1YPZA

Immune receptor
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
260
structure length
260
Chain Sequence
GSHSLRYFYTAVSRPGLGEPWFIIVGYVDDMQVLRFSSKEETPRMAPWLEQEEADNWEQQTRIVTIQGQLSERNLMTLVHFYNKSMDDSHTLQWLQGCDVEPDRHLCLWYNQLAYDSEDLPTLNENPSSCTVGNSTVPHISQDLKSHCSDLLQKYLEKGKERLLRSDPPKAHVTRHPRPEGDVTLRCWALGFYPADITLTWQLNGEELTQDMELVETRPAGDGTFQKWAAVVVPLGKEQSYTCHVYHEGLPEPLILRWGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H2-T22 protein
publication title Structure of a gammadelta T cell receptor in complex with the nonclassical MHC T22.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 48
structure length 260
sequence length 260
chains with identical sequence C
ec nomenclature
pdb deposition date 2005-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ypzA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1ypzA01
2AXGB 1ND0B 1YQVL 4JFPB 3RNKA 3SDCA 2G5BA 1VEOA 4H1LH 2R0WL 2DJ4A 4AENB 3MCG1 5EU6B 3RVXC 4V2CB 1YYMH 4TRPH 3G6JE 3QXDA 2A83B 2IBZX 1PFCA 5DJ8A 1VFMA 3RTQA 1I7TA 4JFQB 3BEVA 4Y4HD 3VFMA 4NKOA 2XA8L 3EO1A 4JFZH 2MCG1 4QKXB 4PRID 3MRMA 1U3HC 2A9MH 3BP5B 1U8HB 3HCVB 2FR4B 2X4PB 1DVFB 1BMGA 4N0CA 2MHAA 2EO1A 1UB6B 1ZA6B 4RMRA 2FEEL 5I1KL 2EZ0D 1KJ3H 5ISZA 4I1NB 2F74B 3RWCA 4PP8C 4JDZB 4P9HC 3T4AB 4PRHD 4XXDB 4Y5XA 1LEGA 3O9WA 3QDHA 4WWKC 1I75A 5I2IB 4JB9H 3KPQB 4OF0A 4U1KA 1ZLVH 4JKPH 1H0DB 3TA3B 4HKJA 3PHQA 1BFTA 4ZNCD 1NGWB 4O51A 3QUML 2YKLH 1R5VA 1SY6H 2AJXL 4RA3A 1PLGL 4X8JB 5DK0A 2VN7A 3MA7B 4AJ0A 2HYMA 2IMNA 5IFAL 4H20H 1UCBL 2AJUL 4JRYA 3MV11 3G04B 3QIBB 1GAFL 3UBXG 5BV7B 3UYPA 4RFOL 1Q9WA 2HJFB 2WWKT 5F9OL 5SWSA 4GRMB 1XGQA 2VLRB 3NIGF 2Y7QA 2BVYA 3EYQD 2WANA 4JPWL 4Y4HC 3OGCA 4K3GA 4JN1H 2ZCLL 7FABH 4DUVA 1WCBB 3DVFA 4QT5A 1JK8A 1EEZA 1UKTA 2XACC 3E8UH 2BXZA 3MACH 5JXAH 1FRGL 4XNUH 5FYLD 4XPTL 3G9VA 1OD9A 1WC7A 1OTSD 4XCEB 3W0WA 1MSPA 2FBJH 3FT3B 1S9WA 2IQ9L 5C70A 1U8JB 5KSBE 4P3WA 5JUEH 4JG1L 4PJDF 1P53A 2EZ0C 4PV9A 1K3IA 1WBZB 4U1LA 3TFKA 1C5BH 1FNEA 4W68A 4DKAA 3X3GH 3SHSA 4X7DC 4PJHF 4QRPE 2IG2H 5CGTA 3B8SA 1OCWL 1YEIL 3OKMB 4BFIA 2XTJB 4TSCL 4G8FB 3S88L 4WFGD 4TSBL 2BCKA 2R39A 1CFTA 2AJVH 3DX9B 2FGWL 2OQJB 4NQCE 2RIKA 4LLVB 3P9MA 4FHBD 3GSNH 3FQWB 2OP4L 3VRJA 3WNKA 4X5WA 3E3QA 3UTQA 3GBNL 4UILH 3VXUE 3RWHA 1W0YT 5ESAB 3EYQC 1B0RA 3OKDA 4XMLH 5HHVL 1C1EH 1A5FL 3QHFL 5J1AA 4BA8A 4JFHD 3HPJB 3IETA 4TN9A 1YUHB 4LNRA 5KANG 5CKAA 4APQA 2RCSL 5D5MB 4X6CB 1A1OA 2J6EL 5I0ZA 3UTZA 4G8GB 4GSDL 5LXGH 1KB9K 4S1RH 2W9EH 1OTSC 1DL7H 2I27N 2QSCL 5EIQA 2YMXH 1B0GA 1KNOB 2DQCL 5LWYH 1LNUA 2LQRA 3H9HA 1DVFD 4XTRD 2R8SL 2J8HA 2NXYB 2K9UA 2FL5B 4NGHH 4JO4H 1LP9F 1AKJB 4LARL 4H1LB 2Q7NA 3Q6FA 4MCYA 4XZUA 3ULVL 4KKLD 1YDPB 5FAAA 4PP2B 3I50L 3UBXI 1ZLWK 4TUKH 4TSAH 3B3IB 4MHHG 5FM8A 1XF3A 5BVJA 1XAUA 2ZUSA 4QXGH 4U2YA 3D39B 3MJ7B 2PTVA 43C9A 2XG4A 4HC1A 5INCB 3K81A 4Z18A 3NIGE 3TA3D 4NQVA 2NW3B 4M6NH 4ZTPH 3ZL4L 4D9QE 1QSVA 3FN3A 3WSQL 5KZCB 5T1MB 5I17B 2GK0A 2CJUL 5GGSA 3F7VB 3GMMA 1BFOB 3B5GA 4HUXB 2EDYA 3VG0H 1F11B 4LRNH 1YEFL 1LD9B 3EGSB 3QIBD 3B2VL 4LEXL 2X05A 3REWA 2F58L 4NP4H 2JK5B 2HFEB 4LQFH 4NQCA 2VLRD 1L7TL 2W9DH 3MBEB 4LVNB 4PJDE 4RGNE 1EAPA 4F15C 3GGWB 4QOKB 1NFKA 2XG5A 4IHOB 1NCBH 5JLZB 3FN0H 3VXUA 3GSWA 3HNTH 4QHMB 4NOBA 5FXCH 4PJHE 4AEHH 2VC2H 1H3WM 2P8PA 1XGYL 4XTRC 1DVFC 4R0LC 5I8CB 4XNQB 2GT9B 1D5IL 5F9JB 1KLGA 1QHOA 1T83A 5KVEL 5SV4A 2X4TB 4FA8A 2WUBL 4KKLC 1TITA 3KVQA 1EGJL 2MCPL 5IEHA 5DHYA 4K55A 5KS9B 2VN4A 1MCPH 2HWZL 3QWOB 1NKRA 3MXVL 5I76B 1JF6A 2JELH 1S9XB 4O2CB 5IV2B 4HIHB 5ID1A 4WFHD 3S36H 4WU7B 2XTJD 5I1HH 3TA3C 3R0MA 1HHIB 5KANI 1NMBL 2Z35A 1EHLH 4YNYA 1SM3H 2JTDA 4MD0A 1NJ9B 2AJ3A 3QJFB 1DP0A 2EEAA 3QIBC 2VZSA 5BV7C 4DK6A 1G9NH 1FG2A 1ZT4A 2AV7B 5JW4M 2EH8H 4NQEB 2BY2A 3V4PL 1X5GA 4XHJD 4C4KT 2F5BH 3DVNA 2IPKA 4ZFGL 3JWDL 1JZ2A 4GW1B 2EDJA 4LCCA 5IJVA 1LP9E 4J3UA 3SGJA 3HC3H 3A0OA 2B2XH 4JPKH 3BYYA 4U1SB 2CLZA 3PGCA 4Z6AT 4LGRB 4ZFOA 1MLCA 1CTNA 1VENA 2CIIB 3IU4L 4MHHI 5HDOA 4J2XA 4G8GD 2DQDH 3OV6A 2CKBH 4HBQA 3F8UB 4JDTL 4M1DH 5EOTA 5DQDL 3QEUB 1CDBA 3FQNA 2FX9H 5TE7L 4PJHA 4DKFH 5JW4Q 5FO9B 3GSNB 4FQLL 2BX5A 5IM7A 5E2UL 5F7EH 4UNTA 4HIEB 5HD8D 4XPBH 2ICEA 2GJ6E 1AR1D 3U1SH 5CEZH 2EYSB 4LQ1A 3L3IA 5CMAA 3QEQE 4X7TA 3QRFM 2XTJC 4M9OA 1UG9A 2HLAB 3I75B 3TBVA 3MRBB 4X98A 2RHEA 3D39D 4W4OC 3H9YA 3TIDB 1KXTB 1J1OL 1AY1L 3AFLA 1QVOA 4LCIL 1AHWB 4KZEL 3B2UD 4CJ1A 4P5MA 5KZCD 3EZJB 3HI5H 4GLRH 3GKWH 3OZ9L 5F72S 4AZ8A 1T04B 3OJDA 3O3BA 3V0WL 1WIUA 3IU3A 4XHJC 5ACZB 5EZLB 2DI9A 3RWGB 2IH3B 1PKQE 2BK8A 4PD4K 1CIUA 2APTA 1AR2A 2BVOB 3FOLB 3Q5OA 4LOUD 5IBTL 1TTFA 4OFDA 4HSQA 1NLBL 3BKYH 1DBBH 3WEXA 5CJXA 4ZG1A 5DJ2B 1G1CA 2W0KA 4QOKD 4WI6A 1ZGLB 1AJ7H 3WHE0 1SEBA 3CFDB 3CXDH 1E4XH 4FQCH 1KTDB 2VDOL 3QNYB 5F1NB 3WS3B 1UJ3A 2PR4L 4AM0A 4LRIC 5E4IA 1ZTXL 3L1OL 4ACPA 4O02L 1J5OH 4HZAA 1C5CH 5FGCB 1IZJA 1O7VA 3OAZH 1RURH 4O5LH 4HS8H 5I15H 4HW6A 3I3EA 4NQUA 4NOFA 1YY8A 5J13B 5C0AB 4WW2B 4HUVA 3JTSA 4HC1L 1NANH 5H94B 5HD8C 3NACL 1AR1C 4PRPA 4UV7H 5GGUB 1QTYT 2HFFB 1A14L 3KPLB 1YJDC 1P4BH 5D93B 1ORSA 3GSXB 3FONA 1MHCB 4PV8B 1MFAH 1XIWB 3T2NH 4P2QE 5TF1L 3I02B 3ZT6A 3ULVD 2GJ6A 3GSRB 1JCKA 1KENH 3B2UC 3N0PB 4NRZB 1NAMH 4QRRB 2ZUUA 3HC4L 4MA3B 4XBPB 1W0WA 1W72L 1WFUA 4G6ML 3NH7L 2PKDA 4LOUC 2J88L 1DDHA 2R1WA 4LVNC 4HK0B 1FNSH 5HJ3B 1FL3B 3PGDA 3MRKB 3W5MA 1DUZA 2HVJB 2AQ2A 1BQHG 1DQML 3EDFA 4R7NB 4WHTB 5BQ7B 5GRVL 1JWUB 3DECA 4OQTH 5KVFL 1A0QH 3CSYA 2XWTA 3FQRA 1FLRL 2FCBA 3GK8H 4JJ5A 1KBGL 3BZ4B 1U2CA 5HYSG 4C59B 1E6JL 4NBYB 1N7ML 3T0WA 5GS2H 3U36B 1C08B 3GUTA 2HG5A 5HHMB 5C7XH 4EOWL 5DEGB 3SPVB 2CLRA 5AZ2H 1J18A 3G5ZB 3O4LB 1BQLL 4L3CA 4LGPB 3BISA 2LU4A 3CZFB 1T89A 2YK1H 1I4FA 3BEWB 3Q6GH 3DX8A 3ULVC 4FQXB 4HLZH 5IKCB 1HHGB 1QFOA 1FL5A 5CZVH 1XH3B 1OD7A 3N1MC 2X5PA 4L3EE 3QPXH 1S5IH 4GG6B 1JF1A 5JW4R 3TZVB 1R3JB 2PF6A 1ULVA 1A1NA 4ZD3H 1JFMA 1RD6A 3BYTA 2XY2A 4X9GA 3SKOA 5FK9B 2ED9A 1N6VA 2DKMA 1GC1H 1ZA3A 5E00A 3DHMA 3MLXL 3QO1A 3WL9A 2QQNH 1DBAL 3QDMD 3QUKA 2JJWA 4HZLB 4ONFL 3U7YH 2A1WL 2P5EA 3MQIA 3GMLA 3GIZL 2ADIA 5FB8B 2X9WA 1TVBA 5SWZB 1A2YB 3WFBH 2Y07L 4HXBH 1YEKL 5K9OB 4TUOA 1XR8A 3DUUB 3KPRD 3O6MH 5E8PA 1JNHB 5D6DA 2VNCA 1KYOJ 3MRLB 4JZOA 4XRCB 4L8SA 3BRGC 3SBWA 1ZEAL 3PQYE 4PJ8B 5C0AD 3JV5A 5EO1B 4YK4B 1M71A 3HLAB 4NKIH 1OAKH 4HAFA 1H3TA 3EYSH 3HAEH 1FZOA 4OBRA 5DJAA 5HGBA 5T1LD 3KPPB 1KLUA 2NY7L 3QIUB 1P5VA 1T21A 4X4ME 1XIWD 1F8TH 5GGRB 2ZJSH 5DRXA 3HRPA 3I2CL 4ZUTA 4R4ND 1MFCH 5JMRA 1AHWC 1ZGLM 4GRWB 4HCRH 3L3GA 4QCIB 4AMKH 1BFSA 5LGKA 5I0DA 4QRRD 4CMMB 1N4XL 4JKWA 4OFIA 4XWGH 4TNVK 1VEMA 5KSVA 2BHZA 4AL8L 1NC4B 4FTVE 1RK1A 1S7XA 4L3EA 2NX5E 4UOW1 3V6BR 2WIMA 5TJWK 2CMRH 3WDJA 5DEFA 4Y4FA 1MCHA 4MXQD 4ODXA 1MJUL 5EORL 3DURB 1LDPL 4QGYA 3WIHH 4HS6B 3D0LA 3SDAA 5IEKB 2G2RB 4F7CB 1NGPL 3LKPA 3KYNA 1ZT7B 3JWDC 1A3LH 2XRAL 4XPAH 2ADFL 5D2NE 4RBPH 4YQXH 4DQOL 4XVUD 3E0GA 3P4MA 4F9LA 3AXLA 3CLEH 4M93B 3P4NA 1NAMB 2NNAB 4KTEH 1M7DB 5HHMD 3VI3F 1W8NA 3L3JA 4X6FB 4A6YH 5J13C 4WW2C 3W9DA 1E4WL 1PGRB 5C3TA 1RZGA 1BIIB 1JNNL 1GGCL 1U9KA 3O4LD 2HRPL 3MNVB 4R8WH 4XP5L 4C83B 1XIWC 2Q8BL 1N2RA 4WHYH 3K4AA 3CFIC 5EDXA 1I1CA 1YNLH 1Q1JH 4NBXB 4R4NC 4O2FA 3VXPA 1DQJB 4NQDE 1BQUA 4KV5F 4LSRL 5DDHA 3J7HA 4Y2DB 2O93L 3K3QA 4X4MA 4AYFA 1UYWH 1I1AA 3Q2CA 3ARTA 3TZVD 5ICXB 2FWOB 2VZTA 2DI8A 3CCHA 5IJKC 1NMAL 1KTRL 2ZG3A 3K1KC 3DYOA 1G6RB 3SE8H 1BZ9B 3ARYA 3DHJA 4UUJA 4YGVA 4Q7DA 4MXQC 4GLRI 4M3JA 4AEFA 4PGCA 4PJFF 5IR1B 4PRBB 4WEMB 5ALBL 4P4KB 2EH7L 1WZMA 1A7RH 5ERWB 5C2UB 3VRIA 4F7TB 1Z6JT 1RUPH 5SWZD 4DVBB 2ILLA 2W65A 4MJIE 5CGYD 4G6JH 2C3VB 4XVUC 2XXMB 2QHLA 1YYLL 1E6OH 1OSZB 4HLZG 4KPHL 4P2RB 2P24B 4DGVL 4X0KB 1JHTA 4PJAB 1PYWB 2P8LB 1KTLB 2YUVA 5IBLD 3LEYH 1E4XI 1WUNT 3NFSL 2E9JA 4FFZL 3QG7L 2LVEA 3N9GL 1RZFH 5D2NA 4XCCL 2C3WA 5MP6L 2X1OA 1R5IA 1SJHA 2VYRE 5C6TL 3RGVD 1VGEL 5CJ5A 1K8DA 4PJGB 1R3HA 5DJZB 4HPYH 4XC1L 4RZCB 4ZS7H 1OLZA 2CD0A 4WCYH 5DJ6B 3QIUD 3ZTNH 2VQ1B 3P2TA 5FHBH 2EE6A 4I3GA 3I85A 5BS0E 4YWGH 2BXYA 3T0BA 2DRUA 4PYGA 2LU3A 1EA9C 4MQ7A 3CDCA 3HKFA 4IMLA 5AUMB 3TZVC 5T3XH 4JRXE 2J7LA 3VXSD 2Z8SA 3GMPB 5GSVA 4LLQB 5IG7B 4KQ4H 4NQDA 4Y1AB 2C4XA 1T5XB 4LF3A 2A6JB 1U2HA 4ZTOH 2IADB 4WHDA 1ERNA 2F53B 5IW3A 1CFVH 3HAEB 3D85D 1KPUA 1I9EA 3VI3E 5C09E 2Y4SA 2V2WB 2M2DA 3QO0A 1AIFB 3BMWA 5T1DL 4HWBA 3EYOA 3MJ8A 2FB4L 3MV01 1KN2L 1RIHH 5CGYC 3SCMD 1F02I 2DD8H 5IW6A 2C3GA 2ZCHH 3T2QA 3W2DH 5HYJE 3T0DA 3NZHL 3ZTJH 5IBLC 3FO1B 3EFFA 5K9KA 2DWDB 3S6CA 3U30B 4OF5A 4KV5E 4MJIA 1X3DA 2XWJA 3BP6B 3RGVC 1IM9B 3LZFL 3IRZA 5KOVC 1FHGA 1JWMB 3O2DH 1TJIL 2NY5L 4JGMA 5BZWA 3QIUC 4FFEX 5IHZB 3CH8A 1X6LA 4DN4L 2YD3A 2EDDA 2EEBA 3RHWK 1CLYL 3EDKA 2G75A 2Q20A 4YFLF 3MPCA 5EO9A 3U46B 1OAUL 2I60H 5A2LH 2IANB 3PWPB 4PJFE 1MNUH 4N8VG 2WINB 2MPAH 3SKNA 4Y2DD 5EH1A 2YSSA 3I3BA 4ODVH 2QSTA 5BJTA 1IGFL 3UPAA 3VE0A 5BS0A 4MQSB 3HNSL 4OLWL 4RNRB 3GMNB 2D7OA 5MERB 1HSBA 1INDH 1MCWM 4KJWD 3IJYB 2P7TB 1UB5B 3D1MC 3T4YA 2OI9A 4ZSOA 2BRRH 5DQ9A 1TVDA 3UTSE 2X70A 4M5YL 5B39B 1HHHB 1UACH 4GXVL 2BSTA 3BH8B 4BZYA 1CBVL 3BGFC 3FB5B 3B5HA 4ISVA 5C6WH 4MVBA 4LEOB 1IGML 4YPJA 3ROOB 3SCMC 5C9JB 2CLVA 3FQUB 3DX6B 4Z95L 3U4EA 4WHYG 4I18B 4OTXH 1TJHL 4Q9QL 2VDRL 4J1UA 2FX7H 2GKIA 4M93C 1I8LC 4PJCA 4P2RD 2VLKB 3WFEL 2R4SH 1MCSA 4I2XE 4U1HA 2Y36L 5D7IF 5E95B 3UYRH 4NDMA 3QDJE 2VKXA 5HYJA 1QSEB 1MJ7L 3M45A 3MUY1 5GGTL 2C1OA 3V7AE 1QBBA 1T1WB 1GSMA 1Z0NA 1X6NA 3IDUA 5HYEA 1RAMA 1V7NL 4G43B 2ZUWA 3VFGL 4Y2DC 2BVQB 4P3DB 4ODHL 2DLEA 3TYGH 2VDNH 3EOBB 4RSVA 5DMKB 3NFNA 1R3KB 3VXQB 4DZ8A 4OT1H 2LE9A 3LPWA 4EVNB 3F12B 3SDYL 1ETZA 2EE2A 3QWQB 4KJWC 4NNPL 4Y1AD 4PJFA 5GZOD 4P23A 4JKLA 1HZHL 3SKJL 4FOMA 1MFBL 1WGOA 4LCUA 4XCNB 5EFIB 4KKAD 2F53D 4JFYB 3P77B 5IT2H 3KPTA 1DUYB 4EI5D 1EO8H 2X2YA 5J1TC 1EIBA 4PREA 2PYEB 2V6HA 1JMZA 2R0WH 3UTSA 2IQAB 1HK6A 1KCRL 2C9AA 3HE6B 5D6CA 3LQZA 2ATPB 2IBZY 2E7HA 2Z93A 1U8LB 4GAJH 5JW4N 2P47B 2QQKH 2K7PA 3KPNB 4NWTH 1GC1C 1UC6A 3EUUA 2XA8H 5F70A 4UT9L 1IEAA 2I07B 1KEML 5D1XD 3CUPB 1IM9D 1AO7B 4OI7A 2P45B 4WI2A 1WBYA 2Z92B 4I2XA 2MKLC 3ZDZF 32C2A 5LBSL 1KN4L 2CRYA 1FAIL 2VAJA 1OPGL 4TPRL 3D3VA 4M6ML 3QNXA 2IAND 4N0UB 1XGUB 3Q1SH 3RIAF 3PWPD 3U82B 4U6VL 3T1FA 5F21B 5M7QA 5EBGA 2AK4E 1CE6B 1HSAB 4Y5YC 1NGXB 3PWUB 2H8PA 1UZ8B 4JDVB 3FHQA 4NFBA 1JI1A 1P84K 4CVUA 5GZOC 5E8OA 5E99H 1JPTL 3VFWB 5TGBB 2ZUTA 2R4RL 3EBAA 3VXTA 2W60A 3ZTJG 3NA4A 4KKAC 3HMXA 3IXTB 1SBBA 1OF2A 4M7JH 4ODTH 1N8ZB 2ZOLB 3AY4A 3BPCA 4EI5C 5KSAA 4CVXA 3QUMH 4C56D 3ARDD 3HG1B 4R3SA 5D7IE 2AJXH 5I16B 4I5BA 3I6GB 5AG9A 3TBTB 1VFBB 1MIML 2YUWA 2Q76B 5IFAH 2ZNXA 5ETUB 4FNLL 2VH5H 2ZG2A 4XBEH 4KGLA 5C0CA 1QNZH 5GRJL 2G5RA 4UU9A 5ACLA 1II4E 3JZ7A 2W07A 5F9OH 3OHXA 1PY4A 4UIKL 3CLFH 2A6DA 5TFSL 5I1JL 3ETBF 5BXFB 2VLKD 3U79A 2E6QA 3TF7C 1A6AB 3U30C 1FZMA 3UTTD 4F9PC 2OTPA 4Z77B 5F6HJ 5D1XC 2BC4A 2ITDB 3KPSE 1B6UA 1J0IA 1I1YB 2DQJL 3BDYL 1SQ2N 5A2IH 3SGEI 3OMZA 5T3ZL 1JHKH 1P1ZB 3U0WL 1QSED 1MCEA 4GO6B 4MQTB 5HY9B 5E5MB 3VD3A 5SWQB 3FT2B 2FO1A 1N59B 3NMEA 1WT5C 1PZ5A 2YD2A 4JG1H 3MR9B 5GZND 1N0XH 1C16B 1BHGA 2AGJL 5GGVH 4JO3H 3HNVH 3ROLB 3KHOA 4YHML 1WV7T 5DVOA 3WHXA 4NNYB 4LHUG 5HDQH 3BI9X 3DETD 5BW7C 4Z7WF 3P11L 2PW1A 5LKNA 4EIGB 3B43A 3ZSSA 4PR5A 2ZP0T 2FJGB 2XZQL 4OJFL 2GTWB 5DUBA 5E2WH 5IB1A 1YEIH 2GSGB 4LCYB 4YBQD 5ANME 3DTXB 4BK4A 1FH5H 2FHBA 4CMHB 1TZHB 1Y0LB 1WISA 4KROD 3MRHA 2AK4A 4TSBH 4CN1A 3ARDC 3O6KL 1CXFA 4WI8A 3OKLB 1ZWIA 3KLDA 3CVIL 2IPTL 4PUBH 1E4JA 2PYED 3OB0K 4Z78A 1BZQK 4LSPL 2Q7YA 3B9DA 2OP4H 1JV5B 5TDNA 1KJ2A 2UWEB 4I18C 5GPRA 1EJOH 2XOTA 5D7IA 4U7SA 3ZDZE 3EYUL 5CJQH 2I26N 3TT3L 5IBUB 5FF6A 4KDTA 5HHVH 1Y6NR 4M9PA 3SKMB 4QHLB 1E4KC 3KYKL 3QHFH 1RK0B 3ARGA 3VGHA 2NY3B 4G9DA 5GQBA 3FRPA 3UC0L 3QXTA 2EIDA 4J8RA 3IFLH 3E2HA 4OLUL 1YEEL 4YDLC 5ILTH 1NAKH 3QDGA 5EU7C 2R8SH 5GZNC 2ARJQ 3PABB 3ARZA 3KPSA 3UP1A 1TMCA 4HKXB 3MRQA 2CR6A 4LARH 4ZYKA 1KIRA 3SGKC 3DETC 1BLNA 5L88H 3MV9D 2QR0B 1PJ9A 2ICWB 2NY5C 3ARFA 5KTEH 4KHTH 4X4ZA 4MD4B 1EDQA 1IAIH 4NQXA 5CP3H 1TCRA 4TNWF 1PG7H 4Y16A 4YBQC 3WJJC 3QWRA 1I9JL 5FV1L 3AROA 4EUPA 3QH3B 4KROC 3P3YA 1WK0A 3ARXA 3RL2B 1MREH 2YRZA 4NC1E 1OB1B 4CBPA 5DD6A 3OX8B 4BQ6A 2UY7A 5C0EB 3FO2B 3X3FH 2Y25A 5EO0B 4PJIF 3HG1D 1OGAE 4WEBH 4QO1A 5ENWB 3PGFH 5JOPE 5KVGH 2X1XR 5F7FA 4FN0A 1YEFH 3LKQA 5FYKE 5DJYA 3LH2L 3UYOD 4LEXH 3AM8C 1CL7L 3MROA 4MGXA 4I13B 5K59F 1M4KA 5A2FA 5CAYB 5EPMA 3ALXA 1X5ZA 3N1FC 5EZOL 4CAGA 2V9QA 2XN9B 4XAWH 4UQ3A 5J89A 5IOPB 4HEPG 3THMH 1Z2KA 4JFFB 2G9HA 2YRLA 4Z7WE 2FJFA 2GAZA 2IBGA 1G7IA 3HUJB 1ACYH 3FRUA 3IDXL 2D7MA 4LLDB 5K93A 4W70A 1Q72H 1MFDL 3HS0B 1T1ZA 1T3FA 1D5IH 3LSOB 3BW9B 3CDGA 1AE6L 2IAMA 3DWTA 3L3KB 2EDKA 5EU6E 4WENB 4KY1L 4YHKH 2DQUL 3DXAE 1NGYA 5FUZH 4H25B 3V0VA 3RY6A 3WBDA 5IIEB 1MVFA 1K6QL 3PP4H 3N1QC 3MXVH 5I74B 5C07B 4ZAKA 5JO5A 3I6LE 3L3OA 3TYFB 1IBGL 2BSSA 3TVMB 3GB7B 5DGQA 3FB7A 3DYPA 2X4NB 2I5YL 4HGKC 5IROC 2AJYH 3QISA 1NMBH 3DNKA 3N1GC 1A7BA 1S7VB 3PHOB 3WIIL 2O5YL 3IDJA 4H0GA 4JFXB 1REIA 4P2OB 5CBAB 4D0DA 2W0LA 2V17H 3BWAA 1MRDL 5JW3L 2GYSA 4WU5B 5DHVA 1N64L 2MOVA 3FZUD 4PGBA 1AGFB 5IWLA 3NCYP 1NGQL 3S5LA 5ESQA 3TCLA 1FYTE 1F5WA 3D69A 1S7TA 2GFBA 4RRPG 5EU5B 4QXWA 2R0LH 3P73A 1G7MA 3JTCA 3VD7A 2Q3AA 2NY3D 3MNZB 4P46A 3JUYA 1A4JB 3C5SA 5I30H 1SVZA 3QA3A 4JAMB 5FOBB 4TVPH 4NO2A 5DQDH 4WGVB 3IDMB 1HINL 5TE7H 1INQA 4MXWH 3HR5B 1C12A 1PG7W 4PJIE 5E2UH 3MCKB 4KDVA 2X44D 5T3ZD 1JZ3A 1LDSA 2F19L 2B0SL 2FO4A 4NSKB 3FT4B 3MC0A 1EUTA 1KJMA 3DMMA 3D6GA 4DCQA 2QEJA 4WY7L 1T03L 2OR9L 1QPXA 3D9AH 1B2WL 3PWNB 5INDB 1IKFL 4E5XA 3MLRH 4XP4H 5LG1A 3CIQA 5GS3A 4YDKL 2FEEI 5K59E 1T0PB 4MS8D 4KRLB 3TH3T 3UTPE 4E0RB 3U9PL 4EN3A 1UWEL 5E6IA 2YWYA 1AY1H 4DKEL 1XZ0B 5D8JL 4Q9RH 1IGCL 2R1XA 5LQBL 4K3EH 2Y06H 4F33B 1F6FB 5FA4B 1X5IA 3FZUC 1NFDB 1JGUH 3LKOA 5IB4B 1WBXB 1X5LA 2XV6B 3U2SA 1OHQA 2KBGA 2VO5A 3B8YA 3LKSA 1H3XA 5IBTH 3X14B 4JY6A 5C08E 4U1MB 3BKJL 4LPCA 2X4SB 3LIZL 4JFFD 2NY3C 2HA1A 1XF5A 2VDOH 3SDCB 5KS9F 2G5BB 4OCSL 4KRPD 1CFSB 1RZJL 4G7YH 2F5AH 2P4AB 2AP2A 2B1AH 1FIGL 3SEPA 1QLFA 3FFCD 2VISA 3FL7A 1HXYA 1DBML 3MFFA 4OD1L 4EI6B 4I77H 3IRPX 3RTQB 2UZIH 1I7TB 3UBXA 3QCUL 1OAZL 3LMJH 4UTAL 1KELL 3BEVB 3VFMB 1W8OA 4LPWA 4QRUB 4NKOB 4HT1H 2E7LC 1F4HA 4HC1H 5C0DB 3MRMB 5IUSA 2DMBA 3CVHL 5HHXH 3QFDB 5BOPA 5I1DA 3TVMD 4MS8C 3MRGB 2MHAB 4PJIA 1DQDH 5TF1H 4AEIL 3HN3A 5DJDA 4NJ9L 3QUYD 5DR5H 4U33A 2Y5TA 4U0RB 5ISZB 1RZKH 3I9GH 4K7FA 3HI1A 1KB5A 1T5WB 4QXTA 5BO1L 4H5SB 3RWCB 3FMGH 5MENA 1D9KA 1JGVL 3C9NA 5CFHA 2KDGA 1LEGB 1OT1A 3O9WB 4C57C 3QB7C 5DURB 3NH7H 2PXYD 5KG9A 4KVNL 4U1KB 2VXTL 4M43L 5CSZB 4Y0GA 3BT2L 5L2KB 1P6FA 4HKJB 2R2BA 3P9LB 3VXME 3PHQB 4O51B 2A9NH 4PRNA 2ENSA 12E8L 1AXTL 4ONGL 2P43B 3MODH 4KRPC 5E94A 1MHHA 5DK0B 5KVFH 2R2EA 3KS0J 4JHWH 4JRYB 5C08A 4KJYA 2JB5H 1Q9WB 4KQ3L 3TGXA 3QI9D 5SWSB 2MQ3A 1XGQB 2J12B 2CUHA 1EO5A 1K4DA 4ZFZB 3VFTA 4N9GA 3OGCB 1F00I 5GRWA 2YPLE 4G7VH 1LO4L 4QT5B 5DMIH 3GMRB 1JK8B 2CDEA 1EEZB 1ADQL 5CILH 1JWSA 2RB8A 1BQLH 2EYRA 2GITA 5I74C 1J11A 1WC7B 3VGBA 3TVMC 2APXA 1EERB 4K3JH 3IXAA 2W9LA 2ITCB 3CFBB 5BZDA 2ZPKH 5F9WB 4GMSL 2CQVA 5CD3A 3FOMA 4CKVX 1PW3A 1BEYL 5LGJA 3QUYC 4RAVA 3UPCA 4C54A 4LVOC 4OKVB 1AI1L 4PV9B 1FORL 1I3UA 1HKLH 3OJMB 4U1LB 4JO2H 1FNEB 2NLJA 2FJHA 5ICYA 3PIQA 1MCOL 5KS9E 2EIZB 5B38G 2PXYC 3O2VL 2FIKA 4BFIB 2HFTA 2DM4A 3NFPA 5C0IA 3TLRA 5DEZA 2YWZA 2VE6A 5A1AA 2AI0L 2BCKB 4QHKJ 3QR2A 2E8YA 1CFTB 1WEJL 2BMKA 1MQKH 1NCCH 4N8PA 3NABL 4O58H 3EYFA 3SDCD 3P9MB 3TO4A 1KCSL 1YMMA 5E9DA 5TE4H 3VXMA 1ZHNA 3PJSB 5C2BL 1SYSA 3QI9C 4X5WB 5BVPL 4UNUA 4U3XA 3RWHB 1MI5A 2R0KL 4NQEE 1B0RB 3OKDB 1YNTB 1MCJA 1IC5H 5J1AB 2E27H 3AREB 4OCWL 5FKAA 1X44A 1OTTD 4LNRB 4X6DF 4HWUA 4APQB 4OM1H 1A1OB 3UTZB 3V6OC 4O4YL 2YD8A 1WIPA 1B0GB 2NY7H 2YPLA 5F7HA 3H9HB 2VERN 4N0CD 1LE9A 4WUUE 3TNMA 3I2CH 2MMXA 2Y5EA 1JF5A 2XQYG 4MCYB 4XZUB 1U6AH 1UWGH 5ISZD 1A7NL 3WLBB 3DUSA 3VD5A 4KAQL 4GKNA 4R9HA 1X5JA 4PB0H 1TENA 1T22A 1SY6A 4ZDHA 1XGRB 1F4WH 3O9WD 4AL8H 3PV6B 4E41A 5BVJB 1XF3B 4ZNEE 1XR9B 43C9B 4FQ1H 1QACA 3X13A 3U9UB 4NQVB 4P59L 4QRPB 4YHIA 3IAGC 5L2KD 3OAYH 1IMHC 4F7PA 1V3KA 3M8OL 4HLJA 2E6PA 5TQ0L 2GK0B 4YFDB 5GGSB 3SDCC 2AXJA 3MOBL 2FGZA 4PJ5A 3RBGA 3CSBA 1ZANL 1NGPH 4JRYD 4KMQA 5L0QC 1I7RA 3PF2A 2XFXA 3QIWA 2HVKA 3REWB 5JW5A 3QUZA 5SWSD 4DQOH 4NQCB 4LFHG 1U8PB 3RWJA 2OZ4L 6FABL 1EAPB 3ZE1F 3WXVL 1OTTC 4YHNA 5L7XL 3HC0A 1P84J 4IOIA 4X9FA 1E4WH 3VXUB 3GSWB 3BIKA 4XVSH 4NWUL 1VACA 4J12A 2P8PB 4Y88A 1CD1A 3OJVC 4N0CC 2Q8BH 4NC2B 4X4XA 4HUNB 1KLGB 1NDGA 1QFWM 3DSNA 3UO1H 1J12A 4U0RC 5FGCE 4LSRH 4R4BB 5IEHB 3EO9H 5FYJH 1IM3B 3TFKD 4M61A 1OAXL 5BCAA 1A47A 2CIKA 4WUUA 4RMQA 4BH8A 5KBNC 4XVTL 3O9WC 4JY5H 1Q8MA 4GQ9L 4BSVA 1RJZA 2AEPH 1LO3H 1A6UH 4TOYL 2FLBT 4TQEH 1PQZA 3BE1H 4L29A 2Z35B 5F7MC 1RHFA 3C2AH 3MV7A 3R1GH 4ZQKA 4MZ2A 5IFHL 4XP9L 2AJ3B 4ZNEA 5TDPA 4AIZA 1FNGA 4ODUB 2HKHL 4R4FL 3BKCH 1FG2B 1ZT4B 4JQXA 3PDDA 5F7KC 3HE7A 5HGAA 4LGSB 1X4XA 2IPKB 2P48B 4DGVH 1DCLA 1UM4L 1RZ7L 2H26A 4OLZH 4LCCB 5IJVB 4OD2A 3B9KD 1D5XA 2UZYB 2OMBA 2CLZB 3PGCB 3ARED 3NFSH 4FFZH 5F3HA 4ZFOB 1MLCB 2VDLH 1RZJC 1H5BC 2XY1A 3QG7H 3QXUA 1S5HB 3OL2A 2MKWA 1VGEH 1B9ZA 5AYUL 3F58H 4RGNB 4ZS6D 1AFVL 5FYJU 2D31A 3GO1L 5FUOL 3BUTA 5F9WC 1CGWA 2IFGA 1NSNL 5EOTB 3BUYA 2BJML 3FQNB 4DW2L 3BAEL 1F58L 4PJHB 4NKMA 4HQQL 3SDDA 1X9QA 1UT9A 1HYRC 3TFKC 1JVKA 1ZHKA 5IM7B 1UWXH 1RIUL 2D2OA 1IQWH 1JNJA 4M3KB 3MJ9L 5AEAA 4DKDC 5CMAB 3L3IB 2QKIA 4X7TB 3J8F7 3WFCL 1CTOA 1FAKT 2J4WH 3TBVB 2DJSA 2VUYA 1KTKE 1Q9OA 4HJ0D 4KDWA 4QRPD 3ZE1E 3UJTL 4FFVD 4JVUA 1QVOB 3P4OA 4XPFL 3ZE2F 4P5MB 1QLEL 4OCRL 5T1DH 3WNPA 4AG4H 3IF1A 1KN2H 1NMCC 3TN0A 5GHWH 4MWFA 3O3BB 2GJZA 3IU3B 5JZ7D 4GKOA 1IEBA 4CDGC 4X6DA 4QEGA 3MUZ1 4Z9KB 1MHPL 1M7XA 4NQCD 1BBJA 5D70H 3B9KC 3QZWA 1A3RL 3EDEA 3AREC 3WEXB 4JFDA 4HFUH 5SX5K 1M05A 4K8RH 4AT6B 3C09B 3T09A 2DBLL 5CEZE 2B39A 3LRGA 2YPKA 3LZFH 4NRXB 4P5KB 3VXUD 1UJ3B 4ZS6C 1TXKA 4X99B 3VFSA 4KTDL 1TJIH 4YBLB 4CVWA 4AM0B 1LP9B 3QQ4A 1BQHA 1RFDH 4JHZA 4L8BA 1EFQA 1JRHL 3MRCA 4N0FA 2BSRA 3G08A 1UGNA 2FD6H 2XYCA 5HYSA 5I8EB 5L8KB 3NTCL 2OL3L 5AG8A 5B8CC 1YY8B 2BHYA 4JM2F 3JTSB 1G7HA 1VFAA 1N6QL 3CMOL 2PO6A 5DRNA 5CIPA 4HF5L 3ARRA 1TQBB 3HNSH 5KW9L 1FFNA 1A7PL 5C6PB 1ORSB 3FONB 4LDOB 2JIXB 1TZIA 2DQGH 4UAOB 3SO3C 4GRLB 2DN7A 1B88A 4HJ0C 1BVKA 1CICA 5HPMA 1J8HE 4FFVC 3P0YH 2GJ6B 4Q9CA 1KJVA 3FN9A 4KVCH 3QEQB 4HKBA 3EYVB 3VXNA 1NCAH 1UA6L 1HIML 1MAML 1LHZA 4GXVH 3MA9L 2DTSA 3SN6N 2PTTA 1KT2A 4J3OC 5JZ7C 3KJ4B 1FO0L 2VIRB 5I66A 2NW2B 4ZUSA 3GFUA 5E8EB 4PJGF 3TV3L 4Z95H 4Y2OA 1G7QA 4D9QD 4GBXD 4Q9QH 1DDHB 5I1CL 1SEQL 2R1WB 3S35H 4X4YB 2CKBA 3EDJA 4NO0D 3WFEH 2Z0BA 2BNRE 4LSUH 3M17A 2IPUK 3CJJA 3RAJH 2F54E 4ZOEA 5E1HB 2X1WL 2KZWA 1JHLH 1PKQB 4RGOL 5I18H 3K74B 3C6LD 3CSYB 2XWTB 1MJ7H 5MEOA 4QYOA 4WTXA 5GGTH 4UT6L 3JWOC 4RGND 2QQLH 4QRTA 2JJVA 2XZAL 1CFQA 3FB6A 1NPUA 1T83C 1LO2H 4IRZL 3GUTB 3MLYL 3CNKA 2ZSWA 2HG5B 4W81A 4YDIL 3TT1H 5BMFL 3C08H 1V7NH 3K1DA 4JPVH 3VFGH 3ZE2E 1N3NA 4OFYA 3GJFK 1INEL 4LPTA 3RUGF 4L3CB 3GNML 1MIEL 4OCLC 3SDYH 4OGAD 2Z8WC 1NC2A 5EOCH 4NNPH 1MCIA 1I4FB 3NCMA 1BJ8A 5HBBA 3SKJH 3MV8A 2OL3B 3G9AB 1ZSDA 1FL5B 1QZ1A 1F2QA 2R29L 1G7JA 1HXMA 5E2TH 4D0CA 5MHSE 5MEQA 5E2VL 1JP5A 3LKRB 4OIAA 4NT6A 1JF1B 1A1NB 4PY8J 1AGCA 2MWCA 3SKOB 1ZLUH 2VJXA 4OAWB 4GBXC 1ZA3B 5E00B 4FZEL 5HVHB 4PJ9D 1G84A 2HN7A 4G5ZH 1UQSA 1QBLL 5IFJA 3QUKB 3ZT5A 1LEIB 1TIUA 2ICES 5E1AA 5A2KH 4IRJB 3BOVA 4F57L 5CINH 4GW5A 1CXIA 2XZZA 3GMLB 2A2QT 4UT9H 2ADIB 3C6LC 5GRUL 3L5JA 1DEEA 1TVBB 1KFAH 4RGNC 5FGRA 2BNRA 1D5ZA 5SX4H 3VRLF 2ZUYA 3S96A 2F54A 1XR8B 4YC2B 5LBSH 4OZIA 5FM5O 4NZUL 4Z76A 2OXHA 4JZOB 5DJCA 1OPGH 2J3SA 4L8SB 1UXWA 2F8VA 1LEKA 5CUSH 3SE9H 4M6MH 3IYLW 3NAAH 1M71B 2LFGA 1ZAGA 2MFNA 3P9WB 4OGAC 5DJAB 1QO3B 1MF2L 5HGBB 5FIEA 1JPTH 1ZS8A 4PJGE 3VD9A 4HWBH 5TE6L 2V2XA 2JIXD 3IDIA 4WDIA 2FECL 1QQDA 2EYTB 2EDFA 1HH9B 4GRLD 1OLLA 1I9IH 5DRXB 4NN7B 3HMWH 5AWNH 5I6XB 2NYYD 4RWYL 2GJ6D 2YPVL 5F7UA 4HIIA 2XZCH 5HHOE 3QEQD 4S1SH 4MDJA 2EDXA 1JUFB 3CDFA 4RISL 4FNLH 5KSVB 1VKXA 4OUOA 5ICZB 2A38A 4DGYL 2GCYA 4PJ9C 1RK1B 1S7XB 4L3EB 4OQTA 2YRPA 5I1JH 2YN5A 4W6WB 5CJXC 5CBEB 1T2XA 2UUDH 5DEFB 2J8UF 3C09C 3AAZB 4KUZL 4ODXB 1YN6B 3MLWH 5TH2B 5I1IL 1RVFH 3D0LB 2AQ3A 2YA1A 3RUGE 3SDAB 1GHFL 4YBLC 3LKPB 4NJAL 3U0WH 3KYNB 5ECJE 3DVIA 3L9RA 4YXHH 5L9DH 4NYLA 5J11B 4JM2A 4UINH 2H6PA 1PSKL 2FATL 3P4MB 2A6IA 4JJHA 3P4NB 3O6FD 1H9VA 4OCXL 2I25N 3L3JB 3RVTD 3W9DB 3A6BL 4XH2A 3QNZA 5LCVL 3PL6D 5IMOA 1RZGB 3P11H 3JV6A 3IFPB 1TQBC 4NUGH 1GYAA 1BVZA 2XZQH 4OJFH 1KPRA 4H0HB 4UAOC 4JKMA 4GRLC 4NM8H 1I3VA 1G1YA 4XCFL 5F93C 2NYYC 5IQ9A 5I75B 5CCKL 4MAYA 4O2FB 3UJJH 3OR7A 2D7TL 4M6OL 5DDHB 3TC9A 5ADPL 4JFEE 5EN2A 5I19L 3C5JA 3WXWL 1FPTL 4P2QD 1I1AB 1X4ZA 4IRSA 5DVKA 5DMJB 3KJ4C 5CEYB 3IJSA 3EJZD 2A73A 2JJSC 3CCHB 1P7KA 3IT8D 3L95A 3MCLL 3VRLE 5HHOA 1QSFA 5FDWA 5JR1L 1GGYA 3N50A 4UUJB 4DFIA 3GMQA 1U42A 4YGVB 3IDGA 2N7BA 2R9HD 4I0PA 1FGVH 4NKQB 3BSZH 4PGCB 4WJ5A 4IRJD 3GSUA 5F97E 2X89D 4OM0L 3UEZA 3UC0H 4O9HL 4HG4K 1RULL 4OLUH 2W65B 1QR1A 4MNGA 1FNFA 2CUIA 4I9WE 1DBJL 3GDBA 3BPOC 3O6FC 5D72L 1T80A 5D2LF 5BRZA 3RVTC 5DUML 3PL6C 1JZ4A 1OARH 5D2NB 2PUQT 4M7LL 4DTGL 1R5IB 4LLAA 3GBMH 1SJHB 1K8DB 1R3HB 3AVEA 1T89C 5E24E 2EC8A 1I9JH 2DTML 5DT1H 1JGLL 5DUPH 1Q0YH 5D1ZD 4K8RD 4TUJA 3ZT7A 1P4LA 4M7LT 1MRFH 2AXFA 4M7ZB 4YDJA 3ORJA 2J8UE 3WHE1 4MQ7B 3RY4A 4IMLB 4WEUD 5HPOA 1MJ8H 4K94L 3EJZC 4Z0BH 3DRQA 4MDIB 4LSSL 5E8DL 5GSVB 2VZVA 1IAMA 4NQDB 3S3SA 3C8DA 3LHPL 5HVHC 4N8VA 4LCWA 4LF3B 2LAAA 4L3ED 3IGAA 3QFJA 4I48A 2R9HC 3BKMH 1HWHB 1U91B 3RU8H 4IRJC 1A4KA 5DD3H 4HUMB 3QO0B 4F58L 4JG0H 1U3HA 4MLIA 1JGEA 1F6AA 3TPUE 1NUGA 1S9YA 3BP4A 2UYLB 3SDAD 4A6YA 4G3YH 3DARA 4P57B 4YHOH 4MA1B 5JDSB 3INUL 4FP8H 1NEZA 4U31A 4YC2C 2BVTA 5IP4A 1NEUA 5D6DC 5IW6B 2AEQL 4KFZC 5DA0B 2VXSL 3H7LA 2Q6WA 3E6HA 4HHAA 4L8SC 4FQQA 2DQUH 3EFFB 3QCVH 4OGXH 5K9KB 1EX0A 4ZOBA 4ELKA 5T3XE 1X5FA 4MJIB 4ETQA 1EHAA 4WWKA 3HMXH 1K6QH 4GKZA 3U7AA 1GIGL 4LHJB 2NPLX 2PCPA 2DYPA 1AO7E 3B6SA 5D1ZC 4K8RC 4P3CH 4PLNC 4MNQE 3SDXA 3PQYD 3IFNL 3VH8B 1U58A 1KF9B 2G75B 4Y8DC 3O45A 5IMLA 4EIZC 1DSFL 2CRIA 5EO9B 2EDBA 4OBSA 1JNLL 2D03L 2O5YH 4BQ9A 1D7FA 4YO0B 3W81A 1EPFA 3SKNB 5C71A 1A6WL 2YSSB 5DMYA 3VE0B 5BS0B 4RX4D 2JF1A 1HSBB 3CC5A 4Y4HA 1IKNA 4RQQA 3T3PF 4BQ8A 3T4YB 2OI9B 1HQ4A 4QXUH 5DTFA 3TEUA 4ZSOB 1N5YL 5DQ9B 5JORA 3QYCA 5D2LE 2X70B 3R06A 2BSTB 1T66D 1UCTA 4FTVD 3SDAC 5I1GH 2NX5D 4ISVB 5L6YH 3NN8B 5DVMA 5D96B 5J11C 5CJOL 4J1UB 2GUOA 3KYMA 1YMHB 2OJZL 3TPUA 5GJSH 2A6KA 5DLMH 1TZGH 1HINH 3KLAA 3HZYA 2PN5A 4RFEB 5CSBA 3GHBL 4PRHA 4U1HB 3VCLB 1ZLVK 3RWDA 1FFOA 1HH6A 1Q94A 2B0SH 3X11A 5SX4I 1YPZF 5HYJB 3GRWL 2OR9H 3RDTB 3T65A 2QBWA 4PY7A 4ZOCA 1I8IA 1L0XA 4YH6A 4GAGL 3LD8B 3CU7A 3MO1A 4MB4A 4IS6B 5KJRL 5F1OB 1HNFA 1KJ2H 1OGTA 5F1KC 4P2YA 3U7WH 1MHEA 2OK0L 3QSKB 1D6VL 1HOCA 1ED3A 5D8JH 2RAMA 4OV5A 4MNQA 1HE7A 5E08L 2XQBL 1Z9LA 3NFNB 5LQBH 4LPXA 4DEPB 3CH1A 4UT7L 4DZ8B 2FDBP 5F71A 3HUJF 2FRGP 4NQDD 5F6HI 2GSIB 4OLYL 4PJFB 4XVJH 1UM6L 4P23B 1Z9SA 1IAKB 3S97C 4LCUB 2W0PA 1KCUL 2DLFH 1B90A 5J6HA 3LQAL 4XMPL 3KYOA 3GSQA 4PJEF 3MRPA 1T66C 4PG2A 2LU7A 3H42L 1PDKA 4PREB 1IGYA 3OKNA 1CLZH 4QTIH 4X80L 1XF4B 1HI6B 2B5IB 3UTSB 2ESVE 1Q0XL 1F3DJ 5D6CB 3LQZB 1FIGH 1L9MA 1S7WA 3O6LH 4OD1H 3STLB 1BF8A 2I9TA 3WFZA 4WHCA 2GI7A 3QCUH 4CU7A 4HX1A 1OP3H 3T0XA 3PNWB 4Q0XL 5D2NC 4MJID 1IEAB 4CL7A 4XP1L 3CFEA 1OM3H 5I9QB 4NHCH 2FSEA 1KG0A 1FDLH 1WBYB 2HT3D 4I2XB 4LVHB 4IDJH 5D71L 3TH4T 3LDBB 32C2B 1QLRA 3E6FA 4YX2L 3T3PE 3K4DA 1JFQL 2P5WE 3QDJB 3KLHD 1ND0A 4M7ZC 2EXYD 4NJ9H 5I1AA 3QNXB 1FZJA 3KS0H 3WNOA 3T1FB 3DGGB 1MRCL 5K33A 4FQJH 1JGVH 1Q9LA 2H8PB 5BS0D 2X41A 1AD9A 1RMFL 4PLJD 1DTUA 5E8OB 5JOEA 1QBMH 1V8HA 1V05A 2VXTH 3SE4A 2R0ZL 3VXTB 3K4ZA 5E4EB 1OF2B 4JRXD 5EU3B 1ES0A 4CVXB 4R3SB 12E8H 4FQ2H 4ONGH 4I5BB 3BP5A 3HCVA 2FR4A 3AMLA 4R0LA 5T5FH 1UB6A 3IB4A 3VFOA 1YPZE 4MA1C 1Q9KA 1I8KA 5C0CB 4P9HL 3ET9F 4UU9B 3MRDA 3P40A 1KEGH 5C09D 4M02A 3OHXB 2Z4QB 3HZKB 2A6DB 4HAGA 4BSJA 5IMMB 3BVNA 5T33L 3UJIL 1W0VA 1LK3H 3QJHB 3ME0A 1FZMB 1DN0B 1GVIA 1CR9L 2ESVA 3SOBL 1F6LL 4G6KL 3MYZA 4FABH 3UX9B 2CGRH 4GG8A 5ACMA 5EIIA 2XXCB 5HYJD 2HT3C 1CGSL 3V95A 3FAXA 3RDTD 3NCJH 2QV2A 1T4KA 3HUJE 5MEPA 1GL4B 3BPLB 3KLHC 1PZ5B 2EXYC 3MZGB 4UV4L 5DHVH 5JDJA 4ZUUA 1A6TA 3WHXB 3ARSA 3OAUH 4PJEE 1FE8L 4DZBA 2YOCA 4MXVF 4OGYH 2VLRA 4PR5B 4U1GB 4DOHE 4PLJC 5DUBB 5C07E 2VLJE 5GJTL 2OI9C 4P23D 1WCBA 2NTSP 3SJVE 4GUPA 4WIQA 2AK4B 3MRFA 2AI0H 3ULUH 3N85H 3VU2A 4CNIB 1JYNA 3NABH 4NM4L 2BZDA 1CDJA 4Z78B 2Q7YB 1BFVH 5TDNB 1KJ2B 3JVGA 2DIBA 4WI7A 3UTSD 2E7CA 2VDKL 4GH7B 5D7IB 4Y19E 2EDTA 2PW2A 5FF6B 4I3RH 1KGCD 4FZ8L 3H2WA 1YPZA 3ARGB 1RSFA 4L3AA 4OCWH 2CO7B 2EEDA 4N8CL 3F6IA 2H3NA 1IT9L 4G9DB 2LV4A 1DEDA 3RDTC 3HFML 4OLEA 3IS1X 3E2HB 4J8RB 2VDML 5F96H 4K23L 4XXCC 3TBSB 2RR3A 2BDNL 3H9SE 3QDGB 3SGDI 2VQUA 1T1XA 3FRPG 3LD8C 3IJHA 3KPSB 4D3CL 1TMCB 3QDJD 3MRQB 3G6AA 4H8WH 1KIRB 4MA7H 1JN6A 1PBYA 1BLNB 4CW1B 3ARFB 2CDGA 1A7NH 2B4CL 3MGAA 4DEPC 4KAQH 1WCQA 5F44A 3QUMA 3QQ9D 1TCRB 4Y16B 1OT2A 3EFDH 1BQSA 4EUPB 4P23C 5DFVD 4PJEA 2WLYA 3AS1A 5D5MA 4X6CA 5DD6B 2H9GA 3RWFA 4OF6A 3PUCA 4NZJA 5F89A 5TQ0H 3MLSL 2VDPL 1GPOL 4KK6D 4LRIA 2VLJA 4KI5F 3QUXD 1MQ8A 5FYKL 3SJVA 3LKQB 2JJTC 1RUAL 2Y9RT 5DJYB 1MWAL 2O5ZL 1LQSR 3MROB 2N56A 2JE8A 3MBXL 1U3ZA 2MSPA 1HN1A 1YDPA 1IC4L 1HQRA 5EPMB 2OZ4H 1F90H 6FABH 3WXVH 4UQ3B 3ZKQD 1LE5A 4XMKL 1OP5H 3KJ6H 1SHMA 4WV1A 2G9HB 4LDEB 3RA7L 4Y19A 5I9QC 2GAZB 4MXVE 1DZBA 1G7IB 3FRUB 2H41A 1DBKL 4LU5L 5T1KD 4NWUH 4MMXC 4YHPA 4RRPA 2NW3A 4LVHC 4DN3L 3LDBC 3MJGX 2F8XC 4NZTL 2NY4B 1A7OH 5AZEL 1T3FB 5F7YC 5EU4A 3CDGB 5JHDE 5B3JF 5I17A 5C0BE 5CHNA 4ZXBB 5GGRY 1NGYB 4UTBH 4X6EB 3DV4B 2O26U 3H9SA 3LN5A 3V0VB 1MJJA 5DD0L 4MA8L 2BY1A 3QQ9C 1LILA 1CD8A 2HFEA 4XVTH 4YHZL 4ZAKB 4TULL 5JO5B 3L3OB 5DFVC 2BSSB 3O3EA 3WKML 2XKSA 3FB7B 3OTTA 5E4EC 1BVLA 2EDWA 4S10A 3LKNA 4TOYH 1XCQA 3TP4A 2AK4D 1VADA 5EBLB 1WSST 1XFPA 2WBJA 3IDJB 4KK6C 3QUXC 1TVHA 5C8JA 5I8CA 2D3VA 4D0DB 3C87A 3OAZK 3BWAB 4R4FH 4FMFA 5DHVB 4K9EH 4UB0L 4N5UA 2R2HA 3CDYA 2J6EA 3LQAC 4PGBB 1OGAB 1GGIL 3S5LB 3TCLB 4BSWB 1AGBA 4FG6D 1R5WB 4Y89A 3ARGD 5I76A 3D69B 3WLWD 2GFBB 3MREA 4URTB 3P73B 1G7MB 4RMWA 1K4CB 1S9XA 3S5LG 4OSUL 1S7UA 4P46B 4WU7A 1WWWX 4XP6L 5C0RL 2FX8L 3C5SB 1AFVH 4K71B 4JZJC 3BPLC 3GSVA 1KCLA 3QA3B 1J0HA 2Q8AH 5IGXL 2HAZA 3MLZH 1NSNH 4NO2B 4DW2H 5EULV 4Z7WB 1NL0H 3ZHKA 4OFPA 1INQB 3S34L 4HQQH 4D0BA 3VW3L 4NCDA 3T8XA 5AD0A 3ARFD 2FO4B 2MQ0A 3DIFA 4KI5E 4U1GC 1KJMB 3DMMB 5JHDA 4DCQB 4R7DA 5C0BA 3ZLQC 1XGPA 2C1PA 2VSCA 4Y16D 3DXAB 4E5XB 3T1WA 1Z0MA 3BQUA 2ARWA 2D9QB 4WO4D 3PP3H 5JA9A 4UBDD 2VXQL 4JPIA 3W0WE 4OLXL 4EN3B 2BNUA 1NGZA 2DDQH 1ONQA 2RQ8A 4WW1A 4HG4J 1ORQA 4XPFH 4K2UH 1QLEH 3U4BH 4LSQH 2R1XB 2WNGA 4G42A 1ZVHA 4NHUA 3SE3C 4TVPE 1NCTA 1BM3L 3LKOB 3RNQB 3U2SB 3LKSB 1MHPH 3FO0L 1F4XL 4FG6C 4JY6B 5B3JE 4HWEL 3AU1A 1WZLA 1A3RH 3ARGC 3WLWC 2CK0H 4OLVL 1MH5B 5DA4A 4MAUH 2DQIL 4KMLB 4FFWD 2OS7A 3E2HC 3V4UH 1EGJA 1FYTB 3V0AC 3VXRE 3REVA 3ELAT 5IB3A 1QLFB 2NY4D 2VISB 3ILPA 1HXYB 4EDWH 3E3QE 2VZUA 3MFFB 3S8WA 2VLLA 1H3PH 4CU8A 4GMTH 1FJ1A 5JHLH 5IK3A 3UBXB 3DO7A 4ZXBD 3NTCH 3GI9L 4U1NB 5ACZA 3ARFC 2CO6B 3QEGH 5EZLA 1CIDA 3L7EB 4HF5H 3F7YB 4QHKI 1FVEA 2BVOA 2K7QA 3FOLA 3QDMA 4Y16C 4YLQT 2WSKA 4ZAKD 5I1DB 4WO4C 2XKUA 4OUUB 4UBDC 5HYQA 5DJ2A 1ZGLA 4PJIB 5I8OL 2DQFA 2DBJA 2WLZA 5DJDB 4CN6A 1I1RA 5ADOL 1ZE3C 1IGJA 2Y5TB 3HI1B 1KB5B 4QXTB 3ZYIA 3KPRA 5MENB 3MOAH 1L6XA 2H32B 1D9KB 3C9NB 4TRPL 2PETA 2VLME 3LS4H 4XCYA 4Z5RA 5ITBH 4HBCL 3SQBA 1YJDL 2NY1B 5KG9B 3WO3B 4QF1B 5C0AA 4WW2A 1OGAD 5B38A 5JOPD 2IH1A 4PRNB 4JM4H 2WAHA 3L7FB 5HHNA 5FYKD 2A9ML 3B9VA 5T1LA 4PV8A 4FFWC 3RY5A 5E94B 1MHHB 5IVNA 4HIJB 4P46D 1WWCA 5C08B 1NUFA 4KJYB 2NY4C 3NZ8A 4M4PA 1CGXA 4K7PH 2ICCA 1KJ3L 1CGVA 1T0NA 4PP1D 4QRSA 3MLYH 3VFTB 3JUZA 4N9GB 4ZXBC 4BZ1L 4QRRA 4LHQB 5BMFH 2CRZA 4MMZC 3VXRA 4D2NA 3NCEB 4JB9L 5IJKA 1TJGH 1JWSB 2EYRB 3BP7A 2GITB 4ZAKC 1MIEH 5EU6D 4HK0A 1JL8A 5CS7A 3MRKA 3DXAD 3GI8H 3IXAB 3O2WH 1H8NA 1SYVA 4MXQA 2YKLL 1NBZA 1JZ8A 1OSPL 2YS4A 4R7NA 1T6WA 3MXWH 4RAVB 5BQ7A 2B4CC 4O00A 1FNLA 4H20L 4RBPK 3CFKA 3KWWA 2HJLA 5E2VH 1IJ9A 2X6MA 3I6LD 3QXWA 2NLJB 4JHAL 4LASL 5ICYB 4NC1C 3O3AA 3PIQB 1O5DT 1WFTA 4LIQL 1WAAA 1LQVA 1Y6KR 4ZODA 4KKCD 4RWHA 5HHMA 4MJ2A 5IWLC 2L0DA 3NFPB 7FABL 1CFBA 5C0IB 4S1QH 4X9BA 5FM4A 5FOJA 2VE6B 3G5ZA 3O4LA 4W4NA 3DLQR 3MACL 3NA9L 5JXAL 2BERA 4WI5A 5DD5H 4U6YA 4J3VA 4F57H 2BMKB 3VDAA 4P46C 1T2QH 2FBJL 3EYFB 3TO4B 1YMMB 3NOIA 5E9DB 1HHGA 1IGTA 3WV0A 3VXMB 1FYTD 1SYSB 4KUCF 4KZDL 3BXNB 4IDLA 3MGTA 4PP1C 1MI5B 5DXWA 1C5BL 4GG6A 3X3GL 2R69H 4NN5B 1R3JA 1BAFH 2IG2L 4Y7MA 4YUEL 4YHLH 4M00A 5FKAB 4LVEA 1OTUD 2VABA 1RJCA 4XHQA 5FGBC 3W9EA 1BJ1J 1MF2H 1S9KC 1J88A 35C8H 2YPLB 1W2KT 3D0VA 3HZVA 1LE9B 3TWCH 1CG9A 3TNMB 1W72A 4LNVA 5J6GB 1GGBH 4BJLA 4X7SL 2YPVH 4HFWA 1FFPA 1YEJH 3GSNL 1RIVH 3GM0A 3C8KA 1C7SA 1A02N 4F37K 3DUSB 4P99A 4GKNB 4KKCC 3UAJD 3UTPD 4XMLL 1K5NA 1T22B 4ZDHB 1C1EL 4XRCA 4E41B 4O2EA 2AW2A 3W39B 2A77L 5HHQA 1ZXQA 3X13B 3UPRA 2R2CA 3MRNA 4N90E 4YHIB 3FTGA 3RGVA 2E5EA 4F7PB 2VZOA 5LXGL 3K2UH 2W9EL 1DL7L 4KUZH 3DI3B 4J3TA 2ZKHL 3KPPA 3F62A 3ZO0A 3QIUA 1GZQA 1A7QH 5LWYL 5I1IH 4PJ5B 1CZ8L 4U6HA 4FQHA 4NFCA 3S37X 3QQ3A 1RU9H 3MLVH 5C08D 4NGHL 4JO4L 1I7RB 1I85C 4AH2A 2XFXB 4L5FH 5F9AC 3QIWB 2HVKB 5CIPH 3X12A 5JW5B 3QUZB 4QCIA 1PSKH 5H2BA 1FVDB 3RWJB 1NCDH 1Z3GL 3DOSA 4R26H 3VXSA 4WUKL 3S3PA 4YHNB 1C5DA 3HC0B 4LSVL 3EOTH 1OTUC 4IOIB 5M94B 2E9IA 3RRQA 4NO5A 2IGFL 5J12B 3LB6D 1VACB 2YD9A 5EUKB 3D85A 1AP2B 2JJUA 4ZTPL 4PS4H 2DQEH 4P0DA 4X4XB 1I8MA 1EHXA 4PBVC 1YEGH 5CCKH 1NDGB 3ZZ1A 2VSDA 4X9HA 1ZKAA 2H1PH 3VG0L 4LRNL 4M6OH 5ADPH 4OCMC 4JR9H 1TNNA 1NCWH 5HHPB 3SCMA 2HP4A 4M61B 3WXWH 5F9DC 1FPTH 4NO3A 4NP4L 2CIKB 3UAJC 5DD1H 4WUUB 3O11A 4BH8B 3DGCR 2H45A 1RZIA 2Y1VA 4PRPE 4XI5D 1I8LA 3MCLH 1JZ5A 4HJJL 2NXYD 2Q86A 4BSVB 1AKJD 1RJZB 5I1LA 2OJEA 3FN0L 3K8KA 1IFHH 3VGAB 4R2GB 4LL9A 3RBSA 3HNTL 3JTTA 3MNVA 5GISL 3B9AA 3ZSTA 2VC2L 5C0GA 1P9MA 5HI3D 2OR8A 3ARBA 5FA3A 1BF2A 2UY6A 3WFDH 5TDPB 4AIZB 1HWGB 1FNGB 2P1YA 1A3QA 1RULH 4JGJA 3VXMD 3VJ6A 3HE7B 3TNNA 5HGAB 1CE1H 1DBJH 3OPZH 1FNAA 4Z7QF 3UROR 1JPGA 2H26B 2YEZB 1YA5A 4J6RL 4OD2B 5FYJE 2YXMA 1D5XB 2FWOA 5DUMH 4K9EC 4JN2A 3FCTB 1Z9OA 2D7NA 4M48H 1L9NA 2JELL 2X1PA 3DSFL 4MJ6A 1A6ZA 3LB6C 1KCKA 3HZMA 1J0KA 1BZ9A 5CLTA 3KDMA 3V4VH 1IC7H 2D31B 2MNUA 1EHLL 5EUOA 2YPLD 3MBED 1L7IH 3BUYB 4PRBA 1SM3L 2P44B 2NR6D 4GS7B 4XNYH 4NKMB 5GIRA 3SDDB 2D7PA 1H8SA 3RZCB 3NPZB 1H15B 3MSPA 5C86A 2F5BL 3I6KB 1OSZA 4XI5C 3C5ZA 4LSSH 4P2RA 4X0KA 1TPXB 4WFFE 2NXYC 2QKIB 3GKZA 2QLVB 5FECB 4L1HA 3HC3L 2B2XL 4JPKL 5E56A 2AV1A 3JV4A 1LVEA 4DK3A 3QAZB 1Q9OB 2HKFH 2DQDL 3P4OB 5HI3C 3EHBD 4F58H 3V7MA 1YEHH 4Q6IB 2BVPA 2DWEA 1WWAX 1G9MH 1LK2B 3IF1B 4M1DL 4Q97A 4JZNB 3TN0B 3VFUA 5H37H 2FX9L 4MWFB 4IM8A 2RBLA 1D5MA 1UXSA 3OXSA 5L8LB 3GSOA 5FCUH 3QIWD 4X6DB 3QUZD 5AUMA 4FQIH 2UZXB 3EW3B 4CUCA 3PXHA 4LAJH 3U1SL 4JFDB 4IMKC 2BFVL 5CEZL 1M05B 2PTUA 4Y5YA 3L3DB 3TESA 2P5EE 2DIJA 3QCTL 3QZWG 2YPKB 4XT1C 5JIPA 4U3CA 4NQED 3ZKMD 3CX5K 3TJHA 2J8OA 1BQHB 2ED7A 3MBEC 3QQ4B 3QRGL 1VGKA 3ZKSD 4L8BB 2V2WA 4EI5A 2NR6C 3MRCB 4POUB 4N0FB 4PY8I 1AGEA 3HI5L 4WRLA 1DSFH 3GKWL 1IRAY 2KUTA 5HYSB 2D03H 2ZUQB 3UTTE 1G7HB 1CDYA 1VFAB 5GS1A 3CXHK 4YE4L 2PO6B 3P0VH 5DRNB 5CIPB 1UKQA 2DLGA 1FVCB 3ALWA 4WUUD 1FFNB 4EQ3A 1QYGH 4NQSB 1EV2E 4F7EA 1TZIB 1GOGA 3P0GB 3MMEA 3TF7A 1T6VN 3MUJA 1AJ7L 1BVKB 1CICB 4Z7QE 5D1XA 5HPMB 1E4XL 4FQCL 4R2GD 4KK5D 1KJVB 1TTUA 3EHBC 3H3PL 5GS0H 2ATKA 2V7NA 4HKBB 3VXNB 1F4AA 4NKDB 4X83A 1EXUA 1P6AB 2VZ1A 5F8RC 1KT2B 2ADJB 2HJKA 1WT5A 4PJBA 1J8KA 3MFGB 5I66B 3X17A 1RURL 3QIWC 4O5LL 5I15L 2IANA 3QUZC 1G7QB 1NBYA 3HE7D 3MYJA 5F7LB 2OJZH 2UVEA 2YUZA 4OD3L 3EO0B 2WINA 2CKBB 3QXAB 1F13A 2WW8A 1I7ZA 4UV7L 3G5VA 5BW7A 4OB5H 3M17B 1B3JA 2AERT 2NZIA 4RNRA 3GMNA 2HFGH 1P4BL 4YPGA 1V3LA 5HXMA 3ZKMC 5J12C 1HCVA 5MEOB 4QYOB 4NN6B 2WIIB 4QRTB 1KENL 4C56A 2YXFA 1DQLH 3ARDA 1CFQB 1YN7A 3GMOA 2BOBA 4OZFH 1HHHA 5KJRH 1OOAA 5T5NG 3FB5A 1NAML 3MLUH 4L9LB 4KXZI 2P8MA 1D6VH 2EKJA 4LEOA 3ROOA 3RZCD 3DX6A 4ONHA 5E08H 2V5YA 2XQBH 1F3DH 1NDMA 4UT7H 2FECI 1FNSL 1I7UB 1WVZA 3WS6A 1NC2B 5I73B 4K3DH 1G0DA 2DF3A 4BFBD 1ITBB 3UTTA 4HUWB 3ZDXF 3JWNC 2E8ZA 3MV8B 4R2GC 5GGVY 4MNHA 2J5LB 4KK5C 3VGAC 1ZSDB 5A40E 4M5ZH 5I1EH 5DRZA 3CFCH 4R6UA 1WZKA 2EE3A 1HXMB 1QSEA 4D0CB 5MEQB 1CGUA 3RX7A 3H42H 4NT6B 2EC9T 4JEGB 1I3GH 4X80H 2CRMA 1AGCB 1J8HB 1TDQA 2GHWB 2C7UA 3QP3A 5CJ8A 3L5IA 3HE7C 5C7XL 3Q5YA 5EA0H 1G6RL 5AZ2L 1FSKB 2HN7B 3VMNA 4GT7A 1UQSB 1QFHA 3CSPA 4ALAH 5IFJB 3L6FB 1R3KA 3VXQA 1P4IL 4JGUA 1J9CT 3CX2A 1FG9C 4GW5B 2I9LB 1BBDH 2Z8VC 3WJJA 4XP1H 2YK1L 1DEEB 3Q6GL 3D48R 4E42A 5CLWA 8FABA 3G5XB 5CZVL 2BNRB 4KJQD 1D5ZB 1U8MA 4JFYA 1J1XL 4MJ5A 4P9ML 2YA2A 3R0NA 2F54B 3RP1A 4OZIB 3QPXL 4YX2H 4Z76B 1JFQH 5DJCB 2PYEA 3PWVA 1LEKB 3RZCC 2HRLA 1GC1L 2IQAA 3O3UN 2ATPA 1NCUA 1OQOA 2PO6D 1KIUA 1V7ML 1OAQH 2QQNL 2EDRA 5H37G 3G5YA 3DX7A 1TFHA 1BIHA 2VXUH 4BK5A 3U7YL 1ZS8B 3KPNA 2V2XB 3IDIB 4Y4KA 3K8LA 1HEZA 3QAZC 3TIEB 4OZHA 2F15A 4PJCF 5IVXA 1FN4A 4MB3A 3F5WB 4Q6IC 1KV3A 4HXBL 2NXZB 5F7NC 5D93C 4MDJB 4PJ7F 1JYVA 1JI2A 3NCYS 1NLDH 1ZT1A 1VKXB 3EOAA 4PYHA 4FQXD 2GCYB 4DUWA 3MV9A 5FFLA 2J1KA 3T3MF 4OIIH 3VWJB 3WUWA 2FNBA 1MUJA 4NKIL 3AUVA 5GGTA 1OAKL 3BZDA 5KOMC 3OKOA 5T33H 3T0EE 1UM5H 3EYSL 4WI3A 2NZ9D 1NGXA 1CR9H 2B1HL 1OP9A 2VB5A 5TGBA 2ENYA 3SQOH 4KJQC 3DRTA 1CXEA 4RFNB 1BD2E 1CGSH 3L9RB 4ZUVA 2ZOLA 3V5HB 1MFCL 4HMEA 4HCRL 4JM2B 2H6PB 3ZDXE 5JXEA 3I6GA 5CEZD 2A6IB 4KH2A 4XGZA 2ZUQC 1IQDA 4M1GL 1DE4A 4U1JA 5FHAH 4XH2B 1FE8H 4H88H 2PO6C 5IMOB 4AQOA 1RQ5A 4AQ1B 4XBGA 3BGMA 3SGEH 4PTUB 4X6BB 4ZFFA 4XNMA 1PVHA 15C8H 1NC2D 5CGMA 4S2SA 1G9NC 5IQ9B 4MAYB 3WIHL 4V1DE 1I1YA 4PJ8D 3BD4A 1Z9MA 3MRJB 2XT1B 4QHNA 1A3LL 5EN2B 5DI8B 4F3FA 5AAWA 2QADB 3C5JB 4NM4H 5SWQA 4YQXL 3CFJB 3MRIB 4IRSB 4PGJA 3IJSB 1U8NA 3MR9A 1J8HD 1C16A 1EEYA 1P7KB 2A73B 1H3VA 3L95B 4FQXC 1VSCA 4N1CA 1U95A 1DFBL 2VDKH 3ROLA 4OZFG 5HHOB 4ZMAT 4NNYA 1RHHA 3HI6L 1QSFB 2G60H 1PZUB 4WWID 3HRZA 2NZ9C 3OF6A 3IDGB 5EC1A 1BGXH 4I0PB 4WJ5B 4ZSOE 5CD5D 3GSUB 1BZ7B 3DTXA 1EUUA 1PY9A 1NC4D 1TZHA 1MCRA 1GRWA 4LAQL 3T0EA 4NN6C 1YNLL 1Q1JL 4AK1A 2BNRD 1LO0H 2VDMH 1QPPA 2BDNH 4MNGB 3QHZL 2F54D 1KB9J 3MRRA 4D3CH 4P49A 4WTWA 1PEZA 3TM6A 3RUGB 1UYWL 4L9LC 1CVSC 2ZCKH 4FFYH 1BD2A 4PJCE 3S3JA 1HHKA 2W1NA 3GBLA 3W5NA 3AS3A 1FP5A 5DSCA 1A6VH 3VWKB 3DPBA 4PJ7E 3SE8L 4HGWB 1R0AL 5FYLH 1HNGA 5ID0B 4HIXH 2JLLA 4QHLA 5I73C 1EO7A 3FFCE 1ZLSL 4TUJB 1P4LB 2J5LC 1XF2A 2AXFB 4PJ8C 5TQ2L 3T3ME 3GZKA 4YK4C 4PB9H 4PTTA 2SEBA 1A7RL 1RUPL 3MNWA 4QRQB 2FEDD 4ZO6A 4G6JL 2VDPH 5ESVA 2NXZD 1CGTA 1E6OL 1TETH 3DRQB 2K3TA 5CKGA 4V1DA 4P5TA 4YXKL 1MWAH 2X1QA 4N8VB 4HUUA 1FCGA 3U4AA 4JFEB 5MHSD 2HH0L 4KU1A 4YIQB 4I48B 3VWJD 2WWMD 4MD4A 4EXPX 5CD5C 1A4KB 4HPYL 5GS2D 3RA7H 1JGEB 1F6AB 4OFVA 4ZS7L 1KIQB 1S9YB 3BP4B 2DLHA 5FHBL 4MS8A 1IVLA 4A6YB 5DZOA 5FO7A 2BSED 4JE4B 4YWGL 4J3XA 3VDBA 5HYIA 4DGIH 2RFXA 3ISWA 3OXRB 2DL2A 1G9MC 4JM2D 4LKCA 1J05B 2Q6WB 3E6HB 1CLOH 5ENWA 2AVGA 3WDIA 5D9SA 1XGTB 1NEZG 4P4KD 4ELKB 3WD5L 4KQ4L 1BX2A 4ETQB 4WWKB 4EXKA 4QTHB 4GKZB 3C6SA 3S4SG 4ZTOL 1AQKL 2PCPB 3P30H 3GHEH 3B6SB 1KSRA 1CFVL 1K2DA 5IOPA 3SDXB 3IKKA 2DLTA 2W59A 3O0RL 1U58B 4JFFA 3ALPA 5KVDH 2JB6A 3O45B 5IMLB 2NY0B 4PJ7A 4FXKA 4MAYD 1RIHL 2FEDC 5J9PA 4LLDA 2DKSA 2NXZC 4G9FE 2FHFA 2IPUG 2ARJB 3A6CH 3D3VE 3FFCA 2QADD 2I24N 3RQ3A 5J3HD 2ZCHL 3LSOA 4U3HA 4IRSD 3W2DL 3L3KA 2ZWLT 3R4DA 5GGSY 5E8NA 3G6DH 4Y4HB 2J8UB 1N26A 5KSUA 4RQQB 3VWJC 1MFEH 2WWMC 3ABZA 4H25A 4JLRA 1CK0H 5DTFB 1GGIH 5EZJA 4M62H 5JORB 1J1PL 4I0PD 3O2DL 5GGQH 3R06B 1J86A 3CK0H 4IIQA 1XEDA 5JPNB 1WWBX 3QUYA 4XPHL 5BV7H 4NQTA 3V6FA 2I60L 4QHUA 4JM2C 3OGOE 3KYMB 5C0CE 3TPUB 4GXUN 1MNUL 1EFXA 2MPAL 2ZUXA 3RGHA 3KLAB 4P4KC 3HZYB 4ODVL 4S0TD 4PRHB 1YQVH 1INDL 2PXYA 1FFOB 1U36A 1IL1A 1HH6B 3VWKD 1Q94B 3X11B 1UVQA 4YDVA 5E6ZA 4XAKE 4PY7B 1I8IB 2E3VA 2BHUA 5GRVK 1KIPA 4ZUWA 5EU5A 4MAYC 2VXQH 3T04D 3L3HB 1OGTB 3BHBA 1MHEB 4JQVA 1HOCB 3VGDA 1ED3B 3BD3A 2QADC 3WFHB 4OV5B 3RI5F 3QI9A 4MNQB 3MTRA 5J3HC 4OTXL 4IRSC 2FX7L 4X7EC 1IAOB 2ORBL 1A9EB 4FXGB 2VR9A 4LK4A 3LV3B 1BP3B 3HR5A 4JFED 3UYRL 4G9FA 3ECBB 3VFVA 5I1KH 2R23A 3FO0H 8CGTA 1F4XH 25C8L 3N1PC 4HWEH 4ORZC 5C0FA 2O5XL 4I0PC 4RMVA 4OLVH 3E1F1 4PD4J 1Z5LA 3MRPB 1X4YA 4PPTA 1IGYB 1LGVA 3OKNB 5JQHC 1QA9B 3DJ9A 5IVOA 2DQIH 2HLFD 4E0RA 3EDDA 1F3JB 5D2LB 4YAQA 1XZ0A 5F6IB 4RMTA 4CDHA 2YD1A 4RIRB 3TYGL 2VDNL 1AXIB 3PWLA 4KC3B 4HX1B 1PLGH 5IF0A 4OT1L 3VWKC 4NRYA 1UCBH 2AJUH 1S8DA 3CFEB 4I9WD 5IB4A 1GAFH 4PJXA 2EECA 3OBAA 4RFOH 2FSEB 2O61B 3X14A 4JPWH 1QLRB 3RPIA 3E6FB 1EO8L 3QDGE 2Y72A 2ZCLH 2NY0D 3B4NA 5J7CC 5IHUL 5ADOH 5I1AB 1CFSA 1FZJB 4ODSL 1FRGH 4XPTH 2PYFA 5DJXB 4PDCE 1A64A 1Q9LB 2K1MA 1CT8B 2IQ9H 4GAJL 4EI6A 1AQDA 1CDUA 5CEXB 1CXKA 4HBCH 1AD9B 4LHUB 2DOCA 4Q58C 1YJDH 2QQKL 3TBWA 4NWTL 4F15B 3ULUF 4D8PA 4QRUA 1JPFA 2VL4A 2OTWA 2EKSA 1T20A 4PGDA 5C0DA 2OCFD 5C9KA 5F3BA 1ES0B 3CX5J 3VXOB 5LGHL 3QFDA 4WGWB 4OZGA 2HLFC 1OCWH 4R0LB 4XNZB 1FL6A 3MRGA 5HI5D 3VFOB 3UDWA 4TSCH 1Q9KB 1I8KB 2ICWJ 1WFNA 3MRDB 3S88H 4L1DA 3Q1SL 3TJEL 3CXHJ 1ZHBA 3KLSA 4U6XA 1T5WA 3BVNB 4H5SA 1W0VB 3S7GA 4UQ2A 4BZ1H 1QOKA 2FGWH 4FMKA 4GKSA 1N0LA 3BO8A 2ESVB 2IALA 5E99L 4GG8B 2X4UB 3OAYK 5EIIB 1EZVY 2BNQE 2XKNA 3HE6D 3GBNH 5CSZA 4ODTL 4M7JL 5L2KA 3P9LA 1T4KB 5MEPB 5T3XD 1SMAA 1A5FH 5TDOA 1OSPH 2NY0C 1U8KA 2RCSH 4ZUUB 2Q87A 1QRNE 2J6EH 2VH5L 5A3ID 1A6TB 4XBEL 1AO7D 4OQ1A 3JV0A 4GSDH 3RVUD 1QNZL 2DMKA 4DZBB 1IZKA 4JHAH 4LASH 2QSCH 4PRAA 4J4PD 4MNQD 3PDOA 3TBYA 4X5XA 4LIQH 2DQCH 3CLFL 2P5WB 4GFTB 1VEPA 4UIMA 4ODWA 1PAMA 4ZFZA 3DYMA 3L5WA 1T0MA 1IKNC 4I3SL 3Q48A 3PDGA 1E0OB 3CSGA 3GMRA 1H5BA 2EDLA 4GUPB 3ULVH 4JANB 3MRFB 3G6JA 3NA9H 3SY0B 1LWRA 3I50H 1JYXA 2YD5A 4KHXL 1JHKL 1BJ1H 2YA0A 4K3HA 2ITCA 2C3HA 3CFBA 5HI5C 2Z9TA 2XNAB 1N0XL 4OKVA 4KZDH 1MCBA 5GGVL 4JO3L 3FB8A 3HNVL 2IMMA 2LABA 5DC4B 3MGOA 5HDQL 2PW2B 3ZL4H 3CVHA 5JA8B 3WSQH 1YPZB 5D7JB 2QSVA 2CJUH 4YUEH 2Y6SD 2EIZA 2H3NB 1R3IL 5E2WL 1FH5L 3HE6C 3K80A 1D6EA 3KPMA 3B2VH 4U0QB 3C60A 1MCCA 1P7QA 2F58H 5D1QB 4PBXA 1L7TH 3KHQA 1T1XB 5IHBA 2IC2A 3ULUE 2YR3A 4BQCA 3IJHB 4HD9A 2D0HA 5B22A 5DC0A 4X7SH 3G6AB 2BNQA 4PUBL 5A3IC 2EDNA 3RVUC 4HWZA 2BOCA 1JN6B 3PJSA 4J4PC 4B0MM 4RMSA 3WE6B 2CDGB 2ZOKA 1EJOL 5CJBA 4GJTB 1VHPA 4B7IA 2QSQA 1XGYH 4G80B 4JHBA 5CJQL 1B6DA 3QUMB 2OTUA 1YNTA 4LHUD 3B9KA 1QRNA 5KVEH 5HGDA 3AREA 4PJEB 2DKUA 3GJEA 2CXGA 2A77H 2WUBH 5FO8A 1EGJH 2MCPH 2YZ8A 2H9GB 3RWFB 4DOHB 5A16A 2ERJB 3LS5L 1A1MB 4PG2C 3IFLL 1IGIL 2HWZH 5F89B 5ILTL 1NAKL 1CF8L 4GAYA 2ZKHH 3IDYB 3WN5A 2VLJB 1D5BA 1CZ8H 5F7DA 3SJVB 5HDLA 4BYHA 1UWXK 4L4TE 5F6IC 1ADQA 2XIDA 4HKZA 5L88L 2Z91A 2HT2D 5B8CA 1HQRB 5KTEL 4KHTL 3WLBA 3HTLX 4I4WA 3STZA 2Y6SC 1Z3GH 2FH6A 1MFNA 4H1LG 4WUKH 5KSBA 3BFOA 4RAUA 2AKRA 1LE5B 1IAIL 2C4FT 4LSVH 1PG7L 1XGRA 5CP7A 2ESVD 4WV1B 3PV6A 1I3RB 1KOAA 4Y19B 3GIVA 1XR9A 5GRYA 1ODAA 3V4PH 2IGFH 1MREL 3U9UA 2APWA 4YHPB 1KC5L 4QRPA 5IB5B 2W91A 5D4QA 4ZFGH 3JWDH 3OKEA 3X3FL 4LSTL 3U0TA 3FQTB 5EU4B 3OG4B 4MCZA 5H35A 4WEBL 3EZ8A 5KVGL 3PGFL 4WNQB 1YEDA 5CHNB 3LQMA 3IU4H 1P5UA 3MUGA 4HUKB 3LN5B 3H9SB 1MJJB 1FC2D 3V6ZB 4JDTH 3K8MA 3V52L 1U8PA 2P5WD 1G7LA 4XAWL 3O3EB 4HJJH 3THML 3SE4C 3RVWD 2R56L 1BVLB 4FQLH 3LKNB 1XCQB 2IBBA 1VADB 5L2JA 1ACYL 5GISH 4BH7B 5AYQA 1JPSL 1WITA 2WBJB 3ES6A 1Q72L 2FZ3A 1TVHB 2EDOA 5C8JB 4AIOA 4PFEA 4XNZC 2VKWA 2X4RA 2AJSL 4HH9A 2B20A 4CMHC 1GOHA 1JZ6A 1JPST 4YHKL 5MENE 2R2HB 4PRDA 2DQTL 1WTGT 4B7LA 1J1OH 2HT2C 4R4BA 5FUZL 3BRDA 3Q3GA 1IM3A 2V5MA 4LCIH 4U6TA 4WFEE 4KZEH 3PP4L 2EDEA 1A9BB 4YR6B 1H3UA 4J6RH 1AGBB 1UADC 5DRWB 2HMID 2GQHA 2WV3A 1QFWL 4QLRA 5D7JD 5GRXG 3V5DA 2UV3A 4AIXA 2R1YB 1R3LA 3MREB 4L4TA 3OZ9H 3DSFH 4NC0B 2WM0A 2OSLA 3V0WH 1S7UB 1T7YA 1FZKA 5B4MD 1YZZA 2FLRT 3IDNA 2AJYL 5D1QD 3GSVB 1BWMA 1NLBH 3ESVF 4D9RE 2XN9D 2V2TA 1IARB 1QFPA 4YZFF 3T77A 3OB8A 5HI4D 1H8OA 1N5AA 4D0BB 4N1EA 1OW0C 2V17L 1C7TA 4ODUA 3RNKB 3ZDYF 3T8XB 5AD0B 2PR4H 4GBXA 3DIFB 5JHDB 1ZTXH 3L1OH 4NO0A 4R7DB 4O02H 1KLFA 4G6FB 1XGPB 5C0BB 2C1PB 3QXDB 4K7PX 4LLYA 5DJ8B 3RVWC 3BQUB 3S9DB 5F7WC 2R0LL 4JPIB 2AAVA 1IILE 1S5HA 3C6LA 2BNUB 1NGZB 3EO1B 1ONQB 4WW1B 3NACH 1ORQB 4PJDA 3FQXA 5J8OA 1A14H 2X9YA 5I30L 5F1IA 2OZ4A 5C07D 5DJ0A 1WJ3A 2VLJD 4G42B 4TVPL 1FC1A 1RPQA 3JVGC 1DQQA 4JKKA 4NHUB 3SJVD 1FLTX 3A67L 4P4RA 1F3RB 4MXWL 1FV1A 1EBAA 2KZ1B 4CVZA 1T7VA 5D7SL 2GK2A 2HMIC 4CU6A 5D7JC 3AU1B 3QPQD 3W11D 2BFVH 4P2OD 3D9AL 4B53A 5FM5M 1MLBA 2NY6B 3HC4H 1P7HL 3MLRL 4XP4L 1W72H 3QCTH 4Y5XB 5B4MC 3QHTC 4Y19D 4G6MH 1F2XK 5D1QC 2J88H 3KPOA 3REVB 5K9QG 4OGZA 3WMSA 3QRGH 1YMME 5E9DE 5IB3B 2A74A 4LMQI 4JVWA 3ILPB 5HI4C 4L4VE 4Q9RL 2VLLB 4H26A 4G59A 1FJ1B 1R5VB 1ZLUK 5IK3B 1DQMH 1MI5E 2NY2B 3DO7B 4K3EL 2Y06L 3QQNA 4KRNA 2E9WA 1JGUL 3H9SD 1FLRH 4YE4H 4PLOB 1KBGH 3NPSB 3M1BA 4PJ9A 2AQ1A 1FVEB 2L7UA 3QDMB 4OF8A 1U3YA 1E6JH 4XC3L 1N7MH 2Y7QB 1KXQE 5HYQB