4PG9A

Mhc class i in complex with sendai virus nucleoprotein peptide fapgnypal
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
276
structure length
276
Chain Sequence
GPHSLRYFVTAVSRPGLGEPRYMEVGYVDDTEFVRFDSDAENPRYEPRARWMEQEGPEYWERETQKAKGNEQSFRVDLRTLLGYYNQSKGGSHTIQVISGCEVGSDGRLLRGYQQYAYDGCDYIALNEDLKTWTAADMAALITKHKWEQAGEAERLRAYLEGTCVEWLRRYLKNGNATLLRTDSPKAHVTHHSRPEDKVTLRCWALGFYPADITLTWQLNGEELIQDMELVETRPAGDGTFQKWASVVVPLGKEQYYTCHVYHQGLPEPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The first step of peptide selection in antigen presentation by MHC class I molecules.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system/peptide
molecule keywords H-2 class I histocompatibility antigen, K-B alpha chain
total genus 76
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2014-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4pg9A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4pg9A01
3GSWA 2DQEH 3WL9A 4KTDL 3BEWA 3MCLL 4OCNC 1YN6B 1OP5H 1DBAL 5D9SA 5CEXA 1ZLVH 5IFJA 3LEYH 1F3JB 2H2PD 4TRPH 1F02I 3VWKB 1MNUH 3L3IA 1WZMA 4GKNA 4L9LA 4HFUL 4FABH 1IEAB 4Z7VB 1KULA 5DT1H 1N2RB 4S1DD 2OL3B 3LKPA 5ESVB 3BGAA 5J12B 4BZ1L 2GJJA 5J57B 5ESVA 3WFBL 3QEQD 2VLKB 3C87A 1FFPB 4UB0H 4GW1A 4PJAF 4OLXL 3FFDA 3OJVC 5M7QA 4R90L 3QULB 2YRZA 2FH6A 1I3RA 4PJXE 3WKMH 3DWTA 1T04B 4RAUB 5IVNA 4PD4J 1I8LA 5A1AA 4E5XB 5FGCB 3HC3H 4LSQL 3UTPE 4IMKC 5MEND 5GIRB 4V1DB 4WHYH 5CWSA 4KUZL 3QQ4B 4Y1AA 3D3VD 2BVEA 1IC4H 3PHQA 5GZOD 5I71C 5F1KC 4JG1H 1P4IL 3GBML 5A2FA 4HIHB 5CSZB 3QRGL 1YY9C 4HGWB 3O3AB 1K8DA 4MS8C 3OG4B 3V6OE 3D39A 4U1JB 1N8ZB 1ONQB 3EUUA 2DD8L 3M8OL 5F1IA 5AAWA 3ARDB 1FNSH 2VZ1A 2D03H 4ODHL 4KK5D 1MI5B 2Z31D 2IQ9H 2DKMA 3N9GL 3QFJE 2NY4B 1YJDH 2H3NB 3MGOB 1ED3A 4M1DH 5JXEA 4FP8H 2FJFB 1CL7I 4JJ5A 4XMPL 5FUZL 1NMCB 4OI7A 3OKLB 3VFOB 3WE6A 1IRAY 2FJFA 5CLTA 4XP1L 5CGYC 1OF2A 4QHLB 3GJEB 5L9DH 2VN4A 3MA9L 1H3XA 3FQNB 2DQFB 4LPVA 1UM5L 3A67L 4PJCA 1F3DJ 5LWYL 2ATPA 4I77H 5A16A 1AKJB 1G7IA 1JPFA 3QFDB 4Z77A 3HG1B 5F97E 4MDIB 5D7IE 2CDEA 2G2RA 1YY9D 2AK1L 1E6JH 3IAQA 2R56H 1AXSA 3BZFA 4O5LL 4XX1G 5HPOA 4WUKL 4PRDA 4X5WB 4P48A 3O6LH 1I7TB 4G6JL 1LO3H 3WUWB 1AC6A 3OAYK 4XCYA 1QACA 2NYYC 3ARGC 3QXAB 5I1EH 5GS0D 3MXVL 1CFSA 5ALBL 2LU3A 4L8BB 1AC0A 3ARZA 4PUBL 5LAXA 1EMTL 2G60H 4OD1H 3RUGF 4LLVA 3EYQC 2C3VB 4JQIL 3DJ9A 4X6CA 1E28A 4HX1B 3RNKA 4WHYG 4QGTA 1HNFA 4UT6H 4F7PA 2OL3A 1JYNA 4Q7DA 4Y4HD 4S1DC 3K4ZA 2J3SA 2ITCB 4JFFD 2CK0H 4OQTH 1I1AB 1WQVT 3LEYL 2NY7H 2QQQA 4GQPH 1KTRL 1D5MB 4PREA 1CXEA 4D9RD 1KIUA 3HZKB 4PGZA 5KG9A 3H9YA 4PG2A 1K5NB 3EOTH 1ZWIB 2BSSA 3GO1H 1P5UA 1FL3A 1BVLB 3GSQB 1M7IB 1TIUA 5C0GB 5DUML 4N8VG 1I3GL 2LFGA 2J4WL 2NX5E 4G6FB 3N1MC 3CSPA 2FIKA 3DX7B 4WI3A 4UDTA 1IJ9A 3DYMA 2JCCB 4ZXBB 2C7UA 3DUUA 3MLSL 1A21A 3MV11 2EC9U 1CL7L 1A02N 4HIXL 4PG9B 2XZAH 4K7PH 3T3PE 3OKKA 1IKFL 2A9ML 1CT8B 4JR9H 4N8VA 4PJHB 1QSFB 4Y5YA 3MYJA 3BIBX 3OKKB 1JGUL 4O51B 5C09D 4OF5A 1CZ8H 4Y4FD 3L7EA 5C0BE 5HHQB 2EC8A 4PRHA 2I25N 4X7DC 5HVGB 1XGQB 1CDYA 5BVJA 5EBWB 4F37K 2X4SA 4XPFL 1M1SA 5C9JB 4MVBA 2X40A 3MBEB 3O41B 1KJ2A 2LV4A 4GSDL 4XBPA 1NH6A 1ULVA 3VI3F 2YPLE 4NT6A 4MJID 1DVFC 5F7DA 1U8NA 4IOSD 4LIQL 1EEYB 2BRQA 3FB8A 1ZT1B 3MV8B 1IGIH 3BD3A 3SGDH 1ZS8B 4DQOL 4MGXA 2HLFD 5MENB 1CDIA 5JXAL 1MCHA 5E99H 3L3JB 4F9PA 2UUDH 3QWQB 4N68A 5LG1A 3MFGB 3BYTA 3TH3T 3N1FC 1MWAH 5EOTA 3QEUA 4YXKH 1HI6A 1MCLA 1XGUA 3FQWA 1FFOB 4BFIB 2H1PL 3V6ZB 2DQUL 4V1DA 2VL4A 3LPWA 5ACLA 1O0VA 3CLEL 3CZFA 4B7LA 1CICB 4PRBB 3MMEB 1AQKH 2AXFA 3BPNB 5I1GH 5HYSG 3QYCA 3RDTB 1UXSA 2B8OT 2DQIH 4UB0L 3J7HA 2R0ZL 3CFIC 4EUPA 1MEXH 3BZEB 1AO7B 3AS0A 5GSRB 5IFAL 4OIAA 1RUQH 2XNAB 3K2UH 4P2OB 5F88B 4QOKE 3HC3L 1JZ3A 1PX3A 4E41A 1CFBA 1NFDB 3MJ6A 4WWKC 4HUWB 1RJCA 1UB6A 4E41B 3U9UB 3MJ8A 4M61B 5KVEL 1TNMA 3GO1L 3CFBB 3KPSB 2EDFA 2UYLB 1OWRM 1MCBA 4M93B 3O0RH 1DP0A 5FFLA 3RVXC 3WFBH 3ZKMC 1RMFH 1VEPA 4PR5A 3HE7A 3KDMB 3FB6B 4GKOA 3MO1A 4IRSB 2ESVA 3VXMB 3K8KA 3ZKNC 5I76A 1CT8A 1KCLA 2EDLA 1J88A 2B4CL 3N85L 4OT1L 5E8PB 2A0LD 1TQBC 1P53A 2NPLX 4KY1L 2APFA 4TSAL 3UTTB 4DVRL 4G3YH 4MCZB 5D1XD 3MLXL 4JAMB 1P4BH 1OCWH 4JM4L 4L9DA 1QFWI 1W2KT 2FRGP 3U7YH 1P9MC 1P1ZB 3PHSA 1KF9B 5F44A 4JN1H 5D7JD 5D1QD 1U6AH 3DXAE 2YXMA 4BZ1H 5IKCB 2NNAB 1FP5A 3VWJB 5SX4I 1NGWA 3ULVC 5DJZA 4MDJB 2NY4D 3V0VB 3ULVF 4I3GA 1G7HA 4YHNB 4BM7A 4BH7B 2Q20A 3FCTB 3V5DB 1OARL 3GBNL 3HI1B 1RIVL 4NYLA 4YZFF 2PYEE 1T3FA 4Z76B 32C2A 2X89A 2DQJH 3HNTL 4Z7NF 1NCWL 5AZ2L 3IXTB 5IW1B 3ULUD 1H5BC 3QAZB 5I74B 1QHOA 2AKRA 1RUAL 5GRUL 1FNGB 3OKEA 1SHMA 2VDPH 4YZFE 3SGJC 4MX7A 4HLZG 4QY8A 2FATH 1DVFD 4QOKA 3SY0B 4LNRB 1HILB 4XWOD 2J5LB 3VFRB 4I18B 1QZ1A 1QRNB 4YUEH 1KXTB 1RZ7L 4KK9C 5IBUB 4JG0H 1G9NH 3MV01 1BBDH 4PRPB 1T1WA 3FOLB 4I3SH 1XGRA 1WBYB 5BRZE 4PRPA 1G6RA 4XH2B 2HFEA 1CE1H 1R5WA 4L4VD 1H5BA 2WUCL 4PYHA 5IHUL 1EO8L 2X4PA 1A3RH 3D85B 4R0LA 4S1RL 1MJUL 4L4TB 3MREB 4X8JA 1AIFA 4NO5B 3U9UA 3OR6B 1QSEE 3VI4F 1A22B 2AXGA 4HK3N 1JBJA 5IJVB 1T0NA 2P5EA 1JUFA 2QHRL 5M94B 1FNFA 2DBLL 5HYIA 1MVUB 3WNPA 2R0KH 3PWNA 3QFJB 3WFDH 5TE4L 4HWEH 4YFLI 4RMWA 1YEGH 3KJ6H 2WAHA 4HIHA 2G5RA 4Z18A 5T5FH 1CZ8L 1EEZA 3ES6B 3QA3B 3UBXA 1HHKB 1V3LA 3B43A 3EJYC 5DUMH 4HIIA 2XRAL 1XGPB 1RMFL 3S37H 4HHAA 5B38G 5I18L 2IBZY 2VR5A 4KI5D 3LDBC 3FQXA 1YEHL 5GGVH 3IF1B 1KJMA 3MRCA 4UV4L 3EYSH 4XZUB 1FJ1A 3V5HB 5KVFH 3OHXA 1MH5A 5GS1B 1NAMH 5F7HA 2YD7A 1OCWL 3U82B 5C09B 4Q97A 5T3XE 1BF8A 1RK1B 3ZE1E 2NY0B 3ARGD 4OKDA 3VXOA 3P9MB 3MRNA 1OVZA 3F12A 4XPGL 4MXWL 1AXSB 4ZFGH 3LEXA 3MRJB 2HLFC 3TZVC 2EKSB 3AS3A 4L9LB 2BVTA 1HOCA 4KC3B 2XKUA 5IW1A 4U7MA 4YHMH 1T1YA 4NQCB 1JNNH 2NTSP 3CDCA 3LPFA 3PQYE 3B8SA 1MAMH 4PTUA 3MSPA 5I74C 2DQDH 4EIGB 2H26B 4HUKB 4X6FA 4HUWA 5FYJD 3QEGH 3TGXA 5IEHA 4H0IA 4PJXF 3FFCA 3G6AA 1VDGA 1L9MA 1A7OL 1FNAA 4XBEH 2D4FA 3C5SA 1SJHB 1IC7L 4I18C 5D7JA 1FZJA 3PABB 1R0AL 4YDLC 2CRIA 1E6OL 4W81A 1Q0XH 4FZ8L 1U8HA 3DX6B 4P2QA 4XPFH 5EPMA 2NTFB 4YUEL 1CVSC 1ADQL 4WV1C 5ENWB 4AJ0A 4CMHC 4Y19B 3T0ED 1NGQH 2X4PB 4IIQA 4JO3H 5DSCB 4KMTL 1QRKA 3H9ZA 1OAQL 1J0YA 5HJ3B 3QJFB 3SE8L 4FZEL 4XMLH 4CJ0A 5C0ND 1TZHA 4LF3B 4OLVL 5DVLA 5L0QC 4FQHA 2AV7A 3PGCA 2EXYC 2VL5A 2CSPA 1CD9B 2OJEB 2KZ1B 4F2MB 4XPAH 3LRSA 4J3SA 2H6PA 3RWIA 5ISZD 4MSWA 4D0CA 4KVCH 4Q58C 2ZOLA 4TSCL 3RY6A 4CADA 4UQ2A 5F70A 4M93C 5BS0B 2V6HA 4HV8B 2W9LA 4NJAH 2ESVB 5F9OL 4FMKA 4JDZA 4G9DA 5FGBA 1LD9A 2FECL 2GJ6B 4HUVA 4HWBL 4WO4D 2BNUB 2R0KL 4JRWA 1AP2A 1M7DB 2AJ3A 3QIUA 5D5ME 1GJIA 4KJQD 3O41A 1ZANH 4HPOL 4JFZH 4PRPD 1NGXA 3MLYL 3RWHB 5I1GL 1OLZA 4LSPL 1YN6A 4XAWL 5IHUH 1KC5H 4JN2A 2HG5A 1MRCL 5C9JA 4L4VB 5FECB 1L0YA 1MRDH 3WSQL 1E4WH 4QRTA 1HZHH 2VXSH 3P9MA 3VG0L 1HH6A 2Y6SD 4YFLF 1PSKL 4OIIL 1DJSA 2R1YA 2D7OA 5E2VH 1X44A 4AEEA 4UTAL 3SPVB 1F3DH 1K6QL 5AWNH 4CN6A 1BEYH 2B39A 2IWGA 4OCYL 4JPIB 5FA4B 3ZTNH 1KTDA 5ID1B 5KAQG 3L95A 2G75A 4WFED 1MWAA 2Q6WB 4F9PC 3SDYL 3I84A 4UBDD 2GT9B 4HF5L 5I8CB 3ZMRA 3O2WL 2WM0A 4KJPD 3MGTA 2Z8RA 3ARQA 3QIBD 4GW4B 1Z3GH 1UM4L 1VADA 1ZTXH 4Y2DA 4MLIA 4OLXH 1KELH 1J18A 1XGUB 1MELA 3V52L 4EDWL 3KNBB 2AVGA 4HC1L 4QNPE 2OBGA 3EYSL 2DQJL 1IBGH 3TJEH 5MI0B 5HGGS 2HYMA 1GGCH 4KK5C 3TA3A 1CFNB 4HFWB 2C4FT 4WFFD 5DJ2B 4MVBC 4AL8H 1BJ8A 1MJ7L 2R4RL 4RAVB 2VDOH 5J06A 3B3IB 4MXQA 1U95B 4L5FH 5K59E 3Q5YA 1A6UH 2DQTL 4HJ0C 4GS7B 1FYHB 4JHAL 4HPYH 3RBGA 1FNSL 5B8CC 3CZJA 4BH8A 3IS0X 3DUHA 4YHKL 4O2FB 1EAJA 2FHFA 5D72H 1DR9A 3VD4A 4PRHB 4Z5RA 4P5TD 2DQFA 1S7WB 4PTTA 4Y16A 4U6XB 5DA4A 5IB3B 3B9AA 4YDKH 4K7PY 4OGAD 1LE5B 5KSAB 3OKLA 3VRJB 4ZUVA 4U05A 5DRXA 5T5FL 2FYYA 3R8QA 4ZPTB 5IMLB 5B22A 1LO2H 3Q48A 2IPTH 1N6QL 4PR5B 4ZPTA 3P30H 1LP9E 4G9FE 4HKZA 1HIMH 2EICA 4EN3A 5C0BD 1YECH 2CDEB 1IC5L 2ZZUT 5DVKA 5HDQH 4V3EB 3QG6B 4X6EB 3EOBA 3QH3B 1JPSL 4PGJA 4LHQB 4PV9A 4XPTH 1NGQL 4JO3L 4YBLC 1OSPH 4LCIH 3QHFL 3U36A 4HLZH 5LAXB 2E7MA 3QPXH 4HD9A 5CJQH 2VUYA 3L3OA 5A2KH 2A9NL 1YQ2A 4JCMA 1F45A 3NCBB 3D9AL 1ZANL 4N0YH 3CDGB 5BMFL 1KNOA 1A2YA 1CTNA 5D1ZD 4L3EE 4PJAA 1INEH 3E6HA 4AT6A 2YN5A 3EW3B 2XWTA 4MB5A 3AMKA 3OB0H 4BSWA 4WUUB 1F42A 4PGBB 3ZL4H 3X3FH 3QUYB 4HS6B 3ARGB 1FE8H 3OX8B 4P3DB 2MCG1 1NCDH 3CK0H 5ERWA 2J88L 1R6VA 4JM2B 5IM7A 2BC4B 2G9HB 5D2NA 2W0FB 3O6FD 3RA7L 3ZTNL 1TZIA 4YWGL 1DQLL 5L8LB 4R96B 5IM7B 3GIVB 4JFZL 4WV1A 2DICA 2R9HD 1R3IH 4Q0XH 3QR2A 2X05A 3S37L 3HZMB 3VFRA 1T89C 2MOVA 5HHOA 5IGXH 1S7UA 1F11A 1KB9J 3P0YL 3BO8A 4MB3A 3QXDA 3K8LA 3CFBA 3KPSA 1MRDL 3WSQH 1RQ5A 2H32A 1KJVA 4UIMB 4JZJB 3MCKB 4PJHF 2D7TL 3X13A 1Z6JT 1BJMA 1YEIL 2WBJC 3KPLA 1Q94A 4G8GE 4X7EC 5AD0A 4HIEA 4M7LH 4K7PL 1IAII 3RI5K 3C8KA 1KCUL 3P73A 3OZ9H 4QRQA 1AE6L 4ZS6C 4MAUL 3GBMH 2P47B 2VISB 5DLML 1QLRB 3U46A 1S8DA 2GITA 3CFJA 5I66A 3L7EB 3DARA 4U6XA 4WENB 3PHOA 1LEGA 2RIKA 4NQSA 3QPQC 3CC5B 3GMOA 2C5DC 4XTRC 1MLBA 4UV7H 4ERSL 3I02B 4JHWH 3JV6A 3PWPE 3LRSB 3DX8A 1I3UA 1A4JA 3I6LD 3QA3A 3UBXB 1A0QH 3LH2L 5LJYH 1RIHH 4UQ2B 1JNHB 1NC2B 3C5ZC 2AEPL 3CJJA 2NZIA 4QLRA 4EN3B 3E2HC 3MA9H 4R7NB 3MXVH 1N8ZA 5J0BA 4BFBD 3HMXL 4N1HB 4N90E 4X9FA 8FABA 3SDCA 3RKDD 5E9DA 1KJMB 1MQ8A 2W60B 5DYOA 5DURD 1X4ZA 4DGIL 4NKDB 3OHXB 2HT3C 1I7TA 4K8RD 4XI5C 5EULV 2R0LL 4G42B 1NLBL 5DYOB 3V8CA 1CLOL 2VXQL 4M6OL 2X1XR 1ADQH 4N0UE 4KXZH 1LO4L 1TJHH 1LQVA 4QEGA 4ZQKA 3AREC 3DI2B 1MJ8H 1Q8MA 4LLQA 3P4NA 1LO3L 3KPPB 4PV8A 3QIUD 1JNLH 4Y19D 5DUPH 2QQKH 1IILE 2FNBA 5I16B 1B4RA 1LWRA 5C0CD 5D8JH 3DUSA 2V2XB 2DL2A 4RGNE 3GI9L 1F4XL 4OD1L 2AEWA 5DD1H 2CMRL 3S5LG 3U30C 4NUGL 4PTUB 1E4XL 3MACL 4J6RL 3FRUB 4Q2ZB 2IF7A 4FFYH 4KGLA 2W0FA 2WWKT 3EHBC 1E27B 3WIFB 3MLUH 5CZXD 3GIVA 4DUWA 3RVUD 4I0KA 4HH9B 3QO0A 4M61A 3VWKC 2YBRB 1L0QA 4UTAH 4YR6A 5F88A 4R0LB 2DLEA 1NCDL 4R3SA 4LLDA 4M4RA 3L7FB 4N0FA 1S5HA 4R0LC 5CS7A 4APQC 3S34H 2UY7A 3G04A 3WHXB 2VE6A 1MHEA 3MLPA 3C8HA 5DK0A 2F5BL 1J05B 4HKZB 2JF1A 1KN4H 4O58L 3HUJB 2XYCA 3MLTB 1RZGA 3OL2A 3SOBL 4BJLA 4GSDH 3ILQC 5K9KA 5JR1L 1ZMYA 1K3ZA 3C60A 3HRZA 4OIIH 5HYJA 4DVRH 4Z7WA 3RL1A 4OJFL 2CRZA 5C0EA 1HSAB 4XVJL 3MGOA 4HW6A 4NBYB 5I15L 1YEEH 3PNWB 2K7PA 3TVMB 1KIRA 5I19L 1XF2B 1ZVSA 2NY2B 5JW3H 4NFDA 1I9JH 3MZGB 2HH0L 4PJAB 5J1TC 4I3RH 5IVOA 4FQQA 3VWJA 4L3CB 1G7LA 4JRYA 4XC1H 3QIBB 1A7QL 2VDNH 2C1PB 1BD2E 1MFAH 3RWEA 2EDEA 2CLVA 2X9YA 3W5MA 3NIFF 4X4XB 5E5MA 5I1HL 2LTQC 1BX2B 2A83A 1OSPL 4LCIL 2XY2A 1MIMH 5FM5M 4XXCC 5GGQL 3W0WB 4X6EA 2YRLA 3O2VH 4YHPB 1KIPA 3KWWA 4IEFB 3GGWB 2ERJB 4K23L 3DLQR 5H8DA 4JFXB 2AKRB 4YQXH 1EMTH 2G60L 1CIUA 1Q9LB 3QHZL 3TO4C 1HHGA 4QHNA 5IT2L 4LGPB 2OTWB 2H26A 4HPYL 3P4MA 2BSED 3HMWL 4OZIF 1LO5A 4L3AA 4YHLH 1D9KB 1WT5A 4GLRI 1T1ZB 1N2RA 4L29B 4WCYH 4M62L 2DF3A 4BKLA 1RUMH 4S0UC 4GKZA 1UB5A 1INQA 1F90H 3RGHA 2B5IB 1JE6A 1VENA 5HVHC 3DURB 1KV3A 5F1NB 1ZLSL 3R1GH 1ZLWH 5FYKL 4UNUA 1JGVL 1NC2D 1MCJA 4X83A 5BRZD 3QUMA 1Q0YH 2P5EE 3MODL 3MRMA 4OM0L 5FGBC 3RTQD 3BT2H 1G84A 5DD1L 1FL3B 4U6HA 5I1CH 4GW4A 4XAKE 1LEGB 3CCHA 4ISVB 5K93A 1S5IH 2YXFA 4GH7B 4KY1H 1S7UB 3GB7A 4GRLB 5SWSE 3FB6A 5GIRA 1CFNA 2COQA 2ESVE 4UMGA 3I3DA 3S4SG 2QEJA 3MMEA 3BJLA 1RI8A 3IGAB 1MCWM 5EDXA 1ZXQA 2WUBH 3KYMB 3DVIA 1R3HB 4HIIB 4JN1L 4XT1C 2GEEA 1QSED 3KVQA 2AS5M 3NFSH 3JUZA 1U8KB 4K9EL 4DUVA 4HUNB 1MSPA 4Y4KA 2RJMA 5KN5A 2AGJH 1J1PH 3MXWL 4FNLL 1L7IL 3BX7C 4P2OA 2E9BA 2X4TB 3ISWA 1N4XL 2DWDB 1XCQA 3O2DL 1OARH 3GBNH 3D18A 5LGJB 1RVFH 5JW4M 2UWEF 4H8WL 3CC5A 3GMOB 2BNRB 3ZT5A 5EBLB 5DS8A 4LSVH 3MUJA 3RVVD 3WD5H 5A40E 1TMCA 4Y5XA 4EXKA 1DVFA 1TXKA 4LBEB 4MNQB 1N5YL 2JJTA 3MLZL 1QR1B 2UWEE 3VG9C 1UH3A 4EEEA 4ZFOL 3BUYA 2QJDA 1K4DB 1CLZL 5ICYB 1IQDA 1PLGL 1QA9A 3I2CL 4MAYB 1NKOA 3MRFA 5KW9H 1I9RL 4PLJC 1GC1C 5I73C 3L95B 5GRJH 2R0WH 5L8JB 4IRSD 4ZUTB 2AEQH 4RWYL 4GRWB 2XZQL 4ZNEA 1N59A 4K3JL 2AEPH 1G7QA 1T1XB 4LLYB 4NM8L 4RFNC 4W4NA 1JZ7A 5GGUB 4H1LH 4JY4B 1EX0A 1QYGL 4HWNA 1KCUH 1R5VB 4NC0B 5CUSH 3QEGL 2OZ4A 5EN2A 1YEEL 3NZHH 5B39A 2DIJA 2IC2A 5EUOB 4XP9L 5DK0B 4UUJB 1BGXH 4MWFA 1F3RB 3HZYB 2CPCA 4XP5H 3DHJA 1DLHB 3HC4H 3JWNC 4POZC 3VXTB 4Y5YC 1A6WL 2ADIA 1DQDL 1XGRB 3FO9B 3QEQE 3PL6C 2VZVA 3VWJD 3GSVA 1E4XI 1K8DB 1GCFA 4PGBA 5FK9B 1FRGL 4MJ5B 2CIKB 3OKDB 3CDFA 1AO7A 1OSZA 1CGSH 3JXAA 4R97C 5FUOH 5GZND 4BK4A 5AZ2H 3S3SA 5HDBF 3KPRB 1AIFB 3O8XD 4AK1A 2BSSB 4X7TB 5DSCA 1H9VA 1XAUA 5ID0B 3BP6B 2C26A 3B5GA 3W9DB 5I30L 1QFHA 2XQBL 4Z7UA 2GW5A 2VOTA 4XRCB 2X70B 3UP1A 5C0JA 5BS0A 1MFCL 5DJ6A 1ZLWK 5D5MF 4HBCH 2ATPB 5DC4B 1BZ9A 2ATKA 4LLWA 1EEZB 4DKEH 1KEML 4WFGD 3IFOB 3VD5A 1QRND 3H7BA 4PLKD 1I4FA 1PYWA 1OB1B 3CVHA 3FZUD 5DD5L 1N0XL 1R3KB 2AI0H 4XVSL 4PJBF 5MEOA 3IF1A 5D71H 1J0JA 2IFFL 4PJGE 2EEBA 5KVGH 2IJ0C 4LKCB 1AJ7L 4WHCA 2X2YA 2GCYA 1F6AB 5EO1A 1JK8B 4MQTB 4P4KD 1JGEA 4F37F 4R7DA 4HC1A 4M7ZC 5LBSL 1KN2L 5IMOB 2ZKHL 4AENB 5BRZB 5J11C 3MTRA 4UTBH 1GXEA 3RUGE 3D85D 1BFVL 3E6FB 3I02A 4PJIA 2CR6A 1QLEL 4XNXL 5FM5O 5HYJD 1QR1A 3B5HA 3QAZC 1E28B 4XVTH 3RNKB 2HTLD 3JWOL 3QI9D 1NAMB 1U93B 1BVZA 1SMAA 2VSDA 2ZSVB 3RFZC 4M3KB 2QQNL 3VXRA 4PJIE 4YNYA 5LGHL 3H9SD 1QSEA 1N5YH 4MNGB 4ODTH 4M1CD 4P2RD 4JB9L 4NKDA 5I1IL 4GG6E 4PP2A 1RJYA 2BHUA 4YXLH 3HMWH 4NPYB 1IGTB 2CO7B 1NQBA 5I18H 1DUZB 4XNMA 4PJXA 3O3EB 2N1KA 3OAUL 1FFOA 3SE9H 3C5SB 1CN4A 5BV7L 2A2QT 5TDOA 2V2XA 5L8KB 2HFFB 3ZE1F 4GKNB 4NQUA 2SEBB 4YBQC 3MV9E 3BO8B 3C8DA 4NP4H 3K7UA 1CICA 2O26U 4MD5A 5IK3A 1J12A 1SM3H 3MLRL 1D6EA 3PL6B 3CFDA 4X7FC 4YJZL 5DMGD 5E4IA 4RBPK 5DD3L 1CLZH 4OIBA 1XCQB 3DBXB 4I2XE 5DJ0A 5EU4A 3VU2A 4FQHB 4GXVH 1MNUL 2RFXA 2VLJB 4J4PA 2DQCL 4NN6B 5DJ0B 3ALXA 3BH8B 2YMXH 3IJYB 4X9IA 2IBBA 3BKYL 1A9BA 5MP6H 1YDPA 2PN5A 1BP3B 1OGAE 4LLDB 4GRLA 2ZOKB 4DGVH 1EERB 5MERB 1MUJB 1EHNA 1A4JB 4JFDD 2AQ2A 5I30H 2BNQA 2MQ0A 3HE7B 3RU8L 1EHLH 5GS0H 3L5HA 1N6QH 2BNUA 5HI5C 1FAKT 4EBQL 4PJBB 1IQDB 5C2BL 4YPJA 43CAA 3AXLA 3B9KA 4KHTL 1WWAX 2D3VA 4QRPE 3MRBB 4MS8A 3Q6FB 4QHKI 2P8LA 4RFEB 5IB1B 4MA7L 1JPTL 4UINL 3IKCA 3OQ3B 5IMMB 5C08D 5TF1L 3IFLL 1DCLA 4G8EA 4K7PX 3V5DA 5D71L 2EO9A 1UZ8A 4OUUA 4YDIH 3NCJH 2EEDA 3L3OB 4NO0A 2C1PA 3BKCL 4PP1D 4FFVD 4OF7A 1B9ZA 2F74A 4MDJA 2CLRA 4P23C 3C6LB 4HV8A 1AR1D 5DJYB 4H0GA 5I1CL 5JPMB 3QCTL 4M8QA 1VSCA 2F54B 5D7IA 4LRNH 1WFOA 4RWYH 4U3XA 3FRPA 4TPRH 3SGKC 4MAYA 3ARSA 2XA3A 3GSNB 1JZ6A 5I9QC 2C4FU 1TZIB 4DN4L 2NQCA 1XH3A 3WBDA 2QL1A 4KQ4H 2YUZA 5D7SH 5L6YL 1C7TA 1MCOL 2E9WA 4U49A 3CXDL 2GSIA 5T33H 4QXGH 3SQOH 3JZ7A 5DQDH 1MRFL 4D9LL 1BGXL 3O3DA 4Y19E 5IBLC 1LK3H 1CE6B 4WY7L 4DTGL 4R4ND 4BKLB 3PV6A 1UEYA 3UTSD 5F7KC 2O61B 2F5AH 3LRGA 5CKGA 5F89A 5J13B 5GGVY 3UCRA 1BBJA 1GHFH 2UZIH 4O5LH 3SGJA 2R1XB 1JF6A 1N26A 2OTPA 3V6OA 5MEQA 4PLKC 3NVQA 2E27L 3O45B 5EUOE 5DGQA 3MLWL 4U1NA 1I8MB 4EI5D 2YKLL 3HA0A 4MJ5A 1IFHH 3ARRA 4U6HB 5I8CA 3AC0A 1NBYA 4AY0A 1VKXA 3MGTB 2X4SB 3MV7A 2EDJA 1ZK9A 2XXCB 3RL1B 2BRRH 4Z7WB 3MNVB 2BHYA 2ICWJ 2VXTL 4XPBL 4R7DB 3MOBL 4X8JB 1NBQA 5F7WC 3H9SB 5E03A 5I66B 1CTOA 5FYLD 1ZTXL 4WU7A 2FL5B 2R0WL 2WWMD 4Q6IC 1FIGL 4EDWH 5ACMA 2GFBA 1A5FL 2XWJB 3MQIA 1PKQA 4AIZA 1IM3B 5CD3B 3BP5B 4HHAB 5DMIL 5DVMA 4LLUB 5AG8A 2R2HA 1JPGB 3PDOB 4QTIH 1J9CT 4NHCL 4R6UA 3CAFA 2I07A 4BSVB 1KGCE 3B4NA 3TPUA 3QRFM 5F7NC 3HI5H 4OF6A 4TSBL 1FC2D 1FGVH 3HMXH 4O02L 1JPGA 3HE6A 3PDOA 4XX1E 5CZVL 4UDUB 4KZEL 2XN9D 4DKFH 4GXUN 3IDUA 1BX2A 2NXYD 3QEUB 1IQWL 2K7QA 5E94B 2DLGA 1X9QA 4KFZC 3RDTD 4LQFL 3U4BH 4NM4H 2W65A 1OQXA 3BE1H 4LEXH 1DL7L 1U3ZA 4LQ1A 2JK5B 5DD0L 2QADB 3H9HA 3RWJB 4BK5A 2Q3ZA 4N0CA 4WUUE 2WIMA 2VABA 3V4UL 4CU6A 1T1ZA 1VCAA 2WSKA 1JGUH 35C8H 4OFYD 3U7WH 4ZFFB 5DUPL 1U36A 3JVGA 3ESVF 4OLUL 3V8OA 1JTOA 3O0RL 3LKPB 1AHWC 2DTML 1IM9A 4YXLL 3QUML 5IP4A 1DQQB 5JHLH 3O6MH 3KPSD 2XFXA 3BFOA 3CFCL 5J12C 3BN3B 2W1NA 5E0QA 4AEIH 4OAWA 4OZFG 1S3KH 1FL5B 2B5IC 1JP5A 1BECA 2I24N 4KHTH 5DI8A 4NQVA 5HHVL 2OZ4H 1KJ3H 4OB5H 5B39B 1NUNB 1UZ6F 2DJUA 3O3DB 2ICWB 4KKLC 4LIQH 1VFMA 3RZCC 4KAQH 1S5HB 4RX4A 1KB9K 2YUXA 1OQOA 3CX5K 1I8LC 2VE6B 3UJJH 1C08B 2DMCA 4YR6B 4KQ4L 4A2LA 3MRHA 5K9OA 2GTZA 1ZT7A 3L1OL 3MROB 2QSTA 4OGYH 2QHLA 3HR5B 1QBAA 4X9HA 5CSZA 1Y6KR 3WXVH 5JZ7D 3O4LE 2BCKB 3C6SA 1KPUB 1V7NH 43CAB 5IIEB 4NZRH 2NY3D 1P2CA 2D0HA 3PGFH 3SDCC 3W9EA 4H26B 2PF6A 1BM3L 2EH7H 4M7KL 5KSUB 3KHQA 3E2HB 2B4CH 4UILH 2GJZA 1ZE3C 4L8CB 2RQ8A 5IROA 3S6CA 5AEAA 4CVWA 3NZ8A 2VLLA 4YDKL 1ED3B 4MD0B 3WJLC 4GQ9H 5IMMA 1SVCP 5E2JA 5KJRL 1WFUA 1QLFB 1S7WA 3HI6L 3QI9C 3UPRB 5HSFA 2ED8A 1EFXA 1F4WH 4KU1A 3U9PH 4OFKA 4C56A 4UDTB 5DHVH 4NWTL 5DK2A 5EU6B 2AV1B 1DEEA 4JFHD 3P9LB 1XF2A 1RK1A 2JCCA 4ZXBA 1RU9L 4D3CL 2X42A 4X7SL 4EOWH 1TVDA 3VXQA 2DMKA 5C3LD 3OAUH 4IS6B 1MFDL 4P4KC 3KG5A 4P59L 1MFEH 3WIIH 3E1F1 4PJHA 4LKCA 4K71C 2CGRL 1P6FA 2YZ1A 3RGVB 1TQBB 3L3DA 2WBJB 5IOPB 5BV7B 4YPGB 4NHCH 4ZODA 5DRNA 4L1HA 4P57A 5EA0L 1PAMA 4KKCC 4Y4FA 1C5DA 4YK4B 2Q86A 1ORQA 5FYJH 3IVKA 4TN9A 3VCLB 2W91A 2ITDB 2VKXA 3BQUC 3KYKL 5FXCH 4JN2B 3MBEC 3MBXL 5HHXH 2YPVL 1ORQB 3IVKB 3VD7A 5F3HB 5IFJB 3FOLA 1T1WB 3BGMA 4AT6B 4Y7MA 5DRZA 4RZCB 1RURH 3K74B 1IEAA 4Z7VA 1MJ8L 2DIAA 5INDB 3BKMH 4PBVC 3O8XC 1UB5B 5K9JL 2OSLB 1YEGL 4Y8AA 4GW5B 4X6CE 3I6KA 3L3KA 1WIOA 4WTWA 4OSUL 3UC0L 4NO0D 4RAUA 4JQVA 4UOW0 4MX7B 5DC9B 2UV3A 3WNMA 4BELD 4DKAA 1WEJL 4PJGB 3VWJC 1ROWA 2HFFA 4OZGF 5F9JB 3GHEL 4GO6B 1DUZA 1OAKH 4MXQC 4YFDB 3B9VA 2K1MA 4ZQKB 4ZTOL 3OJ2C 1X5GA 4G80A 1DBKH 1DN0A 2CLZA 2LAGB 1VEMA 5LQBH 1F11B 4J23A 1CCZA 4NC1C 4H25B 1LEKA 2R2CA 5BS0E 3GMMA 3VFVA 2LVEA 3AREA 4JM2C 3MLTA 1YNLH 3ABZA 3DNKA 3BXNA 3STZB 3WV0A 3KLHD 4WTZA 4Z0XB 5IUSA 2EXWC 1I1RA 5HYSB 1DLFL 4YHZH 4AMKH 4PLJD 5KN5B 4R4BB 2R23B 4OQ1A 3VGAC 2EE3A 1JVKA 3KPRE 4HJGB 1BQHA 2B2XH 1OP5K 1J7VR 4OCLC 3QCVL 1AY1H 2YD9A 1AKJA 1A0QL 3LH2H 1P6AB 4HJGA 2HRPL 4U1LB 2MQCA 4Y16C 4Z6AT 3QDJB 5FYJE 2AQ1A 1N64L 3IYLW 5CJ8A 4O2EB 3X12A 4P46D 2XN9E 4D0DB 1CE1L 4FFZL 4M6NL 2V2WB 3UYRH 3B9KB 3WJJA 5JXEC 1G9NC 2PKDA 4NO3A 1L7TL 1U41A 3LKOB 4MA1C 5E5RB 1OD9A 4R9HA 5CKAA 2BJMH 4JAMA 1CGTA 4JG0L 3QUKB 2Q6WA 1QA9B 4PGEB 1I9RH 3T0AA 2NMSA 4P59H 4RFEA 3KS0J 5ESAB 1CXHA 4HCRH 2CJUL 3QXAA 1WCQA 4OLEA 5EUOA 1IFHL 3R8BB 4KK8D 2NR6C 3RJDA 4L29A 3GSNH 5KBNC 1EHXA 1UM5H 2ADGA 3HE6D 4GRWF 1A6PA 1F4WL 4RNRA 2DTMH 1OP3H 2ZCHL 5KAQF 2I5YL 1M7XA 4ELKA 5CBEB 2FCBA 3EYFA 1I8KB 1R5IB 2BC4A 3SN6N 4H26A 4NGHH 1VFOA 5HHVH 4Z7NE 2NX5B 1TVBB 4WW1A 2BNRE 3RY5A 1YYLL 2OTUA 1IGMH 1ZGLM 1TZHB 3WIFA 4U4BA 3CMOL 4Y4KD 5JA8B 4Z7UB 2VH5H 1ZLSH 4RMQA 4I0CC 1EO5A 3RGVD 1CR9H 3QIWB 4WWKA 3W0WD 1IM9D 3RVWC 4M6ML 5DRWB 4X6BA 3RQ3A 4UU9B 5DJCA 5HGBB 1W8NA 3T8XB 5DRXB 1N4XH 3MBXH 2IAMC 5F96L 3WO4B 3MOQA 3CVHB 4X0KB 3TCLB 1SJVA 1NBYB 1KJ3L 1QFWM 3EFDL 4OB5L 2ATKB 4LLWB 5E8PA 4U1NB 4ETQB 2VZTA 4HULB 4NQED 4HWBH 5DMJB 2XKNA 35C8L 4U1IB 4L4TE 4ZXBC 2VTFA 1JK8A 2HJKA 2VXUL 4XPGH 2GSGA 2FL5A 1PZ5B 1AXIB 1OGAD 3DRQA 2NY3B 2X5PA 2KH2B 1PJ9A 1WEJH 1V7NL 3DI3B 5L0QB 2Y1VA 1A6TA 2AK1H 5F1SA 2LE9A 4D0DA 1J0HA 1CI5A 4PRPE 5JW5B 1BVKB 4L8SB 3NPSB 1JFMA 5CCKH 5DEZA 3V52H 3OPZL 1OPGH 2YA0A 1JZ5A 1V7ML 3REWA 4XP6H 4CMHB 1JNJA 1U0QA 3SE8H 3ROOA 4KTEL 3QBTB 3O11B 4NQDA 2GT9A 1G7MB 1XZ0A 1A7RH 4R8WH 4HS8L 2ZUSA 5BOZG 4S0TD 3UYRL 1ZEAL 1C5CL 2R2BB 5D6DC 4WHTA 3R4DA 4JQIH 2JK5A 5HPMA 4LHUD 3O4LD 4K3DH 1QSFD 3MXWH 5HXMA 4MQ7A 1BQLL 4P5KA 4DKDC 1HXMA 3HLAA 1C12A 2CRMA 4LNRA 1VFBA 5SV3A 4OZIB 3ARDD 3MFFB 2XG5A 4HFWA 5DS8B 1FRGH 3BVNA 4YO0A 1BD2B 3GSXB 5EIIB 2V7NB 2WINA 2CGRH 4KTYA 5TDOB 1GPOH 4WU5B 5HHPB 4XVUC 4KROD 4MZ2A 3X3GL 4FQ2H 5CD5D 3H7LA 5TQ2H 2OMNA 3STZA 4X5XB 2VDOL 4N8PA 5HHMA 4ZUUA 3U9PL 3DURA 5FYJL 3GKWL 1MREH 3WHE0 4OZIE 5F7UA 4BQBA 4JRXD 1XF1A 4X7TA 1QPXA 4WJ5A 1N59B 4XBGA 2BVUA 3C2AH 3MRDB 3WNOA 3UX9B 4OQTL 1H3PL 4PFEA 4ZUSB 1JMZA 5CEZD 2HT2C 1L4IA 4P5TC 3OF6D 2EDOA 4PJ8D 4GXVL 3TVMC 4AEFA 1AXTH 1U58B 1FZJB 4APQA 4RCAA 1FZMA 1TZGL 3QPXL 5CJQL 4OSUH 3UC0H 1JGLH 1UVQA 2YWZA 2DJ4A 5CZKA 5JPNA 3OWEA 4NHUB 4PG2C 3DGGA 3MJ7B 1FNEA 4XCEA 3LQMA 1ZAGA 2AJUL 1MUJA 3PGDA 4PY8I 1JTPA 5LCVL 4IM8A 5B4MD 4WW2B 5MEOB 5GSVA 4XI5D 1QD0A 5HVHB 4PJBA 4M43L 1UEMA 2F53B 2Y7QA 5EZLA 1PZ5A 4QXTA 4YDVA 5DHVA 2E6JA 5TDNB 3D18B 4XCCH 5LGJA 4P99A 2YK1L 4I2XA 5I1AB 4XPTL 1YMMD 1QNZL 5JIPA 4XGZA 4KRPC 5A16B 4KJPC 2DAVA 3TIDA 2ZCLH 4GG8B 3D2UD 1FLRL 4QRRE 4BH7A 3RBSA 4HBCL 3ROLB 3KYOB 3TBWB 1JFQH 2JIXD 4MXVE 2CO6B 1DUYB 1WAAF 4OT1H 1T1YB 3S36X 1DQJA 2CJUH 2A73B 3B2UC 4E0RA 1WISA 5CGTA 4WI8A 1OT2A 4F15C 2L4OA 1QYGH 3P4MB 3OB8A 5MEPA 2R4RH 1AE6H 4NN5C 1FFQA 4CU7A 1NBVL 5L2KD 2FSEA 3S36L 3I75A 2KQNA 1TTUA 4WI6A 4DZBA 3ZKXC 2NLJA 1JL8A 3J8F7 1A2YB 1IARB 5J9PB 4G7YL 4I48B 1T21B 5ITBH 1FVCA 3BKJH 1NLDL 1QFWL 4QT5A 4N0RA 1T4KB 1NDGA 1L6XA 4JFYA 4WRLA 5DRZB 3DO7B 1D6EB 3DETC 4JVWA 1QHPA 1HWGB 4ZOBA 3QDHA 3T2NH 4OF0A 4XP6L 1YEJH 5BO1H 3KPNB 3MRKB 1S9KC 5SWZB 2Z8SA 3LN5B 4LCUA 4JPVL 5LGHH 3MRKA 4U3HA 4P46B 2ADFL 2RFXB 1D5IL 3U79A 4TTDC 5CP3A 3B9KD 5FCSH 3Q6GH 2FZ3B 3C6LC 2NX5D 4QYOB 3ZE0E 4EBQH 5HHOB 1QSFE 2HVJB 3DO3A 4TUOB 4CVZB 2XTLA 3BZ4A 3UPRA 4DZ8A 3QXDB 3DSFH 5C0AD 1KACB 3OXSB 1JV5A 3QQ4A 4CU8A 5JLZB 3K2UL 5TE7L 1JF1A 2DYPD 4KRNA 1ZLUK 1OAXL 4G9FA 5T1KB 3HFMH 4PJCE 2QQLL 2D31B 2UZXB 3BRDA 1OB1A 4M5ZH 4RGND 1KCRH 1KJ2H 4U2YA 5D70H 5C09E 2AQ3A 3S4SA 3T04D 2ZUWA 1MF2H 2A1WH 5TQ2L 1I9IL 2BSRB 3B6SB 3H3KA 3DVFA 4Y88A 5KS9F 4YDLB 3NFPB 1GGIL 1IZKA 4YHPA 2EIZB 5C2BH 2VLJA 3QG7L 1RPQA 4JFOA 4P5MB 5E9DE 3VXOB 3LVEA 4RMTA 4LSDA 3ZYIA 1YUHB 2XZAL 1NGPL 1V7MH 4QRUA 1F3JA 4NZUH 1ZSDA 4XP4H 4JFEA 3U7YL 1F13A 3WDJA 3OZ9L 5I75C 2QR0A 2K9UA 4NIKB 3QQ9C 5DGRA 1NL0H 1AH1A 4OV5A 4I4WB 1ZEAH 3VXNB 1OGTB 3VFGL 3ARYA 1LK3L 4R2GB 1CK0H 1EA9C 5FO7B 5H35A 2NZ9C 4M8VA 3TH4T 3P4OB 1P4LB 5GS0L 3T2QA 2XY1A 3QIWD 2P42B 3MRLA 4CKVX 1IAOA 4ELMB 3TF7A 1ZHLA 2B1HL 2YBRA 1JTTA 5C0CE 5TJWK 5FOJA 1FAIL 1WZ1L 4N5EA 2AK4D 4N0CC 5ISZE 4F58L 2QSCH 4L8BA 4UUJA 3BSZL 3FT2A 4X6FB 4U0QB 4ZD3H 4FQXD 2C1OA 4OCSL 3ULUL 5F89B 2NTFA 1EHAA 2ORBL 5DQ9B 1GGUA 3C5JB 1J05A 5T33L 1G0YR 3QUXC 2W92A 2EO1A 2FWOB 3F5WB 3VDCA 3DGGB 2FATL 1B3JA 4M7JL 3VD9A 4M48H 4NCC2 1BWMA 2VJXA 4NC2B 1I8MA 1OGAB 4Y89A 1WWCA 4BFEA 1YQVL 1BD2D 1C5BH 5E2UL 2WK2A 3P77B 4PJFE 2D7MA 1XH3B 4U0RC 1VGEH 1QBMH 4PRHE 5CILH 5IEKB 1S7TB 3TC9A 3B9EA 1WAAA 1D5BA 4WJ5B 4L8CA 4I2XB 2R23A 4R96A 2CRYA 5SV4A 1GAFH 5SWSD 4L4JA 3KJ6L 5AUMB 3VFOA 3A6OA 4PTTB 2JB5H 4QRRA 4CADB 4OZFB 4QXGL 3SQOL 4F9LC 1A7NL 2Y6SC 5B39G 5INCB 3H7BB 1U2CA 1I9JL 2VDLH 4ETQA 3IJHA 2R1WB 2VWEC 1FNEB 1G1YA 3M17B 5JOFB 4P9HC 4JDVB 2ZSWA 3TNMB 1G9NL 3EO9L 3BI9X 3VXQB 3NFNB 1CBVL 2EYTA 4E0RB 3V6FB 4BQ8A 1FVEA 1QFOA 2E8ZA 2F53A 3ELAT 1YNKL 3ULSB 4KK9D 3GRWL 1VGKA 4NDMA 3RY6C 3B8YA 3WUWA 4S2SB 1RJZA 3S35H 1HYSC 3PXHA 2N7AA 4NDMB 3SDDB 4RQQB 2F5BH 1OD7A 3CXHK 5H94B 1UWGL 2Z92B 1WTGT 3GEWB 4WFHD 3X11A 3L5XL 2QKIA 3ECBA 4R4FH 5BZDA 2VDRH 4YHIB 1EEYA 3OKOB 4Y2OA 1XZ0B 4TSCH 3X11B 5AZEH 4MWFB 4BZ2H 4Z76A 5E8EB 5D2LB 1NAML 5I15H 5MHSD 4PY8J 5JORA 2MKLC 3AB0B 3RWFA 2NY1B 3LZFL 5ID1A 5SWZA 4MQ7B 5T5NG 2HP4A 4PJ5E 4GUPB 3QJHB 5SX4H 3T0EC 5KG9B 2HN7A 5DR5H 4MXWH 3HI5L 1T7XA 2ADJA 1DTUA 1Q9LA 2AXHA 1A3LL 1WZKA 1KBGH 2F5AL 4QYOA 5HD8D 4I18A 5D7JC 1HINL 4PP8C 4PJ7A 1VADB 1CICC 3F62A 1UQSB 1NLDH 1QFWH 1RFDL 1MRCH 3WNLA 3VMOA 3KPPA 4PV8B 5J9PA 2M26A 1QBLL 3SDAC 4MA8H 3HZVB 4UAOB 3HAEG 3MLWH 3GSXA 4TOYL 1V05A 4MQXC 1KJVB 3BSZH 3LQZB 2Y9RT 3QDAA 4WU5A 5HHPA 1S7XB 3H0TB 4IRJD 4LSVL 1M05B 1NMBH 5MEQB 2VDPL 4GBXD 5C08A 4F8TA 3ZKND 2WUBL 4JFFE 2Q7YB 5A43C 3W11D 4JO4H 4PYGA 3FRUA 5D7KE 1YMMB 3JVGC 3VE0B 6CGTA 3F7YB 1MHHB 2VXTH 3G6JA 4OFPA 4W6XB 4XPBH 2DM3A 4D9RE 2FJHB 4WFFE 3LCYA 5E8NB 3SJVA 5IVZA 1L7IH 2VO5A 4U1IA 5FDWA 3CCHB 2AJZB 3N9GH 5EZIH 1Z5LB 1A14L 1RHHA 4ZUWA 2HVJA 3IDJA 1KJ2B 3BH8A 1DEEB 4HC1H 1MVUA 5IVXE 4G43A 2XZQH 15C8H 3TBYB 3JV6B 3HPLA 4FQCH 2WWKO 2FO1A 1A9EB 4FZEH 4YIQA 4IOFC 2DQGL 3HR5A 3BP4B 3Q5OA 1NFKA 2XWJA 4LSSL 4L8SA 4LVEA 1F58L 4V1DD 2F19L 4LLUA 4XP9H 2A6DA 4GFTB 4YDVB 4PRDB 1IMHC 2APWA 3ZE0F 2CXGA 2H3NA 4XCFH 1BJ1J 1WTLA 2QSVA 7FABH 1GIGL 4KI5C 4KVCL 3U36B 3T3MF 5FHBL 2F58H 3LN4A 5C2UB 5E94A 3UTZA 4KJWD 1NGPH 4CVUA 5GGTL 4RMUA 4UT7L 4AYFA 3TJHC 4WUKH 4PJFA 5IW3A 2Z92A 1G7IB 1GAFL 4RFOL 4OLZL 1F4YL 4MDIA 3WN5A 4OF3A 3FTGB 1FL6B 4RZCA 1B6UA 2VERN 4MNQE 2O5YH 1XFPA 1DSFH 3DUSB 1QTYT 1JZ2A 3SGDI 3RWEB 3V4VH 2MTPA 5EOCL 3HS0B 3GMPA 4FMFA 4UV4H 4MD5B 1H8OA 5KVFL 4X9GA 1YECL 4PGDA 1X4YA 1MFDH 3RPIA 1WBXA 2FSEB 4P3CH 1TCRB 4Y4HB 3SE3C 4G6ML 3D87B 4P57B 1W0YT 1MIEH 5IEHB 2C3XA 2HKHL 1EUUA 1H3GA 2DBJA 2OMBA 4LNVA 5EU4B 3LY6A 1QFPA 1KLGA 3AS1A 4WV1B 4OZHE 4PGCA 4GAGH 4PUBH 1YC7A 3HZMA 4Y4FC 1JN6B 2OL3H 4OQTA 4HKJA 2VKWA 4PGCB 5DFVC 1C5BL 1UH4A 4X6BB 1EXUB 4XWOC 2RR3A 4ZTOH 5GPRA 4C57C 1R3KA 3BN9C 4N5ED 1FNHA 2UVEA 3HZKA 5JA9A 3TF7C 1G6RB 3PWLB 1LEIB 4XCNB 1N3NA 4PD4K 1X7QA 1J1OH 3QNZA 1H5BB 4K8RH 1QOKA 2FZ3A 3UXFA 2ORBH 1A7BA 1B0RB 3LS5L 4IOIA 3S88L 1X7QB 3NIDE 5HI3C 12E8L 1FLTX 4MD0A 1B2WH 1EVUA 2RAMA 5BRZA 4AENA 5F7EL 4MD4B 4JB9H 4XRCA 5H94A 3ZYOA 5I1IH 1BPVA 3O6FB 1IL1B 5IJVA 1AGBB 4X99B 1KOAA 1XF3B 3G5XA 4GAYB 5CIPA 2NY2C 1KELL 1LP9B 3MRRA 4UNTA 1U93A 2DDQL 2UWEA 4XMPH 3LAFA 4K2UL 4GAYA 4I5BA 5D1QC 4XVTL 1QKZH 2HWZL 3BUTA 1V8HA 8FABB 5JO5A 4FQXB 1IGTA 5L7XL 4BFIA 5D1XC 2JJSA 2A73A 3UJTL 4ZTPH 1UWGH 3FQRA 3GGWA 5DRNB 2A0LC 1WWWX 4XZUA 1A6WH 1DLFH 4WVRA 1HCVA 2PO6A 3CLFH 4Y4FB 3SJVD 2YPLD 5IR1B 4HKXA 1OLLA 1HILA 1RULH 2V5MA 3KR3H 3CZFB 2W65B 4O4YH 5BVPH 5FO8A 3TO4B 2YA2A 5E08L 2OXHA 4GAJH 1U8OA 3QNXB 5EZIL 4NQTA 5F7LB 4O2EA 3ZKMD 5IR1A 2AERT 4F57L 4Q74A 1HCFX 5FO8B 1ZLUH 4GRWH 3OKNA 5KSBA 1KG0B 5CINL 3OV6A 4FQLH 1S7XA 1T21A 3H0TA 1YEDA 3KLDA 5I16A 2Z8WC 4H1LB 1X6NA 4HPOH 2J6EH 5D96B 5FUCC 2KQMA 1ZHLB 3QO1B 1AJ7H 2VUOA 5LVEA 1CR9L 5ICYA 5EO9A 1WBYA 2Y23A 2FIRT 5T3ZL 4ZO7A 2IPTL 2W38A 3QO0B 3W11C 2FJHA 1UC6A 5ETUB 2FR4B 3GKWH 1HQ4B 4F3FB 3TNNB 4IRJC 4JFQB 4Z7VF 4G8FA 4X4YA 4HCRA 3VXUE 3WLBB 8CGTA 5C7XH 2JELH 4G8FB 3WFZA 1NDMB 2ADGB 4RDQF 3HUJE 4DZ8B 4MAUH 1HNGA 3EYUH 4OZHA 2GTWA 4I8DA 1U8HB 5GRZA 4U1SB 3ARVA 3P77A 3D39B 4U1JA 4C4KO 5D2NC 4ZDHA 4LDOB 5KS9A 5MHSE 4AIXA 3O9WB 1FORL 1TCMA 2XA8L 5AYUH 4MJIB 4X80H 4E41E 3VXSB 5GZOC 5EZOH 3C5ZA 4PJ9B 3SE9L 3C08H 4OCRL 1NFDE 3F6LA 1HH9B 4WW2A 4W6WB 3ZL4L 1HKLH 1RZIA 1MCRA 4G7VH 4Z8FH 4N9GB 5FYLE 5FCUH 1AO7D 4QHUA 1QSZA 3ESUF 3QQ3B 4R26L 4CMMA 4WHDA 1A6VH 4M7LL 4GOSA 1G7JA 4NP4L 1AO7E 4WNQA 4WWKB 4FFZH 4KKNA 5D5MB 2X1WL 3TIDB 3VRJA 3CUPB 5CEYB 1S9VA 3AY4C 4PY7A 1RZ8B 4M03A 5JUEL 3CSGA 1DBJL 3SCMB 5IHZB 2AV1A 3VI3E 5I0DA 1HYSD 3X14B 4DTGH 2WY3A 4FXKB 4A6YA 3T1WA 5IB5B 1MHCB 4E42B 4MCZA 4FRWA 3MNWA 2WBJA 5IOPA 1Q1JH 2P43B 3DV6B 4GRMB 1M7DA 3QIUB 4RGMC 1WBXB 4YE4H 4K3EH 4TVPL 5ICXA 1RIHL 1OTTD 2OR9H 1TTFA 1AGEA 4FN0A 3ULSA 3FO2B 3DRQB 4NKIL 2ARWA 3UTQA 3GSWB 5JXAH 1FVDB 1KLGB 2JE8A 3ZHDA 3WLWC 4EI5B 3UZEA 4TNVK 5DQDL 2PYFB 3UEZA 4M1GH 3TBSA 2WINB 2YD8A 1PG7L 5MENE 1J10A 5D7JB 1PDKA 4DZBB 1BVKA 3KYAA 1IC5H 3MRHB 3MV8E 1WF5A 1OWWA 3CH8A 2ZUXA 1O7VA 2BFVL 4J8RB 3RWCB 1GC1L 4LAQL 3FO9A 5EBWA 5CEZH 3FFCE 3FAXA 2X44D 1MWAB 2E7CA 4QHKJ 4FG6D 1ZWIA 1SY6A 1MCDA 5JIIA 1NC4B 5KSVB 1U8NB 2E6QA 2YUWA 1P84J 4X4YB 1B90A 3H9SA 4OI9A 5D4QA 3WKNA 5T3ZH 5D2LE 3QUXD 3TCXA 4GAFB 2BVPB 2HMIC 2Q3AA 4CN1A 2KDGA 4BSJA 3T0DA 5H37G 3TA3C 3KYMA 2NXYB 1LGVA 1RZ7H 1IM3A 5CD3A 5JPNB 3EYQD 1U8KA 3AB0C 2UWEB 1HXYA 2R1XA 4Y2DC 1FNLA 1M6OB 3CK0L 5T3XL 2JCCE 2NY5C 1ORSA 2VAAA 4KK6D 5SX5H 3LKSB 4FABL 2NYYD 3LS5H 5TE4H 1FSKB 4JQXC 5T1LD 5E8NA 5BCAA 1BAFL 3JTSB 2VLRD 4CBPA 3KPMB 3VGHA 3VE0A 1JGVH 2DLIA 2EYTB 3NCMA 5BOPA 5ANME 3EBAA 4G43B 2DWDA 4PRBA 4NRYB 3RWDB 2E8YA 3BD5A 1JWUA 3N1QC 1CG9A 2YC1B 4XBPB 4WI9A 4PY7B 5T3ZE 2F15A 3RIFF 3PWNB 2WW8A 3QFJA 2D7TH 5TE6H 4NFCA 4PJEE 5I1HH 2MPAH 4FTVE 4OV5B 2OJZL 3VMPA 4OCXH 1DVFB 4I5BB 2R2EA 3INUL 1ERNA 1PGRB 3DV6A 4JKPL 3ZT7A 1JYXA 3ARFD 4KI5E 1YMHA 1HE7A 4X4ME 1CS6A 2OL3L 4Y5VB 4O58H 3Q6FA 1ND0A 2ZUQC 1AI1H 3IRPX 1RIVH 5B3JF 4P9HH 5I1LA 4ZUTA 4DCQB 3VRIA 4UILL 5M95B 4MS8D 3MNZB 5I75B 1MAML 3HZYA 1LQSR 1I85C 1ZT7B 2CDGA 4YO0B 2X9XA 4RFNB 1UJ3C 3G5YA 4ODVL 3UJJL 1MVFA 4BQ6A 4MJ6A 12E8H 4P4RB 5B8CB 1CDCA 5FYLL 4JY6B 2FX7H 3FTGA 3O8XA 1BQHG 3HG1E 1IAKB 4OD3H 2HH0H 3TVMD 4LPTA 5C0RH 1QRNE 2IG2H 2X89D 5DZOA 3TV3L 4G6KL 2FR4A 1J8HD 3FN9A 5ESQA 3WMSA 3BDYH 2XQYK 4H88H 4FS0A 3K3QA 2H8PA 1BVLA 1CF8L 2FX9L 3GSQA 1Q72H 1N6UA 2D2OA 1ZA3A 5L9DL 4NN7C 3CUPA 3FN3A 5CEYA 5I1EL 1G6RH 3W9DA 1Z5LA 5CD5C 2WIIA 5JW4Q 2F8XC 4TSBH 4ETYA 4S1QH 5KSAA 1K8IA 1PG7X 3DROA 4XBEL 1EO8H 2H2PC 3PDDA 4PJEB 1JCKA 1I4FB 5MERA 1FNGA 5IHBA 3Q6GL 1A9EA 4YIQB 3FT4A 1ZT4B 3O2DH 4D3CH 2ZJSH 4ZDHB 1RULL 4O4YL 1W0VA 5BVPL 1W72A 3B2UD 3ZDYE 4JFED 5DFWH 3RI5F 3LKRA 3DXAB 5C0EB 1UA6H 4N1CA 4LF3A 3MRBA 3O6LL 4G6JH 3WCYA 1P7QD 3ALWA 5C07A 3TLRA 3PGCB 3IXAB 1OAUL 2AV7B 1CFQA 3ILPA 4ODXB 4ZS7L 3QQ3A 2VLKE 3SKMA 1G6VK 1G7JB 3Q1SL 3BZ4B 3O6FA 1S9VB 5F93C 3SKJH 1JV5B 5JLZA 1UZ8B 4OUUB 1UKQA 4NZRL 1S7SA 1FGNH 4XPAL 4C56E 3CVIH 4LOUD 3PWJA 2K3TA 3VXRB 4U3CA 4IS6A 3JUYA 4FQXA 4TUKL 4JRXE 4XB8A 2V9TA 2NY7L 4GKSB 3ROOB 4F15B 4XP1H 4TUJA 4HS6A 3KPQB 4I1NB 5D2LA 3OXRB 3MRLB 5L88L 1IAIL 5B4MC 5B38A 4JG1L 1JI1A 3I85A 2PYED 3L3DB 4LSRH 5T1LA 2FD6L 3DRTA 4S0SD 1G9MH 3TO4A 2OX5A 3MLYH 4QOKB 2VLRA 3QJHA 4LVOC 3WXVL 2VC2L 3D39D 1H8NA 3IS1X 1HH6B 2F8VA 3TPKA 5EORL 1G9EA 2VLKD 5F3HA 5BQ7A 1P7HL 4YHKH 1KB5B 3UYOD 2BERA 2KKQA 4X5XA 4WEMB 3MJ9H 5FUZH 5K33A 1F5WA 4NZTL 1MIML 5HGAB 3ULVH 3KXFD 2NY5L 3DSNA 4U0RB 4Q9QL 3RGVC 2OJZH 4JANA 4NNPH 5FO7A 1HQ4A 2HFEB 3DBXA 5F6IB 3QDMA 1MCIA 3KPNA 3LPGA 1BQHB 1FPTL 3D69B 5CJXA 2IALB 4ZNEE 4X5LA 1CQYA 4RAHA 4AMKL 4YHZL 4ALAH 4HS3B 4KROC 4I0PB 3H3BC 1UZ6E 4P2RB 4H20L 4XHJC 4MMZC 1DN0B 2CLZB 2XXMB 5D1XA 5C0IB 3DROB 2DOCA 3MC0A 5T3XH 4NHUA 3KYNB 2CXKA 4XAKD 1PQZB 5IG7A 3WS3A 3GIZH 3GMMB 3O9WA 3HE6C 3ULUH 2FGWH 5F1IB 1AR2A 1G6RL 4U1SA 4MA3A 3WDHA 4R7NA 2FX7L 3QUXA 1AQKL 3GUTB 1YMHB 4OBSA 4J3XA 5DHVB 4UQ3B 5HYSA 3QUKA 3SCMC 2ZCHH 4M48L 3UTTA 3LN4B 3G6AB 3EDFA 3HRZB 1I1AD 1E6JL 2VLLB 1MHPL 4HUXA 2IG2L 1XGYH 3JV0A 4IMLB 2ZPKH 3SKMB 3X3FL 3NCCB 5FHAH 1PEWA 3PQYB 5DMYA 4P2QB 4JFOB 4P5MA 4GBXC 4NQCE 3BAEH 3L5WB 2PTTA 2WLYA 4C56B 3T3PF 5FA3A 4YHIA 2FJGB 3K0WA 4HUUA 3RNQB 4DAGL 5DR5L 1JF5A 1OP9A 2BOBB 3LEXB 3MRJA 3ARBC 4TVPD 4U1KA 3HS0A 1K4DA 3N06B 1IGJB 3MUY1 2PCPA 5GRYA 3GHEH 2V9QA 32C2B 4ZXBD 3T2OA 2CLVB 1E4WL 3HPJA 1U91B 1RVFL 3NMEA 4OD2A 1DE4B 5BV7H 3V6FA 3EOAB 5EFIA 3SDXF 1LO0H 2AABH 2PXYD 1N64H 5DQJB 4OCSH 1IKFH 4WUUD 5TH2B 1K6QH 1G7QB 1H3WM 1T1XA 3C9NB 1CD1B 4UINH 2X4QB 4QHNB 1DQTA 3MNZA 3G6JF 1DQML 1YNTB 3INUH 5GS1C 5FYLH 3FKUS 4EI5A 3RVWD 3S35L 2X4QA 4JM2D 4TQEH 2XI9A 4ZOEA 3DECA 5GGSA 4JGUA 1RZFL 3PJSB 3I9GH 5CBEA 4ELKB 5TPWH 2CKBH 1HEZA 3UMTA 1W0WA 1A7PH 4IRZH 2E7LA 1SY6H 1IAMA 4JFYB 5LXGH 3DVGB 3VXMD 2OP4L 3F7YA 1JHKL 4LGRB 5DJAA 3W9EB 1GGCL 3IAPA 1TETL 2EZ0D 4GW5A 1Q72L 2HJKB 5J8OA 5C0DB 3QUMB 3KPRA 4LPYA 1U8QA 1WIUA 4F7TA 1MQKH 3U83A 4UAOC 2V9RA 4U31A 3SDAB 1A7NH 1JZ4A 1IL1A 3S88H 3QZWB 1IKNC 2NY1D 3VD3A 3LEVH 4D9LH 5GISH 2X4OA 2Q8BL 5I1AA 3BGFB 5JW5A 3BP5A 3T8XA 4PRID 4DWHA 3WXWL 1OAYL 5D72L 4ZPVB 1XIWA 3MBED 1BBDL 5FUOL 1A6AB 1G7LB 3L3HA 1T83A 3K4AA 2DQCH 5C6WH 3ZYJA 1TITA 4ZFZA 1ORSB 3ARXA 3L6FA 4D8PB 2R2BA 3GIZL 4GMTH 1HN1A 5HY9B 3RHWF 5K9QG 3CLEH 4EIZC 1M71A 2ID5A 3NCJL 1KB5L 4KROB 2WUCH 3IXAA 3MLRH 4NQDE 1M71B 3UPCA 1D7FA 5EOCJ 1NAKL 4H1LG 2FGZA 4P46C 3PWPD 3VCLA 1UACH 1LVEA 1FVDA 2EEAA 3D48R 3DXAD 2UVFA 4Y5XB 4Y16D 2PYFA 3QDGE 4KUCF 5GGTH 2MSPA 5A2LH 5MENA 3CMOH 1MFBH 4YHYC 4M5YL 4ZOCA 4GKZB 2R39A 1JHLL 2FD6H 4HLJA 2HJFB 5HGDB 5JHDD 4OLWH 1IGCL 5JORB 5FM4A 3KLHC 1OL0A 1D3CA 1KBGL 3JTTB 4ODSH 3IFPA 2J7LA 4K94C 4NKOB 3DRTB 2FO4B 3VW3L 1E4KC 1MJUH 4PLOB 4NKOA 4FFYL 4LASL 1CWVA 1ZVHA 1VFAA 5E8OA 2UZIL 5DQ9A 3MFFA 4G8GA 3HRPA 3VGGA 3TN0D 4L4TD 4KDTC 4HG4J 4CRPA 5T1MA 5GGRB 4XNQB 1FFRA 2J88H 3LHPH 1C08A 4NNPL 5DA0B 1MAJA 2VQUA 5D7SL 3BMWA 5I2IB 4HWEL 1G0DA 3BIKB 5EPMB 4JY6A 5E7BA 1HXYB 4PB0H 1KEGL 5C08B 3BESR 1ODAA 4NSKA 1KPUA 4DUXA 3GSRA 2AJUH 3MOBH 5IQ9B 1FLRH 4KKLD 3MRQB 4UI2A 3D2UB 5LCVH 5TFSH 1A14H 1GH7A 2C3VA 4ONFL 3CVHH 1KIRB 2BSRA 3B6SA 2ENYA 1LNUB 4HZLB 2XTJD 3C60D 4KRMB 3CPLB 4YDJA 1LO0L 5E6IA 2HT4D 1J86A 2PXYA 2YKLH 2LVCA 2XKSA 2WQRA 5DMIH 4U6VH 2I26N 4QHUB 5DO2D 5DVOA 3TJHA 1T5WB 4JQXA 2XPGA 2W59A 1A7RL 5GS3A 5IB4A 4KKBC 4PREB 1BZ7B 3I6GB 3QDJE 4KKCD 2VN7A 3QDGA 4JM2A 1RZGB 4I0PD 3ROLA 1ZA6B 1BZ9B 2Z35A 2R69H 2R1WA 1BQLH 1YYML 3B9KC 4TTDD 3KWWB 4YPGA 3P0GB 3RDTC 5I8OH 5IB5A 4KKAD 5JNYB 4YC2B 1FCGA 3VXPA 5EBMA 3DMMB 3U4EB 3OKYA 3UTQB 4WEBH 4XNUH 5T5NF 2NY5H 3T4AA 5J6GA 3RKPA 4DGVL 3TFKC 1BOGA 25C8H 3X3GH 3PQYA 5GRUH 5CEZE 3GMRB 5FYKE 1S7SB 4ZAKD 3TESA 3P0VH 1MQKL 4HK3J 2DTSA 3UZQA 3FB5B 7CGTA 3FO2A 1FGVL 4O02H 5LWYH 3FT2B 5JW3L 4GG8A 1YEKH 4NUGH 4QT5B 2WBWB 4G5ZH 3RWCA 4FQJH 5FB8A 5GS2H 2J8UB 2BXZA 3CD4A 4LP5A 4S1RH 1TJIH 1QVOB 2VXQH 4M6OH 5DJYA 4AG4L 2XQYG 2R1YB 5DVNA 4P2QD 2WWMC 3T3ME 3RX7A 3VDBA 2EIDA 2ITCA 4DW2H 3LQAH 1EEQA 2PCPB 1KLFA 4WCYL 1VPOL 1REIA 2DDQH 2FEEL 2GKIA 3MRMB 1TVBA 4RMVA 3SDCD 3SKUD 4I3SL 1T03H 1U8QB 2OSLA 5IW6A 1RJYB 5KZCB 5DQJA 3SDAA 3AAZA 1F4HA 1DEDA 5DD6B 2ADJB 5DEFB 3CU1A 5CZVH 1A4KA 4OV6F 4Z95L 3UO1H 1MOEA 4H25A 2RGSA 3MACH 4TNWK 3TYGH 5TPWL 5ITFB 5EUOF 4YK4C 1I1FB 3PWPA 2SEBA 5LGKA 5FV1L 1KYOJ 3MCKA 4M62H 5L2JA 1VHPA 2E7LC 1Q94B 2MQ3A 1OAXH 3O81A 2B1AL 4OM1H 1A6VL 1AKJD 2E6PA 3EYVA 4HWZB 4NCDA 3TT3L 3QUZD 4W70A 1N3NB 4QRPA 1MCPH 3WJJC 4Z0BL 3EZ8A 4HEPG 4QXWA 1TPXC 3QWOB 3OR6A 2AGJL 4NWUH 4MD4A 1U8LB 3SKNB 4P2RA 3JTCA 2DMBA 3MCLH 4ODXA 4J7RA 2AK4A 1CXFA 1JNNL 3RWDA 4FQ1H 1YDPB 43C9B 3QDJA 1AR1C 5EU6E 1WZ1H 3QDGB 5GRXG 1PSKH 2A6IA 2EDHA 4FFVC 5J3HC 1GGTA 3JV4A 2D31A 4OCXL 4HZAA 1CLCA 1HHHB 1TJGL 1FDLL 3L3JA 2HT2D 4F7EB 3VH8B 2NXYC 4KQ3H 4Y5VA 1T7WA 4ESKA 2BY2A 2O5ZH 1HHJA 1I7ZA 3VFGH 1RZFH 4FZ8H 1QSEB 1MPAH 5E95B 4YHLL 3EOBB 5J6GB 4ODHH 4IMKA 2B2XL 2PO6B 4C58B 3VXSD 2AEQL 1WZLA 3V6ZA 1CGWA 3P4NB 1S9WB 4Q6YA 4PJ7B 3AS2A 2HFGH 3KJ4B 1JHLH 1EAPA 4OZGA 5I2IA 4X8XA 3OKNB 4OF8A 3BP7A 5CP7A 3CXHJ 1D5IH 1QQDA 4P0DA 3LEVL 5ISZB 2YPKB 3TBWA 4NWTH 1NGZB 4OKVB 3O9WC 1T2QH 1D5XB 3VFUA 4OAWB 4ELME 5ALCH 1RZKL 4EI5C 3CFDB 2JIXA 4OFIA 1GVIA 2GJ6D 1SJEB 4PDCE 2DRUA 1F00I 2BHZA 3MYZA 4FP8L 3RY4A 4H8WC 3V4UH 4QF1A 2ICCA 5FDWB 2BVOB 1HYRC 1T3FB 2P1YA 2NY6B 1U2HA 4W6YB 4P5TB 1LDPH 4Q6IB 4ACPA 2BVOA 1NDMA 4R4NC 5D1QA 1G9MC 3DX9B 4U1MA 3QUMH 4LAJH 3KDMA 4JDTL 5IB2B 2J1KA 3A6CH 4P9ML 2WMPA 2YD6A 5KSBF 3LKSA 1LK2B 1OAKL 4YGAB 3A0OA 3UBXI 1HIML 1OSZB 4TTGA 1MCFA 3QI9B 1YEFH 2OI9B 2VR9A 3P73B 4PRIE 1S7TA 5EBMB 2BVYA 3GSUA 4JE4B 1LO5B 3SJVE 1C8PA 1CBVH 1UXWA 3HCVA 2A9MH 2X4OB 4D9QE 4NRYA 1BQSA 2VL5B 3EOTL 3LIZH 2YC1A 4I13B 3MOAL 4LSTH 1KENL 5F7FA 5CLWA 2X4RB 2DD8H 4WNQB 3NACH 5D5MA 1L7TH 4NFBA 1WLHA 5INCA 4U1GB 1XIWB 5KZCD 2N4IA 5GQBA 5J1AB 4NQEE 3WJLA 5EG6C 4HT1H 4RWHA 4NO0B 3OTTA 1UWXK 5BZWA 5KW9L 4M7KH 3H42L 4M1DL 3QIBA 1WJ3A 2LQRA 2HRPH 5AZEL 1HHJB 1H3VA 1IGJA 2DQUH 4G9FD 2CUMA 5I6XC 1KLUA 3HE6B 4HIJB 3TN0B 3HMXA 4FFWD 5FF6A 1KIPB 2DM7A 1WGOA 4HIJA 3TIEB 1FCCA 3VRIB 3LD8C 4IRJB 4L4VA 2ED7A 1RY7B 5E24E 3QEQA 3BDBA 3S5LB 4NZDA 3C9NA 3SEPA 1X5XA 2VZUA 3T2PA 5DD3H 1YEDB 2VLJD 5J89A 4ODBD 5IFAH 3LQAL 4PJEF 2O5XH 3O8XB 5HHMB 1QLEH 1JPSH 3S35X 2NR6D 4BFGA 4ZAKB 1X5HA 2YSSB 2XWBB 4MHHI 1YY8A 4LGSB 3QDMB 3D3VA 2XG4A 4HJJL 3REVB 3QXWA 2VH5L 5E1AB 4ODVH 2DWEA 2XFXB 3BPCA 4N0YL 4XB7A 1T22A 4IIQC 3REVA 4KPHL 1LEIA 2DQTH 3WFCH 1TQCB 1YMME 2Z91A 3GMLB 1VKXB 3AGVA 5HHXL 1F8TH 5GZNC 3AFLA 3ZDZE 3D0LB 1TQCC 5B3JE 5D1XB 5C0IA 3TEUA 3HE7C 5IV2A 3O6KH 3PL6D 4ZUSA 5BV7C 3SBWA 5JXED 5DJ2A 1RURL 1YN7A 1CDUA 1EUTA 1FZOB 3VMNA 2DLHA 3K1DA 4JZOA 4J4PD 4MJ6B 1MHEB 2YMXL 3PGDB 1AGDA 15C8L 3RZCA 4U33A 5HVWA 5CHNB 5J1SC 4JKKA 5C3TA 5L2JB 1KYOK 4P4KB 4WTXA 1XF4A 3ES6A 4JKWA 3VRLF 2CR3A 4WI2A 1HSBA 5KS9B 3NCEB 3P0YH 4X6CB 5HYJB 4QHMA 5HY9A 1SJHA 1HSAA 2BXYA 4LSUH 1FYTA 1JI2A 3RX8A 3MRPA 4QXTB 1TPXB 3BH9B 5C0BB 3OPZH 5HDQL 2Y07L 5I1KL 4JRXB 3HNTH 3D39E 1YEIH 2JCCF 3TPUE 3VXRE 1FO0A 4MB4A 4U2ZA 1CQKA 1J87A 4DN3H 1MHCA 4E42A 3FFCD 2PO6C 3GRWA 3BISA 4QRPD 5I9QB 2X4UB 3S34L 2X1PA 5JMRA 3BEVB 5E1HB 3SCMA 5IHZA 1WBZB 2Y4SA 3Q1SH 4Z95H 1WIPA 3EDEA 4I4WA 2DQIL 3H8NA 5H35B 2OXGA 4UTBL 3QCVH 3HE7D 3S3PA 1RZKC 1AFVL 1P4LA 4JFFA 1SJEA 4LKXB 1OPGL 3TT1H 2D4DA 1Q9OB 4KDWA 3EOAA 1KXVC 1AGEB 5HYFA 2XZCH 3GNMH 2IPKB 1VFAB 4Q6IA 2C1OB 4JO4L 1D9KA 1U6AL 4OD3L 4KI5F 4U1MB 1P7QB 4BSWB 2FB4H 2ADIB 3EYFB 2WQ8A 4FQPA 2AXJA 5EORH 3WYRA 5FAAA 1BJ1H 1PX4A 1JRHI 1S7RA 3CX5J 3T4YB 1F6AA 4WGWB 5EO1B 2RBLA 2AP2A 5CAYB 2DB8A 4H0HB 3NGBC 3VFMA 1A5FH 3I6KB 2JIXB 3L3KB 3NIFE 4M02A 1QKZL 2PW1A 3FONB 5SX5K 3U1SL 3C5ZB 4PJ9A 1IEHA 4FQ2L 1KCSH 1NEZB 1PY4A 3W82A 2J6EA 1ZS8A 3AAZB 3NA9H 3DPBA 1T66D 3ARFA 3ZDXE 1JF1B 1NBVH 3DIFB 5DLMH 3THML 3LRHA 1IC7H 4BYHA 2ZSVA 4DVBB 2D0FA 3DUUB 4JQVC 1T6VN 3DIFA 2DQEL 2EYSA 4HDIA 5EOCH 5T1DL 4EQ3A 5L2KB 4QOKD 4PJ7E 1BF2A 5D6DA 4UV7L 5JHDE 3UTSB 1TJHL 4ERSH 3RX5A 4JZNB 1JWSA 2ZNWA 1Z9OA 4EN3C 4XCCL 2ZUUA 3MJ9L 3PWLA 1AQDB 2BVQB 5C0CB 3EO1A 1RK0B 1A6AA 3WFEH 4EDXA 2GITB 3CFJB 3FQTB 4HJJH 1RK0A 1CDJA 2IALA 2A38A 4JZJC 3T0WA 3ET9F 4JDTH 4OGXH 2JB6A 5KSBE 3LN9A 3G5ZA 2MNUA 3E8UH 1CIDA 2PTUA 2X4NA 3DX8B 3O3AA 5JZ7C 1DDHB 3VXUD 1CG9B 3BZEA 3UROR 3LKNB 3AUVA 1JNHA 3N1PC 3RP1A 3VXNA 5FHAL 3TBSB 4LRIA 4JKMA 3S7GA 1FIGH 5DD0H 3PWJB 2YSSA 2J8UA 1EIBA 5JOPD 1B0GA 3ME0A 2JJUA 1Y0LA 5L6YH 4MQSB 5DTFB 2IAMB 1B2WL 4HAGA 3WE6B 4OLUH 3ULUF 3KPTA 3MUHL 3UYPA 4HGMA 4GAGL 4LKXA 4WHTB 3SGEI 1NFIB 1YJDC 2VC2H 2BZDA 2Z91B 5FYKD 4GUPA 1XF5A 2JJTC 3FQWB 3NOIA 3QWRA 2EDXA 3FO1A 2XA8H 5AYUL 2IMNA 1V3KA 4BQCA 3IFNH 4ZO6A 4KZDL 3OAZK 1Y18B 1EAPB 4DCQA 3VA6A 5K9OB 4R90H 1SMOA 3V7MA 2X9WA 1R5VA 1BD2A 1RHFA 4OCWL 4XVJH 2B20A 2GTWB 2CIIA 2DM4A 5FDYA 4GQ9L 3G5YB 3H9SE 4K23H 3SKOA 1BQUA 1RUKL 4CDHA 4Q2ZA 4RISH 3VFPB 4M7ZB 4CNIB 1IGYB 1HH9A 3GHBL 4HT1L 1NGWB 4QHMB 4EOWL 4LL9A 4X6DF 5I8KH 5ITBL 4R2GD 4MHHG 5J56B 3GMLA 2BP3A 2YD4A 4X98B 1VESA 2NW2B 1AFVH 2IPUG 3RL2B 2ZCKH 2OP4H 1MLCB 2AJZA 5EU6A 2H8PB 3GMNA 3CU7A 3W81A 3V0WH 4ZUWB 3AU1A 3I6GA 3U48A 2EYSB 2IPUK 2XN9B 3IJHB 2BDNH 3FT4B 3PWUA 3RAJL 5C0JB 4D94A 1ZA6A 4PB9L 4UU9A 5DJCB 5HGBA 3MO1B 4X9BA 1IGFH 2X4UA 4K9EC 3QIUC 4PJEA 1U3HB 2FHCA 5IB4B 1EXUA 2G9HA 1P2CB 3S9DB 3NH7H 3L5JA 4CL7A 1AD0A 3CLFL 2GSIB 4LEOA 1AHWB 2Y36H 5C07B 4JFDE 3TZVA 5HGHB 4XC1L 3F6IA 2BFVH 2VDQH 5KSAC 1X3DA 2YR3A 2Z8VC 4L8DA 5HGHA 3WDIA 1EH9A 1YA5A 3OJMB 4X4ZA 3T2NL 4YHOL 3NIDF 2GAZA 3DMMA 2H9GB 1Q9WA 3U4EA 3UJIH 4UIMA 5HDBE 1LE9A 4NBXB 1UCBL 3S8WA 3LMJL 5I1LB 3T0EA 4LOUC 1XR9A 1G7HB 5LKNA 4KPHH 4HF5H 3LS4H 4OUOA 5SWSB 4PS4L 2EC9T 4OGXL 2ZNXA 3QNYB 1E6OH 1LP9A 1NMAH 2XWTB 5INDA 2LABA 3F58H 3DYOA 4RSVA 3DGCR 2I60H 4HQQH 1AD9B 1GGYA 4P4RA 4LLAA 5B8CA 5IBLD 3MR9A 3I50H 5C7XL 1OAYH 1JYWA 5F9OH 5EO0B 4YLQT 4P3DA 5C0AB 4HFUH 4NQXA 4PJ5B 3WFHA 2W0KA 5B38B 3VXSE 1ITBB 1N0XH 5MEPB 3KLAA 1F4AA 2X7LB 4OI8A 4PJBE 2VQ1B 5JDSA 5SWQA 1HK6A 4K9EH 4XC3H 1CD1A 2A1WL 1U8IB 3HLAB 1MI5D 2Z31B 5FIEA 3O6ML 1I7RB 1D6VH 1A4KB 2HJLA 5KTEL 2Z31A 3B5TA 1A1NA 3TYFA 2WIIB 2YPLA 1JN6A 1KT2B 4KMQA 1F6FB 3VG0H 3SDXE 3DX9A 1T4KA 2W9DL 1FQ9C 5CZXC 3VXUB 3FB7B 5D96C 3MUGA 5C0FB 3ULVE 3K80A 4C54A 4ZAKC 1X5ZA 5DHXB 3D2UA 3WUZA 3TFKD 1EV2E 2M8XA 3W39B 1JGDB 4F7TB 2VABB 4ODTL 3HCVB 5IVZB 2XACC 3QWOA 3BQUA 3GB7B 5J3HD 3PF2A 4OLYH 2EYRA 5GRJL 1SBSL 3BWAA 4N5UA 4LARL 3JV4B 3CSYA 4GW1B 1OHQA 4XNXH 4DOHE 3ZSTA 2EIBA 4HIXH 2XZCL 5C70A 4JPWL 2A6IB 4XPHH 4OCYH 5DO2C 3O11A 3EFFA 4NQDB 5GJTL 2X41A 3PHQB 3FQTA 4F7MA 2QV2A 3NH7L 5TGBA 4YGVB 5DMGC 3ARFC 3KAAA 1HHIA 2BNRA 3TV3H 4P5KB 4PJDE 1P7KA 3QB7C 3V4PL 2DLFH 4DJMA 3I3BA 5CFHA 2RHEA 1DBBL 4K07A 4K3JH 2D9CA 2D0GA 4YWGH 3P40A 3LKOA 4Z7OE 3GSNL 2NX5A 2DJSA 4G6FD 3DHMA 3MR9B 4KH2A 4OZGB 3EGSB 5E6ZA 2OTUB 1RUPH 4PJGF 5HGAA 1H3UA 5EUKA 4N8CH 4KZDH 1ND0B 1EGJL 4OD2B 2YRPA 1MAKA 5KANI 3U0PB 4HAFA 5HYQA 1RZKH 2IPKA 5DD6A 4YXKL 3VH8G 5B3NA 4YHNA 3P11H 4JFQA 4FQQB 1H0DB 5C07D 4PBXA 5BXFB 4HJ0D 1BEYL 1NANH 2LTQB 3WLBA 5D1QB 1PW3A 2QQNH 4HBQA 4WI5A 4LCWB 4JKPH 1VA9A 5I73B 1DQLH 1T83C 5KVGL 4P2CG 2I9LA 2R9HC 3OKMA 4LCWA 3W0WA 1CDGA 4OZHB 3UO1L 3Q5TA 4HUMB 1B6DA 3RU8H 1EHLL 4ZFOA 1UG9A 2YZ8A 2BY3A 3PV7A 1MY7A 1AGCA 5DXWA 5F6IC 1KEMH 2FEDD 5CEXB 5D7LE 2Q8AL 1T0PB 3SE4A 1D5BB 3GSOB 4TOYH 2VDKH 5IW6B 1P4BL 4IJ3B 1PG7W 2PW1B 3BJ91 3U0WL 4N9GA 1LNUA 4HZLA 4DQOH 1RZJL 1C1EH 1MLCA 3P4LA 4I0PC 3MRPB 4LHUB 5D2LF 4I9WE 5D1ZC 4HS8H 4ZG1A 5DZLA 2L7JA 4DGIH 3PWUB 3L5WA 3O4OB 3O3BB 4X0KA 1BZ7A 1YYMH 5L2KA 5FA3B 1FZKB 1NCBH 4KRLB 5CIPB 4V2CB 5E2UH 2HT4C 1PKQB 4L3EA 3SOBH 3CH1A 3DOSA 3QP3A 1KPRB 4LEOB 4L4TA 4E5XA 4TPRL 4ZFZB 2V5RA 3BPLC 4FXGB 4GRLC 2F54D 3HC0A 4Q9QH 4OFYA 4A6YH 3KPOB 5D6CB 5CMAA 2J2ZA 2CDFB 1LEKB 2VXUH 1C5DB 3BEWB 2EZ0C 3K81A 1ONQA 1LDSA 1GGBL 3E6FA 3U30B 3I75B 3W5NA 3EDKA 43C9A 1YNTA 1S7VB 5IWLC 1GOFA 5ALCL 2IBGA 3TN0C 2WNGA 5HGDA 5KANG 4QCIA 4ZYKB 5I17A 3U2SB 4E41D 2O5XL 2PTVA 2DLFL 2ZWLT 3GKZA 5DMKA 5E4EB 3BOVA 1OGTA 3UJIL 4GLRH 2J8HA 1IM9B 3TNNA 1MH5B 5DMKB 3K46A 5F72S 4LMQE 1CFVL 3ZYZA 1WSST 2PW2B 2ARJB 1SM3L 1UKSA 4KV5F 2PXYC 5HBBA 5EOQH 3IJSA 4YXHL 4YFEA 4M6MH 3A6CL 3LN5A 4LCUB 5CSGA 2F54E 5F9JA 1S9XA 4BQ9A 1GIGH 2R8SL 1T80A 2P8MB 3BWAB 4KUCD 3BUYB 5A3ID 3WS3B 5ITFA 3VFWA 4NNYB 4OFVA 3FO0H 5E08H 5CHNA 3IU4L 2IANB 1U95A 1I7UB 3GM8A 2CUHA 3QQNA 4NBZB 3RVVC 3WEXA