3WLBA

Hla-a24 in complex with hiv-1 nef126-10(8t10f)
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
274
structure length
274
Chain Sequence
GSHSMRYFSTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDEETGKVKAHSQTDRENLRIALRYYNQSEAGSHTLQMMFGCDVGSDGRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQITKRKWEAAHVAEQQRAYLEGTCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, A-24 alpha chain
publication title Switching and emergence of CTL epitopes in HIV-1 infection
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 77
structure length 274
sequence length 274
ec nomenclature
pdb deposition date 2013-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3wlbA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3wlbA01
2NX5B 2YUVA 3CDYA 1ZT4A 4WU7B 3ULSA 1KIUA 1UB6B 1KIQA 3MOAL 3VXRE 1T4KA 3VXPA 3VXUD 2Z4QB 5DO2C 1C16B 3SBWC 2GSGA 3LD8C 1BFSA 4R2GC 4H88L 2NY5H 4Y8DC 5CUSH 3C5JB 5JDSA 4OIBA 4FZ8H 1MJUH 3MODL 4DGVH 3WV0A 3ARBD 5DVNA 2FJHA 3DI2B 3UPCA 2DQIH 2CDGB 3BPNC 3WO3B 1FNSL 1R3LA 3P9MB 1CCZA 5F3BB 1URLA 5I8OL 3QULB 6FABL 3DURB 3TBYB 2GJ6B 4Z95H 5HVFB 1SM3H 2YEZB 1KCKA 1ZWIA 4FQ2L 4OQTA 4OTXL 4BZ1H 3D69B 4MNQA 4RFOH 1YEFL 1CTOA 4BUGA 1KEML 3MNZA 3LOWA 4KVNH 4Q7DA 5BOZG 5KVEL 3K4AA 5IFHL 5L7XH 5DFWH 4LVNC 1A1NB 3HE6C 2VDRH 3BUYB 5DUPL 4JRYB 1YNKL 4JDTH 1UCBL 4UDUB 4ZFFA 1YJDH 1KCUH 1EBAA 1K8IA 2HA1A 2VZTA 4P23B 2A6KA 3BJLA 3QUYB 1TLKA 2NY0C 4YHZH 3RWGB 4O2FB 3F5WA 3ES6A 5IHUH 1FGVH 4P2QB 4YXKL 5TFSL 1KG0B 3HMWL 3ROLA 2P8LA 2BNQD 3FN3A 4J3OC 4FXKB 1T3FA 2HWZL 3BISA 4L8BA 1KUMA 3OKKB 4P9HH 2WIIB 4XRCB 1AE6L 3CCHB 1A7RH 1MHEA 1OGAB 4ZS6C 5GGTA 5GJSL 1KBGH 2IBZY 4L4TA 4WHYH 3TYFB 5ETUA 1UG9A 3NZHL 2AJUH 5F3HA 3B3IB 4JM2A 5HHPB 3THMH 2DQFA 4OQTH 3G6JB 1A0QH 2W0PA 3G9AB 1WTGT 3TPKA 1IBGH 1P7HL 4K7PH 5BRZB 1IGCH 5D1XB 5ENWB 4M61B 3IF1B 1I1FA 1FORL 4L9LB 4PJIA 3HZKB 3NFPB 4ELMB 4KUZH 3TN0A 5J11B 3H9ZA 4MLIA 4Y4KB 5IHZA 4JFFB 3WHXA 2P46B 3L5WB 3DYOA 5CSGA 5BO1L 2R1YB 4GAJH 4X4XA 5FYLE 2FO4B 1ZK9A 4NZTL 1P84K 4MXWL 5FUCE 5HHNB 5JOFB 1MLCA 4ZAKB 3CMOH 2P5EB 3E6FB 1YNLH 4GUPA 2F54D 1YEIL 3SY0B 1QNZL 1XGRA 3HNTH 3R0NA 4R7NA 1NFDF 2GYSA 4XP6H 5D5MF 1YUHA 2YUXA 4WFEE 2WZPD 4KROB 3TJHD 4ODSH 3PWLB 3QUZD 3SEPA 1ZSDB 3MFFA 2DJUA 3DMMB 3EOAA 5GGTH 1F97A 1UWEL 4RGNE 1SY6L 4GG6E 4NQUA 4MAUH 4OFKA 2R69H 4AJ0A 2BC4A 1L6ZA 1HKFA 3B8SA 4FQXD 4I9WD 3VGGA 2ADIA 3FO1B 4UNTA 4DJMA 4PLJC 4F57L 1Z5LB 3DLQR 2W9EH 1MVUA 3IXTA 5EZOL 5GGRY 2ICCA 2I9TA 4YDVB 3NA4A 4GLRI 4M5YL 3UTTB 1G0YR 3QRFM 3SKUD 3HZVA 4WW1A 3OB8A 3FO0H 4OD3L 4KJQC 1Q94A 1FQ9C 1FO0B 4F58H 4PRID 2ID5A 3B9AA 4GRWF 4LLVA 1G9NC 5I1DB 3U7YL 5I15H 4N0FA 1FYTE 3O2VH 4MJ6B 1NBYA 2ZUQB 5C0CB 4XH2B 12E8L 5I16A 3AB0B 2BDNL 1JFQL 2OI9B 1PGRB 3RVUD 3H9YA 3O3DB 2CKBL 2BVOA 2OQJA 2D0GA 3E8UH 3VWJD 2IJ0C 3EYVB 4DKDC 4LCCA 1WBXA 5DZOA 2WV3A 5C71A 5IVOA 3LKOB 1VFAA 5MEOB 4PB9H 4N9GA 4PJ8B 5JOPE 2FSEB 4Z78A 3DXAE 2EDNA 1BZ9B 3HUJB 1XGYL 1TVBB 3H2WA 3MREB 1WCBA 3EUUA 4LF3A 1MWAL 2RBLA 3GHBH 4PRPB 5BVJB 4HAFA 4EOWL 4F2MB 3O4LB 1ND0B 3WS3B 1I3RA 2CMRL 4HH9B 4OLEA 4UDTB 4Y5VC 1HINL 5JPMB 3VXRA 1J9CT 5I18L 4BYHA 2X09A 1BWMA 4QHLA 4ZPVA 5DQJA 1QSZA 4N68A 1EJOL 4WGWB 3SCMA 4E0RA 4PJBB 2YN5A 1Y18A 3ZE2F 1MAML 3PWJB 3RWCA 2VXQH 2H2SC 3VGAB 4AH2B 1T89C 1F6LL 4ETYA 3VFVB 4LIQH 5FM8A 4NFBA 2ED8A 1JWSA 4TUKH 4XVUD 1ZMYA 3TH4T 1DQML 4NM4L 3HZYB 3VGBA 3GSUA 4JG1H 2BRQA 1H3TA 5E6IA 3SKOB 5IKCA 3HR5A 5A2IH 4WW2C 5E5MB 1KJ3L 5ESAA 4IRJC 3ET9F 4KVCH 4X0KB 3B9EA 4NJAL 3AM8A 3DX8B 1A6AB 2Y36H 1IAKA 2VKXA 4GKSA 3DVGB 4LSDA 3QXVA 4ZYKA 1VFUA 2NYYC 1F2XK 2GIYA 3W2DH 4ODXB 3N1PC 4PJ5D 4PJHF 1KCLA 1XR8B 5E1AA 5MHSE 3RL2A 5IB5A 3NA9L 3VFSB 4HS8H 5KVFL 4TUJA 2LQRA 1WV7T 2IPTL 2QQQA 3ARQA 4XNYL 3MRNB 2X7LB 2AEQL 1DLHA 1Q72L 1WAAF 5F7YC 4AIZB 3Q5OA 4C56D 4KV5F 1BD2B 5TPWH 4OLVH 1JYNA 2AV1A 3I50H 1F90H 3FKUS 2A83A 2EO1A 4ZTPH 1DVFB 5IW6B 3RP1A 1EZVY 2P8MA 1A4KA 2VITB 3IGAB 1R0AL 2A9NL 3H3BC 3H9SE 1U93A 3SGDH 4HLZH 2XOTA 3GBMH 4E42A 4PV9A 2EDDA 2LVCA 3ZDXF 1RHFA 4KZDL 3O3AB 3VMNA 2EXWC 4HWZA 1WEJH 2AEPH 3QEQD 1KCRL 4XNUH 2YK1H 4UQ2A 1YEGL 3RJDA 4NN6B 1U41A 3TO4A 2LU7A 4KTYA 2O93L 1WZLA 1MI5A 2NY3B 4XPBH 1OP5H 3JTSA 3O6KH 3QAZB 2FWOA 2DRUA 5EORH 5C08E 5C0JA 1ODAA 4DCQA 4LBEA 4LQFH 5C9JA 1NGYA 3NVQA 1CLZH 5I2IB 5DMGC 5EN2B 5HYFA 4XNXH 4HG4K 3GSRA 1UXWB 2ATPA 4HJGA 3MLSH 4OJFL 4JRWA 1RUML 3U4EA 1IM9A 3U7WL 3FHQA 2BVQA 3RGVC 4RAUA 3QDJB 1UM6H 1N6UA 2XN9D 2HJFB 3JV0A 4UOW1 2VZ3A 4PYGA 2R56L 4X6CB 5ADOH 4X4YB 5DC9B 5AZ2H 3DX7A 4XMPH 3UC0H 1C1EH 4PB0L 2JB5L 3RAJL 1CZ8L 1EFXA 1Z3GL 1XGPB 2W59A 4KJYB 1M7DB 4XXCA 3UYPA 3HI6L 1QLEH 1QBAA 2FX8H 1C7SA 2YD7A 4XNQA 5I1AA 3PWPE 1UACH 2O5XL 1TCRA 5CJQH 4DVBB 1LE9B 1KFAL 3SE3A 1B9ZA 4KJPD 4LCWB 4P5TA 4DEPC 3VXMA 3Q6GL 4GG6A 5C09D 4RDQF 5IBLD 5DDHA 1NGPH 2A77L 4Y4HC 1X5GA 1I7ZB 1SJXA 3GSWB 3TYGL 4AEIL 5E9DE 4C83B 5INDB 5FIEA 4IRSB 5GSVB 3IKKA 1J1XH 1S7WA 2EIEA 4MDJA 5HHOE 1TZIB 3SO3C 4RFEB 5DRXB 2DM7A 2AJVL 1S7SA 2IAND 1I1AC 5SWQB 1G7HA 4NHUB 2Y7QA 2OTUA 5DD1L 5FYLH 3WDJA 1CT8A 1N0XL 5HYIA 4QO1A 1CG9B 5L88L 1ZVSB 1AR2A 2FHBA 4I48A 3RWJA 5DA4A 4MNHA 2V17H 3K4DA 3MLTB 3ARGC 4BFIA 2MKLC 1OP3K 1WIOA 3R8BB 2FJFA 4HIXL 1FYTA 2C4FT 5H8DA 4OCYH 3N9GL 3H7BA 1FNGB 1ZHBB 5D7SL 4M7ZB 1OF2B 5FK9B 4OLWL 3RDTA 4M7KH 4IMLB 1YN7A 2PXYD 1LO3L 4ENED 3ZYJA 3PGFH 3P0VL 5FYJL 5DLMH 2WY3A 2J1KA 4ZTOL 1FE8H 3MZTA 1HH6A 3A67H 5H94A 5EOCL 4J3VA 5D1ZD 4YZFE 4JY5H 5EU5B 3TCLB 4P2RD 5BV7L 4F80A 3JWNC 1FFOA 2ADFL 2IGFH 3DXAA 4X83A 4Z77A 1MVFA 1QRNE 3ZE1F 5D7LE 3VI3F 1N5YH 5ACMA 3P0YL 1I1YA 2BJMH 4UIMB 4S0TD 3MRHA 1IC5L 5H37G 2ENSA 3SKMA 3RFZC 4ORGB 2CLZA 4M7LT 1ZGLA 1KCSL 1P7KA 4HS3B 4ODVH 3B9KD 3GMOA 5E08L 1G6VK 3GMPA 3HRZB 4LCIH 4JFQB 4YHNA 4G9FD 1RZJL 1D9KA 2DQDL 3QDGD 5CD5D 2E7LE 3IXTB 5HGDA 3G5VB 1TJHH 4NIKB 5DMYA 2C3XA 4P4RB 4DK6A 5DEFA 3HZVB 1G7JB 3NCYS 1QR1B 3OKOA 4YFLF 2F53E 3CH1A 3F58L 1CU4H 3NBNA 3STZB 3KYKL 4V1DE 4HAGA 1Q94B 5DJ0B 4OV5B 2CR6A 3WSQH 3MRMA 3VJ6B 1G6RL 1KN2H 4RA3A 5LCVH 35C8L 4U1IA 2P44B 3QPXL 4M03A 4YPGB 4YEFA 1GAFL 3UAJC 4PIRF 1AO7E 3LB6C 2BVOB 2QLVB 5I1HL 1N4XH 4QHNA 2ILLA 1QZ1A 1C12A 4M6NL 4U49A 2Y4SA 3AC0A 4BH8A 2VC2L 4LCCB 4IEFB 1F58H 4WI7A 2Q1EA 1EHAA 3PGCA 4YHLH 1AGBA 3BIKA 3FB8A 5T5FH 2MHAA 1DSFH 4OF7A 1TVHA 3OX8B 3V7MA 1UWXK 3AS0A 3CPLA 4H0GA 1A6TA 1NSNL 4HD9A 4QRUB 5KSBB 1NCBH 4G8GB 1AHWA 1KGCE 3ILQD 2IQ9L 3IAQA 3DUUB 5SWZE 3DUHA 4HBCL 3ALXA 4OM1H 3IJSB 2CO6B 3OJ2C 4XHQA 1CTNA 1NGQH 2PNDA 3FT3B 5HYQA 3ZHLA 2DI8A 4PREA 3HI1B 1BOGA 1T03H 3FQWB 5DQJB 5DJXA 4XPHH 4D9QD 2GJ6D 3LH2H 4P23C 4POYA 4YXHH 1RJZA 3S34H 3F6IA 4PY8J 1EUTA 4NRYA 3FO9B 5GS0D 1OW0C 3RWCB 2H8PB 1KTRL 5C08A 3QCTL 4LLQA 1BJ1H 2BVPA 5J0BA 1GGCL 3C08L 5GS1A 2C1PA 3O6FC 5DFVD 2F5BL 1NDGB 4MA3B 4M8QB 3NTCL 1F4YL 1FC1A 1YYLH 2UYLB 1ORSB 4X5LA 2MQ0A 5C0IA 1EHLL 3RTQB 3T77A 1JP5A 4PJFB 1Q0XL 2GUOA 2R2EA 3P2TA 4Z5RA 3NOIA 2YPLE 3RWHB 2E6PA 4MJIE 5D1XC 2DDQH 1G9ML 2IBZX 1CGUA 3QUYD 2QQLL 4L9LC 4YNYB 5T5NF 2X2YA 4O02L 4GAFB 4M4PA 4JO1H 2DQJL 3ECBA 4I18A 3U9UB 3K8KA 3B9DA 5J11C 3UTSE 5DHXB 4Y4KC 5F7NC 3GJEB 4P46A 3RL2B 5A2KH 3GGWB 5HTSA 3PWPA 3VXSE 4NQDE 4TUOA 2NR6C 1VSCA 1CFTB 4UTAH 3R1GL 1MF2H 4I5BB 4D0BA 5HYJE 5GXBB 2VLLB 4IBLT 4ZAKC 2XRAH 5I1LA 4PTUA 3IYLW 2AV1B 3KPOA 2W9LA 3DGCR 3RQ3A 5IEKB 2ZP0T 2ZUYA 4P59L 5E9DA 2AJSH 1A1MA 1MIMH 3KPQB 2P8MB 1A4KB 4JM4L 2A0LD 1RZKL 1TIUA 1BZ7A 3I3BA 3VD5A 2NZ9D 4Y4KD 4HWZB 5DQDL 4BK4A 1S78C 1BIIA 3LKNA 4JFFD 4YR6B 5DFTA 4KDTA 4RZCA 5I17A 5GPRA 3L7FA 4J3TA 3OKMA 5GIRA 4R26L 1M4KA 1GZPB 5T3ZE 2Q7NA 3WFCL 2P5ED 1PEZA 43CAA 4UBDC 4CADA 4Y5XC 3HB3C 2QV2A 3CVHH 2Q3ZA 2EDYA 4YIQA 5C9JB 4FHBD 4G42A 3P4LA 4LL9A 4KROD 1E4WH 1FNEA 4ZFOL 3KVQA 4I3GA 3CFBB 2Z35A 3DMMD 1IM9B 5FGSA 4XWOD 1N64H 2WUCL 5H2BA 1U8HB 2HKHH 4KK6C 4BFGA 4NUGH 5EBWA 5IEHA 1KPRB 5IJKA 3BD4A 3HS0A 1WBYB 4GSDH 4HZAA 4S0UC 2ZPKH 3AB0C 5C0AB 3T8XB 2Y06H 2OI9C 1E6JH 1QRNA 5D7LA 2DL9A 3RY5A 1S9YB 1Z2KA 2DTSA 5GJTH 1A6VH 1R3JA 4NQED 3UTTD 5JW4N 2MKWA 4KXZH 4P5TB 2AJ3A 4XC3H 2N4IA 3KJ6L 4KJWC 2AXGA 4DTGH 4LP5A 5E6ZA 5KTEH 1O0VA 1QLFB 2CK0H 4NZRH 5LBSH 1Q9WB 1W0YT 3GIZH 1CD1B 4WJ5B 1UGNA 3MRIB 1LEGB 1F00I 1XEDA 2E7LA 5DC0A 3WE6A 5C0CD 4KFZC 4TSCH 1EAJA 4NZUH 5DJZA 5HGAA 3OKEA 4UNUA 1X4YA 3HCVA 4V1DA 1R6VA 5HHMD 1PSKL 3L5JA 3O6FA 5GGVH 2M2DA 4M02A 3IFPA 1JZ6A 4IOIA 3BEVA 4AG4H 1RK0A 2DTMH 1GGIH 3KJ4B 2J8UB 5DJDA 3VGAC 2W38A 5HBBA 4XCNB 4ZS7H 1FP5A 4BZ2L 2UVFA 4PJ8D 5KOMC 3GHEL 4HWBH 4XNZB 4CDHA 3PDOA 3MA9L 4FQHB 1AO7A 1CWVA 5MP6L 1YN7B 5C0RL 1VGKA 2FIRT 1KPVA 3LS4L 4Q6YA 4PRPD 2XWBA 1DUYA 2EH7L 5H94B 4PR5A 1RY7B 1S9WB 2C9AA 3EO1A 3S98A 1NCAH 1E4XI 3MMEB 1A7PH 5EUOE 5DJCB 5GRVK 3RKDC 2X1XR 3LY6A 4M1GL 1YY8A 4LCYA 5AG9A 4Z0XA 3WLWC 3BAEH 4PJ7E 3EFDL 1DQDL 1QLRB 1KB5B 3JTTA 4KRNA 5E8NA 5F9OL 3D39D 1G7LA 1FVEA 4YHOH 5SWZA 1INQA 1GGBH 2BCKB 3BVNA 4LPXA 1UH3A 3OB0K 4GFTB 4QHMA 1SBBA 4JANA 4YFDB 2FHFA 3ELAT 3I9GL 3I75A 3SE9L 1MRCH 4K71B 3MRDB 4JFPA 5CSZB 1AI1H 1JNHB 1QSFD 4L8CB 4FFWD 5B8CB 1DVFC 4YEEA 1I8MB 2X41A 4PRAA 3QIWA 4PP1C 3JBG7 2YSSA 4HZLA 3Q3GA 1Q38A 2DLGA 2XKSA 3BP5B 3TCXA 4XPFH 4CVZA 4YLQT 4Y5XA 3S8WA 4Y4FD 1JRHH 2X9WA 1EZVX 1UVQB 1UJ3B 4I2XE 4J4PD 4HUMB 3F6LA 3ZDYF 4NN6C 5JHLH 2FX7H 4MJIA 4NQSB 3KPRB 4NHCH 3C9NA 3KYMA 1BD2D 3QAZC 5SX4I 3GMLB 3GNMH 3UMTA 5J9PB 4ZUVA 4E41A 2V5TA 5ICXB 3UYRH 1R3KB 5CHNA 3MUGB 3V5DA 1AGDB 4HIHA 5FO8A 1XCQA 5E8OB 4F33B 1CICB 2VDOH 1DVFD 2XXCB 2EYTB 4Z76A 1FCGA 2DD8H 3UTSA 5LQBH 1ZT1B 1P53A 3NFSL 1JMXA 3FQNB 2CLVB 3VXSA 3RNQB 4NQDA 2OSLB 3FQXA 4NQVB 4OLUL 3EYOA 3V4UH 1UM4H 2DQCH 2YRLA 1CFQA 1ZE3C 3S4SB 5IB1A 5HYJA 3H3PH 2MHAB 1LE5B 4M1CC 1NGXB 2F74A 1AD9A 5IVXF 1NMBL 2Q7YB 5DD3L 3O3BB 2NY3D 2CDEA 1H3PL 1FLRH 2DQUL 1LDPH 1F3DJ 5DD6A 1AHWB 1RURL 4U1NB 1MEXH 4EBQH 4OZFA 3H9SB 2Q8BL 4FFVC 5KW9L 3W9DA 3QUMB 4GKNB 1XR9A 2HFGL 3FCTA 4QOKB 2VQ1B 5C6PB 1P6AB 3GSNA 1LP9F 1YEJL 4AEHH 3QHFL 1ZTXL 5LXGL 3MC0A 1BLNB 4XP1L 2QQKL 3C2AH 3OKDA 1S7TB 4BKLA 4PJDA 1DQLL 1SJEB 2WWKT 3MV11 5EZJB 1IAMA 5JHDE 2G2RB 3A6BH 2A1WH 1OY3B 3L5XL 4MNQD 2YD5A 4P4KA 4R4FL 2GTZB 1T66D 1OAXL 4AIXA 1WK0A 4HBQA 4QRSA 5HJ3B 3IETB 4LPTA 5F88B 2O5ZH 1RIHL 1CXEA 1L0YA 2XZZA 5IUSA 4D8PA 2PKDA 5FDWA 1W0WB 1BM3L 4HUNB 3JV6B 4OT1H 2P8PA 4K9EC 3NIFE 3SE4A 4O9HH 1RZFH 3TBSB 5TQ2L 3H42H 4PLKD 1W72B 3KR3H 3TZVB 2G9HA 4IDJL 3MJ8B 3SDDB 4UT7H 3MRPB 4NFCA 4ZUSB 4LSQH 3CVHB 4L29B 4M7ZC 2A74A 1S7UB 3QXDA 4IRSD 3PP3K 4BK5A 3DYPA 3U1SH 4QNPE 5F1IB 2DLIA 4OZ4B 1BFVH 3D1MC 3M1BA 2ICWA 3MRRB 1AH1A 3P30L 2EDQA 4L4TD 2HVKB 1OTSD 4ZDHB 2OXHA 5TQ0L 4ZNCD 4JM2D 3BN3B 5T3ZH 1IGTB 5TJWK 3MSPA 2AQ1A 4IHOA 4OV6F 5T1LA 4WI5A 3H0TB 1IQDA 1PY9A 1FPTL 1UH2A 4YGVA 5JO5B 3GSOB 5HHOB 4PJCE 3WKNA 4JREB 5DURD 7CGTA 3IVKB 3WO4B 3U4BH 3PP4H 3IAGC 3OKNB 4YDIH 3VFRA 1ED3B 5IMOA 2APBA 4OD1L 1FV1B 5F9AC 5BZDA 3MXWH 5IFAL 2FEDD 2V7NB 1GC1C 1K2DA 3DUSA 2JLLA 1JGLH 4JO2H 5IWLA 1A4JB 1L7TH 5TF1H 5KZCB 1AGCB 1J05A 2D7NA 1T1XA 1CYGA 2YMXL 3KPMB 5IGXH 1D5MB 4XCFL 1K4CB 5IB2A 4EN3A 2B4CH 4P5MB 3GSVB 1CE1H 1XIWA 3QNZA 4O2EB 2VISB 4UTBH 2BHYA 4M5ZL 2ITCA 3SJVE 1F2QA 2PYFA 2BSRA 1MCRA 3GRWA 4XBPA 3M45A 4K3JH 4MNGB 4JR9L 4YBHA 3OL2A 5EUOA 4PGJA 4JM2F 2XY2A 2O5YH 3GB7B 1JPFB 1GVIA 3ISWA 3TT3H 4PJ7A 4AZ8A 1MJJA 1K3IA 1RU9H 4KTDH 2FJGA 2J8OA 4CKVX 3WIFA 2J6EA 5ID1A 4ONHA 3QWQB 2EYRA 4ONFH 5DD5L 3T65B 4PJIF 3F7RA 1Q9LA 3UPRA 3W5MA 4YUEL 3U30B 5IMKA 3ZO0A 4YC2B 5FYKE 1QQDA 3LN4A 3N85H 3SDCB 4JY4A 4L8SB 3FJTA 4GQ9H 5CJBA 4F3FA 4F7PB 1RZ8A 4OCWL 5FO9A 3VH8B 2FGWH 1NMAL 2GAZA 5TDOB 4K8RH 4WUKH 1P4IH 5E8DH 4MSWB 2Q86A 3P11L 4P57B 1R5WA 2HT4C 1H8NA 5E6YA 1KLFA 1C7TA 1F8TH 1JHKL 1G7MB 4WO4B 2ZUUA 4N1CA 1I4FA 4DKAA 3T3PF 1CIDA 2EEDA 2F53B 5FXCH 3FFCE 4U05A 3ULVL 4LSPL 3TNNA 1K6QH 3L3HB 4KPHH 5JNYA 5BMFL 3GRWH 1F4WL 2IBGA 3RBGA 1OWWA 3VDCA 5IVZA 1T22B 4ERSL 4OB5H 1A14L 1WC7B 3N06B 2D03H 4XPGL 1EH9A 3CXHK 1SBSL 1BF8A 1ZLWK 2VAJA 4KK9D 1YQVL 3IDJA 2J6EH 4Y1AB 4XPTH 2XWTB 4DK3A 1HIML 4ZXBA 4JG0H 2NCMA 4EI6A 1KULA 2ZKHH 1CFSA 1RUQL 2XV6B 3FL7A 3DGGB 1AD0A 3U9PH 2EDBA 2J88L 1EHXA 3EO1B 1DUZA 1TVDA 1ZS8B 4RGOH 1MAJA 3VE0A 4PJEB 5SX5K 1B6DA 4U1MB 3SCMD 4PJ9A 2X4QB 1WGOA 3QUXA 1I9JH 1BVLB 2W9DL 2V9RA 5E8NB 3O81A 5J56B 3GI9H 5DUML 2B2XH 1T0MA 5T1KB 2DIAA 3L1OH 2BSSA 1ZLVH 3LQAC 4XVSL 2XQYK 4JANB 2DYPA 3RTQD 3WS6C 4G6AD 4JQVA 1FC2D 4RQQB 5E6ID 4C55A 4Y19E 2ZCHL 5DJYB 3A6CL 3QCUL 5EO9A 4LHUA 5SWSE 2W0KA 5JHDA 4WNQA 2MOVA 1BBDL 4UV4H 4FQCL 5AEAA 2Z31A 3TNMB 4N0CA 5K59F 4CU7A 2VXSL 4JPVH 1XAUA 2ESVE 1MCLA 4NNXB 1PZ5B 2XPGB 3U36A 3HC0B 3MLYH 2XKNA 5IMMB 4XNMA 5IT2H 4A6YL 4M9OA 3S5LB 2YPLB 3Q5YA 3CFKB 1I7TA 3QCVH 1IGFH 4K3EL 1HYSD 2X4SB 5EBGA 1I9RL 2VE6A 1J8HB 2BHUA 3TJEH 1UZ8B 2IALB 3TWCH 3V0VB 3UDWC 3CGTA 4MAYB 5T33L 5KANG 1I9IL 5C0EA 1OLLA 2NXZB 4MJ5A 1A7QH 4G6KL 1S7RB 3RBSA 5B39B 4U6VH 5GS3A 1G7IA 5TDPA 3MR9B 5GRJH 5I1IL 1PZUB 1DE4B 1LNUB 1IC1A 2GK0A 3G6AA 5DSCA 1KJVB 3RVXD 4KMLB 5D72L 4DUVA 1OAKL 3C8KA 3A6OA 4R4ND 4OQ1A 2R9HD 1F4XH 2J4WH 1XF4B 5EU6B 5DT1L 3QIBB 3TO4D 3T0BA 1MFDH 3K1DA 3QEHB 3DV6B 1KJMB 3SE8L 1SEBB 2DQEL 1A1OB 3NZ8A 4O51B 1FVCB 2CK2A 4EI5A 1FZMB 1BZQK 4XGZA 4PJCA 3T2NH 2UZIH 1KLGA 4X7SL 4JQIH 4UU9A 1CK0H 3TO2A 3AXLB 2Z0BA 1A9BA 3HNVL 4NO5A 5FM4A 4J8RA 5EOQL 4BUHA 3HZMA 4TSAH 1G0DA 5IK3A 5FYLD 3TIEA 3FB6B 4L4VA 4ODWA 5F7FA 1IM9D 3KYAA 2DQTL 1XGQA 2AK4B 1FG2B 4XAKE 4HHAB 4QXTB 5F89A 3NN8B 5KS9E 4NRZB 3GZKA 2CKNA 2FLRT 3LIZL 1EFXD 4DAGH 2VXTL 4WFED 2J2ZA 5T1DL 1UB5A 2EO9A 5FDWB 3AMLA 3GK8L 4O58L 3VDBA 5IOPA 3MOQA 3SJVA 1MREL 3BKJH 5D7IE 4K2UH 4RGND 3LEYL 4P5TD 4PJXB 1JWMB 4HIEA 1MRFH 5EFIB 2NTSP 1H5BB 1F6AB 5EC1B 3KPNA 3MRBA 4PRBB 2UWEB 3DO7A 5DD0L 4XNZC 1A3LL 1QFUL 1AXTL 3QXDB 4DKEH 3S36L 5LAXA 1F13A 4NOBA 4C57C 3BQUA 3GKWL 1YN6A 4G6JL 1IKFH 2HJKA 4BQCA 4TOYL 1MRDL 1ITBB 2JJTA 4OI7A 1P7QA 4YAQB 3QNXA 2XIDA 3HC3H 3ZYOA 4D2NA 2GJZA 2PO6A 4NJ9H 5C0FB 1LDSA 4MA7L 4UILL 1QBLL 1FZJB 4M00A 4ZUWA 4DOHB 3RGHA 2BOBB 5J3HC 4JPKH 3OGCB 3X3GH 1NGZB 4M1DL 3MUY1 3FOMA 1FYTD 3OG6B 5I30H 2HVJA 1D5BA 1N6QH 1MLBB 4WV1B 3MRLA 4J3SA 2KDGA 3RDTD 3VWKA 2P24B 3ME0A 4Q2ZB 2R1XB 1CGSH 5E8EA 4FP8H 3S96B 3QDHA 1KENL 4Q9RH 1M71A 4HUWA 4KQ3L 4K71C 1U3HA 1KT2B 4CMHB 4LSSL 3W39A 5L8LB 4OZHA 1C5BH 4CL7A 4GG6F 1RZIB 3FTGB 5B8CC 4QRRB 5JOPD 1J1OL 2RGSA 4OM0L 1B4JH 3DXAD 2HTKC 3HN3A 4FS0A 3ILPA 4NRXB 2FX9L 2AI0H 4LGPB 2ADJB 3UDWA 1OTTD 2YD6A 3ZTJG 3QHZL 2C7UB 2G5BB 5FYKH 1XIWB 2NY4B 2ZOKB 4P3WA 1UJ3C 4G80B 3T0EB 2V5YA 5AD0A 4PRHA 4JLRB 4XBPB 4TVPL 2H6PA 1KACB 3N1FC 5D1QB 4XCYB 5EUOB 2R39A 3VRJB 4ZG1A 1Q0YH 3LQZA 5E7FA 4YWGL 3VFMB 4AT6A 4HKXA 1D9KD 3O8XA 1CICC 1FRGL 4JFXB 1T83A 5HVWA 3BKYL 2BNRE 5FUOL 4UT6H 4XP9H 1V5JA 4IIQA 3ZHDA 1ZEAH 1G9NL 1UADC 1OSZB 4P5KA 4OI9A 4H8WH 2ZCLH 1EMTH 1MFAL 1ES0A 4R9HA 3SKJL 3DIFB 4Y19A 1RZ8B 1BX2A 1DBBH 2WM0A 1GZQB 3ZKSD 4S1SL 1JHLL 4Z9KB 1KXTB 1U92A 2ZSWB 2AXFB 4LOUC 3HHRB 3RIFF 1GYAA 2VZOA 5GZND 4KGLA 3RVTD 1F3JA 1T1WB 4GXVH 2ESVA 1BFTA 4TRPL 3MRFB 3FMGH 5E2TH 5JXED 3FZUC 4XTRC 2A6JA 4MCZB 4U1JB 5I8KL 1X5IA 3VRIB 2B1HL 1JGDA 4I2XB 5DJAB 3QUKB 1XGTB 5CMAA 4TSBH 3EZ8A 3UJTH 1RSFA 3QISA 3SGEI 3MROB 3LZFH 4JCMA 1KJ2A 2R23A 3QRGL 3EYQC 3QWRA 5IJVB 2FZ3B 3WD5L 4B5EA 1LILA 5HDOA 3WHE1 1DQQB 5DWUH 2MJWA 4PLOB 2OK0L 1U36A 2Q76B 4JN2B 4FQIH 4OLXH 1J10A 3H9SD 3B8YA 3PDGA 5H35A 3REVA 4NGHL 3MLVL 5HHXH 3WIHH 5I74B 4RMSA 2CJUL 1YC8A 5L0QB 3DTXB 5MEPB 4HCRA 3VXTA 3NCYP 3TZVC 4GMSH 4ODHL 1U8MB 3SDDC 3ZDZE 3NPZB 5DHVA 2X1QA 4ZUTB 5C08D 1DJSA 2DLHA 2Z92B 3TBWA 1AQKL 5GGQL 4OIIH 5JW4R 5CIPA 5BZWA 3V6BR 4FABL 3WL9B 5F7KC 3BUTA 3PL6B 2BRRH 3GJFA 2VXVL 5MEQA 1DP0A 3ZL4H 4NYLB 3MCKB 3O3EB 4PG2A 5EO9B 5SV4A 3GBNL 3BPOB 3TBVB 4NSKB 3GSQA 3P9LB 5HY9A 3DV4A 1QYGL 1KJ2H 4I77H 4BSVA 4C4KO 2Z31B 3QH3B 1LQSR 4MS8C 5KS9A 3KPSB 1S7XA 3QEUA 4K07A 5GGSA 2BY3A 5KSAB 2F58H 4JREC 3WO4C 1HHJB 3QJHB 4L9DA 4P46D 4H26B 5CINL 5EWIH 3PWPD 4HKBA 3STLA 4NM8H 5CZVL 3IDXL 4G8EA 5FB8A 1J5OL 1IC7L 1R5IB 4ODUB 1QPXA 4MQSB 2X4RA 4X6DE 1QHOA 4Q0XH 5DHVH 1EEYB 3LKQB 3EBAA 2BHZA 2DLFL 5E9DD 5KAQG 5DRNA 4CJ1A 5CIPH 4EUPG 3MLZH 2CLRB 1OT1A 4KKBC 5JPNB 3DOSA 4O4YH 5HHOD 1R3IL 3GJFH 1TMCB 3P73A 4LVEA 4NBYB 4NO0B 5EZLA 1R3HB 4FQQA 1A7NL 3TPUE 4Z6AT 3QT2A 3EOTH 4OGXL 2EDXA 3C8KB 3WEXA 4YJZL 4HC1L 2R8SH 3L3GB 5DQ9B 2N7AA 1V7NH 3OAYH 1S5HA 1YY9C 4GW4B 4J3XA 4X7EC 3BZ4A 1TZGH 1S5IL 4S1QL 5DEGA 3IU3B 5A2LH 1VGEL 3I6KA 2XI9A 1INDH 4EI5B 4MJ4A 3AY4A 3NGBB 4I3RL 2EKSB 4XGZB 4MA8L 2YOCA 5DGQA 5J1AB 5ADPL 1V05A 1OSPL 4P3DA 1IKNC 4UU9B 2Q6WA 3QIUB 1DBKH 4PJGB 1H0DA 1M7IA 4G43A 3KPPA 3CSGA 4F9LC 1L0QA 3JSSA 4YC2C 4GG8A 1AJ7L 2X4OB 3CFCH 4L8SC 4O5LL 4N0YH 4PG9A 1CQKA 1YEDB 1NBZB 2DQHL 4ZO9A 4CU6A 5CBEB 3MOAH 3W81A 1QSEB 4X98A 4WO4C 1QRND 4LARL 2JB6B 5D7LD 4BFEA 1U0QA 1FBIL 4B53A 4H88H 1RAMA 1P4LB 4WUUB 2A9ML 3BRFA 4HS6A 3KYNA 2WINB 3P4MB 4KZEL 3T0DA 5T1MA 3SDAA 4BSWA 3SOBL 3MODH 5FOBA 5HVHB 4XBEL 2VLKA 3SDCD 4HF5L 1UXSB 3BW9A 1EPFA 1QTYT 5INCA 3DHJA 1FNSH 1MH5B 5I8OH 3F62A 1VCAA 1JZ7A 6FABH 4XI5C 4GAGL 3ULUC 4QY8B 5HPMB 1UKQA 2ATKA 1NUNB 5C0BB 4PV8B 5I0DA 2QEJA 4EIGB 4FQ2H 1DDHA 2I60L 4OTXH 2CUMA 4GLRH 3GMRB 3S97C 2I5YL 1YEFH 1AKJB 2JJSC 1KEMH 2F53D 1PG7L 5KVEH 4V1DD 3JWOC 3KXFE 4FTVE 3NACL 5IFHH 1N7ML 2IAMB 2Q8AL 5DUPH 2VL5B 3BGFC 1YNKH 1PYWB 1G7PB 3IJYB 3MJ7B 1UCBH 2EZ0D 3PABA 5IFJB 4YZFF 2ITDB 3OTTA 1I85C 2FL5B 1AO7D 4NPYB 4I4WA 1MCDA 3FFCB 2NY6B 2G75A 5HYEA 3P4OA 1FVDB 4XBGA 4YXKH 2V7HA 5FO7B 5TFSH 1SQ2N 3HMWH 4HFWA 2JJWA 2P42B 4QRTA 3U0WL 4MD0B 1WVZA 5DMKB 2HWZH 1J7VR 2V2TA 4TTDC 3FRUB 1AE6H 3JV4B 1IMHC 3CX5K 2O61B 3OG4B 1T80A 1ACYL 4OCXL 4RDQG 5GJSH 3NZHH 4ZMAT 1JZ2A 1SY6A 4XZUB 2AQ3A 1KGCD 4JZJB 5IR1A 1AC0A 4K94C 1IL1B 3GIVB 5SWZD 5HGHB 2FEEL 3P0GB 1AP2A 4LVHB 4YDJB 5T1KD 1YNTB 3TVMC 1FORH 5CEYA 3RY4A 1I1RA 4YHIA 1C5CL 2HKFL 3C09B 2WLYA 4N0UB 5CGMA 2PYEE 1XH3A 1ETZB 4MB5A 4R7DA 3SPVA 2IF7A 3BHBA 1B2WL 3QDME 4MAYC 3DRQB 1HOCA 5BO1H 1N6VA 5DEZA 4KRPD 3DARA 1DN0B 4NZTH 4MXWH 2NXZC 1I8LA 5J6GB 3RY6A 3RPIA 4PY7B 1LK2A 4K3DL 3QIWD 5FF6B 4ZO6A 1YEIH 1QNZH 3E2HA 2RJMA 3F65A 1MHPH 1FZKB 1RUAL 1A7OL 3VXQA 3CVIL 4LLDA 2EDEA 1ZGLP 1ZA3A 1KTDA 1RK1A 5F1NB 5SWSB 2YPLD 2CKBA 1X9QA 3QIBC 1FL3A 4MJID 5FYJE 1UWEH 2ADGB 3EYUL 5T3XL 1WIUA 1SY6H 2B20A 2COQA 1J0IA 4CVXA 3WJJC 1VENA 2KZ1B 4I0PB 3EJYC 4IS6B 43C9B 1MHHB 4LPVA 3UTSD 5I76A 2WP3O 2VQUA 3JVGC 1ZT7B 1J0HA 2VERN 3GI8L 5TGBB 3VXSD 4F8QA 4F57H 4NQDD 3C5ZA 5EZOH 1MJ7L 5HYJD 1MWAA 1P84J 4ZODA 1A6ZA 4M5YH 3RWIB 3NPSB 4DZBA 3QQNA 4OD3H 2R23B 4X6DA 1BBJA 3DVNA 3ROOA 5MI0B 3BYTA 4FFEX 4O00A 1JNNL 3PJSB 1D5ZB 2FO1A 1YPZA 1XF5B 3GSXB 1QFWI 5IROA 3U7YH 3T1FB 3MRKA 2MWCA 3TPUA 4EIZC 12E8H 5IQ9A 2GFBA 3VA6A 1IGYA 1TJIL 2BDNH 3B2VL 1JFQH 5IV2B 3EYFB 2CKBH 1JI1A 4N5EC 4FQPA 4JFYB 3TBTA 2XQYG 15C8L 2EIZB 1RZGA 1H5BC 1BF2A 3QEGL 2IH1B 5L2KE 5T3ZD 1WCQA 1N26A 3MBEB 4ELKA 4KC3B 1U8JB 2H9GA 4P4KD 1CXLA 2B39A 4J23A 5CBAB 3EDJA 1MCIA 4ONGL 1LD9B 5CIPB 5DK0B 2B4CC 3VGHA 4AMKH 8FABA 2CIKA 2NLJB 3AUVA 5AWNL 3HC4L 2ZWLT 1XGYH 3O9WB 1ZHKB 2OL3B 4X80L 3X11A 4MXQC 4R6UA 5C8JB 1SHMA 1MWAH 4LVOC 1JPTL 3BEWB 2FEEI 4EOWH 3DV4B 3LKPA 3X3FL 3V8OA 2CMRH 4KI1A 4XP5L 5DTFB 5JORA 4GW5A 3RUGB 4HKJB 2EKJA 5I18H 1RIUL 3C60A 3GDBA 4WV1C 5E0QA 1A8JH 3V5HA 3VFNA 5LGJB 3B6SA 1EJOH 3O11A 2R0KL 4HKBB 3B43A 1IFHL 1HILA 1J8KA 3PG2A 2VZVA 5D7IB 1OCWL 3T08A 2DKUA 3OB0H 1HCVA 4GJTB 5FB8B 2GW5A 1LGVA 1TCMA 4C58B 5MERA 1KXQE 5JXAL 5DC4B 1DQMH 4CMHC 1HZHL 1I8IB 4K8RC 4NM4H 5E2VL 4GOSA 3TVMA 1P5UA 1HXYB 4MWFA 4APQB 2FNBA 4PJDF 1NBQA 5T1LD 2R0WL 2QR0A 1I75A 1GGTA 3REWB 2CH8A 3GMMA 4XHJD 5AUMA 1KJ3H 5ERWA 3TA3B 4NJAH 4EUPA 3MYJB 3QG6A 3QO1A 3V6OC 4JDVA 1J11A 2FB4H 5CP7A 2NY4C 1J1PL 4J3UA 2YBRA 3T0EC 4X5WB 3KXFA 3HE7A 4FTVA 2W0LA 4P99A 4H20L 2FBJL 5D1QC 4PD4J 4LRNL 4X9FA 3J7HA 3LSOB 3ESUF 4I3SL 5EIIA 3NA9H 1U58B 3DX6B 5KVFH 2UY7A 2YA1A 2IPTH 4XNYH 1FO0L 4QCIB 3QJFA 4GMTL 2AEQH 1Q72H 5F1SA 3QQ3A 5T5NG 3D0LB 1JWUA 1WJ3A 4WRLA 3IDUA 4RRPA 1H0DB 1HHGB 3KLHC 4PLNC 3HAEB 1VDGA 4WEMB 4UOW0 3DROA 4XAWL 4W68A 2C26A 1UEYA 1XIWD 1NCWH 4NWUL 4DGIL 4AM0A 1F4HA 2A9NH 1OAZL 2BSTA 3JVGA 2ICEA 2AXJA 4QXWA 4JO3L 5IW1A 4L4JA 4CVWA 3UTPE 5D1QD 4KZDH 1YMMB 2HT2C 3BDBA 1JL8A 1KCRH 4CDGC 5IB4B 4HT1L 1K4DA 1YEGH 2OYPA 4EUPH 3IFOA 4NBZB 3FN0L 1AGEB 3BP4B 4R4BA 1K8DB 1N59A 3GSNL 5CZXC 5C0GA 5CCKH 5C2UB 4PGDB 2DI9A 1QOKA 5BOPA 2PYEA 4LEOB 4BH7B 3AAZA 1D7FA 2W65B 3QDMA 4D0CB 5K9KB 3Q1SL 4NNYB 2C1OB 3O4OB 4OJFH 5C6TL 1RUMH 2BNRB 3U7WH 3UZQA 5KG9A 5DJ6B 1FN4A 4HPYL 3HR6A 4HWNA 4UV7L 2X4NA 2R56H 4GW1B 5E2UL 2RCSL 5A16B 1S7QA 3FQTA 3GMQA 4U1SB 3PGDB 4XC1L 4PB0H 2JB5H 5I74C 1CZ8H 2LV4A 1Z3GH 3BT2L 3D25A 4HSQA 5L0QC 3HI6H 2VLRE 4Z8FL 3LPGA 1OAYL 4Z7UE 3ZZ1A 2DB8A 5J1TC 1KFAH 4OGYL 1LO4H 1JPSL 4JZOA 4E5XB 2P5WB 2YC1B 4MCYB 3Q6GH 5EUOF 3L3OA 2XTJB 3PHOB 4D0DA 3MLPA 1MFEL 4JHZA 2A77H 2G75B 3PL6C 4PJ7F 2E5EA 4ZXBD 4H0HB 4AEIH 3TYGH 4HG4J 4M6ML 3P40A 1SJHB 4JQXC 4G8IB 1P69B 3MLRL 3O45A 5FHBL 2FR4B 3BPOC 1MCCA 5TE7L 5LG1A 5DD1H 3U0PB 1N0XH 4PJ9D 2WBJB 3QUXD 3VFPB 3D2UA 3VXUB 5KSAC 3EGSA 5L88H 2AERT 2EXYC 2H26B 3FO2A 4Q9BA 1Y0LB 4MMXC 1KPUA 1ONQB 4HIXH 1B0RB 5F96L 3N9GH 2DYPD 4YDKL 3MCLL 5D7SH 3ARBB 4OLWH 1FZOB 1P9MC 3WUWA 1W0VA 1BFOA 1ADQL 3P0VH 1MFCL 2X4UB 4JDTL 2GKIA 3I85A 4X4MA 5FYJH 5GGUB 5JHDD 3RIFK 5L2KA 3SKNA 4ZTOH 2XWJA 5HDBF 3EJZD 2KBGA 2Z31D 4N0CD 3NFNB 3NMEA 5EOCH 5F7DB 1G6RA 4JRXE 5E56A 3WN5A 4OCNC 1U8PB 4UQ3A 3G08A 1KEGL 5JQ6L 3OJDA 1PKQE 5J7CC 3EO0B 3E3QC 2ADFH 4OF6A 3EJJX 3TFKA 4NWTL 5KSUA 3BZDA 3LKSA 1ZA3B 4N1EA 3T0VA 1EGJL 3ZLQC 1U91B 3AREA 1VADA 3P0YH 4H25B 4QWWD 3RHWF 2CKBB 5DYOB 4LAJH 2J12B 5JR1L 1CF8L 3UTQA 1RJYB 5FHAL 1MCWW 1NLBL 1T0NA 3NGBC 1Q9OB 5HYSG 2RQ8A 3LV3B 3P3YA 3H8NA 1HSAB 2D7PA 5E08H 1NFDB 3QIUC 2F9BT 4OGAC 5I76B 5D5MB 1RZJH 2DQDH 4TN9A 2D31B 3MBXL 2SEBA 3BGMB 1C5DB 1ZLUH 4S2SA 3ARXA 2XZQL 4P3CL 1GJIA 4G8FA 2VN4A 4KKAD 4Z7WE 3F58H 3EHBC 4HUVA 2BMKA 5EBMB 4MVBA 3KYKH 3C5SB 3WDIA 4HUXA 1TETL 1G6RH 4Z7VE 1SYSA 4EI5D 4QRPA 3PDDA 1FGNL 35C8H 2HN7A 1QO3A 4FQJL 3QPXH 2GCYA 2VR5A 4YPJA 3TPUB 3QIUD 4B41A 2AEWA 4KKCC 3D0VB 4U1GB 2PTUA 3BPCB 3L9RB 2CIIB 3BIBX 1GAFH 5HVHC 3WFDH 1EAPB 3TBTB 3CH8A 5I0ZA 1JTTA 3NIFF 3WKML 3ZKMC 2EIDA 5GRWA 4UUJB 3OR7A 4GRMB 3QFDB 4K9EL 1HHIA 2V2XB 4GRWB 3OR6B 2NW2A 5JA9A 4KU1A 1HHKB 1UQSA 5EU7C 2J8HA 4U1LB 4HXBL 3OHXA 4PBWD 1TZHA 1GSMA 1NSNH 2PETA 3BH9A 4BQBA 4QNPF 4HIIB 1II4E 2IAMC 3SJVD 4HBCH 3RL1B 1U8IB 1NFIB 2VDMH 3PV6B 5EBLB 3F12A 2HLAA 4JKMA 5GGRB 1NKOA 4F9PC 1N2RB 4EVNA 1A9EA 5ICZB 4MX7B 1OQXA 4JZNB 5B22A 2NY6C 4FQXB 2DICA 5HI4D 3O2VL 3RNKA 4LLWA 3BQUD 5LKNA 1DEEA 2F8VA 4PJCF 3CMGA 2BNUA 3VMPA 3QCTH 1GGCH 5FYKD 2YXFA 1P7QD 3C08H 3BP6A 1VPOL 2BOCA 1NEZG 2F5BH 3NTCH 2PO6D 5I6XC 3JUZA 1EHLH 1T2JA 1Q0XH 5J6HA 2AV7B 4RIRA 2XG4A 2HJLA 4PRIB 2PW1B 1P9MA 1A6UL 4JDZA 1GC1L 1DLFL 4JZJC 2GTWA 2NY2C 2ICES 4PB9L 1EXUA 1G9MH 5FA3B 2KQNA 1SYVA 4H5SA 4LVHC 3VWKD 2YBRB 3FFCD 2QQLH 2UUDH 3U48A 4D3CL 3GUTA 2E8YA 4O02H 3MZGB 3V8CA 4MD5A 2DQJH 3C09C 3BWAA 1UYWL 2VLRA 4GBXB 3VWJB 4DZ8B 4HMEA 1U3HD 4WIQA 4Z7UA 4AK1A 2CDFB 5CJXC 1RHHB 5AAWA 1ZA6B 3R1GH 4ZFOA 3QJFB 1X5JA 5ACZA 2PW2B 4ISVA 4ETQB 4NP4L 3WNPA 1OQOA 4WU5A 5I8EB 3UX9B 4G3YL 4P59H 2H32H 1O5DT 3PQYE 3K8LA 5IBTL 3I3EA 1CVSC 1I8KA 3QXWA 4PJHB 2V5SA 1MOEA 4JM4H 4U0RB 4HIJB 3X13A 4QLRA 1U8KA 1DTUA 5KJRL 4ZFZA 4LLYA 3ZHKA 1N8ZA 1RZKH 3TIDA 4NZJA 4U1KB 2VOTA 5JW5B 2AABL 3STBA 3PE9A 2ZUXA 5DQDH 5IW3A 3KHOA 1GIGL 4F7EB 4KVCL 5CILL 2WBKA 4I0PC 4R26H 4PTTA 4XMKL 1CDJA 2ZNWA 5JZ7D 4IOFD 5BS0E 2OTWA 4LGSB 4KMTL 5HI5D 3S37L 2DBLL 3FQUA 5DHYB 2B1AL 4Y7MA 3D3VE 4Y19D 3NPSC 1LP9E 3KLDA 5BXFB 5SWSD 4F8TA 4RBPH 1T5XB 4AYFA 3QPQD 5MI0C 4NKDB 2WUCH 1FL6A 4JRXA 4B7LA 3IS0X 3HKFA 1NEUA 3MA7A 5K9OB 3D87B 2VDNL 2X4NB 3LN5B 4U6HA 3VXNB 4HXAL 4CN1A 3B83A 5D7JB 5FA4B 2C3GA 3FT4A 1JF1A 4PJ5B 4JO4L 3MBEC 2HFFB 4NDMB 1KNOA 5F93C 4E9LA 3KJ6H 2A6IA 4JFZL 3OZ9L 3QWRD 3C6LA 4HFUL 3DBXA 1MQKL 5F6IC 5C3LD 4NQXB 3KLAB 4KI5E 3UBXB 4L8DA 2VL4A 3UTZA 3LPFA 3O9WC 2VKWA 4P49A 1GGYA 2VDLL 3KWWB 5F7EL 2CSPA 1X6LA 4JFHE 4Z7WA 1OHQA 3LQAL 1TTFA 1ZHNA 3QI9C 2YXMA 2CUHA 3HPLB 5AG8A 1PSKH 3CFEA 3NCJL 3QEQB 3HLAA 4WEUD 5D2NE 4Z7VA 3MBED 4LLMA 3DECA 2X4PA 4HK3N 1CDIA 1IGJA 1NJ9A 5GRXG 3QYCA 1SEQL 4PP2A 2APXA 3WFHA 1ZOXA 2ERJC 3OKLA 4BZ2H 2IFGA 3GHEH 5B4MC 1HKLL 5ID0B 3MA9H 3QFJE 5MP6H 5C0RH 2UZYB 3KPTA 2FX8L 4TVSa 3LS4H 1H15B 3S7GA 3EOBB 2K9UA 4X9IA 2V2WB 5GRUL 4CRPA 1S9VA 3LCYA 3ULVE 5FOJA 4H1LB 1QEWB 4XAKD 4XCCL 5FCUL 3D18B 2EH7H 1S9XA 3VI4F 4HGWB 4K7FB 4X99A 5E95B 1UJTA 3TA3C 2XN9B 3QA3B 3DJ9A 5IB3B 3VFGL 1E4KC 2HLFC 1R24A 1OGTA 3LRSA 4M1GH 3NCMA 5C2BL 2OJEA 2ZCKL 3LKSB 4N8VA 4S1DD 3EFDH 1DQDH 1DBAL 2FGZA 4ZSOB 1I7RB 3JWDC 5F9OH 5GRYA 2MMXA 1Q9KA 4JEGB 5B38A 3C6SA 1MCHA 5C0DA 4KTEL 5GGSY 4UINL 3ARFA 5MENE 3VFUA 4ZPTA 4NN7B 1TITA 2FIKA 1LO0L 3SGJC 3I9GH 4X6FB 3U2SA 4APQD 5C09B 4HDIA 3ARDA 5FECA 1EUUA 4JY6A 3SE9H 4X7FC 2QSCL 5I1KL 1T5WB 2R4RL 3QB7C 3G04B 4FA8A 4OCYL 3VW3L 2RAMA 1AGFB 2EE9A 2QSVA 3DNKA 1FFPA 5KOVC 3L3IA 3LRHA 3I6GB 2PTVA 1TXKA 3V5KB 2QADB 2IANB 1XGUA 3PWVA 4S1RL 3SQOL 5FKAA 3HNSL 1P4BL 1FE8L 1HXMA 3K74B 1SYSB 4Q6IA 1B3JA 3M8OH 1YC7A 3UROR 4OBRA 1NBVL 3NCCB 1I3GL 4J1UA 5KS9F 2IPUG 3W0WE 4AQ1B 1Y6NR 4WHDA 1WWBX 4EDXB 2RFXB 4Z7NE 5EO0B 4KK8C 4RFNB 3LDBB 2N56A 3KYOB 3C8DA 2PXYB 4GRLC 1HQRB 2DWEB 3NFSH 3KDMA 4DQOL 4O2CB 3LVEA 4OLUH 4NOFA 4AIOA 3CIQA 3O4OC 5GRZA 1I3UA 2XFXA 1HSBA 4OLYL 5D1ZB 1L9MA 2RR3A 1FDLH 4P2RB 1BMGA 4OFYD 3MRQA 1JF6A 1NMBH 1TZHB 2WK2A 4LLAA 4Y5YB 5DD3H 3LAFA 2EDLA 5FDYA 2DQUH 1RURH 2DKSA 4CNIA 2HFEA 3SDAD 1MHCB 3NIGE 2Q8BH 4R96A 5FYKU 1OB1A 3PWUA 5HD8C 5F6HI 5KW9H 3OXSB 2HFGH 4HCRL 3VRLE 3BRDA 1LO2L 1NC2A 1YEJH 2AKRB 3WSQL 4W4OA 3OXRA 3QHFH 1ZTXH 5LXGH 1QA9A 1YQ2A 4XP1H 1D5XA 2QQKH 3B9KB 3DRTA 4XWGL 2XTJC 3ZKQD 2I07B 1DQLH 2H3NA 2BNRD 3QI9A 1WT5A 4G9FB 5BS0A 3BKCL 3L5XH 4QEGA 3QDGB 2H32B 1KB5L 4R4FH 5IIEB 4PGCB 1H3XA 1OAXH 4JHAL 1N4XL 1NEZA 1CLYL 1MCKA 2I9LB 3D3VA 3MRGA 2W60B 3KPLB 1KCGC 1RIHH 4NQCE 4YBQD 1HI6B 3Q48A 3QO0B 1FJ1B 1BM3H 2WBJC 3BKML 5GSRA 4UIKH 3M17B 5EU4A 5E03A 2GTWB 5IF0A 2ARJB 5TQ2H 5F7LB 3TF7C 1UKTA 1HQ4A 2JCCA 3T2PA 4IDJH 3QXAA 3QZWA 4LNRB 1CDHA 1OTUD 3B9VA 1KOAA 4NN5B 1YEHL 3ARBC 4X5XB 4X6EA 1KTLA 2VXUL 2BVYA 1PD6A 1RIVL 1N5AB 2LTQB 4R0LB 4Q9QL 4MZ2A 3DX9B 3Q6FA 4IM8A 1LQVA 5D6DA 3P30H 3H9HB 3PNWB 4XPHL 2WBJD 2DAVA 3MGTA 5TQ0H 4PJAE 3ZT7A 3LH2L 3RZCA 5EC2B 4P2OA 2AGJL 2HTLD 2VWEC 4QHUB 4U3CA 1AXSB 1FPTH 5C0NC 4JE4B 1U8KB 3B5GA 5ITFB 4ZFZB 3KS0H 3VG0L 3P77A 5EO1A 1YYLL 4MQXD 1BP3B 5BJTB 3EDEA 1DBML 3IDIB 5IMLB 2VLJE 3V79C 4OD1H 2I24N 5D2NA 1U8NA 4RMUA 5IFAH 2W0FA 4W6XB 1JTOA 4PTTB 4L3CA 4YK4B 1WBZB 2B0SL 4G7YL 5F8QC 3FAXA 2MNUA 2YMXH 3IDYB 2VABA 4XCFH 3QFJA 4GAYA 2JJVA 2ZUSA 1MY5A 5C0ND 1IILE 3QUML 1HEZA 4GKZB 4PGBB 2GITA 4LU5L 2XTLA 4M5ZH 4MHHG 2XRAL 3CXDL 5JA8B 1U8LA 1FFNB 2ZOLA 1CI5A 1UM5L 1IAIM 1PKQB 4JR9H 3X12B 5HGBB 3BESR 1S3KL 1XMWA 1C08A 4X8JA 5CLWA 4F7TA 1V3JA 3RIAF 4U1GC 3IJHA 4NKMA 3C5ZD 5IG7B 4M8VA 2EIBA 3FT4B 4NKOB 1P5VA 5DD5H 2YZ8A 4Y16A 4YO0B 1MSPA 4LSVL 4YHPA 5E8PA 4XXDB 3PHSA 4YUEH 5B21A 3TV3H 4NT6B 5MENA 1B0GB 3PHQA 3UO1H 2QTEA 4ODTL 4G9DB 2VUYA 4MDIA 3F7YB 4JN1L 2GT9B 3I6LE 1CS6A 2DOCA 3EDKA 5E5UB 3ZDZF 4QXGL 5EPMA 1W72L 1NMAH 1T21B 4TVPE 3RWDB 5CKAA 1SMAA 3P11H 1MI5E 4F7MA 1H8SA 5JQHC 2P7TB 4W4NA 4XVTL 5BVPL 1M1SA 3EO9L 3FB5B 3TJHC 1U8OA 1JHKH 1ZLVK 3QUZC 4PRDB 3U6RA 4EDWL 1R5VB 4W81A 3ULVH 3L6FA 4LSPH 3WLBA 4LAQL 2G60L 2WNGA 3MNWA 3DSFL 4LKCB 5BMFH 1F4WH 1D6VH 3TM6A 3BOVA 4FQXC 3QR2A 4ERSH 3RWFB 1PX4A 3W0WA 1A14H 1JPGA 1T1ZA 2X4TB 4HUUA 4XPGH 1SBSH 1F4AA 5EU3B 1ORQB 5DRZA 1YQVH 1U8QB 4LPWA 5DJ8A 1KIPA 3RHWK 3X14B 5L2JA 5EIQA 1H3GA 1F5WA 1HIMH 3W9EB 1J87A 2V5RA 1YMHB 4V2CB 4A6YA 4JVWA 2J88H 5I66A 5ITBL 3C60D 5KTEL 2XNAB 3S88L 4X6DF 3VXME 4QYOB 1KB9K 1QRKA 2Z8WC 3V6ZA 3L7EB 4JJ5A 1YPZF 3RVUC 2W9DH 3FONA 5ISZE 3QWOB 4GBXC 5DUMH 3AVEA 4QT5A 3SBWA 3VWJC 2BFVL 2OTPA 4NQEB 3CU7A 3BO8A 2FH6A 2R0ZL 4XVSH 4ZPTB 3L3JA 5HYSB 4JY6B 4X8XA 1DL7L 2ZCHH 3A6CH 3QCUH 5E2WL 1LO5A 3BH8B 2ZSVA 3MGAA 3LEXA 3AFLA 1BBDH 1A3RL 4FQCH 1T7YA 5K9JL 3O41A 4HWBL 4U0RC 2VXSH 1JV5B 3KXFD 3HE7D 1XZ0B 1JGVL 4FTVD 1E28A 4ZD3L 5DI8B 1EO8L 3FFDB 4NQCA 3WXVL 4GBXD 3VCLA 1CLCA 2Q3AA 5HHMB 1T6WA 2BNQA 3BYYA 1Z9LA 2LVEA 4A6YH 5D9SB 5A43C 4LNVA 4K3EH 1I9RH 1JHTA 5JLZB 3MV8E 3HE6A 2DLTA 5ELIA 2Z93A 1F6FB 3EIFA 3E6HB 5DJ2B 1NGWA 1OAUL 1IAOB 4NO3B 4P2CG 5T33H 5BQ7B 4JHWL 5CGYD 1HDMB 5F21B 2ZUTA 2Z8RA 4R90L 1I9IH 4JHBA 4JFEE 5KSVB 4XVUC 5ICYA 1P1ZA 4OKVA 4G6KH 1XCTB 4WFFE 4QF1B 4RMWA 4WWID 5I1IH 5F9JB 4WY7L 4R8WL 3FQRA 3WFEL 4JFDE 5D72H 1OAKH 3BZEA 2E27L 2RHEA 4FNLL 5K9QG 3FOLA 4PJAA 2IQAA 1MCPL 1S8DB 1OARL 5DT1H 2R1WA 3PQYB 5KAQF 3SE8H 1J0YA 3FB7B 2IH3B 5D7JC 3ULUL 3H3KA 4CMMA 5F8RC 4NO2A 2P4AB 3D39B 4LKXB 1CN4A 5D2LE 5C07E 5KVDL 4X7SH 3G5YB 2PYED 3L3DA 1LVEA 3AROA 4HLJA 2GI7A 4UB0L 4HV8A 3HNVH 1L4IA 2DL2A 5EOQH 3QDMD 2MPAH 5ANME 2VLJA 4Y2DB 3JWOL 5IVXB 3QUZA 5EUKA 3IDNA 4OAWA 4NHCL 1ZHLA 1XF2B 3EAKA 2R2BB 2DQTH 2Y23A 1QSFB 1CLOH 4U6XB 5FKPB 4OUUB 4WWKB 1XF3B 3TP4A 3LIZH 3HPJA 3DETD 5D7JD 2FLBT 4MQ7A 2VXTH 1B4RA 1LEKB 3VXOA 1EO7A 3OQ3B 1LP9B 5DUBA 3QSKB 5T1DH 4U7KA 5DK2A 5ESQB 1UM4L 4Y4FB 3OBAA 1K5NB 3GK8H 1ZLSL 3ABZA 4O58H 5FYJD 1YDPB 5C70A 3RVWD 1MREH 2C3VA 5CEXA 4X4ZA 3MV7E 3V2AR 5DVOA 3RKPA 4JFOB 5ESVA 5TH2B 4KAQL 1JFMA 1UA6L 2Y9RT 1HHHB 5DD0H 1KIRB 5HDQL 5I75B 1MEXL 1A3LH 5CD3A 1QFUH 4OSUL 1AXTH 3R06B 3S36H 3CDGB 4K94L 2QKIB 3FT2A 4JPWL 3ZSSA 1BQHA 3GKWH 4G6JH 4J2XA 4MB4A 4TOYH 1MRDH 4RX4A 3SGEH 1ZT4B 3ULSB 2OXGA 4CW1A 4HX1A 1KIQB 1T4KB 3VXPB 3MGTB 2MCPL 1HNFA 3D2UD 4BELD 3I02A 1T04A 2ORBL 4MA7H 4UILH 2GSGB 4IJ3B 4JPIA 2Y6SD 2QHRL 5JDSB 2EDKA 3T4AA 5FEBA 4FXGA 3MV9E 5JW3L 1AC6A 4PGEA 3HG1E 2NTFA 1JN6A 1LMKA 2O5ZL 3W11D 2FJHB 1DANU 3RVVD 4HQQH 1M05A 4NN7C 3ARVA 1R3LB 4KJPC 5L2KD 3BZFA 1G1YA 1KENH 2W0FB 5E1HB 4KHTH 4KQ3H 3G5XA 5IBLC 1CFNA 4GXUM 2IPKA 3UJIL 1JGEA 2F8XC 1G7QA 2HG5A 3FAWA 1ZWIB 4LSSH 1HH9A 1DQJA 4MNQB 4U31A 1J1OH 4OM0H 4UT9L 4JB9H 3TFKD 3MNZB 1ZVHA 1U3YA 3BXNA 3F7VA 3RWEA 3ARED 2QADC 1JGUL 2FX9H 1FNHA 1NC4A 2A6DA 2NNAA 3QHZH 5BW7C 4TNVF 4N0RA 4ONOA 4EXKA 4ZFFB 5ILTL 2FYYA 4TVPH 1K8IB 4QRQA 5E4EB 3DSNA 4L3EE 1WWWX 2JK5A 4MGXA 4S0SD 4YWGH 2A6KB 4MJ2A 1XFPA 4Y5VA 3F5WB 3ES6B 4RFNC 4XB8A 1FRGH 3LDBC 2QQNL 3BKYH 1NANI 5FUOH 2PXYC 2IADA 1EA9C 3QQ4A 3ROLB 2P8LB 4FG6D 5ISZA 3U0TA 1G9NH 4ENEC 4RMQA 5D6CA 5JIIA 1T3FB 4L8BB 4YDIL 4X6BA 2QADD 1MHEB 1UT9A 4DW2L 1FYHB 5JOEA 4MVBD 4CU8A 1MFAH 1T89A 2F5AL 4L4TB 2EEAA 5C7XH 5ETUB 3GMNA 5D1ZC 1AY1L 3SKJH 3NH7L 5F3HB 3VFOA 3PIQA 4JM2B 1X5AA 5F97E 2DQFB 4S1SH 1JHLH 3IXAA 2NX5E 4Y5YC 3OWEA 4HH8A 2EDWA 4RAVA 4K3GA 4WDIA 2EC9U 4Z18A 3T0AA 3HA0A 3CC5A 1I1FB 4PJIB 4WW2A 4TRPH 4IRJA 5DURB 4KK5D 4JAMA 3TN0B 1I7UA 5I8KH 1X7QA 4HK0A 5IHZB 2B1HH 3OGOE 3WMSA 3WHXB 2X70A 2AJYL 3B9KC 3BP7A 3D85A 4X4XB 3MO1A 1H3UA 1Q1JL 1IGIL 4V3DB 1MLCB 4OD2A 3MV8A 4LSTL 3W0WB 2PCPA 4GUPB 2O5YL 1XGRB 5CD5C 2ARJQ 3QRGH 4R7NB 3MJ9A 3WD5H 2EH8L 3SGKC 5T3XE 1KSRA 4KWUA 2Y5EA 4JFEA 2ZUWA 1YUHB 5CWSA 2OK0H 4NKIL 3VGEA 3PV7A 4BJLA 1PBYA 3KNBA 3MFFB 4NGHH 3MLVH 1AIFA 2VNCA 3CFDA 1CR9L 1VFBA 3EOAB 4JFDA 3UTPD 3N85L 1BAFL 1KLUA 2IMNA 3KGRA 2JELL 2CJUH 2GY7B 3ZKND 4U6YA 2H2PC 4K8RL 2BC4B 2VYRE 4Y2OA 4ODHH 4JRYE 3NAAL 3ZKXC 4H0IA 2ADIB 4NN5C 2GSIA 4AENA 3U4AA 1IEAA 3GJFK 3LKRA 1OL0A 3TGXA 1AQKH 1MVUB 1P2CA 2I9TB 5D2LA 5C07A 4R2GB 4WI8A 4FABH 2LTQC 3BO8B 25C8L 4OBSA 1U42A 4WW1B 2VXVH 3U46A 5CJOL 3L3JB 4P2QE 2FCBA 5ANMA 5IQ7L 2XY1A 1IZJA 5EDXA 4PRNA 3OAYK 2YKLL 3MGOA 4HC1A 3ALWA 1FL5A 3GBNH 4FRWA 3O6LL 2W91A 2VZ1A 1OGAE 2YD2A 3G5ZA 1QYGH 2IC2A 3IDMA 4LLVB 2VAAA 1PX3A 4N0FB 2H2PD 1NBYB 4NBXB 3TH2T 3ILQC 5I16B 3RGVA 5TDNA 3G6JE 5E94A 1J12A 4CJ0A 3V52L 1IQWL 2OQJB 5BRZE 2VLRD 2YPKA 5CINH 5CEZL 1VACA 4HKZA 3OAUL 1QVOA 1IEBA 5CZVH 1WBXB 3IDXH 4ELME 5KN5A 1QUNA 3MV7A 4YK4C 1IC7H 4V2BA 1VFAB 5GS0C 2E6QA 4TULL 2P48B 4N9GB 4Z78B 3IDYC 2DWDA 2DLFH 1EBPA 4QTIL 1K9TA 5DFVC 5FFLA 1WCBB 4LF3B 1P1ZB 4POZC 2PUQT 3VFTA 1UH4A 3CSYA 4OZFG 1KYOK 1R3IH 3V6FA 4Y4HA 3L3KA 1A7NH 4X7TA 3UJJH 1I3RB 4YHML 1NPUA 1BQLL 2FD6L 3VXRB 4HC1H 4QHLB 4ZPVB 4ZNEA 3TESA 1FAIH 1I1AA 4S1QH 1S5IH 3EFFA 3QUYC 3SCMB 4E0RB 1VGEH 4WHTA 1Y18B 2VZSA 3IKCA 2DIJA 1MQ8A 1CXHA 3MV9A 4I3RH 3ARPA 1FNLA 2XZAL 1N0LA 4MA8H 1HCFX 5ADPH 3HG1A 1IM3A 1OSPH 3PWNA 3L3DB 2DMKA 1IC4L 3ARGA 1JWSB 1RMFL 4HJ0D 4POZD 1EEUA 4KKLD 3GSUB 1AJ7H 1CE6A 4KRMB 3BDYL 3MNVA 5AAMA 4ZQKA 3WXWL 1JNLH 4L5FL 4O5LH 3CUPA 5E6IB 4Z7UF 4B7IA 5IKCB 3CD4A 3HR5B 5FYJU 5CP3A 4KRLB 1N3NA 4D9RE 5ESAB 4JRXD 2L0DA 2DQHH 2VR4A 1IAKB 4AL8L 4GKSB 1JK8A 1A2YA 4E41E 3P9WB 1NDMA 2A0LC 3IDGA 4LCUA 2AJXL 1PQZA 4LARH 4M3JA 4ZYKB 3VXOB 1CD8A 4LRIC 1FBIH 5I1JL 32C2A 1B90A 2NZ9C 5E1AB 3JUYA 5IB5B 5JMOC 2JIXA 3QHTC 4TUJB 4KZEH 2EDOA 4IRZH 4U1HA 4N9OB 2YZ1A 3SOBH 4LHQB 4FQLL 4JVPA 1DLHB 4XBEH 4MD4A 4HF5H 3C6LD 5EZIL 4YDLB 4L3EA 1MFDL 1U3JA 5CS7A 3O6ML 3QQ9D 2A83B 3ARSA 2DLEA 2DM2A 4CN4A 4RNRA 4GAGH 1S7VA 3AU1A 5DRWA 4KROC 2I60H 3INUL 4UAOB 5HHQA 1U93B 2HMID 2I5YH 3IRZA 4E42B 3EZJB 5J57B 4KY1L 5CJ5A 3DMMC 4PV9B 1PG7H 3HUJE 1E4XL 4XWOC 1E6OL 3BI9X 3NACH 5FAAA 5LGHL 4UQ2B 1N7MH 4I0CC 2CR3A 4PJDE 1J0JA 1CQYA 2NX5A 3O4LE 4JPIB 2Q8AH 3TO4B 1MI5B 4WU7A 4I1NB 3JTSB 1UB6A 2FWOB 2B7DT 1VEOA 4DN4H 3V95A 4IDLA 5E99H 5C0JB 2Z4QA 1C16A 4BQ6A 4Z7OE 1PKOA 4DCQB 4LBEB 1NGYB 4M7LL 4PJBE 3C5JA 1LEIA 3GSRB 2LABA 1WISA 2ATPB 2HH0L 4HJGB 3V4PH 4M4RA 3U0WH 3U4EB 2BVQB 4RAUB 1FCCA 2CDGA 3CLFL 3P9MA 4Z7QF 5KBNC 5F3BA 3RIAK 1OM3L 1ACYH 3QULA 4OCXH 2ZUQC 1RI8A 3DURA 3TBYA 2GJ6A 3O2DL 3DX7B 1KV3A 5F71A 1EFXB 2YEZA 5EA0L 3D69A 4XNQB 5I1AB 4X7DC 1TCRB 3T09A 3ARFD 1PAMA 2HKFH 4Z7WF 4RGNB 3VXMB 4GG6B 1A1NA 3ARDD 3BUYA 1B2WH 4Z7VF 4JRYA 5DDHB 4PJ8C 4CVUA 4UDUA 4YBLB 4AY0A 4K3DH 1S7WB 4MDJB 4P23A 4X6BB 1CDGA 1S7SB 3RWGA 1OW0A 3CX5J 4FP8L 4P2QA 1RUAH 1A7OH 1G7HB 3CVIH 1KG0A 2OTUB 1DBJL 2DM4A 2Y7QB 1C8PA 1CT8B 1PW3A 3FHAA 1TNNA 4FXKA 4NC1C 2WIIA 4XRCA 4I48B 3RWJB 4MNHB 5D8JL 1OGAA 1VFOA 4BFIB 2DS4A 4JKWA 4U7SA 2FJFB 1FIGL 3TYFA 1FYTB 5JIPA 3EYUH 5T3XH 3WJLC 4HEME 3B3IA 3H7BB 5HHPA 2VZUA 3G6JA 3WIIH 3RDTB 1J86A 2F8OA 2CXKA 2YA2A 5CZKA 2Z9TA 5D1XA 1MCSA 5BRZA 5ENWA 2PR4L 3LS5L 4M61A 3GI8H 2FRGP 3IF1A 4Y2DC 4L9LA 4CUCA 3GM8A 4P2YA 3NFPA 1J0ZA 1HH6B 2XZCL 4ELMA 1MJ7H 5GZOD 3KG5A 5JIHA 4Y4KA 2C4FU 1WUNT 2EE6A 4JFFA 3L5WA 2NY5C 4FFWC 2GQHA 2R1YA 2QSTA 4WWKC 1FFOB 3D5OF 2WWMD 2FO4A 3DXAB 3PQYD 4Z77B 4U3HA 1EHNA 5HHNA 3B2UD 5DZLA 3QDJE 4ZAKA 1JNNH 2P5EA 3E6FA 4XP4L 4RWHA 1I1YB 3SY0A 4OFIA 4X6CE 4Y4FC 1WTLA 3MRHB 1NUGA 3C87A 3TH3T 2D2OA 1TJIH 3B2VH 1NCNA 1U3ZA 4J4PC 3SKMB 3MLXL 2CGRH 4YHKL 2CLZB 4Y2DD 1ZGLB 1P7KB 3PWLA 3GMOB 15C8H 2YUZA 4LHUG 3GMPB 3DMMA 3QEGH 4FQ1L 4YHNB 3K2UL 3L5IA 1RZ7L 5BS0D 5I75C 1D9KB 2GSIB 4LCWE 1IEAB 4NKQB 5HGDB 4WWKD 3O0RL 2IG2L 1YYML 4ONGH 3WFBL 1V3KA 5AYUL 5DEFB 2NXYD 3D3VD 3WNKA 3OKOB 4TPRL 2FBOJ 3FO1A 2FECI 3CH1B 5AWNH 1Z5LA 3HC4H 1BVZA 2YWYA 2KPNA 1MPAL 2ZJSL 4X80H 5C3TA 3RI5F 3MRMB 4YDVA 3GO1L 1JPTH 1IT9L 4LK4A 1YJDC 1A22B 3UTTA 1ZGLM 4IJ3C 4BZYA 4U1IB 5HDBE 2NY3C 3X3FH 1I3VA 4NHUE 4MQTB 4YH6A 1A5FL 2BERA 3E1F1 1RIUH 1FO0A 3Q0HA 3MLUL 4LASL 4P48A 1TPXB 1Q8MA 2PN5A 5I1DA 4QHNB 3IFLL 4P9HC 2R0KH 1C12B 1VACB 4XH2A 4BH8B 1IFHH 4HPOL 2AK1L 2J3SA 2OI9A 1OCWH 3SDXE 3O3DA 5I9QB 3PGCB 1AGBB 3BIKB 3FB8B 3OV6A 5JXAH 1TVHB 1HZHH 5E00A 5E2VH 5J1SC 2OP4H 4KI5D 3EYVA 3CPLB 1MCNA 5DVKA 2R0WH 4P2OD 3DWTA 1T66C 1A6TB 5M95B 3LKOA 1MELA 3G9VA 4LSRL 5MEOA 4PJ8A 4JFHD 1J1PH 1MNUL 3D9AL 1CD0A 3HUJA 1TVBA 5HYQB 1MCOL 4PREB 2VB5A 1BOGB 4H20H 2FBJH 2FDBP 3SO3B 4LRNH 4PRPA 5DJXB 5E4EC 4PLKC 5BVJA 4F2MA 1BEYL 4I3SH 3O4LA 1WIPA 1ND0A 3WS3A 5DK3A 1RJLA 1RJZB 4HH9A 4UDTA 4ZUUA 4NRYB 3VD4A 1FO0H 3ARWA 3MV9B 3B4NA 4GMTH 5C08B 5IESL 5LWYL 4IRSC 4LLQB 2BVPB 2JCCF 1NKRA 5D96B 5GS1B 2C1PB 3QFJD 1MFBL 2AXHA 4PJBA 5DR5L 5EIVA 3T2QA 3PWJA 2H1PL 5C0IB 2CRIA 4KH2A 4AH2A 4XAWH 3SN6N 3T77B 3WJLA 3ULVD 1OTSC 2GUOB 1DZBA 1G0XA 3VFVA 4NWUH 4DGIH 2WQRA 2R2EB 4Z5RB 4JM2C 2VR9A 1OAZH 3BWUC 2CXGA 2EICA 3LMJL 4JO3H 3HZYA 2NQCA 4RISL 1YEEL 1OP9A 3SKOA 3IU4L 4KI5F 4LSUL 2C4XA 4HT1H 4ZOBA 1WWAX 2VH5L 5E5MA 3ECBB 4I18B 5JUEL 1HE7A 4OZFH 3TN0C 1LK3L 3DX8A 3FN0H 1SJVA 3R0MA 4EKXA 1KELL 1A6AA 4P46B 4Y16D 2QHLA 4PP8C 2WW8A 3PWPB 4TUOB 2OL3L 3GSNH 5MEND 2FEDC 3T0XA 4D0BB 2C3WA 4ODXA 1A21A 1XR8A 1IE5A 1TQCB 5I1LB 4PTUB 3VFSA 2E9IA 5F6HJ 2J5LB 3KPOB 3MRNA 3Q1SH 4J4PA 4RNRB 2APVA 5E9DB 2X7LA 5C6TH 1A1MB 4AIZA 4JGMA 3MJGX 4FFYL 4HPYH 4P0DA 4UV7H 5C86A 1YA5A 3U79A 4PUBL 5E2UH 3TN0D 2RCSH 1BZ7B 3HTLX 2VDKL 3O2WL 5KSBE 4GKOA 1DVFA 3OF6A 4G8GE 4XC1H 3BT2H 1BIIB 3LKNB 3IGAA 2VITA 3CZJA 4KQ4L 4WI6A 1MJ8L 4RZCB 5I17B 5I1CL 3ULVF 4Z8FH 3L7FB 3OKMB 1NLDL 1CD9B 1OAYH 4L4VE 5GIRB 4G6FD 1ADQA 2Q20A 1DANT 3O3AA 3W0WD 1JBJA 4OGYH 1NL0L 2R2CA 2VLME 1JPSH 43CAB 4CADB 3TT1L 2WUBL 4YIQB 4FZEL 4NC2B 1MFEH 1GL4B 4G42B 5F9DC 1A6WL 1V7ML 1LEIB 3BSZL 4M6MH 5F70A 4TNVK 1CIUA 1FNEB 2DMCA 5L9DL 3HFML 1QHPA 2Z35B 3JWDL 4Q74A 3MLRH 1EGJA 5FHBH 2LU3A 5I2IA 5H2BB 5TE7H 5EN2A 3S6CA 1M7XA 1OPGH 1UXWA 5EBWB 5IEHB 4PJFE 4KMQA 3HS0B 4JGJA 2M26A 1JTPA 1QRNB 3QDJA 5D7LB 1WZ1L 2HJFA 5DO2D 4WTZG 1TENA 4WTXA 4X6CA 4R2GD 4X4YA 1ZLUK 1R3JB 1JCKA 5F96H 4JJHA 1T7WA 4LCCC 4YHYB 4YDKH 3MCLH 1XGPA 4KJYA 1M7DA 2AJ3B 2R2HA 2AXGB 4ZOAA 3KAAA 1ADQH 1FSKB 1EJ6A 1MFCH 4DVBA 1LE9A 4KK9C 1JE6A 3ESVF 4LCWA 3RA7L 3WE6B 4MYWB 1KEGH 1JZ4A 5JQ6H 5TE6L 4Z7NF 1NCCH 1I7ZA 3GSWA 5DJZB 5HGAB 5INDA 4C83A 4NQCD 3OKEB 2EC9T 4LP4A 4NWTH 3HCVB 4V1DB 4IRSA 5GSVA 2DQGH 5ECJE 4G6ML 1EGJH 3QXTA 3O6FB 4NC0B 2OBGA 1TZIA 4OLZL 4RFEA 1V8HA 5DRXA 3IFPB 4PGZA 1VHPA 4IOIB 5FGBC 1IGML 5JR1H 2BY1A 1CF8H 3BEVB 5SWQA 3SCMC 1RK0B 5FHAH 4NHUA 1L7IL 3HE6D 1NLBH 5DJDB 4OZHE 1CG9A 1ZVSA 2YR3A 2HAZA 3PDOB 1AO7B 3MLTA 1VGKB 1KPVB 5D93B 5FM5O 3MBXH 3RTQC 2NY0D 3NIGF 4G6AC 1FNGA 1ZHBA 2XWBB 5E6IC 3SDXA 1DUYB 1OF2A 5FK9A 2XZQH 4P3CH 4PR5B 3VRLF 4IMLA 1KC5H 1TTUA 2IWGA 4PRHE 3VXRD 5L8KB 3AM8C 3VD3A 3S3PA 5KVGL 4RWYL 2A73A 1RUKL 2WBWB 1X5FA 2R29L 2UZXB 3JXAA 4D9LL 1YY8B 4LCYB 2D7TL 2LFGA 3BMVA 1TETH 4RMVA 4ZS6D 4Z0XB 1YECL 3JTTB 1A6PA 1NAML 1OAQL 5K93A 1FGNH 5EU5A 3TCLA 4FQJH 1MCBA 1FVEB 1G7LB 5SWZB 5IP4A 1INQB 1MHPL 3BVNB 3DYMA 5KANI 5B3JF 5C0AE 4QHMB 3LN9A 1CL7L 4HGMA 2VLJD 1HYSC 3I75B 4ZO7A 4YDLC 4UIMA 3OMZA 5D70L 3V0WL 3WKMH 4YE4L 4JFPB 1AQDA 4KRPB 4K9EH 1MIEL 2I26N 4ORGA 4XMLL 1CGTA 4HS3A 4QTHA 4PRAB 3QIWB 4UAOC 2UUDK 3HRZA 3UZVB 4JFQA 2YSSB 4HXBH 3Q3GB 4HZLB 1QACA 3RVXC 1L0XA 4CVZB 4Y5XB 1KCVL 4R4NC 3G5VA 3HMXL 2R9HC 4P4RA 2XKUA 5KVMC 3MACL 4OF3A 1G7JA 3TO4C 1QR1A 1HYRC 2N7BA 4MJIB 3STZA 3VI4E 9CGTA 3C9NB 3KYMB 5DJ0A 1BJ1J 4PJAF 4ZUVB 4E41B 4OV5A 4LDEB 3VJ6A 5CHNB 5FO8B 3V5DB 4HIHB 1TNMA 1XCQB 1EDQA 5TE4L 2LU4A 2QSQA 4OZGE 2OLDA 4Z76B 3UTSB 2J8UE 3KLSA 3VXSB 4NQDB 5CGTA 3FQXB 4YPGA 4RX4D 3EYOB 2JTDA 4PLJD 1LHZA 1CFQB 2XQBL 5IB1B 1BGXL 5FUCC 1VPOH 5HYJB 3I6LD 1OLZA 3ZYZA 5E00B 2F74B 1AD9B 3CZFA 4TVPD 1OD7A 5I19L 1WICA 1RULL 1MI5D 2CDEB 3S4SG 3RU8L 4KJQD 1INEL 5DD6B 1GPOL 1A6UH 1GC1H 1DLFH 3VMOA 4RCAA 1FH5L 4XXCC 4AMKL 4OZFB 3OX8A 4YQXL 4JKPL 3W9DB 1XR9B 3FCTB 4D3CH 4QRUA 3SE3C 1VFMA 5KSBA 3GSNB 4G8GA 3DVIA 2UV3A 4RGNC 3BDXA 4P5TC 4HWEL 1OVZA 3DUUA 2X6MA 3OKDB 4BKLB 1UYWH 4RBPK 3IJSA 4PJDB 4LEXL 1RJLB 3FT3A 4PFEA 4ZUUB 3OPZL 3HI1A 5HGGS 4YBLC 4P4KB 4PD4K 3FQWA 5GRVL 1NCDL 5FGBA 3G6DL 5HPOA 4NP4H 4QRSB 3VGFA 3FO9A 4G3YH 2UY6A 2R4SL 2H8PA 5IBTH 2D7OA 1NC4D 4D8PB 1QBML 2D0FA 3ZTNH 3R8QA 3V7AG 5E5RB 2P8PB 4LDLB 1NDGA 4MA3A 4M8QA 5KJRH 5JW4M 2UYLA 3VXMD 1ORSA 3RTQA 2AABH 6CGTA 5ALCL 1CDCA 4PJFA 3KJ4C 5FUZL 1CL7I 2G9HB 1TFHA 1GIGH 3RWHA 5CILH 2A74B 3RDTC 3KPRE 5ISZD 2FB4L 4K55A 4XMKH 3BJ91 1RUPL 4KKNA 4KMTH 3Q5TA 1QKZL 3OAZH 4YNYA 3S37H 2DBLH 3M1BB 2FATH 5ACLA 2ICWB 1U6AH 5C92A 3U9UA 2H2SD 2X1OA 1F3DH 2B1AH 3J8F7 4B0MM 1GCFA 5E70A 3GJEA 4Y0GA 4RSVA 3GGWA 4FFZL 4PS4L 4LPCA 1CFTA 3ERYA 3PF2A 4IHOB 5T1LB 1WQVT 4I5BA 3ZSTA 3WS6A 1IQDB 4Y8AA 2VLLA 4YGVB 3QNYA 2VDNH 1OTTC 4IRJD 3VU2A 5IEKA 2NPLX 3RRQA 4HXAH 3VFRB 2XT1B 1Z6JT 5IMOB 3KPQA 1NCWL 1PLGH 4ZFGL 5BZDB 3D85D 5EOTA 3K4ZA 4JO4H 2NYYD 2OR8A 3T4YA 1K2DB 3DUSB 3S3JA 4QOKE 3SHSA 8CGTA 3MV8D 1D9KC 1J05B 4YR6A 1QBBA 1T1XB 4JFZH 3OZ9H 4HFUH 1MQKH 2D9QB 4JFED 4Q97A 3PUCA 1GZPA 5IB2B 1QPPA 4EN3B 4WFFD 1ZVYA 5E24E 3V9FA 4U0QB 5CCKL 3QNZB 4JFDD 3V7AE 2VDLH 3TC9A 2ITCB 2PYFB 2BSRB 5F7EH 1NFKA 2IFFL 1VB9A 3I2CH 1D5IL 2VLKE 3LQAH 3V4VH 4WI3A 3CFBA 3NCJH 5GZNC 3RVTC 2EXWD 2I27N 1U8HA 4NNPL 1MJJB 4PJ7B 4RGMB 1TPXC 4BA8A 2FJGB 3WIFB 5JXEC 1KPRA 5ID1B 4ONHB 5C07D 2EYRB 4WTZA 2BP3A 1SEQH 1RFDL 1WBYA 1Q9LB 2NZIA 4WW2F 1TJGL 5C0AA 3T8XA 5JDJA 3UPRB 5IMKB 2AP2A 1HKLH 5HHVL 1NAKL 1QQDB 1S9YA 3LN4B 2R2HB 3QG7L 5I9QC 4KHXL 4JY4B 3RX5A 2YD1A 4F3FB 5FO9B 2RB8A 2GAZB 5GRUH 3UPAA 3MOBL 5DMGD 1LO4L 2Q86B 2R0LH 5FCUH 1R5WB 4XCCH 4QXUL 1FHGA 1AHWC 2ARWA 2K1MA 3VH8G 1QLFA 3SDYL 3VFGH 3RGVD 1I4FB 1Q9WA 1CD1A 4WJ5A 1GXEA 3MRIA 5C2BH