA 4I77H 1EX0A 4AQ1B 2EC9T 1MPAL 1OQOA 4WV1C 5FGBA 4MNGA 1HKFA 1X5JA 3WIHA 1CQKA 3EYQC 2VIRA 4QYOA 3ZDYF 3RDTD 5BQ7A 3HE7A 2QTEA 5CEXB 4OF3A 4LARL 5D6CB 4XB7A 4JFHD 4QNPF 4JLRA 2GKIA 3G6AB 1CS6A 1QR1A 5KVGL 1BVZA 3T0EC 4QGTA 4JFFD 3SKNB 1NC2A 4M93C 5E8PB 3RGVA 1MF2H 1KJ2A 5K9JL 4NSKB 3O0RH 3BEWB 3WS6C 4QOKD 1CDGA 1I4FA 3G6DL 2ZWLT 4X6CF 4YHYC 1T04A 3DSFH 4LLYB 4P5MB 4JM2F 1S9KC 1Q94A 3FQRB 1WBXB 3MV8E 1YQVH 1Z9OA 5I66A 3FB7B 3PL6B 5IB5A 1GAFL 4M6ML 4M7ZB 3CU1A 3D85B 2PXYC 4KJQC 3IRPX 4KI1A 3JWDL 3N1GC 1IARB 1EPFA 4YDVA 4PUBH 3PNWA 5L88H 3FO2B 1B0WA 4LNRA 5CD5C 1X5YA 2VR9A 3DPBA 5BCAA 2YS4A 4HWNA 4TOYH 3BPCB 3MYJB 3IAGC 3LRGA 4APQC 5C2UB 1XGQA 3F8UB 3L9RB 5SWSA 3IDYC 1C1EH 1KCUL 1UVQA 4Y1AD 1HI6B 4WW1A 1U8OB 4ELME 2B5IB 1QSFA 1RZGB 1FNEA 1MCLA 2IWGA 1PJ9A 3U7YL 2NNAB 2V2XA 3OJDA 4HIIB 1NAKL 1DFBH 4U3CA 4ONGH 3UAJC 2J4WL 4QY8B 3VGBA 1K4DB 2IBBA 4P23B 5IVXE 5HYFA 1P4BL 3HI6H 3I6KB 4FXKB 3TN0D 1FLTX 4N8CH 3E6FA 3O4LE 4OLYL 4POUB 2EKSB 1FE8H 5BXFB 5FYKL 5GSRB 4C58B 5TE4H 4QRTB 2L7UA 5I1AA 5JW4Q 1RIHH 5JORB 4YHKL 4XNZC 1IC4L 4WW2A 3UJIL 3EGSB 4XRCA 4TSCL 1MI5D 2XG4A 4JB9L 4H26B 4OQTA 1J05B 4FQXD 4JGUA 3CFJA 4TUJA 3TP4A 1OB1B 1PY4A 4HKZA 1Q9LA 1JRHL 3A6BH 1NCCL 5EZLA 3RRQA 4BZ2L 4PJ5D 2X1XR 4R9HA 3R06A 1VFUA 3NMEA 3MLUH 2B2XH 5LGHH 5GJTH 4E42A 1T1XB 5ID0A 1PG7L 4HPYH 2AXJA 3OXSA 4FXLA 1TQCB 2HWZH 3PL6A 3U9PH 1KB5B 3MA9H 2DI9A 4IOFD 1TZIA 2A74B 2CJUH 4IJ3C 3BE1L 5F72S 3V2AR 3BQUA 1FORH 4KK8C 2XTJC 1J0ZA 2Q86A 4WEBH 1BD2D 1PZ5A 1D9KA 1T2XA 2AJYL 4FQPA 3DVNB 4UQ2A 4XCYA 3FB5B 3GSOB 5D2NC 1IM3A 3BD5A 3GSNB 5HYQA 4H1LB 1XGTB 1U58A 1FYTA 2E8ZA 3EYUL 4IOIB 3TH2T 3GNMH 3OKMA 4FQXC 4MJIA 5EC1A 1WZMA 1AHWB 2NY1D 4PJAA 2YA2A 3GMMB 1CICA 1UJ3C 3IF1B 3O3AB 2DQJL 3N50A 2AS5M 3NIGE 2R39A 3QIBD 1GGYA 1Y0LA 3CLFH 3G08A 1FNLA 4MXQD 3NPSC 3TIDB 3SDYH 1FZOB 5MP6L 1HINH 5IFAL 1JGUL 5MHSE 5JW4M 3I6KA 3UPAA 4KXZI 3SE9L 1JK8A 2AEPH 5HI5D 3WFDL 2QQNL 1BBDL 4WO4B 5D8JH 2EDWA 2ID5A 5BXFA 1A9BB 1VEMA 1WFOA 1NBQA 4I5BA 2OM5A 1U95B 2P8MB 5AZEH 5K59F 1KPUA 2J8UA 3MBXL 3QEUA 4FTVD 4OCRL 1NUFA 2BVOA 4YBLB 3MREA 2VDOL 2APXA 4FFYL 2HFFB 3V6OE 4AL8L 5DYOB 1J05A 4R97B 4P2QE 1FIGH 1G7HB 1OB1A 1A1OB 2ARJB 1N26A 4LIQH 2O5XL 3NFSH 1OAXL 1F58H 4Z18A 2R69H 5H8DA 5JUEH 2IALA 1Q1JH 1IQWL 4IMLA 3ARED 3U30C 2E3VA 1OTUD 2RB8A 3LKOA 3ARGC 3E2HC 1G7IB 1E4WH 4KHXH 3DMMB 2WAHA 1QTYT 2C1OA 2Z35B 4S1DD 2NMSA 2FCBA 4CMHB 1RPQA 4GMTL 5D7JA 1S7WB 1VDGA 2VLKA 3IDIA 2B20A 2BY3A 3CSBA 3UYOD 5DLMH 1A6WL 4Z5RB 2X4QB 2IANE 3QIUC 5K93A 3K74B 1U8JA 3MV01 3VG0L 2OZ4H 1INDH 1A14L 5F7WC 1TNNA 1MJ8H 1QHOA 4FS0A 4N1HB 4YHML 4OCWH 4P46A 4PG9B 4ZUSA 4N1CA 5A3ID 2DICA 3HI1B 3JWOH 3G6JF 3AAZB 1AHWA 4CW1A 1DUYB 4YDKL 4MXWL 4PJ9C 1T83C 3CX2A 2Z31B 5D2LB 1DE4B 1G7LB 4PJEA 3HUJA 3NOIA 1A7PL 2C4XA 4G6JL 5E9DA 2BJMH 3BEVB 4EIGB 1ZS8A 3TO2B 3C5SA 3GJFB 1Z3GH 3AREC 5EUKB 1OTUC 1FZOA 4Z7VF 1EO8L 4QCIB 4PRHB 3GMQA 4XTRD 2QQKH 4S1RH 4N8VG 1JHKL 4S1DC 3WIIH 3UO1L 2APTA 4IRJC 3M17B 2BNRB 2LABA 4ZSOB 4NRYB 3AB0B 4PV8A 1JCKA 1U95A 2NPLX 2VABB 4I18C 4OT1H 1EVTC 3LN9A 5KN5B 2PR4H 1MCEA 5DRXA 2P24B 3PDOB 3SDXF 3VE0A 5E00A 1XGRA 2BFVL 4GRMB 4MA7H 3BISA 4JO2H 4PJGB 4L8CA 2YUVA 4LVEA 3NABH 4JO3H 5AG8A 5JXEA 4I2XE 3I9GH 4XP6L 4KHTH 3IU4L 5A3IC 5C0AE 1JPFA 1WFTA 5D7KD 1IGFH 2IH1A 1U3JA 2YEZA 5IFJB 5IB1A 2W9EH 3GSWA 3WBDA 1VFAA 2OP4L 2NXYC 2Z93A 5D9SB 5IVZB 3B9EA 1KN4H 3TZVB 3ZKNC 2V2WB 1V8HA 1NMCC 2XZCL 5EOCJ 5KVEH 3F7YA 2X7LB 5K9OA 5IJKA 1MELA 4R0LB 1O5DT 2AERT 1SEQL 1IL1A 3BGFB 3HCVA 4OZHF 2PYFA 2G60L 3X14B 2CUIA 4Y2DC 2D7MA 4PGEA 1MFEH 4BSWB 3MRLB 4NJ9L 3FFDA 1T21B 3FQNA 2A6IB 1FNSL 4HK0A 4JEGB 3MRJA 5E8OA 2JJSA 5E2WH 1NL0L 3GGWB 1KIPB 1SQ2N 2APVA 1UZ6F 1MCNA 3WLBA 3CVHA 2UWEF 1RULH 4PJXE 3KXFB 3MOBL 4LLWB 4U1LB 5DJCB 3E0GA 3LN5B 5DHVA 1XF4A 3FB6A 4JPVH 4MD0A 5DEFA 5IEKA 3NAAH 1B3JA 4JY4B 4K7FA 2MPAH 4OZFA 3AC0A 4PLNC 4DUWA 1J86A 3WEXA 2ITCB 1C08A 2XRAL 1KCKA 1FSKB 5SX4H 5ADOL 1ACYH 3NTCH 4X98B 5J56B 4QXWA 2ADFH 4P2OA 4OKVB 3RVXD 3S88H 2RIKA 4L3AA 1G0DA 4XCNA 1Q0YH 2H9GA 1GL4B 3C87A 4J8RB 4GRMA 4TQEL 3BAEH 4L9LA 4RRPA 2VUOA 1QVOB 2ZP0T 2B8OT 1NCUA 1OY3B 1S5IL 5I8CB 4O2EB 3ARSA 2R4RL 5DMGC 1J5OH 4R3SA 2F5AL 5H94A 4MAYD 2F54B 4JAMA 3QPQD 3CDYA 1RZFL 1JHLH 5ISZD 3NACH 2IMMA 4S2SA 4I8DA 2MFNA 4HBCH 5F88B 2XNAA 2NLJB 5EWIH 5GGSY 1BEYL 4MQTB 3DETD 3PJSB 5E24E 1LP9B 4K7PY 3CPLA 5BS0D 2X7LA 4O4YL 3MMEA 1FPTH 1RK0B 4DZBB 4JCMA 2DDQH 4JRXD 1RAMA 1ZVSB 3U9UB 4WVRA 3VI4E 2X9YA 3LB6C 4N5UA 1CVSC 3CUPB 1T03L 3HC4H 1NAMH 3GJEA 3MRLA 4YQXH 1P7QA 2AJXL 1R3JA 2LV4A 3L6FB 5JOPD 3OQ3B 1JE6A 3M8OL 5BMFL 2N7BA 3OPZL 4YHPA 4UNUA 5D1XC 1TMCB 3PQYE 1FL3B 4OIIL 1EIBA 1DLFH 5FKAB 4NQDD 4L8BA 5IFHL 2A2QT 1QSEA 3NZHH 4HWZB 1DL7H 1J1PH 1T20B 3QPQC 2QLVB 3KYNA 3BIKA 3NIFE 1JN6B 3I3BA 5KSBF 1UM6L 3TT1H 2YUWA 5EO9A 3UBXG 3GMRB 5DVKA 3RWIA 3SO3B 1GGCL 5DHXB 2DWDA 3VJ6B 5I0ZA 2B4CH 2RFXB 3DETC 1T2QL 4F8TA 4MJ6B 5CSGA 5EZOL 1CBVL 2EXWC 4M3JA 2PTTB 2UV3A 4HXAL 2EYRA 4POZD 4ZNEE 4NPYB 1CDBA 4FN0A 2I60L 3VXUE 3OAZK 5IWLA 5B3JE 5MERA 4Q97A 2ARWA 2Q8BL 3TIEA 4M6NL 1AP2B 3RPIB 2CKBH 4U1MB 3LH2H 5DD0L 3RWHB 2DQCH 4Y4KA 4PY8J 1IGIL 1X6NA 4QRUB 3TH3T 2FZ3A 3DO7B 2FX9H 2KH2B 2GJJA 3RBGA 5IMLA 4XNQB 4YHOH 3QUXB 2NLJA 3GM8A 1MIEH 1ZVHA 4N8VB 4TTDC 3EYFA 2GFBB 2OJEA 5C08D 2VZOA 2X4NA 4HXBH 4RAUB 2C26A 3MRNA 4HX1B 3DECA 4PJFB 4RCAA 3DROB 2BVQB 1CGYA 3EO1B 1WIPA 1FL5B 3SGKC 4YE4L 4UOJA 1BGXH 1HHKA 2GHWB 1AFVL 4LVOB 2HJFA 1NC4D 4LCWB 3HAEH 2Y9RT 4FQ1H 2EE6A 4TSAL 3SDCD 4Q9CA 3EHBD 5FO7A 5BV7H 5E4EC 4XXCC 1OP3K 3HZVB 1U3HB 1PX3A 3QI9D 1NCBL 1NGWB 4ZYKB 2X4OA 3UTPD 3QEQB 5T3ZH 1I1AD 1J8HE 3QEGH 2ZNWA 1Z5LB 2KZWA 4HWZA 3TO4B 1N0XH 5J89A 1T1YA 4FQLH 1Q72H 5DJ0A 5EB9A 1FGNH 1DQLH 1MVUB 4V3DB 1GZQB 3O41A 4LPUA 5DD3H 5EZIL 2BCKA 4CN4A 1NGQL 5T5NF 1W0WA 5EUOB 4MX7B 2CRYA 4NZRL 5TDPB 3QO0B 4DGIH 3O8XA 5AYUH 5ERWA 4KMTL 4Z7OE 1BM3L 1JWSA 5C07E 5I17B 1T4KA 4MGXA 4M00A 1KV3A 1DQTA 4QTIH 1RJZA 4P9HC 2MQ0A 4MS8C 4XPAH 3OR7B 4TUKH 2DYPB 3DHMA 2LVEA 2VMFA 4LRNH 4JQXC 2G2RA 3KJ4B 1U8LB 2FBOJ 1K4CA 4MD4B 5FYLL 4FMFA 1T66C 2E9WA 4N5ED 3ZT6A 2VNCA 4P48A 3MLSH 3MYZA 3VFMA 1IEBB 1TTFA 1H3PH 2CK0H 3PV6B 3VXSE 1FV1A 4PRBB 1U0QA 3WN5C 4GRWE 4KRPB 4BELD 3P3YA 4LSTL 3U48A 3JTTB 3LQZB 3HMXL 4HIHA 3BWUC 4HPOH 1OP5H 3S3PA 5E2UH 2BOCB 2AXFB 3DROA 5A40E 1DQJA 2HMID 3QUKA 4G8FA 4OGXH 4G80A 3HR5A 4A2LA 1JTTA 3WV0A 4X5XB 3BZ4B 2HN7A 2VLME 4OUUB 2JCCB 4LFHD 2DKSA 2EDXA 1UM4H 3LKRB 3FT4B 1BVKB 3IFLL 1MFAL 2MKLC 5SV3A 3H9ZA 4J23A 5F7YC 4G8EB 3L5XH 1F4WH 3RWFA 4U6HB 1SVZA 3P11H 4U6TA 4JFHE 5ICYB 2YKLH 3D39A 3GI8H 2FSEA 4JFFE 3FQXB 4WY7L 4M61A 5TE6H 1GGIH 4OCNC 4NZUH 5SWZB 3K4DA 4QRPB 2YN5A 4XMPH 4D9LL 1GHFL 1S9VA 4QOKE 4KK6C 2BZDA 4HKBA 1MUJB 1JNNL 3TBSA 5J0BA 4HIJB 3GHBH 4P4RB 4GG6B 3B6SB 1U3ZA 1GC1C 3MXWH 1ZLWH 2WUBL 5I17A 1WEJL 4FABH 5IW3A 4PTTB 2DRUA 4YHLL 4YDLB 1SJVA 1VCAA 3QXAB 2Y4SA 2VWEE 3GMLB 4XVTH 3A6OA 2HVKA 2VTFA 4JG0L 1U41A 4XZUB 3MROA 3MGAA 4UV4L 2R0ZH 4ZOBA 5JPMB 4Y4HA 1M7DB 3GM0A 3LKNA 4U1IB 1KLGA 4HWEH 3BZDA 5EU4B 1MAJA 4DKEL 3B9KA 4P5TC 4Y5YB 4DAGL 2WQRA 1JF5A 1I8KB 3SDDC 1IAOB 2IH3A 5IB2B 3VD9A 4OCMC 5I8KL 4Y1AE 4JKMA 3UBXB 2ICWB 2IF7A 4KXZH 2ZG2A 3IJHB 5H2BB 4PIRF 4CMMA 3CGTA 3O9WA 3CLEL 5HD8D 2YPLB 1ZHNB 4O9HL 5ANMA 1S7TB 1IGYB 3TNNB 1WBYA 3KYOA 4ZQKA 5JPNA 1FP5A 3ERYA 1MJJB 4X5XA 3BZ4A 4RGMC 2EECA 4R7NA 4QRRA 2EH7L 2FECL 5EBLB 4KVNH 4UI2A 4E41B 3CZFB 4LOUC 1UKTA 4MA3B 3AXLB 4OD2B 4ZO6A 4G8EA 4OSUH 5MENB 2D03H 3L5HA 1UKQA 4LMQI 1X5HA 3X13B 1FC1A 1XMWA 1MI5E 1FNAA 4N0CC 3JWDH 4EUPH 5L2JA 5FV1L 2P5WA 1QNZL 3HRZB 4XPBL 1XF1A 1S7VA 3IFNH 3VFNA 4ZFFA 2QADC 5F93C 4XNUL 2AABL 2AK4B 2NY7L 2PNDA 3MGTB 3UZQA 2V5TA 1U9KA 4WDIA 3G5VA 3HMWL 3ZDZE 1MUJA 2C5DC 4LQFL 5L6YH 2B1HL 3AY4C 5HGBB 5BZDB 2NY3C 3FO0L 1RURL 3IDXL 2RQ8A 3VXTB 3PIQA 3MLWH 4X83A 4X7DC 3MUGA 3QXDA 2X09A 4Y16D 1AO7D 1FH5L 4KVCH 2Y06H 3ZL4H 2VN7A 4XC3L 4S1SL 3UTQA 5FOJA 5IMKA 1XR8B 3E3QC 4KKNA 2J4WH 1BD2E 1HH9A 5LGJB 5IB3B 3U6RA 2H3NB 5SWQB 1OT1A 5JIHA 5DF0A 3H0TA 5I19H 4MD5B 1F42A 5I1DA 5FYKH 5FUCC 3KDMB 2ERJB 3UTTB 1CFQB 1ZHKA 4XVUD 3PWJA 3SQOH 4AQOA 4PP1D 1I8KA 4JFYB 5HHXL 1ZT4B 4HQQL 5IB2A 2BNQE 4U1GB 4TSCH 4OGZA 2Y5TA 4KZDH 4JB9H 1FFRA 3IJHA 1JGVL 1A4JA 5H2BA 5EU7C 3QDMA 3ETBF 1D5XB 3VGHA 5KZCD 1Y6NR 1A7BA 5CGYC 2NY5L 2M8XA 2X6MA 4C83B 1G7QA 1REIA 4EN3A 1YMMA 1HQ4B 1E27A 5DJYA 3F5WA 4L3ED 4EJ1C 1PG7H 4XWGL 1MFCH 5CINL 4Y16C 4PJ8C 2PF6A 3D69B 3O6FD 4FTVE 5DUPL 2YWZA 5CJOL 3ARFC 3MV9D 3SDAB 2O61B 4UIKL 5B8CB 3I02B 1MWAH 1VKXA 1T1WB 4BUHA 4D9RD 2XWBA 5E8DH 3NA4A 1JWUB 5E94B 4J3WA 1X3DA 2GITA 3A6CH 2FL5B 3RWDB 3SKOB 4PRID 7FABH 4HKXA 1RZJH 1MRFH 4EI5D 3DX9B 3O4OB 4ZTPL 3I85A 3RKPA 3SE4A 3JV5A 4G5ZH 1I7TB 1FVCB 4NQEA 1DVFA 2F53B 5F70A 8FABB 4K23L 5BZDA 2OI9A 4FG6D 4UU9A 4WUKH 3W11C 1AE6L 2DQJH 4J7RA 3DV6B 4NN7C 1KXTB 5J3HC 4X6DE 4HJGB 4MQSB 5IBLD 2VH5L 3I75B 1NDMB 2Q7YA 5DC9B 2KQNA 4Y5XA 4IRSB 4EVNA 1TTUA 1I1FB 3WFDH 4MJ2A 2QQNH 2F8OA 3GDBA 2GTZA 5IVXF 3G5ZA 2YD2A 4UDTB 3QT2A 3KDMA 3UTTA 3W5NA 5I1CL 3MBXH 1QRNB 3RY5A 2Y6SC 3WNKA 1A1MA 3Q6FB 2PW1B 4UDUA 2YMXH 2WBJA 4MDJB 5ESAA 4H5SB 1UACL 1B0RA 1EEYB 4ZAKB 4DOHB 3NFNB 3K8LA 1BJ1J 2HT4C 1B6DA 2O5XH 3UTSB 3HAEG 1WTGT 4UILH 4U6YB 2EXYD 3RAJL 1IQWH 3T77B 1BIIB 2Z8SA 2ZSWB 3F62A 3SJVA 1EAPA 3T3PE 5C9JA 4JRYD 1ONQB 1U93B 5DRNB 4D0CA 4MNQD 2AKRA 3IKCA 1UWGH 2F58L 1EV2E 1CD8A 4KV5F 4UOW0 1U2HA 4MQ7B 3WE6B 4GMTH 3ZE1E 1NFIA 1GIGH 4U1HA 3MUZ1 3WHXB 1A7NH 2DD8L 3FRUB 2V7NB 3BP6B 1K8IA 3TYFA 4RFOL 1YUHA 4C4KO 4YZFE 4IRZL 4XCFH 1ZA3B 4I4WB 4YJZL 5D7KE 1H3VA 5C7XL 3RWCA 2NW3A 3THMH 4OGYL 1KG0A 1NEZA 5KG9B 35C8L 4L8SC 2F53A 3SQBA 4KROB 3F7QA 2LU3A 4OIBA 2BNUA 3LIZL 1RFDH 3CMGA 3EOAB 3HI5L 4GRLD 4JZJC 3DV6A 1IRAY 2J8OA 5I1JH 1P7HL 4HS8H 5HYJD 1FN4B 3LHPL 4NRXA 2DF3A 2QHRL 1CLOL 3FRPA 2BSED 4NYLA 2Y07H 4IIQC 4I3SL 3MRMB 4YR6B 3T3MF 2GK0B 2AJZA 5D1QD 3UO1H 1T5XA 5FGCB 5T1DH 1A22B 1QG3A 3PP4L 4CADA 2WM0A 4EDXB 5FDYA 1J10A 4YXKL 2Q76B 1BREA 1EUUA 5C8JB 1QFUL 2BFVH 3KPSA 3LKQA 4YGVA 5HHNB 3RVWC 3TNMB 5F9JA 1KULA 4MDJA 1N5AB 2OL3L 2V5MA 3CSYB 1OWWA 2Y72A 3ULSA 3VFOB 1AGFB 1KBGL 2R2CA 2JJTC 3IU4H 4LLDA 4YUEL 5E6ID 5F1IA 3S96A 5EPMB 4UNVA 4GO6B 2F8VA 4DW2H 5L0QB 5DFVC 4PP2B 2ZSWA 1NGXB 4V1DB 1JPGB 1NUGA 3CXDL 5CJ5A 2I9LA 1WT5A 2YRZA 4TVSa 3H3PL 5EOTA 5DT1L 1YJDC 2XZCH 1ORSB 2VDRL 4W68A 4HUUB 3L3GB 2A9NH 1YEHL 3HE7D 1K8DB 4P2CG 2QQLH 4WCYL 4OZIE 3FRUA 2A0LD 5GISH 3WSQH 2MHAB 3MV7B 5IM7A 2V7NA 1C12A 2OYPA 4OQ1A 1XIWA 3QDJA 4NOFA 4ODSH 2YOCA 1NC2D 3RGVD 1XGPA 1NAMB 4M43L 1FNSH 5KS9F 3BZEB 4P2RA 1A6TB 1BFOA 3TFKA 5F7HA 2E9IA 3S36H 5ISZE 3MOBH 5DMKA 1ERNA 4G3YL 3W9EB 1S7QA 2ED9A 2W65A 3EOAA 4LVNB 1ZKAA 1NGZB 5BS0E 2YBRA 4CAGA 5CP7B 3UJJH 4KQ4L 4X5LA 3QFJD 4JRXE 2WINA 3FQTB 3NCMA 4LCUB 3PABA 3CDCA 3O3EB 1A7RL 3QH3A 4NM4L 4RRPG 3F7PC 4RFEA 2VXUL 2X4PA 3ARDC 4V2BA 3EJJX 3HE7C 3OKEA 4V2CB 2PTUA 4WHCA 2AV7B 4TVPD 2Q76A 4K8RL 4ZPVA 2A0LC 1MFBH 3JVGA 5SWSD 2AV1B 2PO6A 3QEHB 4AH2B 1TVBA 4TQEH 3TNMA 2CO7B 2R23B 2XZQL 5D93C 4NQDE 1QSFD 3AS3A 1DUZB 5GHWH 1INQB 5HPMA 4FQJL 1G1CA 4GJTB 2RCSL 4KQ3H 1GGBL 4H8WL 4Z7UE 1IZKA 5GGVH 3IJSB 1JV5B 2CKBB 2VXVL 1P53A 1ES0B 2IADB 5I9QC 2B1AL 1JPGA 4XP1L 2XWTB 1IILE 1L8JA 3ECBB 5HHVL 1IFHL 4EUPG 4ZDHA 1B2WH 2CIKB 3ARBB 1F6AA 1LO2L 4OB5H 3CD4A 1G9MC 4XI5C 1IEAB 1N5YH 1LEKB 1LEIA 5FUOH 1NLBL 4M8QB 5I75C 4ODUA 3ZE0F 4U7KA 2CLRA 1B4RA 2X4TA 5HGDB 5CFHA 4ZG1A 3HNVL 5GS1B 1A7OL 2AJXH 3BZEA 1NAMA 3Q3GA 5I1LB 5SV4A 5I74B 4FOMA 3MOAL 5BMFH 3SKUD 3OPZH 1YEEL 2IANA 3HAEB 1FNHA 4X6CA 1ZTXH 4L29B 4JM2A 2ZUXA 5BV7B 3AM8C 2R0WH 3PL6D 4HK3J 4JR9L 4WIQA 4TRPL 4PJXF 3S35L 5C08E 3F12B 5DR5L 1JYWA 1EGJH 3MJ7B 3IDGB 1ETZB 1KIQB 1HILB 5IHUH 2DB8A 2A77H 1BQLL 1BQHG 5EZJB 4QF1A 1D9KD 3RVTD 5F71A 1AKJB 1GGCH 3CFKB 5DHYB 5BVJB 3BSZH 4NRZB 5EZOH 5KW9H 1CBVH 2BMKB 4LHUA 1VGEH 3O3UN 1FYTD 3SKJL 1I9JL 1PVHA 4HXAH 5D7SH 4MJID 1B9ZA 4OCSL 2A83B 5D7LA 1CICD 3PWUA 3UTPE 1F3JB 4ZO7A 5E5MB 5L7XL 4M6NH 2V2TA 4HUVA 1U91B 1INQA 1NLDL 5JOFA 2Q3ZA 1Z2KA 2JELL 3O45B 5HYIA 4F37K 4EBQL 2YA1A 4JANA 3T2QA 3MJ9L 1X4YA 1I1CA 3MCKB 4M7KH 1JHTA 4HBQA 4GFTB 3PL6C 3R4DA 4M7ZC 2IAMA 5KVFL 4KUZL 1WCQA 1U8HB 2CLZA 2ZKHL 3STZA 2YD5A 1OSZA 4MCZA 5DJZB 5FCUL 4BK5A 1UWEL 5TQ2H 5TPWL 1IEAA 2QQQA 3HFML 3T4AA 4EI6A 2J1KA 3LEYL 3NCYP 4ODTL 4WI5A 5LWYL 1SEBA 1FGVH 3P4MA 4X9IA 3OAZH 4NN6B 4YE4H 5E2TH 3DXAA 5FKPA 4UNTA 5HGDA 3VFSA 5FM8A 4AZ8A 3VI4F 5BRZB 5FHBH 5ENWB 2V6HA 5F89A 5GRXG 1CFVL 3VFGL 5L2KB 2DQFA 5I1LA 1S3KL 3MNWA 9CGTA 2B5IC 5DRZA 4O2CA 2VYRE 3V7AE 3BO8B 1A9EB 3STLA 1XAUA 2XTLA 4JO1H 4PRNA 3L3DB 1KXQE 2ZNXA 5BJTB 5TQ0L 4CVZA 2VLKD 1NFDE 1I7ZB 1UZ8B 4CJ0A 3F12A 4P23C 3MJ7A 5CKGA 3AFLA 3C60A 3C6LA 4MJ5A 4Y5VB 1TETL 2AI0H 4OLVH 1DBBH 4JFDB 3MRBB 3IAPA 3RTQB 1N2RA 2E27L 1HZHH 1YPZF 3DBXA 4JHBA 3DX6A 4NRZA 4PJIE 4P46D 4NZRH 4PY7A 4LSRL 2BMKA 4F9LA 5FIEA 5CBEB 4M03A 4W4OC 5GZNC 3HG1B 4XBEH 2AJSH 3BWAA 1NJ9A 1OAUH 2P46B 3B4NA 1KLUB 1DDHA 4UUJB 2R2HA 4G6FB 5DUBA 1INEL 3ILPA 5E9DD 5EOQL 1OP3H 2PKDA 5DI8B 2YZ1A 4U1JA 2DM2A 4I3RL 1KTLA 1QKZL 5L9DL 3DJ9A 4FQ2L 1TVHB 4Z7VB 1MNUH 2NXZB 3FTGB 3P2TA 4H88L 4RGOL 3WD5L 1TQCC 4WWKB 1AGBA 1CZ8H 1HXYA 2FD6L 5KSVB 2ADJA 4PJDB 1QEWB 2ADIB 3TBWB 4CDGC 3RNQA 4HWBH 5DJ8A 3ZKMD 3HC0A 3EFDL 3PHOB 1X7QB 1AXSB 1LNUB 3HMXH 1S7UA 3TA3A 5J6GA 3FOMA 3MLRL 4PRPB 3VMOA 3G5XB 5JXED 4DN4L 3ARQA 1FVDB 3IDNB 2CR6A 3L95A 2PYEB 5SX5K 3IFPA 3V5HB 3EUUA 2P48B 5BRZA 1T89C 3VWJA 5T3XL 1AHWC 3UJTL 3IFLH 4RNRB 1RZ7H 1YEFL 3PGDA 5FCSH 5IF0B 4NHUE 2X1PA 5ACZA 4G8GB 5KJRL 3QULA 1RZKC 3VW3L 3DIFB 3O11A 3KPNA 1AXIB 4YDJB 4J3VA 2MQCA 4FNLH 1AD0A 1CGSL 2L0DA 3G5YB 4YEEA 2BY1A 4U4BA 4X7SL 4EUPB 4JPWH 3VFWB 5LJYH 1MCJA 4OD3L 4WO4C 2F5BL 4J4PA 1AY1H 1IT9L 4G42B 4OZHB 3BP4B 1FCCA 2XY1A 4K7PL 3RNKA 3U2SB 4MVBC 4ZO8A 1NEUA 1NFKA 1HH6B 2DLGA 4YBLC 3MRDB 4YBHA 3QUML 3VFVB 4R97C 5JXEC 4HCRH 4CL7A 1F3RB 3G6JA 4YHLH 2UWEB 1WC7A 5DJ6A 1FFNA 4JG0H 2CRIA 3ROLA 3LKSA 3P4OA 4UV4H 3DX7B 1UB5B 3WJLA 1SBSH 1BQUA 4KMQA 1RHFA 4J3TA 4PRAB 2W0PA 3LRSB 2G75B 4HULB 3DMMC 4NBZB 1G6RL 4PV9B 3FTGA 4ZUVB 4CRPA 4DVBB 2H8PB 4CMHC 4U3HA 2BP3A 2UUDK 3OV6A 4JJ5A 3DRTA 3OHXB 4QGYA 4TN9A 5FDWB 4RQQB 5IJKC 3SGDI 1BQHB 1UXWA 5I8KH 5H35B 2C3XA 4P2OD 1G7MB 4XMKL 1LE5B 1G1YA 1A64A 1C16A 2CRMA 1R3IL 1KPRA 3ZKXB 5HHPA 3IDJB 3SDXA 2ITDB 2XKNA 4WUUB 4XAKD 5INCB 1AO7E 3QDGB 4WRLA 4OZGE 5E2VL 3ZYJA 5DJ2A 2DBLH 4RGNB 4UT9H 4GXVH 1T22B 4J6RH 1CXHA 4M1GL 1DR9A 5GS0H 1GOGA 4ORZC 2DWEA 4AIZB 3WFCL 2NTFB 5DXWA 1PG7X 2Z31C 5DFTA 1YNLH 5F3HA 4WI8A 4G8GA 2DQIH 4R96B 1EEUA 5EBWB 5GGRB 1A3QA 1SVCP 4B5EA 1L6XA 1MWAB 5M95B 3NCFB 1I8MB 3WDJA 3ULVC 3BT2L 1LDPL 3P9LB 1UXSB 3AB0C 3X3FL 2HH0L 4G42A 4L3EE 3HNTH 1AC0A 4LQFH 1UH4A 1JGDB 1P7QD 1QYGH 2A9MH 2B1HH 3GBML 5ADPH 5DD1H 2Q87A 5KVDL 3Q5YA 4G7YL 4NQCB 2VLRA 4OF6A 3FO0H 1R3KA 1U36A 3IDXH 5IMMA 3NIDF 4L4VA 3MV9E 4XT1C 1FH5H 4F7TB 3MZTA 4OI8A 3CC5B 2FDBP 3MCLH 3KPPB 4D9RE 3LQAL 3UYRH 1A6AB 1HOCB 1QSED 3MO1B 5D1ZB 4F7EB 3W9DB 4Q74A 2R0LH 5ESQB 4PRIE 2H32A 1UEMA 1KTRL 2L4OA 3QUYA 2QJDA 3TZVC 2EYSA 4LQ1A 3VWKA 4P0DA 5KSBB 1SY6A 4JDTH 5ITBL 4GMSH 5DJXB 1CT8B 2WQ8A 3FOLA 4LCYA 4WV1A 4QHUA 1QHPA 3PGCA 3NA9L 1R6VA 5E1AB 2FEEL 4R0LC 3BESR 3W2DL 2FX7H 3OKLA 1J18A 3TJHC 3GSQA 2Q8AL 4Z7WB 3PUCA 3BGFC 5J06A 4DTGH 1LO4H 1KCVH 4X9FA 1EK3A 1E4XI 3SN6N 3WJJC 3DX8B 5MEPA 3T0EA 4PJBF 4GOSA 5EC2A 4NKIL 4XP9L 5EH1A 2HG5A 4KUCD 5DTFB 2ZSVA 3WS6A 2R2BA 3VDCA 1ZOXA 1XEDA 4PBWD 5CINH 4NKMA 5K9KA 2BY0A 4KTEH 3L1OL 1NMBL 3DI3B 2VDLL 5DUPH 4UIKH 1J1XH 4XC1H 2PXYA 3J7HA 4U3XA 1KELL 4LF3A 1KB9J 1DSFH 3K4AA 3VXMA 5C0FA 2D4DA 4P4KB 3R1GH 1L7IL 4R4FH 5JTWA 1LQVA 4BH7A 2C1PB 1S7SB 1TZHA 4R7DB 1OF2A 1FSKC 1E28B 2D7QA 2ZCKH 3Q1SL 4ZTPH 3U1SL 1CDUA 1KNOB 1YEGL 4DVRL 4JRYE 4EKXA 4APQA 5F7LB 2XQYK 3MGOA 5ETUB 4MNQE 4K23H 3EOTL 4NQCA 3SE3C 5TGBB 3T65B 5FF6B 43C9B 1AE6H 4P9MH 1JYVA 4NGHH 3HPJB 3RQ3A 3PWPB 1KJVA 5C1MB 2ATPB 2YK1H 1OD7A 1A6VL 4KGLA 5HYEA 1RMFL 1EUTA 1ACZA 5A43C 4PJCA 1FL6B 2NY4B 4W6XB 4PRDA 4GAYB 4A6YL 4UIMB 3MLYH 4X0KB 4L8DB 3SOBH 1EVUA 1KJMB 5DJXA 4L5FL 3MJ9A 2VLJA 2YUZA 2C3VB 4NO3A 1JTPA 2NR6C 1P2CB 3O8XD 3D5OF 3D3VA 1VSCA 2DL9A 1FRGH 2V7HA 4YWGH 4JKPL 2V5RA 2HTLD 4TNWK 4M5YH 5ID1A 1OPGH 3RUGB 3EW3B 4NKQB 4WJ5B 5HYJE 2D31A 5GSVA 5C6PB 4LGRB 5DO2D 1XCQB 2X4RA 1A1NB 2FGWL 3GSXA 5C9KA 4LLVB 4YAQA 2AEIT 5I1EH 4RAVA 5C0DB 2W38A 4C56B 3OB0K 3WO4B 4NO2A 1VHPA 3HC3L 3MUHL 5D5ME 3T04D 4X4YA 1DBKL 4K3DL 1PKOA 4JKKA 2DLFL 4QTHB 4FP8L 5TJWK 1I9IL 3SO3C 5F96H 4NP4H 3UXFA 1HQRB 4U1SB 4R7DA 5C7XH 5D2NA 5BOPA 4XCCL 1CD0A 1NCDL 4WHDA 3EZJB 2WW8A 5C0JA 5GGTA 3GSUB 4NC2B 5GRVL 1I3GL 2MSPA 2BVYA 2SEBA 35C8H 4GBXB 3N9GH 1KJ3L 1IAII 1NCWL 4FQXA 5IQ9A 4XHQA 3H9SB 3MNZB 1RU9L 3ULUD 4MNGE 1KTKE 3U0PA 2EDHA 3S36X 4PJHB 1FBIL 1UJ3A 4ZUWA 4PJ5A 4M9OA 2NY6D 4HT1H 3LHPH 4QT5B 4S1QL 5CD3B 4WGWB 3D18B 3EO0A 1F3DH 3D39D 1I3VA 5DVNA 3LOWA 2DQDH 2K9UA 4FZEH 4GKSA 3K8MA 2IPKB 4ODXA 2X1WL 4YIQA 1MLCB 3FB8A 3TCLA 4AY0A 5C0EB 1S9XA 4KK9C 1F6FB 4LEOB 4YXKH 3EYOB 3QUXC 3VH8B 5LAXA 1IGCL 4JFEB 4B7IA 2AEWA 4MDIB 1G6VK 2FWOA 4P9HL 3TH4T 1P2CA 2FJGB 5HY9A 2DN7A 5DJDB 3ZDXE 2VAAB 2OK0L 5T1LB 4MLSA 5IQ7L 4X8JB 4G6KL 4D3CH 4FXGB 4NWTH 4QRQB 5FM5O 2HYMA 3QFJE 4NNXA 4HGKC 1L7TH 4LVOC 3P30H 1BZ7A 4Y4HD 4WEUD 2YPKB 5C09B 4PP8C 3ARGA 2B39A 4X4MA 3E2HA 4NFDA 5CUSL 1RJYA 1U3HC 3B9KD 4PREB 1BOGA 5EU3B 1M71A 4C56A 2YD8A 5C0IA 1ORQB 4JG1H 4TVPE 1Y18A 3IS1X 3DRQB 5SWSE 1FZJA 2P8LA 5JMRA 1YEHH 3M45A 5ICZB 2EDRA 3TO4C 2Z4QB 4FQCL 2RAMA 2VQ1A 3QIUA 3TVMB 3VXPB 1QSFE 2JJVA 3QQ3B 3ABZA 4HC1H 5F7EL 5B4MD 3C6SB 4K94C 4HV8B 3BP5A 5KVMC 2XWJA 4QRRD 3V5KB 4MWFB 4RIRA 4G9FB 4PGJA 1LO3H 4EXKA 3JTCA 3DVIA 4NWUH 2GJ6B 2ZPKH 2QSCL 3EOBB 1D6EB 5DC4B 3OBAA 3MNZA 3VRLF 4PJ9A 1T83A 3VXRA 3IU3A 3ARRA 3QUMA 3ZTJH 2V5SA 5EU5B 3C5ZB 3CVIH 1F02I 3L3HA 4RA0C 3OMZA 1ED3B 6FABL 5FUZL 3KJ4C 1SJXA 2VSCA 1JZ7A 1B4JH 2BC4A 1J0JA 2P5WD 4X6FA 5EU6A 1A7RH 1CK0H 4XMLL 1QP1A 3V6BR 4JN2A 1UQSA 2IPTL 4Q9RH 3E8UL 4EXPX 4IRJA 4QRPD 5I1HH 5M94B 4R8WH 1GC1L 2K3TA 4U49A 4KRPC 4NC1C 1G6RA 4I18A 4LKXB 4GQ9L 3O6KH 3F7VB 4PY8I 2VDQL 4P57A 3RI5K 4KMLB 4PJ7B 4U6XB 3KJ6H 4NT6B 4LCIH 5B4MC 4CBPA 3I6LD 3L5WB 1CXKA 4TNVK 4FQHA 2H6PB 1XR9A 2WIIA 4N0RA 2IQ9H 4YDIH 5D2LF 1GGUA 4JM4H 1YECL 1M4KA 3H7BB 2I27N 4D8PA 3U0WH 5CWSB 2ATKA 2WLYA 4LLQA 5EU3A 1FYTE 2XZAH 2EEAA 5B3NA 1H9VA 2XV6B 4M3KB 3MRCB 4MJIE 1S5HA 2D7NA 4M7LH 4Y7MA 3TM6A 5CLTA 1E6OL 3ULVF 3KLHC 1DBAL 3QDMD 4WTZA 3BKYL 5CIPA 5GGQL 3VXPA 1NLBH 3L5JA 2FATL 4G7VL 2FJHB 3LY6A 1JYXA 4EN3D 4Y2DA 1YMMD 1ZT1A 4F9PC 3C6SA 2EDLA 4WI7A 4PJGF 4WTWA 1YEEH 2Z92A 3VMPA 5EA0H 2BSTA 3ZSSA 4KPHH 2EC9U 2G5BA 1KF9B 3O6LL 4YDLC 4HMEA 4JFZH 3CIQA 3MX0A 2J8UE 4ZFOA 3BKML 2BK8A 3C5ZA 3TGXA 2E5EA 3MV8B 5HDBF 3V0VA 1DLHB 4KKLC 3C2AL 4R26H 1T7WA 2GAZB 1B0GB 5J1AB 2JB6B 4FFVD 4ZS7L 1TENA 1AD9B 4Y5YC 3T0XA 1LQSR 3LKPB 4TYUA 1FNGB 1NBZB 5CZVH 4K3JH 2E9BA 3NFPB 1P9MC 4J3SA 1U8QA 2HFGL 3K0WA 4J2XA 1VFOA 4D2NA 3RIAK 4OCSH 1W72H 4NQED 4ZUUA 1DVFD 1EZVX 2IJ0C 3L3OA 5L7XH 4LLMA 2VLKE 4NT6A 5CHNA 5CZXC 2IGFH 2JELH 3HLAB 1RZIB 4KKBD 5C2BH 3GSVA 5CBAA 4ELMB 3MLPA 1I7RA 4XVJL 2KL6A 3QG7L 5CKAA 1QBMH 1MH5B 4LASL 4HIXH 1X5LA 1ZEAL 4X7EC 1K3IA 1IGTA 5CWSA 3QG6A 4KUZH 3TC9A 1K5NB 3UTTD 5A2FA 3BN9D 3KHOA 4L4TB 5IVXB 3VCLA 3N1QC 2CDEB 4NCDA 1P1ZA 3MRCA 5JLZB 2LTQB 3O4LB 4JQIL 1FG2A 2WBJD 2X2YA 1DANT 1MCPL 4K71B 4Y4FB 4KI5D 3LEYH 4NNPL 3EFFA 1CD9B 4PJEE 3HUJE 1HHIA 3OJVC 12E8H 2NW2A 2BXYA 3HS0A 5E9DE 1GRWA 1FAIL 4GAJH 4U6VL 3GO1H 1JPSL 3WFHB 2V17L 2MNUA 2LU4A 4UQ3B 3CFDA 4F7MA 3B9VA 3SJVD 1N59B 3REWB 3B83A 4TSBL 2C3GA 3EAKA 1JF1A 5DQ9B 3OZ9L 3WXWL 3OAUH 4PLKC 1F4HA 2C7UA 3P77A 3TWCH 4N0FA 5D1XA 3QA3B 2HKFL 1F90L 1IC7L 3O2WH 4ZD3L 3SDAD 1GH7A 3GHEH 5E7FA 1VACA 4XVSL 1JPTL 1FHGA 1DBJH 1YY8A 4ELKB 2NX5B 2E27H 3IFOA 2ERJC 3QWOB 5JA9A 3WUWG 3NFPA 4U1GC 5BS0A 5LKNA 4NKDB 1CL7L 4HJ0D 4RBPK 4HF5L 1EBAA 4NZTL 1DEDA 1OL0A 2EO1A 1YDPA 2F53D 3PWVA 2H2SD 1OSPL 1INEH 2EKJA 5FOBB 1QD0A 1V7ML 5JO5B 2GT9A 1JJUA 1BX2B 5E6YA 5LBSL 1LDSA 4OAWA 2W1NA 4K3HA 1LD9B 4I1NB 4FQ2H 1KT2B 4R4BB 3RJDA 5HHQA 4PGCB 4IRSD 2JF1A 1U8IB 1FZKB 1CIDA 1HSAA 1RUQL 2FD6H 4P3DB 4GUPB 4QEGA 3BRGC 3SDAC 5B8CC 5FYLD 3VRIB 5I73B 1W0VA 3TT3L 2R0KL 3EFDH 2XT1B 3DOSA 1DBMH 4UV7L 1HSBB 3KPSD 5LXGH 1ZK9A 3C8KB 2XICA 1XZ0A 5T5FL 5D71L 4FZ8H 1N3NB 4N9GA 5FO8B 3OAYK 3O4OC 2FR4A 3QQ9C 4WU7B 3SGKA 4XP4L 4UQ3A 3MRRB 2DQHL 2Q3AA 4P2QB 3OKOB 3T1FA 3UJTH 4NKOB 4UMGA 3VMNA 2VXTL 2NY0B 3JWOC 5A2JH 3CH1A 3D0VB 1YMHB 4QHKJ 5EDXA 2NY2B 4KDVA 5DQ9A 1SJEB 1M05A 2OMBA 5KJRH 1X5XA 15C8H 4HFWB 1PKQA 1BZ9B 2XQBL 4XXCA 4Z7QE 4KY1H 1KFAL 4JZOA 3U0TA 5C0CB 1HIMH 3VFRA 4F2MB 4YHZL 3N1MC 1M6OA 4OV5A 3WDIA 1V5JA 1KC5H 4JY5H 3IJYA 5DSCB 4IRSC 3OX8A 4XAKE 3P4NA 1OM3L 1XIWD 3QDJD 3W81A 2ZCLL 3ZE2F 4X6BA 4X8XA 1UKSA 4F7CB 4NNYA 5HI3D 4UTAH 4ONHA 5EG6C 4K7PH 4RMVA 5FM4A 3KHQA 4NM8L 4BKLA 5J1TC 1C5CL 5IW1B 1VGKB 2LE9A 4P2RD 2D0FA 1RUPH 2EH8L 5SX5H 3DTXB 3MJGX 3KPMA 1FFPA 2DQGL 5I1IL 3TFKD 1J9CT 5GIRB 4KTDH 4ZFZB 1G7PA 4Z76B 3RL1A 4ZAKC 4E9LA 1I3RA 3HZMB 4O02L 2ED8A 3DVGB 1EH9A 4MS8A 4PGBB 2R8SL 4K9EH 1W0YT 3ARTA 3EDEA 4XGZB 1WT5C 4JQXA 1U8PB 4HMDA 2X1QA 3DURA 1QQDB 3CFEB 3CU7A 3LS5L 1AI1H 1UCBH 2IBGA 5B39A 3VRIA 1W8NA 4JCLA 4PTUB 4GW4B 2ORBL 2PO6D 1YY9C 4ZTOL 3EYSL 3W39B 5DK2A 3IXTB 2BOBB 5HI3C 3MLVH 3MRKB 2AJVL 2FJFB 5EFIB 3ESVF 4B50A 3FQWB 1V3LA 1QSEE 1HCFX 3X3GH 1HYSD 1OT2A 1OHQA 1VESA 4K3EL 5BVPH 3VXQB 5JW5A 4AEHH 4I2XB 1YJDL 3WFCH 4HLZH 3ZTJG 1RZ8A 4KROC 5EOCH 5LCVH 2OTPA 5C0AB 4HFWA 3JV0A 3FT3B 2A6DA 2I9TB 3NN8B 3RJQB 2UUDH 5IMOB 1GZPB 1MCCA 2XKSA 2W9DL 4ISVA 3G04B 1N6QL 3NH7H 2YR3A 3OKDB 1XF5A 3LS4L 1P4IH 4EDWH 3FQUA 2HH0H 5GRUL 4ETQA 3V5DA 1YN6B 2ZG3A 5JDSB 5F44A 2QR0B 3LV3A 4R4NC 1YNTB 4ZUTA 4NDMB 5IB4A 4XCEB 4B41A 5DD5H 3QCVL 5KS9A 1WAAF 2FIKA 4JFXA 8CGTA 4NUJA 4ZPTA 1EHLH 3KPOB 2ENSA 2A1WL 3RP1A 5F7FA 3KVQA 3AU1A 4JM2D 4Z76A 5BO1H 4MJ4A 4X4ZA 1ZWIA 1FFOB 3P0YH 3VD7A 3ILQC 4PLOB 1WJ3A 3LQAH 1LP9E 2JCCF 4PGBA 3RKDD 4LSSH 4PJIA 5L0QC 4HGWA 1IAIH 3MLZH 4PJXB 2CDFB 2OQJA 2XA8L 1WWAX 3PP3K 2UYLB 4O2FB 3WIHL 1NUDA 2JIXA 3FT2A 5C0BA 5DEZA 1BBJA 2NYYD 5FA4A 2Y7QA 5DZNA 3H7LA 1U8KB 1FIEA 4P5TA 3RVUC 2YD1A 3RHWF 4LHUD 5I1GH 1D5BA 3SDDA 4PTUA 3W2DH 4GW4A 1OCWH 5AG9A 4QWWC 1QLEL 5D7LD 1KEMH 1X5ZA 4JDVB 1J11A 3WUWB 1FVEB 4IHOA 5HDQH 1F6LL 3EOYG 5T1KA 3U46B 5DVLA 3UROR 3FQWA 4BH8A 4ORGB 1GYAA 1YEDB 2X4UB 5J9PB 4GG6F 1T6VN 2GCYB 3MV11 1OW0C 3MBEB 4Z0BH 1D5MA 4S10A 3D2UA 4OZ4B 4RFNB 4WFED 2EIZA 1LO0H 2JB5L 4U0QB 3WL9A 1MHHA 5KSAB 2H26B 1XCTB 2ZCHL 2IAMD 4LVNC 3RKDC 1HDMB 1YEIH 3V4VH 4F15B 5LQBL 1KELH 5IW6A 4M48L 1R5IB 3QCUL 3QIWB 1GZPA 4N0CA 2DKMA 4AT6A 2NYYC 5D7IF 1CFSA 2R15A 4TVPL 3O2DA 1PD6A 4X5WB 5ABDE 3RPKA 2BX5A 1EERB 4HSQA 1P6AB 3U1SH 2ZOLB 2B4CC 2DBJA 3DXAD 1YEGH 3QO1A 5AWNH 2XYCA 4DVRH 2EDDA 5FK9B 1U42A 4CVWA 1JGLH 5JHDA 1JZ5A 3AY4A 3BKCL 1R5WA 1U2CA 2HFEB 4NO0A 4M62L 4J1UA 4MQXD 2FGZA 3H9YA 4ESKA 1I9RL 2DL2A 1AGEA 5BZWB 4IDLA 1L0QA 1IM9A 1AR1D 1E6JL 3A67L 4H20H 2AGJH 1IQDB 5IBUG 5T33H 4AEEA 1YN7B 1OTTD 3EDFA 3JV4A 4XX1E 1NUNB 1UFUA 1EXUB 3F6IA 5DEGB 3UTZB 3E3QA 3C60D 3PQYB 3WNNA 3C6LD 2ZJSH 3MRHA 2R1WA 3KLAB 4MLIA 2BRRL 1I8IB 3IKKA 4A6YH 43CAB 1O7SA 1IGMH 4L5FH 4OQTL 2CRZA 1TJGH 3ARBC 1UM5L 4BZ1H 4JFQA 4HHAA 3PG2A 5IKCB 1WSST 2HLAA 3S4SA 2HA1A 1N4XH 3ULUE 2MCPH 3OKKB 3GIVA 1NCAL 1WBZB 1PLGH 4OM0L 2PCPB 3ZHDA 3K2UL 1DJSA 4GKZB 5GS1C 3GB7A 1RUML 1R0AH 5LGKA 3U4BL 3D39E 1MRDH 1VPOL 3VXUB 5I74C 1GVIA 5HGGS 1CWVA 4ZS6C 5C6TL 3V9FA 3MBEA 4XNMB 2CUMA 25C8L 4G6MH 3GMOB 2R1YA 4MQXC 1U8NA 5AD0A 5BV7C 4X7FC 4BUGA 1MCOL 4PJ8A 1Q0XL 3KWWB 5I1KH 5EUOE 2XFXA 1D6VL 3ARFA 3DYOA 3UX9B 5AAWA 3ZTNH 1E4JA 2DLFH 3DV4A 4LP5A 4I0CC 4PLJC 3TA3D 1MHCB 5D6DC 1FO0H 1RY7B 4EZMA 3NBNA 1QUNA 5FA3B 3KPLB 2VITB 1MREH 3X11B 1XF2B 3P73B 3E1F1 1CN4A 1NCDH 4N1EA 3WS3A 4EEEA 4OFPA 5BRZD 1N8ZB 2HT2D 2MMXA 2YA0A 5F9OL 5FB8A 1I3GH 3VWJD 1U6AH 5L2KD 1CGVA 3BN3B 3KNBB 5IESL 3L5IA 5IOPB 3CCHA 4Z7NE 4ZXBB 4G8IA 2D9QB 3B3IA 4G59A 3ORJA 3QNZB 5C3LD 4S1QH 3PGFL 4OD1L 3CDGA 3OB0H 3RY4A 4OF7A 1NBVL 5MEOB 2J3SA 3WKML 4EQ2A 5JZ7D 4PGZA 3HPLB 1KPVB 4G6AD 1YYLH 3QCTH 1KENL 3N85L 1J8HB 4BK4A 2YD9A 4M7LT 4DGVH 1YPZA 1BZQK 5IGXL 4QRRE 1KCRL 1MFNA 1RHHA 4EIZC 1LEGA 3GSRB 3DARA 5IJVB 3MNVB 4X6EA 4XWOD 1DEEB 1MCRA 4DQOH 1UA6L 2OK0H 4MA8L 4MA1B 4ODHL 3EJYD 4G6FD 4NN6C 3LQMA 4HW6A 1OAZL 1MIML 4HUXB 5C07B 1TPXB 2J88L 4L1HA 5AZ2L 3RL2B 3LSOA 2P5WE 4XPTL 4WI3A 1FJ1A 1KB5L 3S8WA 2AQ3A 1H15A 1IMHC 4AG4L 4MB4A 1G9NH 1KEGL 3VXOB 4JFOA 3TBYB 4OI7A 3QZWA 1RIVL 4OBRA 4QRPE 5DZLA 4RISL 4YHIB 5DUML 2OMNA 3HE6B 3C8DA 4HUWA 4GW1A 4RZCB 4KGJA 4GW5B 2GI7A 4E5XB 1LILA 4FQCH 4D0BB 3TJEL 2ESVA 4HGMA 4DCQB 4Y5VC 3GSNL 5EIIA 1RI8A 5F6IB 4YPJA 3EJZD 1ZA6A 1MHCA 1T1ZB 2AEQH 3RTQC 3I6LE 3VXSB 1ZGLA 1F4XH 1X5FA 2XY2A 2HKHL 1U92A 3VDAA 3KPLA 4CU6A 3D25A 1ZHLB 2VITA 4I0PB 3REVA 2GEEA 4OBSA 2BVTA 2C9AA 2FHFA 4NJAL 5E99L 3B2UC 2GSGA 1RZKL 1U3YA 2BDNL 4X99B 3BUTA 2BRQA 2R2EB 3L3JB 3QRGH 4NO5B 1Q9KA 3S34L 3OJMB 1CD1A 2ARJQ 4L8SA 3BD4A 2CIIB 4YHNB 3ROOB 4X4XB 4G8GD 4OLZL 2Q6WA 1ND0A 4H0IA 1TCRA 4YXHH 4JZJA 6FABH 3BP7A 3S35X 3QJHB 5JQ6L 3QDME 4JRYA 4AMKH 3WMSA 2NXZC 1AGCA 3RDTB 2QKIB 1CTOA 1A3RH 4WWKC 1UYWL 4IIQA 1RIUL 1MLBB 1YMME 4XNYH 4HAFA 4KKCC 5JOEA 3UZVB 3DGGB 1URLA 3MOQA 4JFFB 3KR3L 3ARYA 2VL5A 4NQXB 2VLRD 4JPIB 2H2PD 1W72B 3MRIB 4QOKB 1V05A 3M1BB 4K8RD 4AM0B 1A4KB 4L4VD 1TDQA 5FYJL 1RVFH 2JJTA 4HLZG 1CDYA 4OCYL 2YPVL 1ZLVH 3GMPB 4ALAL 2G9HB 2W0FA 1LO5A 5JXAH 2A6JB 5GJSH 1YECH 2XPGB 5IBUB 3KYMB 5F7DA 2G5RA 3QUYD 4BFIA 5E08L 1K2DA 3TBYA 3VWKD 3HA0A 3PWNB 3HE6A 2FB4H 5IG7B 1AIFA 3EYQD 3T2NL 4NQEE 3PWLA 4TUOB 1QLRA 2VDKL 4GS7B 4XBPB 1A6ZB 3JWDC 4F7PA 3ES6A 4DCQA 1QO3B 1TJIL 3H9HB 3BPNB 1GPOH 1MAKA 3ESUF 4WUUD 1JUFA 4G7VH 2FEDC 3MLTA 3T0ED 4Y1AB 4YNYB 4OLEA 4X9GA 1Z0NA 4PDCE 4BSVA 5JW3L 3GRWL 3S97C 4ONOA 3X12A 1OWRM 4ENED 4QHMB 3ARZA 2VXSH 3QFDA 5F1NA 2CQVA 2VO5A 2VXQL 3MJ6A 3O6LH 3V79C 3I50L 3UTTE 3NZ8B 1MRCL 3BUYA 3LEXB 3TN0B 2D3VA 5HHMA 3C5JA 3IDMA 1N64H 3ULVL 2M2DA 4XP5L 1A0QL 2Z91A 2PXYD 4HS6B 2WSKA 4KI5E 3VG9B 3VXMD 3KYAA 4LAQH 4WW2F 4ZS7H 1HHGB 2VDPL 1JWMB 4LEXL 5CD5D 4OLWH 2P43B 1MI5B 3ARDA 3SJVE 4ONFL 5I30H 1FZMA 1UB6A 4APQD 4ODWA 2D7TH 4FHBD 4MMXC 3ZKXC 3QQ4A 4NQCD 1T5WB 2B0SH 5I8OH 3WFBH 1IKFH 4K55A 4RGNC 2RJMA 3IGAA 4PS4H 2UZIL 4UTBL 4D94A 4ENEC 1OLLA 1EO5A 4BJLA 5CP3A 2GSIB 5FHAH 3UAJD 3LDBB 4DKFL 1MHEB 2UZXB 4IEFB 2XPGA 1NSNH 3S37H 1KB9K 3FFCA 5B38A 2X70B 2XN9A 2WP3T 2VLJD 1BD2B 3RWEB 4NQSA 4Z0XA 3RWJB 3IVKB 3RBSA 3MA7B 3EO9L 2HRPL 3QFJA 5ACLA 5JDJA 3D3VD 1A2YA 2F53E 4XBPA 5E5UB 3WIFA 4XNXL 4MB5A 5I16A 1QO3A 4HZLA 1OOAA 5DWUH 3CAFA 1FAIH 2P7TB 4PJAF 1JPSH 1RZJC 1SJHB 1D5ZA 2BNQB 2J6EH 1MEXL 2NY1B 5AYQA 3D0LA 3OXRA 4LPCA 1HCVA 2GJZB 4PJBA 1I85C 4WNQB 4LSUL 2A38A 1CFNB 2LU7A 1PYWA 3WXWH 3QIBB 4OLUH 3MPCA 4JREB 5DGRA 4X80L 4UBDC 5IEHB 4NZJA 2HTKC 5FYLE 3R8QA 2CH8A 3TPUA 3LPWA 4XB8A 3AM8A 2DQTL 4ZD3H 1VB9A 3SE8L 1XGYL 5D1ZC 3KPSE 4NQTA 4YO0A 3S9DB 4NQVA 3I3EA 5GRWA 4N90D 3L3KB 1AQDA 4KK8D 4FTVB 2XTJD 2ADGB 3DGCR 4TULL 5GGSB 4K7PX 3SCMB 2NCMA 4RMTA 2X9XA 3U7WL 5I18H 5CEXA 5TDNB 4WI6A 5D6CA 5I76B 3G6AA 5FM5M 1QPXA 4YX2L 3SKNA 4NUGH 2D2OA 5E8PA 2N56A 4OLXL 4PR5B 1J0HA 5C86A 1OGAB 5LBSH 4NSKA 1OAQL 2VISB 2FBJL 3BEWA 2BY2A 1GJIA 3U82B 5TDOB 1I8LC 1RK1B 3QDJE 2CDGB 3BGMB 4LLYA 4P5MA 3OR6B 3IETB 2APFA 3FQRA 1WBXA 3DWTA 4XPHH 1LK2B 4FQQB 3WXVL 3P0VH 3FB7A 2A6KB 5IV2B 3FO1B 4LPTA 4P2RE 3TT3H 3D85A 4WU5B 4OTXL 5IBTH 3OGCB 1AGDB 3FHAA 4KK5C 4XBGB 1BJ1H 4P4KC 4RBPH 1P5VA 1I1YB 3FO2A 1NDGB 1J7VR 2CLVB 3BPCA 2WWKT 3MYJA 3QAZB 5ALBL 3BZFB 3L9RA 3CFCL 4UT6L 1JFQL 1D5IH 1HI6A 1U8OA 1OAYH 2CUHA 4OM1L 3ARGD 3UCRA 2XQBH 1RZGA 5J6HB 4AEIL 2OJZL 4C56D 5T3XD 3V0AC 2NNAA 3IXAB 4DGYH 1F4YL 3P40A 4HIIA 5E8EB 1ZANL 3GK8L 3K8KA 4QY8A 3VFPB 1K4DA 3QIUD 4P23A 1OM3H 2NY4C 4FXKA 1Z6JT 3MACH 5EORH 1WZ1H 2RGSA 2EKSA 3QNYB 1SYVB 2Z8WC 5GSRA 4QRTA 4U1NB 4K3GA 5EBMB 3LRHA 3OAYH 2EH8H 3I2CH 3SCMA 1R24B 5FO9B 5JORA 2DQGH 2VC2L 4W4OA 5TDNA 3EGSA 4H26A 1YZZA 3INUL 3H9SD 4Z8FL 4PJ9D 3VXRD 2R8SH 2IG2L 2JK5B 1K6QL 1YA5A 1XGUB 3ZDYE 1CE6B 1OGAA 2P5EB 3UMTA 5HJ3B 1T1XA 3QHZH 3X17A 3A0OA 4JN1H 4QNPE 5EU6D 3WUZA 4HS3B 4JPKH 2F74B 3V4PL 1HHJB 1XF3B 2F19H 3VD3A 2ZOKB 4I48B 3WO4C 1KB5A 4IRJD 3VRJB 4LVHB 3S3SA 4YXLL 3FONB 2A74A 1YC8A 3P4LA 4R90L 5TF1L 4ETYA 3O2VH 4X6CE 1KCSL 5HHOB 1OP9A 1M7IB 4N9OB 1I1YA 1WCBB 5ALCL 3DVNA 1BAFL 3CMOH 3FB5A 3GSOA 4JHAL 3MODL 3GSNA 4RMQA 3K80A 4H1LA 1CLCA 3ULUL 3EDKA 1XGTA 2VUYA 3FMGH 2AXHA 4QKXB 4GBXC 1T89A 4IOIA 5DS8B 5E6ZA 1T3FB 2FRGP 1Z9MA 2AJUH 4W70A 3MFGB 1T0NB 1A3LL 3F58H 3GMMA 2F9BT 3V7AG 3IF1A 3FZUC 2NXYD 4XAWH 3O3AA 4WHTB 3SO5A 3CFBB 3ZKND 2KUTA 4TPRL 2HVJB 2N4IA 2PN5A 5ESVB 4Y0GA 4QXUL 1P4LB 1BMGA 3TIDA 5D7LE 5F3BB 1HE7A 4KZEL 4P5KB 2VSDA 1A5FL 2GTWB 4K94L 3LMJH 4QRSB 4Z9KB 1H5BB 1QA9B 4PJDF 3SKMB 5C0NC 3GBLA 4WO4A 1A9BA 5C92A 5FEBA 1JRHI 4MXVF 4Y2DD 2P8MA 4OZIB 1AJ7H 5L8KB 4LFHG 4DKAA 4MVBA 1UH2A 3MXVH 4WFEE 1NMAL 2A1WH 4QXTB 4PG2C 1SHMA 4WFGD 2WV3A 2HFFA 5DYOA 3RIFF 4LSPL 1CLYH 1RUKL 3NCCB 1G7HA 4MAYB 1A1OA 2ARJA 3FO9B 3C5ZD 3GBNL 4FQIH 1A7QH