4PG9A

Mhc class i in complex with sendai virus nucleoprotein peptide fapgnypal
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
276
structure length
276
Chain Sequence
GPHSLRYFVTAVSRPGLGEPRYMEVGYVDDTEFVRFDSDAENPRYEPRARWMEQEGPEYWERETQKAKGNEQSFRVDLRTLLGYYNQSKGGSHTIQVISGCEVGSDGRLLRGYQQYAYDGCDYIALNEDLKTWTAADMAALITKHKWEQAGEAERLRAYLEGTCVEWLRRYLKNGNATLLRTDSPKAHVTHHSRPEDKVTLRCWALGFYPADITLTWQLNGEELIQDMELVETRPAGDGTFQKWASVVVPLGKEQYYTCHVYHQGLPEPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system/peptide
molecule keywords H-2 class I histocompatibility antigen, K-B alpha chain
publication title The first step of peptide selection in antigen presentation by MHC class I molecules.
pubmed doi rcsb
source organism Mus musculus
total genus 76
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2014-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4pg9A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4pg9A01
5E8OA 4KH2A 1QBLL 3MNWA 2YD8A 5GGTA 4Y89A 1O0VA 3MBXH 3FAXA 3CUPB 4ZD3H 1JE6A 2ZWLT 3B9KA 1RJYB 4P9MH 1KJMB 5T3XH 3O11A 5HHOA 5DVOA 4JRXB 2Y25A 3L9RA 3QUYD 4E42B 5GGQL 3U36B 2OTWA 2VXVL 2BVYA 3EYVA 3PG2A 1U8HA 4V2CB 4Y8AA 1DN2A 4ZPVA 4TSBH 1H8NA 1S7RA 5EU6B 4LAQH 1MFEH 4PJDE 5JNYA 5I66A 5M94B 1RZIB 5BV7B 2GQHA 1X3DA 4OGXH 1GZQA 1MELA 4Q6IB 3UTOA 1J05A 1CN4A 4OZHA 4CNIB 3CDGB 4L1HA 5GISH 3DARA 1XF3A 1JF6A 1K8IB 1UACH 3PWPB 1OL0A 4DJMA 1XR8B 4XNQA 3V4PL 1JWUB 2ADGA 3EYUL 1MFNA 3ZYOA 1CFNA 4LOUC 5BV7C 4L3EB 5CP3A 4Q6IC 4MB5A 1MHHA 1P4LB 3QCVL 4LLAA 3OR6B 5I18H 1TETH 2W07A 5DD1L 1MCFA 1EEQA 5AEAA 3FQUA 4J12A 3D85D 2HTLC 4XPHH 4NN7B 5L8LB 2YRLA 4P23B 2O5XH 4UDUB 3L5XL 1A8JH 3W11C 3KPSE 3PV6B 3WUWA 1F4XL 4XVJL 2YR3A 1ZA6A 3ZE0E 4P4RA 4V2BA 3VXSA 3HRPA 4NRYA 1JRHI 3BZEB 3OQ3B 3QJHB 2HJKA 4U1LA 4OAWB 5F7NC 4O2FB 1G6VK 3DVFA 3O9WA 4GXUN 5KANG 3VMOA 4IMKA 3CSYA 4NN7C 4YDLC 4P23C 3MV01 3TJHA 1SEQL 5IVXA 3FT3A 2YA1A 2QQLH 4NQSB 3ZHKA 1J12A 3MV8D 4M6OL 1CIDA 4A6YH 2CDEA 4R8WL 1WITA 2OSLA 5HDQL 3G5XA 5DO2C 4CVXB 3WNLA 1G7QA 4LEXH 3WNPA 3V52H 4MVBA 4KJPC 4HPOH 1T2QH 3THML 4B5EA 3TCLB 1ZANH 3CX5J 1FGVH 4MNQE 4HGMA 1LNUA 1IM3A 5J4MA 3NIFF 3RVTD 3KPNA 4KHTL 3OPZL 3KYNB 5I1CH 1DFBH 3C5ZA 1TDQA 4PTTA 3MACH 3Q6GL 3U7YH 2F8XC 3IU3A 4JO2H 3RNKB 3GK8H 5J3HC 5F9OL 2VN4A 2YHGA 4YHML 3HNVL 1RZGB 4R6UA 1BF8A 1TFHA 3DO3A 4YBQD 3N85H 3ULVL 5DEZA 1FZOA 3C8KB 2DKSA 4PY7A 4FQXB 5CLTA 2DJ4A 1BVLA 5AUMA 3SQOL 3DGGB 4RA0C 3I6KB 4L3CA 5J13B 1M05A 4NQDB 4OLXH 3VD4A 4X6EB 4P46B 4H8WL 1QACA 5F7FA 3FFCA 5DK3A 1VERA 3BGMB 4F8QA 4X5XA 3F6LA 3TO4B 1R3LA 3MJ6A 4FQXC 5TE6H 4WHYG 5JIKA 3DVGA 4GG8A 1X4ZA 5J13C 3S37L 4ZOBA 4HEME 1BGXL 4P46C 1OF2B 5T1LA 1SEBB 2DRUA 5DJ8B 1CT8A 3MFFA 4XAKD 3HI1A 4M4RA 1VGEH 4X83A 3TF7C 1WJ3A 5DJCA 3U82B 2YSSB 4R4BB 5HGGS 2X6MA 2YRZA 1S9VA 1P9MC 1I1FB 1HHIB 3IJSB 1VHPA 3IJYA 4LNRA 4NZJA 5ENWB 2AJUL 5L2KE 5MP6L 1OT1A 3EUUA 3RX7A 3U7WH 5F1IB 4MDJB 2W1NA 4JDVA 2R69H 2EICA 3D0LA 1BBDL 3ARGD 2YZ1A 1EHLL 4IHOA 5D1QA 4X4MA 2XKUA 5JDJA 1J0KA 1JPST 2JK5B 5BXFB 1EZVX 2W9DH 3ZYIA 1CVRA 4YHLL 2I60L 1YN7B 1NBZA 3IFLH 4GW4B 2BXZA 4M61A 1T1XB 4PYHA 5K9QI 2R0WH 2IH1B 5B8CA 4MGXA 3O8XB 3U46A 1MH5B 5INCA 3MQIA 1C16B 3LSOA 1H15B 2O61B 3H9SD 3IFOB 4X4XB 1Q9KA 3ZTJG 5C0DB 3BH8B 3VXRB 4HWEH 5DMJB 3DIFA 4K8RC 4UOW1 4XP1H 2MTPA 1MCJA 4M7JH 2FATH 3WIHL 3O8XC 4TUJA 3GMOB 4EKXA 2CXKA 1ORQA 3BP7A 1CLZH 4NKMB 2XOTA 4KJYA 2ADFL 5ANMB 1F4YL 3L3GB 3AREA 4ODUB 5GRJL 2ATKB 4NWUH 1CLOH 3UTQB 2R0LL 2ADJA 4UOW0 3HUJA 3IDJB 4JANB 4R7DB 3MBEB 1MAMH 5FK9A 3TNMA 5CBAB 1QNZH 2JJVA 1P1ZB 1UADC 4TUKL 4XXCA 5JW4N 1A6TB 2YC1A 4LLVA 1B9ZA 3WO4B 3BSZH 1QSVA 4RMSA 2AI0H 2PXYB 4Y5VB 1S7UA 5B39B 1FIGH 1SJEA 4OZ4B 5KVEL 3HB3C 5DQ9B 3U0PA 1ZT1B 3ARRA 4HIEA 4LLYB 4PGDA 4X8JA 3WO4C 4EDWH 4Z7UA 2BSED 3VFRB 4PGCA 1MCSA 2PXYC 1NC2B 1PEZA 3PE9A 2AQ2A 4Y5VC 2GUOB 2BCKB 4OLYH 2B4CC 3FQNA 4CADB 5FUOL 4JRYD 5IWLC 2CRMA 2R2CA 4I48A 4YDVA 1HHJB 4X6CF 4NKOB 4EEEA 1JWSA 2DBLH 4LGSB 2FJHB 3X13B 3PWUA 3NFSL 1UJTA 3Q1SL 4TVPE 5K9KB 3WIIL 4HV8A 1T1WA 3WBDA 1JZ6A 4NZRL 4ODXB 3LN5B 1PZ5A 3UYRH 4Z7NF 1YY8A 5GGTH 3T4AB 4MA7H 2Y36H 4XMPL 1AFVH 5H94A 2GTWA 5EZJA 3OB0K 3GSQB 4P5TC 3DI2B 4HS3B 3LEVH 2QHRL 3QQ9D 3C60A 1P6FA 2LE9A 5FKPB 5TFSL 4JQXC 2E8YA 5C07E 3TIDB 4LASL 4L5FH 3MO1B 5D5MF 4OCSH 4XZUB 3I6GB 2ZG3A 3UPRB 5DMIL 1TMCA 3SKNA 3S5LB 3TNNA 3CD4A 5C0BD 4MXQC 5D7JA 5T33L 3FT4B 4GO6B 1DN0A 4QGYA 2NY6B 4P3CH 3FKUS 3OKNA 3F5WB 3LKRA 5DD3H 1I1YB 4KTDL 3BKJH 3HAEG 3HFMH 5CP3H 2WANA 3PP4H 5IMMB 1NLBL 2PO6A 3GSUA 2CPCA 4IRSA 3GHBL 4J8RA 5DUBA 3ULSA 2PCPA 1JGDA 2ZNWA 1GIGH 3OKOB 1SMAA 3T4YA 4NSKB 3WDHA 5EN2B 5F1OB 5E4EB 2FH6A 4Y5YB 4PB0L 4XP4L 3NOIA 4G8GB 4YK4C 5IBTH 1RJLA 3RPIA 1M71A 3TFKD 4OLUL 4FQ1L 1FORL 1G7JA 4LMQE 3SDDD 1VFAA 3SE9H 4Z7QE 5E4EC 3RQ3A 2QQKH 4Y5YC 1RZ7H 2O5ZL 5CJ8A 5C08B 3S3JA 1DTUA 2VDPH 5HHPB 4PLKD 4BM7A 2FX7L 2MSPA 4OZIF 1IVLA 3FB8A 1T20A 2FZ3A 5ETUB 4X7SL 5LGKA 2V7HB 1FBIL 3BUYB 2X1WL 4AZ8A 2ZUQB 1GAFL 4ZFGH 3O4LA 5IQ9B 1TTUA 4LQ1A 1GGTA 7CGTA 3TBYA 2DQDH 2HTLD 4XPAH 4NNPH 1CG9B 4PRPA 3RWCB 3PL6B 4ELMF 3BYYA 4L3ED 4XBPB 4WHTA 5F8QC 2IC2A 3WXWL 5ERWA 2ZUQC 2P5ED 1FVEB 3L5HA 3S36X 1WSST 2EIZA 4GRMB 4WIQA 3BO8A 1OM3H 3PL6C 2EC9T 2XTJE 1NFKA 4RDQF 5SWZD 1P53A 5LWYL 3SBWC 3DTXB 3LQMA 5E08L 3QR2A 1HQ4A 4A2MA 5CJXC 2G2RB 2ICEA 4DGYH 1AJ7H 3HI5L 3AMLA 5CZXC 2H6PA 5E2VL 1RUQH 5E6ID 3QCUH 1PEWA 5BW7A 5C9JA 5GGSA 4XPTH 4N0YH 2B0SH 3FZUC 5T1KB 2DL2A 2XQYG 1K2DB 1RIUL 4HIHA 4HH9A 2DMBA 3N0PB 2YPVL 2E5EA 3ECBB 4P49A 3VFWA 2AAVA 3MLWH 5KOVC 2WNGA 2Y5TB 3DPBA 1J8HB 1ED3A 2VYRE 4XMKH 3PNWB 1T80A 25C8H 3RWEB 3VDAA 3GMRA 4BQCA 2NZIA 2YPKB 3GMLA 3ULUH 3BHBA 2ZOKB 3D39A 4RZCB 3VG0L 1DSFL 2EDFA 4PFEA 4UNTA 5D2NA 1NLDH 4WFED 1ZHLB 4X7DC 3BX7C 5D7LD 2NXYB 3LH2L 4NQCA 4M62L 4WW1B 3W0WB 1TCMA 4FZEL 2W0LA 1PQZA 1KLUB 3WNKA 4ODHH 5ALCL 3G6DL 4P46D 2AERT 2NTSP 5FV1L 3SDCA 2NXYC 4J6RL 3C8DA 4LLWB 3O3AA 5E8PA 1H3PH 2NPLX 3ARTA 2KPNA 4XRCA 1OD7A 3DSFL 3WHXA 2J8UE 4W4OC 3OJDB 4EIZC 5JORB 3UYOD 2CJUH 4R4ND 4TRPL 1DDHB 5DJZB 2H1PH 1CWVA 3O6MH 4CVWA 2VUOA 4NHCH 1JTTA 5CJQH 4ZAKA 1ZEAL 3SEPA 3MC0A 4ZYKB 5IG7A 1MCHA 2E27L 4ONHA 4UUJA 2Y72A 1QFWL 4GRLB 1F4HA 5CJBA 4Z7QF 2VLJA 3VDBA 1RZ8B 1L6XA 5DLMH 3VD9A 4O5LL 3W5MA 4FG6C 4G8EB 4ALAL 4XAWL 4X0KA 3UPAA 5D8JH 4JFDD 2FSEB 5F7WC 1MFDL 4FQCL 1RURL 1ZHBB 2Y06H 3RZCB 4GRLC 2YRPA 4YHZL 1DLHB 3DX7A 2NY1B 1YYMH 1H3XA 2Z0BA 3P9WB 5FYJD 1ZLUH 4N0RA 1AGFB 6FABH 4OCYH 2D03H 4ENEC 5HYIA 4YE4L 3ARWA 5LGHL 1OAUH 3GJFB 4WEMB 2XWJA 3LS5H 1OVZA 1IC7H 1MOEA 3RZCC 5JA8B 4HWZA 2Z31A 2B1AH 1NBYB 3HA0A 3TBTB 4C83B 4XHQA 5HHVL 43C9B 3JV4A 5E5UB 4ZUVB 5I30L 3U0TB 1NAMH 1FZJB 4Y16D 4UT7L 2XQBH 4K8RD 5HI4C 3BH9A 3WIHA 2ZUVA 2BVQA 4ZO7A 3CVHL 3EHBC 4WY7H 3DX8A 2FBOJ 4YGVB 3SKOB 4YXKL 4LLUA 4EJ1C 1BQSA 1MY7A 4FOMA 4DZBA 2R1XB 4Z7VA 5KTEH 1A7PL 5TQ0H 4GW1B 2AKRA 5TDOA 1D5MB 1QUNA 2WW8A 3BQUB 4WWKA 4U6VH 1BD2D 4R97B 5DT1H 3ROOB 1KENH 12E8L 1HHHA 1MJJA 2R0ZH 3CLEL 4G9FB 1YPZE 2KDGA 1DQMH 3ARDD 2DQFA 1QD0A 2EDBA 3UTSA 4P2YA 1VACB 4XCEB 4JRXE 2UZXB 2Z93A 2FEEL 4JJ5A 4UU9B 3RWGB 5I16A 3JWOH 2OZ4L 3TZVC 1WEJH 2CK0L 3BQUC 3HB3D 1CI5A 1F42A 4R97C 4WU7B 2J8OA 1RIVH 4XGZA 3LZFL 4UTBH 1CGYA 1JCKA 4C54A 5EU6E 1NJ9B 2AK4B 5E2TL 5IK3A 1I9RH 5IW6B 4Q9RL 4YZFE 1E6OL 2Q8BH 4PJ8D 5E99H 5DS8B 1GYAA 3QEUA 1WZ1H 3PWPE 3HAEA 1FZKB 3MREA 2DN7A 2V17L 5ESVB 4L3EE 1CD0A 1QBLH 4NQEB 3OKKA 1X5LA 5FB8B 4M48H 3H3PH 2IADA 3VJ6A 3OXRA 2P5EE 1UB6B 4FXLA 1YNKL 2F53B 5ESAB 1F90L 4WU5A 4NRZA 4HHAA 1MRFH 1UT9A 2FX9H 4MQ7A 3UZVB 4P5TD 2F5AL 1FNGA 4XVUC 3CCHB 5SWZE 5I1HH 5EBWA 4F37F 2VLKB 3GSNB 3UBXB 3B2VH 4CMMA 1UZ8B 1B0RA 1QRNA 1LMKA 3BZDA 4P0DA 1WGOA 1LP9A 3Q5TA 4LKXB 4OKVB 5IEHB 4F2MB 4P2QA 2X4QA 2CIKB 4MXQD 4AL8H 5DJ0A 2A9NL 4OD1H 1OQXA 1CFQB 5K9JL 4DCQA 4KVNH 3O3EA 4KMLB 3FB6A 1KT2A 3I50L 1JFMA 1EXUA 1GGCL 1HEZB 3K80A 4LSVH 3UXFA 2FO4A 5DFTA 1NCDL 4F7MA 1KIQA 5FUCC 3BMVA 1YECH 2QSTA 3VXOA 1EJOH 4AT6A 1ACYL 2KH2B 1AH1A 5FO9A 5KG9B 1WZLA 3VWJB 4XVJH 2JB6A 4U33A 5EOQH 5SWQA 3OKLB 5TDPA 1JZ5A 1CL7I 3CC5A 5DYOA 3L3KB 2R4SL 5I19H 5HHXL 1P4IL 2M26A 1CE6A 3NCJL 3VWJC 2OL3L 2VISA 3KYKH 2XICA 3HE7D 3TN0D 3BKMH 4QO1A 1P7QB 3ZHDA 1OPGL 1XZ0B 5CS7A 4NQDE 3P4OA 2DQUH 1UWEH 4P99A 1JIBA 3WFBL 1EAPB 3OKMB 5EFIB 5C7XL 1I85A 1XF4B 3BGFB 4WHYH 5JXED 2ZPKH 4QWWD 2EDNA 5TDNB 4NPYB 1CFTB 1Q9WA 4G6AD 4ZS7L 5ADOH 1JPSL 4HD9A 2F9BT 1UXSB 5HHQA 1PW3A 4KQ4L 4DUWA 3BGFC 4HZAA 1MNUL 5E24E 4K9EL 4UT9L 1NGXB 1ZLSL 3GSOB 2W0PA 1YUHA 6CGTA 3MLYH 1ONQA 3PL6D 4M1GH 5C0AB 5I17B 1GPOH 5D6DA 4Y4KA 4RFOH 4OUUB 2F5BL 2P24A 5EO1B 4F8TA 1QSED 3FQXA 5ID1B 2WUBL 3MCKB 2ITDB 2FGWH 4R96B 1OW0A 5FYJE 3D3VD 2HAZA 4HUXB 5DRZA 4ETYA 1FL5B 2BY0A 3V6ZB 2ZZUT 1H3TA 3OXSB 3OJVC 3K4ZA 1KCGC 3ZTNH 1RHFA 3QEQA 1KJ2B 3P9LB 1A7QH 3FRUA 3P73A 3BMWA 4X99B 1FJ1B 2JB5L 4F7PB 1R6VA 3BP6B 1OGTB 1HH6A 2MOVA 4U1KA 4AMKH 4OI9A 1BGXH 1OSZA 3TYFA 2OK0L 3QQ3A 3IVKB 2F58H 5CLWA 3VWKB 2Q8AL 3MV9B 4NO0A 2BNUA 3C09B 1X5AA 3OAZH 3QUZD 2PTUA 3HN3A 1I9EA 1G7HA 4UV7H 1DQDL 3ZTJH 5TQ2H 5EH1A 1J0YA 4NIKB 1ZLWH 1DBBH 5EUOB 3NCBB 1KPUB 3BT2H 4NJ9L 4LVHB 5GSRA 3TA3C 3VWKC 1IFHH 3C09C 3RWDA 3OV6A 1JHKL 4MAYA 1R3JB 2Y07L 3WLBA 3DV4B 1KJVB 3SE4A 1GC1L 4D0CB 1QHOA 2PTTA 3IXTB 3WN5A 1A4JB 2XKNA 3BZ4A 5C09A 2DTML 3HE6A 1N4XH 5ANME 2BSTB 4RBPK 2JJSA 1MIEL 3NAAH 1YEDB 4NGHL 3LRSB 2OTUB 1MFBL 4LVHC 2IPUG 1FAIL 1HOCB 1DUZB 1WT5A 1J7VR 2ZCKH 5F3BA 4G42B 2ZKHH 2RIKA 4AENA 3T8XB 4JM2A 4U6HB 3B2UC 1MHCB 2QV2A 3W0WD 3SQBA 4E41B 4S1SH 4Z7WB 4HKZA 4IOFC 1F02I 4OZFG 1XCTA 5F7DA 1IAOB 5IM7B 2BSRB 2R2BA 4F80A 1UM4L 2K7PA 4FFYH 3ROLA 3QQ4A 5L2JA 4LF3B 3Q3GA 4Z5RA 3VFTB 5FM5M 4M3JA 2CD0A 2VXUH 3AM8A 2ZG1A 4M3KB 3SDAA 1XGPB 5C0CB 1BLNB 2XRAL 3H42L 1S7QB 3NA4A 3FQTB 4XI5D 4I2XA 2J1KA 1JTOA 2MJWA 3UEZA 3NIDE 1R5WA 1F4YH 1UJ3A 4Y1AB 3KPOB 5DD5H 2QJDA 2DQIH 4FFZL 1V3JA 4L8SB 1P2CA 1U3HC 5ISZD 4HFUL 4WGWB 2ZOLB 3GSWB 1NGWA 4ZXBB 4NM4L 2C7UB 4YDKL 1IGFH 1E4WH 3MSPA 4I8DA 2ORBH 5EIQA 4PB9H 2X40A 2CIIB 1T04A 5D72L 3OHXB 2Y7QB 2VRAA 2KKQA 4JFFD 2A6KB 4L8SC 3UTPE 1R3HB 4L4VA 4ZXBC 3EGSA 5F21B 1WCQA 4HUUB 2NYYD 1MWAL 3L7FB 5KVEH 3KLSA 4M7LT 1RY7B 4FABH 2R1YA 2GJZB 4G6ML 1LK3L 3CVHA 2D31A 4LSPH 3BWAA 3RX5A 3EAKA 5JIHA 2EKSA 4KMTH 3L5IA 2CQVA 4HS8L 3L3OB 2J4WL 1WF5A 2HLFC 5IMOB 4FXKB 5E8NA 3SKJH 4DEPB 5E2WH 3QFJB 4HUWA 3NFSH 3FB7B 1JPGB 3Q1SH 4MCZB 2EH8L 3KR3H 4Z95H 5IIEA 1OTSD 3VXTA 3QWRA 3E6HB 5BCAA 3FOLA 3CFCL 5AD0A 1U8LA 2P8PA 1G84A 3JWDH 5DMKA 4DEPC 1KYOK 1QO3B 1RUAL 4P48A 2IQ9H 1UCTA 2A6IA 2ZUXA 4X9HA 1JF1B 2ZCHH 4QHUA 3WJLA 2VMFA 4LEOB 4RAUB 2QADD 2OZ4A 4K3DL 4NHUB 2G5BA 3S35X 1I8LA 3TZVD 1QFOA 3OR7B 1R5IA 1N5AB 3I3BA 1CGUA 5BZDB 3EJYD 5IMLA 1BX2A 2VO5A 1HDMB 2Z8WC 5GS2H 5KVMC 32C2A 5KN5B 3RIFK 3U30B 5T33H 1QSFB 4RGNB 1WWWX 1FDLL 2XIDA 4JFPA 2EYRB 1OQOA 2AJYH 4NFCA 1AGEA 2UWEB 1VADA 5L88L 1MUJB 4LIQH 3GSXB 2Z35A 3QBTB 4QXUL 5EOTB 5GSVA 5IEKB 5DURD 3QUMB 4QRSB 4QRRD 4U05A 1AXSA 2J6EL 3U30C 3GHBH 4V1DD 3SDXF 1FYTA 3GBNL 1U8JB 2OXGA 2VLRA 5HYQA 3U79A 3R0MA 4XVUD 1U36A 2X2YA 3QWOB 3TBVB 1OTUD 3STLA 3L6FA 4BK5A 4R90L 2CH8A 4HT1L 4YAQB 2X4OA 3MRFA 4NRXA 3M8OL 2GITA 4XP6H 3RU8H 5IHLB 5GRVK 1A7NL 5JR1L 2BVPB 3UJTL 2DIBA 4FQ1H 1BWWA 2FEDD 2VABB 3JZ7A 4HUNB 2Q7NA 4TVSa 5DHVA 5A1AA 1JWMB 4Q7DA 2A38A 5GIRA 3VFSA 4GMSL 3MRLB 1BIIB 1N2RB 4J4PD 1S9WB 1A3RL 2QEJA 3DX6A 1U93A 4M5YH 2BMKB 2ARJA 1OGAB 2Q3ZA 3QUXD 2R15A 1I9JH 4BSVB 1QEWA 2WP3T 5B3NA 4FQQB 4JVPA 2BNRA 3IDYB 1LQSR 1P6AB 1YNLL 3OKDA 3MV8A 4ZUSA 1K4CA 4KFZC 1A3LH 1TZGH 4GMTH 3VFMA 5MERA 5IBUG 1XGQB 4C59B 4KAQH 3LPGA 4LSSH 4Y4FB 5IQ7H 2XZQL 2PYFA 3BXNB 3EYSH 1WBYA 3JXAA 4LCWB 5KW9H 5EIVA 3V4UL 3DROB 1YEIL 3GM8A 3WS3A 3MFGB 2Z8VC 4X6BB 5J9PB 5KVGH 5E08H 1I8MA 5CSGA 3T0WA 5I1DB 1KB9J 1P7HL 4A6YB 2KBGA 1P7KB 3W0WE 1U6AH 4AEIH 2VZOA 2QHLA 4FQ2L 4BUGA 3LEYL 3MLSL 5AAMA 5IFAH 2YD1A 1N7ML 3ZE2F 1DE4B 4FHBD 3RTQC 2EDXA 2J5LB 2XG5A 1H0DB 3HPLB 3L3IB 4JFZH 1S5HB 4H88L 3NZHH 4GOSA 4QRQB 1MCCA 1KTKE 1RV6X 2MMXA 4LU5L 1WLHA 4O00A 5FXCH 1IGYA 1WAAF 2E9BA 3E6FB 3FAWA 5HYSG 3NCCB 2HFEB 5J1AB 1RVFL 3O3BA 1T4KA 2P43B 3BW9B 5DK0A 1U8MB 2AXGA 3MRPA 1UFUA 3BISA 3BOVA 2HT2C 2PW2A 4NNXA 5A2KH 1X6NA 1BJ1J 5I1KL 3I02B 3BIKB 3IDIA 4Y5XB 2WUCL 3QDJA 1JZ2A 1IM9B 2EH7H 4RMQA 1K5NB 2VR4A 4ZNEE 4P2OA 4LBEA 3SGEI 2AW2A 1NC4B 4P59H 2HH0L 3PHOB 3BRDA 4Y5XC 4OZFA 3RVVC 1UVQA 1MLCB 4QY8B 3VMPA 1YDPB 5IR1A 5F96H 3X14A 2HTKC 4OF7A 3U4BL 4PJIB 1I3RB 1A1MA 4NUJA 3MRNA 2EIDA 4Y2DB 5F6HJ 3RIAK 2ZJSL 4MAUH 1K6QL 4I3SL 3S3SA 3CFDB 3NN8B 3TA3D 2P45B 3OJMB 4OQTL 4ELKB 4LQFH 5F97E 1GGIH 5FYJL 1UH4A 4LPCA 2R2EA 1KPRA 4WI4A 2YA0A 1I9IH 4Y2DC 5AYQA 2RHEA 5E70A 3V4VL 5T1DL 4XNUL 4JG1L 1A2YB 1NUFA 2HT4D 2DWDB 3U9UB 2I9TA 3MLRL 3QCTH 3SGDH 5J06A 3H9SA 1H3GA 3OSKA 2DOCA 3UAJD 4YHNA 4AIZA 3V5HB 3JVGC 2FYYA 3B9AA 3K2UH 1M7IB 4K8RL 2GJ6B 4G9FE 2P5WB 2X4UB 2NQCA 3TO2B 4UNUA 5C70A 3FONA 3MRBA 3HMWH 4MB4A 4MD5A 1MCBA 5KOMC 2D7NA 4WJ5B 4URTB 3QNYA 1AHWA 1Q0YH 4GW5A 4PR5A 5JLZB 4E41D 2JCCB 1I1AB 2AK4E 3GNML 3CVHH 3PWLA 3ARFD 4TULH 4X80H 8FABB 4RNRA 5JW4R 4QCIB 3DSNA 1ZHNB 1N0XH 2LV4A 1R3IL 5CUSH 1HYRC 1QBAA 5HPOA 5DEFA 4KGLA 4F3FA 4OD3H 5TH2B 3RL2B 1U3HD 1KIPB 4DN3H 4KROB 1I1AC 5D7SH 1J1OL 4IMLB 4F33A 4TQEH 5JHLL 3MLUH 1FE8L 4NQEE 3WIFA 2DQCH 1EMTL 1HCFX 4JFQA 4JHBA 3WMSA 4JAMA 1AKJD 3EZ8A 3PIQA 3QQNA 2F53E 1MAJA 3CXDL 4KROC 3QRGL 2GSIA 2D2OA 2DD8H 1UZ6E 4JRYA 4LP5A 2B4CL 2VLKE 1A1OA 1E27A 3CLFH 1ITCA 4OJFL 3C2AH 1BJ8A 1O7VA 2OZ4H 3GI9H 3S96B 1NL0L 3B43A 1UA6H 1F97A 5FYKH 1E4KC 3B5HA 3UPCA 4WI2A 4U1SB 1ZGLM 3MLXL 4HBCH 3EFDL 1MRDH 1SYSA 5GRYA 4Q9RH 1T03L 1E6OH 3RWJB 5FA4A 5FUCE 3QDGD 3HZYB 4Q2ZB 4G9DA 1A22B 1AC0A 2HMIC 1TVBB 3FO1A 5EBMA 3EYFB 1FVCB 3F7VA 1IARB 3GIVA 5GHWH 4WEBH 5HGDA 3VGAB 3VU2A 3WFHA 2F19L 4WI8A 5E8OB 4JG0H 4JVWA 3AXLA 1PAMA 3LAFA 4R4FH 3WEXA 3MNWB 5I15L 1RULL 2IANA 2LFGA 2F5AH 4KGJA 3UZQA 5EZOH 3B9KB 4HWBA 3V8CA 5GZND 2EYTA 3VGAC 3O11B 5KSAD 3UO1L 5HHOB 3IETA 1WFOA 3EOTH 2VR9A 5CGYD 2GW5A 2DQTH 4F58L 2ESVD 3HZMA 1G7LA 3RRQA 4L8CA 3P0YL 4WV1A 3EYVB 1U8HB 3K2MC 5C9KA 1OAKH 1S7RB 3B9KC 4QTHA 4EI5A 5JNYB 5I66B 3QA3A 2Y6SC 4X5WA 1BPVA 1GZQB 3G08A 2CKBH 1AO7D 4OZHB 2D7MA 3LKQA 1CF8H 1LWRA 1CU4H 3RVUC 3H0TB 4D3CH 4XNQB 4OI8A 3ARYA 4I0CC 1CFNB 3TFKA 1WCBA 4PJHA 3UC0H 2E7CA 5K9OA 1BEYH 2B1HL 3SDDA 5C0RH 4RIRA 4KJQD 3FQUB 4HC1A 3MUHL 2IPKA 4PG9B 1CGTA 1FCGA 4J2XA 3K4AA 1G9NC 1ZA6B 1U9KA 2R4SH 4P4RB 4RGOH 3VXSB 5C0AE 4NRYB 2OX5A 1QKZH 4U1LB 1CDIA 2OMNA 2ZSVA 3O9WB 3WNOA 5T3XD 2FB4L 3CSYB 1F3DH 1OPGH 4IRJD 4CN1A 5TE4H 3PWNB 3VGBA 3R0NA 3FT3B 4XCCH 3S36L 4KHXH 4MMZC 4RRPG 3OZ9L 1MJUH 3QHTC 1IAII 2CKNA 3O9WC 4PGZA 2OSLB 4IMKC 3P4LA 3G5XB 3Q6FA 4HF5L 3TJHC 4KUCD 3O6FA 1OAZH 4NQTA 4WO4D 3O45A 3F6IA 4DTGH 1CFVL 1OARL 4QXGH 5D4QA 2DDQH 1Z9MA 3GIZL 1FLRL 3HNSH 1JGVL 1KIUA 4JKMA 1LNUB 1IM3B 1WK0A 3MV9E 5E6IA 1B0GA 4K9EH 4PBVC 4UT9H 1HN1A 3SGJA 3GKWL 5HYSA 1WWBX 1G9MH 1A14H 3C5ZB 4MVBC 4O4YH 3IU3B 3ZKQD 3U6RA 5I76B 3KPPB 4KI5F 1YEKH 5EUOE 4YFEA 5H8DA 3ARXA 2WUBH 1Q0XL 2L0DA 3AY4A 4JFOA 3R1GH 5IMKA 4PY7B 3C5ZC 2VXTH 5DD6A 1HIML 1W0WA 4HIIA 3MODH 4L3CB 5DHYA 3TC9A 4ZO9A 1FO0L 2NR6D 3OAUH 3J8F7 2JB5H 4OB5H 5A2FA 3N1QC 4BSWA 1ND0A 2FGZA 5L9DH 1TTFA 4XNMA 1D5ZB 4HBQA 4X5XB 3RTQD 3ZDXE 3JUZA 3D2UB 1PZUB 3HR5A 4BYHA 4QTIH 1CD1A 4GG8B 5DFWH 4OZFH 4E41E 1SBSL 1NBVH 4YIQA 4Z7WE 2Q8AH 4FQJL 2FO1A 3D18A 3KNBA 3TP4A 5DK2A 1CT8B 1Q72H 3B6SA 3IFPA 5EO0A 4YWGH 3HI1B 4MXVE 4N0UB 4GKZA 3EDFA 5DJCB 3HMXA 1JHKH 2HT2D 2YUVA 3WFCL 1S9VB 1NMAH 3CZFB 3U2SA 4LNRB 4XBGA 3IJYB 5FCSH 3CDCA 4Y1AE 4UV4L 3K8MA 1G7MA 1MFBH 3PQYB 2H26A 1FAIH 1TENA 3KLAB 2K1MA 4MDIB 4C56B 4JDVB 2V2WA 3K74B 2YKLH 2YD7A 4ZOEA 4IHOB 1VESA 5D1QB 2IAMA 1CDCA 2XA3A 3T3PF 2VDKH 1NBZB 2HTKD 3MLTA 1LK2A 5HYJD 5L7XH 3O2WH 1T3FA 4JFDA 3JUYA 4M61B 3ES6A 4NBYB 4HXBL 4PV9B 4TYUA 5D1QC 5KSBA 2VLMD 5GGVY 1HH9A 5B8CB 3U46B 1HHGB 4ZQKA 2ED7A 3P77A 4MJ4A 1LO3H 1LDPL 4U4BA 4X8XA 4RMTA 4XCNB 2UZIH 1SYVA 2R0KL 1KN4L 3FO9A 3GBLA 1Q9KB 5GRVL 2P8LA 1BZ7A 3DIFB 4R7NB 3RVXC 5B8CC 3QFJE 4TUJB 4OM1H 1ORQB 3BP7B 4AJ0A 5KZCD 4XBEL 3VXNA 4KJYB 2GYSA 2IH3A 4MQTB 3PGFL 4MZ2A 2C1OA 4YDKH 3AREB 2XZAL 2F54D 4Y16A 2ICES 3KPRD 3LKNA 2R56L 3P2TA 1D7FA 2ADJB 5D72H 3HUJB 3GJEA 4ONFL 5FK9B 5HHNA 3TNMB 1CQYA 2CLVA 4NHUE 4GLRI 5DRXA 3AREC 4LLVB 2W65A 4IRZH 2FX8L 5DRWA 1MI5B 4G59A 5AYUH 5E0QA 1SJEB 1UM6H 4D0DA 3RA7H 1AO7E 2BRRH 15C8H 3U0PB 5L6YL 1GHFH 4XXCC 1CFSA 1F2XK 2HJLA 4HIEB 4PGDB 4X8JB 3ARDA 3LKPA 1QSFE 3QDAA 1ZT7A 4PGCB 4JCMA 1GGYA 4U1MA 4JFYA 3U7AA 2AS5M 4X9GA 2UWEE 5I0ZA 3FQNB 2DWEA 4RMRA 4I48B 4Q97A 4YDVB 1SJXA 1JWSB 3CFCH 3RUGE 2FH8A 3FQRB 3S88H 3QIWB 1T6VN 3H9HB 4HV8B 5EOCH 1T1WB 1JFQH 1WIPA 1NEZG 3KXFD 1EIBA 1PZ5B 4PJ8A 1YY8B 4Z7WF 1BBJA 4XT1C 2A1WL 3EOBB 5H94B 1KTRL 3QULB 5FFLA 3NACH 5FCUL 1IL1A 4G8IB 4HWBH 4PJAA 3E1F1 1T1YA 2A73A 3C60B 5GRWA 3O6LH 1OWWA 4MXVF 2W59A 2VWEC 3ILPB 3QEHA 1AQDA 3QDMD 4PYGA 3OF6D 4WCYL 1KXVC 5DJ2A 5F1KC 1TMCB 1U92B 3SKNB 1EVTC 3TNNB 3L95A 3VFPB 4HZLB 1XH3A 1R0AL 3C60C 1DQQA 5D7JB 1E28A 2FLBT 1OGAE 2NY3D 3VXMD 5HD8C 1MHPL 3FT2B 4LHUG 3OKNB 3C6LD 3LKRB 1ZS8B 2VDQL 5I1EL 4GRWF 1H8SA 4Y19A 1FGNL 3QPXL 4O2EB 3EOYG 5D7JC 3D25B 3ZSSA 3GSNL 3MTRA 4J8RB 3HHRB 2MKLC 5E8EA 5DUBB 2CMRL 4NQUA 3WFEL 2PCPB 1JGDB 1EO8H 2NW2A 43CAB 4HC1H 1I7TB 5EC2B 5D70L 5C1MB 3BN9D 3T4YB 4MB3A 3WHE0 1Y0LA 1JNNL 2VITA 3AROA 4XP5L 4WWID 4IRSC 4LCWE 1DQJA 3EOAA 1RJLB 1VEOA 3B9KD 1KCRH 2NMSA 4YHPA 3RPIB 3F7RA 1M71B 2Y6SD 4RRPA 5IESH 1VFAB 4MNGA 3SCMD 1KG0A 4NO5A 4PJEF 1EBAA 2QQNH 3BIAX 3HTLX 1IEAA 4NWTH 1A6UL 2E7BA 5J89A 3HE7A 3IF1B 1DEEB 4GH7B 5F6HI 4MSWA 2NY5H 3GSRA 3LN4A 2R2HA 3C6SA 4PRPB 4PRDA 1NCNA 4TNWF 3A67L 2AJSL 1EAJA 5D71L 4M1DH 5JXEA 5LXGL 4GBXD 1RUML 1JPTH 5CSZA 3NCFB 2EIZB 3T08A 5IT2L 3BO8B 4JO4L 1QRKA 3L3DA 1NANH 4DVBB 2AJVL 5SX5H 2IFGA 1XR9A 3FHAA 3FN0H 3KJ6L 1Z9LA 1XGTA 5JTWA 1HQ4B 2ICEB 2UWEF 4S0TD 3UTZA 1UKSA 2QTEA 4X7EC 3TJHD 5C9JB 5GGSB 5EZIH 1Y18B 4ZS6C 4K3HA 5TPWL 5E2UH 4JB9L 5GJTL 5D96B 4E5XA 2C4FT 1WIOA 3QSKB 3SGKA 1QSEA 1OSPL 2AV7A 5HBBA 1PFCA 1KCUH 3D3VA 4HK0B 4XPFH 5BW7C 5I1GL 4R26L 4PJIE 3LKSA 5GPRA 3LEXA 4MVBD 5D96C 3LQAH 3VFWB 4MHHI 4N68A 3UYPA 1XGYL 1ED3B 2X1PA 5JQHC 1BIHA 5F9WB 3O81A 3GMRB 1C5DB 1JGUL 1LO2H 3GMLB 1PY4A 2JELH 2YUWA 1JK8A 3OL2A 4OCXH 3HMXH 1EK3A 3D39B 1JNHA 3TYGH 4KVCH 3SJVD 3QEGH 3R06A 5D2NB 4PP8C 3LKOA 4ZPTA 2XTLA 5IB3A 3QUZA 2EE6A 5F9WC 4XP9L 1I7RA 3ULVC 4LSTH 1MIML 4OF6A 4BH8A 3MYZA 1J87A 1RZKH 3DURA 5D2NC 4XCYB 5KSUB 1PQZB 3RI5K 1FG2A 2GJ6E 4NM8L 2P5WE 2CDGA 1W8NA 3GMMA 4AM0A 2HKHH 2WP3O 3UJJH 2BOBB 2A6DA 3SDCB 1RZJL 3FFCD 1DBJL 3O3AB 5E8PB 1T7VA 4XRCB 3WHXB 3LRHA 4LDLB 1KJ3H 1OCWL 4YBHA 1RPQA 3MRKA 4Z0BL 5GS3A 1QBMH 2OQJA 2JCCE 1T7WA 3VFUA 2H41A 3VFGL 2HG5A 1L8JA 4J3WA 5T1LD 4ZAKB 3SDCC 1RHHA 2EDEA 4OF5A 5IG7B 4JR9L 4ONHB 4UUJB 5LVEA 1JF5A 1A6WL 5CD5C 3FMGL 4XCFL 3V4VH 2DKMA 2VLJB 1T66C 3ULUD 3RNQA 3MXWH 4JKPL 4PLJC 4NOBA 3UTTA 3O2VL 4KK5C 4JQVA 1E4XI 4GXVH 4ZAKC 3ZSTA 1KELH 2A77H 2K9UA 3U48A 3CFBA 4I1NB 4K07A 3DX7B 2BOCA 3N9GL 4X7FC 1CR9H 1FNSL 4LSRL 4YHOL 5I1LB 5FO8A 1NH6A 5CKGA 1K3ZA 2XWJB 3UP1A 2Q87A 1VA9A 4HWZB 2I5YH 3O0RL 4MXWL 5ISZA 4X6DF 4XNYL 3JV4B 4S2SA 2BHYA 1S5IH 2YOCA 4XMLL 3P30H 2GCYA 3NCYS 3BH9B 1KGCD 2YMXL 2Z31C 3OWEA 2BVQB 4JFFA 3DX8B 4MD4A 1YEJL 4OFYA 5T3ZH 5IB5A 1MCRA 1O7SA 4LLUB 5SX4I 3AAZA 4XNXH 3VD7A 4OCMC 4D8PA 4BZ1L 4DZBB 3MGTA 4QHLA 4Z7VB 3M1BA 2NY7H 3QXDA 1NEZA 4I0PD 1X7QA 2FRGP 2H2PD 2AKRB 1MCOL 5TDOB 3T0EB 1AXTL 1NMBL 4D9RE 4WWKB 4F7TA 3EIFA 5ITBL 3ARED 4YX2H 1HXMA 5D1XD 3GMQA 2YBRA 4WEUD 2DQFB 3UTSB 3S98A 5H35B 1I8IB 5HHOE 1CQKA 5I1AA 5I1IH 4X6CA 1IQWL 4JJ5B 2X1OA 4WWKC 3ZT5A 5F71A 4XGZB 2XXMB 3NFPB 4YXHH 3TJEH 4XWOC 4TNVK 1UYWL 3S35L 5IKCA 3A6CL 4IDJL 2SEBA 4PREB 1JRHH 1TJIH 2CUMA 3DV6A 4LHUA 1Q9LA 4OZHE 1FH5H 5B38G 4YQXL 2UYLA 2LU4A 4U7MA 3HAEB 1UM5L 2N1KA 2V5MA 3MREB 2OS7A 5DQDH 4YC2B 3SDYH 5DSCB 2J12B 1PKOA 2QR0B 3E2HA 3OKKB 4JGUA 1M4KA 2AV1B 2HN7A 4POZD 5JPMA 2IADB 5D5MA 3VJ6B 3OXRB 2P42B 3T0AA 4GQ9L 2WLZA 4U1JA 4G43A 1YYLL 4NRZB 4HHAB 4JPWH 2AEQH 4MQ7B 4N0FA 4YC2C 1L0XA 3ZKMD 1EGJL 4DZ8A 2WIIA 3CH1B 3KYOA 1FNGB 1XAUA 5EU3A 5EBWB 3VXSE 4HEPG 5HYFA 1B0RB 2DQJH 4ORZC 4JY5H 4N8CL 4QRRA 2JCCF 5IB4B 1MRCL 3MJ8B 5ALBH 2H32A 2YN3A 4V1DA 1F8TL 2MWCA 5DR5L 1GCFA 4XC1H 1ETZB 4N5ED 5JQ6H 5IVXE 2MPAL 4P2QB 2X4QB 1BOYA 3N1GC 5JO5A 2IPTH 2R1WA 4H26A 2O26U 3QUML 4DCQB 1KT2B 1NCBH 4FRWA 4PJ5D 1DR9A 1EXUB 4HH8A 4HK3N 4YEEA 3DXAD 3MBXL 4KJWD 1HZHH 2WIMA 4ZD3L 3T77A 2HT3D 4ZFFA 2CUHA 4HXAH 3BEVA 3CX2A 5FGSA 3VXOB 4J4PA 5T3XL 5T5NF 3V7MA 4P4KD 3LOWA 4K7FA 4IIQA 5FO9B 4QNPE 2JB6B 3QZWG 3FFDA 5SWQB 3BAEH 3HC0A 2AQ3A 2OBGA 3QUXA 2PO6D 4XWGH 1QR1B 4OZIA 4TSBL 4IRSD 5DYOB 3CC5B 4LAQL 1MFEL 3TLRA 3MGOB 3FO2B 3SKMA 1ULVA 3PXHA 4KK9D 4OGXL 1YMHA 2RB8A 3W39A 2FHCA 2ITCA 4OGZA 2VISB 5DJXA 3ET9F 3S36H 1ZLUK 4XPBH 1UACL 4OCRH 4NZTH 4ELMA 5EULV 2EXYC 1PG7W 5LGJA 3LPFA 1RJZB 3SY0A 4KTEH 1VB9A 4KRLB 4YPJA 2FWOA 3P4OB 3BKYH 4J7RA 4W68A 3MOAH 5I18L 1TETL 3WKMH 4PDCE 4U6XA 5LAXA 3VMNA 2DQHH 3AS1A 5IROC 4JPIA 4XPHL 2O5XL 4PRHA 1URLA 1HE7A 3ZYJA 1LEGA 3DUUB 5MI0B 3DX9A 3FQWA 5HHQB 4M6NH 1I85C 3MV7D 5HVHB 1DUYB 1NGQH 3IXAA 3O4LD 3RI5F 4JEGB 1AIFA 4KK8D 4N0UE 1YUHB 4XTRD 3H7LA 4M6AA 1ONQB 3V6BR 2QQLL 1ZHKA 5IB1A 4Y4KB 1EHAA 3EJZC 5MI0C 2P24B 5E56A 5HVHC 2VXQH 3FQXB 4OFPA 3IJHA 5EPMA 1MVUA 3QIUA 3NCYP 5DRZB 5B4MC 3HS0A 1TNMA 4HIXH 4LEXL 4ONOA 3V52L 3PQYE 1IGIH 4HPOL 5D6DC 1T2QL 4C56E 4Y4KC 4PRBA 5C3TA 1ZANL 3QEQB 1FGVL 3P73B 4X4ME 2P4AB 1QLEH 1HSAB 1X4YA 1HH6B 1OW0C 4Z18A 3KWWA 5I1CL 2WMPA 1DFBL 1OSZB 3TYFB 2XKSA 3U7YL 3MACL 4JO2L 5FDWA 3GK8L 2YUZA 2MCG1 3MGAA 4QHNA 4K7PY 4NO0B 2BNUB 4WFHE 3GB7B 3OB8A 2XN9B 3ARVA 3N85L 2F74A 1MPAH 1A3QA 2Z4QA 4GKSA 5DUMH 3BD5A 3HCVA 4ODWA 5GSRB 4CKVX 4GQPH 4KRPB 4OLXL 4MAYB 1LE9B 2IMNA 3WLBB 4NBZB 3CXHK 3MNVA 3EJJX 2PTTB 3PWJA 2HVKA 3C5JA 3HE6B 3BJ91 5TE6L 3RY6A 4CVZA 5LBSH 5F6IB 3KYMB 5CILH 2E9IA 4KRPC 4MAYC 3HUJE 5F3BB 3SE4C 1K4DA 4BA8A 3RGVA 4AENB 4FQPA 2HP4A 4OSUL 4YO0B 5IHZA 4NQCD 5M7QA 3HE6C 1AY1L 4JM2B 4M5ZH 5CIPA 5F6IC 2JJSC 2OXHA 4OCLC 4GFTB 1VGEL 4HKZB 4WI5A 1QSZA 1XCTB 5F7DB 1MI5E 2R2BB 2EDJA 1WT5C 1LDPH 5FHAH 3QQ4B 5BVJA 4YH6A 4JM2C 5K33A 4PJXF 4NZUH 2A83A 3SDAB 3GGWA 4ZMAT 3ZT6A 3U7WL 1T66D 4PTUB 3DVIA 2R69L 4N0CD 4KK5D 4FFWD 2CRZA 5DXWA 3QXAA 2IALA 3AM8C 1H5BB 5J6GA 2W9DL 3SDAC 1KXQE 3UROR 1P2CB 1U0QA 4TNVF 5DGRA 2VQ1A 1ZSDA 1NGWB 3PGCA 3IFLL 3OBAA 5DWUH 4QRPA 3ARFA 5DC9B 2XV6B 4K3JH 3QHZH 3V5KB 4D9QE 2VWEE 2R0WL 2PYED 1X5YA 1MCDA 1T04B 2WM0A 5D9SB 4KXZI 1OP3K 1NMCC 3VFNB 1JGEA 3U9PL 5DF0A 1T5WA 3O2DA 2YEZB 1A21A 3GBMH 3PABA 3ZE1E 4KKBC 4HWEL 4JDTH 5I8OL 4U1IA 3FCTA 1AKJA 4XP1L 1TTGA 3LHPL 2FATL 3CVHB 2Z31D 3ABZA 4KKLC 2D31B 1CLZL 1JN6A 3TH3T 4X4YA 3BWAB 1M1SA 5B38A 2EKSB 5I8KH 4YDIH 5IF0A 1X5FA 4NWUL 1CLOL 5AG9A 2NTFA 4TSCH 1KCSH 5JZ7D 4HUWB 1I8KA 1MJ8L 1MAML 4NP4H 5IIEB 3VXTB 5D6CA 2GFBA 2IG2L 3FOLB 3FB5B 1U8IB 1U8LB 4QYOA 3BSZL 4FQIH 3TCXA 5CJOL 4LP4A 1MEXH 2AI0L 3QDGA 2KZ1B 4U0QB 1FIGL 5EORL 1CDGA 1GSMA 4QHUB 1KEGH 1D5XA 3B5TA 1DBAH 1U8QA 2EE3A 4W81A 4PRNA 3UDWA 3C87A 5IMLB 4XWOD 5A16A 2H32H 4OLYL 4HPYH 3WJLC 3NBNA 1QBBA 2DBLL 1JYNA 32C2B 5BRZD 1O5DT 1MHPH 4JFPB 5KSAA 1AGEB 3RJDA 1VADB 2VDQH 2MFNA 3LPWA 2ESVA 4QOKA 3UYRL 3OAZK 5GGTL 2EDTA 1EPFA 4MA7L 2Y36L 1DP0A 1AFVL 1AXSB 4N9GA 2EIEA 3BP4A 2BY3A 3QZWA 2VH5H 3HLAA 1EGJA 4PRPE 1DQTA 4S10A 1ZLWK 2DB8A 3LEVL 5D70H 5GXBB 1FFNA 3EO1A 3L6FB 4E0RA 2X9YA 4JPKH 4L5FL 5C0GA 5K59E 2X4OB 5C6WH 3MRFB 4OCSL 3CU1A 4NRXB 4WI9A 3DRQA 1LE5B 3G5YB 3RWFB 1BQLH 3QISA 1FV1A 3X12A 5DHVB 3BN3B 2YD6A 4NQXA 3D85B 3F58H 5E9DD 1QRND 2WQRA 4NFDA 5DD3L 3TGXA 3X17A 4WVRA 4RMWA 1QFWM 1U93B 3BKJL 3G9VA 3PP4L 4LSUH 2LAAA 4LLQA 1QEWB 1GIGL 3DECA 5HY9A 5CD3A 2BNRB 3EFFA 4IRJA 4HUVA 3PP3H 3OKDB 3B9DA 4MWFA 2ADIA 1IKFH 3MV8B 4ZUSB 2ZUSA 1K4CB 4HJ0C 5C2BH 3CDFA 3VFMB 3RY5A 5MERB 4HW6A 4MA8H 5IBTL 1AGBA 2CDFA 4G3YH 1OB1A 3ERYA 3KHQA 2OL3B 3SE9L 4WO4A 2QQKL 3ULVE 1RZ7L 2YPLD 2MQ3A 1WBYB 3D39E 3DYOA 3IGAB 1CGSH 2VDPL 1UEYA 1U8KA 5D2NE 4PJBB 5AZ2L 3WS3B 4G5ZH 2JE8A 1MQ8A 3JBG7 3DUSA 3TWCH 5A40E 1LD9B 4DOHB 4GG6A 2FL5A 5FYLH 4ZFGL 3BPNB 5JMRA 2DQDL 3MROA 4XPAL 4NNPL 1OSPH 3DMMD 4JM4H 1BOGA 2CO6B 4K23H 4NUGH 1DBMH 3RVTC 4G8FB 3BPCA 2F8VA 2ZCLH 4R26H 4Q6IA 4RX4A 3BPNC 1GH7A 3P4MB 5D7IA 4ONGL 3S5LG 4U31A 3RVWD 5A43C 1OM3L 3QXTA 1PYWA 1IGYB 1NGYA 3V6FB 4YBQC 1A7BA 1PBYA 3RL1B 2AXFA 3HI6L 1P4LA 4EI6A 4DGYL 1AJ7L 4K9EC 3MRPB 1RUQL 3QCUL 2VLJE 5F7EL 5B4MD 1G9MC 1IBGH 1GGBL 2PW2B 4NNXB 4UDUA 4XPTL 4N0YL 5D2LB 2B0SL 1L9NA 3E3QA 4K94H 5F89A 4OAWA 3VGEA 3V2AR 2WBWB 4O2FA 3PDGA 4ZNCD 4X7TA 3HZKB 1JP5A 5A3IC 2WWKT 4P2OB 5HGAA 3NPSB 4FFVD 4OLWH 5CEXA 1RZJH 3MLWL 1DBJH 2X89A 1UVQB 3QEQD 1NCWH 4YHKH 2Q1EA 4XMKL 25C8L 1IKNA 5CIPH 5JOFA 2DLEA 3ULUL 1A1MB 1A6ZA 3IKCB 4P2OC 5K59F 4NUJB 3MRNB 3NPSC 3ZO0A 4CVXA 3ARGB 4FP8H 1NLDL 4P9HH 3R8BB 3DWTA 5KANI 5MEPA 4G7YH 3TCLA 1XT5A 3T1FA 2QKIA 2V2TA 3V7AE 2R2EB 1KCLA 2RR3A 4R2GB 2EZ0D 1NEUA 1E6JL 3ARGC 2C1PA 3KYNA 4HFWA 4PJGB 4OZGF 1JNLH 4Z7VE 3RNKA 3MRHA 4PJCB 4ODHL 2I9TB 3ISWA 5IVZB 3TT1H 3N9GH 4GXUM 3H9SB 4R2GC 2FHBA 1H3PL 1FNSH 2ICWJ 3AUVA 1NDGB 4AIZB 4ZUTB 5C09D 2FYYB 4GAYA 4PBXA 3QPQC 2LU7A 3OB0H 1X6LA 4WHDA 2CJUL 5JOPE 4PJFB 3UTSE 1EHNA 4MXWH 2H1PL 2PTVA 3O6ML 4NHCL 5CJQL 3MRBB 4J3SA 4LRNH 3O2DH 4MD5B 1U58A 3KDMA 3BGMA 2BX5A 3GDBA 3N50A 5BVPH 2H3NA 4JM2D 3KPRA 3EKCA 3TO4A 1AHWB 4KI1A 3SO3B 3ULVF 5DLML 1GZPA 4RISH 5D8JL 5F9JA 1RI8A 5EU4A 4AH2A 2XQYK 4RNRB 1SEBA 2Y06L 1H3VA 5HJ3A 2HRLA 4XHJD 2CR3A 4HJJL 3MA7B 2BY2A 1N64H 2DS4A 5DEFB 4F3FB 1AHWC 1YYML 3SDAD 4IBLT 4LLDA 3SO3C 4HSQA 6FABL 4F33B 3WIFB 3LS5L 1C7TA 1AXTH 4JY6A 4EUPG 4R4BA 4JFQB 4Z8FH 1IC7L 4JAMB 3B9VA 2B1AL 3PIQB 1OD9A 3EYQC 1QFPA 3BZFA 3BEWA 2V9TA 3DGCR 2GSIB 4WI6A 1VDGA 1MWAB 2D9CA 4JRYB 1NAML 1E27B 1PJ9A 2XQBL 4GAGH 1QRNE 5I8EA 3P40A 4U49A 4WY7L 1KC5H 2JK5A 1LP9E 2GTZB 1BJMA 3KXFA 4L4VD 3QNZA 2ARJQ 2C9AA 4P2QE 1SYSB 4YFLF 3QRFM 5FA4B 3VRIA 1CL7H 5KTEL 5TQ0L 3TESA 1T1XA 4G9DB 1WWAX 3CU7A 3FO1B 2I9LA 5EBMB 2DAVA 4U6VL 5IHBA 1MH5A 3F7VB 5DT1L 2CRYA 1DQLH 3GIVB 4S0UC 1KENL 2X10A 2R0ZL 1IAMA 4K2UH 1DQML 4GQ9H 5FGRA 5C0DA 4D0BA 3VXRA 3CH8A 3MJ9H 2VZVA 3WFHB 2OCFD 3AXLB 4JZOA 3QG6A 3WEXB 5EA0H 5DJ6A 1EGJH 3JWOL 5C0BB 1WEJL 2E7MA 3QQ9C 3QWRD 1A9BA 3MXVH 4UQ2A 5F88A 2AGJH 2ED9A 1RIVL 3VXMA 1BFSA 4UTBL 3EDJA 3HG1A 3C6LA 2XI9A 3IDGA 4ODUA 2AK1H 3IETB 1I9RL 4OV5A 5DFVD 3M45A 3MV11 2Q8BL 3HZMB 1G7LB 4JANA 3IDJA 3WE6A 4L8CB 2XXCB 2XWTB 3MBEA 4WV1B 5C8JB 1WFTA 4LPUA 5GGUB 3SDXA 1T89A 3VXQA 4KKCD 1WZ1L 1ZT4A 5E7FA 5FYKD 1P1ZA 3AGVA 2QQQA 4I18A 3QA3B 1A6TA 1F11B 3IDXH 1MFCH 2XFXB 1II4E 3JTTA 3G08B 4M48L 3H3PL 4DKDC 1YNTA 4Z7VF 4YFLI 4Y5VA 3LKQB 4WV1C 1VEMA 5DQ9A 1YPZB 4EI5C 1MRFL 4WTWA 2FX9L 3P4NA 3UX9B 1WCBB 3D9AH 4PJHB 5K9OB 3SDDB 1T21A 3VFRA 5I1HL 4RIRB 4L8BB 3B2VL 3DHMA 2GUOA 1BZ9A 2BCKA 3SCMA 1SM3H 4CADA 2LABA 3UMTA 4JQIH 3VD3A 5GGRY 1Z5LA 3FOMA 5I73C 2B2XH 3TFKC 1FYTD 1WC7A 4U1GB 4Y88A 3SDDC 2QSQA 2VLRD 4LCCA 5HXMA 4AL8L 1FN4A 4OD1L 4RFNB 3NABH 2ZSVB 5A2JH 3LN5A 4ETQA 4KVNL 3WJJA 4PLKC 2P7TA 3I2CH 2BC4B 1C12A 5JW4M 2HKFL 4LSVL 4U1GC 2P8MA 3FHQA 1EO7A 2P5EB 4RFNC 4K3EH 1YECL 4GBXA 3QEQE 5FKPA 1EJOL 5C0NC 4YDLB 4XX1G 2RQ8A 4WFGD 5EOQL 5SWZB 5ACMA 3S5LA 1U3ZA 3KAAA 3JWNC 4J23A 4HJ0D 2EEAA 2BSSA 2EDHA 4UILH 5I19L 3FT4A 4PS4H 5E6IB 3FTGA 1B0GB 1CDJA 2XWBA 4HWUA 2BNRD 1XMWA 2XN9E 5HYSB 4A2LA 3GKZA 3F5WA 3O6FC 3KYKL 1MQKL 3CNKA 5ICZB 1I1YA 2NY5C 3BKML 3IS1X 4OQ1A 3U6RB 1HNGA 5KVFH 1ZLVH 4GJTB 4L8DB 1ADQA 2DQUL 1UWEL 5E6IC 3SGJC 3D5OF 3GHEH 4JFOB 1S7WA 4DKAA 1B6UA 1V05A 4MJID 1JVKA 5C09E 2ZPKL 1LQVA 5DD6B 5E94A 4HIIB 1WAAA 4PGEB 1B4JL 5DHYB 5ADOL 3LIZH 4G8GA 1AR1D 1ND0B 1I7UB 3CAFA 4XNMB 5DI8A 2VDRH 3AY4C 3OG4B 3LMJH 4JDZA 4L29A 4NN6B 2DI8A 3I3DA 4LHQB 2EYSA 3SJVA 2W0FB 5C08A 3W2DH 4UDTA 1U8OA 2A6JA 3MLYL 1IQDA 5HHPA 4M1GL 3KNBB 1GPOL 5D7LB 4RFOL 3I6LD 3GM0A 4NN6C 1F3JA 3WSQH 4LCYB 2HFFA 3IFPB 5E6YA 5EO0B 2FGWL 4FTVD 1CZ8H 4S1DD 3GFUA 1Z9OA 1JHTA 3TT3H 3U2SB 4XBGB 3ZTNL 5CZVH 4ZOAA 4DUVA 1A7QL 4YDJA 5IGXH 5TF1H 2IEPA 4HJGA 1GGUA 1G7MB 4AMKL 3MRQB 1YN6A 3QJFB 4NKIH 5A3ID 1UWGL 2V2WB 2F58L 4OSUH 1AY1H 3MRJB 3DTXA 3QDJD 4ZFOL 1HKLH 2OJZL 3MLTB 4R4NC 5GS0H 5HHMD 1ITBB 4UV7L 3RX8A 5DJAB 1T3FB 4L4VE 4JFDB 4P2OD 4XVSH 5TQ2L 2X7LA 4PJDF 5A2IH 1DBBL 3RBGA 3BT2L 5KSBB 2IAMC 2D7OA 1IFHL 5IV2A 3P77B 5CSBA 5L0QB 3C8HA 1KNOA 1SYVB 4XB8A 1RUPH 2LQRA 3BDYH 4LPWA 5MEQA 1N4XL 2P8LB 1BZ7B 3NAAL 4DQOH 1MY5A 1F45A 1HI6A 1J8HA 5L0QC 2ZCKL 4EUPA 5C0FA 5E00A 2ZKHL 4HMCA 3VXNB 1Q9OA 2IH3B 5IFJA 4R2GD 2YPKA 4Y16B 3HNTH 3CVIL 4LVNB 4S1SL 3LKNB 3ZE0F 2WBKA 3QPQD 5GJSH 3WXVH 1ZTXH 4YXLH 3GJEB 4FFYL 5HHNB 3U9PH 2CLVB 4RFEA 2VXUL 3P11H 4BFBD 5DRXB 3F7YA 4Y16C 5I8OH 2W65B 4LVNC 1ZMYA 4HKBA 4NC1C 9CGTA 4I0PA 2XPGA 5DRWB 3VDCA 3LHPH 1A5FH 1N6VA 1FLTX 3RY4A 2XA8H 1FC1A 2DLTA 1KLUA 4D0DB 4HIJA 4JJHA 5MEND 5KS9B 1BD2B 2HJLB 2GY7B 5DD5L 2GAZA 4ISVA 4JHAH 5D1XA 2DQIL 3ARDB 3LKPB 1ZT7B 2DM3A 2YD3A 4RA3A 5CBEA 4U1MB 2R29H 1H3WM 1MJ8H 1ZXQA 5JORA 3ZHLA 1IGFL 3P0GB 1E4WL 1DDHA 4M9OA 2ENYA 1NSNH 2ORBL 2IG2H 3Q5YA 4PB9L 4I9WD 1ODAA 2FECL 3BP5B 4ZYKA 5C2UB 1A6VH 3ARDC 5CJOH 3EYQD 2DLFH 4GSDL 1AE6H 4L3AA 5IP4A 5HSFA 2VLRE 4DW2H 5EORH 5JIIA 1NAMA 4PJ8B 3AMKA 4JLRB 2AXJA 1FNLA 4S1QH 4G8EA 3Q2CA 4FABL 1BBJB 3V5DA 2FSEA 2C4XA 4DKEH 1ZHBA 3MRRB 1YEGH 5CEZD 2OJEB 4LSPL 1I4FA 1NKRA 1T1YB 1K85A 1FZMB 5DJDB 2DL9A 4KMTL 2IPUK 5IOPA 5J12B 4PJ8C 1EEZB 3SKJL 2NY2D 1AQDB 3MR9A 3GJFA 4R9HA 5E2WL 3W9EB 5DJ2B 2C3XA 5HGHA 4Z95L 3KR3L 3OKEA 2A9MH 4P5TB 1W0VB 1YJDH 4WFGE 5DZNA 3L95B 1XH3B 43C9A 2EDDA 1DQQB 5J12C 5FDYA 5L8KB 2YZ8A 1J9CT 3JWDL 1HINH 1V3LA 3KLHD 2IQ9L 1C08A 2ARWA 2BNQD 2BNRE 4F15C 4N5EA 3G9AB 2GSGA 2ZCHL 1LO4H 3CFEB 5ECJE 2FIKA 4PY8J 3NH7H 1B2WL 3MV8E 3ZKND 4LK4A 2ATPB 3BI9X 2XZZA 5E8EB 2R8SH 1I7ZB 4PJ5A 2NY0D 4WUUD 2RJMA 3DXAA 3TPUA 1Y0LB 4GW1A 2RCSH 2VITB 3KHOA 2IAND 3B8SA 1TZHB 1DQJB 3BQUA 2VUYA 1PG7H 3EOAB 4LDOB 4AIOA 4PJBE 4ZDHA 2AJYL 4P4KA 5LKNA 4G9FA 5C6TH 1QFWI 4F7EA 3NA9H 5I6XB 4LIQL 5ABDE 3G04A 4DOHE 4JN2B 3WFDH 5GRXG 4MNGB 1N3NA 1UKTA 1U8PA 1YMMA 1T6WA 1KG0B 4NO5B 4YK4B 2H9GA 3HC3H 3RGHA 4EI5D 1IEAB 3AS0A 4OD2A 2DJUA 1FL3B 5I6XC 1OT2A 1A64A 3HE7B 3I6LE 3TN0B 4MSWB 4ZFZA 2I24N 3GSRB 3LN4B 2R2HB 4XP6L 3RU8L 3C6SB 3MYJA 1P84K 3SPVA 3STBA 5ITFB 3SGEH 4LPTA 3HE7C 5ESVA 2Y1VA 4NQEA 3TN0C 1TJHH 5CSZB 2D4DA 4RSVA 1TVDA 5GS1A 1UB6A 5AZ2H 2F53A 2VDOH 1AI1H 3L3DB 2C26A 4M5YL 5EBGA 1IEBA 3ZDZE 2GY5A 1XR9B 1ADQH 1IGJA 1L7TL 3MJGX 4Y4HD 2ICWI 1XGTB 5D2LE 1I9JL 1KBGH 3MV7A 3CCHA 3MMEA 5EUKB 4YJZL 2VXSL 4FN0A 5JXEC 1CXHA 3DNKA 4M02A 4QWWC 4XAKE 1UXWA 1S7XA 4XH2A 3UTZB 5C0ND 4G6AC 3D87B 1BQHG 3L5JA 4WRLA 1G0DA 3KPMA 3R8QA 4G6FD 1A3LL 1TZGL 4GMTL 3NPZB 4OKVA 1SJHA 4F2MA 5IEHA 4TPRH 1QSEB 5F9AC 4KAQL 5DEGA 4ONGH 5DRNA 3D3VB 4M03A 2NX5D 1CFQA 4LSSL 4AQ1B 1E4XL 4QRTA 5IQ7L 3O6FD 3OTTA 5L8JB 3LKSB 1CTNA 3EYSL 1HEZA 2BHUA 3LEXB 1N5YH 4QRUA 1HQRA 5KW9L 5KVGL 3SGKC 3HI6H 2FEEI 4DVRH 2ZSWA 5KVDH 4JN1H 1EBPA 2N7BA 3VW3H 5F7EH 1JK8B 1DLFH 1GGBH 4KC3B 1JNHB 2MQ0A 4B41A 4UB0H 1U6AL 3R06B 4AEIL 4HKXA 4PJGE 2FLRT 1GVIA 1FO0B 3LKOB 5IFAL 5IB3B 3QUZB 4PJCE 2G5RA 3L3KA 4BQ6A 5LCVH 4PJ7A 1I7RB 1FPTH 2D7QA 2X09A 4L4TD 1IGTA 3G6AA 1I1CA 3H9SE 4Z76A 4JFZL 4BH8B 3E0GA 3H9YA 3NZHL 4FNLH 4OGYH 4JZNB 3MLVL 4EBQL 1FG2B 4FZ8H 2CDGB 3GMMB 3LB6D 3QUZC 4PJFE 4AM0B 4L9LA 4NO3A 3WD5H 1NPUA 4LAJH 2A6DB 4X6FB 1CE1H 3IAGC 5I71B 1XCQA 3VH8G 3I9GH 1EAPA 3OKMA 4CW1A 1FFPA 5D7KD 3ME0A 3MRKB 3DHJA 3IYLW 4AY0A 3VFUB 3IU4H 2HG5B 2R39A 2IBZY 4ZTPH 1LHZA 1RHHB 3ZYZA 4PJBF 5I71C 3RAJH 5JMOC 3BE1L 4V3DB 1E6JH 3F8UB 1UXSA 4I9WE 1T7ZA 2B39A 3G6JA 2EH7L 5C0IA 3RNQB 2VAJA 1WBZA 2GK2A 2X4TA 4HCRL 3UTTB 4MD0A 3GSOA 1PLGH 1XGRA 2R23A 1GOHA 4EUPH 4TTGA 4P59L 3RDTD 2VTFA 5BQ7B 4OLVH 1BZQK 2BFVH 3X3FH 5I17A 3CFBB 4WW2F 4OUUA 2CLRB 5F96L 4O51B 4ZFOA 2BOCB 1G6RA 4IS6B 4DGVH 4X98A 3FL7A 4N0CA 3ZMRA 5FO8B 4JQVC 2V2XA 1BM3H 5ADPH 2CXGA 4JRYE 4KRNA 3V6ZA 1U2HA 1PKQA 4M7LH 4N90D 4NN5B 4MAUL 2VLLB 1S7TA 4UBDD 2IAMD 4D2NA 2G9HB 5ISZB 4LQFL 1GGIL 1KJ2A 3P9LA 4X99A 1HHKA 3IB4A 1K8DA 4S2SB 4XI5C 4PP2B 2X70A 3PDOA 3X3GH 1I9IL 3V6OA 2GCYB 2PYEA 4NN5C 5JHDD 2E7LA 1OP9A 4S1RH 3ZDZF 3U0WH 1XIWD 4HJJH 4JFFB 4MD4B 5D2LF 5IB5B 3MV9A 3QCTL 4NJAH 3AAZB 1T1ZA 4J3TA 7FABH 2MQCA 1M7DA 5I9QC 1AD9A 2AXHA 5HVFB 3K2UL 4QHLB 2WAHA 4O02H 4W6YB 3M1BB 3QXDB 1NEZB 4N5UA 3JTCA 4ZSOB 3NVQA 1S9XB 3HMWL 2NYYC 2IANE 5C0BE 1JZ3A 5F3HA 2WWKO 3IXTA 2YUXA 1HXMB 1X4XA 1Q0YL 2YBRB 3GMQB 5CEYA 2W9EH 5FYKU 4PG2A 1HWHB 2DMCA 4MZ3A 5I1AB 3LRSA 1QPXA 1TJGH 4TULL 4X80L 1N0XL 4X9FA 4G42A 5CUSL 3AU1A 4LMQI 2XY2A 4OD3L 1J8KA 4DN3L 3GJFH 1FNEA 1OAXH 2E8ZA 5D7SL 1VFUA 4L4JA 4TQEL 4Z7WA 2GT9A 1OTSC 3MLUL 4PJGF 2DQCL 2QADB 3DV6B 1Q9LB 3TZVB 3ZZ1A 2PR4H 4PJCF 5T3ZD 2J8HA 1WUNT 2VSCA 1CGVA 3WFZA 1BFVH 3IDNA 4PJHE 2DD8L 5C0CA 3PV7A 2HN7B 2QADC 3ESUF 3CLFL 3D69A 5JPMB 3C2AL 3KS0H 3GI9L 3KGRA 4U1JB 1J11A 4G43B 4PJFF 1X5KA 1IAIH 3EJYC 5BRZA 1UA6L 4WHCA 5F1NA 1BVKA 5FYKL 4ODBD 3QUKB 1WQVT 4DZ8B 1ZV5A 3U1SH 5J0BA 3B4NA 4HBCL 1MRDL 1A02N 1X5ZA 4LSDA 1TVHA 5DURB 4Q58C 4QRRB 2NLJB 1Q1JH 1A7RH 2YWZA 3L5WA 2XZCH 2H32B 4V1DB 5SWSA 5FOBA 3N1FC 5BJTA 4O9HH 3VXUA 2CIIA 4IOSD 5EO9A 2C3WA 4MJ5A 1AR2A 2R4RH 8CGTA 4JKLA 4BQBA 1R3HA 5GHWL 4OM0H 5JO5B 2CUIA 3JV5A 2R1WB 3GRWA 4H26B 4WEBL 3L7FA 5MEOB 2H2SC 1ZOXA 4JG0L 3WS6A 4R4FL 2GJZA 4JCLA 1WTGT 2GHWB 2E6PA 3GI8H 2C4FU 1IT9H 2J8UF 1NQBA 1KTDB 4CJ1A 5EZOL 1OTUC 4ZFFB 1IRAY 3BEVB 3KLDA 5E9DA 1M7XA 4PP1D 3E8UH 2YA2A 4N8VG 1ES0A 4FXKA 3EOTL 4LL9A 3T2QA 1S7SA 2DQTL 2E3VA 5C71A 3FFDB 2FEDC 1JPGA 2NZ9D 3FB7A 3HC0B 4PJEA 4Y19D 4M6MH 3QUXB 1XGUB 1OAKL 4CUCA 1J0HA 4J4PC 4G80A 2FD6L 4DN4H 1YMHB 3CFIC 4IIQC 1QO3A 2CKBL 3MA9L 2ITCB 3K0WA 3MRMA 4L1DA 5SV3A 4HG4J 5DJXB 2HKFH 1CF8L 1CU4L 1T5XA 3C08H 3QUXC 4D3CL 1CICA 5FHBH 4ELMB 5DMYA 1BQHA 1FP5A 1OY3B 1JHLH 3SY0B 1P5UA 3WDIA 2FWOB 3UC0L 1RMFL 1BEYL 5C0RL 2YPLA 1KTLA 4PBWD 3MUZ1 1PX4A 5LAXB 5MHSD 1INDH 1ORSA 2K7QA 4JPIB 4TOYL 4WFEE 4PRHB 4C4KT 1NDMA 3P0VH 3F12A 5IJKA 5B21A 4RGOL 3FRPG 1V7MH 4Q9QH 1YY9D 3D6GA 1LEGB 1QKZL 5D7LE 3DX9B 3FQWB 1FCCA 4JFED 4QF1A 3ORJA 1MQKH 1RK1A 1YEHH 3IXAB 4BKLA 3L7EB 4ODVL 5IEKA 1AIFB 3DMMA 3MJ7A 5TE4L 5ICYA 2HWZH 3WV0A 4XCCL 5TF0A 1UH3A 1QFHA 4KHXL 5IB1B 3K81A 3EDKA 3BD3A 1MJUL 3MOBH 1TCRA 1KYOJ 1IZKA 1IAIM 3IJHB 3MOQA 2FJGB 3PJSB 1MVUB 3RWIA 4P2RD 3QIUB 4YAQA 4BSJA 1B4JH 3HS0B 1OAZL 1EV2E 1NGPH 1EERB 4DTGL 3IDMB 4QXGL 2DDQL 4JREB 1YPZF 4H0IA 4PRBB 5CGTA 3CMOL 3HNSL 4OV6F 3QIUC 2A0LC 1N2RA 1L0QA 3KWWB 5DD0H 3VH8A 1S9WA 5FGBA 1G9ML 1A14L 4O4YL 3PGDA 3NFNA 4JFDE 5FDWB 4O58H 1A4KA 4JREC 1MFAH 4QHNB 1YEKL 2VIRA 5KSBE 3W9DA 4BSVA 5BS0D 4YZFF 3CZJA 1W72A 4FQQA 4UMGA 3R1GL 2F74B 1IC4H 2Z4QB 3T2NH 2VXTL 3QYCA 4GLRH 3SE8H 3W5NA 4GKSB 5EDXA 3MODL 2MHAA 3HCVB 1ZVSA 4ODWB 4OB5L 3OAUL 2GIYA 2ERJB 4ODSH 5L9DL 2AJZA 3MNVB 3PWJB 2HVKB 1UWGH 4Y4FA 4M9PA 4QTIL 2WBJA 3I84A 4EVNB 3QO1A 4NC1E 3PWVA 1NBVL 3TA3B 4LCWA 2ERJC 3DROA 1NFDB 4M1CD 4X6BA 5J9PA 1WICA 2OJZH 1K4DB 4APQD 1G6RH 3RGVB 3MRIA 5IHZB 1Q72L 3RY6C 5CIPB 2V9RA 1P7KA 4YWGL 3H3BC 5FECA 4Z77B 1KJ2H 4U1NA 1NMAL 1RZJC 5DDHA 5BVJB 3OGOE 3RGVC 4MA3A 1DE4A 5KS9E 1BD2E 2A83B 2HT4C 1YC7A 1ZGLA 3IRZA 4HCRA 4XXDB 5F7KC 4PY8I 4HKJB 5ID0B 2YKLL 4P9HC 3UAJC 3QXAB 2IALB 1QYGH 4WTZG 3KS0J 4WFFD 1C1EH 5J6GB 4X6DA 2HFEA 3CVIH 4MQXD 2VDKL 5HI5C 5M95B 1U8MA 1ZSDB 4OI7A 5L7XL 2ILLA 3O2WL 3PGCB 3ARFB 3AVEA 3KPSD 3UTTD 3VI3E 4JZJA 5CP7A 4PGJA 3BIKA 4ACPA 1CXLA 1RIHH 1CXKA 1LO3L 1U3HB 1JGEB 2UZIL 5DMGD 1T5WB 1Y6MR 4JPVH 4N9OB 3TBWA 3ARFC 3PABB 3VRJA 3DYPA 4U1IB 1ROWA 4MA1B 3ARBD 5DUPH 3TV3H 1AKJB 2RFXA 1C5CH 3O6KH 4OM1L 5J56B 3ALPA 4JKKA 1JN6B 2VQUA 4X4YB 5B38B 2Q86A 1BJ1H 2G75B 4HG4K 2Z92A 1EFXD 5C0JA 5IF0B 4MA1C 3K8KA 4Y2DA 2NTFB 4LLMA 5F7UA 5E1AB 1I8KB 4UT6H 2Z8RA 4JHZA 3V95A 3CFDA 4MNQD 1G7IA 4OFYD 5DA4A 4GSDH 5BO1L 4HLZG 3TVMA 5D6CB 2GFBB 4OF8A 4Y19E 1EHXA 2YXFA 5FM8A 5T1MA 1FHGA 4IRZL 4ORGA 3QDGB 5FIEA 5AYUL 4Z6AT 4P5KB 1L7IL 1A2YA 1UM6L 2DWDA 4HS6A 3RA7L 2BRRL 2UUDK 3HZVA 5KSBF 2WINB 4YFDB 1U8QB 2DIAA 15C8L 1GHFL 5JW3L 1D5IH 4PRNB 1M6OA 5HYEA 1JBJA 2Q76A 2DYPD 1ZWIA 4OIIH 2X4PA 5A16B 4GRWH 4ODTH 5BOPA 1EEUA 1T22B 5KJRH 3IFNH 3TO2A 3QIBD 4MNGE 3S88L 1VEPA 3UDWC 4MCYB 3DO7A 3GRWH 5EOCL 1OLLA 4WDIA 5KSAB 4WJ5A 1JFQL 3TIEA 5D1ZD 4CGTA 5C6PB 5JLZA 4IOIB 2RAMA 2ESVB 1I1AA 1T0MA 4QOKB 3CFKB 1N26A 3RBSA 2IFFH 4LHUD 1B2WH 4N8VA 2MCPH 8FABA 3NACL 4QCIA 3BP4B 2D7PA 3TM6A 5IUSA 2BY1A 4HWBL 5GZNC 1OTTD 5KSAC 1RSFA 5CGYC 4M43H 3RL2A 1FFNB 3EO1B 3O6LL 1AO7B 4Q74A 1QA9A 4E0RB 1DVFD 5C0GB 3PF2A 5J6HA 5EWIH 5ACZB 1UC6A 1U91A 2AQ1A 5L2KD 4QXTA 3DRQB 3KPQA 5TGBA 5KS9F 2V5TA 1FV1B 3X12B 3CSGA 4UTAH 5F72S 3RUGB 3NIFE 1NFIA 2H2SD 3NZ8A 1FAKT 4KJQC 5FF6B 5GGVH 4LLQB 5JXAL 1KUMA 3LV3A 3RP1A 2EEBA 1QSEE 1EO8L 3FRPA 4HC1L 2X4NB 3U4EA 5CD3B 1Z6JT 3QHFL 4IRJB 4HUVB 1CXIA 5C0EA 4KK6D 1F6AB 3D3VE 3C5SA 1RFDH 2ADIB 1RUKH 5F93C 4F9PA 4JO1H 3QWQB 1DBKH 5I8CA 2V7NA 3JSSA 1AGBB 4BUHA 2CDFB 1KCRL 1A47A 1JPFB 3G5VA 4IRJC 4W6WB 3GZKA 4M7KH 5IESL 2CKBA 1T83C 1CGWA 2QSCH 3NIDF 4WO4B 3T65B 4XC3L 2I07A 1KCVH 1L7TH 1A1NA 4KQ3H 1U8KB 2QQNL 1PD6A 3WL9A 2VXSH 3G5ZA 4NWTL 5FM4A 3DUSB 1UWXK 3O4OC 3CGTA 4F57H 4GG6B 2FL5B 4WO4C 5IB2A 1RZFH 2NY5L 3LQZB 4Q6YA 5E95B 1BAFH 1QFUH 3MROB 4P3WA 2ID5A 3O3UN 5I1JH 1VFBA 1BOGB 4O2CA 4PV8A 3OG6B 3BPCB 1E4XH 2Q7YA 2WQ8A 4MJIA 4G6KH 4M1DL 2YXMA 1JPTL 2GKIA 5D7IB 3CK0L 2O5YH 4OBRA 5HPMA 3H0TA 4PRHD 1PYWB 1NGYB 5HI3D 3B3IA 1FSKB 3FN0L 5IBLD 3RTQB 1W72H 2AXFB 1KPVA 5IJVA 3T1WA 4N1CA 4WFFE 3WO3B 4EI6B 2APVA 1JZ7A 4PRAA 3FO0H 4JVUA 2NR6C 4PG9A 1F58H 5EZIL 1XF2A 1KFAH 4TVPD 5HVGB 5E2UL 1FSKC 3UTTE 1IC5H 2APWA 3OKYA 5F89B 2EIBA 3GSVA 1KCUL 4FTVA 4XPFL 3QIUD 3MLVH 4X7TB 2A0LD 4EBQH 5SX4H 2CGRH 2BDNH 5FYLD 5HGAB 1NCTA 1FG9C 3PWNA 4DAGH 2NNAA 3LQAL 4RMVA 3K1KC 5CEXB 2G60H 3E3QC 2K3TA 2VL5B 2I25N 1AGDA 5C07D 5JOFB 2PNDA 4OLZH 5ISZE 1LO2L 2JELL 1LEIA 1A6ZB 4OCXL 3INUH 3HMXL 3M17B 3TYGL 4KVCL 1NUDA 3QEGL 1P4BH 3BE1H 4LNVA 1Z0NA 5MEPB 2ICCA 1IKNC 4JFFE 2DQGL 3T1FB 5AG8A 5HHMA 2QKIB 5HYJB 2V2TB 4WTZA 4LSTL 4HCRH 1MF2H 5E2JA 3H9ZA 2C1PB 4HFWB 1RZKL 4KY1H 4Q0XH 5JW4Q 3MRHB 1R3KB 3LS4L 5I76A 2HKHL 3KPPA 4X5LA 4ZSOE 3UJJL 4I3RH 5DA0B 1HCVA 3A0OA 4QT5A 4H20L 4PJXA 5H37H 1GL4B 1Q8MA 4GAYB 1KJ3L 4OIBA 1S3KH 1UGNA 4U6YA 5D93B 1QBML 5C92A 3ZL4H 1ZA3B 5KZCB 3MNZA 4X6CE 1KN2L 3RGVD 1U58B 3KDMB 2F54B 1D5ZA 1XEDA 2H3NB 3KPRB 3D2UA 4KPHH 5GS0C 4CJ0A 5D93C 3VFOA 1GZPB 4PRIA 3MXWL 4Z7NE 5F9JB 3ILQD 3PXJA 4GXVL 1KELL 1S78D 5EU4B 2A77L 4AH2B 4G7VL 3PP3K 1FL6A 4JO3H 5HJ3B 4TSAH 4B53A 3TO4C 1LEKA 1PSKL 2YK1H 4LLDB 1CR9L 5HI5D 2VNCA 4N0UA 5MENA 3I85A 1U95B 4JY6B 5D5ME 4Z0XA 3CZFA 4U2YA 4E9LA 2I5YL 3DLQR 1UQSA 4M8VA 4LCUA 4G6JL 3WUZA 3BZFB 3BEWB 3MCLH 4FQHA 1J1PH 1S5IL 2D4FA 4QRPD 3PQYA 3P30L 2XTJD 4MDIA 3KLAA 4C56A 4QRRE 5I8EB 5T3ZL 2X4RB 4V1DE 4Z78B 4XNXL 1WBXB 3KXFB 3QNZB 3EO9H 2FDBP 5CJ5A 3HRZA 2L7JA 3QG7H 5E8DH 1F4WH 3LDBB 3VRIB 2NY7L 3RIFF 3NIGE 3QI9D 1MREH 2OR9H 5EBLA 4I4WA 2AJXL 3D0VA 4PV9A 2OP4H 3VFVB 1HHGA 1AGCA 2I9LB 4LSQH 3P9MA 2VAAA 4XCNA 4ZUUB 4YX2L 3QDMB 4PUBH 3LDBC 2D3VA 4D0BB 1YEFL 4PJ9D 4R7NA 4JZOB 2HRPH 3QG6B 4PGBB 5DTFA 5I1IL 5DJ6B 4N1HB 1A9BB 4UQ2B 5CINH 5F88B 3A6BH 2EO9A 2NY3B 1V8HA 3VXMB 4MS8A 4OZIE 4YXHL 4OFVA 3TJEL 3HG1B 3C6LB 3IDGB 2BNQA 4OV5B 1RQ5A 1JRHL 1TJIL 1KCKA 3WE6B 4M93B 4OTXH 1FH5L 3SDXB 3VXQB 4NYLA 2NY3C 2AEPH 1ZT4B 2R9HD 4I18B 4ELME 2V9QA 5DQDL 3SDYL 3C6LC 3BUTA 4WUUA 3KVQA 3JTTB 3BKCH 4DGIH 1YNTB 1MI5A 3WCYA 2DLIA 2J2ZA 2ZUYA 3MBEC 4M93C 3ESVF 4XVTH 5AZEL 4NT6A 1T89C 1S8DA 1D3CA 4JPWL 2AEQL 3KPLA 4I18C 3P4NB 1YJDC 1LILA 4PRHE 4F7CA 3BN9C 1T21B 3QDHA 1WWCA 3CFJA 1QOKA 3L9RB 2DQJL 2XYCA 4QOKD 1BZ9B 1C5BH 4JY5L 2OTWB 3SCMB 3ZDYE 2VDMH 1N59A 1YQVH 5ALBL 3V7AG 4ZPVB 1Z5LB 3FOMB 1S7VA 2NCMA 4XC1L 2KQNA 5JQ6L 3FQRA 3QIWA 1WC7B 2FD6H 3QO0A 5CWSA 2FR4A 1VPOL 2XY1A 3H9HA 1QZ1A 1J05B 4LCCB 3N1MC 3MA9H 2CLZA 5CZKA 2IPTL 1FN4B 3SCMC 2NXZD 1XF3B 4ETQB 5I75B 1NCBL 2P7TB 1HXYA 2ADGB 1C12B 1Q38A 3EOBA 1INEL 3QULA 3CX5K 5FYLE 1HZHL 1K3IA 1RMFH 2P8MB 2V5YA 3LD8B 4G8IA 3UJIH 1MHHB 4LCCC 4HXAL 4ZUWA 4R0LA 1CDBA 4GBXB 1Z3GH 4KU1A 5I75C 1FQ9C 3WJJC 1OLZA 4J1UA 4TOYH 3ILPA 2O93L 2EDLA 1PG7X 1AP2A 3WUWB 4P3DA 4EOWL 4RCAA 1U92A 1OAYL 1XF1A 3BAEL 4Y4HA 2HYMA 3LD8C 4XWGL 2HJKB 4QHKJ 4BQ8A 4CMHB 3S97C 4HZLA 3VFPA 2BSSB 1ZKAA 4GBXC 2VZUA 1QLFA 2DKUA 4ODVH 3FTGB 2XWBB 1KULA 3FT2A 2IGFH 5IVXB 1NCAH 1ZS8A 4GAFB 2GEEA 4XPBL 1G9NH 4OCRL 4CMHC 3REVA 4NZTL 2CDEB 5CMAA 5DVLA 4O2EA 4KTEL 5IHUH 3D25A 3BKYL 2NX5A 2NY6C 1OP5H 3JV6A 43CAA 3MOAL 5F1SA 4V3EB 1G7QB 1S7WB 1I7TA 5EC2A 3WKML 3NIGF 2YD4A 2DQHL 1CXFA 3KJ4B 5E94B 4KV5E 3CMOH 4QGTA 1UZ6F 1CBVH 3H8NA 1NFDE 5DI8B 4WI3A 5BMFH 3KPNB 4B0MM 4OFKA 4JDZB 4L29B 4M6NL 3C9NA 1AQKH 1DL7H 1NGQL 4IDLA 4PTTB 2EYSB 5GRUH 4JRXD 3SJVB 4EZMA 4YUEL 1X5XA 3KJ4C 1J0JA 4HX1A 5IVNA 4UDTB 1JYXA 1U8OB 2A6JB 2EC8A 1CLYH 1IQDB 3K7UA 5EU6D 4GKNA 4LOUD 4JY4A 4R3SA 4L4TA 3OX8A 2C5DC 1F3RB 1FZOB 1F3JB 2VXQL 3RIAF 1NGZA 3NMEA 3IF1A 4RX4D 1DEEA