3WLBA

Hla-a24 in complex with hiv-1 nef126-10(8t10f)
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
274
structure length
274
Chain Sequence
GSHSMRYFSTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDEETGKVKAHSQTDRENLRIALRYYNQSEAGSHTLQMMFGCDVGSDGRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQITKRKWEAAHVAEQQRAYLEGTCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Switching and emergence of CTL epitopes in HIV-1 infection
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, A-24 alpha chain
total genus 77
structure length 274
sequence length 274
ec nomenclature
pdb deposition date 2013-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3wlbA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3wlbA01
3F12A 4GAJH 1D5IH 1T80A 3GIZH 4FABH 1FG2A 5EBWA 1R3HA 2FJFA 2VDPL 2WIIA 1OP5H 3OXRB 1IILE 5TE4L 3O6KH 5HI5D 3IFOB 1E6OH 2V9QA 2NLJB 2W0LA 3NIGE 1I1AD 3IYLW 5JPNA 1D5BB 3DV4B 1I7ZA 1K4DA 4X6CE 1HILA 3FQXA 1NMCB 1LO0H 4N5ED 3GUTB 1GYAA 5AYUL 1FH5H 2Y36L 3KPPB 3MRJB 3EGSB 1N5AA 3IKCB 4WHYG 2AXJA 3CC5B 5HHMA 3S88H 4LCWB 2EXYC 2LU7A 3FRUA 1G7IB 1A7RL 4KK6C 3UDWC 3L9RB 2QEJA 4Q74A 2CDFA 3BZFA 4JHZA 3DTXA 4IRZH 3DWTA 3W9EB 1RUPL 2NXYB 5F89B 5DDHA 1QNZH 1I7TA 5CKAA 4R96B 3MLVH 3RPIB 5I0DA 3FQWA 2IADB 4XVTH 1I9RH 4GSDH 1E6JL 1CXFA 4NN5C 4RGNE 5DTFA 4CU8A 2LTQC 2YPKA 1ORQB 1N59A 4JHAL 3FAWA 3U36A 2Q86B 2XZZA 5F3BA 1JTPA 5D1ZA 2VC2H 4PJ7A 3KXFE 4N9OB 5HD8C 3HHRB 1KIUA 5FO8B 2W91A 3DXAE 4GMSH 5IW1A 5C0DA 1QBLL 3O3AB 3VXQA 3AS0A 3SE9L 4C57C 1KFAH 4J8RB 4BUGA 4NNPL 4P3DB 3W0WE 3PDOB 3TJHC 2BNUA 4I8DA 1QQDA 5KZCD 3L3IA 4U6XA 4N1CA 1KPVA 1BX2A 2FR4A 2CDEB 3AROA 2VZ3A 3VFSA 3MO1A 4IRJB 5IVZA 2C1OA 5SX4I 4PRIB 3CX5K 1FAKT 4LCWD 5FGBC 1P7KB 4MDIA 4JFOA 4S11A 4Y4HB 5D5MA 4UIKH 2DQEL 4X99A 4D2NA 1ETZB 1Q0XH 4IIQC 1T1ZA 1UM4H 4ZS6C 4G9FB 5ICYA 1BWWA 1IGCL 3ROOA 4PJCA 4QTHB 5TDNB 3VU2A 4WIQA 4X6BB 2P5ED 3DUUA 3EO9H 1HCFX 1S7VB 2NY4C 4OLZH 2BZDA 2CK2A 1GOGA 4LSVH 4L8CB 1MUJB 3MPCA 1IGJA 4P46A 1JRHH 3EJZC 1UZ6E 4JDZB 1CLOL 2XV6B 1PAMA 4G6MH 2D9CA 4ELKB 1KLGB 2ATPB 1V7ML 5D70L 3OB0H 3L7EB 4J3OC 2VR4A 3PWJB 4NZUL 3N1PC 1PYWA 1SJHB 4PTUB 2IQAB 3IFNL 4MQXC 4YO0A 4QNPE 4PJFF 4KMLB 3WXVL 2LE9A 3MREA 3PG2A 2VQUA 2WMPA 3LKRA 2PW1A 1INDH 5I1LA 2BCKB 2FGWL 4NRXB 3ULUH 3OWEA 2BVQA 1BF8A 2JJSC 1DJSA 2P44B 4QHUA 4OSUH 2ARJB 3MV8E 1WZKA 2IQ9H 4U1HA 3W2DL 4NQSB 3PWVA 5DJAA 2BOCB 4OF0A 1QLFA 3SDYH 4TPRH 4RNRB 5E2WL 5E2VL 1KT2A 4FZ8L 1T5XB 3F12B 5DMGC 1RZ8B 5C0FA 1EHXA 3HNSL 4OQTA 2QV2A 1IM9B 3CXHK 5F9JA 4YHPA 4DKEH 3SBWC 4BSWB 1L0YA 1GGBL 4MMZC 4FQHA 1CLOH 2NY2B 3MA7A 3RJDA 4MVBA 4PV8B 3W0WA 1XIWB 4FTVB 1VFUA 2X05A 5DJZA 1G6RL 5GRYA 1B0RB 3ARRA 4RAHA 5EO9A 2VLRD 3FONB 4PREA 5GGTH 3Q48A 4KVCL 4ODXA 4FP8L 1B2WH 5J89A 5GSVA 3GSWB 1DEDA 4KV5E 1TCRB 2DQDL 4UDUA 2BNQA 3SDAD 2D7MA 3C08L 1NGWA 4ELME 4J3SA 1HE7A 1I3GH 4P0DA 3L95B 3TIDA 1WTLA 1N0XH 4H25A 3BIAX 3DOSA 5I71C 4D0CA 3SQOH 1IKFL 3HG1A 5GS0L 1N7MH 2HG5A 5I1JH 3GHEL 4ODWA 1EPFA 1RIUL 1R24A 4YPGB 1N3NA 3RNQA 3ZHDA 1JL8A 4U33A 3H3PL 32C2A 1CFNA 5MENA 1FV1B 1RU9L 1WVZA 1JGUL 3LV3B 4XX1G 5HBBA 3FZUC 5DJXB 5E8DL 4NYLB 4PJ7B 5FGRA 3LEXA 3OXSA 5J6HB 5HYQB 4X5XB 4YHMH 4YPJA 1UZ8A 4M1CC 4XMPL 3NPSB 1MPAH 3GSNB 4HUMB 2X44D 1XF5B 2HFEA 3LRSB 1IGMH 4NM4L 3G04A 1XGUA 4PR5A 5E6YA 4BK5A 5DZNA 2YWYA 4X9BA 4U1MA 4I4WB 3S37L 3TBSB 1ZT1A 2MPAL 5D9SA 1KPVB 1TMCA 1A6ZA 5FM4A 3EFFA 5JUEH 2DI7A 1A3LL 3MRPA 1RZ7L 4G5ZH 3OAZH 5IJVA 2RAMA 2CXGA 1UH3A 2ATKB 3CVIL 4XNUH 1A2YB 2BVPB 3KDMA 1GGYA 4HUWA 4P4KA 4IRSD 4RIRA 1K8IB 2GSIA 1CXKA 4QRSB 3U2SA 5B3JE 4ORGA 3DETC 2ESVA 2CLRB 4ODVH 2NX5E 1OAUH 3CXDH 3ZDXF 5EPMB 3TH4T 1J05A 3GSNH 2GJJA 2CK0H 3DIFB 4U3XA 4F9PA 4JJHA 1KNOB 3ULVF 3WV0A 1S7TB 3HKFA 2FR4B 1GSMA 1L6ZA 4G5ZL 3ZTNH 3BO8A 2XQYK 5EC2B 3FN9A 5F1NB 5FKAB 4QCIA 5C6TL 1BD2B 3NPZB 4JY5L 5FV1L 1R3KB 2IANA 4HKXB 2VQ1B 4X7EC 2VZOA 3MROA 5A2IH 4KQ3L 2BNQE 4HG4J 4CADB 4LF3A 2D7OA 1KCVL 3GJFA 4LLUB 1JWUB 5CJ5A 5ANME 1A3RL 3WS3B 1MVFA 5E94B 1UWGH 4ZFGL 4NO2B 3EDDA 1ZWIA 2IJ0C 4K7FB 4XPAH 4X7TB 1GGIH 4XPFH 1N6QL 2EO9A 3B8YA 4P4KD 3TJHA 4GAGL 5DJAB 4K23H 3TJEH 3MV8D 1UM5H 4Y1AA 3CPLA 4WW2B 1FFPB 1A6TB 4PJEE 2ATPA 4NUJB 4Z8FL 1MJ7H 2HJLB 3DLQR 5BOZG 3GSUA 5I8KH 3BPOB 5JOEA 1HINL 1G84A 2WWKT 3QWQB 1T1WB 1QBMH 3MV7B 3TP4A 1KELL 1WQVT 4M7KH 5AZ2L 4P5KB 2ZKHL 4PRPD 1WCQA 2ZUQB 3QFJA 5CJOH 4B53A 1DBBH 4NQCB 4QHLB 2EEAA 4UU9A 5FO9A 1SY6A 4ZXBA 3QUYC 1I8IA 5MERA 3I3EA 4ZOCA 5F71A 1S9WA 1MFDL 4Z7WE 3PWVB 1H8SA 5CEZD 4KHXH 5DMYA 3MRKB 5IB1A 1JNLH 4LLAA 1HHGA 3ARZA 5HY9B 4YIQA 4HT1H 5KSAB 5E8DH 1JRHI 2ICEB 2J6EL 4XWOC 4NRYA 4DKEL 3P0YH 4Z95L 2NX5A 4GMTL 4JN2B 3GMLA 3TJHD 1MELA 1JZ6A 5T33H 3B2VH 2FYYB 4RAVB 1FVDA 3O2WH 3GGWB 3FTGA 4WVRA 4APQC 4WCYH 1XGTA 2I5YH 3PQYB 2PF6A 5B4MD 4OGZA 4PJ8C 4YK4C 4K3DL 4U6TA 3LS4L 5C71A 2UWEA 3IB4A 4XT1C 5FKPA 5AYUH 2WY3A 4Y2DC 1NC2D 1YPZE 1MFEH 4MVBD 5IB3A 2OR9H 3ARDB 3C08H 4MD4B 3BUYB 3HMXH 3KS0J 3VRIA 4V1DE 4XBEL 1FYTA 4MX7B 4YNYB 4MAUH 1ETZA 5FDYA 4DOHE 2VXQL 3KPQA 1A3RH 2BNRD 3G5XB 4DK3A 2FX9L 4MNQE 4RWYH 1A02N 4JQIH 4QHNB 1P6FA 4R97C 4PP2B 3MRJA 2ZUXA 1QLEH 3WHE1 4RWYL 3O8XC 5D5MF 4Y1AE 4JDZA 5CUSH 2Y06H 5HHMB 5EUOB 3UJTH 3QULB 3NFSH 3ILPB 1AGDA 5LWYL 5B38G 4WI2A 5FECB 1FNEA 3S3SA 2I24N 5T5NF 3MLWL 3REVA 3LRSA 5HGBB 1OGAE 2HLAA 4R90L 3DIFA 3STLB 1XGUB 5DC0A 7CGTA 2EDLA 3NCYP 4YDKL 4WO4D 1CDUA 5GIRB 3I6LD 5DC4B 3VE0B 2A83A 2R1XA 4K3GA 5T3ZL 1RZKC 5JDJA 5C0BA 1FG9C 1MLBA 4U05A 5IHUH 2DQGH 3CLEH 1WZ1L 2IANB 3QYCA 6CGTA 1L9MA 4K2UL 1Z9MA 3NCJL 3QEUA 5BZWB 4N5UA 4L8SA 1U3HD 4WI7A 5EU5A 3SE9H 2VLKE 2A6KB 2DM3A 2EIBA 2ZNXA 5D70H 2X4OA 3DURB 5ILTL 5JLZB 4WJ5A 5CJXC 1EEZB 3DRQA 3RNKB 5ERWB 2E27H 3T0ED 1JNHB 1TQBB 2AV7A 2EYTB 2Z8SA 3TM6A 3VXMD 2BJMH 3TPKA 5ID0B 4G42B 1ZGLA 1T3FB 2VDNH 4KJYA 4E41E 1CICB 4ONGH 2I07B 4OD3H 3WLBA 4LSTL 3SDAB 1P7QA 5KSVB 5DFVC 2EH8L 4I13B 4BH7B 1DCLA 5L9DL 5J8OA 1KSRA 4NUJA 2IMNA 1LEIB 4RFNC 3SE4C 4KFZC 4DKFL 3GSWA 4G8GE 5DURD 3RZCB 5K59F 4F3FB 1U8LA 2DDQL 1NC4A 1WBXB 1F4YL 1EFXB 2EYSA 4QYOA 1HINH 3O4LA 5CSBA 2HAZA 2OL3B 1QFHA 3T1WA 1UENA 2Z92B 4F80A 2ZKHH 4JPIA 1CZ8H 3RWDA 2A9MH 4D0DB 2V7NB 4YDLB 1CVSC 3B83A 1L6XA 5AD0A 3EHBC 4X4YA 5CEZE 4HG4K 7FABH 1PYWB 1SJHA 4OZGE 1IL1A 2VL4A 2DYPB 3MYZA 4KMTL 3GSVB 2GKIA 1CFNB 3L5WB 1WFUA 3HZKB 2X4RA 1OSZA 1CCZA 1BLNB 4WI3A 1TCMA 3A6CL 5IR1A 2JCCB 3MODH 4UUJB 4D94A 4GAJL 3H6JA 1OAZH 2JE8A 1GGBH 2B2XL 1P9MA 1OVZA 4C56B 3IETB 3OQ3B 5IOPB 5B39A 1MCIA 1UCBH 4K7PY 4PLKD 4EI5D 4D9RD 1Q72H 1U8PB 4HJ0D 2BOCA 1RUPH 2IPTL 3EDEA 4WFGE 4HV8B 3TBSA 1G6RB 5AZEH 1I4FA 1T20B 5ESAA 3SKOA 3UTSA 1KT2B 2VOTA 3X11B 3SKJH 4WW1B 5CIPH 4OFPA 2I60L 4OCYL 3LKSA 4P46C 4EIGB 1KYOK 4UOW1 1Z5LA 4MD4A 4KMTH 4KC3B 2FIRT 4PJAE 4D3CL 2WWMD 1NFDA 3LN5B 1YNLL 1HKLH 2ESVB 1YY8B 5JOPE 4QHKI 5BO1H 3QA3B 4U1GC 3HLAB 3O0RH 1XIWA 4LKCB 3T0XA 3P9MA 1KEGH 3NACL 3LRGA 4HHAB 3TBTB 4FQIH 4JPVH 1D5MB 4PJAF 3ZDZE 4JKKA 2L7UA 4F9PC 2GFBA 1S7TA 1MI5E 5KJRH 1N2RA 2ZG3A 3VXME 4L4TA 5FCUL 2DS4A 1N6UA 2GAZA 2GCYB 5FCSH 3VFVA 4YHYC 4DFIA 3D69B 1YYML 1CGVA 3HC3H 5FKAA 4TSBL 5T3ZD 1O0VA 4ISVA 3EFDL 3O6ML 4L3EA 3EZ8A 1BQHA 5D7JD 1TVDA 4XNMB 1NFIB 1IGML 4NM4H 5D1XC 3I6GB 3NCMA 2VXVH 4L5FL 4LVEA 3GI9H 1HK6A 2B20A 3O4LE 1OGAD 4DN4H 1YEJL 4KTEH 2A83B 1OGAA 5EU4A 4LVOB 8CGTA 3RUGF 1YQ2A 5FYLE 1JVKA 5HDQH 1RUKH 1HSAB 1VCAA 4NN7B 1H3WM 3V52L 2CRZA 3IFPB 1MCHA 1NJ9A 4ZFZB 3FKUS 3QZWG 4Z7UA 2DQHL 3U82B 4BFBD 3IXTB 5KBNC 1XF5A 1CFQB 5IMLB 3WE6A 4M5ZL 2V5TA 1CDIA 4ZODA 5INDA 5F96H 3E3QC 1X5ZA 3OPZH 4M1DL 3OR7A 2VLJA 4WRLA 3BDYH 4LPXA 4O2EB 3FQNA 4WGVB 1WWWX 3BP6A 1YDPA 4R4NC 1P7QB 2ADGB 2R56H 5IK3A 4OT1H 5HDQL 1U93A 5GZND 4N5EA 4M8VA 1HSBA 1YUHA 5JHDB 1C8PA 4Y0GA 1J8HA 1SJEA 4X6CB 5MERB 1QO3A 5K59E 1L7TL 4DUXA 3U2SB 3CIQA 3NFSL 3T8XB 5EBLA 3OMZA 3P4LA 4GG8A 1X5FA 1OD9A 1Z2KA 4WHCA 2MQ3A 4M8QB 4FQQB 3FN3A 4MQ7B 2DB8A 5F6HI 1JP5A 4QYOB 1DQDH 4YDLC 4PLJD 2FL5A 2FECI 4P9MH 5KG9B 4NRYB 3G6DL 5H35B 3VXUE 1SBSL 4AENB 1G9NH 3O41A 4FTVE 3W2DH 4K9EC 3GGWA 4HK0B 2J6EA 1YPZF 4GQ9L 3VI4E 5CD5D 1JPST 1U8OB 2IG2L 3GSVA 1BFVH 2QLVB 1AY1L 5I1AB 4NFBA 5DJ0B 1X44A 1TZHA 3GMOB 5E94A 3SDXF 2YD6A 3LQZA 3CXDL 3HI5L 4ODSH 3PNWA 5FDWA 4X7TA 5C0CB 4PB0L 2DM4A 1EAPB 2CMRH 4X5WA 4F2MB 2ICWB 1KPRA 5L2KA 3ARFC 2ESVD 3QUZB 3RWDB 3MRFA 1TJIL 2HTLC 3C9NB 2WWKO 1RZ7H 1CDJA 2DMBA 5AD0B 1A6WL 1YEHL 4WDIA 3RL1A 2UZYB 4QHNA 4CU7A 4Z7NE 3BKYL 3KLAA 1J5OL 4D0BA 1M4KA 1AJ7H 1FL5B 1A9EB 2AW2A 3VW3L 3FHAA 1JNLL 3MUJA 4Z7WF 4HUNB 4I1NB 1L7IL 2JCCA 5ICXB 5E4EB 3E3QE 2A6JB 4PS4H 1TXKA 3T65B 4C56A 4O5LH 1CFVL 1X3DA 4G7YH 3NTCH 1PX3A 4HUUA 2DL9A 2UZIL 1V8HA 3O6LL 4P5TC 4EDWL 1U8PA 4MAYC 1RZIB 1QRNE 4K94C 2Y6SD 2C4FT 5HSFA 1X7QA 2MHAA 3N06B 3BI9X 1OARH 5DSCA 3KYMA 5IIEB 4PD4J 1S8DA 1OTTC 4X4ME 3ULSA 4WEBH 4Y5VC 4ZSOE 3S7GA 4EIZC 1MFAL 3BQUB 5T33L 3QEUB 4FXLA 2D7NA 5EU5B 1ZS8B 3HNVH 3FAXA 4JR9L 3SGJA 4AIOA 2RGSA 3ZKSD 1WT5A 4LGSB 3O6LH 5EULV 2X1WL 1K5NB 4FMKA 1ZHBA 1U8MA 1MWAA 3L5XL 4J1UB 4O02L 1R3IL 4JDVB 3DX8B 5ADPH 2DQTH 4NHCL 4L3AA 2BC4B 4J4PC 1ONQB 4HULB 3ZKNC 2FHFA 3QFJD 3K46A 5GSRA 4E9LA 3BUTA 4E42B 1ZXQA 3VFMB 1DQML 3MLZH 3U0WH 2JB6A 4G6KH 4NQTA 4WEBL 3ULUD 1FYTD 4I9WD 4NQDD 2WIMA 1BQSA 4ISVB 1CGWA 4PLJC 2DLFL 2LVCA 2EDBA 1OTUC 4N8CH 3HMWH 5I8CB 2V2XB 3MJGX 4KROB 3G5XA 4JM2A 1OB1B 4U0QB 4EBQH 4NNYA 4OLYL 3GZKA 1OAKL 3VA2C 1CLYL 3V5KA 1FL3A 1EFXA 2ZJSH 3EOAB 3T2PA 4JO4L 4YBQC 1HQRA 3DVNB 1BBDL 1A7NH 3DETD 1AGFA 5DZLA 5T1MA 5L7XH 4PJ5B 3QR2A 4EUPH 1T83A 2NY5L 1EHAA 2XWJA 1BBDH 1XGPA 3ARXA 1HIMH 2NNAB 4KU1A 1DN2A 1MHHB 1MRFH 3MLSH 1IL1B 1IFHL 3QWRD 3GFUA 2W0FB 5I1KL 3PWNA 3Q5YA 3OZ9H 3PV7A 2FZ3B 4HPOH 4YWGH 2GTZA 3HMWL 3ARFD 4QRQA 1QA9A 5E2UL 1EHLL 1YEDA 2ZOKA 4NO0A 4YLQT 1GVIA 4WHDA 2ADGA 3DARA 1JNNL 1VGEH 2AQ2A 1P4IL 1TJIH 4HWBH 4JQIL 1MLBB 3UTZB 3V4UH 1WITA 4LCCA 5SWSB 3VRLF 5E70A 1FFRA 2QJDA 3H9SB 2DKUA 3OB0K 5HJ3B 4GG8B 2NW2B 4P2QA 3SKMB 5HHQA 2VIRB 5EOTB 2X70A 4LIQE 1FIGH 3R06B 3L3DB 3C60A 1INQB 3GO1H 4BKLB 3F7YB 3KPTA 4NNXA 2ICWA 3R0MA 1P7HL 3QQ4A 4UTAL 1UVQA 2P24A 5D1ZC 5E6ID 1NCBH 4GKSA 1N7ML 2FO1A 1RZGB 4XBPA 5ICZB 4JAMB 1GRWA 4DGYL 1X4XA 5FA4B 1IT9L 4ELMF 1Q8MA 1ED3A 2QQNL 3WUWG 1A1OA 3I75B 1S7XA 3NFPA 4F3FA 2AEQL 2CKBL 4I3SH 2CRIA 1UQSA 5D7IA 4FXGA 1WAAE 2JELH 5HYSB 3KR3H 3FFCD 4GS7B 1N2RB 1U8IA 5FYKU 1NBVH 2AEPH 1ZEAL 2P45B 1LO4L 4LSSH 1DQQA 3U0WL 2XICA 4ZPVA 3QFJE 3TO2B 3F58L 1X5YA 3H9HA 1VHPA 3QIWA 4PG9A 2BFVH 4X80L 3P9LA 1BECA 2VKXA 4D0DA 4CJ0A 4XNMA 3S37X 4TSAL 2DQTL 1ZT4A 4NHCH 4ERSH 5C0JB 1MCOL 3I6GA 1NAMA 1CIDA 1U8QA 1K9TA 3L5XH 1GAFH 5GGSA 1T1XB 4H88L 1RPQA 2OZ4H 3OBAA 4JFYB 3C8KA 4V3EB 4OCSH 3NCJH 2XNAB 2ZCKH 1KIPA 2PYED 2WBJB 1H0DB 2ZG2A 5IBLD 3U48A 3TN0C 3VDAA 4M9OA 1X5KA 5IHZA 2B1HH 4LARH 4MXQD 2KZ1B 5DVLA 3EJYC 1OARL 3BHBA 5TQ0H 4TNWK 4Y4FC 3RGVA 4FQ2L 1BJ8A 1XR8B 4JZJC 3ZKMC 5EZLB 4QOKB 3L1OL 1FZOB 1YJDL 2GJZB 5J13C 1KEGL 5L2JA 4LMQI 4FFWD 1N0XL 4KRNA 5EC1A 2VLJB 2VAAA 2QADC 1BJMA 5E5MB 4UQ2B 4EQ2A 3WFHA 2E6PA 4LLDA 3L3HB 2NLJA 5GS3A 5JPNB 5D2LB 5EORL 5DRWB 3E2HB 5FA3B 1KG0A 4O51A 4OLWL 4ENEC 4JM2C 4YUEL 5ENWB 5GGTL 5BCAA 1P4LB 5JXAL 2OI9A 4JZOA 2AVGA 1C08A 1OP9A 3F7RA 1S8DB 2PETA 3VRJA 3QJFB 2EEBA 4PRPA 1FYTE 2V2XA 4XP6H 3EOBA 5H37G 4URTB 4Z77B 3CFCL 5F7HA 4EUPG 25C8L 2AJUL 2R1WA 5J9PB 3RKPA 1EZVX 2J88H 3D6GA 1N4XL 3K4AA 2WM0A 4LSVL 3BZFB 4OAWB 3VWKB 5H35A 2F19H 1J8KA 4G3YH 1II4E 4PJBB 4L4TD 4JZNA 2GAZB 3O8XB 2VE6A 3VFVB 3X3FH 4QXUL 1MHHA 2AJXH 2W9EH 3KNBB 4NQUA 1J0JA 5GGTA 5SWZB 2ZCHH 3C09B 1SHMA 4R6UA 4MJIB 1I1YA 1ZKAA 3ZE0E 1ITBB 1FVCA 1U2CA 4M1DH 1YEIH 3TZVB 4ZQKA 2Q8BH 4QRQB 3PGFH 5CP7A 5IHLB 4MD5B 4PRID 4PJCE 1IAIH 4U1KB 2WQ8A 5KSBB 2YEZB 1EAPA 4MCYB 4R26H 2ORBH 1U58A 5FUOL 2BNUB 3VDCA 1KPRB 3QEHB 3OF6D 2DQUL 4OZGF 1EXUB 3S34L 4R0LA 1KIRA 3EYUL 5F7EH 1W0YT 1GAFL 5J1AB 1BX2B 1F3JB 3ETBF 3O3EA 4YHIA 4MS8C 5FYJD 1MAML 1JRHL 5EO0A 1ZLVH 4MA7L 2VDLH 1XCQB 3WNMA 2VNCA 3R06A 5DUPL 1KACB 4PRDB 1JWSA 1E27A 1IARB 3QNXB 1U8JA 1U3YA 3TNMB 3QRFM 2WZPD 2R9HC 4G9FA 5ICYB 4ONGL 2H26B 1QA9B 3EFDH 3QQ4B 4J3XA 1IGCH 3GSOA 4JFEB 3TBWB 1JI2A 4PJHA 1JYVA 1HSBB 4I5BB 1U91A 4ALAH 43C9B 5TPWL 1PKOA 2AV1A 4P9HL 4U6YA 1K2DA 4JO3H 4MB5A 5CZXC 5E00B 4CMHC 3NFNA 3H9SA 3TCLA 2UZXB 1KIQA 4MQ7A 5F88A 3MBEB 2H2PD 3MRHB 3QZWA 4YZFF 4GS7C 3ZE1E 1WAAA 3GO1L 4PRPE 1Q9WB 4PTUA 1JPSH 4NQCE 4H26B 2F54B 3GKZA 1WEJH 1KXVC 2CDGA 4OZHE 5IBTL 1KJ2A 3LKRB 4JJ5A 2J8UB 4JZJB 4QOKD 4QRTA 3FO2B 2BJML 2XKSA 1ZHBB 5HHOA 1CF8H 1ED3B 5LBSL 5TGBA 1EA9C 4S1SL 2E7LC 5BXFA 3CFDA 1MCNA 4OI7A 2X4TA 3O45A 4KQ3H 3UZQA 3BZEA 3BPLC 2XZQL 4FXGB 4I18A 5BVPL 3QDMA 4JKMA 3KPMA 4YH6A 4YE4H 1XF3B 3HNSH 1DZBA 5I74C 2VL5A 3C9NA 1NGZA 4JCLA 4W6YB 2VAAB 1ES0B 1FNGB 3UO1H 1QRNB 3K74B 3LY6A 2LTQB 3GMPA 1S9KC 3QQNA 3BMVA 3WNPA 5K9KB 1A9EA 4OCYH 4WEUD 3WLWD 3BSZH 4LVOC 1QP1A 1T2QH 5MEND 5EG6C 5ICXA 5GISL 5D1XB 4HCRH 4JY6B 4ZYKB 2GHWB 5EWIH 5IB2B 4MJIE 5DK0A 5F1IB 1UB6A 5C0EA 1MHEB 2GK0A 2Q3AA 4NZUH 4N0YH 2HWZL 4XCFH 4BZ2L 4K3JH 1E28A 1R0AH 4NRZA 3OAYH 3OKKA 3VGDA 1Q9LA 1DSFH 2YR3A 8FABA 4WW2C 1JFMA 1CF8L 1Q72L 4JFDA 1FPTH 4Z18A 2NY3C 5KVFH 4CKVX 1JUFA 2FBJH 3TO4A 3WDHA 5ENWA 3NGBC 2EH8H 1CU4H 4UIMB 1EO5A 2NXZB 3VFPB 1JK8A 3QUYA 5DJXA 2UYLB 3QIBA 3E6HB 3B3IA 4MJ6B 5IBUB 4GUPB 3TN0A 1MCWM 1ZHNB 1EUTA 3KGRA 3GB7A 3GJFK 5ILTH 4OJFL 3T4AB 3LD8B 3MJ8B 1TZGL 5I16B 2MKWA 4O58H 4MCYA 4PR5B 3TIEB 2VR5A 5IHUL 2VZTA 3PP4H 4H1LG 4P9HH 4Q0XH 2EDRA 1A6UL 1MHCA 1NUGA 3QNYA 3NIDF 2JJUA 4QHMA 2AI0L 4JAMA 5EOQH 4QEGA 4RFEB 3SDDB 2AXFA 4QOKE 3LEVH 2DJ4A 2VZVA 1TZIB 4M7ZC 3JTSB 2OS7A 1SMAA 3MV9E 4PS4L 1KTLA 4NNYB 4XVUC 1Q1JL 3WFDL 4MA7H 2VXSL 4K9EH 3BPCB 2VDOL 2VZSA 5MP6H 3ULUF 1A1MB 3N85H 3O2DH 3TO2A 4AMKH 3QIWB 3SCMA 3PWPA 2V9RA 4U0RB 1T0NB 4DCQB 5DEGB 1GC1H 4FFYL 4QRPB 3X13B 2ERJC 4XNQB 2AABH 3X12A 4GW4A 3SE4A 4B7IA 2P47B 5EC2A 2P7TA 3HCVB 3RX7A 4LCIH 4PY8I 2R0KL 2Q8AL 1G1CA 1MLCB 4OV5B 4U6HA 1RK0A 1H15B 2R29H 4M00A 1NC2A 4NBYB 3U7YH 3WIHH 2J1KA 2JK5A 2VABB 3IDYC 3TEUA 1U91B 1HKLL 4YGVB 4JFFA 4KWUA 1I7UA 4F8TA 1WBZA 1A7PH 2QQKL 5KVGL 4JRXD 1GGUA 4UT6L 3Q1SH 2QHRL 5E00A 5ALCL 4XHJD 2FLBT 2NTFB 3SDAC 5DJYB 5HYFA 5HHQB 1XMWA 4G6AC 1CE1H 3OKEA 3BKML 5E24E 4Z7WA 4OF5A 5HHVH 3WIIL 1T21B 3DV6A 1XF3A 1RJCA 3C60B 3HZYB 4B50A 2R2EB 5DD0H 4JANB 3H2WA 1DQDL 1D9KB 1M05B 3G5ZA 5GRJH 2IBBA 1JYWA 4N0YL 1YMME 2Q1EA 3QNZB 3CH1A 4KI1A 4UDTB 1UXWB 4E5XA 1S7SA 4JO1H 4HWZB 5L88L 2NR6C 5E2TH 1VFMA 1AGEB 3MODL 4LCWE 4WHTB 2FD6H 5E4EC 2YKLL 3DJ9A 2HRLA 4N1HB 1FIEA 5C0AB 2NY7L 1FP5A 1WK0A 2BRQA 2CK0L 1I8IB 3WN5C 3O4OC 1IKNA 5HYSA 4JQVA 5I17A 4JFQA 3SGEH 1KF9B 5CZXD 3ZMRA 1NANH 3BGFB 5JNYB 4M02A 1MAJA 5EUKB 2I5YL 2WAHA 2J5LC 3E3QA 4ESKA 5TE7L 4XVJL 4OKVB 1JF1B 2JIXA 5F9DC 5L0QB 4U1SB 4Y4KC 4XCEB 5GGUA 3VXSA 3QUZC 3ARFB 4MJIA 3GMQB 5HVHB 4A6YH 1U3HA 4S1QL 3E1F1 4HWNA 4R4ND 4HUVB 3NZ8B 3AB0B 1F13A 1A6PA 4GW5A 2FYYA 4MD5A 3UJIH 3T0EA 1GC1C 4WFHD 2WBJA 1H8OA 5DMJB 4PJ5D 1QPXA 1WICA 1IEHA 4XP1H 3RDTB 5DJ8B 4RMRA 1JPFB 3FQRB 4U1NB 1JMZA 1AQDB 4JM4L 3MUZ1 4M7JH 4H1LH 3VD9A 3RPKA 2C1PB 3QDGD 3BUYA 1YMMB 5DD3H 3OKKB 1IZJA 2ADJA 1YYMH 3V7MA 1IAII 2Y07H 4UQ2A 3K7UA 3VFWA 4PRAB 3RX5A 3ARUA 3OAUH 3G9VA 3T77B 1EEUA 4L8DA 3QUXA 3UBXA 5D2NE 3JWOC 4XCCH 5IW6B 1KG0B 2VDRH 5DTFB 1WWAX 1MHCB 43C9A 2NY4B 3ZO0A 1KCRH 4KJWD 1LQVA 5E2VH 3M1BA 5DRZB 4U6VH 2YS4A 5IUSA 1M71A 1B0GB 3L3JA 3QIUD 4HK3J 1F42A 2IAMA 4ZO9A 2YOCA 4X4XA 1SYSA 3KPLB 3BE1L 1EGJH 4HH8A 2AK4D 1DFBH 4TUOB 1C16A 4ZNEA 4J23A 1E6OL 2E8ZA 3SDDD 3C2AH 3MLWH 2HTLD 4H1LB 2OYPA 3QCUL 5I2IB 4X7SH 1G7QB 1U6AL 4EVNB 3SQBA 5L88H 4FG6C 1XCTA 4G6AD 4QRTB 4E41A 4IS6A 2CO7B 4JFZL 4ONOA 3PXHA 3CFBA 1F45A 4XNZC 2F74A 1HYSD 3O45B 2JJVA 2OQJA 1YYLH 3D2UD 3WJJC 1U0QA 4L8SB 5IFAH 2HYMA 4OCMC 5LAXB 5FUCC 4AK1A 3SJVE 4DKAA 3VI4F 3L6FA 4PJAA 4S10A 1ZTXH 4MQTB 4X0KA 2OTPA 3BT2L 1P53A 3SGKA 5DWUL 4NGHL 2FGWH 1WBYA 3ARGD 3VD4A 4K7PX 2I07A 2YWZA 1AY1H 4OM0L 4NJ9H 1RZJL 2R0WH 4LAQL 3BD4A 3CVIH 4XNUL 4LEXL 5D1ZD 3TNMA 1E4WH 1OPGH 2NY3B 3EYVB 2BMKA 2G2RB 2X7LA 2QTEA 5DD5L 4YHYB 1CD1B 1NC2B 5C0CD 1SVCP 1V3KA 4OFIA 3OKYA 3F5WA 3HR5B 3NZHH 5IMKA 3CLFL 4LIQL 3VFOB 8FABB 2QL1A 2X4SB 5BMFH 5LVEA 4ZNCD 3F8UB 4EI5A 1A7QL 5BZDA 4Y16C 1RVFL 3D2UA 4EXKA 4ZPTB 1CLCA 4ZD3H 3DV4A 4LPVA 5E9DD 4KHXL 5CKGA 3QUML 5LXGL 1P2CB 2VH5L 1T5WA 1DR9A 1AI1H 4H26A 4Q58C 4Z7UE 3AY4A 1SM3L 4Z6AT 3L7FA 5E08H 3GUTA 2E9IA 4JGMA 4F7PB 4L4VA 4A6YB 4DUVA 3KLDA 5TQ0L 2N4IA 1FO0B 1YMHA 2Q7YA 5I15H 4J3UA 5I74B 1REIA 4IRZL 4J3WA 5IOPA 4P2RE 1TNMA 4TTGA 5T1DH 5C0AE 1JI1A 3VGEA 1OAYH 2CKBA 5L8LB 4XHQA 2AK4E 1KENH 4WI6A 3ZKMD 5EZJB 3T0EE 1BVLA 4Z0BH 4G9FD 5K9JH 1TJHH 1S3KH 1P6AB 2HT3D 2G75B 4PRBB 5BJTA 4PJ9A 4KRPB 2M1KA 3LKPB 1IGFL 4JFOB 1P9MC 2C9AA 3V8OA 3MRIA 4AIZA 3DSFH 5EN2B 5TF1H 4IRJD 3D5OF 5TE4H 2EKSA 1PDKA 3TA3A 3T77A 4QTHA 5SV3A 4Q9QL 1EV2E 4YPGA 5IESL 5DJ6B 4G8IA 2NYYC 4M5YH 1I8KA 4G8FB 4G8EB 1B4JL 1IAIL 1OD7A 4OM1H 1J0KA 1T6VN 3VGAC 4XCYB 5EU7E 3LPWA 4PY8J 4O00A 2EDYA 3EGSA 3BPNC 3MRBA 1F2QA 1DTUA 1AQDA 3LKOB 3FRUB 3KPSE 3VFSB 4HBCL 2AS5M 1I9EA 4NQDB 1JN6B 5TH2B 3DX9A 1ZLWK 3PP3K 1Q9LB 3FT4B 5IGXL 4RDQG 1C16B 1KC5L 4F8QA 3SGEI 5DDHB 4Q2ZB 1BBJA 2H32H 3IFOA 3TVMC 3EYFA 2HJFA 1RK0B 5EIIA 3PL6A 4FS0A 3THML 1NLDH 3UO1L 3BN3B 3O9WA 2GUOA 4ZAKD 4NSKB 5IJVB 3GIVA 3QI9D 3K2UH 1TQBC 5CIPB 5IB5B 3FT3A 4LHQB 4RIRB 5C0GA 4JCMA 1YN6A 1G7IA 2X09A 3HC4L 5ISZB 3A6OA 2CLRA 3ARQA 2EYRA 1P4BL 3NA9L 1F4WL 5D2LF 5IB4A 2GTWB 1KCUH 4OLZL 1AIFB 5TFSH 2WP3O 4WWKB 3SJVD 1C5CL 2XYCA 4RA3A 3H9YA 3JV6A 2NY6C 3PWUB 4DJMA 1I1AB 2DKSA 4S0SD 2AERT 4C55A 1N64H 3HN3A 2PW1B 3HFML 4H8WH 2IF7A 4JHAH 5I1LB 1DVFB 2IAMD 4LVNB 3B6SB 4YHZH 3PV6A 4PV8A 4JG1L 3N9GL 4V1DD 1TZIA 2VR9A 4X6CA 1F3RB 5KANG 2GSGB 1B0RA 5EO9B 4XAWH 2HN7B 1WJ3A 5IMOA 5I1HH 1AD9B 1MI5B 1MWAL 5F93C 5F96L 1KBGL 2KKQA 1CXHA 2BNRE 5KSAC 3K8LA 5TDNA 5C08E 3C60C 1JGLL 3N1GC 1HQ4B 3MNVA 3T0BA 3QG6A 4OFDA 3UTQA 3HI6H 5CEZL 1QBML 4PJHE 1MWAH 1T2XA 4NNPH 5H94B 3H3BC 2JIXB 1ZWIB 3WCYA 5F7FA 1MUJA 4GG6F 2X4PB 3GMRB 4U6XB 5C09A 4OGAD 5DMGD 1F6AB 3LH2H 5JXEA 1P1ZA 5AUMA 1EZVY 2YMXL 4G9DA 5JORA 4BSJA 1RIHH 1BFOA 3GSQB 2VAJA 2VRAA 5C9KA 4AEEA 1KCUL 5TFSL 3QFDA 5DUPH 3U0TB 1PJ9A 5I1AA 3EYVA 1M7DA 4HGMA 1AHWC 4LP4A 3MREB 4P9HC 2NY5C 1MIMH 4LSRH 3C5JA 4NN7C 4NYLA 4R9HA 5FYKE 3DO7A 3VW3H 2FJGB 1AP2A 1RUQL 2FJFB 3WNOA 3VMNA 4BQ6A 3QG7H 4AT6A 4C56E 4YAQA 4HD9A 4NZTL 1EEYB 3WN5B 1W72H 3FRPA 4E0RA 3FB6B 3MRQA 3MV9D 1F3DJ 4NZJA 3ZE2F 2DQGL 4XH2A 3RKDD 2ZOLA 4GXVL 5C6WH 4NUGH 5LKNA 4CMMB 2EE6A 1U95B 1ACYH 3SPVB 5F7DA 2PYEE 3MRMA 3PE9A 3SDYL 2VDKH 4IRSC 3EFFB 2DLTA 4OD2B 1T5WB 3L7FB 4ODSL 1D6EB 3ES6A 1NAMH 2OJEB 3VXMB 4AIZB 2E7CA 1MCLA 2Y36H 4N8VA 2D03L 1ZHLA 3WUWB 1AGEA 3ILQD 4HXBH 2NY7H 4UMGA 2V17H 4TUOA 3RZWA 2Q87A 4RBPK 4X6FA 4JG0H 3O6KL 2NZIA 4G80A 3MV7D 5E0QA 5TQ2L 3SGDI 2XN9B 2YUWA 1P69B 1LP9F 4UDUB 3D3VD 3QCVL 4Y88A 5JNYA 4OZGB 1AO7E 1G7HA 2XZQH 5HHNA 1ZMYA 3CFCH 4OM1L 2JIXD 3PHOA 1L9NA 4PRBA 3V6FA 4RMUA 1Y6MR 2AJVH 2Q7NA 3KHOA 4TOYL 2VXQH 5GRUL 3WNNA 4HUVA 1ZVYA 5LCVH 4ODWB 3AXLB 3IXAA 4WENB 1ZS8A 3R8BB 1MFCH 3WSQH 3KPNB 4MNQA 2QQKH 3G08B 1MQKL 2Y7QB 4FXKB 5A16A 1N5YL 4M7LL 1KXQE 1P5UA 1WWCA 4J1UA 5HGDA 2VDKL 1A7BA 3VXTB 2NXZC 3FQRA 4K3EL 3V0VB 5C7XH 5TF0A 3UTTE 3M8OL 2XZCH 3AM8A 3MO1B 4IRJA 1FNAA 4U3HA 3LQAH 5LGJA 3RP1A 2H3NB 5C9JB 2ICCA 2N1KA 3RAJH 4LPYA 1V3LA 2APWA 4HFUH 3CX2A 4M5ZH 4GBXA 4V2BA 1OCWL 3IU3B 4UQ3B 5KS9E 5T1LB 5T1KA 1MRCH 1SM3H 4J2XA 1RMFL 3EUUA 2N7AA 1CBVL 5I8EB 4HMCA 2IBZY 3PQYE 4HS6B 1FNSH 5MEOA 5CILH 1MCEA 3NTCL 4G7YL 2VYRE 5C0BE 4OUOA 1DN0A 4L8CA 4OD3L 5MENB 5DRNB 4XVUD 1LO2L 1AGFB 4ZUVB 1K85A 1GOHA 1S7RB 3CSYB 3MRLB 2IPUG 2DQFA 3ZLQC 3JV4A 1MFDH 1RI8A 3ZSSA 2O61A 1LO4H 4C83A 1S7WA 3CMOH 1URLA 1QRND 2IH3B 4MJ4A 2VLKD 3CD4A 4JHWH 2QHLA 2HFEB 1KPUA 4YIQB 5BS0D 3ALXA 4L4VB 4YDVB 1HHHB 4ZAKA 4MLSA 4NZRH 1JGLH 1A4JB 5C1MB 4RAUB 4MWFA 3PGFL 3GMLB 3GI8H 6FABH 5K9QI 1I8MA 3UBXG 2GYSA 5B8CB 4NO5B 4Q6IC 5T3ZH 1P1ZB 4LSQL 2C4FU 1FNLA 5D2LE 4F7EB 5JORB 4UTAH 2ARJA 3SOBL 1T7WA 2AJSH 2XG5A 4NKDA 2YD1A 1UKTA 1X6NA 2CGRL 3MOQA 3V4PH 1NGQL 3S96B 2OMNA 3TFKC 3CK0L 1MVUB 2K3TA 2AJ3A 3UEZA 4P4KC 3MNVB 5JO5B 3C5JB 2UWEB 3QXTA 2H45A 4NQCD 1MCSA 1DLHB 5IB3B 3RTQC 3BH8B 4LQFH 4PY7A 5BRZB 4S1RL 4HXAL 4JPIB 4YNYA 2LQRA 1F3DH 4L3CA 2IPTH 3ET9F 5DF0A 1PKQA 1C5DA 2YK1L 3BQUC 2YRLA 1EEQA 5IFHL 4XH2B 4X98B 3MBED 1CDHA 1FGVL 2YXFA 4WFEE 3FONA 5EU3A 2CIKA 1OTTD 5F7UA 1HHJB 2XA8L 5KVMC 1KCSH 2EXYD 3HZKA 4KK6D 5L2KD 2PKDA 1UYWH 4KROC 4I0KA 2BHUA 4E41D 3MV9B 4N8VB 2FJHA 2VLMD 2OR9L 1W0WA 1JN6A 3F5WB 2NY2C 3MXVH 2DBJA 4K7FA 2DQEH 4BSVA 4FFVD 3QRGH 4PG9B 5I73C 3VRIB 3MFFA 2DOCA 1DBJH 4LLMA 3D0VA 4LOUC 1DLFL 2HLAB 2PW2B 4W6WB 5HVHC 5I1IH 2ZOLB 5IFJA 2WK2A 1UGNA 4HS8H 4TULL 4XP9L 5SWSE 2V5SA 4KI5E 3C8KB 3ZYJA 4PJXA 1HKFA 4OF7A 4IIQB 5I6XB 3MV7A 1ZA3A 2P49B 4Y7MA 3C09C 3PGDA 3KLHC 3FB5B 3LN9A 2NY3D 4BUHA 4HT1L 1CVRA 3CFEB 1I7RB 1S7QB 3Q2CA 2EYRB 2YUZA 3I9GH 5FO9B 4HIEB 3MACH 3AM8C 4DZ8B 4RA0C 2FX8H 4JFFE 1JPTH 4K8RH 1RZJC 4MXWL 4JN1L 1V7NH 3IJHA 5HGHA 4Z7VA 4LSDA 3WMSA 5D2LA 2NQCA 3LH2L 2ICWJ 3EHBD 3ULVH 4L4TB 4XZUB 2VISB 4XP9H 4ZTPL 4LKXB 4N5EC 2VDML 5B38B 4JN2A 3SDXB 3WL9A 4KY1H 1RD6A 3RTQB 2ZUSA 1OAQL 1F6LL 1HQ4A 1FVDB 4BQCA 1AXSB 5KAQF 3NBNA 3HNTL 2VXTL 3D25B 4WWKD 5C8JA 3MRGA 4GAGH 1Q9OA 1Z6JT 3ZDYE 3NABL 1JHKL 3PQYA 1UG9A 3WD5L 2HFTA 5D7KE 1ADQA 4OZIE 2ITDB 3QISA 1IC7L 3MLXL 5ISZD 3MRLA 4HPYL 1V7NL 1OLZA 1FNFA 4NFDA 3SE3A 3ZL4H 5J13B 3HZMA 3D3VB 4XTRD 1C1EL 2LU3A 4BH7A 3VXRE 2CRYA 1PFCA 2CR6A 5DFTA 1IZKA 2ID5A 2C3VB 2IH3A 4TSBH 4IDLA 4CVXA 2PCPA 2VLJD 2A6IA 2BX5A 5JW5B 3JSSA 4MVBC 1MAKA 4DAGL 3OB8A 1KGCE 1OSZB 3RZCA 4HIHA 5CEYB 2P8PB 3WS3A 4RAUA 3DMMA 1TPXB 1YDPB 1F5WA 5IBUG 1WLHA 1FN4B 1OSPH 3GIVB 4GBXD 5DRNA 5KVGH 1TDQA 1XGYH 4JQXA 4YHNA 5ADOH 4OSUL 5H37H 3FO0L 1J1PH 2A6KA 4R7DB 2EDNA 1AGDB 3BP5A 2X4NB 3H0TA 1INEL 4GLRI 5FYLL 1JV5B 4P3CL 3VXUA 4BFEA 3EKCA 2MNUA 3R0NA 1ZVSA 3PWUA 4ZUSA 15C8L 1RHHB 2XXCB 1YNTA 5EZOL 3IAQA 1FLTX 4WO4C 4FFYH 5DO2C 1NGYA 4DN3L 3P77A 4JFZH 3HAEA 1A6VL 4RFOL 1JHTA 1FC1A 2XTJE 3LSOA 5I76B 4XMPH 5DD1H 2EYSB 5JLZA 3D85A 3LQZB 3QSKB 4YR6B 3MA9H 1HI6B 4P5MB 4I77H 4ACPA 2NMSA 2VLME 4G6FB 4HGKC 1B90A 1F00I 3GMRA 3AU1A 2E7LE 4LMQE 5ID0A 5J1SC 2VDNL 2ADFH 5ANMB 5DA4A 3RVWD 1NKOA 5HYJA 1LK2B 4BQBA 1SJXA 3TYGH 1Q94B 1C5DB 4WGWB 2X1XR 4X6EA 4X98A 4X6DB 5DVOA 1RV6X 4LEOA 1EDQA 1G1YA 5FFLA 1G0YR 2EDQA 5LGKA 3VXUD 1HH9A 2CD0A 4KUCD 4HFWB 2BVOB 3U7AA 1SY6L 1TTFA 4I18B 3RVUC 4ZTPH 2MQCA 5LGJB 3QDMB 4PGDB 5JDSA 2FEDD 4PB9H 5B21A 5I1HL 5EZIL 3BMWA 1X9QA 1UWXH 3INUH 3HPJA 4V1DA 4Y5VB 1TVBB 3OKLA 2ICES 4O2FA 3B9EA 2E5EA 1FFQA 5I9QC 2G5BA 4KK5C 3IJHB 4CMMA 2NTSP 2WV3A 3BEWB 4X4YB 4K7PH 4EN3B 3UTSB 3VXOB 2M26A 4DVRL 3CVHL 3D85D 1JFQH 5F3BB 3WIFA 3BN9C 5C09D 5IIEA 3O6MH 4ZSOA 5B38A 4ZUTB 1HYRC 4UBDC 1FGNL 4P23C 4UT7H 4YFDB 4EI6B 4LRIC 5F1IA 4TNWF 3PDDA 4CBPA 2DM7A 4IHOB 4XPHH 4M6NH 3B9KA 1D5MA 5FV2A 3VFGH 4D8PA 1HHHA 1YEGH 4KK8C 1T0PB 2FIKB 2YXMA 2ITCA 3EDFA 4QXUH 3TGXA 1MFEL 4PFEA 3G5YB 4QY8B 4R3SA 2XXMB 4KMQA 3QWOA 1RUMH 4NP4H 5DEFA 1MRDH 3ZHLA 2DJSA 2R9HD 3MR9A 4JM2D 2UYLA 2X1OA 3QIBB 4HZAA 2VMFA 1ZANL 3HLAA 2FO4A 5A3ID 2ZPKH 3IRPX 5F3HB 4RMQA 2SEBA 2AXHA 5LGHH 4NN6B 4PRHD 3I50L 1UWXK 1O7VA 2FSEA 1NKRA 1VEPA 3TIEA 2F8VA 4HDIA 3V5DA 4Z7UB 4NQXB 1J12A 2AXGA 4JG0L 4TRPH 4P59H 3BGMB 3UPCA 5I1KH 4ONHA 1AKJD 3RL1B 2YMXH 2JJWA 4D0BB 4PV9A 1Q1JH 4CVUA 3V4PL 3BGFC 2VN7A 4I0PA 3OX8B 1N26A 3FQNB 1KULA 1YEDB 2ZOKB 4NO0B 3BP7B 1JHKH 3DXAB 5DHYA 1DN0B 5JZ7D 4HMDA 4OTXH 5FUZL 5JW4N 4OD1L 3U46B 2O26U 3GMMB 3WLWC 2B8OT 5F9OL 2P8LA 4Y2DA 2HP4A 3D39D 4ZOBA 1A3LH 2GW5A 3GK8L 1T04B 4M8QA 4A2MA 2APFA 2V2TB 5IFJB 1XGQA 5TDPA 5I1CL 3MLUL 3KLHD 2ZP0T 4JVUA 2HFGL 1KXTB 5DUBB 3L5WA 3RY6A 3O2DL 3N85L 4AMKL 2LV4A 4OFYD 3M07A 4IRJC 3VCLB 3FMGH 2C7UA 2YBRA 1J0HA 4NNXB 5GGVH 5C09E 3VD5A 1I7RA 5C86A 5IBTH 1IAOA 1OAXL 5DHVB 1RZGA 1JZ8A 5T1KD 2P43B 1FPTL 3QDHA 4M43H 5FA4A 5C3LD 3RIAF 1YEEH 2A38A 5T3XE 3RUGE 1JYNA 5FCUH 5E9DE 1G6RA 5SWZE 1G7PB 4GRLC 2BVOA 2E8YA 4JQXC 4G59A 1BVZA 5ABDE 1KELH 4M7KL 1KTRL 1F2XK 4PRIE 1OPGL 3PHQB 5GHWH 3GEWB 3L95A 1NGXB 3BH8A 1RJZA 3GNML 4HWBA 4Q6YA 2JB6B 3HI6L 4QXTA 3RWEA 4KUZH 3TVMA 2OJZH 4XP4H 4D0CB 1D9KA 5JR1L 4AH2B 4OD1H 3EOTL 2H8PA 3C5SA 1T83C 3QA3A 4O2FB 3WJLC 1LK2A 1YNLH 4DFHA 3CGTA 5DI8B 1DDHB 3UDWA 1VADB 5CBAB 5I19L 4JG1H 3TLRA 1AKJB 3C5ZA 2VLRA 3F7VA 1MCPH 2PYEA 4IOIB 4X7FC 4XNYH 1NBQA 3QUMB 1Q9OB 1CDGA 5DD1L 1BOGB 2B39A 1GGTA 2OX5A 3FHQA 4PJ5A 3TBYB 4RMTA 3G6AB 3SHSA 1KN4H 4X7DC 5HYQA 3RI5F 3PUCA 3TPUB 4PGCB 3W39A 4NWUH 3T4YB 1RK1A 4J4PD 5ACMA 2VN4A 3UAJC 4PRHB 3UZEA 1JCKA 3T0VA 2VSCA 5MHSE 3K8MA 4H0IA 4LHUG 4XPTL 3OZ9L 4KUCF 3DMMB 2FWOA 4XRCA 3WDJA 2B0SL 3CU7A 1J1XH 3DRTB 5DRWA 4NKIH 1W0VA 1BQLH 3RX8A 2XPGB 1NEZG 4OI8A 2QHRH 1S3KL 1FL6A 2NY0B 2YN5A 3CMGA 4ZOEA 2BY1A 1PZ5B 1AGCB 3BQUA 4UT9L 1IC4H 4ODVL 3DX6B 1JPFA 3FOMB 2EH7H 4KTYA 1JZ7A 5JHLH 5HJ3A 4WUKH 4Y19E 1VFBB 4HIEA 4NQDE 4UIKL 1NMAL 1ULVA 5EOTA 3TO4D 1K5NA 4Y16B 5DXWA 3T1FA 5IG7B 1PG7L 5D7JB 3P11H 3MGAA 3OJ2C 3H42H 1J0IA 4N8CL 4XB8A 2EDFA 2HVKA 4J6RL 2GTZB 1UM6H 4WCYL 2R4SH 4PJIE 3BO8B 4NT6A 5F1SA 4GKSB 4APQD 2GJ6A 3HE7D 4NQVB 3KYMB 4QKXB 3P0VH 1J8HB 5IEHA 2QQLH 1BZ7B 4MHHG 5DEFB 1L4IA 3MROB 3T0DA 5C07D 5EBLB 2WBKA 4OLWH 1S9XB 3P2TA 5TF1L 1M71B 5B39G 2J2ZA 4EEEA 5GGVL 4XVSH 2VDOH 2VUYA 3EOAA 4YR6A 3RIFK 2L4OA 5KTEH 4P5MA 1S9YA 3SDCC 3DGGB 3UTTB 3AU1B 3GMNA 5GGQH 3A67L 1MHPL 3K0WA 3EYUH 1A8JH 1U58B 3QEHA 4J6RH 1S5IH 4OCXL 2FX7L 4Z78B 1MCFA 4EVNA 4DGIL 4OCWL 1IBGL 1KN2H 4K3EH 3BRFA 3U83A 3MLTA 3CFBB 5IT2L 3CSPA 2ADIA 5BV7L 5I1DB 3VMOA 2HKHH 4FQ1H 4HQQL 3G6JF 3GMOA 4MA3A 4Y5XC 5ID1B 1NFDF 3MRDB 2YPLE 1U3HC 1QSED 1NDMA 3MJ6A 5C0CA 3GJEB 1UA6L 1KJ2L 3DVNA 4CVZA 5IKCB 4POUB 1OLLA 1C7TA 3IGAB 3TFKD 1S9WB 2BVTA 2FHCA 1KB9J 2YSSB 4W70A 4R7DA 3CLFH 4LIQH 3H7BB 1MREL 4X9IA 5FM5M 2J8UF 3KYOB 3HC3L 3MGTB 4Y4KD 5E9DA 4M6OL 4RGND 3H3KA 4ZSOB 5DD5H 2IALA 5FYKD 3QJFA 1QFWL 2WSKA 3KXFA 3GM8A 3ECBA 1H3XA 2XA3A 5K9QG 3GBMH 3KYNB 1KTDA 4OZIF 4YHLH 4HUUB 4BZ1H 4ZXBD 4D9QE 2X41A 4UB0H 1IC7H 3MLXH 5J0BA 2VLRB 3F7VB 4YFLF 1A22B 4ZUWA 1TETL 3RZCC 2X2YA 1CDBA 2X4SA 4PJFB 1RZIA 5EC1B 1LNUB 4OAWA 1UQSB 5D7IB 3VWKA 4H20L 5DFVD 3U9UA 3WHXB 1JF6A 3MRCA 1J1PL 1KB5B 2MJWA 1ND0B 3U0PB 5GS0C 1BZ9A 3GNMH 1F11B 4M61B 3N1QC 3QWRA 1XIWC 3RWEB 5JPMB 3UJJL 2HKFH 2IFFH 1OAKH 1JZ3A 4QRRA 3BDXA 2Z9TA 1LILA 5CJQH 5MHSD 4XPGL 4O4YH 4M43L 1CK0L 1ZLUH 5EU6B 3MOBH 4XI5C 4PD4K 3OKMB 4JN1H 4N0CC 3RQ3A 5F70A 3IDJA 4XGZA 3VXRB 4B7LA 4EUPA 2J4WL 5INCB 4O9HH 4FQCH 1GIGH 1LO2H 5F97E 1QSEB 2VE6B 4MQXD 1GHFH 2UV3A 5I73B 2IC2A 1WEJL 3C5ZD 4KI5F 4JRXE 2DF3A 1C12A 2HVJB 3AVEA 4YDIH 5I8CA 4HQQH 1YA5A 4PRDA 3I2CL 5HI3D 4Z7OF 3IT8D 2ARWA 3LPGA 4MJ5A 4FFVC 4HGWB 5FEBA 4NQEB 3TYFB 5D1QC 2P5WB 3REWA 5J57B 4G43B 2W60A 3JTTB 3M45A 1KYOJ 2MFNA 4O51B 1RIUH 1W0VB 3RVVC 3IAGC 4I5BA 4MA1B 4OCXH 3JBG7 3U46A 3RUGB 2YEZA 4HWUA 4PJIA 1U36A 4JKPL 3N9GH 1YMMD 4M3JA 1CXIA 3IVKA 5GS1B 3QUYB 5F8RC 3E6HA 2AP2A 3IDYB 2R1WB 1LWRA 2Q20A 3PABA 3B9VA 4PJIF 1FZOA 1MJ8L 4DN4L 1JZ5A 5DUBA 1F58H 1ZA6A 3HB3C 1WSST 3LOWA 4O02H 4JDTH 4LSSL 1ZLUK 5JIIA 5K33A 3MOBL 2F54A 4K8RL 3ARGC 4G42A 1ZGLB 1F4WH 2ITCB 3B4NA 3BPOC 2HJFB 3MACL 3EW3B 3EYOB 4POYA 3QPXH 1RMFH 4APQB 4DGVH 1HWGB 4ZS6D 1IAOB 3ZYZA 5CSZB 1JGEB 4P2OA 1XZ0A 4NSKA 2ORBL 3O4OB 1KB9K 5TGBB 4YXHH 3NFNB 1DQTA 1MCKA 1NDGB 1T4KA 1EMTL 3VWJA 1G9MC 15C8H 4WI4A 4TSCH 1FORL 1INQA 2P5WD 3L5HA 2OL3A 2CLVA 5EH1A 5DVNA 2Z31A 2B7DT 3U7YL 1D9KC 4NGHH 2XY2A 3C6LA 4JFDE 3QHTC 3HG1D 1O5DT 4OLXH 2D9QB 1K8DA 1F3JA 3O3EB 1FVEB 5MEQA 2YD4A 4XBPB 5DI8A 1IGIL 2QQQA 3WEXA 4X6DF 3ULVE 2ZUQC 1K3ZA 2LAGB 1CWVA 2VQTA 2O93L 4JQVC 2P7TB 3ZHKA 3K80A 1LK3H 4FHBD 4NHUA 4YXHL 3W5NA 4YE4L 2VWEC 3BQUD 3MNWA 3ARDC 5CP7B 1DQQB 4NO3A 4H0GA 4PGCA 1A5FL 3T4YA 4ODBD 2MCPL 4DAGH 1UADC 2ZUVA 4CNIA 2GK0B 1F8TL 4PJDB 1Q9KA 3WS6C 3IGAA 5KOVC 4OZIA 1R3HB 4LQFL 1X5IA 1T7YA 1OGTB 1RJYB 2I9TB 4OLXL 2NY6D 1T1XA 4UZGA 4ZFOL 3QZWB 4JFDB 1FZJA 3H7BA 3LEVL 4PDCE 1D5BA 4P23B 2WBJC 4QGYA 4G9DB 3VWJD 3EIFA 1RAMA 3WNLA 3KLSA 3LKSB 3QXAA 4PRHE 1H0DA 3O11B 1SEQH 4TSCL 3VCLA 1U8JB 1H3PH 2YBRB 4B41A 4BK4A 4JANA 2D7PA 4QF1A 2OJZL 4XP4L 4HIIA 4PJ8A 4P5TA 4ELMA 2ZSWB 4JY4B 4X7CC 4YC2C 3RGVB 3CC5A 5FOJA 4LCWA 4M93C 3PWPE 3QG7L 1HNFA 4QRRE 1LD9B 4HHAA 1DUYB 4KHTH 1VDGA 3S35X 2DI8A 3BKCH 2NX5D 1MNUH 5D7LB 2Y5EA 4RGNB 5B3NA 4OB5H 2R69L 1HZHH 1FC2D 3KPMB 1RJZB 4YHZL 4J12A 1G9ML 3QXUA 5MENE 4U1JB 2XQBH 2W65A 4PJBE 3KWWA 4XMLL 5HVGB 5T5NG 2IAND 4GKNB 2OTWA 3LD8C 1OP3H 5D1ZB 3SDCD 2BSRA 4JZJA 1A9BB 3UJIL 3VH8G 5F7LB 3TYFA 4JPWL 1R5WB 4HX1A 4GW5B 4R4BA 3V6OE 4GSDL 4BFIB 4OFYA 3D39B 3LPFA 4IRSB 5GGRY 1NMBH 3PWPB 4ZFFB 1P84J 1HSAA 3IFPA 1ZE3C 1MI5D 5D7SL 2XN9A 1KBGH 2DQHH 1CD9B 1E4WL 1IGIH 2DLHA 3N1MC 5HHNB 5JHLL 2Y72A 4M6MH 2GQHA 2WLZA 5F7WC 4Z8FH 3CSGA 2C1PA 5EOCJ 1GHFL 1YMMA 4S2SA 3JTSA 2PR4L 3T2OA 2E7HA 5DJDA 5K93A 1L7IH 5HHPA 4OV5A 4R2GD 4M7LH 5EUOF 4HGWA 3REWB 3KPNA 4MNQB 4G43A 1MFCL 4QO1A 4R8WH 1MFNA 1PLGL 1U93B 3IS1X 4NQEE 3VFUB 5D71H 3VFTA 4BELD 2F53A 4L9LB 3U9PL 1QO3B 1G9NL 1XEDA 4UV7L 1JPGB 5DD6B 2DLEA 3K81A 3VXRD 2GEEA 5CCKL 3X12B 3CZJA 1T4KB 5KJRL 1MIML 4XWOD 3QDME 1R0AL 3VFRB 1I3UA 5HVWA 3CFKB 4IOFD 3KPLA 4OZHF 5E7FA 2XZAL 1HOCB 2PXYD 1CR9H 1GZQA 4HJGB 2P8MA 3K4ZA 1B9ZA 1BAFH 5E1AA 4ENED 4TN9A 1A7PL 1T66D 3BD5A 3BZ4B 3CCHA 3EYOA 1AGBB 3TO4B 1KTDB 2HA1A 4EDXA 1PX4A 4HWZA 2KH2B 3HNTH 4CGTA 1TETH 3F6LA 4RFEA 3WNKA 3U36B 5E2JA 2Q86A 3BPLB 3O3DB 4XNXH 5F7NC 4YBQD 3C6LD 5E7BA 3EO0A 5B22A 2DQIL 5F88B 1JE6A 3MRHA 3JVGC 4JGUA 2DLGA 5IT2H 3MV7E 3QDGB 1KB5A 4H5SB 1IRAY 4DQOH 3G6DH 1RURL 3AY4C 4N8VG 4LP5A 4J8RA 4DKFH 4PLOB 1FRGL 3DVIA 4IDJL 4P2OD 5ALBH 1KFAL 1UCBL 2FEEI 2VDRL 1JNJA 5DYOB 4XI5D 5E8PB 5IM7A 3X13A 1KJ2B 4JJ5B 4MWFB 1OGTA 4CRPA 4BSWA 1J7VR 5DMKA 1I1RA 1OF2B 3QQ9C 4LLVA 1ROWA 3Q0HA 2BY2A 5CZVH 1P7KA 1MCRA 1G7MA 1F4HA 1H9VA 1MCDA 2DL2A 4LRIA 3MNWB 4HIIB 4ZFOB 2V6HA 1W72B 3SGJC 1FRGH 5CJOL 4JB9H 4H25B 4GRLD 2HKFL 5FYJL 3SEPA 4D9RE 3GJFH 1D5ZA 3HG1B 1RJYA 2JB5L 5D7LA 5GS0H 1LDPH 4NQEA 5JQHC 3ALPA 4GG6E 2X42A 3QUXB 3UBXB 1DBMH 4JFED 4ZPTA 3FQXB 3OJDB 3V6ZB 4MZ3A 3TNNA 2EIZA 3OR6B 3V8CA 1BD2E 4K3HA 4N90E 4PJ8B 5F9WC 3ZDZF 3MV9A 5F6HJ 4R90H 1IQDA 2I60H 1HHIA 4MGXA 3BW9B 4NRXA 1WBZB 2D2OA 4KRPC 5C0AA 4KI5C 5SX5K 2B0SH 3GSNA 2FD6L 2ZCLL 2BVEA 4CW1A 25C8H 1OW0A 2AJUH 4P46D 1QSFD 2X40A 3ARBA 2YPLB 3LKQB 5DJYA 5I75B 5T3XL 2AK1L 1QFWM 2QKIB 5HTSA 5HHVL 3WIIH 1UM6L 1T21A 3QDJE 4WFHE 3U9PH 1QFOA 4AL8H 1XCTB 3HE7B 5HDBF 4NWUL 3KPRD 1AXTL 1NFKA 2R1YA 5C0FB 5C6PB 4P2OB 3CLEL 3MRPB 5E2WH 5DHVH 3K3QA 5ESVA 5GGRB 1A64A 3IU4L 2ZPKL 4G8GA 4MJ6A 4Y19B 3HUJE 2GY5A 1NGQH 4KDTA 4PB0H 4PJCF 1ZHNA 4MMXC 1NDGA 2K1MA 3C2AL 1KCLA 4FQHB 3GHBL 4KTDL 4M7LT 4NC0B 5F21B 1SYSB 3OKMA 2I26N 4BFIA 3W9EA 5E8OA 4OGYH 2R8SH 6FABL 5ESQA 2A6DB 1RJLB 1CZ8L 3HPLB 4GXUM 3BZDA 3E2HC 3IDIB 3LKOA 2R0KH 3O81A 1IC5L 4QLRA 2XI9A 2F53D 4Z7UF 3RWHB 3VFRA 4LNVA 4HH9B 3PWNB 4QCIB 3OGOE 5FB8B 2NXYC 1U3HB 1KN4L 4PRAA 2JJTC 3D0LA 5E6IC 4ERSL 2A77H 4HMEA 2FX9H 2BMKB 2G2RA 3A6CH 3EYFB 4K7PL 4Y4FB 4HLJA 2HRPL 3SCMB 3I02B 4XCNA 2BY3A 3EO9L 4QT5B 4IOFC 1T0NA 4DCQA 2YPVH 1TVHB 5EORH 2ITDA 1FZKA 3WXWH 3ZYOA 5C0GB 2A74B 1TJGH 4KRMB 5BVJB 3LKNA 3LB6D 4LGRB 2MQ0A 2NY4D 4N0CA 4MDIB 1I9IL 3OPZL 1LO5A 4QF1B 5FYJH 1HCVA 4M1GL 5FK9B 2YA2A 3ROOB 5I2IA 4M1CD 5F6IB 3T3PF 1XH3B 4IJ3C 1RZJH 2A9NL 1FCGA 1N8ZA 5HPMB 4LNRB 4AY0A 4OGXH 5DMIL 4CAGA 2K9UA 4NN5B 4DVBA 4MHHI 2B4CL 3M1BB 5EU7C 2A1WH 2GSGA 1RIVH 3QCTH 3SE8H 1MI5A 1FBIH 4PYGA 4V3DB 2OTUA 3HUJB 5CZVL 3DROA 4Q9CA 1T5XA 5D7JC 5H8DA 5CGYD 4U1JA 4XPAL 4CN1A 1IM9A 2Y9RT 1KJ3H 1P4BH 2EC9T 3RGHA 4GKNA 1ERNA 1S7SB 4MCZA 1FO0H 3L3GB 4J3TA 3J8F7 3K2UL 2CMRL 4XMKH 4G8IB 4FG6D 2F74B 4QHUB 4GRLA 4YFLI 2BOBB 3HAEB 3LQAC 3VA6A 3ZTNL 5DJ2A 3MLRH 5IQ9A 3FFCA 5IHZB 1NAML 5EZJA 4GW1B 1JWUA 4HKZB 5LJYH 4NP4L 4OZFB 1U92A 2OSLB 1W72A 2EDHA 3IDMA 4FQJH 1FORH 2DTSA 4GRMA 2GI7A 4K94L 3VXSE 1SBBA 2QBWA 5E2TL 3RWFB 5J12B 4RGOH 2HT3C 3NZ8A 2JB5H 4D9LL 3D2UB 3S9DB 2BNQD 3L5IA 1G7LB 3S36X 4F33B 3W0WB 3I50H 4S0UC 3ZSTA 1OSPL 2GJ6D 3HE7A 2H2SC 1J8HE 4F58L 1YEEL 3VRLE 3QQ9D 2EIZB 5I1EH 1FYHB 4P5TB 4ELMB 4PRPB 4MNGE 1P7QD 5J7CC 1CD1A 3MRBB 2OJEA 3VXMA 5IB5A 5BQ7B 3OXSB 5J6HA 4N68A 3TIDB 1LD9A 3BW9A 3FN0H 5I30H 5F7MC 3CX5J 1DANU 2ADJB 4BYHA 4KJPD 2K7PA 4Y5VA 3QIBD 5JIHA 3WIHL 1QYGH 5E5RB 1M6OB 2A6DA 2AJSL 1BFSA 1DEEA 5EBMB 4HCRA 5D9SB 4PJGB 3MLRL 5CD5C 2FDBP 1A6ZB 4KKLC 4EDXB 3VE0A 5C2BH 2GITA 4Y16D 4AEIL 4JFHE 5AAMA 1QG3A 2VDMH 3ULUE 4TNVF 3MGOB 4EBQL 5F9AC 4UT7L 1OP3K 2FRGP 2HMID 5IROA 1KV3A 4ODUA 1AE6H 3IRZA 3JVGA 2WLYA 1F4YH 3SQOL 2BRRL 1J05B 5DJ6A 3QG6B 1NANI 3RBSA 4PRNB 1QLRA 3DYMA 3UZVB 5DO2D 2XOTA 1QYGL 4QT5A 1Z3GH 5E8OB 4ZNEE 43CAA 5F8QC 5MP6L 1UCTA 5L2KE 4U31A 4AM0A 3QEQD 2NXYD 4ZG1A 4Z7NF 5C09B 3UXFA 3L3OA 3VXPB 4YHIB 3WLBB 5FKPB 1A7QH 3IDIA 5J06A 3EDKA 2V2WB 5BJTB 5C07E 5L0QC 3QWOB 3RWHA 4MNGB 1RU9H 3DBXA 2X5PA 2XWBB 3QAZC 2OQJB 3P0VL 1E27B 2GSIB 1NCUA 4PUBH 3IJSA 3QXWA 5J6GA 1OOAA 1CFSA 3D9AL 2RQ8A 5LGHL 4B0MM 5C0IA 4PJHB 5EPMA 4PJAB 5H2BB 3T2NH 3FB7B 3P11L 1NLDL 1UB5A 3MX0A 1A7OH 4U6YB 4TULH 3IF1B 3THMH 2DIJA 4NIKB 4K71C 4ZUVA 1OWWA 1FJ1A 2A73B 5M94B 4R7NB 3VWKD 3W9DB 1YN6B 4NPYA 5JW3H 4Y1AB 2CIIB 3HI1A 2OTUB 3V5HA 3MCG1 1S7WB 3EOYG 4GQ9H 3ERYA 4PBXA 1Q9WA 2XA8H 1Q38A 3JV0A 3REVB 3GI8L 2AGJH 5EIIB 1UYWL 2Z35A 2YC1B 1HEZA 2JJTA 1AR2A 3L3GA 1HHIB 1VGEL 4N9GB 1DVFA 3HR5A 3PV6B 5JUEL 1KLUA 2DN7A 3C60D 5B39B 2J8OA 4F7EA 2DYPD 1F4XH 5JIKA 3ARBB 5BZDB 4G6JL 1JFQL 4S1SH 1T04A 3ULUC 3V0WH 1YEFL 3MRKA 5IB1B 3DROB 1A47A 5IB4B 1PSKH 1J11A 2GTWA 3KPSA 5H94A 3KS0H 1WZMA 4WW1A 5JXAH 1M7IB 1MY7A 4FZEH 3V79C 5D1QA 5ACZB 2DI9A 5D1QD 5DMKB 1ZLWH 1FFOA 2J12B 2HFFB 2C3HA 1A6UH 4FXKA 3FTGB 4RISH 1XIWD 3T04D 4ZDHA 4HZLB 1ZAGA 1XGTB 5BS0E 4X9GA 3PJSB 2PXYA 2OMBA 5FM5O 2EDEA 3WKMH 2GJ6E 3VXTA 4JHWL 4OUUA 3X14B 2WINA 2YRPA 3ROLA 4TUKL 4Z7QE 4F37F 1AP2B 1W0WB 1WFNA 2R2BA 4PJ9B 4BH8A 5DJCB 3BD3A 1NLBL 4YZFE 2OK0H 3WFBH 4YXLH 3DVGB 4RCAA 1R3JA 3MRNB 3RPIA 4OZHB 2R4RL 3NH7L 2Y5TA 3OAZK 2FBJL 1JGUH 5A16B 1I8KB 4Z0XB 2UVFA 2VXTH 4W4OA 1CD8A 3O3BA 2D0HA 2XG4A 3I6KB 3OR6A 3S5LG 3S34H 2EDJA 4XWGH 3TBYA 3RWGB 2A74A 2D0FA 4ONFL 1UH4A 3LKNB 5GZOD 3ISWA 4KH2A 3RVXC 1S7QA 4MXVF 1RK1B 4GKOA 5C0DB 4RSVA 1KJVB 3MJ8A 4N0UB 1P84K 2YPLA 4G80B 4HXBL 1M6OA 2XTJD 2R0LL 4XX1E 1DL7H 1H3TA 1DEEB 5DWUH 1XH3A 4FNLH 5FF6A 1RUKL 3L3OB 5HHMD 3AGVA 3O9WB 4BQ8A 3AUVA 3ULUL 1JHLL 2NZ9D 3MJ9A 4FQCL 3SDDA 1Z5LB 2HJKB 5LWYH 2EDDA 4TUJB 5B4MC 1N0LA 4LVHB 3RY6C 4FFZH 1VFOA 1VERA 3ESVF 5EUOA 5BZWA 2BNRB 4KKAD 1WIUA 1A6AB 1E0OB 2D7QA 3W11D 2FATH 3OAYK 3G08A 1AR1D 3FO1B 4WFGD 4PIRF 4LSUL 1WGOA 3P9MB 2W9DH 4Y16A 3VDBA 3TBTA 1YY9C 5M7QA 3MRGB 4XHJC 1U6AH 3JV6B 3HPLA 4NM8L 4PY7B 4YDVA 4ZAKB 2G9HB 1MCCA 4P46B 5GIRA 3IDUA 1IMHC 1BVKA 5I1GL 3K1DA 2R1XB 4N90D 2H9GB 3VXPA 4YDJB 5IVZB 2ILLA 4H0HB 2IQ9L 2V2WA 2VZ1A 4KPHH 1MCPL 2AJYL 2Z91A 3CDGB 1CICC 2EXWD 3F6IA 2C3VA 4H20H 1T66C 3ARPA 4POZD 1HIML 1HHJA 4X99B 3SO3C 1Q0XL 5CFHA 2D7TH 3EOTH 4OZ4B 4PJCB 4GW1A 4HKZA 5J11C 3MLPA 3ZKXC 2VABA 4I2XE 5H2BA 2H32A 2HMIC 3C6LC 3GBML 1CXLA 4JFFB 3HG1E 1JNHA 2AV7B 2IFGA 3T2NL 4XP5H 3V0VA 2N7BA 3MFFB 1IGJB 1XGRB 4ZO6A 3OAUL 5A43C 1PVHA 5SWQA 4OLVL 4NQSA 3OG6B 1KOAA 1NJ9B 3IJYB 1QEWB 3RIAK 4OI9A 5C9JA 4HUXB 4ALAL 4M5YL 4Z7WB 3U4EA 3V5HB 4F7CB 4G6FD 5DLML 4WY7L 5JQ6H 3CMOL 3O4LD 1BPVA 3WFCH 3BESR 5GRVL 2PO6C 4F7MA 3STZA 3HS0B 5DR5L 2PXYC 5B8CA 4DVBB 5DS8A 5I71B 3U79A 3T0EC 4DZ8A 2R69H 1NEZA 5E95B 4M4RA 4IMLB 4MSWA 4U1LB 4I3SL 4DK6A 1EFXD 1JHTB 3GRWH 3F62A 5F7DB 4RISL 3X11A 1BJ1J 4RQQB 4TVPD 1I9IH 2E7BA 2X4RB 4XCEA 5GGUB 2ZUWA 4LKXA 1QBLH 2B1AL 1U8NB 4WUUE 3TESA 1MY5A 1WAAF 3FO9A 4TSAH 2Y5TB 3AB0C 4RZCB 3FN0L 1F8TH 4WI8A 4G3YL 3D25A 4PREB 1AJ7L 5C8JB 32C2B 1ORSB 3ARWA 5CILL 1YEKL 2WUCH 5HGAB 4OFKA 3FFCB 4PJFA 5J4MA 1FV1A 1LNUA 1G6RH 3L3IB 1SYVA 3VH8B 5I8OL 2L7JA 4FFWC 2QQLL 1G7HB 5HDLA 4ZMAT 4M62H 2FJHB 3RBGA 3NIFE 2C1OB 4Q7DA 3DUHA 2DWDB 5KSBF 3G5VA 4X6CF 5IJKA 1DSFL 4A2LA 5BOPA 2IFFL 5EBWB 5D93C 2XWBA 5FAAA 1T2JA 4X5WB 4F2MA 4JRXA 4L1HA 2HG5B 1I1FB 4P2QD 5J6GB 1LO3H 4Y8DC 3GSXA 3RTQA 2Y7QA 2ICWI 2XQYG 4MA8L 4KVNH 4WU7B 4X6BA 3MJ7B 2V17L 3VWKC 5I0ZA 2R0WL 5D2NB 1VACA 4MNQD 3VXNB 3BSZL 1BFVL 3QPQC 1UXSB 4L4TE 3IDJB 2I9LA 2HJKA 4FNLL 2A73A 1H5BC 2AJYH 5BW7A 3FQTB 3H9SD 2H3NA 4P57A 3RJQB 2EECA 1J1OH 4ZUTA 2YD8A 1KLGA 1V3JA 2V5MA 2XWJB 4YHNB 4LDOB 2IAMB 2HKHL 3D69A 3QDGE 4UI2A 4EI6A 3V6BR 1J9CT 3DTXB 5EUOE 3VG9B 2X4NA 4OLYH 4W6XB 2J3SA 4R96A 3W81A 4JVPA 5I15L 1VENA 4XXCA 3UAJD 5EBMA 3T08A 3BYTA 5HGHB 1GC1L 2OLDA 5D7LE 3RA7L 2HH0L 2CR3A 2RHEA 1YNTB 1O7SA 4MAYA 5E4IA 5CEXA 3QQ3B 5GGQL 4MAYD 3CVHH 4KKCC 3MC0A 2X4UB 3G5YA 4QY8A 5C07B 1F4AA 1PQZB 1Z0NA 1TQCC 4PGEA 3Q3GB 4TUJA 2DQFB 3VXSD 1SVZA 4WU5B 3WJJA 3MV01 4ORGB 3F58H 3MCLL 2OXGA 2FH8A 4L29A 5DQ9B 2VLJE 3PABB 4GXUN 3WE6B 4MDJA 1M7IA 3PDOA 3WO3B 5SV4A 3VG0H 2A9ML 2JTDA 4U0RC 2WUBH 2G9HA 4WV1C 4Z7VB 2CDEA 3LS5L 4MJ2A 2V9TA 4DGIH 3GHEH 1F97A 2NYYD 3X17A 3DBXB 3RGVD 2VSDA 5F1NA 3GRWL 3MLZL 4ODXB 4I0PD 4LPCA 4PUBL 4H8WC 4WUKL 3S4SA 1GIGL 4GMTH 2VDQL 1KTKE 4HFWA 4UT9H 4FQQA 4OZ4A 3T2QA 5CGTA 3VWJB 1FSKB 4R0LC 3HRPA 4NQCA 1JGVH 1UKQA 3HZVA 4HEPG 4LDEB 1CD0A 2KQNA 3MBXL 4RFOH 3TV3H 1KCGC 1BIIA 1Z3GL 1QEWA 2G5BB 4EOWH 1FVEA 2DD8H 5MEQB 3BKYH 1DQJA 5GS0D 1YEHH 5TDPB 2HJLA 2XN9E 2PCPB 4LEOB 4NWTL 4XTRC 3S36H 1AE6L 4KQ4L 4JFYA 1L0XA 3RVXD 1ZVSB 3MMEB 1T1WA 4HW6A 4ZUSB 2ZUYA 1S78D 5HI3C 4C58B 2C7UB 1FO0A 3NPSC 1MJJA 4FQJL 1P5VA 4PTTB 3T65A 4LPTA 5DUML 1K3IA 2XKNB 5IV2B 4Y4KA 5D7IF 1CDYA 4K55A 3QRGL 2HT2C 3LDBB 3P4OB 4L9LC 3QDAA 4GBXC 3LEYH 1NBYA 2VIRA 1UEYA 4WDIB 1RZ8A 4KUZL 4NCC1 1AXTH 1IEAA 3ARDA 2ATKA 3O11A 5CMAA 3U6RA 4U3CA 1DBAH 2ARJQ 2FATL 1SBSH 1YY9D 2B4CC 5HYJB 2HFFA 2EKSB 4X8XA 4XP6L 1Q0YL 4UINL 4UTBH 4FTVA 2ZSVA 5ICZA 4RX4D 1MSPA 2DJUA 1QOKA 1QFWI 1PEWA 2WUCL 5D71L 3P0GB 1ORSA 1OT2A 3QCTL 4GKZA 3OJVC 3STBA 5IVXF 3FQTA 4P57B 5A2LH 1F90H 1ADQH 3QHZL 4JZNB 2OP4L 5MEPB 3LAFA 2YD7A 1HI6A 2YA1A 4ODTL 2CGRH 2P48B 5GJSH 5IGXH 3GBNH 1TTGA 3CH8A 4Q9RL 4HC1A 3MRNA 2EE9A 3MR9B 1L0QA 2Q8AH 3IFLL 4I0PB 3UYOD 1R24B 1OB1A 2Y25A 1JTOA 3V5KB 5T1DL 5F1KC 1FSKC 5J12C 1BM3H 1KLFA 5CHNB 3PF2A 2SEBB 1I75A 5TPWH 4KKNA 4AEIH 5EA0H 4QRPE 2LVEA 2OZ4L 2MPAH 3DECA 2BSED 4H88H 5GSRB 2DDQH 4UNTA 1RULH 1QRKA 5ISZA 4E42A 3LMJH 5HXMA 3FOLA 3UX9B 3HE6B 4ZS7H 4QOKA 2CPCA 4WJ5B 2E9WA 2W0FA 4MDJB 5FHAH 4OCRH 2EDKA 3LDBC 4Y5YC 4L5FH 2BSTA 2R56L 4YHOL 4YXLL 2DMKA 3WFHB 1I1AA 3NCCB 4MAYB 4XPGH 2A9NH 1QBAA 2HT4D 4CN4A 1KN2L 5C07A 2F53B 5CGMA 2XFXB 2P8LB 4OIBA 4NKOA 3UTSE 2EDOA 5ITFB 1FDLL 3QO1A 1S9XA 3N1FC 2APTA 1CL7H 5DK2B 5KOMC 3C8HA 5C0RH 1DP0A 3SY0B 4U7MA 4PJGF 2D7TL 3E0GA 3BGAA 5HD8D 1AFVL 3F7YA 2FSEB 3OG4B 4Y4HC 3BOVA 1NCWL 2H9GA 3FFDB 3V2AR 3OKOB 4O5LL 3OGCA 2EE3A 1RFDL 5FOBA 1NGYB 4RZCA 4KV5F 3UTZA 4P3WA 3TZVC 4HKJA 2F58H 5FYJU 5AZEL 1S7XB 3SGDH 1IM9D 3EO0B 5D96B 4CADA 3GJFB 4JPKH 4X8JB 5CJ8A 4X9FA 1OHQA 3QUZD 2GK2A 3BP7A 3DXAA 5DHYB 2JCCF 5HYSG 3T3MF 4N0RA 4GRWB 3NACH 1EBPA 1CXEA 4X7SL 1NCWH 5I19H 4YHKL 1HXYB 2V5RA 2Z8RA 4FQXB 4HUXA 3SKUD 1OM3L 3FB6A 5HYJE 4WW2A 5EU6E 4WO4A 4WV1A 1NBYB 1I4FB 4TYUA 5ESAB 3SKOB 4UT6H 5K9JL 4AG4L 2YN3A 5GQBA 4OIIL 2B4CH 3GMPB 1CL7L 4F57H 1LDPL 1BQLL 4PP2A 4WTZG 2IG2H 4PLKC 4EI5C 3U6RB 5BW7C 4LCUA 1YY8A 1FGNH 2D31A 4NJAH 5IB2A 4OQTL 1UB6B 2DLFH 1NFDE 5C0EB 3NVQA 4AEHH 4C56D 1KJ3L 3U4BH 1NEZB 2DD8L 1K2DB 4HAGA 1ZT4B 2ZUTA 1XT5A 3JV5A 2QR0B 3QHFH 4HJJH 3P4OA 3VG9C 2CO6B 3JUYA 2P5EB 1RZFL 3R1GH 2W0KA 5DEZA 5T5FL 2M2DA 1HYSC 1QSEE 1RVFH 2J6EH 2ICEA 5JHDD 5EOCL 4XNYL 3V6ZA 1G9NC 1H5BB 1U8NA 1PQZA 1L7TH 2AEPL 2VLLB 1NLBH 1Z0MA 3SCMD 5JQ6L 3W5MA 3KR3L 5C0ND 1JPSL 2CDGB 1JBJA 3KJ4C 3VJ6A 1NCNA 4W81A 3QB7C 1RURH 1OCWH 2BRRH 3MCKB 2ZSVB 3MLYL 4P4RB 5CHNA 1NCAL 3V7AG 1I3RB 2XTLA 1QBBA 3KYAA 2PN5A 5D7JA 1B4RA 3DGGA 3EJZD 5E5MA 5EZOH 1XR9A 3MLYH 1MJ7L 4UOJA 3ARGA 1FH5L 1LO0L 5F44A 2VXUH 1FYTB 1MFBL 3AREC 3WSQL 1RHFA 2ADIB 1FVCB 1ZTXL 3S4SB 5I8EA 4YQXH 4G7VH 1DDHA 2XY1A 3BP6B 3GI9L 2NY1C 5FGCB 2HLFD 2W07A 1JNNH 5JHDA 1Z9OA 1BGXH 3UTTA 3VGBA 4KKAC 4DTGH 3GM0A 3K4DA 4XB7A 1EXUA 1E6JH 3QDJB 1T22A 1KIRB 3PL6D 4Z78A 3TPUA 5IQ7H 3B2UC 5DK0B 1DQJB 3UTSD 5GISH 5EFIA 4I3GA 1PBYA 1TTUA 4UAOC 1UH2A 3LZFH 5HGBA 3TCXA 4JGJA 2HTKC 3T3ME 4L4VE 3QNXA 4ZAKC 4P2YA 1DBJL 3TZVA 3M17B 5GZOC 4WI9A 5E8EA 5ETUA 4Q9BA 1EGJL 4O2EA 3DUSA 4R2GB 2APXA 2R2HA 4UUJA 1DL7L 1NAKL 4NT6B 5FOBB 2XPGA 2X4UA 4EXPX 2ZJSL 1YUHB 2XTJC 5IKCA 2EDXA 4LDLB 3B5TA 1JGEA 4UB0L 4U7SA 2O5YL 4P59L 5IQ7L 1FZKB 4NKOB 3IFNH 3K2MC 35C8L 4HIXL 3WS6A 3BWAB 4QHKJ 1VFBA 4LCIL 1XGQB 5JXEC 5C08D 3LZFL 3DSNA 3O9WC 1Y0LB 3I3BA 1DUZA 3MGTA 4N1EA 1EIBA 5E9DB 9CGTA 1A14H 2JJSA 2R23A 2X9YA 4LSRL 4WHYH 3W11C 4S1RH 4TVPH 2RJMA 1HXYA 1LO5B 2YZ1A 1LMKA 3E6FA 3MQIA 3OJMB