1YPZA

Immune receptor
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
260
structure length
260
Chain Sequence
GSHSLRYFYTAVSRPGLGEPWFIIVGYVDDMQVLRFSSKEETPRMAPWLEQEEADNWEQQTRIVTIQGQLSERNLMTLVHFYNKSMDDSHTLQWLQGCDVEPDRHLCLWYNQLAYDSEDLPTLNENPSSCTVGNSTVPHISQDLKSHCSDLLQKYLEKGKERLLRSDPPKAHVTRHPRPEGDVTLRCWALGFYPADITLTWQLNGEELTQDMELVETRPAGDGTFQKWAAVVVPLGKEQSYTCHVYHEGLPEPLILRWGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords H2-T22 protein
publication title Structure of a gammadelta T cell receptor in complex with the nonclassical MHC T22.
pubmed doi rcsb
source organism Mus musculus
total genus 48
structure length 260
sequence length 260
chains with identical sequence C
ec nomenclature
pdb deposition date 2005-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ypzA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1ypzA01
4M6ML 4L8SC 4R2GC 5FA3A 4ZSOA 5E08L 3AU1A 4QY8B 1B88A 4G8GA 4HS3B 4JM2C 5J6HA 2OX5A 1F6AA 5C2BH 4ZAKB 5IVXA 3REWA 2PETA 2JK5A 5EIQA 4HKXB 3S35L 1IL1B 3ZYOA 2XTJC 4RMRA 1QFWL 5IHBA 3EYUL 4CAGA 4BZ1H 4TVPE 3B6SB 2CMRL 2IAMB 4PJIB 3T77A 3QIWA 3SDDA 2ZSVA 2IFFL 4YDVB 1H8OA 5C6TL 5D70L 3SDAB 2HFFA 5F9WB 4WI4A 3VH8G 4F7TB 4A6YH 1PY9A 4NNPH 3MBEA 2Y07H 5FF6B 4XVUC 3JVGC 1NGZB 3TN0C 3BGFC 5DA0B 2VITB 4ZYKB 1LO4L 4YDJB 3S6CA 1J11A 4HIHA 1DFBL 3V0AC 5J3HC 3ESVF 3OKEA 5ACMA 4V1DA 4OBRA 3OAUL 4ZFFB 3RWJB 5IHZB 4PBXA 3TBTA 3QQ9D 4ELMA 3T0DA 4IS6A 3M17B 5F96L 5DRNB 4WFFE 2DQEL 5I1GH 1X5XA 1QLRB 3IU3A 3JBG7 4PREA 2QLVB 4Y5VC 5F88B 3D2UD 3CFBB 3BKCH 1Q9OB 1ZGLP 1DE4A 5IROC 1XF4A 2VZTA 2XKUA 2HTKD 5GRVK 5KVDH 4RCAA 1A6AB 4U6HB 4R96A 2X40A 1JGDB 1BJMA 4ZNEA 4HWNA 5CZXC 3MYJA 4F9LA 4WNQA 5TQ0H 4EN3A 3ZKXC 4NWTL 3JTTA 5DRWB 1CZ8L 1IGMH 2B1HL 1D5IH 4H5SA 4B0MM 1Y0LB 3GSUA 1IKNC 3I50L 3V9FA 3ZT5A 4M48L 3KG5A 4ZXBD 1UWGH 2D9QB 4NGHH 5DXWA 2WIMA 1NAKH 1ZANL 3OGOE 1A9EB 5T3XD 4A6YB 1KCSL 5IW1A 2YXMA 1YN7A 4XP4L 4WI3A 3EZJB 3KHOA 5E1HB 3FO1B 3B2UD 1S5IH 5IB4B 5DMIL 5EBMB 3BKMH 3P4MB 1H3WM 3MACH 2X4NA 1QYGH 2A9MH 2OR9H 3B9VA 2F53D 1ES0B 3ZT6A 4K3EL 3WS6C 3GJEB 2OS7A 2ZWLT 1MJJA 4JREC 1IC7L 4M1DH 4QHUB 4JKWA 4PJHB 1IQWH 2Z4QA 4Z78A 5GS2H 1GOHA 5JA9A 1S9WA 3FOLA 3VXOB 3REVA 5ENWB 3HE6B 4HMCA 5E99H 1TJIH 3BZDA 5KS9E 1VERA 3EKCA 3HMXA 3SPVA 2IBZX 3MLYH 1HYSD 4NQSA 3FOMA 3HNVH 3LN5B 4GS7C 5IMOB 1OTUD 5D6CB 3TFKD 4PJXF 5GSRB 4XCYA 3W81A 5D1QC 3V5KA 1B4RA 2RAMA 3MBXH 4UT9H 4JGJA 3GMPA 3QUMA 2X4SB 4Z7VB 1U95A 4S0UC 3HS0A 4AEIL 1MREH 1H0DA 2AJUL 1R3HB 2X89D 3VFUA 2FECI 1PG7L 1J10A 4LCCC 5IIEB 3RDTB 3BO8B 5CLTA 2C4XA 1EBPA 1HINH 2X4OB 1P7KB 3B9KA 1GGUA 1GGCL 2ZSWB 1OWRM 5JHDE 1KLUB 1QLEL 2DLIA 4X4MA 1X5YA 3KWWA 4MJ5B 4CN6A 1JRHL 5DT1H 2EKSB 3RHWK 1AE6H 2YZ1A 3N85L 3ZDZE 2N56A 1AGFB 2FLRT 1MLBB 4XP1H 3N1FC 4PJAB 1YJDC 1ZHLB 2X70B 4RNRB 5C70A 2ERJB 3SEPA 2Y25A 1P5VA 4E42B 1AXIB 4JJHA 1DL7H 2NZ9C 2YPLB 4RMVA 4JFFD 4KJQC 1VEOA 3WFCH 3WN5A 1CGVA 3GBML 3L3IA 5CLWA 1NGWA 4X7EC 4FTVE 4D0CA 2CO7B 3MV9D 1JNJA 1HOCA 32C2A 4GSDL 3HPLB 3WFEL 2EKJA 3U7YH 1GYAA 2EE2A 4PRBA 4ZFZA 3ZZ1A 2V7HB 3SGJA 1FFPA 4WJ5A 2VABA 1I3GH 5DMGD 4LPVA 3WE6A 4MGXA 1M71B 1X4XA 5CJOL 2MHAB 3ULVL 4PTTA 3CZFA 3NPSC 4KKLD 4XGZB 1BD2A 2R8SL 2NXZD 3V5HB 5CJQH 3OJ2C 5DQJA 5HD8D 4YHNB 1UJ3C 3GBNH 3VFGL 1SY6H 3O2VH 1TVBB 3CFKA 3WFBL 5C3LD 4U1KA 4PPTA 3QUYC 3OAZK 1JPTL 1PZ5B 4JFEB 4WO4C 5E8PA 4WEBL 1EJOH 5DQ9B 5I1JL 1I9JH 1EK3A 5ICZA 1ADQA 3BXNA 1QSEE 4Y4KA 3VJ6A 3FB7A 4O02L 4DVRH 1S7SA 1FNHA 2C1OB 2MQCA 3GRWL 4U1JA 4P5MA 1U8IB 2X4QB 5DUBB 3AMKA 3BW9B 4QNPE 2YUWA 3LHPL 5I1KH 3PXHA 4KK9D 1DQJA 4X5XA 1KN2H 4AH2B 4ZO9A 1BHGA 5DLML 3M8OL 1EGJH 4F33A 1EO5A 4M93B 1OW0C 4NN5C 4KRNA 3B83A 1TIUA 4G8IA 2W59A 3VGEA 4PJDA 2UZXB 3QRFM 4WWKD 5FM5O 5EO0A 1RK0A 4ZTPL 1LD9A 1CYGA 1WWAX 4RBPH 2EYSB 3IGAA 5DJYA 2IANE 2OTWB 1UM5H 2OSLA 2FX8H 3O3AA 1V3KA 3EBAA 2AJYL 4RX4D 3TT3L 4QXGH 1AHWC 5I17A 3RL1A 5FM8A 3P40A 1NGQH 2XY1A 4XP6H 3GSQB 2GW5A 3SOBH 5IFAL 2DQUL 5DVMA 3RAJH 5KVMC 2W0FA 1VSCA 3VXSB 5JNYA 3RL2A 2ICEA 4K3HA 3H9SD 2DQCH 1H3VA 4RMTA 2EDYA 4ODTH 3U30C 4J2XA 2BSSA 5FA3B 4ZSOB 1QRNE 3AU1B 1NCTA 2Q76B 3P0VH 4G8GB 4Z7UA 4F37K 1RZJH 2VDPH 5J6HB 4LASH 1F6AB 5IVXB 4N0UA 3REWB 2JK5B 4MD5A 2PXYA 1SEQH 3ZSTA 4OCWL 2NY6B 2Q86A 1N5YL 1CI5A 2G60H 4XH2A 3NBNA 3DHJA 1NKOA 2FEEI 3QIWB 3SDDB 1J8HD 5SX5H 3FFDA 1KCGC 1NC2D 2HFFB 4OCSL 1KTKE 3WD5H 3O11A 1YPZE 3ZTNH 1MF2H 5CIPA 2PYEE 3VXMA 1F4HA 3MBEB 3W11C 5E4EC 3GIVA 3ALWA 3CIQA 4KGJA 1MIMH 1F8TL 1NFKA 2YBRA 4YUEH 4L8SA 1R3IL 3FAWA 3MQIA 1OD7A 4I4WA 3F7RA 4JVWA 4ESKA 3O3UN 1FE8L 1ZK9A 4OZHF 3CCHA 2WUCH 3OKEB 1U6AL 2AI0H 2M2DA 3TJHD 1UCBL 4DAGL 5TF1H 1ACYH 2IPTL 1WUNT 4ELMB 4IS6B 1CF8L 4KVNL 2DMKA 3FO2A 5C0ND 1MHPH 3JWDH 5BS0D 2ZUTA 2G2RB 3IU3B 2XA3A 3MSPA 4Y4FD 3SO5A 4ZD3H 5LGHL 4PREB 4HIXH 3RVVD 3I3BA 5AWNL 2RHEA 4MCYA 1DE4B 1GGIH 5GGTA 3RIAK 4DKEL 1XF4B 4ZTOH 3QUMH 4KI1A 1CDHA 2KQMA 3NZ8A 3JVGA 3SE9H 4GMSL 4R96B 1I1FA 3DURA 4G9FD 1KCRH 4Z95L 3TN0A 3MYJB 4WNQB 4EN3B 1CU4L 3HZVA 5LQBL 3JTTB 1YYLL 4K7FA 3W9EA 4AM0B 3DRQA 5I1HH 2GY5A 4H5SB 4UB0L 1IAKA 2AK1L 1A7BA 1OM3L 3GSUB 1CXFA 4GAJH 4HWUA 3KS0J 4H88L 4LLWA 1LWRA 5HVWA 1TNNA 4ODVH 5IW1B 3D39E 4ZDHA 1YN7B 4Y5VA 3JZ7A 4HCRL 4H20L 3SDCD 5IROA 1KENL 4HX1A 3WNNA 5J6GA 3PWJA 4M62H 1DLFH 1HHKA 3CK0L 1YNLL 3O45B 5F7EL 2P8MA 4GG6E 2R69L 2FLBT 3SKNA 1MJJB 1YY9D 3E3QC 3G5XB 4YC2B 4BFGA 3IDYB 3LSOA 2Z4QB 5HGAA 4Z78B 1S9WB 3FOLB 1CICD 1VFBA 2N7AA 3REVB 4QHMA 1YMMD 4FQHB 1P53A 1IGYA 1IKNA 1XMWA 5HHOE 1G9NL 3SE8L 3SPVB 4KKCC 3EDJA 3H8NA 4NQSB 1J7VR 5GRUH 3FOMB 3VI4E 1S7TA 4OCXL 4ZNCD 1I9IL 2FSEA 4EOWH 2IH3A 3C6LA 3CFCH 3T3PF 4XCYB 5T1KD 5CSBA 5EU3A 3WFDL 3V5KB 1IC5L 2R0WH 1J0IA 4DQOL 4IOFD 3GMPB 1U95B 4PP8C 3HS0B 2J2ZA 4MJ6A 1J1OH 1H0DB 1N4XL 2I07A 3VFUB 2Z35A 4N0CA 4X4YA 5IQ9A 1AD0A 3THMH 3U0PA 4N1HB 4MZ2A 1CR9L 1H5BC 5SWZD 4ENED 4EZMA 3EJJX 2WLZA 3B9KB 5BW7C 3PQYE 3SDXB 2F8VA 1N7ML 3CPLA 2EEBA 4UINH 1YEJL 2VYRE 3KWWB 5IW6A 4HC1A 4LPXA 4CVUA 2D2OA 3B9DA 4S1DC 4XRCA 3ARYA 4N8PA 4WW2F 4PRDA 1FDLH 5J13B 3MLRL 4C4KO 5JPNA 4J4PA 1QSEA 3VXUA 5D1QA 1W0VA 2E7BA 4LSTH 2NY0C 2J1KA 5KJRL 4FP8L 1DEDA 4NUJA 4HS8L 5DHYA 4PJXA 4KU1A 4ODSL 4EXPX 4XNZC 5TE6H 2O5XL 3HI5L 1KSRA 4KJYA 4ODHL 1AY1H 4XMPH 3WN5B 4Y19D 1OP3H 2H45A 3L3IB 3DGGA 1NGWB 4RA0C 4D0CB 3LQAC 5JIHA 4D9RD 4DUVA 4CN4A 32C2B 4Z7QF 4P0DA 4WHDA 5IBLD 1MIEH 5T3ZH 1DQMH 3VG9C 1NCWL 3STLA 5CHNA 4P2QD 4PRBB 4ZFZB 2ICWA 3ZSSA 1FFPB 4WJ5B 2VABB 3QIUA 4R97C 5LGKA 3WE6B 2EDFA 1A0QL 5JOPE 4BJLA 5F6IB 1IGCL 2NY1D 5CILH 5I1IL 2QQNH 2R0ZL 3CZFB 1I1RA 1C1EH 3RKDC 4MS8D 1BD2B 4OIIL 2B7DT 4U49A 3RY6A 3E3QE 1FNSL 1UM6H 2C3VA 3MLTA 5DQJB 5I2IA 4M7KH 1YEEH 5LAXA 4KY1H 3L7EA 2DQFA 3VFRA 1T5WB 3CFKB 5BVJA 3X3GL 4U1KB 3FRUA 4APQA 3Q2CA 4DGIH 5GS0H 1E6OH 1MI5D 4WW1A 3C8KA 4N5UA 5DJ6A 3OKMA 5E8PB 4DN4H 4KJPD 5ICZB 3BXNB 4F7PB 3RQ3A 1QRNA 4HZAA 1MCOH 2A0LC 3FB7B 4FQQA 1H3PH 3VJ6B 3DXAA 3MLWH 5ESAA 5C9KA 2O5YL 1MQKH 3D85A 3LDBB 2W0LA 1S7SB 3FQXA 5KBNC 4U1JB 4P5MB 4DGYL 3FAXA 4GOSA 3R0NA 1WFOA 4K71B 3WIHH 5E6IC 1SMOA 2NYYD 3I6LE 2YC1A 2CGRL 5IBUG 1TVDA 3PP3H 3UBXG 1J86A 1DQJB 2GJ6D 1R24A 5CIPH 5ID1A 1UJ3A 3OWEA 4O58H 4P9MH 3QFJE 5B39A 4G6KH 3LEVH 5KW9L 2JIXD 4JFDD 4I0KA 2PYEA 4PJDB 4ALAL 4F58H 4OAWA 5KSAC 5EO0B 3QUYA 1RK0B 3WHXA 2HFTA 5F89A 3MNZB 1LDSA 2ESVD 4K3DH 5DFTA 1LD9B 1MPAL 1ULVA 4NM4L 1XIWD 4WO4A 3IGAB 5DJYB 3QHFH 2OSLB 3O3AB 3SO3B 1P7QA 3KPMA 1RK1A 3IFNH 3V6FB 1I4FA 4PJCE 5GISH 3NH7L 5TFSH 2EXYC 3ARXA 5I17B 4TNWF 4TSAL 1KC5H 3ROOA 1J87A 6FABH 1R0AH 3RL1B 3QRGL 1DP0A 3UJIL 4OLVH 4Y88A 3TWCL 4HFUH 5GRXG 1WF5A 1BFVL 4OFDA 1NFDE 2W0FB 4JO3L 3RL2B 2ICEB 4M02A 1AI1H 5I8CA 1TPXC 3VFTB 4U1GB 3NACH 2OXHA 1OW0A 3MCLL 3MV8E 4XAKE 2BSSB 3U4BH 4D3CL 4JQIH 4CADA 1P4BH 4Z7UB 5F72S 4GUPA 4N0UB 1WBYA 2PXYB 1QNZH 4LP5A 1GPOL 4MD5B 3VG0L 3OQ3B 5DWUL 2Q86B 3SGKA 4XH2B 2WP3O 4I0PC 2AXGA 5E2TH 4NWUH 4OZFA 3AS1A 1ONQA 2ZCHH 3FMGH 1XR8A 3FFDB 3AFLA 1G7JA 1CLZH 3UX9B 2LTQC 2DQDL 1T2XA 2VDNH 2B2XH 5FIEA 3VXMB 3U6RA 1IC4L 3MV7D 2FYYA 3NFNB 1V3LA 2QEJA 1CL7H 2CDGA 1G6RH 3QDJD 4JN2A 2YBRB 4L8SB 4R2GB 4UU9A 4J3XA 4OFIA 2GUOA 2D7PA 4I4WB 2COQA 3PL6D 4JDVB 5IGXH 2E7CA 4TPRH 3EW3B 3QCTH 3CCHB 4I0CC 1SM3H 2VLKD 5GS1C 3BEWA 2XTJB 3GB7A 4PJBE 3IDXH 3BH9A 4GG6A 3FO2B 4N8VG 3VGDA 4P3DA 1VA9A 2E9JA 1IGIL 5FFLA 1ZT7A 4CMMA 3LKPB 1WICA 1AFVL 3F65A 4G6FB 1IE5A 1GOGA 1KV3A 5KS9B 4MCYB 5E24E 5HHPA 4I2XA 1A5FL 1X6LA 1ZE3C 1FC2D 1J0YA 1YYML 3NZ8B 4FQXD 1I1FB 5C92A 5HHNB 3TN0B 1JGLL 1JWMA 4YX2L 5T33L 1PSKH 1XGPA 3HZVB 4L4VD 1XGRA 2W9DL 3EGSA 3D3VA 4ISVA 4K7FB 3W9EB 3DRQB 1QFUL 2CXGA 4O51A 3WLBB 1T04A 3P2TA 4M61A 1RVFH 4GMTL 4LRNH 2DJSA 5EA0L 4P5TD 3MOQA 1A7QH 3F7YA 1A1NA 4P59H 2HFGH 3ULVC 4BZ2L 3D69A 5BJTB 1KCVH 4XCEA 3CVIH 3ILQC 2V2WA 2QR0A 4JCMA 5LCVH 3ILPA 4ZDHB 5JHDB 1KJ2H 4Y5VB 3ZE2E 1FYHB 2WIIB 3B5GA 2KZ1B 2GAZA 3EYSH 5CJXC 3VXNA 2WW8A 5DJZA 2HN7A 4HX1B 5ALCH 1KN4L 2F19H 3N9GL 4KGLA 5A3ID 1HHKB 4WU5A 2XA8L 5DFVD 5BZWA 4OUOA 1QFWM 3TT1L 4KRPB 1K6QL 1ZAGA 2DBJA 3MLUH 2DKUA 2P8MB 5J56B 3SKNB 4XCFH 1RZGA 1A7PL 1LO2H 3K2UL 3LSOB 1KB5L 5HGAB 4C58B 1VFBB 4QHMB 1CFQA 1KEGL 4LGPB 2PTTA 1IGYB 4Q9BA 1UZ6F 4C54A 3BWAA 3O9WC 5L88L 3QDMA 1S7TB 2UWEF 4HWEH 2FSEB 4U05A 1JN6B 3C6LB 4WU7A 5EU3B 5J4MA 1RIVH 3ARQA 5EULV 7CGTA 3RWDA 1FGNL 3K4AA 4MJ6B 2FO4A 2ICES 2CDFA 4ZPVA 2ED7A 2I07B 4BM7A 2Z35B 3LZFH 5GZND 4X4YB 1P4IH 3UTSA 5IQ9B 15C8L 1AO7D 2ZCLH 1AD0B 3WEXA 3U0PB 1I9RH 5E6ZA 5H94A 1NL0L 4PLOB 3MRMA 2DLFL 3U2SA 2X9YA 2GJJA 2ITDA 1X5ZA 5FHAL 4OF8A 3CPLB 3QG7L 5C3TA 3FO0L 5C86A 2Y06H 4YO0B 5IW6B 4KFZC 1VGEH 4XRCB 4NZUH 4GS7B 4PRDB 4Q7DA 5JPNB 4DZBA 4M5ZH 1LHZA 4ONGL 1QSEB 3VXUB 3QUZA 1W0VB 5D1QB 2VKWA 3ABZA 3TESA 3QQ9C 2F54D 2ZUVA 4KTEL 1PZUB 2IFGA 3MNWA 2YD5A 4PB9H 4NUJB 4PJXB 3FRPA 5IM7A 3ULUD 4JY4A 4XHJC 1MCQA 5INCA 2PO6A 2X9XA 4JLRA 3MOBL 1OLZA 5CEYA 1FL3A 2APWA 3DGGB 3KYKL 4DK3A 5JHLL 1QTYT 3ULVE 5D1XD 3X14A 4TSBH 2XRAL 3W0WA 4I3RH 1LNUA 3ZYJA 3QFJA 2DWDA 2V17H 1TQBC 1KXQE 3O2WH 3STLB 2BVEA 5CHNB 2ICWB 2EIDA 1U42A 4BSVA 3QIUB 4EDWL 3BESR 2IWGA 1U0QA 4N8CH 3D9AH 2DYPA 1I3RA 2MMXA 5L2KD 4AMKH 3C9NA 4R0LC 1F3DH 3N1GC 1IMHC 3JV0A 4DJMA 2C3VB 3RGVA 1V5JA 3MLTB 2OTUA 5I2IB 5LAXB 1XCQA 3L7EB 4CJ0A 1WAAF 2DQFB 4M6OH 5ESVB 1YMHA 1BZQK 5EZOH 3VFRB 5BVJB 3FRUB 3KPSE 4APQB 4YXLL 4WW1B 3C8KB 3Q6GL 5FDYA 5DC4B 5DJ6B 3OKMB 25C8H 3UZVB 1P69B 2NY5L 3B2UC 4HGWA 5C07D 4U3HA 1T7WA 1F4WL 2K7PA 1CGSL 2XG5A 1E28A 1QBLL 3C5ZD 4KZEL 2X4PA 4CDHA 1LK2B 1QRNB 3QG6A 1OGAD 2AGJL 3PNWA 1G7IA 4FQQB 3DXAB 5ESAB 3D85B 1JNHA 1INQB 5FYJU 3ZKND 2FIKA 3P4LA 4CU8A 4F3FA 4KWUA 4X5LA 4U3CA 1SYVA 4QRTA 3KPRA 4WI2A 4HIEA 3GIZH 4XNYL 1IRAY 4IRSC 2E6PA 2QJDA 1R24B 4MXVF 4JZJA 2HMID 3ARGC 2R23A 5ID1B 1RMFH 1UJ3B 4G8EA 5MP6L 1OTUC 3TFKC 1CL7I 3IKCA 3TBWA 5B39B 4YHLL 3MGTA 4EIZC 3ZE0F 4ZODA 4GW1A 2PYEB 1QKZH 1I8IB 3NGBC 3QUYB 2G9HA 4NN6C 5F89B 1ZGLA 4FFZL 3O8XD 5EU7C 3IFPB 1RJCA 4WO4B 2CLRA 3MRRA 4LCIL 1ZLWH 1U3ZA 1P7QB 3HB3D 1JWUA 1RK1B 3KPMB 4U1SA 5CEZH 4LHUD 1OOAA 1I4FB 3L3GA 3OSKA 5JW5A 1IM3A 3ROOB 3UZEA 1G9MH 5FYLH 4WV1A 4ERSH 1K8DA 1UYWL 5E6IA 3CU1A 3SHSA 4JHWL 2X10A 3HNTH 5I8CB 3UAJD 1G7MA 2X05A 5F9OH 5IHLB 1RZFH 2VZ3A 5E2UH 4HXBH 5KZCD 2YPVL 1EAJA 4OTXL 5EO1B 4CADB 5HHVL 1CGUA 4GUPB 4PY8I 1XGUA 2OR8A 2IG2H 2VOTA 2A6JA 1G9NC 4G80A 1WBYB 3QDAA 2B5IB 1A7RL 2YSSA 3CDCA 3RI5K 2AXGB 1HQ4A 1TCRB 1I7RA 4OZFB 3L5XL 3MJ6A 1EHNA 5K9OB 1ONQB 5E7FA 2UVFA 2X6MA 1ZS8B 3TGXA 1VKXA 1FPTH 2DOCA 1BFOA 1DBML 1XR8B 3QXWA 4IOIB 4LOUD 1G7JB 4PGZA 3X17A 3RU8L 4F57H 4KKAC 3U6RB 2UVEA 1IZJA 3WHE0 2FYYB 2A1WH 5DMGC 2VAJA 2CDGB 4JN2B 4M43L 2B20A 2OL3L 4UU9B 1BQLH 2I25N 2GUOB 4KKLC 3VXTA 5GS3A 5IT2L 2FHFA 3RWIB 3TCLB 2NXZC 2YXFA 3KPOA 3BEWB 2VLJA 4XVJL 3VWJA 1B6DA 3GB7B 5DUPL 5CD5C 1N6VA 4I0PA 2ZNWA 3BH9B 1U91B 1GXEA 2RQ8A 4GG6B 4P3DB 4NOFA 4JDZA 2VSDA 4U1IA 1ZT7B 4ZOCA 4S0TD 4CMMB 2ICWI 4JRXE 4ZAKD 2NY3B 4FFYH 1MHCA 4H1LG 4PYHA 1MELA 4JY5H 4TQEH 5JW4N 3AAZA 2WWMD 4LCUA 4P46C 4QRSA 4I2XB 5HHPB 3BYTA 1DQDH 2DL9A 3GNMH 2IAMD 5EU7E 2FD6L 2EH7L 2H8PA 4X7SL 1MWAL 4O2CA 1Y6KR 2X4TA 5J11B 1T0MA 3SDAD 1JWMB 1T6WA 3R0MA 1UA6H 3RVUD 1FH5H 1XGPB 3MGOA 3FT4A 3MPCA 1XGRB 3EGSB 4ISVB 3D3VB 5IVZA 4OM1L 1HDMA 4O51B 1T04B 4M61B 4UT6L 1NGYA 2GYSA 1OSPL 2Y5TA 2YZ8A 3IT8D 5D7SL 1XF5A 1J0JA 1CTOA 2R0LH 1A1NB 1A6UH 4J3SA 1LK3H 2LFGA 3D69B 4HPYL 1LDPH 1WCBA 4XCEB 1RQ5A 2V2WB 2QR0B 4D0DA 5BRZE 3ILPB 4BKLA 3S34H 2GAZB 3GSNL 1FO0L 4R8WH 5DJZB 1GC1H 5JXED 4YQXH 1MHHA 2HN7B 2XQBL 4LSRL 3S37X 2OI9C 3C2AL 2RR3A 4WU5B 1OB1A 5BZWB 4DVBA 4W68A 4C4KT 2NX5A 4PGCA 4DFHA 1KCUH 2SEBB 3SQOH 4D9LL 1RZGB 4HS6B 3MV9E 4XVTL 4KUCF 4XI5C 3IDIA 5JLZA 4HUKB 5F7NC 2DQJH 2PTTB 4YHMH 3HFMH 3BWAB 4YXHH 3V8CA 2GSIA 1FAIH 3ALXA 3QDMB 2CIIB 5I74B 3HE7C 3INUL 4YFLF 3JTSA 4LVHC 4D2NA 4WU7B 3PWPD 2AABH 2YRLA 5FHBL 5BQ7A 1NPUA 3IDMA 1BQHA 3VRLE 3KPNA 4PB0L 4NNXA 2FO4B 4GO6B 4TSCL 2CDFB 3WJLA 1K4CA 2DKSA 3H2WA 1K3ZA 3G04A 3B8SA 3UTSB 5JW3L 1AXTL 3WEXB 5H94B 5MEOA 1HH9A 2EEAA 3MRMB 4Y4HA 1ZLSH 4NKMA 1BWWA 1A6TA 4GRWF 1A4KA 2ITDB 1EMTL 1FYTA 4HJ0C 4ZQKA 3V7AE 4NHCL 3RNQA 4HT1H 2DIAA 3GRWA 4EI5A 1MLCB 3KPSA 3I84A 4KI5F 5EOCJ 1FVCA 1UKSA 4UIKL 1F2QA 4M7JH 4KXZI 4DZBB 3DO7A 4QHLA 3QUZB 3HE6D 3PV6A 3RJQB 4KK5C 5E9DA 2DLTA 2UWEA 3MNWB 5C0NC 5C0IA 1EBAA 2AQ1A 2DDQL 12E8H 5DUMH 3WDIA 5BVPH 5IM7B 4JY4B 4NQCE 5INCB 2PO6B 4JLRB 1H5BB 5CEYB 1FL3B 2HFEA 3DV4A 1ZT4A 2BSTA 3X14B 2Z92A 2ADJB 1N0XL 2RFXA 1LNUB 5FYJL 3QFJB 2DWDB 3RDTD 4NM8L 1IAIL 1CE6B 5GJTL 1BLNA 5JUEL 4BSVB 1FRGH 4I48A 2XPGB 4OFPA 4V2BA 4DW2H 2J7LA 3WDJA 3W2DH 1M7DA 1MCFA 1VPOL 4U3XA 2BNRA 2DYPB 3BT2H 5HVHC 1FC1A 4DOHB 1I3RB 3L3KA 3GUTA 1RUPH 1E6JH 3OBAA 5CJBA 4IRJA 4HF5H 3UCRA 2NY0B 5KOVC 4PLJC 3RGVB 2EECA 1JNNL 2OTUB 1XCQB 4XNZB 5GGUA 3H9SE 1I9EA 4L9LC 5FYKD 1YMHB 4XTRC 1T7YA 4AYFA 1F13A 1G7HA 3SDCC 2E9BA 3PGFL 4HGWB 3BRDA 4MJ2A 3QQ3A 1S3KL 1E28B 2P7TA 2X4PB 2YPLD 3QG6B 4KZDH 3PNWB 4DUXA 1R5IB 3AB0C 2R56L 3QFDA 1JNHB 3S35X 4XNUH 4R97B 2FIKB 4F3FB 1WZLA 2JTDA 4WFGE 1SYVB 2GCYA 3KPRB 4QRTB 4HIEB 2WBJC 4NJ9L 4ZMAT 3U1SH 1MUJA 2E27H 2WP3T 4NBXB 4JZJB 2R23B 1EZVY 3HNSH 3MO1A 4WFHD 2J8UF 3IKCB 3MCKB 3MGTB 4WUKL 2MKWA 1DBAH 1M1SA 2AXFB 1ZGLB 1JI1A 1WAAA 2L7UA 2OZ4L 3MJ8A 4EDXA 5D5ME 3MRRB 2CLRB 1OTSD 1PEWA 1J1PL 1JWUB 4U1SB 2GIYA 2V7NA 3L3GB 3VXRA 5JW5B 3CD4A 1IM3B 2ARJQ 5CS7A 5F21B 4JQXC 2EZ0C 3OAYH 4WV1B 4JFED 1K8DB 2VN7A 5E6IB 3CUPA 5DJ8A 4C57C 1P1ZA 2FECL 3HG1A 3LKRA 4WTZA 1RU9H 4AEIH 1X7QA 4JZNA 3R8QA 4IRSA 4BYHA 3PV7A 3WLWC 1G7MB 1IQDA 1X5LA 4LAQL 2NNAA 4JRXA 3SY0B 5GZOD 1A7NH 4WUUE 1MAMH 3VFMA 2A2QT 3RX5A 1Z3GL 4RISL 5KSAB 5E6YA 1XGUB 3K74B 1C7SA 3O6LH 1UH4A 1MFNA 2A6JB 4G80B 3V4PL 1VHPA 4KHTH 1P7HL 2YSSB 5I1EL 3I3DA 2W9LA 1UVQA 3L1OL 1MFAL 1HQ4B 1JYXA 1LGVA 4PLKC 1UM4L 4MAUL 4HCRA 4POZD 1VKXB 1YEFL 5IBLC 2YA1A 3OHXB 4YXKH 5HPMA 5EBGA 2YD7A 1ZWIA 4RFOH 4RWYH 2VDQL 3HC3H 4ODXA 2NY1C 3GK8L 1KJ3H 1ZSDB 3TV3L 4CDGC 4FZEL 3NFPA 4TRPL 4HQQH 4MS8C 3ZL4L 3VXSD 4L5FH 4OLUL 3MXWL 4HUNB 5HYJE 1IAOA 2G5RA 3KPOB 1OF2A 3VWJB 2R29H 2HT2D 4NP4H 2H32A 2X1PA 4I0PB 4Z0BL 2M1KA 4K8RL 5KSBF 5H37H 1QOKA 4U7MA 5FK9A 4G8GD 1WV7T 4JDZB 2XQYK 1QBAA 4U1IB 1FJ1A 2CK2A 3F7QA 2P48B 1MHCB 2NY6D 4Z0XA 7FABH 2LTQB 3DUSA 2HLFD 3AAZB 3G6JF 3I9GH 4LCUB 1JTPA 3O3EA 3QIWD 3SDDD 2H8PB 4O2CB 2X4TB 4PG9A 1T0MB 5C2BL 4FNLL 3WUWB 2EYRA 5HSFA 3EO9H 3MGOB 3MRLA 3IU4H 5SWZE 3T65A 3FT4B 3BZEA 5IVZB 1HHIA 3OTTA 4Z76A 3FFCA 3MBED 3G5YA 4BZ1L 1HDMB 5EC2A 1NGYB 2Y5TB 5HHME 2DL2A 4RGMC 1CS6A 1XF5B 1T83C 2BSRA 5CP7A 1WCBB 4RQQA 4A6YL 1QLFA 1S5HA 4D0DB 1CXIA 1FCGA 4NNPL 5TDNB 4BKLB 2Y07L 4F9PC 2HTLC 1SJXA 2Z31A 3VFNA 1RFDH 4P46A 3K0WA 1MHHB 3M07A 4WFED 3WO3B 2BC4A 1U58A 4KKBC 2BX5A 5I9QC 4DVBB 4E41A 3UPRA 4H8WH 2NX5B 1AKJA 4Y19E 5IJVA 1NLDH 5I16A 3ZHLA 5D7IE 3IDIB 2HP4A 5I1GL 5JLZB 5MEQA 3CFDA 4M7LH 5EDXA 3FT2B 4NDMA 3BRGC 1HKFA 2FBOJ 3QH3A 2ZPKH 4TYUA 2GSIB 2RIKA 2OJZH 4EN3D 1RJZA 3BKCL 2DWEA 3P9MA 3QDGA 2BRQA 4IIQA 3OG4B 3JTSB 4OLXH 4N5EC 4MDJA 1X9QA 4ZO6A 2GFBA 4ETQA 5KVDL 5BQ7B 3IDMB 1KYOJ 1IKFL 1BQHB 4P23C 1J12A 3KPNB 4HUXA 4NNXB 1VFMA 1K4CB 3DX9A 3G04B 5TQ0L 4LMQE 4NFBA 3ZYZA 5J1TC 4G6MH 4HJJH 5IJKC 3RZCC 5MEOB 1HH9B 3DUUA 4Y4HB 3MUJA 1D5IL 4NKMB 2XWBA 5AYUH 1A6TB 4Y5XC 1A4KB 1WLHA 1FYTB 4PJ5D 4ZQKB 2FEEL 1UWGL 4GAYA 4NGHL 4YZFF 3RNQB 5LVEA 4EI5B 3NCCB 2O26U 3GI8H 1NAKL 3KPSB 2N4IA 1FVCB 3PL6C 3IFOA 4XHQA 4UILH 1CWVA 4K7PX 2H3NB 3I02A 3LEYH 3PIQA 1OP5H 4CW1A 3TIEA 3Q5TA 4TUJA 1YC7A 3DO7B 4X6DF 4QHLB 3BKML 2CUMA 3PV6B 1CQYA 4G3YH 3MACL 2GKIA 4UUJA 1F00I 4PJCF 2UWEB 5TF0A 4EJ1C 5C0IB 1QYGL 2A9ML 2OR9L 2VZOA 2GJ6E 4GRLC 5H2BA 2DAVA 4NRYA 3O2DA 1VESA 3DJ9A 4NC1C 2XN9E 4S1RH 3VFPA 2A6IA 3RWFA 2DD8H 2GY7B 1IQWL 1N8ZA 3IRZA 2KUTA 5E03A 2HFEB 1GH7A 4JFDE 1BREA 3DV4B 1ZT4B 1S9KC 2NY2B 2MKLC 2Z92B 1E27A 4ZPTA 1U8QA 5E99L 4TVPH 2RFXB 1TJIL 4WTXA 4JGMA 3MLYL 3OGCA 3QHZH 2D31A 4LDOB 5F3HA 3HNVL 4KVNH 3V79C 2NY7H 2VNCA 1ACZA 1BLNB 4I48B 3E1F1 4TUKH 3MROA 1IGFH 3MBXL 3B9KD 1A14H 4UT9L 2FR4A 1M7DB 4IMKC 2BMKA 1DBBH 2BNRB 1MREL 3GUTB 3L3KB 4IRJB 1IEBA 4I8DA 4Q9RH 1G6VK 4R26H 1RI8A 4HFWA 4B5EA 1HINL 4NUGH 1K85A 2WLYA 3ZDYF 5GGUB 4Z7NF 4OQTH 1BZ7A 4QO1A 1D7FA 5GHWH 1CU4H 1P84J 3E2HC 1G7HB 3BGAA 3PXJA 1A6ZA 5C8JA 5EUOF 4WUUA 3QQ3B 5E8OA 1RURH 3LS4H 5DT1L 3PUCA 1AE6L 4MHHI 5C0AA 4KUZH 2EXWD 1FL5A 4XP1L 3K3QA 3RVXC 2GCYB 3V6BR 2VLMD 4PD4K 3EO0A 4PGEA 1DL7L 2HJKA 4NFCA 5LG1A 4OB5H 2FCBA 5D9SA 4NCC1 1HYRC 2KL6A 1MUJB 5B4MD 1MHEA 3WFCL 1W72H 3BD3A 2AV1A 4J3WA 3MV7E 3MO1B 4UTAH 3S4SA 3WKMH 4HKBA 3OB0H 3QEGH 3SKJH 1S8DA 1BD2D 4OZIE 4RBPK 3U7YL 1FNLA 3P9LA 4YDLC 1PKQA 3MJ8B 4MXQC 1C5CH 2VLKE 4LQFH 3G6DH 1I3GL 4I9WE 4OQ1A 3LB6D 4HJGA 4U7SA 5FV1L 2V7NB 3EDFA 3VXRB 3HAEA 1C12A 4RAVA 3S36H 1CXKA 2FGWH 5HYJA 1IVLA 2VR5A 2VUYA 3IS0X 4HMEA 3CUPB 5D8JH 1IM9A 1P1ZB 1J88A 2X4RA 5CJQL 3HG1B 3LKRB 5FB8A 3GBNL 3NIDE 3QXAB 1X7QB 4JZNB 5GPRA 4IRSB 4OM0H 1IQDB 1SY6L 3O2VL 2NNAB 4JRXB 3HUJF 3VFMB 1V7NL 5EIIA 1Y6NR 5D7JA 5IVNA 2W1NA 3ZE2F 1G9EA 1EJOL 4G42A 1I9JL 4RMSA 4HEME 3NGBB 4NN6B 5TJWK 4XXDA 4GQ9H 3WIFA 2XTLA 2J8UA 4L4VE 4DVRL 1CLYH 3QJHA 2HT4C 4KRLB 3N1MC 5F7FA 1UVQB 3BP4A 3UPCA 3BDYH 2FH6A 4J7RA 4HXAH 5JW4Q 2VZVA 4JQXA 5SX5K 3J8F7 5TDPA 3VGFA 3BGMA 4HG4J 5I1KL 3HZKA 1KN2L 4LLYA 5HHMA 5C0BA 5HPMB 5DJDA 2DTMH 4P2RA 5B38A 1EGJL 4G43A 3UROR 2DIBA 2AAVA 1ZWIB 2E9IA 2WBKA 4MVBA 1MCCA 4ODXB 1SJHA 4HPOH 3PABA 1JGEA 1MCEA 5D1ZC 1NAMH 1BVZA 1GZPA 1KB5A 3G9VA 3NFPB 3GSVA 3G5ZA 4OBSA 1UM5L 2FX8L 4WFFD 2YUZA 1UWEH 1IAOB 4Q6IA 3GFUA 1FIGH 4QXGL 4KV5E 2H32B 4S10A 3IAGC 1U8KA 1HI6A 1NGQL 4XP6L 1KIPB 4PV8A 3SOBL 3WFHA 1FJ1B 2EDXA 5D7IA 4OGXH 1JHKH 3RAJL 3NIFE 5CP3A 2PXYD 4QRPA 1BBJA 1WSST 5AZ2H 2BNQA 4Z0XB 3DUSB 4FQJH 3EYQD 2DQCL 4K9EH 3KLHD 4A2LA 1J05B 4ODTL 5I0DA 3K46A 3P0VL 4PG9B 1RZJL 1OP9A 2AK4A 5BMFH 2VDPL 5DZNA 4MA1C 4LASL 1NLBH 5IHUH 3WJJA 1AO7E 2EYRB 1G7PA 1SEQL 1FHGA 3MRLB 4F7CA 3T65B 4LLAA 3BZEB 1HHIB 4Z76B 3FFCB 3G6AA 3G5YB 1DUYA 5D2LE 5EC2B 2ID5A 4RGNB 2FIRT 4UDUA 4R2GD 3DROA 3QUXA 3RTQA 2IPUG 2P43B 2ZCKH 4JM2D 2BSRB 5CP7B 3WD5L 3ZTNL 4RQQB 1MF2L 1JZ6A 1MCDA 2VRAA 1QLFB 1S5HB 3DVGA 5IBTH 5BZDA 4ONFH 2CXKA 2XTJD 1I7ZA 5KSBA 3BKJH 3D87B 2Z31B 3VFNB 4P46B 1MIML 1DBJH 4XCCH 4RAHA 4YUEL 1CQKA 2AEPH 2BC4B 1PVHA 3DGCR 3C6SA 3DNKA 4LVNC 5DEFA 5F97E 5IK3B 3U0TA 4NKQB 5J12B 4MD4A 3G6JA 3TZVA 5FUOH 2WUCL 4G6FD 4E41B 2AI0L 3UPRB 1AKJB 3O2DH 5IJVB 5TF1L 1ACYL 5B3JF 3BPLC 2EDDA 1S9VA 5FGBC 4B7LA 2F74A 3VDCA 2D7QA 5MEQB 1MHPL 4XVUD 4PRAA 3JWDL 1Z5LA 2YN5A 2Z0BA 1F90H 2F8OA 3CFDB 3QXVA 4ZD3L 5I8OH 4FQ2H 4NDMB 4Z8FH 2KKQA 4JG0H 1MVFA 1ED3A 3QH3B 3TN0D 4HIXL 1WZKA 4J6RH 3LPGA 1RJZB 1AIFB 5J3HD 2DWEB 3P9MB 3QDGB 4GRWH 1T2QH 1GGIL 4MDJB 2GFBB 4ETQB 2Q20A 2D7OA 2NY4B 4ZTOL 4F9PA 3QUML 3DSFH 3SE9L 1CFVH 5DVKA 1LILA 4HUXB 1RZ8A 3V0VA 1KCRL 1NCBH 3DX9B 4Q2ZA 4LIQH 2OI9B 5HHXH 3MLPA 3KJ6H 5JHDD 8FABA 4P49A 4LDLB 5DVNA 5I1HL 3DUUB 2XWBB 3IDJB 2OJEA 1U3HC 5HJ3A 4BA8A 4PJEA 3CX2A 1CD1A 3B2VH 4GAJL 4GAYB 4P3CH 4NKIH 1MJUH 4QHKI 4ODVL 4KRPD 1OGAE 3T4AA 5CZVH 1F4XH 5T1LA 3IFOB 3I02B 1JF1A 5E00A 3HE7B 3TIEB 4TUJB 1MAJA 4LVHB 5F7MC 3DI3B 3LKQA 5FYJE 4M62L 4P23A 4UUJB 2O93L 2YD6A 1W2KT 3KYOA 3DPBA 3VRJA 1DLFL 3MUZ1 5H2BB 1TZGH 1F45A 3QXTA 1F2XK 4NRYB 3VFPB 2G5BB 2CR6A 2A6IB 3RWFB 1MFCH 2V5SA 2Y4SA 1OP3K 1N8ZB 5IJKA 1NSNH 2WWMC 1T89A 1E27B 4ZPTB 1T2JA 1U8QB 1UKTA 2ED9A 4TOYH 2IAMC 3OGCB 1GZQA 2HLAA 2D31B 3MZGB 3S5LB 5GRUL 3HZMA 5F3HB 2EE3A 2Y7QA 4EOWL 3DOSA 3CFCL 4PJFF 3DRTA 5DMJB 4DEPB 2D9CA 3TIDA 3MROB 2R0WL 2FR4B 2QL1A 5D5MB 3IRPX 2BMKB 2D7TH 5C0RH 5E2VH 4CUCA 4Q74A 3OX8A 1J1OL 4G59A 4N68A 4ONOA 1J0ZA 1IEBB 3TH2T 4R4FH 3THML 4HFWB 4X6DA 4YPGA 4HUUA 2YRZA 4NZTH 1JGLH 3RJDA 1QSED 3F58H 5D1QD 3QZWA 3VWKC 1TETH 1MRDH 1P4LA 1A6ZB 5A40E 4UINL 3TYGH 3SE4C 5JXEC 4K8RC 3PDDA 4YHOH 5C8JB 4WUUB 3CFIC 4RFNC 5E8OB 1KF9B 1MEXH 4ZG1A 4PJ8C 2MQ3A 5C0AB 1FDLL 2HT3C 4S1SH 3VW3H 4KDTC 5B8CC 3V4VH 4ELKA 1FL5B 3KHQA 1CXLA 4LVEA 2JB6A 4LSTL 4W6XB 4D0BA 2DMCA 1BVLA 4MB5A 4MAYA 5HVHB 3EO0B 4PGEB 4Z7OE 2HJKB 1NCAH 3PP3K 4MLSA 4EBQH 2D7MA 5TE6L 4XC3H 5D9SB 4BUGA 4MA3B 4F37F 1DVFA 1MHEB 4OGZA 1AY1L 4XMPL 1WFUA 2AV1B 4KHXH 4MYWB 4NT6A 5I1AB 4MXWH 3RWCA 3P0YH 2H9GA 3FB8A 2CUIA 2JCCF 3E2HA 3S4SB 3KXFA 4HKBB 5IFJA 1NMCC 1S8DB 1B6UA 1MIEL 4Y1AE 5T3ZL 3TPUE 1DQML 3P9LB 5D93C 1T3FA 4XZUA 3S96A 1OCWH 5ILTH 4LHUG 1OAKH 1PLGH 2NZ9D 4MNGA 4NN7B 4MJIE 2AEWA 4HJGB 4UTBH 3DYMA 4KJQD 4OCRH 3AB0B 4NCC2 5CILL 3J7HA 3HAEB 3MA7A 2QQNL 4RAVB 3QYCA 4KQ4H 5EUOA 5HYJB 3U4AA 5LGJB 1C1EL 4LARH 5MEPA 4HKJA 2FJFA 1T20A 1UM6L 1IM9B 2X4RB 3JUYA 5CP3H 1QRND 1MWAA 4M7KL 1YEEL 4KY1L 5HGDB 3DXAD 4MA8H 3D85D 3QAZB 4OZGF 1IARB 4DGIL 5GS0L 4LPWA 1E6OL 4OV5A 2ADIA 4Y5YC 5EIIB 4D8PA 3RBSA 3JWNC 5D7JB 2YRPA 4DN4L 1Z6JT 2EDWA 3NIGF 5K33A 1FL6A 4G42B 3MRFA 4GXUN 4XXDB 2CH8A 3WIFB 1MCOL 4LSDA 2J8UB 1H3PL 4WI9A 4MXQA 3L95A 3MLWL 4JEGB 1BF8A 1MQKL 3QJHB 1NBZA 1KLFA 1XT5A 4ACPA 2Q87A 3BP4B 1Z9MA 3OMZA 5KSVA 2V9TA 3FQWA 3WIHL 3IAQA 2PYED 5A43C 3QUYD 3QPXH 5TDPB 3WS3A 3BGMB 4WO4D 3NZHH 3HZKB 3GEWB 4PD4J 1UEYA 4LLYB 4U6YA 5HHMB 5C0BB 3GBLA 1P7QD 4P2RB 5B38B 4G43B 4O58L 2OK0H 4P9ML 3N0PB 4G6KL 3LEVL 3S37H 4F58L 1SJHB 3LKOA 3PABB 4CU6A 1JGEB 2YMXH 3AUVA 4K3DL 4YFLI 5E8NA 3CZJA 3T1FA 1GZPB 1KB5B 3GSVB 1LE5A 3G5ZB 4HDIA 1OAXH 3QHFL 1EEZA 5SWSA 4M7ZC 1CK0L 3HUJA 3IFNL 4ZUUA 3T2NH 4Q6IB 5GISL 4HZLA 5TFSL 4UV7H 1KC5L 2W38A 6FABL 3T2PA 1LO3H 3FL7A 4OLVL 1U8KB 1HI6B 4HFUL 1YEGH 3SE3C 3L3JA 3QJFA 4PV8B 3WFHB 5K59F 5D7IB 5DGQA 1JFMA 3RWHA 4QRPB 1BBJB 4HIIA 4P4RA 2DQGH 1AI1L 4WVRA 2BNQB 3NACL 1T21A 3BAEH 3U4BL 2IQAA 5A2JH 4FMKA 4NO2A 4JQIL 1P4BL 2DIJA 1JPST 2I9TA 1QHOA 3QQ4A 4XNQA 5EOTA 1QNZL 3TO2A 1G7PB 5K9QI 4R90L 2C9AA 2R15A 2RJMA 4QKXB 4F7CB 3I85A 5E2TL 1DUYB 4S0SD 1QP1A 4NWUL 5DJAA 3Q48A 5TDOA 4UDUB 3QPQC 2ZCHL 3DROB 3QUXB 3RTQB 3FMGL 4FQPA 1LQSR 4KPHH 4JGUA 1CLZL 1H3XA 4MSWA 5BO1H 4DTGH 2VDNL 2B2XL 3AROA 5BZDB 4PJHE 1N0LA 4ORGA 1I7ZB 2XZQL 5KSBB 3BZ4A 4KTDH 1DZBA 1CL7L 1G6RL 3FHAA 5IG7A 3GKWH 1ZTXH 4QTHA 3C6SB 5DEFB 5IGXL 2P8PA 3U0TB 2NY3D 2DI8A 3G6JB 4MD4B 4TPRL 3QCTL 3QWQB 4LQ1A 1SM3L 1LEIA 4CU7A 5HHOD 3TCXA 3IDXL 2V2XA 2BY3A 5F6HJ 1DQQA 1S9VB 3W11D 2UZYB 2F74B 2F9BT 2XN9B 3BSZH 3GSOA 4PRAB 1Z5LB 4N1EA 4RGMB 4EUPA 1ED3B 5JIIA 4ONHA 1NGPH 1WT5C 3HC4H 3D3VD 1MSPA 5IBUB 1P5UA 2EEDA 1PEZA 4K23H 1PAMA 4M93C 4N0RA 5DC0A 1A9BA 4MQSB 1RZ8B 4AIZA 2FHBA 4Q2ZB 3PQYD 1PSKL 2CKBH 1I1CA 5I9QB 1WEJH 5C08A 3GM8A 3VI3E 8FABB 3GI9H 3GKZA 3OXRA 2OJEB 2XACC 1RVFL 4PJAE 4LRNL 1LE9A 1DN2A 5HJ3B 4PJEB 2V5YA 3S3JA 1CD1B 1A7QL 4P59L 2HFGL 3S88H 5J1SC 2BY1A 3ARTA 2ZUSA 3ARUA 3IF1B 1KCVL 4X9BA 3CVIL 3T4AB 5F8QC 5LCVL 1KJ2L 4F8QA 3K80A 1JF1B 5E00B 3EYSL 3PHQB 4U33A 5FGSA 1FLRH 2F15A 3LKQB 5E94A 5ALCL 2F19L 4P23B 3KYOB 4X7FC 3VRJB 1F4YH 3NN8A 1C16A 3QDMD 3MLUL 2Y5EA 3EFDH 5C0EA 4XPBH 4XCFL 1LO2L 2NY6C 4G7YH 2HLFC 4WHYG 5TPWH 4OCLC 4FMFA 5KG9A 5JOPD 5C9JB 3QIWC 1CGXA 1GZQB 1CXHA 2HLAB 3CDFA 3UTSD 1EHLH 3HZMB 2Y7QB 4HWEL 2OCFD 4PUBH 3ISWA 1A8JH 1IGJA 2X5PA 4Y1AA 3DRTB 1NBVH 5KVEH 2BOBA 4PRHE 3TIDB 1RIVL 2HRLA 5FO8A 4QXWA 1BEYH 4I13B 1PW3A 1JF5A 3MXVH 3OX8B 3LZFL 1P4IL 2ZCLL 4KKCD 4NKOA 1I9RL 3ARFC 3GJFA 4X6DB 4YPGB 4YHIB 1DSFH 1ZXQA 3P30H 4X4ZA 3QUZD 1LP9E 3QZWB 4WHTA 1ND0A 1P4LB 5DJ0A 1BGXH 4I77H 4KK8C 2Y06L 4H0IA 1VGEL 1FVDB 1K4DA 2R0KH 1A3RH 4NZUL 3I6LD 2CUHA 2VWEC 2VUOA 2PO6D 2ZG1A 4PS4H 4M5ZL 4ELKB 5FOJA 1MCPH 5DI8A 4ZUWB 2JB6B 3GM0A 3IKKA 4D0BB 3IJHA 1BVLB 4UNUA 3QFJD 3KS0H 4MAYB 4PB9L 4UQ2A 2XZCH 5BXFA 4PJFA 1RZJC 5C0CE 2A77H 2OL3B 2XFXA 4S1DD 1DVFB 4F9LC 1U3JA 2J88H 2WM0A 4K55A 2J5LC 4XP9L 3RUGA 2BK8A 2H2SC 3RWCB 2H9GB 3FB8B 3L3HA 4TSBL 1W8OA 2DYPD 4I3RL 1MAKA 4YFDB 2VDLH 3RP1A 5DK3A 3E2HB 3KXFB 3VWKA 5IVOA 5IFJB 4GW5A 2V17L 4XVTH 2NY0D 3O2WL 3SE4A 1T3FB 1TTGA 4XZUB 3S96B 3RGVD 1Q9LA 3ZHKA 4MNGB 1D5BB 2AJXH 2DICA 4PJ8A 1S7UA 4PV9A 2HAZA 1P2CB 2W0PA 43CAA 4KDTA 3MA7B 5B8CA 4ZSOE 4N8CL 1BOYA 3D9AL 5EUOB 2DMBA 4G8GE 1T1ZA 4LSQH 4HKJB 2FJFB 5MEPB 5IVXE 2WQ8A 3U9PH 2NQCA 1T20B 3C8DA 3OV6A 1MWAB 4ZOBA 4JM4H 4IM8A 5I15H 4M6OL 2IC2A 2R4RH 5EZOL 3GO1H 4YC2C 4OV5B 1E4XH 2ADIB 3IDYC 2DM4A 1RSFA 4D8PB 25C8L 3KPRD 1EEYA 1OY3B 2BJMH 1FL6B 3RKDD 3JV5A 2Q3AA 3JWDC 3MRFB 1KIRB 4YDLB 4LPTA 3BE1H 3L95B 2JCCA 1NBZB 3GMNA 5KSVB 3FQWB 5TH2A 3RA7H 4QWWC 3GIZL 1T7VA 3T3MF 1FO0B 2X89A 3WS3B 2VDRH 4OD1H 2PTUA 4U6YB 4V1DE 1B90A 2VN4A 3B5HA 1RMFL 2GEEA 2A0LD 1FFNA 3VU2A 1P6AB 1EFXA 1H8SA 4ELME 5EFIA 3IVKA 2HJLA 4XP5H 2Q3ZA 1QKZL 2VJXA 5HYQA 3F8UB 3LKOB 4WFEE 4Y5YA 5M94B 5E8NB 5E6ID 3T1FB 2VWEE 1LE5B 1TTUA 4RWHA 4HDIB 3AXLA 4OZGA 1JZ5A 1EEZB 5SWSB 3UJTH 1FFOA 3HUJB 4WDIA 5CEZL 2V9QA 3CXHK 1V3MA 3KPLA 4HZLB 1G9ML 1RUKH 5FYLL 3EZ8A 4XPAH 4ERSL 3PWLA 4MX7A 1P9MA 3L3JB 4ZNEE 2X1WL 3QJFB 5KSAD 2UZIH 5ITBH 1LVEA 3MJ9A 3HNTL 4HIIB 4P4RB 1T66D 3RIFK 3RVWC 4JFFA 4CGTA 2VLLA 3BZFA 4JQVA 3SCMA 1RZFL 4UQ3A 1A47A 1BOGA 1T21B 5E2UL 2EXYD 2EXWC 2IQAB 4NO2B 1F6FB 4OV6F 5SV4A 1B2WH 5E0QA 2I9TB 3NCMA 2IG2L 3QQ4B 5D1ZB 5DS8A 4XNQB 3KPTA 3ARDA 5CJ5A 3TO2B 4R7DB 4JAMB 5EPMB 1HQRB 4NFDA 5DJAB 5TDOB 1KCLA 3EIFA 3T04D 1FPTL 1OPGH 1RIUL 3FN0H 4XBGA 4MSWB 3FONA 1RULH 4K7PH 4F57L 4LSSH 4ORGB 4GW4A 2J8HA 4QCIA 3BZ4B 3RVTC 4I0PD 4FQIH 3C87A 3QP3A 5FA4A 1K2DA 1SJEA 5IG7B 3K8KA 4WCYH 1BQLL 4QTHB 2OMBA 2P8PB 4Z7WF 1Q0XH 3O81A 1MFEH 1LEIB 1MCBA 2A6DB 4Y4KC 2V2XB 4OGYH 1DQQB 4M4PA 3LDBC 3AGVA 3GSOB 2P4AB 3MA9H 4WI7A 4K71C 4JJ5B 4EUPB 1GL4B 1L0QA 4FFYL 4ONHB 4MJ4A 1XEDA 3IFLH 3CH1B 1WITA 5KSUA 4JY5L 3MJ7A 1MOEA 1EJ6A 1Q8MA 1UT9A 2MTPA 1DQDL 3KNBA 1IC1A 3O0RH 1A9BB 4KC3B 5HDBE 2FO1A 1NEUA 4PRHA 1Q9WA 4AIZB 1UA6L 1FH5L 3ZE1E 5IF0A 2VAAA 3GJFH 4HK0A 5C08B 2FB4H 2EC9U 1T4KA 5KVFH 3CMOH 2ATPA 4RX4A 3ZHDA 3OXRB 1LE9B 4P48A 1AGEA 4EQ3A 3BPLB 1IGTB 2XXMB 1UXWA 4FG6D 2R0LL 1VACA 1A6UL 1HKLH 1LK3L 3OAZH 1HN1A 3GGWA 1LDPL 4POYA 1LP9A 1V05A 4X6CF 3WXVH 1D6VH 1WT5A 4JRYA 2JB5H 3S34L 3VFVA 4H1LH 4R8WL 1BJ1J 1GC1L 4NJAL 5INDB 4YQXL 1UB5A 5E94B 4OD2A 5GS0C 1JWSA 1BIIA 3AY4A 3ULVD 3NN8B 2QQKL 1C16B 3MUY1 3KLSA 5C0EB 1KCUL 3SQOL 5A2IH 2YWZA 5FDWA 4LSVH 3F6LA 5C0CA 1T80A 2K1MA 4O9HH 3O3DA 2DQJL 4YHML 1BD2E 4XPGH 5KG9B 5E95B 3CFJA 3HFML 4WGVB 4YXHL 1FAIL 4QXUH 3IJYA 1TENA 5T3XH 1IGJB 4Y1AB 3MRGA 1XGYH 2BOBB 2AABL 3ZDXE 5FO8B 3CDGA 3G5VA 3H0TA 1FYTD 3C5JA 4NO5A 1CDUA 2R4SH 4V3DB 4EI5D 4PJ7F 5A2FA 3A67H 2YWYA 3MV01 3KPSD 2FZ3A 1A6PA 3O9WD 1Q72H 4G9DA 4XB8A 1AXSB 4NKOB 4YBLB 1O7VA 3GJFB 2VKXA 1JUFA 1ZLSL 1X5JA 4FNLH 4KVCH 3NFSH 1E4XI 1F6LL 3DHMA 4MB3A 4WHTB 3PWVA 2D0FA 3WUZA 5EOQH 3TVMC 1ND0B 1JGUH 4HT1L 5DJ0B 3BVNA 5BS0A 4Y4FA 1FZMA 1K4DB 2EE6A 2LU3A 3FCTA 1RZ7H 4M8QA 4Q9QH 2X2YA 4M7JL 3T0EA 3QCUH 3DV6A 5LBSH 5DI8B 5HI4C 5KTEH 4PJDE 1S9YA 1EGJA 3IJHB 3LQZA 5T3ZE 1QSFE 5GIRA 1WZ1H 3LY6A 4G9FA 12E8L 5BXFB 2VDMH 4PJFB 5DUML 5BVPL 1PX4A 2YEZA 3TA3C 4JZOA 2XFXB 5FECA 2E9WA 4P9HH 3CX5J 3ARFA 3RUGB 3DMMC 5HGHA 3L3HB 2BNRD 3VWKB 4XX1G 4FXGA 4JKPH 3RI5F 4GW5B 4IRJD 5DQDH 3ARZA 4S11A 2CK0H 4MD0A 1JPSH 1DANU 1Q9LB 4RFNB 4K3GA 1FRGL 4F80A 4LLUA 4PJ8B 1IAII 5DURB 4DW2L 1S7UB 4PV9B 4LNVA 4XHJD 3VD7A 3W2DL 3AREC 3QEHA 3T2OA 43CAB 1NC4D 5B8CB 1ZLVH 5CWSB 3BT2L 4Z7UE 1T1ZB 1RIHH 4A2MA 1RUPL 1E6JL 4HF5L 2I60H 4MA7L 5HDOA 2JJVA 3DETC 4N0UE 1IKFH 4F7MA 4TNVF 3MJ9H 2PYFA 4KRPC 2DJ4A 3HRZA 4EEEA 5HBBA 2VMFA 1KNOA 5DEZA 3M1BA 1M4KA 4L1DA 1EEYB 5KN5A 1VDGA 1KTLA 3BN3B 1NMCB 5EUKA 2VDKH 4KZDL 2FEDD 5D93B 1BECA 3VXME 2JCCB 4XNUL 3LIZH 3C6LC 3GMNB 3DVFA 3ULUF 5TH2B 2V5RA 1B9ZA 3P4OA 4OFVA 2D4DA 2ZKHH 1D5ZB 4RIRA 1UACH 1UZ8B 1OHQA 3HR6A 3U1SL 4N0CC 2E27L 2W91A 4MDIA 2XTJE 3JTCA 3HNSL 2NTFB 1FFNB 2OBGA 1EFXB 4F8TA 3VXRD 5EFIB 1VADA 2HJLB 1DLHA 4LSPH 5I0ZA 4ZUSA 5DDHA 5HYQB 1DBAL 2QHLA 3O6MH 4LKCA 4IMLA 3U7AA 4Y5YB 2WY3A 5FO7A 2GITB 3STBA 3F5WA 5C7XH 3HG1D 4OZGB 3AXLB 4U0QB 3K4DA 1FFOB 4IRSD 4WDIB 1FFQA 1OVZA 3U36A 1ZHKA 3KPLB 4JRXD 3ARGD 4J4PC 1SVCP 3PWLB 4MX7B 2Z8VC 2APBA 1TVHA 4BQCA 3U4EA 1RU9L 2BHYA 4GKOA 1M6OA 3WO4B 5I75B 4JFFB 2VLLB 3CLEH 3BZFB 1A7NL 1HH6A 3SCMB 1MAML 2APTA 4UQ3B 1BOGB 3RX7A 4JKKA 2MQ0A 1HSBA 2ITCB 2IBBA 1FLTX 3O6LL 5DS8B 1KGCD 1UWXH 2BP3A 3ARDB 5T5FH 4KHTL 4P2QA 4YHYC 3ARBC 2FJHA 4DK6A 2FATH 4M7ZB 5ID0B 3QIUC 4JN1H 1EUTA 1DEEA 3H7LA 5BRZD 4UV4H 4BK5A 2NW2A 2JLLA 3B9AA 4XBGB 2Y23A 4YXKL 4XXCA 3FONB 3RY6C 3H7BA 5MERB 4IHOA 4RFOL 4TULH 4GW4B 3X3FH 4RWYL 4QCIB 2P8LA 3OXSA 3HC3L 5J7CC 5IB2B 4LKXA 4DN3H 1EDQA 5FA4B 5JZ7C 3KPQA 1SJEB 1KJ3L 4L4TE 4OD3H 4APQC 5IB1A 4HQQL 2X41A 3WCYA 4L5FL 1KIQA 4WWID 4GAGH 2R1WA 2R29L 3MRKB 4NP4L 4M6NH 4KKAD 3CXHJ 1LO5A 4IEFB 4NQEE 1X5HA 4F7EB 5HYIA 1E4KA 1JV5A 4HK3N 5EB9A 4QLRA 5FXCH 1HE7A 1B4JH 5KSUB 3MJ7B 3UPAA 7FABL 3I9GL 3GZKA 3FFCD 5ITFA 4PJGF 5CD5D 2X1QA 5HYSA 1II4E 4RGND 1S7RA 4Z5RA 2RCSH 1A2YA 4PRHB 1Q9WB 2ESVA 1V7NH 3EO9L 2AQ2A 2BVYA 5IF0B 1T0NA 3IU4L 2VAAB 3EHBC 4HK0B 1MY7A 5IP4A 4Y89A 1T4KB 3QNXA 1WGOA 1CBVH 3VXUE 3QI9A 2Z31D 5CSGA 1AGEB 3PDGA 4P46D 5FCUH 1K3IA 3U46A 4Z7WA 1UXWB 1ITCA 1VACB 2FJGA 3GGWB 4KRMB 4WENB 2H6PA 4PJXE 1G7QA 4YPJA 5EU4A 5DJ2A 1LP9B 4E41D 1AKJD 2BY0A 1A1OA 1OP5K 4JRYB 1X5FA 5FEBA 2DBLH 1RFDL 3MOAH 3VFVB 4IDLA 4NQCD 1UB5B 4OD2B 1JWSB 4FQCH 1BIIB 5HYEA 5K9JH 1FCCA 1CFNB 4Q0XH 4ZOEA 1KLGA 2FX7H 4H8WL 2DJUA 4PRPE 1QSFA 1NLDL 5AG9A 2B5IC 1PGRB 3VE0A 4LLQA 2BHZA 5C0CB 3FZUC 3HPJA 3SGKC 1WISA 3O3DB 4M7LL 1EHAA 3SDYH 5HVGB 3CFJB 2ZPKL 5IB5A 5AEAA 2OJZL 4PJIF 3SBWC 3C09B 4ODWA 4OLXL 1KB9K 2EIZA 2X09A 3RWEA 1NCDH 1WWCA 3CFEA 3CDGB 4G5ZH 3G5VB 3H0TB 3QDJA 3C5JB 4JFXA 4NO5B 4XI5D 2R9HD 4TTDC 2FZ3B 4G6ML 3RZWA 4G9DB 4DZ8A 4OSUH 3DXAE 2PR4H 5DD1H 4HJJL 4KUCD 2YD9A 5I71B 3WSQH 1K5NA 1JUFB 5AYUL 3PP4L 3HE7D 3BQUA 2FGZA 4G6JH 1GIGH 4LPCA 3F12A 5E5MA 3PWVB 1G9MC 1CD9B 3BVNB 2CRZA 1RUAH 3QXDA 5L8JB 2PF6A 3GI8L 4JPIA 1FZMB 3WIHA 4R7NA 3T77B 5HVFB 1XAUA 4QTIH 5MENA 2ZSVB 4WFGD 2JKXA 4M8QB 2NY3C 4UILL 2Y9RT 3LEYL 3T0EB 3DV6B 3DX8A 4U1LA 3P77A 3C5SA 1HNFA 4CVZA 4G3YL 1S9YB 3LQZB 3UJJH 3T0VA 4HJ0D 5GIRB 3CVHA 4WY7H 3MV11 3ZLQC 2QSTA 4G9FB 2I5YH 4GXVH 1RUMH 5J11C 4JZOB 4S1RL 3V52H 2DD8L 4K07A 1U36A 4HIHB 3ARFB 3MRCA 2BVPA 1NCCH 3PWNA 5I1CH 4V1DB 1DQLH 4TVPL 2UYLA 3OB0K 4KI5D 1OAZH 4FXGB 4KK5D 3TVMA 3QHZL 3TBTB 1OWWA 3EYOA 4MD0B 2NY7L 5JMOC 2PUQT 4R3SA 4TUKL 1IGFL 5BV7H 1A14L 3QEHB 1CFSA 4AIOA 2NXYC 4M03A 1DBBL 1KCKA 5GJSH 4LSUH 2WBWB 4Q9RL 4WUUD 2MJWA 4OCNC 4R26L 3OKLA 3SKMA 3I2CH 3VGAC 4F7MB 3EDEA 4L8CA 4NUGL 5C0AD 3TA3A 4JFZH 2PYFB 5C0GA 1QR4A 4OQTL 5GHWL 4KDWA 3OF6A 1KNOB 1B0GA 4NQDE 2J5LB 2V6HA 1MCKA 3M1BB 3BFOA 3DMMA 2LVCA 4XPFH 4H26A 5KN5B 1KTLB 1EZVX 1RURL 3LS4L 5EUKB 3FKUS 2UY7A 2A6KA 3V6ZA 4PLJD 2GK0A 3EAKA 5B39G 4KUZL 3BKYH 5I74C 1YY8A 3QNZA 3WNPA 1BP3B 3AREA 4XTRD 5EN2A 2VTFA 1TJGH 1WC7A 2Z93A 4Z7VF 1G6RA 4RIRB 4OB5L 2A38A 4LEXH 4NNYA 5EOCH 2EO1A 8CGTA 2X4NB 1W72L 4MDIB 1L7TH 1RJYA 4WI8A 2H1PH 3SJVE 3QIBC 1RZKH 5IOPA 4UTAL 1VADB 1QFHA 2IQ9H 1DLHB 5FYLE 5HYJD 5E5UB 1DCLA 4ZUSB 3WKML 5DDHB 3QEGL 3SKJL 4LKCB 1QFOA 3A6OA 4IMLB 5FO7B 4XBPA 3HI1A 4JFOA 2HKFH 2RBLA 1WQVT 3L5IA 1C5CL 1IM9D 4LQFL 2WBJD 3G6DL 5T5NG 4L4TA 4XPTH 4RMWA 3U36B 4I2XE 2BHUA 2ARJA 3S36L 2FGWL 3Q0HA 5D7JD 2I27N 1DTUA 1GC1C 3QUZC 2B0SH 1K8IA 2F54A 5AAMA 4PJAF 5D8JL 1TVHB 3QUMB 4NQEA 3MRNA 1M6OB 3D3VE 4OGAC 4OM0L 4R4BA 4K3JH 4OZFG 1HH6B 4O2FA 1YN6A 2PO6C 5IQ7H 4RA3A 5D1XA 2WANA 5F1IA 4OZHE 1HSBB 4YEEA 2EZ0D 2R1YA 4GQ9L 5HHMD 4P2QB 5JA8B 1CLYL 4P2RD 2FJHB 5H35A 3A6CH 4YDKH 2DQTH 3WLWD 1MCRA 3BDYL 5LKNA 1EIBA 3QNYA 1KJ2A 4HXAL 1UG9A 4QF1A 1DEEB 1FNEA 2NW2B 2AV7A 5L2KA 3EOTH 3QEUA 4OI8A 5K93A 4WW2C 2DTML 3NCBB 3H7BB 2CKNA 1BM3H 4IHOB 3RGVC 3CSBA 4J3TA 2J6EH 2P8LB 3OXSB 1N5AA 2BY2A 4R4NC 4HPOL 2JJTC 4LKXB 3KPQB 4PLKD 4Y7MA 1NAML 5IB1B 2VERN 4LP4A 2E5EA 3QDME 1HOCB 3C5ZA 5ACZA 1KIQB 1IBGH 1UWEL 2FX9H 1FIGL 2R1WB 2GT9A 3ARBA 3PF2A 1LO5B 3STZA 1ZHNA 1JV5B 3C60C 4PRPA 3VRIA 1JP5A 2XY2A 4OGXL 3UTSE 1JHKL 1U9KA 4X7TA 4PTTB 5AZ2L 5D2NA 4FQJL 4K9EL 4YEFA 3HTLX 2E7MA 4UDTA 1I75A 5ITFB 4JZJC 3LMJH 3VFWA 1REIA 4X5WA 5HYSB 1OD9A 1S7RB 4Z5RB 5BMFL 2NMSA 1A2YB 1NLBL 5IHUL 2HVKA 4OZ4A 5DO2D 1T0NB 4KH2A 2NCMA 3HHRB 5CEXA 2LABA 3QI9B 4Y4KB 1A6WH 3F7PC 4L8BA 3FO9A 3U46B 4Z7WB 2QQQA 2FJGB 2O5ZH 2IPKA 3VD5A 3GHBH 3SKUD 2H6PB 2ZCKL 1G7QB 3T3PE 4WV1C 1T03H 5EU4B 5DJ2B 1ZVHA 5IBTL 4ONFL 1A1OB 2KH2B 3BKJL 4FFWD 2YUVA 35C8H 4X5XB 4XCCL 1DBJL 5DK2A 3W0WE 2XN9D 3F62A 2AEPL 4F33B 5DMKA 2AXHA 5CSZA 1BF2A 2E8YA 3CVHH 4G8IB 3EJYC 1PG7W 5FUOL 3R8BB 2GI7A 4AEFA 1A02N 3OJDA 3O2DL 4PJGA 4RZCA 4YFEA 1QSFB 2VQUA 5IVXF 2HKHH 1T66C 3VE0B 1FNGA 3AS2A 4LLQB 4CJ1A 2HTLD 3IS1X 1CK0H 4DOHE 1D5XA 1F90L 5I8OL 4FQ2L 4Z8FL 3H3PH 4JG0L 1U2HA 3TF7A 5F1OB 4TUOA 2CIKA 4J6RL 4DKAA 5L0QC 4GXUM 5JDSA 4KKBD 4U6XA 1T2QL 4ODWB 1AJ7H 2EIZB 3V4UH 2P1YA 2APXA 3RWEB 5JNYB 1CCZA 3DSFL 3CFEB 3S98A 1CFVL 3QDJB 1KEMH 1AC6A 4JFXB 2EYTA 4ZFGH 1F11A 1NCBL 1YQVH 2AQ3A 4LIQL 4HV8A 5HHXL 4AG4H 4DZ8B 3KJ6L 5JOEA 3U83A 2DB8A 1K5NB 3BD4A 4J3UA 4Z7QE 3BQUB 4N5ED 4R90H 2XIDA 3VWJC 3F12B 5E5MB 3B2VL 3KPRE 5EWIH 4P23D 3FRPG 4P3CL 3KAAA 4NKIL 1MJUL 1G0DA 3QXDB 2F5AH 4NQDA 5F44A 4R7NB 2AXJA 1A64A 5CZVL 1F4XL 1GVIA 2JJWA 4HKXA 5MENB 3D18A 3SBWA 1IL1A 3H42H 4JFYA 1J0HA 2YK1H 3V0WH 3RZCD 3DX8B 3O11B 4U1LB 3P77B 3C5SB 1XF1A 5CIPB 4CVZB 4CL7A 1CE1H 4WI5A 3GIVB 2XZQH 1UCTA 3CVHB 3VD4A 4L4JA 5D71H 1TZGL 4FQ1H 1MJ7H 1BAFH 1MFCL 1U92A 3MRCB 1G7LA 1BMGA 4BH8A 3PWNB 1NSNL 2C7UA 1CVSC 1FORH 3U0WH 4I9WD 2UYLB 4N90D 1MFBH 3D25A 4TOYL 3ES6A 3SJVA 3TVMB 4HH9A 4YDJA 5KOMC 3UYPA 3GSWA 3EYOB 3BUTA 2DN7A 2E8ZA 4GRLD 4R3SB 5ELIA 5DEGA 3D1MC 1EO7A 1WBXA 3T4YA 2CRIA 3UYOD 3V6OA 2D7TL 5C0RL 5E2VL 3H9HA 2X1OA 4M1GH 3TBVA 3DSNA 4FG6C 5EORH 2OR7A 5ISZE 4R4FL 3OKLB 3SKMB 2W60A 1Z9LA 3DURB 5F88A 4NZTL 3TA3B 3CFBA 3ULUH 2WMPA 5C0GB 4ZFOL 1XFPA 2BXYA 3F58L 1SBSH 1B0GB 3DMMB 4N0FA 1TETL 1MRDL 3OZ9H 5GRJH 3FB5A 3TYGL 4H26B 1IAKB 4YHOL 2VXSH 1OARH 1MEXL 2DM2A 2A6KB 4OZHA 3V6ZB 1ZOXA 2GK0B 3MRQA 1CXEA 4S1SL 5DRWA 3VW3L 3V4VL 1YY8B 4LLWB 4HWBA 3QNZB 3PWPA 3AREB 2G75A 1GOFA 3MLXH 3OB8A 3CXDH 3KXFD 4NSKA 2Z93B 2AVGA 4YE4H 3E6FA 1G6RB 1NCAL 4EBQL 3WJLC 4NNYB 3KJ4C 4XC3L 5J6GB 3PWJB 2VLJE 4KHXL 1RJYB 1ETZA 4MXWL 3LH2H 1ZT1A 3P0YL 5IOPB 2DTSA 5CGYD 4Y4HC 4J8RA 5IB4A 5I30H 4MQXD 1ZLUH 2W9EH 3RVXD 4NRZA 3JSSA 3HI1B 4JFOB 1L7IH 2H2PD 4XBPB 3SDXF 1OCWL 5ILTL 1OAKL 1PLGL 3LRHA 4EI5C 3GJEA 4L4TB 4UTBL 5DVLA 1VFUA 4OCRL 2ARJB 4RMQA 4KQ4L 2IH3B 5K9KA 4LARL 3UDWC 4OI7A 2EC9T 2LAAA 4NQEB 3MRNB 2EC8A 4LU5H 4MXQD 4MA8L 3OL2A 5HYFA 2FL5A 1YEHH 4H8WC 4R4BB 1FGVH 3DX6A 5GSRA 4O2FB 1YN6B 2C26A 3QIBA 5ALBH 2VO5A 3HC0A 6CGTA 4ZO7A 9CGTA 5D1XB 1ZGLM 5FCSH 2LVEA 5F1IB 2NY2C 2R1YB 3B5TA 1TXKA 4X6EA 5E8DH 4IJ3C 1B3JA 1UENA 1I7UA 3A6BH 1AGBA 1S7XA 2IF7A 4HUWA 5H35B 4WHCA 2FBJH 4BFBD 5HDQH 3QNYB 1KJ2B 4QF1B 2D03H 4FXLA 1BX2A 1CD0A 1FNEB 3QPXL 4LGSB 4UAOC 2AV7B 3NZHL 1DR9A 2NX5E 3QEUB 4IRJC 1L0YA 2QQLH 2OK0L 5DHYB 3UTTE 2EDEA 4DGVL 2J8OA 4YDIH 2OM5A 4NZRH 2HT4D 1OGTA 3S37L 1N5AB 1NJ9A 4B41A 1ZHLA 1O5DT 4KJYB 2Y6SC 3OKDA 2YMXL 1ROWA 4XP9H 1CGTA 1CTNA 4KMTH 1OAXL 2J4WH 1C7TA 5CCKH 3T2NL 5AZEH 2GT9B 4YHYB 2R2HA 4N9OB 3ARBB 4UV7L 3EFFA 3OJMB 1LO3L 5ANMA 4PRPB 3WUWG 1NCNA 1YEGL 4U6TA 5A2KH 3HPLA 3GMRA 2OQJA 3K1KC 5D1ZD 4X7TB 5IESH 4PJ9A 4MHHG 5D2NB 2DQGL 2AERT 4WW2A 1MCJA 2FEDC 4UDTB 3BAEL 3O41A 1H15A 3VFWB 1FYTE 4X5WB 4JB9H 3ME0A 5C09E 5J9PA 2JJTA 4B53A 2MCPH 5F7LB 4XGZA 1NUGA 4M7LT 2ZJSH 1UJTA 2P46B 3GMOA 2HVKB 1UQSA 4OZ4B 2FRGP 1TQCC 2R2BA 4D9QD 2P5WA 1XR9A 3L5JA 4UNTA 2VH5H 3R06A 5CEXB 1JZ3A 3W5NA 5C71A 1ORSA 5EBLA 1Z0MA 1KJVA 4L8BB 4LVOC 3NABH 1KT2A 3FO9B 3DWTA 5E9DE 3FQXB 2UWEE 4XC1H 2ILLA 3C60A 4KPHL 3MUGA 5D72H 1JZ4A 5KAQG 1FBIH 4GG8A 5FYJD 5BO1L 4DTGL 2YC1B 5CUSH 2Z8SA 4Q97A 4NQTA 2YUXA 4KTDL 3DVIA 2YPKA 4OCYH 4XBEH 5DK2B 1Z2KA 3GKWL 3PHOA 3ARPA 1DANT 5DMKB 5KZCB 5CSZB 1ZTXL 2E6QA 3U9UA 4C56A 5D7LE 4CN1A 2EH8H 4JANA 4OAWB 3WHXB 4PJGB 4JR9H 4RZCB 2WINA 3FTGA 4GFTB 1YNKH 1BQHG 1FNGB 1OTTC 2EDHA 2BNRE 3ET9F 3QEQE 3BSZL 4IDJH 1D5XB 4RFEA 5F71A 4XMLL 4H25A 4TUOB 2CIKB 4ODUA 3OKKA 4P4KC 3VXPA 5JDSB 1NGPL 4CKVX 3HC4L 1FIEA 1I8LC 4U6XB 1BJ8A 5ESQA 3NCYP 1JK8A 4K23L 2HYMA 3RY4A 5HI3D 1CLOH 4NQXA 1QPPA 2EYTB 3MRPA 1F11B 4QGTA 3V95A 2AEQH 4HV8B 2CKBL 4HK3J 1H8NA 1WEJL 3VXSA 3H3BC 2AKRA 5E4IA 2X44D 3QULA 3GI9L 5HGBA 4JM2F 5ISZA 3SKOA 2HJFA 4W4OC 3S88L 4QOKA 2Q76A 4O5LH 4JPKH 4DFIA 1TDQA 4NQDB 3WNMA 3D18B 1WFTA 1GHFH 3I6GA 4JFYB 2IGFH 4AT6A 1RIUH 3KR3H 3LQAL 5CAYB 1NKRA 4JG1H 5DZOA 5D6DC 4OLZH 1Q94A 4HWBH 1FLRL 1U3HD 2P49B 3NMEA 5KS9F 4X6FA 4HAFA 5JMRA 1F4YL 1WAAE 4HEPG 4MQ7A 3NA4A 1XGTA 1LMKA 3EFDL 4XPBL 4CVWA 1U92B 4Y1AD 5EU6A 1HSAA 1G7LB 3VXRE 4BH8B 1TLKA 4G7YL 2PTVA 2C7UB 5TPWL 4MJID 1XCTA 3D48R 3ZKSD 2K3TA 3D25B 5EZIH 3ES6B 4RGNC 3SJVB 4HH9B 1EHLL 2P5EA 1QQDA 3HG1E 3GSWB 3MC0A 1QRKA 4PUBL 5DEGB 1NBVL 5KVEL 2ADGA 1FG2A 1WBXB 5FM5M 3T4YB 1AR1C 1BEYL 4JHAH 4Z77A 1U3YA 3H9HB 3MXVL 2Z31C 1OAYH 1U93A 4MXVE 1U8OA 1XF2A 5ABDE 2G2RA 1PJ9A 3TBVB 2ORBH 1IEAA 4L3EA 3MR9A 4U4BA 5J12C 2AJSH 2W60B 3ZE0E 3ZDZF 1F3JA 1DSFL 1PY4A 3P30L 2XOTA 2BOCA 3JUZA 4N0FB 3RX8A 2ZUWA 1BGXL 3FB5B 1AQKH 3DO3A 3HR5A 4I77L 4LCWA 2MNUA 1URLA 1KGCE 3LV3A 2R0KL 1A3RL 4WHYH 1EH9A 5JO5A 4L8DA 3F7YB 4OZHB 3MRQB 3RBGA 2CO6B 3GHEH 3BH8A 4PS4L 1YQ2A 4AM0A 5DD3H 1RUQH 4IIQC 2LU7A 1MCPL 4JO2H 3V8OA 3V5DA 4K9EC 3PWPB 5FGRA 1CIDA 2G75B 2B4CH 2NY4C 1BZ9A 2NXYB 3BX7C 2UV3A 3VWKD 4NSKB 5F7UA 4FFVD 2XZCL 3VXNB 4NJAH 3E6FB 4K8RD 4PRIA 2A77L 5E2JA 2W0KA 2J88L 3VGAB 4PJ8D 5DURD 2CD0A 1ETZB 4O4YH 4ZUTA 1GGBH 2HT3D 2QQKH 1ZT1B 4XNMA 1YEDA 1HWHB 5A2LH 5FYKH 2VDLL 4J8RB 1FZJA 2DQIH 1QSZA 2X42A 4QRUA 5SV3A 4PJ5A 1MCIA 3UTTA 1UH3A 3ORJA 4EQ2A 4WTZG 4NRZB 1CFQB 1FSKC 5EIVA 2R9HC 1EAPA 2AJXL 3O45A 3H3KA 1OAUL 2JJSA 3G5XA 5IWLA 4QRRE 4RGOH 5K9KB 3NAAH 2E3VA 4FQHA 4LSQL 3U9PL 4Y16A 3DTXA 4M9OA 3RWDB 4JM4L 4ZPVB 4F15B 2FL5B 3FFCE 5I15L 2R4RL 3DX6B 2Y72A 3GO1L 5F9AC 5F9DC 4RGNE 4PLNC 1E4XL 3QIBB 4GKZA 1I1AA 3HC0B 5GRVL 3MTRA 4QNPF 3U2SB 2BJML 1NEZA 4X6EB 3TO4C 4GT7A 2C3GA 2VB5A 5C09A 3BE1L 1I7UB 2APVA 1AGBB 1CDIA 1S7XB 3ARRA 4HUWB 1EFXD 3VA2C 3T8XA 5JORA 4DEPC 3UTZA 3IETA 4NHUA 3SDXA 3S8WA 3RA7L 1BX2B 4L1HA 1BWMA 2VDRL 4OD1L 4KI5C 4E41E 3UDWA 1LEKA 3K4ZA 2L7JA 5AG8A 1J1XH 5HI5C 4OIAA 1OGTB 1NJ9B 2EIBA 4XP5L 3OKDB 5ERWA 5IKCA 3B3IA 3W0WB 1FG9C 3QDGE 3UJTL 5D7LA 2KBGA 2R2HB 3SCMD 3JWOH 3ULSA 1HHJA 3EFFB 1MRFH 1RUKL 4XPAL 5ANMB 3VH8A 4X80H 2UZIL 5ITBL 1F02I 3GMRB 2ADFH 2OQJB 3ARDD 1INEH 1S7VA 3QEQA 4PJ9B 3C2SA 2BVUA 4MA7H 3C9NB 4WW2B 3BISA 1ZA3A 4KKNA 3NA9H 3O41B 1H15B 3U7WH 1MCWW 1JGVH 5LXGL 1VEPA 1B2WL 2XKSA 5J9PB 3V7AG 1YPZF 3GMOB 1R5VA 1UQSB 1TITA 3I75A 2R2BB 3GJFK 2P5WB 1XR9B 3R06B 2HG5A 3FQRA 1ORSB 4NN7C 5EBLB 3P11H 5I6XC 3IDNA 1T5WA 1G7IB 1KJVB 3AM8A 1KT2B 4L3AA 5CINH 5GS2D 1OPGL 1O0VA 3C60B 4UOW1 3MUGB 3FN0L 1UXSA 3P0GB 1MQ8A 3VFOA 1D9KC 1JZ7A 4RDQG 4GG8B 4N1CA 4F7PA 3CDYA 1RULL 1ZEAH 4K7PL 1NQBA 4LSSL 2CLZA 2EDRA 2E7HA 3QAZC 3LKSA 4FQIL 2YPKB 2CJUH 3QDHA 4KK6D 4G8EB 3PHOB 4WCYL 5T5NF 4NKDA 3LS5H 3TBWB 3QPQD 4C56B 3U9UB 4XMKH 5D7JC 4GW1B 1Q0XL 2D4FA 2VXTH 2MFNA 2F58H 4JANB 1CN4A 2ED8A 1MFEL 4GRWE 4CNIA 1J0KA 2G9HB 2AJVH 2WINB 3L9RA 3FTGB 2O61A 2JELL 1QR1A 4OGYL 4P2OA 3P3YA 2C5DC 1CDJA 4OFYA 1PBYA 4KI5E 3MA9L 3UYRH 4RFEB 4PRHD 4LIQE 3WXWH 3MNZA 4H25B 3TEUA 4ODUB 2VR4A 3OKKB 3IFLL 4LNRA 3VXPB 4UBDD 5D7KE 5HHQA 5ESQB 1FNAA 2VLRE 4P2CG 1JK8B 3V6FA 1PYWA 3HCVA 5FUZH 3O0RL 3L3DA 5AAWA 4MVBC 2VL5A 4OQTA 2R2EA 4NQXB 3MRPB 4ZO8A 4X9FA 2VDOH 3ZKMC 4JPVH 5C0AE 1JL8A 2FB4L 2WUBH 2AKRB 1G0XA 5KVFL 4JRYD 1EPFA 3CMOL 3QB7C 3D0VA 3QULB 3EYFA 5HGBB 5ISZB 3VFTA 3SKOB 4Q6IC 3UTPE 3OKOA 2HJFB 1CDBA 1HKLL 5I8EA 4QOKB 4AQ1B 3CMGA 5F1SA 3DARA 1I7RB 4GG6F 1YEKH 4P4KA 1PD6A 3WXVL 5L0QB 1D6VL 3X13A 1BFOB 3I6GB 4IOSD 2JB5L 1I8LA 4AT6B 4FZ8H 2D0HA 4N0YH 5C0CD 5CFHA 1Q94B 2YN3A 1W72A 1OLLA 3S5LG 3LD8C 3RY5A 4X6FB 3MRDA 1PKQE 2V5MA 3VI4F 4MQ7B 4S1QH 1XGTB 3MYZA 3O4LE 3X12A 3WJJC 3A0OA 4LSVL 5EU6B 1HSAB 3VXTB 4HLZG 3NFNA 4O9HL 1O7SA 4LDEB 4EI6A 1M7XA 3W82A 4N9GA 2VLJB 1XCTB 4XWGH 4XPGL 1GAFH 3TJEH 4W4OA 3UTQA 1A7OH 1EERB 4QXUL 5K9QG 2P5EB 1QQDB