3MROA

Crystal structure of mhc class i hla-a2 molecule complexed with melan-a mart1 decapeptide variant
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
275
structure length
275
Chain Sequence
GSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDGETRKVKAHSQTHRVDLGTLRGYYNQSEAGSHTVQRMYGCDVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQTTKHKWEAAHVAEQLRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHEATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWVAVVVPSGQEQRYTCHVQHEGLPKPLTLRWE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
publication title Analysis of Relationships between Peptide/MHC Structural Features and Naive T Cell Frequency in Humans.
pubmed doi rcsb
source organism Homo sapiens
total genus 77
structure length 275
sequence length 275
ec nomenclature
pdb deposition date 2010-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mroA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3mroA01
3D6GA 5C0RL 4NBYB 4UT7L 3U4BL 2BOBA 1DE4B 3DUHA 2FWOA 1LEKA 3I50H 4X4XB 1ZOXA 5GSVB 2Z93B 4OGXH 4O00A 4JRYB 1CL7I 5DUPH 5HGBA 3IFOA 2GAZB 5FECB 4C4KT 4P2OB 3MRCA 4ODUA 3CDCA 2QQQA 3QIBC 4LNVA 4C59B 1FL3B 2P46B 5IMOA 4WO4D 3QXDB 4GUPB 3ZKND 4W6XB 5GGUA 1U3ZA 3O8XB 3IKKA 3MV9D 1C8PA 4XVTH 1CLOL 4PTTB 5C0DA 4OZHA 4FQQB 4XNQB 1IGYA 2FHCA 5DI8B 4JG1H 2YPVL 1PKQE 1U6AL 3DI2B 3I75A 5I71C 5D6DC 4O4YL 1AGFA 4EI5D 2IBGA 3CSGA 2R8SL 1UCTA 4UT9L 4IRJA 3O4LB 5AZ2L 15C8H 3SGKC 3V8OA 1KOAA 3DGGB 4TQEH 1MJUL 4PJDB 1F58H 1FL6A 3FFDA 3D5OF 4EUPG 5MHSD 1U8QB 2NY2C 4OUOA 2NW2B 4Z8FH 3RGVA 4PRNB 1G1CA 4GW1B 1IT9L 5E56A 3KYKL 5DHYA 2VABA 3S3SA 1NCDH 3TFKA 4KKBD 1NGXA 4PTTA 1ZA6B 3HPLB 2CIIB 1KTDA 5EO0A 4XNQA 5SWSB 4PJIB 5E8OB 1WFNA 5CWSA 5ALBH 2CUHA 4Y2DA 3K1KC 4ODVH 1FSKB 2XNAA 4S2SB 4CRPA 1HK6A 2XQBL 1DBAL 1ED3B 1WWWX 4QRRD 4JM4H 2X4NA 4NN5C 2EKSA 2F53E 2AK4A 4PJXA 1CT8A 5KW9H 1MCFA 4XNZC 3BP5B 4S11A 4BH7B 4B41A 2QTEA 3A6CL 2MCPL 3GBMH 4HG4J 4ETQA 4ORGA 1M05A 1IKNA 1NCAH 4UNVA 5DQ9B 1H3UA 4CN4A 1MEXH 4G9FD 3MA7B 4P5TD 4AEFA 1OQXA 5T1LB 1CG9A 1T4KA 4M6NH 5EZJB 5T3ZD 4XPFH 5IB2A 4YQXL 1GXEA 4CU6A 4IRJC 3GB7A 3MUJA 1KB5L 1FQ9C 1IEBB 1EHNA 3VXUE 2M2DA 1WBYB 3ROLB 4FABH 4G9DB 3UJJH 4KU1A 5L8KB 1S5HA 4P2YA 1YECH 1WSST 2L7JA 3BO8A 3BI9X 3ARGA 3LD8B 1ETZB 3RDTD 3ARQA 3M45A 1TVBA 3RGVC 1AHWA 2ICWA 1UWEH 4YDJB 5FM4A 3TFKC 2OK0L 3ES6A 2AJZA 3SO3B 1CXKA 3MA7A 2NY4B 1FC2D 3DRQA 1T3FA 5IM7A 4Y2DC 5AUMB 3R0MA 2FX9H 5ETUB 1HCVA 1XCQA 3DUUA 3BMVA 5GGVL 4PLJC 5HDOA 4ZAKD 4J6RL 5T1MB 5HHPA 4H8WC 3BHBB 1HSAB 2SEBA 3FJTA 3MOAH 4HS6A 1CZ8L 1UZ6E 3MLZL 4G9DA 2X4PA 4N9GA 1CFQB 4UDTA 1FNAA 5TF1H 1BREA 3EYQD 4XWOC 1ETZA 4M43H 5TF0A 4UILH 4UBDC 4C4KO 5GGRB 5GGSB 1LEIB 5C8JB 3V6BR 1J8KA 4YBQD 4D9RE 5J57B 1QLFA 2O5XL 1AO7B 1VEMA 4DEPB 4NUJA 1IKNC 2FIKA 4NKQB 2JJSA 4FZ8L 3ZTNL 1H5BB 1YJDL 1A0QH 5BMFH 3PQYD 1CGXA 5EU3A 5SWQB 1N6QH 4PJ7A 4GS7C 4GW4B 3PWUB 4PP1D 2P5WE 2IAMB 3OJMB 5M95B 2HMIC 4X8JB 3MLSL 5FUCC 1CFQA 2AABL 3UZQA 3JZ7A 3AS2A 4EDWL 2O5ZH 1NEUA 5ALCH 1BOYA 3ARGC 4YAQA 3MUZ1 4H5SB 2ITDB 1AHWC 1ZEAH 3O45B 2HKHL 2CDEA 4IMKA 3SBWA 3OKKA 3IJHB 1IM9A 2J8OA 4D8PA 2GHWB 3Q1SH 2JB5L 4HWUA 1ZV5A 2RIKA 3NACL 1N6VA 4IDJL 2X7LA 3QNZA 5FYKL 3U6RB 4P4KA 5DR5H 2NTFA 4G8GA 3MV7B 1A6UL 1P7HL 4DK6A 3VW3L 4CW1A 1S7RA 2DOCA 5AD0A 5I9QB 3VGAB 3LDBB 4K9EH 3RY6A 4I2XE 2W60A 1BMGA 3WHE1 5DD0H 3QNXA 3JTSB 5IMMA 3IDMA 3T77B 5HVHB 4MHHG 5D7SL 5C3TA 1MCDA 5T33L 4WHYH 4LCCA 5HHQA 3TA3D 4EN3B 2D03L 1D5IH 3V5KA 1FZOB 1EGJL 1IFHL 2CXGA 3UAJD 4YH6A 3S5LA 3O9WB 3RL2A 4G3YH 3R0NA 1KIPB 3H8NA 2JJSC 2GITA 4XVSL 1AD0B 2UUDK 2P7TB 4WU5B 3MLUL 1I4FB 2RB8A 3DRTA 1BZQK 1OTUD 5FF6A 4ZXBA 3UTSD 4KDWA 2IBZY 4NQDB 4Y5XA 3IU4H 1OWWA 4TULL 5D7LE 5EO9B 5KSBB 3VI3E 5B39B 1KJVB 4LF3A 5J1AB 4CUCA 8FABB 1NDGB 1LHZA 3WIFB 4IMKC 3SBWC 4LLWB 1RHFA 3QEGL 3HMWL 4R9HA 1RULH 4YC2B 3UTTD 5D7IB 3VFPB 2OQJB 2Z92A 4QRPE 3EHBD 4JFEB 3IU3A 2P43B 4KTEL 3QHFL 3IDNB 4GQ9L 4X9FA 1A4JB 2LABA 3V0WH 3OKOA 5C09E 4P4KC 2FJGB 2AI0H 4RAVA 1QEWA 3VXQA 3ZYOA 2I60H 5K9JH 2BDNL 3VXRB 1MCSA 3RY6C 4JCLA 5FAAA 1P7QA 2WM0A 5MHSE 4LGRB 3V9FA 4X0KB 4K7PX 1EJOH 4P23D 3BJ91 1KJVA 2IH1A 2D3VA 5JDSA 4BK5A 5I8OL 5JPNB 2YD1A 4LCCC 4KDTA 4L9LA 3WLBA 4LPTA 43C9B 5H35B 3FOLB 5D72H 2WIIB 3W82A 5DHVB 4HF5L 2A38A 4O9HH 5DRXB 2B4CH 5GISH 3N06B 5IESL 5KAQG 1KBGL 4KI5E 1NCBH 2VYRE 3CXDL 1RUPH 4N90D 2BVEA 1M4KA 1JN6A 3D3VB 1J1PL 3RL1A 2GJ6B 4D0CB 5JW3L 2R23A 4RGNB 2F8VA 3O3DA 4ZXBC 2I9TB 3NTCL 3AS1A 1X5YA 3BIKA 2PTUA 4IOSD 3V0AC 4Y5XC 4Y8DC 5IVNA 1W8OA 3MGOA 4HPYL 2HTLC 2HRPL 1XH3A 5LCVL 2W9DH 1JF6A 1EHLL 3V79C 3FOLA 1GAFH 4NM8H 4Y4HD 4FQCH 5F9DC 1NAMA 4M7ZC 2FSEA 2QLVB 5F9JA 1EVTC 1YQ2A 3OR7B 4JAMB 2GFBA 5L6YH 4XP9L 3FO2B 2PCPA 4K9EC 1KN2H 1OF2A 3LKRA 2IC2A 1ZGLA 4HGMA 4OIBA 4PP2A 1A7QH 1A1MA 4RMSA 1VADB 3LEXA 3RJDA 1TZHA 4E9LA 4Y4KB 1FRGL 3OPZH 4KDTC 4L9LC 1A6TA 1F4XH 4JO3L 2E7MA 4X4YA 2DM3A 3N1PC 5FM8A 3TLRA 4GRWB 3TWCH 3GI9L 2DD8H 1HYSD 1Q72L 5GRVL 5E9DD 5INDB 3FO2A 2A9ML 2DF3A 3VI3F 2P8LB 4C58B 5LGHL 1EMTL 3GDBA 1P6AB 3X14B 2C4FT 3TJEL 2NZ9D 4F58L 5T3XE 5JQ6H 5B39G 3QEHA 2Z31D 2C4FU 2XIDA 4JM2F 4JANB 1DJSA 5F7FA 4Y4KA 4W70A 1M7DA 4R8WH 1H3VA 5IB5B 4G8IB 1XZ0B 4YK4B 4IHOB 1HXYB 3BX7C 5CZXC 4NIKB 3F65A 4LSTH 4Y8AA 5IKCA 5F3BB 3SJVA 2CD0A 5BRZD 2R2EA 3LS5H 1GRWA 2BFVH 1C5DA 3B9KD 1F3DH 4PJ9B 1CDJA 4D9LH 4I77L 5INDA 2FZ3A 4NFBA 3ARBB 5AYUH 2IGFH 1CVRA 1JWUA 3D69B 4GAGL 4Z77B 4XP1H 4Q2ZA 4LCWE 4G6ML 3MBED 1SYSA 3AVEA 4F37F 1Z9LA 4RBPH 2F8OA 2A1WL 1KXQE 2X4RA 2VNCA 3BW9A 4PRPB 3O4OB 5IB5A 1RJYB 3ZT7A 3VG0L 1UKTA 4KI5F 5A40E 3TZVB 1MIMH 3DX6A 4TSCH 4JN1L 1NC2A 2R1YB 5KVGL 4YE4H 1A1NA 4QXTA 2Z4QA 3SDAD 2BXYA 3SY0B 3SKJL 5MENA 1MPAH 2F58L 4FQXD 5IVZB 5JORA 1I1AA 5DQJB 3DLQR 3P30L 1IGTB 1L6XA 4IM8A 2AERT 2A6JB 4TVPD 3EO1B 3VH8A 5EOQH 3MC0A 2H8PA 3MTRA 3VFUB 5KVEH 1VFMA 4JFPA 4JLRB 2CDFA 5TQ2L 5J11C 3P11L 1SY6A 3IDJA 4ZUSA 2XXMB 3U36B 4XI5C 4JHWH 1CDUA 4GKNA 4POZC 3EDDA 1QSEE 3CLEH 4QHMA 4ZFGH 4HKZB 5IGXL 4Y4KC 5JW4Q 2YMXH 4JRYE 1FAIH 5HPOA 2HKFL 3FN9A 2D0HA 3MJ9H 3EFFB 3FOMA 5IEHA 4JDTL 4EDXA 2R1YA 5JHDA 4CDHA 1C1EL 4QYOA 1KIRB 3DECA 4WHTA 1V7NH 3BP6A 2XKSA 1FN4A 3CFEA 5HPMB 1IGTA 1Z6JT 4YBLB 3EO1A 2GTWB 4I0CC 3VFUA 3UTSE 3X13B 5MP6L 1YEFL 3WD5L 1PKQA 1ZT4B 1EXUB 1QFOA 3U36A 3AREB 3LKNA 4HIXH 1TMCB 5D5MB 5E4EC 1HOCB 5DEGA 2Q8AH 3NFNA 5EN2B 2ESVE 3BN9D 5D71H 4PJDE 4PJ8D 3PP4L 4K94C 3D9AL 2E7LE 4H0GA 3ULUD 4GRMA 1XMWA 3EFFA 2AJXL 5L2JB 2P45B 3MRDA 5DURD 5KG9A 1OP9A 3DSFL 3SEPA 4PJHB 1KIRA 3SPVB 5H94B 2NY0C 3IGAA 2OX5A 2X4UB 4PS4H 5DFVC 2V9QA 4OF6A 2AJUH 1I1AC 2BNRB 5SWSE 5C6TL 4MQTB 2C5DC 4YNYB 3BOVA 3OG6B 4RRPA 3K2UL 3OKLA 3QWRA 4NOFA 2DDQH 3H7BA 5C6PB 2VXUL 4FRWA 1VFAB 3H9SD 2I24N 5GHWL 4K3JL 5LBSL 4PB9L 5D5MA 1RU9H 1Y18A 3HI6H 1IC7H 3QJFA 4Y16A 5TDOB 4X5XB 3O4OC 2A73B 2D7NA 4HS3A 5CP7A 2UY6A 4Y19E 4XNXL 5F7EH 1DQDH 1UWGL 2MSPA 3MRMB 4GG6B 1T7VA 3KXFB 2F53A 1JCKA 1YYMH 1TNMA 4FTVD 2A74B 4OSUH 3SPVA 3GM8A 5FFLA 1JNJA 2X4UA 4FS0A 3P77B 4P9ML 5IBTL 4ODBD 4LPWA 4W6WB 4JKPL 3VH8G 4KQ3H 1XT5A 4MAYA 3ZDYF 2BJMH 4FFWD 3DX9A 4F7PA 1FC1A 1JHTB 4JFQA 1BBJB 4LFHD 1JI1A 2QQNH 5JA9A 4JZNA 1Y6MR 3MUGB 2A83B 1GIGH 3U4EB 5FDWB 5I1DB 3ILPB 3DMMD 1A5FH 4ZUVB 2PYEB 4I3RL 3PGCB 1NBYA 3MRMA 3IS0X 3VXUA 3VFWA 1A47A 4K3HA 4RGOL 3QFJB 1JJUA 1CLYH 1QVOB 1QOKA 3QCVH 4GKOA 2ICCA 1KG0B 3FQUB 1R5IB 4RFOL 2VXSL 3RJQB 1AH1A 2XQYG 1TTUA 5D7JA 2BX5A 3ME0A 4NQCB 1A3RL 4Y5YA 2LAGB 3GFUA 5L0QB 3THML 1MUJA 4GQPH 3FB7A 4I5BA 4YGVA 3GM0A 5SX5K 1OTSC 1KJMA 3SDCA 1YN6A 1KCGC 4OZ4B 3ARUA 5EZLB 1NFKA 2BVOB 2B39A 2J4WL 3BH9B 5IW6B 4HSQA 1FGVL 4OF3A 4Y16C 3ILPA 3HS0A 3JWDH 3DVGB 1A6AA 5DHXB 4TNWK 2OZ4L 4KK9C 3OAZK 1AQDB 3ULVF 4XC1H 5F9OH 4R4BA 3PGFH 1T5WA 4LLDB 3V4VL 1SYVA 1D6EB 2JB6A 4YPGA 3T2NL 2R39A 4YEFA 1TJHL 5I1AA 2N56A 2V7HA 4OCRH 5CJXA 1KG0A 1B9ZA 4JPWH 5E9DE 3N9GH 2CLZB 2ZJSL 1HHIA 4E5XB 1CK0L 4RRPG 1C5CL 3VWKA 2X1QA 5TE7H 1R5VB 4JREB 4PREB 4ZFOA 1P7KA 3U9UA 2EYRA 4PJDF 4N0CA 4R4ND 4QF1A 2VH5H 1RZIB 2VC2H 2GUOA 3FO9A 3U0PB 3MRGB 1FJ1B 1NC4B 2P5WA 5EC1B 5EUOE 4WV1B 1W72B 1P9MA 5FO9A 4XMPL 1BX2B 5BZDB 4OZGE 5DWUH 4LHUA 2B5IB 4RMWA 2I5YL 3B2UD 4PJIF 1QFUH 4RGMC 2AQ2A 1TDQA 4FQ1L 2YPLA 3FO0L 1RVFH 1L8JA 3QCUH 4I1NB 5MEPB 1CD1A 4Y5YC 5E6IB 1S5IL 4X7SH 3MQIA 1X6NA 4DGIH 3CVHL 4APQB 1SVCP 5C2BL 2R56H 3KPNB 1EFXB 3ARFA 4Z7VE 3SDCC 5T1KB 3QA3A 5D96C 2FB4H 2P5EA 4KY1L 4CU7A 5GS2H 1LD9B 3GI8H 3FZUC 3OGOE 1U8IA 1CF8H 4MQ7B 5DMIH 4X7FC 5EO1A 3WL9A 1I1CA 3I6KB 5A3IC 4L4TD 5AAWA 4HWBL 4P9HH 3L3GB 1VB9A 3EYUH 4YDLB 1CBVH 5HHXL 4I2XA 3L1OL 2EDQA 1KC5H 3O3UN 2E9WA 4N0FB 3TEUA 5J6HB 4HT1L 3LIZH 1X5ZA 3SHSA 5CJXC 1IAII 4X7CC 5EWIH 3GJFB 2HFFB 2FR4A 4M7LT 1L0XA 4DTGH 7FABL 3O41B 4TVPE 4APQA 3MA9H 4BJLA 1CLZH 4PTUB 1EK3A 5JXAL 2RBLA 4N0CC 3O2WL 1WVZA 3ORJA 5F9AC 4ZDHA 4OM0H 4YXLL 4ZO8A 4KVNH 1MRCL 1VFOA 4CMMA 3I6KA 5CCKL 4LVNC 1HEZA 3FQXB 4EBQL 3BDYL 2YZ8A 4KK5D 3AU1B 1R3HB 3L7FB 1P9MC 1MNUL 1ZA3B 1CICB 2PR4L 4XCNA 3BYTA 2Y5EA 1MQKH 2VLJB 4QHNA 3BZFB 4BZYA 2YHGA 3GEWB 4YHIB 2MFNA 3P73B 3WO4C 4CVXB 3HG1E 1RIHH 3GJFA 2X4SA 4WO4A 1MFDL 4JFEE 3O41A 3MV9A 1NCWL 2HT4D 2XZCH 1NBZA 2FL5A 1L0QA 4QRPA 1ADQL 3ARFC 5E1AB 1FL5A 2BVQB 3Q3GA 4G5ZH 5EH1A 4D3CL 3SOBL 4G80A 5C0AD 4EI5A 4YHOL 3CMOL 5C09A 2XRAH 3RX8A 3HZVB 2V9RA 2APBA 4LHUG 1Z0NA 3LEVH 1NLDH 4UAOC 2UYLB 1GGCL 4QRRB 1R3HA 4P49A 1PZ5B 2WZPD 1MI5B 2FATL 2G5BA 2AK1H 3RNQA 1QFWI 2VDOL 4HIIB 1QSFB 3X17A 3H3KA 3ZHKA 3SE9H 2ADJA 1VFBA 5HI5C 3VGEA 3OZ9H 4N1HB 1AJ7H 4HUUB 4JKMA 3LQAC 1LWRA 2W0KA 3TNMB 4APQC 4X6BA 3ZE2E 4AT6A 1BZ7A 2Y4SA 2ZG2A 2B0SH 1AQKL 5FCUH 5A16A 5MERA 1DANT 2J12B 5EUOF 2ZUSA 3BDBA 4G9FB 4LKXB 2QKIB 4OGYL 4P5TB 3RAJH 4Z7UB 1E28B 1JTTA 2IQAB 1JBJA 1LE5A 3I50L 2GJ6E 1IC4H 4OGXL 1CXLA 4GLRI 5DUPL 4KMTH 1CXFA 1NEZA 5C92A 5K9OB 3CXHJ 1C12B 2C9AA 1J86A 3D48R 5T3XH 2D4DA 3MXVH 4AK1A 4QEGA 4XVTL 4NQXA 3WDIA 4LGPB 3RDTB 1INDL 3IFPA 1A7BA 1KLUB 4MS8D 4WO4C 1HI6A 4JG1L 5TE6H 4HIEA 3SKNA 3P3YA 3HAEH 4C56B 4BFBD 2NXZD 5F89B 3HNSL 2A9NH 2GCYB 2EZ0C 4G9FA 1A64A 2ORBH 1E28A 3TYFA 3S35H 15C8L 4TQEL 1AY1H 3ZZ1A 4JO4H 4BH8B 1F58L 3PJSB 4EI5C 2HT3D 3LKPA 1U8MB 1YNKH 4ZAKB 4IRZL 5K9OA 1T1YA 1K8DB 1K4CB 2MNUA 4HJGA 3MLXH 1C12A 4Z8FL 2DICA 4JHBA 5DK2B 4HG4K 3ZKXB 4NJAH 3PGDB 1F4HA 2AJSH 4MD0A 1NCDL 3SDXB 1YMME 5DUBA 1R3JB 5IOPA 5I73B 5ALBL 4PUBH 1HHHB 1S9XA 3X12A 3UBXB 5GS1B 4GKZB 1RFDH 2CO6B 2DKMA 3O2DH 3OKDA 4DK3A 2ZKHH 4Q6IB 4OCLC 1EEYA 2JJWA 4RIRB 3RY4A 3A67H 3RWFB 3SKUD 3CDFA 5HYSA 1CLCA 3KPPB 3PQYB 5I1HH 1B0GB 5KSBF 2JK5A 2AKRB 1X5LA 3RGHA 4LSSL 2VWEC 4ZAKA 5CBAA 5KW9L 2G75A 4HK3J 1N5YH 1YQVH 5JIHA 1E4XI 3PGDA 4OIAA 1JF1B 2K1MA 5DVMA 3IKCB 1SQ2N 3CZFB 4WI6A 1R3JA 3ARWA 3FQWB 1G6RB 1NCAL 3GSWA 1KPUB 5GJTL 3REVB 1MEXL 3LB6D 2VAAA 2Z8VC 3KPRD 4O51B 4HGWB 4V3DB 3DO7B 3HAEA 3VE0A 4R7NB 2QR0B 5T5NF 4M6NL 4KI1A 4XPFL 1CGSH 3QUMH 2DRUA 5L88H 1BFTA 4RZCA 5CSGA 5JOPE 1NEZG 5FHBL 2ICWJ 5DO2D 4FABL 3ULVH 5KVDH 3UJJL 4FNLH 3O6KL 1YECL 5ANMB 2DLHA 1PKOA 1U92B 4WI7A 2IEPA 3LS4H 1NGWB 4OCSH 2E27H 1JF1A 1UWEL 3OJDB 3CFJA 4OT1H 2LVEA 3EGSB 3RWJB 3ZE2F 4PRPE 2IWGA 2Q7NA 4WIQA 1FIGH 4C57C 2N7BA 5EOCH 1R3LA 2BNQB 4PJCE 4M8VA 4B5EA 3WS3A 2FX9L 1XF2A 5DEFB 2H26A 4RMQA 5EPMA 4HH9B 1FFPB 1RJZB 4HV8A 2VZOA 5HYIA 3QQ9D 1DN0A 3MOAL 3PWLA 1I1FB 4P48A 5FGBA 4TRPL 5LXGH 1RURH 2O61B 5TF1L 1ZHLA 3MRJA 4XPTH 3HRZB 4ZAKC 4Z7WB 1K8IB 2QL1A 4L4TE 4M43L 1ND0A 4UILL 2WANA 4I0PD 2Y36H 1OAXH 3ARDB 3QPXH 3EYQC 3C5JB 2ZCLH 2ID5A 3SDDB 4CNIB 1BOGA 1QSEA 4NKOA 5C7XH 2BSSA 5BXFB 3KWWB 4P5MA 3NCEB 1QPXA 3TA3A 4YBQC 3GMRA 4GAJH 1A0QL 1U8LB 5BMFL 4F7TA 1N6QL 3TM6A 5B22A 3UTTB 1FFRA 5E2VH 3GSRA 3QUMA 4Q6IC 1E4KA 2W65A 1YUHB 3WDHA 3LKSA 3OWEA 2Y7QB 5FA3B 1D9KD 3DIFB 3T3ME 1INQB 2O5ZL 1FNGA 4PP1C 5ALCL 5F1NB 2BVPB 5JOFB 1BBDH 4L3CA 4P0DA 3QDMB 4QWWD 3UTSA 4FN0A 2YS4A 1ZEAL 2C7UA 4PJAE 3FB8A 1FV1B 5JO5B 2ZOLB 4QT5A 3UBXG 3Q1SL 1J8HB 3HA0A 3IDIA 3KWWA 3HAEG 3BVNB 3P4NB 1YDPB 5CBEB 1T1XA 4FZEL 1WJ3A 1ZVYA 1U8LA 1FZJB 1OGAB 4IS6A 2E7LA 1RJLA 4PJHE 5DR5L 3Q6FB 2PKDA 1DUZB 2D4FA 5I1LB 1F42A 4OD1H 4K9EL 5C0AE 3JTCA 1QLEH 1TZGH 5FGBC 1ZHNB 2FX7H 5DD0L 2HN7B 5F1NA 4A6YB 4M1DH 1TJGH 4ORZC 4HWZB 3BUYA 2BMKB 1FVDB 1D5IL 3OHXA 1FAKT 3RX5A 1FV1A 4L5FH 4U1SA 5GRWA 2F54D 4M02A 1EEZB 5FUZH 4X6CE 4P23A 4OFDA 1RZJL 2EDWA 4G3YL 3VXTB 4XNMB 5H8DA 1PYWB 3TA3C 5F97E 4Q9RL 2FGZA 4Y19A 4S1QH 4ZPTA 4HK3N 5GRUH 2NY1D 4P3CL 3UAJC 5K9KA 2X10A 4Y4HB 5I1LA 3PHOB 3FO1B 3L3KB 1E4KC 3CFBB 3TO4A 5GGQL 3HC3H 5DMJB 5I76A 1T0MA 4JO1H 3IU4L 4J8RB 3RWHB 1EBAA 1MFAH 1BVLA 3HZMA 1C16A 3PWVA 1DBJH 3H2WA 5I66A 3WNMA 3PWJB 4HKJA 1RULL 3O6FB 1FDLL 5DD1H 1EAPA 2PYEE 1GGUA 5H2BB 4LASH 3BE1H 4G6FB 1ZHKB 2OXGA 3V0WL 2E7LC 1JUFA 1A3QA 2AI0L 3EHBC 4Y4HA 3QXAA 1WBXB 3PHOA 3FO1A 3NFPA 4Z5RA 1F4YH 5C0FB 2I60L 3QULA 5K9JL 2XKNB 4MSWB 3VXPB 1FNLA 4MA8H 3NCBB 1ZT7A 5CMAA 4U0RC 3B6SA 1FZMB 3WN5B 3K4ZA 1HNFA 1S7QA 2Q86A 3NCJL 4I18A 4HCRH 3GMPB 4HLZH 4S0UC 5E00A 4H1LH 3IXTB 1FFNA 5J12B 3TBYB 4MA1B 5FYKD 4XXCA 2Z31B 25C8H 2DI7A 1NLBH 1CXEA 3HNVH 1IZJA 4U0QB 4P23C 5HYQB 1X3DA 1CFSA 1RZFL 2W9EH 5IHBA 4O9HL 1ZHKA 3NBNA 2APVA 1DL7H 2B4CL 5GISL 3DETD 3LN5B 3CU7A 3T3MF 4YR6A 1NCBL 1RUPL 3GMOB 2C3HA 1TQCC 2P8PA 1M71A 5FO7A 4Y88A 3QPQD 5ABDE 2VRAA 3TO4C 4N68A 1OM3H 4OIIH 2XKNA 4N5ED 5E9DA 3OSKA 2CKBB 1YEHH 4WDIA 2VE6A 4X80H 1MH5B 3MJGX 1S9WA 5E2JA 2R2BA 4C55A 2YOCA 1N64H 2WBJD 3IF1A 4KK6D 3VFVB 1FO0A 1RY7B 1KPVB 3K4DA 5EOTA 5F8RC 4PJ5D 4PJHF 2W9DL 3GKZA 3MRLB 1GAFL 4NM8L 3KYNA 2QBWA 4FQCL 3TC9A 5EUOA 5BCAA 1A9EB 1ONQA 3LN4B 3LN5A 2PW1B 4OZGA 3PWPE 2R2CA 1VGEH 5DA0B 1FNSH 4OD3L 3MRBA 3MNWB 3WFBH 5L6YL 4Y4HC 5EBLB 2GSIA 5BRZA 5IMKA 5AG9A 5HHNA 2NNAA 6CGTA 5I0ZA 3B9KA 1Q94A 4HUVB 5TGBB 5I2IA 3HMXA 4FQXB 2YUVA 4OD2A 4G42B 1R5WA 2RCSH 5EU4B 4D0DB 5C0CB 3MRPA 1A7QL 4X6CF 4I18C 2ZSVA 4Z95H 3MO1A 4GG6F 4H1LA 4Z7VA 3OPZL 5T1DH 2XZAH 1G7MA 3MBEA 5TQ0H 4ZPVA 3ARRA 4LSVL 1I7UB 2B1HH 1F4XL 4XXCC 5DSCB 4HBCH 3RWIB 3R4DA 1R24A 4KRPB 1I7RA 1J87A 3LN4A 3TWCL 1G7LB 2DD8L 4R7DB 2X1PA 3IETA 5EU5B 1L9MA 4QRUB 2EEAA 4K8RH 2MOVA 3SDAA 3P0VH 1SHMA 3QDJD 4LLMB 3RPIB 1P2CA 5JQ6L 2KUTA 4POUB 4UU9A 1RPQA 3WJLA 2XWBA 1MIEH 3KNBB 2E3VA 1WWAX 2KDGA 4R8WL 2NZ9C 3U2SA 3V6ZB 3FB5B 4PJGB 2AJVH 4MA1C 4LSRH 4OBSA 1YNTA 3VXSD 4XX1E 4TN9A 1U95B 1U8KB 2DQHL 4WRLA 5F44A 4PJ8B 2ATKA 3QI9B 3DSNA 3WKMH 4D9LL 4R7DA 5DJAA 2QJDA 1BP3B 2B8OT 4NFCA 4RAHA 3NA9L 4LEOB 5FV1L 4Y4FB 3MRKA 1K6QL 5AYUL 5J06A 5D1QB 2IGFL 1KT2B 3DX8A 3HG1A 3B9KC 4XP1L 3LSOB 2MTPA 5DMGC 3E0GA 1UZ8A 1V7MH 1D5BB 3O2VH 35C8H 5ADOL 3VDAA 4YJZL 4PGZA 1XIWA 1WBZA 3EO9H 3C5ZD 5E08H 4P46D 1YN7A 1PX3A 1IL1B 3MBEC 3H9SB 1CGVA 4UQ3B 1MIML 4TSCL 1MI5E 4LKCB 1MLBA 1UCBH 5BV7H 1MPAL 3H0TA 4L8SB 1BVZA 1WZ1H 1S7VB 3AAZA 3G6JB 1MFNA 1ZVSA 4FTVB 2XA8H 5GZND 4BQBA 3ULSA 1X4YA 1MWAL 4R2GC 2X2YA 1DUYA 1RJCA 5E5RB 3SDAC 2AAVA 5EOQL 3OF6D 1YPZB 3RBSA 4FQXC 1RHHB 4U1IB 1E6JH 4JHWL 1FE8H 1CFNA 4ZS7H 1W8NA 3WJLC 3BQUD 5I30H 3KPMB 1S7WA 4Z76A 4ZFGL 4UTBH 1I8LA 2YMXL 4QHLA 1RIUH 1QACA 5AWNH 2B1AH 3H9SA 3N1GC 5GRYA 5IF0B 3MJ9L 2J8UE 1T0PB 2XPGA 3NABL 5TPWH 5HHOE 1HQ4B 1FLRH 3DMMB 2COQA 3MCKA 4RA3A 1V7NL 2P49B 3GSOB 5F1OB 5ILTH 3EYVA 1ZVHA 2OL3H 3SE3A 2J5LC 1WZKA 2G60H 3QB7C 4AM0A 4UIMA 5ICXA 1F6AA 4DVBA 1QZ1A 1UM4H 3F5WA 3WKNA 2X41A 2GT9B 2VZVA 1KYOJ 4ZD3H 4MJ5B 3SDYH 1TXKA 2A6DA 4JKKA 4LCYB 4UV4L 5ESAB 4JQIH 2Q8AL 4RSVA 4N5UA 1XIWC 1P84J 3G5YB 4K55A 1BD2B 1DQMH 4M62H 1BQLH 3QUKB 5MEOA 1ZHBA 2V2TA 1MHEB 3FN0H 3L9RB 2ZOKB 4P57B 2V2XA 1V3LA 1BIIB 3NPZB 3QQ3A 4PS4L 2AJUL 4JRXD 4U3XA 4N8CH 4K8RC 1ES0A 3V5HB 1YMMA 5KZCB 4MB4A 1ZLWK 4MCYA 2DDQL 3DXAD 1IAIH 4YHNA 4N1EA 3LV3A 4PY7A 4ZTOH 1RU9L 3HI6L 2D2OA 1IC7L 4HFWB 4LCYA 5GJSH 1CGWA 3VXMD 2DI9A 2YD3A 3VRLF 1EHXA 3RUGB 4NRZB 2Q76A 3VFOA 1AIFA 4ZQKB 1DQDL 4LPUA 5GSRB 4OSUL 1S8DB 5HBBA 3G5XA 1YYLH 1S78D 3QBTB 1LO5A 2JE8A 1T04B 5C0GB 5DS8B 1KLGA 1C08A 2OL3A 1P53A 2Z8WC 4Y5VA 3SE3C 2BJML 2ADFH 4KWUA 1X4ZA 3V5HA 5J13C 1YEGH 4MDIB 1LVEA 2DQTH 3P9MB 3CC5A 2HLAB 4I4WA 3STZB 3KPSB 3WFHB 4AZ8A 1D6VH 5JLZB 4EZMA 4YZFE 1JYVA 2QQNL 4HFWA 1QD0A 1P4LB 3OB0K 43CAA 3U83A 4CU8A 4BSWB 5FO8A 4MGXA 1ITCA 1YC7A 5F7DA 3FFCB 3MRIB 1CLYL 4XCEB 5IUSA 1ODAA 1NCTA 3QCVL 5HDQH 3NN8B 4KH2A 1HH6A 5F88B 4V2BA 4X6EA 2IAND 2NYYD 4Q9BA 2KPNA 3D25A 4Z7UF 4HULB 1HNGA 1QFWH 1UWXK 1UVQB 2VL5A 3FONB 2FJFB 4UOW0 3OXRA 4PJCA 1Q9KA 5DZOA 5TFSL 5JLZA 2IMNA 1U41A 4PJFB 1F45A 2J8UF 5IJKA 5LQBL 1RD6A 3DHMA 4N9OB 3BZDA 3JWDL 2D31A 5SWZB 4L3ED 2EDOA 3AS0A 4YHPB 4K7FB 5I1CH 4XC1L 5D1ZB 5F9OL 1HE7A 3PGFL 4Z7WE 4C83A 1IAKB 3QRGH 3QZWB 3F7RA 2AEQH 3KPLA 4GLRH 4L4TA 1CL7L 2MJWA 4JPWL 2DLFH 5F7NC 3TO2A 1N6UA 1NDMA 3FQTB 1W0WB 3QUXD 4FQIH 4Y5VC 1A6ZB 5TE7L 4YEEA 2OLDA 3T4AB 4KMLB 1EV2E 3RWGA 1J10A 5CEZL 2VH5L 2XWTB 1JPTH 2YD6A 1WK0A 2VC2L 2JCCB 4LCUB 5D4QA 5IG7B 1MJ7L 4LPXA 1DDHA 4R4NC 3BPOB 4BA8A 2AS5M 2EE3A 3FAWA 4NT6A 5JIPA 1JGEB 3SCMA 4U1GC 2EYTA 5DWUL 1WAAA 2HJLA 1JPGB 1QFUL 3QDME 1YMHA 4HIHA 2YWYA 5HGHB 5KSVB 1RVFL 1ZKAA 3E1F1 3JBG7 3QCUL 2QQKH 3B2UC 4X7SL 4HIJA 4PJAA 4DGIL 3BWUC 3GHBL 2OTWB 2YC1A 3T04D 3RVVD 3U0TA 3U7YH 4DZ8A 1CDIA 4K2UH 4P2QB 4XP4H 2KZWA 3KLAB 2FB4L 3GI8L 3GMLB 1UH2A 3TBVA 4PGCB 5D2NB 1CF8L 5IJKC 4KQ4L 5DMIL 5DT1H 4P2RD 3P4LA 2YR3A 1MRFH 3C5SB 4P9HL 1NMAL 4DW2H 5C0AA 5C3LD 1KC5L 4JHAH 3AXLA 1CN4A 2BSTA 2YBRA 3GMQA 1FCCA 1N8ZB 1ZGLP 3L7EA 2NQCA 5EWIL 6FABH 4FXKA 1U0QA 2VQ1A 3W9DB 1E4XH 2FBJL 4AIXA 1I7TA 3MA9L 4QOKD 4X6CA 1CLZL 1YEJH 4FQHA 4JQVA 4JVPA 3IJYB 4OLYH 5CSBA 3R06B 3CPLA 4OFPA 3FTGB 4WTWA 2KQMA 3H3PH 1UJTA 2H3NB 2QEJA 3I85A 3KR3H 4OM0L 3CU1A 1UB5A 1A4KA 2NXZB 2MKWA 3S88H 2YEZB 4J3SA 2Q7YB 3F58H 2OM5A 5DJDB 1FVEB 1KJ2H 1MQKL 3SCMC 5TE4L 2VISB 4E0RB 5ICYB 4Q7DA 2JIXD 4ENED 4U1HB 5DUMH 4WVRA 4KK5C 5BZWB 1RIHL 3CFCH 2ZUTA 3SE4A 4IRSB 3JTTB 4E41D 4M93C 4NO3A 1KTRL 5EUKB 4BZ2H 2DYPB 2XZCL 4AY0A 1DVFD 1W72H 3KYOA 1AGCB 2Q3AA 5I15H 4PRHD 4KUZH 4MS8A 2CJUL 4NNXA 4ZS6D 1U8JB 2HVKA 1U42A 4G5ZL 5JW4R 4Z7WF 4MJIB 2HT4C 4M6MH 1RSFA 4XZUA 2XRAL 4Z7NE 2A6IB 3C60B 3LEVL 1NLDL 3RVXD 4O2EA 3CXHK 3CFDB 2AK1L 1NFDE 2IH3A 2V5TA 2XT1B 4HGKC 4U1HA 1CLOH 4B7LA 1BQHB 5J6GB 1I3VA 3SE9L 5FUOH 2JKXA 1CDHA 1QTYT 2IPKA 1X9QA 4GG8B 3MLPA 1AJ7L 4JRXE 2DLGA 3WXWH 5DTFA 3FT3B 3RTQB 5FCUL 2B0SL 3X11B 4UDUB 2ZSWB 3STLA 4JQVC 3EYFB 3DBXA 3RAJL 4JVWA 2CK0H 3S37H 1MCQA 4WTXA 4U6HA 4DJMA 4RFEA 3HUJB 2Y1VA 2ZWLT 1IC4L 4NO0D 5EB9A 4Y1AE 4KMTL 2C1OA 2NY5H 2P24A 4R6UA 4L1DA 3NFSH 4J12A 1LQSR 3DUSA 2JJVA 1KJ2A 1PY9A 4HDIB 1DBBH 1RIVH 3KYKH 3JWOC 5GGTH 5T3XL 3MXVL 2Q20A 1N2RA 3U30B 2D7TL 3GSNH 3DTXB 1LE9B 3SE4C 5I8KH 3NZHH 4NYLB 3D0VB 2FJHB 3EDEA 2HG5B 4KJYB 3HC0B 2A9NL 2ZSWA 3OGCA 4HAGA 3OJ2C 2ORBL 3IJSA 1H3XA 4MS8C 1WICA 1V3KA 3KPRA 1U8HB 5FM5O 3S35L 1AY1L 3PWPA 3RKPA 4JO4L 4NQSB 4NNYB 2NXZC 5EZOH 1TQBB 1YNKL 1ZLVH 5DGRA 3CGTA 4LDOB 2UV3A 1HN1A 3MLXL 4ZG1A 2DS4A 2V6HA 3A6CH 3P9LB 1GZQA 3KS0J 5IB3B 4NJAL 3TH3T 2AJSL 4JFFD 2HT3C 4HWEH 3TIDA 1X5JA 3ZL4H 1MQ8A 3MFFB 3D2UD 4I0PB 3SKOA 3FQRA 4PUBL 4K7PY 5BJTB 1O7VA 1BWWA 4WUUD 1RFDL 4MNQD 2ILLA 3U7WH 3MJ8A 4OKVA 2FYYB 3O2DL 1DLFL 1PQZB 4F7CA 3B9VA 3C09B 3CAFA 3O11B 3QWQB 3QDGE 1CQKA 1Z9OA 2MHAB 5JIIA 4YHMH 3TFKD 1N5YL 4U6YB 1YA5A 1YQVL 3NGBB 1JK8B 5ITFA 4RMVA 5LJYH 4ODHH 4Y2DD 1D9KB 4LSPH 1HHKA 5GGTA 2W07A 1R3KA 3V6FA 3GSNA 3ARYA 1OQOA 1UXSB 4M00A 4KZEH 1UJ3A 3QJHA 3ZDZE 2G2RA 4I0PA 2VLRD 4OKDA 4ZSOE 3BUTA 2NCMA 4QHUA 2YK1H 4Z7NF 3FRUB 2CLRB 3K8KA 4PV9B 1CGSL 3QUML 1H3WM 1Y0LB 2VN7A 5IK3A 3W0WD 1U9KA 5L2KE 3ULVL 5K93A 1NFDF 5KVDL 3C8HA 2VLKB 1WCQA 4BSJA 3PL6B 1JV5A 2NX5B 4RFNC 1AI1H 4NPYB 1S7XA 3BAEH 3LS4L 4WEBH 4P99A 2QHRH 2E27L 1I1YA 1DQLL 3QIWD 4MZ3A 3L3DB 4ZOEA 5DO2C 2HTKD 4JZOB 4O2CB 1T83A 1XGTA 2VDML 3HKFA 4OT1L 3I6GB 3VRJB 2P8MB 3OKNA 4KC3B 4TOYH 1FIGL 5EOCL 3ZTNH 5IB4B 4YXHL 5IW1B 4MX7B 5JNYA 5EU6E 1KCSH 1YEDA 4V2CB 2F54B 4WWID 1QLRB 3FRUA 4PV9A 4X99B 3G6AA 1KB5A 3FAXA 3ELAT 4J23A 3FT4A 1RURL 4AIZB 1ULVA 4XPTL 1WCBB 4U1MA 3QQ9C 1K4DA 2Y36L 1OAXL 5EG6C 2MQ3A 4XAKD 1UYWH 3QPXL 2CRYA 4MNHB 2ZCLL 3UJIH 4JDVB 3K46A 1UJ3C 5C7XL 4YDVB 4I0PC 5C08B 2AXJA 2GK0A 4GAJL 4GOSA 1TNNA 3RPKA 3OAYK 2MPAH 4QOKE 4GXVH 2J8UA 2WAHA 5E2VL 4R3SA 3VW3H 4KK8D 4GMTH 3JVGA 5HHOA 3WE6A 4M9PA 5IHLB 1S3KH 2CQVA 4AIZA 1MCPH 3LY6A 2V5YA 1G6RH 3GSXA 4YPJA 4MZ2A 2FLBT 5HI3D 1BBDL 2WWKT 1M1SA 2BXZA 2A77H 5F71A 3FMGL 4G6KL 1RI8A 4RAUA 1D9KC 3D0LB 4EXPX 2YD4A 5CD3B 1T83C 3ARVA 5H37G 2GQHA 1XGUB 1BD2E 4YDVA 4S1RH 5FKAA 5TDPB 1JGDA 4OFIA 4QWWC 1A6WH 1BVKB 1EO7A 1N5AB 3T0WA 1RAMA 1QHPA 2VJXA 5F7HA 2YSSB 3WS6A 3BIBX 1Z5LA 4EVNA 5ITBH 2LV4A 3MCLL 4PRHE 3QEUA 3WUWB 1XGRB 4IOIB 5FYJL 4N8VB 4OD1L 2NR6D 3LRGA 3U7AA 2RJMA 1QLEL 1TZGL 4PD4J 4UQ2A 2FX7L 3OKMB 2CK2A 2UWEA 1LDSA 1E4WH 4FQ2H 4FQLH 2CIKB 4M1DL 1UQSA 5IP4A 4R0LA 1TJGL 4LVHC 4X6FA 5SV3A 1OPGH 5E2TL 1I8MA 4UUJA 3VD4A 4L5FL 5FV2A 3HMWH 3MREB 4H25A 4P4KD 5EC2B 5FUZL 5AYQA 1I3GH 1XGUA 4G8GD 3HLAB 3S4SA 1JZ4A 3NZ8A 1N59B 1KB9J 4GQ9H 5MI0B 1MHCB 4PJ5B 2NY3B 4KROB 1IGFH 5GRUL 1J0YA 4LLYB 1BM3H 3VMOA 2NY6D 3NPSC 4MDJA 3JVGC 3LMJH 3HC3L 3BZEA 2H45A 2PW2B 5CHNA 5DEZA 3WXVH 2NY1C 4D0BA 1JNLH 2F5BH 1MRDH 1K2DB 1KENH 4JO1L 4WWKA 3J7HA 1S7UB 3QNYA 1JI2A 4YHYB 1MFAL 3QEQE 4RDQF 4N5EA 1F3RB 3B83A 1DBJL 1X7QA 4M5ZH 2X4QB 4TSAH 3F7VA 1OY3B 4ZFFA 1KGCE 4WW2F 5FCSH 5DD1L 2LTQC 2Y06H 3CUPA 3GNMH 5BVPH 2WBJA 5DVNA 5CINH 2XN9D 4LASL 4L8CA 4UIKH 4V1DD 5IVXB 1YJDC 2BHUA 4HHAB 5BW7A 5E8PB 3WS6C 4CADB 3WJJA 1J1PH 1F4YL 3QUYB 4OZIE 5IV2A 4P3DA 3U1SH 3T4YB 4MA8L 3UPRB 5FGCB 2ICES 5FK9A 1DQQA 3PIQB 3BGFB 1MFCH 1J5OH 3GMMA 1LMKA 4HCRL 4R0LC 4XHJD 5B38A 4WFED 4HK0B 5LCVH 4WFFD 5E7BA 1DLHB 25C8L 3G5ZA 3HNVL 4CVZA 2ITCB 5IWLA 1WC7A 4GMSL 4LPVA 4GXUM 1FYTD 2NLJB 3C6LD 3E6FB 3KYAA 4WUUE 4XP5H 1DL7L 3L95B 2DQFA 4MNQE 3WEXB 3FQNA 4LHQB 1DEEA 5DD6A 5HI4D 3VXSB 4DVRH 2UUDH 1P7QD 1J1OH 1AKJB 2HLFD 3GSUB 4DZBB 1BLNB 4XP9H 1OM3L 4OIIL 4NCC2 2DWEA 5L9DL 1QHOA 3DETC 5ERWB 3UPRA 1OSPH 2E9BA 3RP1A 3PIQA 4KTDH 3ZSSA 3R1GH 3CSBA 5DJZA 3QPQC 1RUQL 5FM5M 3HCVA 2WWKO 3QDJA 1N64L 4N5EC 2JCCE 5J9PA 4OAWB 1F4WL 3UZEA 4M8QA 2PYFB 2VLRE 1TETH 3TPUE 3BH8A 4OZFB 2WBJC 3C5ZB 5DC4B 1U93B 1OP3K 1NGZB 4ZUUB 3PABB 1VGEL 3TVMA 1OAUH 2FHFA 5BW7C 1IJ9A 3GSUA 4KRLB 3WJJC 3WFBL 4JE4B 3EOTH 3W0WE 3QIUB 3NIGE 1GHFH 3CSYB 3ZKQD 4OUUB 3W11D 1V5JA 2X9WA 4F58H 3QP3A 5JMOC 4JJ5B 3CH1A 2RCSL 1T7WA 3RUGF 5DGQA 4LVEA 1R6VA 4JY6B 1T2QH 4Z95L 1VGKA 4RQQB 5T1DL 2XZAL 2R29L 5TQ0L 3MODH 4ZNCD 1OB1B 1WT5C 1BZ9B 4HBCL 3DVNA 5IWLC 3C5ZA 4NKMA 1AGBA 4XH2A 1KCVH 4P46A 1NGZA 1W0VB 1U3HD 1MLCB 1UC6A 1U3YA 4NQED 1TENA 1G6VK 3BGMA 4I3GA 4ONGH 1MCEA 4DKAA 2APWA 3WNLA 1AP2A 4K8RL 3IB4A 3LHPH 2V2WB 3LZFH 3P0VL 4PV8B 3BFOA 4JFOB 3V0VB 3D85D 2F19H 5I16B 3F8UB 4BSVA 5B38G 4LPCA 2A1WH 3LRHA 1MIEL 3VDBA 3S8WA 3PNWB 4Q0XH 2J88H 1QFHA 3VWJD 1RK1A 4PLNC 2CRIA 2P47B 1RUKH 2AJVL 3AM8C 4LSRL 2R9HD 3C6SA 2ARWA 1T5XA 3BQUA 4TNWF 4U1LA 4OZIF 1W0VA 1L0YA 1UXWB 3HNTH 5I75B 1P1ZB 3TVMC 3VRIA 1IVLA 2YA0A 3L5WA 4GT7A 2NXYD 3TBSA 1Z9MA 4OV5A 1XGYH 1WQVT 4PJFF 4XMKH 3ARSA 3ECBB 3O2VL 35C8L 2GJZA 3L3OB 5F1IB 3EO9L 5E08L 3VXNA 2PO6D 1G7HA 3DXAB 4LPYA 1XFPA 4Z7OF 5K9QG 4QNPF 3W39B 3VGFA 2BSRB 5CIPA 2R4RH 3VXMB 2ZUWA 2XQYK 5M94B 4NQTA 3C5ZC 4QCIA 4P46C 5D2LE 1N3NA 1UCBL 5BV7L 1OGTA 4NKDB 3BYYA 3R8BB 1WZ1L 1T1WB 1NFDA 1JYWA 1KEGH 2XA8L 1FFQA 3LCYA 4PRIB 1Q0XH 1KCRL 3T0DA 3G08B 1GL4B 3MRRA 3MYJB 4A2MA 2IF7A 4MA7H 5MP6H 2JCCF 4PDCE 5BO1H 2LE9A 2VOTA 4KJPC 4JRXA 1E6JL 5IEKB 1FE8L 4ZS7L 2H9GA 3F12B 2MQ0A 4P4RA 2QADD 2BY1A 4I9WD 3EOAB 1IGML 1J0IA 4UTBL 1LK2A 3L5IA 4JN2A 1RIUL 1I9JH 5AWNL 4OZFG 3O6LH 1AC0A 2XACC 5INCA 1F2QA 1KELH 3BQUC 4Y1AA 4PGEA 2OYPA 1PW3A 1HSBA 1FLRL 5FXCH 3NIGF 3V5DB 1BWMA 4F7MB 4DUXA 2G60L 2XYCA 4QRTA 1B0RA 4G6JH 3K2UH 4WU7B 1QR4A 1NMBH 1UM4L 3HZKB 5B8CA 5HHMD 1IM3A 1EA9C 2ADIB 2VXUH 2IANB 2DWDB 3FB6B 2N7AA 4K3JH 5GHWH 3SDYL 5DRWB 3HE7A 1I8KB 5FB8B 3PV6A 5IB1B 4QXWA 5E4IA 3B3IA 5I0DA 1IAOA 4U31A 1DQML 4M62L 4HXBH 1UWGH 1ITBB 4RCAA 2HVJB 3MNZA 5CJ8A 4YWGH 3CCHB 4LLAA 3FN0L 1D5MB 4NN7C 5K59E 1AFVH 1KSRA 2KKQA 4MD4A 4HZLB 2E8YA 2DQIL 3RNKA 3DYPA 4N8CL 2EEBA 4PJEE 2GK2A 3HPJA 1IAIL 5DJCB 3OXSB 1WLHA 1XR9A 1HWGB 3QUXB 1NH6A 4GRLA 3VFRB 4LNRA 3RWCA 4ZTOL 1REIA 1XCTB 2BNUA 3BPCA 4XRCA 1FFOB 3HTLX 2E6PA 4HKXB 1TZIB 1KF9B 1P4IH 5KSAA 3BP7A 4MA3A 3FHQA 4WFFE 3E6HA 3QDGA 1TITA 4TUJA 1EUTA 4PRBB 4Y2OA 4MXQA 4RGOH 1FYTE 1OTSD 1YYLL 4L3EA 5IW3A 3QUZB 5ACLA 5IHZA 3OX8A 3QFDA 2GJJA 4F2MA 4UB0L 2OMNA 5HGDA 2Y5TA 2ADFL 5BS0B 4JFXB 1S78C 5HD8D 3ARZA 2DQTL 3I3EA 4UINH 5CKGA 5B8CC 1D6VL 2VR4A 3VFMA 1PEWA 3VFRA 3NCMA 3HE7C 4Y7MA 1NGQH 3GSQB 4KHTH 4MQSB 5D2LF 1HHGA 1T0NA 4X4ZA 2VLKE 4XMLL 2NX5E 4M4PA 3SE8H 2ARJB 5E1HB 2NY7H 4GBXD 3TNNB 2ED8A 4HUWB 1DN2A 4MAYD 3T2NH 1TJHH 5HDQL 3O3AA 2Y9RT 4LMQI 5I1GH 1GJIA 4KMQA 3EJZD 3ZO0A 1VKXA 3V2AR 4MNGE 3MRFA 4QRSA 3VXOA 2NMSA 5IFJA 1QFWL 3HUJF 5DYOB 1UGNA 2IQ9H 1IGCH 4I48B 4NDMA 4YGAB 1JRHI 2NYYC 2VR5A 3MJ7B 5C0JA 4G8EB 2EDBA 3GGWB 3W9EA 2C3VA 4RNRA 5F96H 4WW2A 3U4AA 3RWDB 3Q5YA 2VIRA 2OJEA 32C2B 3GIZH 3C9NB 4R4FH 1QRND 5I1CL 1B0WA 4PRDB 3CDYA 5D7JD 2I5YH 4MD5A 3QRGL 3JV6B 4P2RA 3BXNB 2AEQL 4LLVA 5ESQA 5KSUB 2GTZB 1D3CA 3INUH 5CD5C 3FCTA 1KULA 1HHJA 2Z35A 1KPRA 2G9HB 3M17A 3GBNH 3FZUD 1HH9A 2XTJD 5DJXA 5F7KC 3CVHH 4AMKL 4XB7A 2JIXB 3ILQC 4TUKH 3OG4B 1M7IB 1T6VN 4N0UE 1ZS8B 3DGCR 4RMRA 1JPTL 5KS9E 1EAJA 2FRGP 3QQ4A 3RQ3A 4QOKA 3AROA 3VD7A 5K59F 1U8PA 5ISZB 1JGVH 3ROOA 4JZJA 5C0BD 2OZ4A 1YEIH 1PFCA 1UA6H 3QIBB 4EUPB 4O58H 4LLQB 5HHXH 1O5DT 1KCUL 3AMKA 3VWKD 4D9RD 3TCLB 5C07B 4LP4A 3B4NA 5F6IC 5EZIL 5L8LB 2WUCH 2BCKB 4PRAB 1Y6KR 4N0CD 1XGQA 2ICEA 5I71B 9CGTA 2QQKL 2I27N 5HDBF 4NJ9H 5SX5H 5F8QC 4WI2A 1K5NA 3OKEB 5BOZG 3U7YL 4K2UL 5F9WB 4XP4L 5DZLA 4E41A 3EO0B 2X9YA 1OCWL 1DVFA 3RVVC 4MB3A 4PRHA 2NY2B 5EBWA 3CD4A 3OAZH 3GJFK 3V8CA 1MFEH 1MRFL 2FO4A 3TIEB 1M6OB 4JHAL 2BC4B 4NO0B 4UTAH 5AAMA 4AEIH 4OM1H 6FABL 1H15B 1MAKA 4MWFB 4JY4A 2BK8A 1E4XL 3BEWB 1VERA 2HFEB 1LEGB 3CVHA 4WENB 1MJJA 4AEHH 3QO0B 4JR9H 2H2PD 3NCCB 1U3JA 1ADQH 5F1SA 4OLYL 4JFDE 3WNNA 3WNKA 3H3PL 4NHUA 3HI5H 4NN5B 2FWOB 1LEKB 3KR3L 4ODTH 3PDOA 3REWA 5IR1A 5D8JL 2XFXA 5T5FH 3S88L 5HGBB 4XNZB 3EOBA 3F58L 4JZJC 4PJBB 1B4JH 3D39D 1NUNB 4ODUB 2VDLH 2VUOA 5IMOB 4JDZA 5GGUB 4BYHA 3VGGA 5CJBA 5IMLA 2CH8A 5ID1B 5DUML 1J1XH 4OF8A 3CFCL 4ONFH 5C0DB 3QEQA 1IGYB 5CEZD 5HYJD 2BY3A 3I75B 3RA7H 3W2DH 1AGFB 3HR5A 4BZ2L 4ENEC 5A2LH 1BFSA 4F9LA 1W72L 3MRNA 4ZOBA 5HHME 5I15L 4KUZL 4IRJB 2DQJH 4OGYH 4NO5A 2DLIA 1FVCA 3T08A 4M6ML 1ZLSH 1FL6B 3FFDB 1DVFC 5JXED 4XXDA 4PJBA 4OZIA 5D7LD 4ZS6C 2VXQH 3MV8D 3RGVB 4PPTA 4OLZH 2Y72A 1F2XK 1T7ZA 2C1PA 5DHYB 1SBBA 5ID1A 5I1EH 2VABB 1D5XA 4Z7QF 3RVXC 1NGXB 1INDH 2EZ0D 5FUOL 4JM2D 4QRPD 1KTDB 3KG5A 5EO0B 1GOHA 5CWSB 2A6KA 5KS9F 4Y2DB 1JZ2A 3UCRA 5GS2D 2ADGA 2XNAB 3IDGA 4JFFA 3WXWL 2AXGA 1G7IA 1CI5A 4JGUA 3W5MA 5C09D 2VZSA 3HNSH 4J3OC 4E42A 3HC4H 5FA4A 1G84A 1ADQA 3N50A 3D2UA 5F9WC 5JHLH 1R0AH 2JTDA 5I8EA 4ESKA 2OR7A 2CK0L 4WUUA 3S37L 4IMLA 1QNZH 2X4NB 4PLKD 4MNQA 4AYFA 4XAWH 2EKSB 4UOW1 3NH7H 3ARTA 2AK4B 2NY5L 3BP4A 4PJXB 4IRZH 3QO1A 1CT8B 3NFSL 5FYLE 1U8NA 3KJ6H 2OS7A 1H9VA 3GRWH 1DBBL 1RIVL 1PSKL 4FQPA 5GGTL 4ETQB 1LO4H 4ORGB 5I1IH 3N85H 3GSNL 1M05B 1CXIA 2CLVA 4LMQE 5I8KL 3HE6D 3NZHL 4HUMB 4D9QD 1B6UA 2I25N 4KI5D 2EO9A 2HJKA 4GS7B 4UZGA 1CG9B 1T4KB 1FNFA 1JTPA 1Q9OA 3RVTC 4F9LC 4HWNA 1YC8A 2VLRA 3NCFB 4U1KA 3TPUA 5CAYB 5IB2B 3GB7B 4D2NA 3WIIH 1WFTA 4F9PA 1AC6A 1S5HB 4LSSH 5EZOL 3BO8B 4PP8C 1NCCH 3E3QA 1KCKA 3ARGB 1F8TH 4QRQB 3W0WA 1KTLA 1GGYA 1JPFA 5E8EA 3RVUD 5SV4A 5F3HA 1TVBB 1AHWB 3TN0A 2ICWB 3D18A 1P5UA 4WNQA 4K7PH 4HWEL 3ES6B 5JIKA 2AJZB 5GJTH 3ZL4L 3QH3A 3QIWA 3DRQB 1T3FB 1VENA 5IM7B 4PGBA 3U7WL 4XNUH 2ERJC 4Z0XA 1EDQA 1XCQB 3DUUB 2W91A 5HHPB 4BK4A 3DROA 2SEBB 2Z8SA 2R0LH 3TV3H 4HS6B 5FHBH 1JZ7A 1S7TB 2X4PB 3WNPA 4N9GB 3O6KH 4UDTB 3TBTA 4OI7A 4YHML 3SKMA 3S7GA 4QRQA 2VUYA 4PY8J 2X05A 1QRNE 5E8NA 5HJ3A 3S36X 1RZ8A 4ODHL 4LSPL 1QLFB 1KJ3H 2Q8BH 3QCTH 4NUJB 4KZEL 5HDLA 2FIKB 3BPLC 2XTJE 5EU3B 4PJ7B 2YK1L 1QQDA 4XCYA 1T6WA 5DD5H 4ELKA 1JWSB 5LAXA 2F9BT 4TRPH 1S7TA 5F7LB 5T3XD 1ZAGA 5DF0A 4KDVA 1AI1L 4F9PC 4YFEA 4OJFH 2FGWH 5C0BE 4PBVC 3BAEL 4AL8H 3E3QC 4YAQB 4WEBL 3QG7H 2QHRL 4X8XA 2I9LA 2R0WH 5DJ6A 3TT1H 4XVUD 2ZUQC 5C0EB 3TN0C 2CDEB 3OKKB 5CUSH 4KFZC 1IM9B 1OAQH 4D8PB 4NQVA 3T0ED 2R1XA 4TOYL 4N8PA 1QO3A 3QIWC 4HPOL 4NRXA 2HTKC 4UMGA 1KCSL 1V3JA 2X7LB 3QNZB 5FGRA 4P4KB 1DQJA 4X6DE 2NTFB 4G8GB 3VA6A 1OT1A 3PF2A 3Q6GH 1JWSA 5EU7E 4CW1B 1S7RB 5AD0B 5FKPA 3QXTA 2QV2A 2W60B 4LCWD 5JA8B 4R97C 3QNXB 2NY6B 5IMMB 3IDMB 5EIQA 3U79A 2L7UA 1G7PB 4IOFC 5E5MA 4LCCB 5C0EA 2OTUA 5HHQB 3PXJA 4I8DA 3V5KB 3L3JA 2H6PA 1LO0H 1UYWL 3CK0H 1MVUA 4ODXB 5HHVH 3UJIL 5DQDH 4EEEA 1A8JH 3S5LB 3P2TA 3RL2B 4L4VD 4FZEH 2GITB 4IIQA 3CVIL 3GSVB 2H32H 3MLYH 2MPAL 4GXVL 5CSZB 2NTSP 1OWRM 3I9GH 3K2MC 2BY2A 5DDHA 4GMTL 2CPCA 5KOVC 2RFXA 1LNUA 4V1DB 3DVFA 3DRTB 4GAYA 4PD4K 5FF6B 4ZXBB 4NP4L 1S3KL 3H9HA 1JGUH 1MCPL 1G6RL 4NUGH 4TSBH 4KK8C 4Y5XB 4YLQT 1QSED 2EEDA 3D39E 3MACH 3T65A 1G7PA 2A77L 3CLFH 4PGDA 5B3NA 4LF3B 3VCLA 4KJQD 4LRNH 4DKEL 1F6FB 2AGJL 4JRYD 3WIHH 5I17B 4ODXA 4RWHA 4ONHA 5HI3C 4P2OD 2Z92B 1RZJH 4S1RL 3IU3B 4JPIA 5CEZE 5HYJE 1A6WL 3H42H 3GSVA 4M7ZB 4Y0GA 4Q9RH 12E8H 1RMFL 3O8XD 3OKOB 3ULVD 5CSZA 4P3CH 5ITBL 4ALAH 4ODWA 1GYAA 2XN9A 4RAVB 1QEWB 3VXQB 4JFHD 4V1DA 5GGQH 4W4NA 5GGRY 5GGSY 2FEDD 2HH0H 5DK0B 1P7QB 2Z91A 2XXCB 5TH2A 1E4WL 4FQ2L 5EIIA 2YD5A 4FQLL 4PJEA 5CJ5A 3MV8E 1V3MA 2ZPKH 2NR6C 4BUGA 2OI9A 2IH1B 2ESVD 5JDSB 1OPGL 4HLJA 2ATPA 4BQ6A 3MV11 1K3ZA 1BF8A 3WLBB 4L9LB 3HFMH 1TTGA 3KHQA 5I17A 2C3GA 1FDLH 1I3GL 1SVZA 5IIEA 3L3HA 2YXMA 3P4MA 2J3SA 4IIQC 2H32A 1IGFL 1LP9E 2CUMA 3ZTJH 2YD7A 1BM3L 4H20H 2KL6A 1CCZA 1ZTXL 1CU4H 1FYTA 2CMRH 1SJEB 5SWSD 1JN6B 3C6LA 3EZJB 1VHPA 3RL1B 3LMJL 2IADA 2R23B 2JJUA 3O3DB 3WXVL 4U7MA 5DK0A 4GKSA 1SEBA 1AXIB 1JNLL 2F5BL 1MRDL 3BIKB 1KENL 2NY6C 4DOHB 3NCJH 3I3BA 3MGOB 4FP8H 3MOBL 4R96A 1GGIH 1XH3B 2X40A 2XWJA 4M5ZL 4Y19D 4TSAL 4ODSH 4X6DF 2Y06L 4TTGA 3GNML 5BVPL 2VMFA 3FKUS 5CINL 5JQHC 1CDBA 1WWBX 3UC0H 1RZFH 2W0LA 3TO4D 2CDGA 4UIKL 4D9QE 1NAMB 2BRQA 3EDJA 2FSEB 1T03H 2YPKA 5F9JB 2GFBB 2WBWB 1SJEA 1PDKA 3U1SL 1U3HB 2PCPB 3K7UA 5KN5A 2J7LA 1OF2B 3V7AG 3LKRB 1ZGLB 3F7YA 4MNGA 5DJYB 1MFCL 4PP2B 5CJQH 1J5OL 2I07A 1IQDA 1A1MB 3LEXB 1IKFH 1TZHB 4NBZB 5DJ8A 2OI9C 3OL2A 1OLLA 3S5LG 1J18A 1AGDA 1A6TB 3UTZA 3T8XA 1BAFH 1F11A 1AE6H 4X4YB 4ZO9A 1T21A 4FXGB 1G0YR 2ICWI 4XHJC 5FYJD 3RI5F 1WF5A 4MHHI 4XP5L 3GBLA 3LKOA 3OV6A 3ZHDA 3F6IA 4OD3H 4DVRL 3T1WA 1J1OL 4J1UA 4GSDH 1JZ5A 3VMNA 3UJTH 3C6LC 1U3HA 3UZVB 1NUDA 2OJZH 4NQEA 1OSPL 5HI4C 3MPCA 5J11B 5IQ9A 2HLFC 4KTDL 2UZYB 3QEHB 3Q5TA 5DJYA 2DN7A 3KDMA 2KBGA 3R1GL 3T1FA 5ADPH 4NZUH 4GW5A 5F93C 3O3BA 2XZZA 1N26A 1M7DB 3D85A 3GK8H 4N0UA 4MQXD 4LSVH 5KS9A 5ISZE 1AR1D 4KV5E 1DSFH 1NL0H 4FXGA 1RZJC 1TETL 5IKCB 2CSPA 3VWJA 1OARH 4YO0A 3SJVB 2X42A 2R2EB 3DJ9A 1NANI 1C5DB 5AEAA 2OMBA 1AO7D 1OAUL 3WHXA 5IJVA 1A21A 2FZ3B 3EOTL 4HAFA 2EE6A 1JWUB 1GHFL 4N0RA 1UB6A 2ZP0T 4Q2ZB 3CIQA 4RMUA 4WHYG 1SYSB 2RAMA 2IAMD 5E4EB 4WHCA 4O2FA 2X4RB 4U1JA 1T2QL 3VFSA 5A2FA 4LCIH 3RU8L 3BW9B 3N1QC 3W11C 2WWMD 1LP9F 3MODL 4A2LA 1KN4L 4URTB 3T0EE 4ISVA 3DX6B 1NC2B 2DQHH 1KCVL 2PO6A 3K8MA 1A1NB 3MLTA 4QXTB 2NY0B 2Z4QB 3NVQA 4ELME 5MENB 1T2JA 2X44D 3LQZA 4XBGA 4L8BA 5DMGD 3N0PB 3IFNL 1SBSL 4J4PD 4ONGL 1DEDA 1SJXA 1I1AB 5JORB 3NA9H 1K6QH 2E6QA 1OSZB 2RR3A 3LHPL 3LZFL 1NMCC 1U3HC 3VH8B 2H8PB 3NMEA 4JFPB 2CDFB 1NGYA 2F19L 1Q9WA 4MJ4A 4ZUSB 3IDJB 3MV7D 3RWEA 5ADOH 4NHCH 4FG6C 3ZDYE 4GKNB 2VDNH 4OF5A 4QHMB 3OAUH 4Q0XL 2J88L 2P1YA 2FEEI 3X3FH 1ZWIA 5E70A 4NWUH 1RUKL 5I74C 3OQ3B 1JF5A 3FOMB 4XP6H 5IEHB 4EDXB 1FZKA 5ENWA 5JHDB 4L4VE 3PHQA 3IXAA 3ETBF 4OFKA 4R2GD 3VFTA 3VWJC 4QYOB 2C4XA 5C2UB 2BZDA 1S7SA 4WHTB 4EN3D 2B4CC 5FYLH 3HNTL 1A7NH 2M8XA 3BP6B 1TVHA 2R9HC 2DLEA 1FN4B 3CFEB 1TJIH 1ZLUK 1WGOA 1OSZA 2F15A 4OZHE 3O9WD 2VLLA 1MWAH 4F33A 1XGYL 2ARJQ 4XMKL 1I3RA 2R4SH 5ACZA 3LH2H 5HY9A 1PKQB 4H26B 3K74B 2NXYC 4Y89A 4U6XA 2W0FA 3LKNB 3MLRH 5DEGB 1E27A 3NFNB 5DZNA 1EO5A 4Q9QH 3G04A 5HHMA 1T22A 4NNPH 2R69H 4ZUWA 4OFYA 1IQWH 4GRMB 1JRHH 1TPXB 2R4RL 3Q48A 8CGTA 3NABH 3MRDB 5KG9B 2VQUA 4BFGA 2PO6C 4OQTL 1YEKH 3HG1D 3K1DA 1QBBA 3ULVE 3IGAB 1KIQA 3PUCA 4G43A 3LOWA 1MHPH 5ID0A 4JFED 1KEGL 4JFHE 1OTTD 1Q0XL 1ZT1B 1PG7X 5EBMA 5KVFH 1XIWD 1RZKH 4MA7L 1TVDA 3OKLB 4Z78B 3H7BB 3EYSH 5BO1L 2PTTA 2UY7A 2EYSA 4H26A 3U0WH 4KV5F 4J2XA 1Y18B 4UV4H 5FOBA 3O4LE 2C26A 3QJFB 4Y16B 4CN1A 3VXRD 3BN3B 2KQNA 5JPMA 1BJMA 4HS3B 5CP7B 5D6CA 1I9JL 4KKNA 3O6LL 1PAMA 4PJXE 4AH2A 1KELL 5IT2H 5HVWA 4NBXB 3L5HA 3BKYH 2QADC 2F53B 2GYSA 4K8RD 1IEHA 4XC3H 1M7XA 2HAZA 1I9IH 2OSLA 2P48B 2EC8A 3QR2A 3DO3A 5F7WC 4F80A 5L7XH 4GBXB 2PF6A 5EFIA 1WZMA 4MAYB 4PJIE 1U58B 1MWAA 3DX9B 1ZT1A 1ACYH 4G6JL 4F7PB 1T7YA 4QTHA 3V52H 4Z78A 1NMBL 4JFQB 4LBEA 5IFAH 1D5ZA 1A9BA 4JZNB 3D3VD 4MXWL 2GJ6D 4TUOA 2BOCA 1AGEA 5J1TC 1NUFA 1AXSA 4ELMF 1HILA 1NGPH 2VDRH 4HXBL 1NBYB 1BJ1J 3MJ9A 3VXUB 3VFWB 4B50A 1F4AA 4LDLB 4YWGL 4RGMB 1JHKH 1ZSDA 4B7IA 1AFVL 4NSKA 1VFUA 2ZUYA 2EDDA 4GBXA 5D7JB 1CGTA 4Y5YB 4N1CA 5LGJA 1U58A 1MUJB 3FB7B 4I5BB 3CH8A 4YGVB 5EDXA 1KJMB 3UTQA 1CD8A 3SDCB 1YN6B 4ZYKA 3A6BH 1G9ML 3TP4A 5D96B 1ZXQA 1UACH 4F15C 5D9SA 1F13A 2LFGA 3IFLH 4KPHH 1CFTB 5FYJU 2WINA 3HS0B 5CS7A 1P4IL 2FCBA 1A6AB 1GVIA 4NRYA 4QXGH 5KJRH 5D93C 4X9GA 4R4BB 1KUMA 1T5WB 1TPXC 4X9HA 4OZHF 1SYVB 2JB6B 3ZLQC 4YPGB 5FYJE 5I1AB 2VITA 2V7HB 1YMMD 2XZQH 1FNEB 3PDGA 1QRNA 2VSDA 5BQ7B 1SJHA 4JG0H 1HHIB 1FNHA 2IFFH 3BEVA 3HI1A 1BPVA 3VWKB 5FDYA 3JUZA 4ZFOB 3DYOA 1P7KB 1IZKA 4UINL 1MREH 2EYRB 5F6HJ 3U9UB 4CJ1A 1I7ZA 4QF1B 5TFSH 1IC5H 2GUOB 3FO9B 5LQBH 2O26U 5HD8C 4ZNEE 1FG2A 1CFTA 1NGQL 4KHTL 5I8CA 4LVNB 3MRHA 2P5WB 5FO9B 3SE8L 4LHUB 2NY7L 1U8OA 1GC1L 5C0BA 3WO4B 5I1GL 1CL7H 1FNEA 1NJ9A 1KNOA 2J6EH 1WEJH 4M61A 2N4IA 1AO7E 5BQ7A 2YPLB 4PBWD 4GBXC 1NFIA 1CD1B 3BWAA 2E7HA 4MAYC 4K3DL 2A0LD 4OV6F 5CEXA 3MGAA 1ZLWH 4P5KA 4PJ9D 3ARFB 2GW5A 4HUXA 2P4AB 1WTGT 2IQ9L 3EJZC 5CEZH 3S96A 1IGCL 3QA3B 1FIEA 2DQUH 4HX1A 2P5EB 3DOSA 4PJXF 3BPNC 5JOPD 1VACA 4X7TA 1U8IB 2NZIA 3MRQA 1IE5A 4X6DA 5EO1B 5F96L 3WL9B 5CP3H 1MCKA 1MJ7H 3FT2A 2HFGH 4UAOB 3GIZL 2HYMA 4R4FL 4HQQH 4I2XB 2YUWA 1K3IA 1L9NA 4PRPD 1J12A 3O0RH 3INUL 2UZIH 2QSTA 4X5WA 2FR4B 5D7JC 4O5LH 3GBNL 4WFGE 3GHBH 3UYOD 3GIVA 1XF4A 4MXVE 4TUKL 2EDKA 4JB9H 4L8DA 1FGNH 4X98B 1T1ZA 3MV7E 5GS0H 1KFAH 2XTJC 2EDHA 4ZDHB 1WIUA 4KQ4H 4HJJL 3OB0H 4I0KA 4CMMB 4M5YH 4HJ0D 1JGVL 2BHZA 4LVOB 4NZDA 5I1JH 1HEZB 2BSED 1YEIL 1NMAH 1UA6L 4EQ3A 4XCNB 4O58L 2VZ1A 4MCZA 4QHNB 1S9VA 4K3EH 4HKBA 5HGAA 4XPGH 3RHWK 3AC0A 5EORL 5ICZA 3IAGC 2J6EA 2IPUG 2WUCL 3D39A 2YRLA 5D7LB 2WNGA 3S36L 2X4SB 1A7RH 4WO4B 5JW5A 2FBJH 3VWKC 3MV9B 4NJ9L 1UWXH 4ZFZA 3BKCH 1NBZB 2FL5B 2DAVA 4QRPB 4X98A 5HYJA 1FL5B 3Q3GB 1EERB 1TCRA 4MLIA 1E6OH 3SCMD 4G80B 3GUTA 2R0KH 1HZHH 4EI5B 5C09B 3TJHA 1J05A 1LK3H 4CMHC 4NQDE 1MFEL 4H88L 3ARED 2OXHA 4KGLA 2EO1A 3KPQA 2G5BB 3SO5A 1JPSH 4XBPA 5TE4H 5KSBE 5DJ2A 4UTAL 5JXEA 3RNQB 2DQCH 4AEIL 5D7LA 3L5XH 4OM1L 3MV8A 1A2YA 3VGDA 2ADJB 1VFBB 2R1WA 5D7IE 5JW4M 3AUVA 5KANG 4PR5A 3B9EA 1NKOA 3IDXH 4AEHL 4AT6B 4X6BB 4JR9L 1BZ7B 2EIZA 4WI9A 5A16B 3SGEI 5MERB 4JM2A 2CJUH 2K7PA 4F8QA 1EO8H 3HI5L 2BNRD 1LE5B 1LP9A 4ODTL 2H2PC 2L4OA 1Q9LA 4XGZA 5T5FL 3VXRE 3JWDC 3EUUA 1NEZB 2OBGA 1B4JL 1X44A 2VDLL 5CEYA 5B4MD 4DOHE 4JHZA 4BFEA 4XCCH 3BKML 4NQXB 1J1XL 4ONFL 3IFPB 4F3FA 3ESVF 3OR6A 1HI6B 4WHDA 2HJFA 4NN6C 3RA7L 4HIEB 3W2DL 3KXFD 3ARXA 5KAQF 3SKNB 4F57H 1F3JA 1QSVA 3TBWA 1IGJA 2UVEA 2EE9A 3HE6A 4EUPH 2DQJL 3VG9C 3O81A 5E94A 4QHKJ 3TYFB 4JQXA 4LP5A 1A02N 3U46A 3D3VE 5CZVH 1ZLSL 3N1FC 4EJ1C 4B53A 4RGNE 1NKRA 3LKPB 4LVOC 1OAZH 5LG1A 1T1YB 5IHUH 2VXQL 4HJGB 4HMDA 2JELH 1E4JA 2YD9A 4OLZL 1QR1A 1C5BH 4HXAH 4MD0B 3P40A 5JXEC 2D7TH 5I1EL 5E99H 4LEXH 4MXVF 5DUBB 4OLVH 1EEQA 2PYED 1MHHA 5IOPB 1I8IA 2IALA 4U1NA 1S9XB 1S9YA 1EUUA 4YDIH 3X12B 5BVJA 1A14H 2AV1A 3GMNA 1X5KA 3OKDB 3HC4L 4JM2C 1R0AL 2GSGA 5JHLL 4U2ZA 1EEYB 2LAAA 1JMXA 4NQCD 5DFWH 1G1YA 4L29A 1QNZL 5HYSB 3CMGA 1FG9C 2QSCH 4XAWL 2EIDA 3PDDA 3KYMB 3VJ6A 2JK5B 3NH7L 2EDNA 1MCLA 3RY5A 5CBAB 2JJTA 2G75B 2EH7H 3DURA 5DD3H 3TYGL 4LSDA 3VDCA 4P9HC 1NUGA 3KJ6L 4PLKC 3GRWL 3VU2A 3BKJL 1CE6A 3MGTA 5M7QA 1DBKH 3L5JA 1LO4L 1PEZA 5I1IL 3VFNB 3N85L 2LVCA 3QRFM 3NIFF 4PYHA 3OBAA 3GSWB 1LDPH 4ZUTA 2VAAB 1ORQA 2VDPL 3UYRH 3HAEB 3VE0B 2DKSA 3OB8A 1DLFH 4GRWE 4RX4A 3HE6C 1XR8B 4JFZL 2QQLH 1RQ5A 4RZCB 3WIIL 2FECI 4JQXC 4NKIH 3KYMA 4KI5C 5DJ0A 4ZTPH 2XKUA 3QQNA 1NCCL 1F8TL 1GPOH 4NZRH 3UMTA 5D7IF 3HB3D 3CFJB 4LCWB 1URLA 1XF1A 1ROWA 1NC4D 4KUCD 3VFNA 4K7PL 1A1OA 4OGZA 1MAJA 1CE1H 4LOUD 3RVUC 1R3LB 3MNVB 1PLGH 3WS3B 5DRZA 3PWPD 4XNUL 1XF2B 3T0EA 7CGTA 5MENE 2H26B 1WUNT 5EPMB 4N0YH 1XR8A 3PHSA 4R26H 4HV8B 5GIRA 3TV3L 2R0LL 1DN0B 3PWLB 4WJ5A 5E6ID 4DQOH 4ELMA 4F7EA 2DQGH 1CIDA 2AXFA 1ZHLB 1EFXD 3MRJB 4FA8A 5T1KD 2ZCKH 1ND0B 2JJTC 1H0DA 2VDKL 3B9AA 4MMZC 2O5YH 5DRNB 1DQLH 2EDTA 1BFOA 3GJEA 4LCWA 2VDMH 1KJ3L 1A3LH 1JWMA 2ZCHH 2Q8BL 2DIAA 3QCTL 1BOGB 1QSEB 4H8WH 4NKOB 4LK4A 2BSSB 5C0IA 3MNVA 4P5MB 1HIMH 3TA3B 4YXHH 1B6DA 3GMRB 1GZPA 1ORSA 5JHDE 3QWOA 4F7TB 3O2DA 5DD5L 1SMOA 2FH6A 4P2CG 4LU5H 3GSRB 3QUMB 4L4VA 2W65B 3LKSB 1K9TA 4XPHH 4DKFH 3PWNA 5I1KH 5LWYH 1DTUA 4J3UA 4FFEX 4OJFL 1FNGB 2FGWL 2EIEA 1UKSA 4AL8L 4L3CB 3QG7L 2R0WL 5B3JE 5DRNA 1X4XA 3UTSB 3TT1L 3M8OH 2C7UB 4BFIA 5CUSL 2VL4A 3FB8B 1OAQL 4QT5B 1DE4A 1CICD 3IDIB 3IYLW 2ESVB 1ZMYA 3Q5OA 2VLJD 1T1XB 4X4XA 4XVUC 5GSVA 2Z93A 4JRYA 2DJSA 4IS6B 5JDJA 2GAZA 3CFIC 1RJLB 5FECA 4P2OA 5HYSG 3T0EC 3C08H 1NQBA 1FL3A 3Q6GL 3QXDA 4GUPA 3QT2A 1GOFA 2D7PA 3O8XA 4U0RB 1U36A 1EEUA 4FQQA 3KLDA 4U2YA 5DI8A 2YD2A 1W2KT 4LGSB 4WI3A 3FMGH 4G6KH 5D5ME 3BUYB 2JF1A 3OHXB 1LO0L 1EFQA 3LQMA 3CK0L 4U1SB 5HHVL 4GRWF 5DQDL 1EZVX 3O4LA 4P23B 2ESVA 3DGGA 4PJDA 1MI5D 4FFVC 4HUNB 4Y19B 2V5RA 4ZPTB 1U8QA 3MLYL 1QSFD 2NW2A 1MJ8H 1TQCB 2X1OA 3MCLH 3I9GL 5K9KB 5F21B 4PRNA 1H8SA 4GW1A 5FYJH 3TO4B 2BNRE 4KKLD 4FHBD 4ONOA 3TGXA 1NANH 1JGUL 3KJ4C 5I76B 1T0MB 4M48H 4FMFA 1ZA6A 3HPLA 2CIIA 3TESA 4NUGL 4TSBL 4PJIA 5SWSA 5E8OA 1T2XA 3RIAK 4HMCA 5C0NC 3MACL 3CLFL 5CJOH 4EI6B 1BVLB 3HZMB 4S2SA 5E2TH 1C16B 4LRNL 3PWVB 2K9UA 5I66B 1ED3A 3WIHL 4HKJB 4PBXA 1EAPB 1PG7W 2ED9A 5DLMH 1N0XH 5HHOD 4GG6E 4KJQC 3H42L 12E8L 3KXFE 5I6XB 3T2OA 5GQBA 4NC2B 4ALAL 1JUFB 4P2OC 3BP5A 4BH7A 4KZDH 4ETYA 3QXAB 3NFPB 4Z5RB 3QULB 2CXKA 3O8XC 3PP3K 3ULVC 2HH0L 1ZT7B 3QDAA 4C56D 5CMAB 4OBRA 3B6SB 4WEUD 5DQ9A 1S7QB 4XPAL 2Q86B 4I18B 2ZPKL 4EI6A 4S0TD 5E00B 5T1LA 3NCYS 1WIOA 2FEDC 1FFNB 5EZJA 3HFML 3S98A 4OCYH 4ACPA 1IEBA 1CFSB 1WBYA 3ROLA 3QFJE 3OAYH 4YR6B 2AV7B 4YIQB 2NW3B 4H20L 4WY7L 2P8PB 1CU4L 1M71B 2CMRL 5FO7B 3X3GH 4NQCE 4YDJA 5B3JF 5HXMA 3SGJA 5E9DB 3WFDH 3H3BC 4WDIB 2VE6B 1I9RH 1S9WB 2D7MA 1PG7L 2R2BB 1JL8A 3U9PH 1FSKC 5AUMA 3KHOA 4FP8L 3IF1B 5ETUA 1FO0B 1GGIL 4RISL 5EOTB 2VB5A 1YNLH 4ODSL 5T1MA 4ERSH 3HN3A 3BHBA 4ZNEA 1HSAA 1KLFA 4GMSH 3KYNB 3JV5A 4KKAD 3UC0L 1UFUA 5EUOB 1ONQB 1H3TA 3MBXH 4OZGB 1T03L 2AV7A 3IVKB 4YIQA 5FIEA 2NW3A 3MRBB 1QKZH 4WWKD 5GGRA 2YPLE 5GGSA 1LEIA 2GSIB 3B43A 3UBXI 5C8JA 5BRZB 3TPKA 5IMKB 4JY5H 4OLUH 2NNAB 5HHNB 3B9KB 5L9DH 5D5MF 2MMXA 4XPBH 1AO7A 4LAQH 1Q94B 5I2IB 4OD2B 5CILH 4I3SH 4J3TA 1R5WB 3MRPB 1RUQH 5CJQL 3VD5A 2P5EE 1H5BA 1IKFL 2ZSVB 3MO1B 4H1LB 4Z7VB 5SWQA 1JNNH 1G7MB 3MBEB 4GW4A 4ZPVB 3PWUA 4EIZC 1F4WH 2IAMA 1BAFL 1AE6L 4X8JA 4S0SD 1F02I 4OF0A 1R24B 1I7RB 1RZGB 1MCHA 5I6XC 5CKAA 3IVKA 4U7SA 3IETB 3LD8C 4GSDL 3EOYG 4H5SA 3UJTL 2ITDA 4OFVA 1BJ8A 3FN3A 4R2GB 2BNQD 3O45A 3SDAB 3C8DA 3IJHA 2D0GA 2OJZL 3QG6B 4MMXC 1OHQA 4J4PA 3SGJC 1P2CB 2X89D 4LQFL 1C7SA 5ADPL 4FFYH 4UU9B 3SO3C 3NIDE 3F7QA 4NZUL 2NY4C 2XWBB 4HCRA 3TCXA 3U2SB 1QG3A 3U6RA 3GK8L 2I26N 2R29H 1X5IA 3MV7A 3V95A 1YNTB 2W0PA 5DXWA 1DSFL 1NL0L 1OARL 1RZGA 4M9OA 4DUVA 2IMMA 2ATKB 4MQXC 1BQUA 3JTSA 1II4E 3ARDD 3T77A 3I84A 5DJAB 3SDDD 5MEQB 1AR1C 2J5LB 3MRKB 1Q1JH 3DX8B 4MYWB 4EN3A 1FZOA 3HG1B 3S97C 2D7OA 3MV9E 3QG6A 5E2UH 1UM5H 1UZ8B 1LQVA 2B20A 4DEPC 4IDLA 3O9WA 1KIPA 5DHVH 5IVOA 4CVWA 4YXKH 1XIWB 4LCIL 1NAMH 1WBZB 4WEMB 1H5BC 1UZ6F 3DX7B 1YN7B 5GRVK 2OP4H 1AD0A 2P7TA 4WU5A 1I4FA 3TVMD 2IAMC 3F7PC 4NZTH 3QDMD 2VLJE 4EKXA 3VRLE 1MLBB 2WWMC 3WFZA 4NQDA 3QISA 3H0TB 5MEQA 3AAZB 5EO9A 5KSBA 1ZVSB 5DURB 1J8HD 4YX2L 5B39A 3ULSB 5J1AA 8FABA 1NDGA 1DUYB 2BRRH 3WIFA 1OGAD 4LLWA 5E0QA 1ZGLM 4J4PC 4ZMAT 5D7IA 3VFPA 2OQJA 2DQEH 4JFEA 4NHCL 3WV0A 1CFNB 4CL7A 2V7NB 2VDNL 3IDNA 3OAUL 1A4JA 1S7WB 3DX7A 4J7RA 2APFA 4Z76B 4QHLB 3X3FL 2APTA 2FJGA 4NWUL 3UPAA 2VWEE 4EIGB 4QRRE 3Q0HA 4XP6L 5I9QC 2XPGB 4MVBA 4DGYH 3VXRA 3VGAC 3LDBC 1OP3H 3UO1H 3MCKB 5FYLL 3EYVB 1A7NL 3UX9B 1WV7T 1QSFE 4X0KA 4KJPD 5HVHC 2KH2B 1TJIL 5JPNA 5J13B 1KCRH 3DYMA 4AM0B 4UIMB 5ICXB 2DMCA 1F6AB 4EN3C 4DVBB 2R4SL 3F5WB 4Q74A 3LH2L 43C9A 4KUCF 4HLZG 5H35A 4H1LG 4G8FB 1BQSA 3L6FB 3H6JA 2WIIA 3O9WC 1QRKA 4G9FE 2V7NA 5DHVA 3D1MC 2A6DB 4Z7UE 3MLRL 5DRXA 3SGDI 1RUMH 4GRWH 4J3XA 1IGMH 4Q9QL 3SN6N 3CZJA 1F3DJ 2WSKA 4QO1A 4NNPL 2R69L 4HZAA 5T3ZE 5MEOB 1IQWL 2E7CA 3D3VA 1JRHL 2GJ6A