1YPZA

Immune receptor
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
260
structure length
260
Chain Sequence
GSHSLRYFYTAVSRPGLGEPWFIIVGYVDDMQVLRFSSKEETPRMAPWLEQEEADNWEQQTRIVTIQGQLSERNLMTLVHFYNKSMDDSHTLQWLQGCDVEPDRHLCLWYNQLAYDSEDLPTLNENPSSCTVGNSTVPHISQDLKSHCSDLLQKYLEKGKERLLRSDPPKAHVTRHPRPEGDVTLRCWALGFYPADITLTWQLNGEELTQDMELVETRPAGDGTFQKWAAVVVPLGKEQSYTCHVYHEGLPEPLILRWGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a gammadelta T cell receptor in complex with the nonclassical MHC T22.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords H2-T22 protein
total genus 48
structure length 260
sequence length 260
chains with identical sequence C
ec nomenclature
pdb deposition date 2005-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ypzA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1ypzA01
4O5LL 5TQ0L 3UZEA 3EDEA 3L5HA 1NLBL 4JM4H 2EE2A 4F37F 3KJ4C 1T0PB 4IOSD 2YUVA 2XRAH 4P5TB 4Y2DB 3ARGD 5EZLA 3BXNA 2BNRA 1JI2A 4ODXB 2PCPA 5BW7A 1LEGB 2NY5C 1BGXH 3DYMA 3H3KA 3N85L 4FFZH 1FGNL 4PJDA 2CIKB 1NCTA 3NFNA 4Z77A 4TPRH 1OTUD 2X6MA 1DFBH 3MROA 4FABH 1EFXA 5FM4A 2KZ1B 3L3GA 3KNBA 4JJHA 3TIEA 4E0RB 2A38A 3RZCA 3WV0A 4TUKH 1QEWB 1LO5B 4ODTH 5KSAC 4O2FA 5KS9F 4BQ8A 2NY3C 2A0LD 3QUZA 1FDLL 3TBVA 4EN3B 2IAMC 3RWFB 1PGRB 4LRIA 2P47B 4PJFF 1KUMA 5I2IA 3F7YA 4P3DA 2OXGA 3UJIH 1UG9A 2BCKA 3WNLA 1ETZB 2E8YA 3MBED 4M4RA 3MUGB 3P2TA 3VI4E 1AQDB 1RIUH 2MQ3A 1RZIA 4OZ4B 3GB7A 5F7KC 2F53E 2WAHA 1HHIB 1G1YA 1BQHG 1FRGH 3I3BA 5LWYH 3DTXA 3V2AR 4KMTH 4HQQL 4LVOC 1B0WA 3TN0A 1UH3A 1LQVA 3NCYP 4H1LH 5C7XH 5LGJB 1J8HA 2EH8H 2WLZA 1BECA 5GS0D 1S9WA 2EYSA 5BV7L 3CFBA 1M6OB 1JHKH 5DWUH 2OTWB 3PL6C 5J12B 3ARPA 1R6VA 2HT4D 4OQ1A 1MRCL 4B5EA 3R0NA 4MA1B 4HGKC 3WNPA 3RBSA 4DQOL 1X4YA 3QXDB 1YPZE 3L5WB 2NNAB 5DJ8B 2BRRL 2HT4C 2V7HA 3GMPB 4MHHI 4MSWB 1A3LH 1FNHA 2Z92B 4D9RE 5C0CA 2QHRL 4UT9L 5AAWA 3TEUA 4HKZA 1Z5LB 5C0EB 1NC2B 3GNML 3MRPA 4LSQH 4KDTA 1XF5A 1QA9A 1CWVA 2K1MA 5SWSD 15C8L 1DBML 3LHPL 4IMKC 3DUUB 4YEFA 1JWUA 1K6QH 5IFHH 5GPRA 2NX5E 4A6YB 1A6WH 1A14H 5BS0B 2AJUH 3MV8D 1YC7A 1CVSC 1HN1A 1MQ8A 1AGCB 3AAZA 3VJ6B 4MQ7A 3RWHA 1B3JA 5ABDE 3LPFA 4RQQA 3H3BC 3F12A 3U1SH 5AZEH 5HHMA 2EIBA 3CFJB 4FXKA 3X13A 4JFFB 1L6ZA 4HT1H 5DR5H 3T4AB 4QYOB 5CWSB 4LCIH 5H37G 1T2JA 3S35X 3EHBC 3G9AB 3V52H 1LK2A 1TTFA 4QHUA 1J05B 2H32H 5CZKA 5JDSA 3S36X 3GSUA 1QLFA 1TVBA 5C6WH 3CC5B 2Z35A 4KJPC 1FZMB 2B1HL 3GSQB 3HLAA 1UWGH 1MRDL 1NAMB 3HG1B 1OD7A 4KMLB 4P99A 3V6OE 4TPRL 4OQTL 3RWCB 3QJHB 1I1YA 2PYED 1QR1B 4XPAH 5CGTA 2D9QB 2YMXL 1TQCC 2YK1H 1MFNA 1SYSA 5BOPA 1S7QB 3RVTD 2HFEA 4P5MA 1GL4B 4X7TB 3LKPA 3U6RB 4Y19D 3ERYA 4Z7OF 4PTTA 2DQIH 5HI5C 2F8VA 3NZHL 4PJDE 3MFGB 3SDDA 1JZ6A 2X1WL 3OF6D 4ZXBA 2DIJA 2P8PB 4OFDA 1JNNL 3DROB 1ZTXL 3HPLB 5CJ8A 4F7CA 1MY5A 2BK8A 5E2VL 1P6AB 3VFWA 4RDQG 2AEIT 1EJOL 4OI9A 3OAZH 3GZKA 4JLRB 1GGIL 2I24N 4YDLC 3I6GB 3IFPB 3NA9H 4K71B 1PG7W 2R15A 1LE5A 1JVKA 4EI5D 3C60C 3HN3A 4MMZC 4RFEA 3FB5B 1T7VA 2GTZA 4PGDA 3CFEB 4QRRD 1JZ3A 3SKNA 4AH2B 5FA4A 1DQLL 2C4FU 4M1GH 1CF8L 4PRHD 5D7LB 4I77H 4JDVA 1WJ3A 4U1LA 4JB9L 5GGRA 3TJHC 3WCYA 1CL7H 4ZDHA 5ILTH 2X4PA 3UTTE 3OKKB 2OI9B 2CJUH 3IJHA 5CHNA 1RURL 3FT2A 3SDDD 2A74A 1MWAH 2W9EH 1IEHA 3BRDA 5DHYB 4U1MB 4RA3A 3QG7L 4D0DB 3QBTB 3EDFA 3GHBH 3HNTH 2IF7A 3HC0B 5MENE 4JFOB 5F9JA 2JJSC 2GUOA 4XMPL 2ITCB 2BVPB 3ZHLA 3PL6B 4JN2A 4UOJA 1BQLH 2B2XH 4PS4H 5I8CA 4OKVB 4AEFA 1DTUA 1D9KC 3N50A 1R3IL 2DQFA 3EJYD 5E8EB 3V4UH 1GVIA 4NQUA 4Z0XB 4OFKA 5MP6L 4ODVH 4D9LH 3OKNA 4J12A 3BEWA 3ARRA 4G6ML 3QXAB 4WEBL 4HJ0D 1UKQA 2ZP0T 4U7KA 1EZVX 2EZ0C 3RX7A 5DMIH 2BNUA 3KPRB 3X3GH 2R29H 4Q74A 5EC2A 3ZLQC 1JN6A 1I7ZB 4RAVB 3FRUB 4R8WL 1KN2L 2LTQC 4P3WA 2Q76B 3QQ4A 5C0IB 2IG2L 4JDZB 4WU5A 4KHXL 1N6QH 1WF5A 2CDGA 5F3HA 4M62L 4Y1AA 1RU9H 2ESVD 4C56E 4LCWE 3AREA 4X80L 1NFIB 4NFDA 4N5UA 1S7UB 2N1KA 3V0VA 3PWNA 2V5RA 3LRHA 1G7LB 5J8OA 4F2MB 4P23C 2ED7A 5C0JA 1MJ7H 1U6AH 2Y72A 3GBMH 5HVGB 4R7DB 3KDMA 3V95A 1T03H 4JFEB 5JQ6L 3OR7A 2ZUQB 1RJZA 1ZV5A 4ZAKC 3GMNA 2DI9A 1I8LA 5CILH 3ZT5A 3C5ZA 3HE7B 1KJVB 4NKQB 2XNAA 1M05A 3P4MA 5A3ID 2XZZA 4Q6YA 4S2SA 1IAOB 1Q8MA 1Y6NR 3IXAB 3MV01 3EOBA 3NA9L 1I4FA 4YC2B 2VLRE 1JPGB 2EZ0D 1FL5B 2DQEH 4N0UB 5FGBC 2VDLH 4X5WB 4YBHA 4ODSL 1QFUH 4HH9A 5TPWH 4WFED 5D1ZD 3OKEB 2ZSVA 4X4ZA 3ZL4L 2DMCA 5JXEA 2VIRB 4OJFH 3O3BA 4JY6B 5HGAA 4PYGA 5IGXH 3QH3A 2CRZA 3MLUH 1JNHB 3HZYA 4AG4L 3DV6A 4K07A 2OXHA 2WSKA 1FORL 1H9VA 2E9WA 4X4YA 2XWBA 3PJSB 4IRSB 2H41A 3N9GH 3BIAX 4U6VH 1U8MA 1MFAL 1PG7H 1CGSL 1MCNA 1VCAA 1YNKH 3OF6A 5AD0A 2Y07L 2B39A 1U95B 2YEZA 1KLGA 3EJJX 3RIFF 4BSJA 4OCXH 5J3HC 2D31A 5EORH 1IGYB 1R3HB 5JO5A 4QRQB 1U3YA 3DMMA 1CGWA 4I4WB 2EDJA 3Q3GB 2X10A 4EVNA 4IOFC 5DEGA 4LSVL 5E9DB 1CLYL 1XZ0B 1V3MA 3SDAA 3MACL 2IQ9L 2K7QA 2NY7L 4NSKA 3BGAA 3RPIA 3OKDB 5CP3A 1CDBA 2PO6B 4KRPC 3UC0H 2X9WA 3FQXB 1MOEA 4HGWA 3I2CL 5HSFA 3CFKA 5D7JD 5I19L 1BMGA 1UXWB 1DSFH 1YEGL 4GXUM 4RMSA 1MFCH 4KZDH 3QWRA 2XV6B 1Q9OA 4XCCL 3WXVL 3LHPH 3BKJL 5HGGS 4DKEL 3MO1A 1OP3K 3PWPE 5BV7B 1MHCA 4PR5A 4NQEB 5F7EL 2VDKH 5E7BA 5FGBA 1RZKL 1WFTA 4GJTB 4NC2B 3SDXF 1QRNE 4LEOA 5CJBA 2HTLC 3RUGF 5HHQA 1OQOA 3MV8A 4LSUH 3QZWA 1AY1H 2BJMH 4JFDB 5DSCB 1FZJA 2P5EA 1HHJB 4JM2B 1A7OL 5KSBB 1MI5D 4BQ9A 4DGIL 3LD8B 3TYFB 3VFSB 2BVOB 1CXLA 4RNRA 1QBAA 5ISZE 4FQ1H 1GC1C 2A83A 4JO2H 5BZDA 5IV2B 3MV9A 4YFDB 4C59B 3MJ8B 1TPXB 2DD8L 4I48A 4HX1A 4PG9A 2EIZB 1A6AA 4LSDA 5CEXA 2FNBA 3GSNA 4GAJH 4OZIB 1X5LA 3WIHH 4J3TA 1P53A 3TO2B 3EYQD 1CK0H 4JPVL 1N0XL 2BXYA 1W0VA 1OVZA 5E6ID 5I1AB 1KT2B 4LFHG 2EE6A 2E7BA 2WP3O 2DLHA 3BJLA 5AYQA 3MRGA 2LTQB 1JFMA 3DX6B 2BMKB 1ZHKA 1YYLH 4Y5XA 2NW3A 3V7MA 4YK4C 1EO8L 3RNQB 1ND0A 1MJUL 3VRLE 2ICWI 1M7XA 5HY9A 3RVVD 3IFOB 4NYLA 2DKSA 2EYRB 4DN4L 1YNLL 3D2UD 3LN9A 3BI9X 4HS8L 4LSRH 3ULUL 1BIHA 1J8HD 2CD0A 2FIRT 1QYGH 1DQML 1CIDA 3O2VL 4TNVK 1L6XA 2ZUUA 1ZA6A 4XNXH 4YX2H 2WIIB 4QGYA 1OB1B 5E08L 3MNZA 1RAMA 3MBEB 4HIJA 5E2VH 2O5YL 4XPHH 2P44B 5EUOE 2VLJB 3ECBB 3NIFE 1V3JA 3ILPA 1IAKA 2BHYA 1FFPB 4O2CB 4OGYH 4K8RL 3MLRL 2FJHB 3VFMB 4QRUA 4I0CC 2YPKB 1E28B 1JPFB 5HYJD 5B39G 3R06A 1MLCA 3Q48A 5C86A 4M3KB 2X9XA 5GGTA 3A6BL 4LQFL 1CFSA 3TYGL 1A6UH 4YPJA 2AEPL 2QHLA 2ICCA 3WNKA 5DURB 1VEMA 2AK1H 4JKWA 2HN7B 4LSVH 3SE9L 4JM2D 3JWDL 5C0DA 1KPVA 3SDCC 6FABH 5F89A 1D5BA 4ORGB 2GITA 2CKBL 4ZYKA 3IVKB 1DBKL 1KFAL 1A7QH 4NQED 5ITBL 5EZOL 1TCMA 5DMIL 4KVCH 4XCFL 1DSFL 1JYNA 5F1SA 4GQPH 5T1KA 4Z7NF 3IRPX 4L3AA 5GGRY 4BK5A 5E5RB 2W38A 4ONFH 4EOWL 4U6TA 4CN1A 2BOCB 4Q7DA 4MB3A 3LS4L 1GAFL 3P73A 5DD5H 1G9NL 3K81A 4HJ0C 1QLEL 3ULVF 1Y6MR 1K4CB 5JOPD 4HUVA 1P84J 4W81A 1FYTA 6CGTA 1WIOA 3LKQB 2R2BA 3DVGA 1H3GA 4BZYA 1XGTB 4RAUA 5DDHA 3L3OB 4FS0A 2EKSB 1B2WL 4L8CB 1KPUB 1N59A 4P2QE 5JDJA 2MSPA 2Y23A 3EYUL 1F4AA 3U7YL 2NR6D 3LQAL 3G6DL 3Q5OA 1K9TA 4XMKL 1DDHA 4EZMA 3STBA 4QHMB 3P11H 4PJCF 3SEPA 4YDVA 4YE4L 3FQRA 3VXNA 1ZVHA 3MRFB 2WBJD 1ULVA 3MLVL 1YUHA 1FRGL 1W0WB 2X4OA 5FUZL 4X6CF 4LK4A 4Y16D 3ARDD 1OGAA 4YXLL 5E6IC 4RIRA 4TNVF 4K2UL 3KYAA 1NGZA 3U0TA 1BVLA 1T83C 5CJXC 5IQ7H 1NGPH 3SBWC 4WTZG 5KVEH 1QPXA 3O8XB 5E56A 4R2GD 1IFHH 3D69B 5FO9A 4U1NB 5I76A 1UADC 2FDBP 5EIVA 3MFFB 3MLWL 3VRIA 1E27B 2M8XA 2GTWA 1KXQE 5MERA 3GMRA 2P48B 3VGAC 3RI5F 4WY7L 3LIZH 5EOCL 5D1ZB 3VE0A 2OJEB 2P46B 4KV5E 2EDOA 4HK0A 5F9WB 3MV7B 2R0KL 2GCYA 1KBGH 1Q0YL 4K7PL 3QAZC 2APTA 1G7PA 3MUGA 4N1HB 1UH4A 3QUYC 1HHGB 4EBQH 1UM4H 1P1ZA 1VFBA 4JQVA 2CSPA 3A67L 5E1HB 2AJVH 1J1XL 3I75A 4NO3A 3G6JB 5GS1A 2CMRH 2LE9A 4PJAF 5TE7H 3ARFC 2R56L 2EXWD 5CS7A 3H42H 1QD0A 3ULUC 2ZNWA 4H25B 2VXUL 5B3JE 4JFED 1NCDH 1VA9A 4NQEE 3T2OA 4ZUTA 1JHTA 1M6OA 3JWDH 5JR1L 5F7WC 5FYJU 5I73C 3MTRA 4NO2B 4ALAH 3KXFB 2Y06H 4QHNB 4OM1L 5F6HJ 3U82B 4GG6A 1MIML 3K8LA 5FYLL 4TYUA 5DMJB 1OLLA 4JG1L 4ZPTA 5DHXB 2NXZB 4PRBA 3WYRA 3WIHA 5DQ9B 3C60B 1UC6A 2NY4C 1CFVH 4HXAL 3F62A 2RHEA 4P2CG 2OL3B 4YNYB 3AFLA 4GMSL 4MA8L 4HPOH 2Z91B 5GS0L 5I1DB 4NT6B 2DN7A 1ZEAH 4N0RA 1TJIH 1X3DA 3GMMA 4C54A 4DKEH 4KPHL 3UTPE 4YXKL 1FFOA 2ZG1A 1WBYA 2F53B 3PUCA 3RJQB 4LPCA 2C1OB 4M02A 5C09D 3VWJB 1ORSA 3VD7A 1CTNA 4YHLH 2ZUSA 3DURA 1FVCB 3RKDC 4H5SB 4RGOH 1QBBA 5MEQA 4D9QE 1MEXH 4EUPH 1MJ8H 3VD9A 4N5EA 1ZMYA 2IAMA 3QQNA 5LCVL 3S36L 3NACH 5EU4B 4G8EA 3G5XA 4KK5C 3BKJH 3JVGA 4L3EE 5DK2A 1IKFL 3UPRA 1S7XB 4LRNH 3MA9H 4QRPD 3VWJD 5DJAB 2OL3H 3HUJB 2DAVA 4HKBA 5GHWH 1BD2E 1ORQB 4XVJL 5C2BL 3QIWA 3RNKA 2P24B 4Z78B 2WUCL 3DYPA 4M7ZB 1SEBA 1JP5A 3LN5A 4BYHA 1CK0L 1EX0A 3BN9D 4JPVH 3JTTA 3VWKB 1YPZF 5D96C 2ADFL 2VKWA 2VXVH 3QUYB 2W07A 4EI5A 1UZ8A 2YPLA 3K74B 4HMCA 1F5WA 5JXED 4X9IA 2MJWA 4GRLC 1TZGH 4B50A 2JIXA 3UYOD 1U58A 4MXQA 3FHAA 5EUOF 2DKMA 4L5FH 1OQXA 1JMXA 3EYOB 1RURH 4JRXB 4HUNB 3AMLA 1P4LB 3PGDA 3OAUL 12E8L 1RUKL 1Z9OA 3CSYB 2WQ8A 3UJTH 2IEPA 3RVUD 5L7XH 1X5IA 4ODUA 2B1AH 1HSBA 1CLOL 1VHPA 2M26A 3QDGB 4XGZB 4ZXBB 5CIPB 3CVHA 5KSAB 3B9KD 2ADJB 3MJ9H 3BESR 1LP9E 2GK2A 5DMGC 3QB7C 1VERA 2DQCH 2ADGB 2FX8H 1PKQA 3HTLX 5BMFH 4FFVC 4XP6L 1F13A 2AK4D 2B7DT 3MPCA 1RJYA 3MNWA 2E7LA 5FYLH 3ULVE 3SGDH 3ZDXF 2GY7B 4A6YH 2VAAA 2PYEB 3MLSH 2YC1A 3U9UA 2QADC 4RCAA 4HUMB 4TUJB 5DO2D 4I18C 2FJGB 4F7MB 1VFUA 4K3DH 1QQDB 2H1PH 4R4FH 4AK1A 1I9JL 1NFDA 4LSPL 3L3IA 4Z7NE 3MBXH 1BFVH 1IC7L 4CMMA 1A9BA 3P4OB 3CFEA 4K3JL 2AKRB 2XQBH 4XBEH 5C2UB 3GRWL 4KTDL 2HMIC 2UWEF 3CX5K 4KHTL 2Q86A 1BF8A 3PWJA 3RJDA 1D3CA 4L4VB 1OF2B 1U92B 4NZUL 3AY4C 2DWDA 1S7WA 2YKLL 4WFEE 5H94A 4HXAH 5ELIA 3HAEA 4GKOA 4LLVA 4KWUA 5A2FA 5EBMA 3GGWA 3ARBD 3CFDA 3QEHA 3QI9C 5L0QC 1EGJH 3BISA 1RFDL 4F8TA 2Y6SD 1CTOA 2JJSA 2NTFA 5DJCB 5F7LB 1U8QB 2J8UA 5FGCE 3WD5L 2OL3L 2VL5B 5EU7E 3QUXC 3MRRB 2C9AA 5HYQB 3H0TA 1BBJB 3JUYA 3K3QA 1B0GA 2YZ8A 3EO1B 4V3DB 3ARFB 3L7EA 1I1AA 1YEFH 3IJYB 3MREA 4HWEL 1JN6B 3SDDC 2JELH 1NCCL 4KU1A 2K7PA 3MGAA 3FRUA 4TQEH 5FCUH 1U8OA 3BE1L 5C0CD 1OAQL 1W72A 2BY0A 5KS9B 4XHJC 5K9JH 2PW2A 1KCRL 3QG6A 5DJ6B 1GGIH 3B6SB 5F3HB 4YIQA 4N5EC 2V5SA 3SCMB 5DXWA 4QRRA 1NUFA 2VXQL 2FO4B 3MLUL 2AJ3A 1DL7H 2DM3A 4HKXA 2H26B 4WV1C 5K9QG 1Y0LA 4H0GA 1HQ4A 2ZCHH 4XWOD 4QXWA 3JBG7 1PYWB 5SV3A 4HFUL 1IEAA 1E4XI 3PWLB 2UWEE 3IDGB 1IQDA 5C07B 4U1IA 5AZ2L 2CXKA 4LLUB 4LLDA 5JHDA 3ROOA 3ZSTA 4OV5B 3BD3A 4IMKA 3BKMH 3GI8L 1ZTXH 4YAQB 1KIPA 3DARA 2R2HB 4J7RA 5FAAA 3OJDA 3OSKA 1NUDA 2O61B 4OD3L 1LQSR 1QRND 1G7MA 1EJOH 2AV1A 5HHOD 3VXRE 1UYWL 4OZIE 3JTSA 4HDIB 3MLWH 3HC4H 3LH2L 4MB5A 4R9HA 5DT1L 4P2YA 1F3DH 4PJ8A 3W9DA 1A7PH 3FT4B 5T1MA 1I1RA 4Y2DC 5F3BA 1ZGLA 2Q8AH 5I30L 3NABL 4BZ1H 1NMCB 4WW2F 1J1PH 2VIRA 4JO1L 2JJUA 1A1NA 4NM8H 4EDWH 3RTQA 5FYKU 3R0MA 4ZNCD 3CMOL 4ZTPL 2X1PA 3OPZH 5DFTA 4ZFOL 5EUKB 5TDNA 2OP4H 2V17L 4L4JA 3G04A 4HIIA 1E4KC 3MYJA 1R5IA 4CADB 3PJSA 4IRSA 4R2GC 1BHGA 5F7EH 5JIIA 5J89A 4DZ8A 3DETC 3BZ4B 3NIGF 4ONOA 2P8MB 2DTMH 5CCKH 1PZ5A 1CR9L 2X40A 5JA9A 4N1EA 3OR6B 3WFHA 1CVRA 2JF1A 3MQIA 4XC1L 5FDWB 4HHAB 3REWB 4FFZL 1V8HA 1NDMA 5AYUH 4ZFZA 4S1SL 3WNMA 1N7ML 2ZKHH 1FE8H 5HPMA 1NCWL 2ICEB 4TSCH 3IDIB 1RMFH 3P9MA 3U36B 1Q9LB 5CJQH 2RFXA 3HNVH 3WL9A 4JN1H 3LRSB 2SEBA 3K1DA 5J0BA 3O9WB 1LNUA 3H9YA 2VLKB 3MRDA 2Z31B 4PD4J 4PGBB 5IMMA 4YWGH 1VEPA 4GLRH 3KPTA 5LG1A 4Z7VE 1HDMB 5E2UH 5JQHC 1LP9F 2MNUA 5DFVD 4YFLF 4HV8A 1P4IH 2XOTA 1F45A 4JFDD 2A6DA 3TIDA 5AUMA 2VXTH 4YDJA 1Q9WB 5C3LD 4TQEL 3Q6GL 1HYSD 1OAUH 4YZFF 1I1AD 3RWJA 3TBYB 4WCYL 2HKFH 1FDLH 1DN0A 3OXRA 1G6VK 2CRMA 4OT1H 3FO2B 4ZPVB 3DGGA 4JG0H 4PLOB 1HIML 4WUUD 4Y5YB 4UDTA 1QSZA 1CBVL 1T1WB 3DX9B 4XZUB 4P5TA 2FYYB 5SWZD 1LEKA 1T3FB 1QPPA 1V3LA 5E1AB 5EULV 5TDOB 2I26N 5IVOA 1TJGL 3HC4L 2PO6D 2Z4QB 3C2AH 1A4JA 4LHQB 1MUJB 3TIEB 3VD5A 1FP5A 3BN9C 2R0LL 1U8HB 4YEEA 1YEKL 4J23A 4JKPL 4AMKH 4EDXA 3ZYZA 4U05A 2NQCA 1E6OL 1A6AB 4H8WH 3S4SG 4OLXL 4M03A 4PJGA 5INCA 1KJ2H 5DI8A 4JO1H 3OJVC 3W9EB 3VGDA 4E41D 1FNEB 3LEYL 3P0VL 5E94A 3SDCA 1WT5A 3QDME 2PXYD 1ZLUH 5HYJE 3U9PH 5E2TL 5D5MF 1BOGA 3DVNB 4OF6A 4P57A 4NZJA 1I8IB 5DRNA 1FBIL 1EXUA 3X17A 1TITA 4GKNB 3PHQB 4IOIA 2BMKA 4I3SH 1G7QB 3S37L 3KLHC 4A6YL 3A6BH 2R1XA 1ED3B 3QDGD 1UGNA 1YEGH 3U0WH 4PJGE 4XC1H 1XGUA 1H3PL 3KJ6H 4R96A 5ERWB 1KJMB 1IM3B 3T77A 3WJJC 1CLYH 3OX8B 2BC4B 3IJSB 4LNRB 5K9OB 5KSBE 2J12B 3DUSB 1QO3B 4K8RD 4HWBH 1IM9D 4Y8DC 3VRJB 5LQBL 4I0PA 2LAAA 3GMLB 1KC5L 1UVQB 1RZKH 4NC1C 4S11A 4GG6F 4MSWA 1RQ5A 5IB4B 4YWGL 2IPUK 1AY1L 5MEND 3EJZD 4OF7A 2EXYC 4HKZB 5MI0B 4PJXF 5C0EA 5IB3A 5GRVL 2R2EB 1N7MH 4HMEA 3RGVC 1IC7H 1VFAA 4X99B 1DFBL 3IDNB 2X4UB 5DYOB 3OB0K 2G9HA 5EU6B 4RGND 2RCSL 4FQ1L 4Z7UB 2I07B 3WXWH 3UTTD 2UZIL 3NCJH 4WI7A 1I9EA 4Y5YC 3IKKA 3HUJE 1I7RA 3HE7D 1BD2A 2EC9U 5DMGD 4QNPF 5ITFA 4KFZC 1DP0A 1ZT4B 4N68A 4AM0A 2NW2A 1MCOL 3RWEB 3FONA 3LVEA 4LCUA 3OGCA 4MXVF 4ORGA 1QACA 4PBWD 1RJCA 4DAGH 4Q9CA 3PNWB 4AYFA 1F6AB 3QWQB 2W0LA 3HI1B 1NBQA 3O41A 5T1LA 1KXTB 1Y18A 4P59H 2VO5A 3GSVB 5HHXH 4JO2L 3QIWC 3S5LG 1WEJH 2NXYB 2OI9C 5K9JL 3LN4B 2W0FA 4R7NB 3CXHJ 5C09B 2ESVB 4W6WB 3S35H 3G5YA 2XRAL 5I1LB 2PR4L 4YHZH 3ARDC 1L7TH 1P7KA 4GXVH 4PRAB 3S3SA 5FECB 3X12A 1NGQH 2E7CA 3PWPA 5TFSH 4L8SB 1B4JL 2APXA 5L2KD 5BRZD 4LIQH 3U4EA 4M1CD 4KI1A 3VFGH 5ACMA 1HI6A 3IDUA 2GJ6E 2FWOA 5IQ9A 1NL0H 4B7LA 3MGOA 5J1AB 4KMTL 5EN2B 4RWYH 3S88L 2IQAB 5IB1B 1EK3A 1FZOB 3UYPA 5E2WH 4KTEL 2VZSA 1HEZB 4HJGA 3EZJB 4WTWA 1AQDA 4RGNE 5IEHB 1A6PA 3IXTB 1N5YL 3DX8B 1W8NA 3U7AA 3DVFA 4MJID 4DGVL 4N8VG 5J6HB 1DQLH 4WRLA 3QEUA 4OZFA 1KIQA 5LGJA 1ZLUK 3VA6A 1GGCH 2B4CC 2APFA 3EYFB 3WFZA 5ESQA 3G6JE 1YNTA 4K7PX 3SQOH 1NCBL 3WIFB 3CFBB 1T1XA 3MFFA 3U7WL 1AO7E 3DNKA 5D70L 1MAJA 2PNDA 4NC0B 1K2DA 1KEMH 3ZMRA 4I8DA 43CAA 5F93C 3TZVB 4MA8H 5DK3A 4NJ9H 2BNRE 2BFVH 2FHBA 4U7SA 3TT3H 3HPJA 5DJZB 4HBCL 4H26B 4NWTL 1R24A 2IJ0C 2F5AL 3D85B 1EUTA 1KB5B 1MAMH 2QBWA 4MS8D 2IPKA 4YGAB 4OM1H 3FQWA 3ULUF 3V79C 3VMNA 2NY1D 3SJVA 3LB6D 1F4XH 1OGTA 3VGAB 3W5NA 1EEZB 1A3RH 1KF9B 5D2LA 4ZFFB 2V2WB 3MRIB 1U6AL 4YBQD 1QTYT 1F02I 1RV6X 5EIIA 1D6EA 2H8PB 1LO4L 3DRTA 1T03L 2IPTH 5DRXB 3WFBH 4XVUD 5A2LH 2Z93A 3ZDZE 5TE6L 4F15C 4L1DA 1RY7B 3O8XC 1AGDB 4M62H 1X7QB 2VZOA 4OCYH 3RWDB 1AH1A 3F12B 4WV1B 3EFDL 1B9ZA 1M7DB 1V7NL 3D48R 3IF1A 3BWUC 3VG0H 5TF1H 1EDQA 3NZHH 4JM2F 4GW1A 5BXFB 3CUPB 1PQZB 4QHLA 1NGPL 1NMCC 1XF3B 5EC2B 4LSTL 3V6OA 2WANA 3EGSA 3DSFH 4UIMA 4XNQB 5KSUA 5DD5L 5DLML 1N0LA 1FL6A 1WEJL 4QOKA 1CU4H 1DJSA 4FQXA 2DM2A 1XH3B 4ZODA 1BPVA 3F6IA 2D4FA 2VJXA 2Y4SA 5CBAA 2X70A 1T1ZA 1XMWA 3I9GH 2EDNA 4HH8A 5EBLB 3FOLB 1MCPL 3VFNB 1DEEB 5FKAB 3T3PF 3GJFB 1RHFA 2C5DC 1WC7B 3BOVA 1JCKA 5JPNB 5I1KH 4XP9H 1ZHNB 5C0FA 2OSLB 4IS6B 5T3ZD 4CGTA 1K8IA 5F1IA 3SKOA 1KPRB 4UB0H 1FORH 5E5MB 2XXCB 3BDXA 5C08E 3QXUA 1KLUB 5IM7A 1FGVL 1CL7L 2DL2A 3WN5C 1CFTA 3FFCB 3L1OH 4XC3L 1MFEL 2X4NA 4HUKB 2E9IA 2EEBA 5GGVH 1FVDA 5T1DL 3VFPB 2JB5L 5TE7L 4NKDB 5LJYH 3SKMB 2J8UF 4AIXA 4XB8A 4QTHB 3TF7A 3HE7C 4JEGB 3F7RA 1BAFL 4URTB 4UILH 1ZSDB 3QIUC 5I1IH 5CZXD 5D1QA 4NWUL 1OARL 5BO1L 1A5FL 1PG7L 1TQCB 3LKNA 4M5ZH 3RHWF 4F58H 3DSNA 5JPMA 4D2NA 1EZVY 2OS7A 2C3XA 5HYJB 1LGVA 4ALAL 4L3EB 3HMXH 4PPTA 3HZVA 4NHUA 1S7RA 4DW2H 4HIHB 1B6DA 1KN4L 2PXYA 4M8QA 5ANMB 3SDXE 1EHAA 3TGXA 3UROR 3JSSA 3QEGH 1DVFC 2I5YH 1ERNA 2GJJA 5F70A 1LP9A 3FB6B 4QXUH 1RI8A 4JZJA 4WWID 2Z31C 1KYOJ 4QWWC 4HEME 3D2UB 3TH3T 3QDGA 1BVKB 4O5LH 5MP6H 1W0YT 3OHXA 4R90L 1BQHB 3UX9B 1AE6H 3UXFA 5LBSH 1G84A 5ID0A 4N0YH 3RA7H 2OQJA 3MYZA 1X44A 2IC2A 2FJFA 3RY5A 3GJEB 5CBEA 3TVMD 2Q20A 2ZCKH 1CFNA 5GZNC 2VTFA 4FABL 4PJDF 5DC0A 2AXFB 4QKXB 3C08L 4NKOB 2OK0H 2ERJB 2VNCA 4UU9A 5D9SB 1UENA 2BNUB 4GRLB 2JCCE 2FB4L 2XKUA 4Z5RA 4OIIL 2H9GB 3QPQD 2FD6L 1U8NA 1BFOB 5I66B 5TJWK 1TENA 3RY4A 2IGFH 3P0GB 1WUNT 4MZ3A 2ZZUT 2WM0A 1I8MA 2Q76A 3QQ4B 1FLTX 3KG5A 1OTUC 3BHBA 3Q6FB 1RIVL 4CJ1A 3MV9D 4PJ9A 3O4OC 1D9KB 1LWRA 4U6HB 3PDOA 4BM7A 5GRWA 4JFDE 4WO4A 5FOBB 4XWGH 1ZLWK 4KY1H 4OZHE 4P2OB 3S98A 4X83A 3NCJL 4GAGH 1ES0A 5IVXA 4GBXC 5D2NA 3MRNA 3M1BB 3VXTA 1L0XA 2ATPA 3MA7A 4U1JB 1I3GL 3THMH 3E0GA 5FHAH 3VXUE 4U6XA 2G75B 2HAZA 3G5ZB 3UO1L 3UYRH 4AIZA 3GMQB 2XNAB 4JFZL 1PY9A 5D7JB 3CDGA 3O6MH 1BEYH 4RSVA 4PJEA 1J0HA 2VDNH 2EEDA 1J8HE 3I3EA 4ZNEA 3SGDI 3PV7A 5MHSE 4JE4B 1EMTL 4Q9QL 3OKOB 4LAQL 5IV2A 4O4YL 4FMKA 1LEIA 4JO4L 3LQZA 1BQUA 2MQCA 2YR3A 4HS8H 2I60L 4OZGF 1J0IA 3WUWB 4B53A 3QPQC 3D39A 4TOYH 4KUCD 1G9MC 3GMOA 4MWFA 4BA8A 4F9LC 1B0RB 1LO0H 3K4DA 3CMOH 3EDJA 4M9OA 5C9JB 1IEBA 1MHPH 4G8FA 5GRJL 3X11A 5IJVB 4M9PA 1W0VB 1I75A 3GJFK 1VB9A 3GSRB 4OLUH 1K6QL 1WFOA 4YPGB 2QLVB 2KL6A 4TNWF 4P23B 4JAMB 3OXSA 1R3LA 3W0WE 3IFLL 5DD0L 4WWKC 3C5JA 4PJAB 4DW2L 1XGQA 4NGHL 3SDAC 1J1PL 4IRSD 3EDKA 3UJTL 4U1IB 4Y2DA 1EAPA 5IW3A 4HK3N 2BNRB 4BFIA 2YXMA 4K7PY 2IANA 2ICWB 2YD5A 2ATKA 3I3DA 2FX9H 1S3KH 5H37H 3BYTA 4P0DA 4JQXC 4Z7QE 1CGSH 2ZOKA 3IU4H 4X8JB 2LABA 3QPXH 2OK0L 6FABL 4G6FB 3TWCL 4YC2C 4P46B 1KFAH 4JY4B 1T04B 3I2CH 1A3RL 5IG7B 3RA7L 1IVLA 3KPSB 1NEZA 2NY5H 4UZGA 3MV7E 2VXSH 2DIAA 2EE3A 5CMAB 2DM7A 1NGYB 5EB9A 1T5XA 5FV1L 3WNNA 2LU3A 5GGVY 3C6LB 4XB7A 2J1KA 3BH8B 3AMKA 4LVHC 3LV3B 4MNGA 3FQUB 4FNLL 5FF6A 5DZOA 3OZ9L 1D5BB 3B5GA 4PJ7B 2P8MA 1CD1B 1Z0MA 3VMPA 4C4KO 4DTGH 4QRSA 4WO4C 4XRCA 5F9WC 4NNPL 1MCKA 1GOGA 1KIUA 4D3CL 4W4OC 4KH2A 1A1OB 4V1DD 2OM5A 4AEIL 2XFXB 1NC4A 1HSAB 1P9MA 2C1PA 3OAZK 3REWA 2CK0L 1NDGB 1P4BL 5DVMA 3QR2A 1D5IH 3W39B 5I0DA 2ICWJ 3QXDA 4NBZB 5C0AB 1GZQB 4RFOH 1BZ7B 1QSEA 4QRPE 2NY2D 3H9HB 1N2RA 2UUDK 3LSOB 3LQMA 3RI5K 1NBZA 4JFQA 4C58B 4P9ML 1RULL 3LKOB 3H9SA 3S97C 3BD4A 1VPOL 3ETBF 3KPRD 4G6KL 2QSQA 4P3CL 1U8PA 2NX5A 3UAJC 3C5SB 1AIFA 1YECL 2FGWL 1DBBH 4WW1B 5C7XL 1UB5A 3WS6A 1T7YA 4YHNB 1INEL 2BVQB 5I18L 5GIRB 4CVXB 1JWSB 5DFVC 2GKIA 5B8CC 4APQA 4UDUB 3EYVB 2JTDA 1F90H 3GB7B 4PBXA 1A8JH 1DQJA 3CLFH 1ZANL 2EIEA 5E99L 5BZWA 3ZE0F 1FNGB 4F3FB 3J7HA 2DYPB 1H0DA 1WCQA 4JJ5A 4WEMB 3TNNA 2W92A 4X9HA 1QBMH 1KTRL 3RKDD 4K8RH 5D71H 4G43A 4PJIF 4K9EC 1DLHB 2H2PC 3CDCA 1SMOA 1OAZH 2P8LA 3T1FA 3VFVA 3CK0H 3E6HA 2X89A 2DJSA 3GIVB 4PRPA 3B9KA 5DJYB 4U1GB 4PRHB 4FTVA 5D7LD 4QOKE 2P5EE 1NKRA 4U6YB 4CU6A 4MJ6B 3BKYH 2X5PA 4L8BB 3UTSA 1MWAA 4RMWA 5HDQH 4HCRA 4XBPA 2GCYB 4JRWA 2NY3B 1ZS8B 4PRDB 1JPFA 4YXKH 3QPXL 3W0WA 1JYXA 4NQSB 4ZQKB 3O3DB 1MH5B 2VR4A 1G7HA 3PP4H 4JRYB 5E8OA 4NCC1 3MRBB 5JLZA 2JIXD 4NFCA 4QF1B 3T0DA 1CXFA 2HVKA 4PJIE 4WGVB 1XR9B 4XAWL 2VSCA 5I9QC 4R0LB 1YN7A 1WT5C 4NDMA 1JV5B 1IT9H 4DAGL 1IKNC 3NCEB 1JWUB 2VXSL 1VEOA 2R1XB 4EI6B 2V2XB 1OSZB 3BW9A 1NBYA 2P7TB 2J8OA 2W65B 5A2KH 4HULB 4KROC 3U0PB 2H2SD 3DUHA 2XN9D 1IE5A 4JRYE 2VRAA 4YXHH 3O3EA 2BDNL 4FXKB 3O2DA 4BFGA 1C08B 3GMLA 4Z95H 1H15B 1BJ8A 1MEXL 1JPSL 1NGQL 1RVFH 4QRTA 5IK3A 3S34L 5JW4R 4YDIL 4MQSB 4IIQB 1JNNH 3P73B 3C8HA 3HG1D 2VXVL 4OCSH 4OTXL 4ZO6A 3T8XB 5I16B 2CR6A 5KVEL 3BVNB 3GO1L 2DM4A 4LLQB 3QFDA 3TA3C 3N1FC 3GSUB 4P3CH 4UT7H 5D7KE 4D8PA 4N90D 5FHBH 4I3GA 3NFSH 1MNUH 2YSSA 1NSNH 3VFRA 1TCRB 5EO9B 2ADIB 3QUMH 2YD1A 3MUZ1 3VGEA 5T3ZE 3OBAA 5J6GA 4XVTL 4DK3A 4OLWH 3HR5A 5HJ3B 3L3KB 4LQ1A 4ZOCA 5DC9B 2GSIB 1G0DA 4QT5A 5BJTB 4Y5VC 2IPUG 3O6FC 2BVPA 4M1GL 5MEPA 3T0EC 4N0CC 1OSPL 2BNQD 4W6YB 5ILTL 2X09A 1MPAL 2FX8L 1HQRA 2ZUVA 4HAFA 1T20B 4LMQI 5BS0D 3GSVA 4LAQH 1NFDE 3WHE1 4ZSOA 2HFFA 3P9LA 4NM4H 5IMKA 1P7QB 5CEZE 1CGUA 2VLRB 3LEVH 5SWSB 4OZGE 1SVCP 3U0WL 3B2UC 4RMVA 3MRMB 3TT3L 4U1KB 4XNYH 35C8L 3JV0A 4JLRA 4RX4A 1WGOA 4N9GB 4WJ5A 3QEQB 4EBQL 3P4NB 2X4SA 4R4BA 2YPLB 4HWBL 4K94H 5CEZH 5DMYA 1X6NA 4Y4FB 1YMME 1R3IH 2YN3A 5BMFL 1E4XH 3D3VB 1ZOXA 5D96B 3QDHA 2NY1B 4P2OC 4AMKL 2LFGA 4NZUH 4ZS7H 3ES6A 1CL7I 5IB1A 2HKHL 32C2B 4J3WA 4WUKH 2XT1B 3D85D 4XTRD 1N8ZB 3CX5J 4MNQA 4WWKA 3T65B 1NCDL 1MHPL 4CKVX 5LKNA 1FGNH 5DD3L 3MRCA 4WHTA 2FR4B 3NFPB 3TZVD 3BP5A 2DMKA 3ARTA 4OLUL 3IU4L 4KI5C 4OZIF 2Q7NA 4HIXH 4BH8A 4NNYA 4X6BA 5IW1A 4Z6AT 4L3CB 3KYMB 5FFLA 2BOBB 2KH2B 4GSDL 3DECA 5FUCC 2BDNH 2DOCA 3M17A 4OFYD 1YQ2A 4PJ5A 4JHBA 1INDH 4NQXA 3RWGB 3SGEH 3DO7A 2DWEA 3FOMB 4C83B 3F58H 1CXKA 3V9FA 1QVOA 3B5HA 4CN4A 2NY2C 2YHGA 2NY5L 2HJLB 5ADOL 1DUYB 1PLGH 5EU3A 1MCCA 1IZJA 2DQFB 4S1RH 2DMBA 1JYWA 5CEZD 4OZHB 4GG6B 3BGFB 3ARDA 2CO6B 1F6LL 4GQ9L 5IF0A 3EO0B 1A6ZB 2VLLA 2EC8A 5L88L 4NQCE 2WBJA 3S35L 1PY4A 4J3XA 2DQJH 4LSSL 4FQHA 3RX8A 3C5ZC 5BRZA 3H9SE 2B4CL 4QXTB 4KRNA 1MJ7L 1KENH 4L4VA 4XCNB 1KCKA 1BOYA 2GJ6B 4KJPD 4GBXA 1AD0B 4GKZB 3L7FA 3GMMB 3PWVA 3VGFA 2AEQL 1ONQA 1WISA 3QCUH 2FSEB 5JW4M 5L2KB 4BKLB 4OUOA 2ZCHL 4OD2B 4LLVB 4LCWA 4S0UC 1HYRC 2AJSH 3JV6B 4HMDA 2EYTA 3BWAA 5J7CC 3FCTA 1V3KA 1CZ8L 2NZ9C 5ESVB 5A16B 4QHKI 3VFUB 1F58L 1U95A 2OZ4L 3K7UA 4MD0A 4XBGB 4UNUA 5DJCA 3QIBB 5BV7C 5J1SC 4FQLH 1T6VN 2I9TA 4GAYA 4GKSA 4O2EA 1I8KA 1JZ7A 2FIKB 1YN6B 2F74A 1TXKA 1T7WA 2W0KA 3AS2A 1ZLVH 1WWCA 4OGYL 2CDFB 1NGWA 4L9LB 1FG9C 2YD7A 3IXAA 2E6QA 4Z7VA 5JOPE 4ZFGL 3V5HA 4H20L 3FAWA 1T5WA 2HJFA 3AGVA 1FL5A 4XH2B 4UINH 4G9FE 1KSRA 2Y6SC 2J6EL 1RUQH 1MCBA 5B38G 1N5AB 4LCYA 4ZO7A 4LIQL 3GBLA 4I13B 4NWUH 4ELMF 1VPOH 4AZ8A 4OB5H 3D0LA 4ODWB 2OSLA 4G5ZH 5MENB 3B9AA 3KPSD 1KPRA 4I0PD 5IHZA 5CINL 4L8DB 4MDIA 5CLTA 2VDQL 5C92A 3ROLA 5IKCB 4PJHA 1M7IA 4MAYD 3U46B 3ZZ1A 3U2SB 1S9XA 3MV11 4MAUL 4LEXL 3IDGA 3PQYB 1IM9B 1D5XB 1EJ6A 3DIFA 3TJHA 3HE6D 5IROA 2EDTA 4AY0A 2DI8A 2CRIA 1AGEA 2PCPB 2XPGA 4K71C 2MMXA 5DD3H 4KKLC 4LCIL 1J0KA 2IH3A 2ZKHL 3F7QA 2ADGA 4ODXA 1ZSDA 3LS4H 5DGQA 4I2XA 2CIIB 2DDQL 1UEMA 3CFIC 4LKCB 1J7VR 4Y19E 3QIUA 4Y4KB 4RISL 3OGOE 3MJ8A 3TF7C 5DA0B 5L88H 3QUZB 4FZ8L 4UUJA 1QQDA 3BT2H 2XYCA 4LGRB 5KSBF 2OTUB 1BWWA 1J0JA 1U8KB 5I15L 4OZGA 3RY6C 5IMLA 2ZG3A 2AKRA 2D7NA 1TJHH 4ELMA 3O11B 1ZVYA 5JHLL 1WWBX 4P2QD 4BFEA 1QKZL 2PO6A 2Q1EA 2EH7H 3MOAL 4XP1L 3BZEB 5T3ZL 3D2UA 2R69H 2F9BT 1F3JB 1BQSA 3I6KB 4X7SH 8FABA 2Z9TA 4OGAD 1FFRA 4PJXE 2HA1A 4RAHA 1BJ1J 2COQA 3BGMB 5ICYB 2C3WA 1FCGA 2R8SL 3OR6A 3WFHB 3SGJC 1Z9SA 3L3JA 3GJEA 3ZYOA 4AT6B 4L4TD 1OAUL 4BH7A 5KSVB 3U4BH 1UXSB 1HINL 2EDYA 1OD9A 1WBXB 2FATH 2Y9RT 2ZCLL 4GG8B 4PJAE 4D0BB 3VFMA 4YR6A 2V7HB 3UZQA 3FTGB 5GRUH 4ZFOB 4BUHA 1JGUH 3O6LH 3ULUH 4P2OD 5HYSB 1OOAA 4Y4HC 2APBA 2UUDH 4HUWB 1XCTA 5IR1B 1FL3A 1D9KD 1OTSC 4R0LC 3IS1X 4JZNB 4XHJD 3OKLA 5DTFA 4JFFE 2IBGA 1A5FH 4OGZA 3QG6B 1FZKB 1OAQH 5C0DB 1F42A 2MWCA 1PEZA 4EUPG 4IRJA 1NUGA 4D0CA 2UVFA 3GSWA 3RWJB 5GGVL 1J1OL 4FXGB 3UBXI 1U8JB 2QR0A 3QFJA 3O2DL 3QUML 1F4WH 3MRHA 3QUXD 1MHEA 2XY1A 1A6UL 4UILL 3WHXA 5F88A 1KLFA 3LKRA 2BSSA 5HI3C 2VQ1B 3OPZL 4NQDD 1E6JL 3QWRD 5HPOA 2HJKB 1OSPH 5HY9B 2X4RA 2EYRA 1D6VL 4P2RD 3L1OL 1Z0NA 5CD5C 1YYMH 1X5XA 4YBQC 3B9VA 1T22B 3BH9A 4OBSA 1FH5L 3QSKB 4U1HB 1KN4H 2R2BB 1AO7B 1DQDH 4HUUB 5CSGA 3EO9L 5C0GB 1NANH 4FFYH 1IGTA 2HVJB 3C8DA 2H45A 3ALXA 2PKDA 4XP5L 1EO7A 3TNMB 4HDIA 4G42A 1LEGA 4PRPE 3DETD 3HG1A 4PD4K 3TV3H 2E9JA 4NKMA 5JUEL 5I74C 2DRUA 3GI9H 4TRPL 3L3GB 3HNVL 1HNGA 3RWCA 3HRPA 4L3ED 2F58L 4W6XB 5JW5A 1YY8B 1INDL 3DXAA 4JDTH 3SO5A 3KPOB 3RDTD 3DV4B 2E7MA 1CICD 2PN5A 3IU3A 5I1JL 1G7QA 1UJ3A 3LKPB 4JFHE 3MRJA 3FQTB 4K9EL 4WU7A 3TN0B 2X42A 3UBXG 3V4PH 4LVEA 1HZHL 5FUOH 4IEFB 4X98A 1K4DA 2V6HA 5F97E 2BERA 3O0RL 2I27N 2R4SH 1TZHA 3SHSA 5FO9B 1ADQH 1CFQB 1I7UB 5EO1B 4MQXC 5L8LB 1NCAL 2Y36L 5GHWL 3QCVL 4ZOAA 2AP2A 4R3SA 1T6WA 4OSUL 1UVQA 2C3GA 1DE4B 1KTLB 1L9NA 1JZ4A 2D9CA 1T04A 3G5VA 3P3YA 4Y5VA 1B4JH 4U0QB 1B6UA 3J8F7 3GMPA 1AKJB 1IFHL 3L95B 2HLAA 4PTUB 2AJZB 5GSRB 1U42A 2QSCL 2AQ3A 3NGBC 4JDVB 1AC6A 25C8L 1T1YA 1Z5LA 3WEXA 3SCMD 1LDPH 3UBXA 1P1ZB 1GGBL 5DD6B 5D7LA 3ZSSA 4M5YL 2VN7A 4XVJH 2VISB 3RGVB 2Z0BA 3G6JA 1OHQA 4WY7H 2Z92A 5C0CB 4EIGB 2ORBL 4HC1H 4MNHB 1XR8A 1GGTA 4UQ3A 4QHMA 2AJXH 1HXMA 1KB5H 4A6YA 2VLRD 2QKIB 1MCFA 3QDJD 4G7VL 1UWXK 2OMNA 5FEBA 1PZUB 2CJUL 3NA4A 2EDHA 5JNYB 2ZJSL 3FN0L 3DX9A 4XZUA 3QNXB 3K2UH 3RQ3A 5BS0A 3CH1B 1J12A 5LVEA 5C0AA 1SYVB 2BNQA 1DBAH 4GW4B 5DQJA 3S4SA 5FECA 4I0PC 3L9RA 3DI2B 3H9SD 1MJJB 3U4EB 1PKQE 5IB5A 1GIGL 3IRZA 4JDZA 1U8HA 3BYYA 3RGVD 4X7EC 3CD4A 2XZQL 4ZMAT 2VDQH 1LK2B 2WUBH 4G9FA 5I1GH 2V9QA 3S37H 2WBKA 2FRGP 2YA1A 3ULVC 1INQB 1HH9A 4X8XA 3T4YA 3KS0J 2AGJH 4LGSB 4PB0L 3ELAT 4HJJH 1CDCA 3EUUA 3HZKA 2XQBL 2A1WL 3MBEC 3U4AA 3QRGL 5C6TL 2UZIH 3MZGB 1JPTL 4W4OA 1P2CA 1MCRA 2DF3A 4IHOA 1F8TH 4WI6A 2DQTH 4E5XA 4JQIL 4QCIB 3G6AB 1E4JA 1IM3A 3NH7L 1CFVL 4UQ2A 2UYLB 4EQ2A 5F7FA 5F96L 1VKXA 1HILA 2EECA 4ZXBD 3ZKXC 1QO3A 4F7EA 1S3KL 4YO0B 3WFBL 1CLZL 1F2QA 4B7IA 3KXFA 4BQCA 1CICB 5DZLA 3WKNA 5B8CA 4XMLH 1OTSD 5I1CL 3HCVB 4MVBD 1OP9A 3L3DB 1NBVL 2CK0H 4Y19A 1KG0B 4QXGH 1KCUL 5ALBH 1S7TA 2EH7L 5HI3D 5H35B 1GGYA 5A2JH 1P6FA 4D9RD 1MFDH 5DJDA 3IDJA 4X9BA 4ZXBC 5KG9B 4O58H 1CXIA 5EA0H 4QF1A 3FN3A 4J3UA 1MCIA 2E9BA 3P77A 4GW5B 5GGTH 4EJ1C 1UEYA 4S1QL 5TFSL 3WJLA 1IL1A 2BY3A 1OP5H 5FYLD 3SDYH 1Q94B 1T21A 2XACC 3NIGE 4WDIA 3VWKD 1UM6L 2F19L 3KXFE 3BP4B 2JJVA 3EFFB 1G9MH 4C56A 1FYTE 4PJHF 3MLYH 3C8KA 3QUKA 2VDRH 2EH8L 3L3HA 3ULVD 1MCOH 1OAYL 2XA8H 2KUTA 3FT2B 1ZGLM 1P9MC 4EKXA 5T3XE 5JW3L 2DYPD 3S5LB 4HIEB 4NQDB 1ZWIA 4S10A 2OTPA 5EBWA 1W72H 3HC0A 3SE9H 3GEWB 1YEIL 1XF2A 3QYCA 3S9DB 3C6SA 5C09A 5LWYL 4G59A 1MVFA 4DQOH 1FLRL 1MF2L 4XNQA 1LD9A 2J88L 2GK0A 1J88A 5JHDE 5DT1H 1N3NA 5FKPA 3D1MC 1VACA 5E2WL 5FIEA 3QNYB 3GFUA 3WHE0 1UA6H 1B90A 2D2OA 3BEVA 4NO0A 1OL0A 2NX5D 3CSBA 4QY8B 4M93B 4QTIL 4RFNB 1UCBL 4ORZC 3MJ6A 4HGWB 5A40E 5J9PA 3QHTC 4G9DA 2O5YH 4DWHA 1ZHNA 3HR5B 5FYJL 1YJDH 1S7UA 3GUTA 3EYOA 3MLTA 3UEZA 2F54B 1J5OL 3QT2A 3G08A 3HB3D 1MHCB 4PR5B 2W9LA 3MR9B 2EDBA 4KDTC 4R90H 4TN9A 3VU2A 1M71B 4ELKB 2R1WA 1U8QA 5IIEB 4JFEA 2XTJD 4L4TB 1NFIA 3I6LE 2CKNA 4V1DB 3M8OL 1L9MA 3LEXA 4PJ8C 5BVJB 1D5ZB 1NC4D 5EH1A 3SKMA 2R39A 1HHJA 4DGYL 3R1GH 1QSFA 4N8VB 1ZVSB 4F7PA 3MGTA 3A6CL 1X4XA 1JFQH 4J8RA 3X14A 1EHNA 1NCWH 4ZUUA 3AM8A 5DO2C 1G0XA 1QLEH 1BM3L 4K23H 5FUZH 5HHVH 4X5XB 3BZDA 2OZ4A 3IGAA 3MXVH 4WJ5B 2HLFD 4YXLH 4P4KA 1A7QL 4Y4FA 3S3PA 2DQUL 5CEXB 3U1SL 1ZHLA 1ZT7B 2Y25A 4P2QB 2UV3A 5EPMA 2DQGL 1NFDB 2OR8A 5CP7A 1KB5A 5D8JL 1YPZB 5HDBF 5KBNC 1CI5A 1A6TA 1FHGA 1T83A 3O3UN 4NOFA 1UM6H 1YJDC 4OF8A 5D93B 4ESKA 1Q72H 4KY1L 1NBVH 1R5VA 1GGUA 4JY6A 2YD8A 4GQ9H 2Y1VA 3T0EB 2Y7QB 4ISVA 5D2LB 5GRXG 1S7WB 1H8NA 2AERT 2CR3A 4JPWH 5EU5A 1FO0B 4FOMA 2BOBA 2RIKA 5DJ2B 5IMOB 3BO8A 2EEAA 1UKTA 5I1KL 1CBVH 3EHBD 3VI3E 1CGTA 3HE6A 3O8XD 5FHAL 4J4PA 2BVTA 4S0SD 1ZA6B 2WWMC 3QQ9C 4Y16A 3F5WB 4P2RA 2VLJA 2BY2A 1CU4L 4FP8L 4MAYB 4HIJB 3HUJF 2NZIA 4QRUB 3ILPB 4M5YH 1GPOH 1LE9A 2D03L 5AZ2H 4ZAKA 3RL2A 5EC1A 1BP3B 1UA6L 2NLJA 2NY1C 3VWJC 1I1AB 4HAGA 4HC1L 3RZCD 2BZDA 3H7BB 3QUXA 3V5KA 1WAAF 2D31B 3TT1H 4UTBL 4KXZI 2LV4A 3VH8G 2G2RA 2DJ4A 5HHPA 1IGFL 4JR9L 2UZYB 3O6ML 3ZKQD 4XNMA 4C57C 5GRYA 5GGSA 3IT8D 3RIAF 1Q38A 5D1QD 3MLRH 2Z31D 1MCDA 1T89C 2FL5B 2VLKD 4K94L 2BRRH 1FJ1A 2VZUA 4LCWB 1JJUA 4WW2A 4ZUSA 4MQXD 3VXQB 1FFNA 3MMEA 1TZIB 3TBSA 3F7VB 2F5BL 4LMQE 3KLHD 5DVOA 1OARH 1IEAB 5DK0B 4U1JA 2R0WL 1IQDB 1Q9KA 1S7SB 3FB7A 1GC1H 1MPAH 5I17A 4HUXB 1YY9C 2J3SA 3QP3A 3QNZA 1NH6A 1MFEH 2J8HA 4HWZB 4PJEB 4U1SA 4I18A 4YGVA 3B43A 1FZJB 4PJFE 2P5EB 4JM2A 1J05A 1FVEB 5CJOL 1WITA 4PRHE 1EFXB 2EKSA 3FT3B 1P5VA 2CIKA 3DVGB 4E0RA 4QOKD 1JUFA 4M7ZC 2QSVA 4HS3A 4XXCA 4NZDA 3PABA 4JFYB 1LO5A 1NANI 2GJ6D 1T2QL 4PJ9D 1DBMH 5DSCA 3KPPB 5L8KB 4DFHA 3E3QC 2NYYD 4YBLC 1RZ7L 5HHVL 3ZDXE 1UKSA 1E4XL 2PYFA 3LMJL 2XZQH 4MD4A 3D25B 4EN3A 3HMXL 1MY7A 2Q7YA 3RVWC 4PY8I 1ETZA 2XY2A 4YDVB 4PJFA 3T0WA 4JQIH 3FB6A 1OGAB 2VLJD 1QRNB 3PIQA 5F9AC 5DMKA 3QO1A 1Q0XL 3KPMB 1WVZA 3BPCA 5E4IA 4G6JH 2XPGB 4ODHH 2PW1A 3MJGX 2P8PA 4OZFH 3PHOA 5F1KC 3SQBA 3JWOL 5EWIH 5KJRL 3MOBL 4EI5C 3BP7B 4IRZL 3GBNL 3OQ3B 2Z4QA 3SY0A 5C71A 3KPRE 2RBLA 4LCCA 1J0ZA 4O51B 2ZUXA 3OG4B 3KWWA 5CD3B 1U36A 2Q8BL 5C0BE 5JXAH 1A7RL 4PGCB 5INCB 4FFEX 2B5IB 2ZPKL 5C0ND 5F1OB 1GSMA 1D5MA 1FO0H 3EAKA 1N4XH 3MCKA 3QHZH 2B0SH 3FB5A 4WVRA 5I8KL 4MA7H 5KAQF 5F7DB 1C1EL 1NC2A 4OUUA 4GRWB 1F11A 3D3VD 1EXUB 5GRUL 4Y4FD 1S7VA 5C0NC 3O2WH 2DQIL 2Y5TA 1VFBB 3D3VE 1RZJL 3ZYIA 4OLVL 2VE6A 1RZ8B 2G60H 2WBJC 2A74B 4XPFH 3LB6C 2B20A 1KBGL 5FA3A 1XGUB 2JE8A 4L1HA 5EFIB 4JHWL 3TBYA 1KJMA 4LSPH 4N0FB 3GK8L 1P7QD 4QGTA 4GG6E 4JFOA 3P0YH 3IYLW 4MX7A 4XP6H 1FYHB 1KELH 3CFJA 1RHHA 2DBLH 4QHNA 4N0CA 3MOQA 3QQ3B 2YWYA 3WKMH 5CWSA 3LSOA 1Q0YH 5F1NA 1R3JB 3ARWA 1ROWA 2XQYK 1T2QH 3VXMD 3KPLA 5EO0B 3UJJL 2DLEA 4JGJA 1RZ7H 3T0XA 4OZHF 3PWPD 2FHCA 1FNLA 2VITA 2VMFA 3VXSD 1YMMD 5KN5A 4U49A 5C0IA 3GSQA 1ORSB 3HLAB 1MWAL 2EE9A 1O5DT 1RK1A 2PTTB 1JK8A 4PV8B 2F53A 2VWEC 1YMMA 4M4PA 1KEML 4ZO9A 3HNTL 2R29L 3FQRB 3MROB 4PJXB 1X5HA 5KVGL 1QR1A 2XWJA 3G6JF 4PRNB 5F9DC 5E9DD 4M48L 5AG8A 3GIZH 1JNLH 1RZJC 1BX2A 3VXMA 1MAKA 1R5WB 2IQ9H 3OB8A 2P1YA 1A47A 5DEFB 3JWOH 4M3JA 5CLWA 1UFUA 2ZOLA 3RU8H 5FGCB 4PREA 2J5LC 1EAPB 4K8RC 5ACZB 4IOFD 3VG0L 3VH8B 2HFEB 4P5MB 1V05A 4LDOB 1OY3B 1XAUA 1XGPB 4IM8A 4PV9A 3B9KB 1CD0A 3S36H 5D1XB 4HUUA 3A6OA 2P5WB 1U3ZA 3VRJA 2XZAL 4DKFL 4TSAL 3V6ZA 2MTPA 5JIHA 1FG2B 5EU6E 5HHXL 2O26U 5J06A 1JRHI 5K93A 3BMVA 2JIXB 3U30C 4PRDA 2LU7A 3CGTA 2FATL 2ZCLH 4IRJC 4JRXD 4YZFE 4KZEL 3QCVH 4ZUVB 4OIBA 2GSGB 5C2BH 3NCBB 2I9LB 1QYGL 2GTZB 4PGDB 3WLBA 2CKBB 4RRPA 4NNPH 5CAYB 3KPOA 1U3JA 2AW2A 4OLEA 5E24E 4RDQF 4AEIH 5KS9E 1MRCH 4OGXH 3C5ZD 4OV6F 5BQ7B 5I74B 1EHLH 1KOAA 2XWBB 4NBXB 1HYSC 4H25A 4NRZB 2FHFA 5I18H 2OI9A 3O6LL 2R2CA 5K9KB 1CG9A 1C08A 1JTTA 5E6YA 4OD1L 1FIEA 1XCQA 1DE4A 1KTLA 4CJ0A 1IGYA 2VC2L 5JO5B 1NPUA 2J5LB 2ID5A 3VCLA 1O7SA 2OP4L 1MREH 4NN7C 1AI1H 2R1YB 3T8XA 3STLA 2ESVA 1WLHA 4Y1AD 3DMMB 3OAYH 1JHTB 4MNQE 4WW2C 4LAJH 1UB6A 3MNVA 2GJZB 1KNOB 3TBWA 4UT9H 4YJZL 3KPRA 3RVUC 3O6KL 2FLRT 3UMTA 4NRYB 4XXDB 4LKXA 3OKMA 3RGVA 4HWBA 5DVNA 4HKJA 1DQQA 5DUPL 2CDGB 1JF5A 1MCJA 1UM5L 1CDUA 1AR1D 4KQ3L 1FAIL 5TQ2L 4WENB 1Z9MA 5H94B 1E4WH 1QLFB 5KANI 1TIUA 5IFHL 1G7LA 1L8JA 2VZ1A 1IRAY 3BIBX 5HYIA 5C0AD 1AGDA 1OWWA 5DJ0B 3RWDA 3BD5A 2DJUA 3TCXA 4P5TC 4DZBA 1FH5H 4H1LA 5C0JB 4AEEA 1M1SA 3G5XB 1T20A 1MVUB 3C09B 5C08D 3F58L 3ORJA 4Y16C 4HF5H 5I1JH 1SJVA 3AC0A 4XCYB 1IBGL 5GS2D 4CMHB 1ODAA 3VXUD 1HH6A 1RJZB 2VLRA 3R8BB 3WO4C 4MXVE 4W70A 3SN6N 5JA8B 3HA0A 1GAFH 1A64A 5JW4N 2NY7H 3E6HB 3Q6GH 4FN0A 3CVHL 4XPAL 4TSBL 4Y8AA 4TUOB 3EYSL 4WCYH 3D0VA 3EOBB 3HMWL 3UTTB 3TFKC 2EDDA 1OM3H 4P9HL 1U8OB 5L8JB 4KVCL 5EU6D 3P4MB 4YDKH 4M6OH 2B4CH 1IAOA 4LLMA 4FFYL 4K55A 5F96H 1KCVL 1BGXL 3K1KC 4P4RB 4L29B 2IALB 2FO4A 4PDCE 1T89A 5CZVH 4QRRB 4HWEH 5DUMH 4NP4H 4RMUA 1ZLVK 4JPKH 5TQ0H 3UZVB 3ZHDA 1U2HA 4JN1L 4KRMB 1I85A 2HKFL 2V2WA 1I7TA 1JGEB 4XAKE 4NO5B 4ZAKD 1EBPA 2AXGB 4MCZB 4BSVA 1WZKA 4NRXB 3WIHL 4F57L 3KHQA 1HIMH 5FO8A 1JGDA 5GS0C 3VFPA 7CGTA 2VXQH 1YDPA 3IFOA 4OD1H 1JYVA 1U8MB 3ROOB 3EOAB 3QDMD 2VR5A 1KLGB 3REVA 3UYRL 3BSZH 4YE4H 5J13C 4X0KA 1RJYB 4M6MH 1FLRH 2JK5B 2PYEA 4KI5E 4QRQA 2BSTA 2ADJA 4PP2B 3UTZA 3NVQA 3NFSL 4KI5D 3MCLL 1GJIA 5IK3B 4OSUH 3JTSB 5T1DH 4NZRH 3OKYA 5SX5K 4APQD 3MNWB 4BQBA 1E28A 3QFDB 5I6XC 3C2SA 2V7NB 3W9DB 1TVDA 5DUPH 4OKVA 5M94B 3OKDA 1LP9B 3GO1H 3C9NB 2YUXA 5IVZB 1LDSA 3LCYA 1MREL 3PWUB 4KQ3H 3VXOA 5JOFA 5CFHA 4NNXA 1EVTC 1U8LB 4ZFGH 1X5AA 1AP2B 4OCWH 3BP4A 2ADIA 1JI1A 3QCTH 1TDQA 5J6GB 1A1MA 3BZFA 3FN0H 2GYSA 3RVXC 1HHKB 5I1GL 3H2WA 4MXWL 2JB5H 1E6OH 1S5HB 4ZSOE 5E5MA 2L0DA 4XBGA 1KB5L 4LF3A 2GQHA 5HHME 3D9AH 5F71A 1VESA 4JFFD 1EHXA 3VGHA 2YBRB 5IFJA 1KV3A 1QFOA 4GAYB 4GKSB 4O2EB 5FYKE 3SOBH 2XI9A 2A1WH 5TF0A 4PJ7F 4TSBH 2H6PB 5HGBA 3RDTC 1GYAA 3EO1A 5HYSG 5HHQB 4DJMA 5IW6A 4UU9B 2HRLA 1P7HL 4IRSC 3FRPG 3BXNB 3TYFA 3VFSA 3IJYA 4TTDD 1S9KC 1JWMA 2IMNA 3X3GL 1WICA 1IMHC 1PW3A 5CGMA 3NFNB 4Z77B 3MV9B 4Q58C 1I8MB 3ZDYE 2M2DA 3QZWB 2EDWA 1WV7T 5CZVL 1BZ9B 5BZDB 3D3VA 2AJYH 1FE8L 4KAQH 4D9QD 1NC2D 3HZVB 4O2FB 2ZSWA 2BVOA 3C08H 1C16A 3O9WD 4XWOC 5I6XB 1V5JA 1I3RA 4MJ5A 4FQ2H 3IS0X 1AE6L 2J4WL 4X6CE 2CLVB 3CLEH 4HX1B 4NPYA 4CL7A 5L2JB 3RVXD 4N0YL 4WHCA 3AAZB 3VJ6A 4MQ7B 3RWHB 2R1WB 5BOZG 3HZMB 5GGUB 2X1OA 4ZPVA 1D5XA 4KC3B 1JF1A 3DXAE 2G5BA 4NUJA 1TJIL 1ZLSL 3ARBA 1N64L 4Q2ZB 4U3CA 3QCUL 4TSAH 5AWNL 4LBEA 1JF6A 4NYLB 1D5ZA 5TPWL 3OHXB 3LZFH 3GM0A 3M17B 2IH3B 4KVNH 3NCMA 3WUZA 2EC9T 4QHKJ 1MFDL 4LPTA 1OB1A 43C9A 4PJIA 3VFTA 3MBEA 4UAOC 3QIUB 3RUGA 4Y7MA 4X4YB 5DHVB 1TVBB 2HTLD 4Q9RH 1SJHA 5E2UL 2DQEL 4MJIE 2OR9L 5MEOB 5DRWA 1C5DA 3ECBA 4M61B 3O45B 4PJGB 4WEUD 4G8FB 5DI8B 4OIAA 4FQJH 3MV7A 2YPKA 2EXWC 4YH6A 1GGCL 4FQHB 1XEDA 4YPGA 5E94B 3DX7A 4UV4H 4EEEA 1H3UA 4YHPA 3PV6A 2FJHA 4PJ8D 3S6CA 1F3RB 3TP4A 5DGRA 5ICZB 3KYOA 4YFEA 2VLJE 1R5IB 3HNSH 1L7IL 5HHOA 5GS1B 1Z6JT 3AREC 2EDRA 3RPIB 1E6JH 5DRZB 1EEUA 4IJ3C 1U3HA 3OX8A 3T2QA 1HHIA 3ARGB 3SOBL 4NN5C 5B3NA 3MRNB 1R3KA 4K7FB 2HP4A 5E8NA 2ZWLT 5KSVA 3EJYC 1A9EA 3BMWA 4LLYB 5GJTL 1GHFH 2A6IB 5T1KB 5K9QI 12E8H 1YEDA 3VXUA 2CLZA 1AR1C 3I50H 3MSPA 4J3OC 1CLOH 3CDGB 3KJ6L 4K3DL 1BJMA 5C08A 3RP1A 3DRQA 3BQUC 3P40A 1V7MH 4HK3J 3VDCA 2SEBB 5D7IA 2Z31A 3A0OA 3TV3L 3B9KC 4JFHD 4MAYC 5C0BD 5J56B 1ACYL 2E5EA 2BOCA 2R2EA 2W0PA 3WUWA 5C8JA 1OCWL 5IB2A 3BH8A 5DYOA 3EFDH 4WTZA 2WY3A 4CVZB 4U0RC 1YZZA 1NAMA 4KGLA 5CJOH 3PQYE 4TVPE 5FF6B 3DJ9A 3ARSA 5A3IC 4HLZG 1KJ3H 4LPUA 4LVOB 2VLMD 2D0FA 2O5ZH 4XX1G 5EIQA 3KNBB 5ESAA 1PD6A 3ARFD 2YRPA 4H5SA 2NY6B 3WMSA 4E9LA 1YEJL 1YUHB 2FBJH 1FIGL 4HV8B 3ROLB 3KGRA 2IAMB 4KPHH 3CZFB 3PNWA 2IH1A 5EUOB 1DDHB 5EWIL 3T0AA 3RPKA 4DK6A 4OI8A 3GSOB 5DC4B 4QWWD 3KYNB 4J4PC 3MXVL 1T1WA 2W0FB 2Y36H 2QQKL 2JLLA 1AGFB 2VDOL 5HGDB 1OM3L 3SO3C 4RGMB 3TVMA 3ULSA 3O8XA 4I18B 4AENB 4DTGL 4GT7A 2IFGA 5JXAL 3FO9A 5I15H 1DL7L 4I2XB 4X8JA 3V4PL 5FGRA 1ZLSH 3TJEL 1H5BA 2MHAA 3ILQD 1FO0L 1UQSB 2XG5A 5GQBA 4L4VD 3Q5TA 1H8OA 3SGKA 5BCAA 3IDYB 1QSFE 3VRIB 3BUYB 4Z7UF 3OZ9H 2E27H 3AB0C 2ORBH 4P5KB 3T0VA 3GBML 4HC1A 3V0VB 3ARBC 3QI9D 3JVGC 1K3IA 1PSKH 4P4KC 3NACL 4LASL 2ADFH 2OJEA 3E1F1 4FQXC 1IAII 4JZOA 5JHLH 3V5DB 5DJ8A 1HHGA 4KKCC 5D2NE 5HVHB 4HXBH 3BPCB 4NHCH 2VABB 1P69B 3QEUB 1EAJA 2D03H 4BJLA 3T1FB 5C0CE 3I75B 4NO3B 1GHFL 1T4KB 5TGBB 5CD5D 4MJIA 5I30H 2BVEA 1DR9A 3PHQA 4K3EH 3VFOA 1KCSH 5CSZB 3TESA 1JNJA 4S1DD 4XPHL 1IGFH 3V0WL 2MCPH 4WWKD 2DLFH 1OPGH 1TMCB 3T77B 2NXYC 3LQAC 4ZFOA 1IILE 4HS6B 4WI3A 5D2LE 3T0EE 5GSRA 2QHRH 3MCLH 1YYML 1T1YB 5GISH 4OUUB 1X4ZA 3TT1L 1ZANH 2HT3D 4NDMB 3NTCH 3QIBC 1NFDF 4PRBB 3KLAB 2BFVL 1QFWL 4ZFFA 1L0YA 1RZ8A 5IESH 2GY5A 2BVUA 1TPXC 3NN8A 3PGCA 3VG9C 4FQXD 3VXSA 2BSRB 2Z35B 4RMRA 4A2MA 1VFAB 1VADA 4X99A 1A14L 3ZKMC 2CGRL 1N59B 1S9YA 4MA3B 2C1OA 2ARJB 4AL8L 1X6LA 1KJ2A 1BWMA 3MJ7A 1YY9D 3HI1A 5DK2B 4PUBH 4XP4H 3RVTC 5ISZD 2W91A 3E8UL 5CGYD 2XTJC 3OGCB 3LN4A 3LS5L 1TTUA 3CUPA 3IF1B 2Q6WB 4M7LH 2AXHA 1E0OB 1IGIL 3HUJA 4PFEA 2FZ3A 1OAXL 5CKGA 2P8LB 3ARFA 1T0MB 4CNIA 1CDJA 1SEBB 1WCBA 3AU1B 1NLBH 2D7MA 3V4VH 3Q1SH 3O6FB 4Z0XA 4OT1L 1U93B 1IGTB 4RGNB 5E8DH 4U0RB 1IARB 4FQXB 2GAZB 2PO6C 3SE8L 1HOCB 4AQ1B 4HFWA 1LILA 2LVCA 3O3AA 5KVMC 2ZCKL 1PSKL 4XNUH 3OJ2C 2LQRA 2IQAA 3QEQE 4PJXA 3C60D 4X6EA 3I6GA 5J11B 1SJXA 4KK9C 3NCYS 1IGMH 1F3DJ 2VDRL 3TFKA 2CXGA 4R0LA 2GFBB 4X6CA 4ODUB 2DQJL 3KXFD 4LSSH 4NQEA 2HTKC 1FN4A 3CSYA 3VXRD 2ZOLB 1FZOA 4XPGL 4RA0C 1HHHA 4CW1B 4JFXA 1KENL 4DKDC 4OZFB 3N0PB 3QUZC 1CCZA 3CVHB 5KSAA 1EEYA 5IOPA 3MRQA 3MX0A 3IXTA 3QJFB 3ALPA 1G9ML 3STZA 3DX8A 2ZG2A 1PKQB 2YEZB 1ZLWH 4KK5D 2B8OT 5HXMA 4JZJC 4GRWE 2R23A 3I02B 1NAMH 4I0KA 4H20H 4Y19B 3HAEG 1YEKH 4NQCA 3G5VB 1DVFA 2PXYB 1A4KB 1T66C 5ETUA 1N0XH 1NJ9A 4LLQA 3THML 4NZTL 4PJ9C 3IKCA 2DQDH 3MV7D 1XZ0A 2XKNB 4OCLC 2HFGH 1QFWH 4JHWH 2C3VA 1KT2A 4YHOL 5TH2B 4LHUD 3QI9A 4LLWB 3ZKND 3VFRB 1B4RA 3LH2H 4Q9QH 5HGHB 1DQTA 4MD5B 5HDOA 5EO9A 4C56B 3NOIA 4KTYA 5D1QC 2C4XA 1FNSH 1A7PL 3QA3A 2NW3B 5EBMB 1ND0B 2BP3A 2J6EH 4LLAA 1DQMH 5GZOD 3IDYC 5FM8A 2IBBA 2RAMA 4LSQL 4NQVA 2VXUH 3GSXA 5SWZB 4F9PA 1JNLL 4HIEA 4M7LL 1ZT1A 3KR3H 5I8OL 3LRGA 4F58L 5CINH 3T2NL 3E6FA 2FJFB 4U4BA 4D94A 2NTFB 5DVLA 3GGWB 3WJJA 4DUWA 4NKOA 1BBDL 3BPNC 5HPMB 3H0TB 3MV8B 3RWIB 4LP4A 4PJBB 3DBXB 3SCMC 3QWOA 5CIPH 1TNMA 5E03A 3L9RB 3L5XH 4PUBL 1BFOA 3OR7B 3M8OH 5FYKH 4NM8L 4EDWL 2NY6D 4Z5RB 2XKSA 5ID1B 5EG6C 2BHZA 4M1DH 3UPRB 4NIKB 4GBXB 1XH3A 1H3XA 2V17H 1PG7X 3HE7A 4S1SH 2NMSA 2FSEA 4JO3L 3E2HA 4QXGL 4FMFA 5IFAL 3D87B 4P48A 5DJXB 1I4FB 5DQDL 4KUZH 3VGGA 2HMID 1AQKL 3TPUA 5EZIH 3VFUA 3T65A 3MR9A 2HT2C 2O5ZL 2FR4A 4CUCA 4H1LB 1G7JA 4G8GA 2CUIA 2ITDA 4KK9D 5KVDH 4KJYA 1MVUA 4U1GC 3OMZA 2AEQH 2L7UA 4V1DA 2FBJL 3RZWA 3I85A 4G6KH 1UH2A 1CE1H 4OGXL 5CILL 3MGTB 1JPTH 2HH0L 2VH5H 4L9LA 5JW4Q 5E1AA 5DVKA 1JGLH 4LIQE 4RBPK 3HI5H 5FYKD 1MLBA 2WIIA 1G7MB 3PDDA 3L6FA 4I3RH 4GO6B 4EDXB 3GMOB 4MWFB 4GOSA 1KULA 3BIKA 4PJCE 4QTHA 1G6RB 5H35A 1IEBB 1DN2A 3PHSA 3TBVB 4F33B 1CLCA 4JPIA 4F7TA 1ZGLB 4JAMA 4OCXL 5HYJA 2BCKB 4P57B 3GSNB 5JZ7C 5DRNB 4L4TE 3MLPA 1I9IL 2X9YA 4BSVB 3CLFL 3ZKNC 1A6VH 1NGZB 3U0TB 3RIAK 3CPLA 3ZTJH 1EPFA 4EIZC 5FO7B 1YDPB 3BPNB 4PJCA 1BFVL 3F7YB 3MBXL 3BX7C 3U30B 3ME0A 1J8HB 1NGXA 1UACL 2AI0L 2DLFL 3B2UD 4M7KL 4Y2DD 1S5IL 1UWEL 2DQCL 2ATKB 1MCLA 4JCMA 5C07D 4PGEA 4TVPL 4PRIE 3QIBA 4U1NA 5I76B 4DVBB 4PRID 3NAAH 2LAGB 5C07E 1NMAL 4NQDA 2W9EL 4OFYA 1S9VB 4PJHE 2P42B 1FV1B 3QULB 4E41E 1G6RL 3D5OF 1A0QH 1M4KA 2NLJB 3MO1B 3F65A 5E6IB 3DOSA 4OZGB 3WL9B 2YUZA 5EOTA 5C70A 3B8YA 1CFBA 2V5YA 4U31A 1NGYA 2RFXB 1FYTB 4PGBA 5IVZA 4LEOB 1RUPL 4MCYA 3L3OA 4D9LL 3BHBB 2HWZL 4JFDA 1LK3H 4Z7UA 3I6KA 5TF1L 1YEEL 3L5XL 3QDAA 1Q9WA 4JFPA 4PJGF 5I71B 2H9GA 1I7RB 2A6DB 4P2OA 1Z9LA 2DI7A 4Y88A 4YDJB 2N56A 3VXNB 3IDXH 4Y89A 1DANU 3MRKA 3Q6FA 5AWNH 3EW3B 4KHXH 1N6QL 2RCSH 3L3JB 1CYGA 1S9XB 3QXTA 1O7VA 3OXRB 3FB7B 2ZUTA 5IJKA 5HI5D 4WEBH 2R69L 1NFKA 1K8DA 2CLRB 1KYOK 4G8IB 4JG1H 4LSUL 3CMGA 4Z95L 2CK2A 5D7KD 4B0MM 1ZVSA 3VMOA 3B5TA 1GZQA 5HHMB 1NBZB 4NFBA 3X14B 1TJHL 4Y5YA 3SGKC 4JFFA 3B2VL 4E42B 2YWZA 4Q0XL 1LEIB 4FQIL 4RAVA 3X13B 5C07A 2B0SL 5CJ5A 4LHJB 4NT6A 4ZG1A 3ZO0A 1WAAE 4QYOA 4L4VE 1JTPA 2EO9A 1QFHA 4OV5A 4G7YH 4C56D 5D72H 5H8DA 5L9DL 4FNLH 4YAQA 1JZ5A 1W2KT 4H1LG 5IJVA 2Q7YB 3E3QA 2XN9E 4R4NC 3W2DL 3CXHK 7FABL 3MRHB 3PDGA 4H0IA 1I1CA 3PE9A 1HEZA 4HJGB 1X5JA 2NTSP 4W68A 4Y4HA 4HLJA 4JHAH 5BZWB 4UDUA 4ZUWB 3ALWA 1P4BH 4OBRA 1MQKL 4LRNL 1ED3A 4KJQC 1W0WA 2AK4B 3W82A 4PLJD 1BOGB 5DJ2A 5IMOA 2DTSA 4RFOL 5F6HI 5INDA 1SYSB 2ZJSH 3GHEH 1IQWH 4MXWH 3KPQA 4FFWC 4K3HA 3OTTA 2APVA 3GIVA 5KSAD 4XNZB 4PGZA 1TVHB 2XXMB 1N5YH 4KJWC 5CD3A 4PTTB 4J6RH 1G7IB 5HI4C 4MAYA 15C8H 1RZGB 4I5BB 5ENWA 1MFAH 3QUMB 3T09A 1KIRB 1GIGH 3HPLA 4JANB 3LY6A 4X5WA 3TFKD 1D5MB 3WS3B 5B38A 4MJ2A 4DEPC 2V2TA 4ZAKB 1NAML 1FNAA 1OCWH 3VXME 5C1MB 3VFWB 4NZRL 3D18B 3RVWD 1DBAL 4XPBL 4Z7WB 2A73B 3WKML 2VKXA 1TTGA 3IFPA 4PY7A 2F5BH 5GGSB 5T5NF 3JZ7A 2H1PL 4R4FL 2VE6B 3D9AL 4DVRL 5FXCH 4WHDA 1QBML 1YMHA 5GXBB 3VWJA 4TSCL 2NW2B 5DDHB 1S78D 1BD2B 1Z3GL 1JHLL 1FVCA 1OSZA 4L8CA 4FHBD 3ZT6A 4QRPB 4YHIB 5D6CB 4PJ5E 1I7UA 5EO1A 5CCKL 2QADD 1QA9B 2I07A 3SPVB 2FO1A 2Q3AA 3ARXA 3LV3A 2GUOB 2XFXA 3DUUA 1ZT4A 2BNQE 4G8EB 1A9EB 4CN6A 4N5ED 1PLGL 1P84K 2X4OB 3MUHL 5DHYA 5ECJE 1TETL 3SKUD 3CH8A 4HUXA 5T5FL 4M8VA 3P11L 3T2NH 3AXLB 4PIRF 4YGVB 5F9JB 3LZFL 3DVIA 4ONGL 4ETYA 1BBDH 3AS3A 3MOBH 3QDJA 1Y18B 4KKBD 5DA4A 4GSDH 4WFFE 5GGSY 1H3VA 4OIIH 2F53D 4MLIA 1B2WH 2V5TA 3ARED 1GZPB 2FH8A 5CUSL 4D8PB 2DQHH 3CCHB 5GRZA 1T2XA 1C5CL 3OKNB 4DEPB 5JZ7D 2PF6A 1L4IA 1P4IL 4KK8C 4HPYH 4YNYA 4Y2OA 5E8PB 5GS3A 4Y5XC 2H2SC 4LFHD 3CJJA 3AREB 1MHHA 3ILQC 5C6PB 2OR7A 5FB8A 2ARJQ 1CZ8H 3NPSB 1AHWB 5FYJD 4FQ2L 1BIIB 2ICES 3C2AL 3PGDB 5MI0C 2FLBT 3C5SA 1MCQA 3KDMB 1MCPH 5B39B 4S1QH 3TNNB 1ZA3A 3PL6D 5IQ7L 4GW4A 1G7PB 3PWNB 4GUPA 5K59F 3EYFA 1JMZA 1I8IA 1CFQA 3S3JA 1CF8H 3LKSB 5I8EA 3U9PL 3ARQA 4OF5A 4UV7L 4HXBL 1RK0B 4Q6IB 3WIFA 3P4NA 1FBIH 3SDDB 1S8DA 2GT9A 5ICXA 3HE6C 4FQQB 2A83B 2X1QA 1FG2A 4LVNB 3TCLB 2PW2B 4O02L 4WI9A 3SJVE 4NGHH 4OF0A 3UJIL 4TOYL 2P24A 1MCSA 4MS8A 3OG6B 4MZ2A 3B9EA 5D7IE 2X4QB 1HKFA 3ZHKA 5GRJH 3RDTA 3QHFH 2FX9L 3R4DA 3O4LB 4EI5B 4I77L 3IDMA 4POZC 3GJFH 2UWEA 5DD6A 3EIFA 2G5RA 1XT5A 4M7JH 3FJTA 1S7VB 2Q86B 1REIA 2IBZX 1RSFA 3OKEA 3CDYA 2QQQA 1A3LL 5HGAB 3W0WB 2ZNXA 4M6AA 3BRFA 1O0VA 2OL3A 5EDXA 1YQVH 4LEXH 4IHOB 5F72S 5BV7H 3HI6L 3T1WA 5EFIA 3DRTB 1QVOB 4N0FA 3SKJL 4UQ2B 4X9FA 4QRRE 1S78C 1ZHBA 3DV6B 4RMTA 4NQXB 1VKXB 3IJHB 5CHNB 1EBAA 3SBWA 3U83A 3FKUS 3QH3B 4M6NH 5ALCH 3TO4C 1BJ1H 3V6FB 1JFQL 3O3EB 1WTGT 1VFMA 2FECI 4AM0B 2CUHA 2HTKD 2J8UB 3BDYL 1R3HA 3ARDB 3TWCH 4QEGA 2ESVE 5C09E 3S4SB 5FGSA 3FO1B 4X7SL 3NABH 2WBJB 2HKHH 2IAMD 4WUKL 1KB9K 5E8DL 5EU4A 3V8CA 1PQZA 2KPNA 2I5YL 4WHYG 2X4TA 5T1MB 1VGKB 3MV9E 4MA1C 2AGJL 5E8EA 4HPYL 5I66A 2CDEA 1U41A 4IIQA 3RZCC 3BEWB 3QXAA 1WTLA 1AD0A 2A6JB 2UVEA 5CBAB 3IAQA 3H8NA 5CJQL 5DEGB 1B88A 1YMMB 1ZKAA 4WI2A 3MYJB 1KGCE 4F9LA 3BRGC 1AJ7H 2FB4H 3PWPB 2JCCB 4MDJB 3OV6A 4NQTA 2BSRA 5IHUH 4P49A 5C0BB 3FQXA 4NSKB 4HZLA 1EUUA 3H7LA 3FCTB 1G0YR 1BX2B 5E2JA 4LASH 1CLZH 3UAJD 4DKFH 4J2XA 2VXTL 1XIWB 3CFDB 3LDBB 3PWLA 3QEHB 3TVMC 1BZQK 1BFTA 1QHOA 2YK1L 2EDEA 2CDFA 2VAJA 4DOHB 4UBDC 4ZS6D 4DUVA 1T0MA 3AUVA 1JL8A 4YHZL 2W60A 1KIPB 3O6FA 4XGZA 2WZPD 2VLKA 4MLSA 5DURD 2X4SB 3B83A 1AXSA 3LQZB 4R4BB 3LQAH 4O9HL 1A7NL 5JIPA 1SVZA 1IJ9A 1S7RB 1YEIH 4M6ML 1OLZA 5E95B 5MENA 3HC3L 3S88H 2P43B 2JCCF 4PJ8B 4NHCL 3X3FL 3MV8E 5D72L 5F3BB 1P5UA 4M8QB 5ANMA 2OZ4H 4N0UA 3RRQA 4ZD3L 3ZE2E 3B6SA 1OAYH 2XA8L 3HRZA 3NZ8B 5EZJA 1EV2E 1RUKH 4HH9B 4NKIL 4H26A 3VXPA 4HG4K 4WDIB