3O8XA

Recognition of glycolipid antigen by inkt cell tcr
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
273
structure length
268
Chain Sequence
b'NYTFRCLQMSSFANRSWSRTDSVVWLGDLQTHRWSNDSATISFTKPWSQGKLSNQQWEKLQHMFQVYRVSFTRDIQELVKMMSPKEDYPIEIQLSAGCEMYPGNASESFLHVAFQGKYVVRFWGTSWQTVPGAPSWLDLPIKVLNADQGTSATVQMLLNDTCPLFVRGLLEAGKSDLEKQEKPVAWLSSVPSRQLVCHVSGFYPKPVWVMWMRGDQEQQGTHRGDFLPNADETWYLQATLDVEAGEEAGLACRVKHSSLGGQDIILYW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antigen-presenting glycoprotein CD1d1
publication title The V{alpha}14 invariant natural killer T cell TCR forces microbial glycolipids and CD1d into a conserved binding mode.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 77
structure length 268
sequence length 273
ec nomenclature
pdb deposition date 2010-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3o8xA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3o8xA01
1E4XH 5TDNB 5IB2A 5DSCA 4HWUA 4QWWD 4YR6A 5D1XA 3MCLL 2W0FA 5EPMB 2YXFA 3D0LB 5HGBB 5B38B 1U58A 5GJSH 4RMWA 4JRYD 4QF1B 5D1XC 2I07B 1DLFH 3EBAA 1U3YA 4XCNA 3SGDH 4XPBH 5EU6D 1CE6B 3V5HB 5C70A 4R26H 3OTTA 3SKMB 5LWYL 1RQ5A 5BRZE 3AS0A 3ET9F 4XXDA 5DMIL 2J2ZA 5CD5D 3H8NA 5CJBA 5CEZD 3UPRB 1XF3A 2DQJH 1Q9KA 2JLLA 5IUSA 1AFVL 3RUGA 3PDDA 4DCQB 4QHNB 4FQCL 3THML 3OJMB 5DJCA 4PY8J 4NBXB 1AXSA 5HGHA 5F7YC 2B1HH 3SGEI 1MRCL 5CBAB 3ARFB 1UKQA 1T89C 3CDGB 3R8QA 1OTUD 1IQWL 2E7LE 1C16A 3T0EB 4PP1D 4NKMA 4O2EA 4LHUB 2DTSA 5IESL 1W8NA 1OD7A 2VERN 3P11L 5L0QB 1T20B 1KYOJ 1EEUA 4PBWD 4Z7VF 1MREH 3BYYA 4KJPC 4S1QH 4JPKL 3LV3A 1YC8A 5CP7B 2WLZA 3S34H 1B0RB 4LK4A 3AAZB 1AI1L 1JWSB 2FJGB 2R15A 3GMMB 4XNUL 1XGQA 3D5OF 4E42A 1MELA 2YKLH 3T4YA 1QEWA 5HYQB 1P1ZB 2J88L 1CDGA 1BOGB 1I8KB 1INQB 4LPWA 3CPLA 3PQYE 1SY6A 1ORQB 3DYPA 4UIMA 2C7UA 4NJ9H 4G7VH 1LE9A 1MCJA 2EC9T 3ECBB 2MCG1 2YUWA 1JHTB 3TIEA 3HUJA 4S2SA 5DJ6A 3BD4A 2ARJQ 3OKEB 1JWMB 1X44A 2GK2A 1NFDE 1EUUA 1A6TA 1XGUB 1YMMD 2R39A 3GZKA 1QSFE 1DSFL 1U3HB 3IDIB 1YJDH 3RZCA 2BVTA 1FVEB 1OGAD 4IOIB 3RZCC 4IDJL 1E28A 4M8QB 4KFZC 4HF5H 5EOCJ 1Q8MA 2VH5H 4DGVH 3HC4H 1NCCL 1RZFH 3F7YB 4BK4A 3GIZH 3MA7B 5JR1H 4XNYL 1YY9C 2EDXA 3ZE1F 3JTTA 1CDYA 4XHJD 3K2UL 4HS8H 4L4JA 1OL0A 5BS0A 1FNSL 3U82B 4AEIL 5L8KB 3B9DA 2AAVA 3W11C 1OSPH 5BJTA 1L7TL 5DD6B 3WYRA 1T21B 2H45A 5F9WB 5GS0L 1AQDB 5F1IB 1HHJB 3NFNA 4O02L 2F19L 5DUBA 2OL3L 4F7CB 3VCLA 3J7HA 3IGAA 1RK0A 1AXIB 2IG2L 2XTLA 4X7CC 4N0FA 2F53E 2ZUTA 1CT8A 1S7WB 2VLLB 4RA3A 4ZTOH 1LEKB 4APQA 5SX4H 1NGYA 3O0RH 4RMUA 3QAZB 1J8HD 1I9IH 3E6HA 1WBZA 1XF4A 2AI0H 1P4IH 3FRPA 1IC4H 2FB4L 3RVTD 4APQC 3MLSL 2I9TB 5AG8A 2OTUA 4WEBL 5I1LB 3ILPA 4EI5A 4PJXE 1FP5A 2AJSL 2IANE 2FGWH 3O2WL 2IQAB 4PB0H 4X6DB 4FQXD 4EI5C 4HWZA 4FS0A 3QFDA 4MGXA 4XPTL 4JDZA 1W72A 1K6QL 2VDPH 5GRUH 5HYEA 5D1ZA 4MJID 3WNKA 4PJEA 1QFUH 2CDGA 2IH1A 4RISH 5HHOB 3MOAH 5D1ZC 1EO5A 4WTZA 3BWUC 3B8SA 1E4JA 1N5AA 4HK0B 3M17A 3GM8A 1KYOK 4P5KB 4PBVC 4WI4A 3T08A 4Z77B 3CK0L 2NX5D 3OKKA 5J0BA 3BP6B 3VFMA 5LJYH 1WVZA 1NJ9A 4U4BA 4X5LA 3HLAA 4NRZB 1G6RL 4KY1L 4R3SB 4NM4H 4LEXH 1N6UA 4FP8H 3FONA 4Y2DB 1LMKA 1P7KA 4AH2B 3S8WA 4IDLA 4HT1L 4JFFD 1FLRL 1R3LB 1KB5H 2FIRT 3GMRA 1W72L 3MNWB 4RAUA 4Y16D 4Z78B 2NXYD 3LKRB 5TPWH 1BWWA 3LS4L 3V4UH 5IQ7L 2BC4B 2BNRE 3D2UB 2EH7L 1KIUA 4CMMB 3SDDD 5J56B 3GK8H 1LGVA 3D9AL 2EE2A 2ZCLL 3SJVB 1BQHG 1PKOA 4DFIA 1K2DA 1VADB 4I48B 4MXQD 3TBYB 5JPNB 1M6OA 4KROD 3N9GH 4NHUA 4P46B 4Y88A 2YRLA 4X7TB 5SV4A 3DUUB 4L3ED 2R0LH 5AAMA 5D8JH 4HAFA 1G7HB 2MHAA 2FLBT 1CXIA 2ZCHL 2GTZA 4J3VA 1QRNE 3TBSB 3ZTJG 2WBWB 3IJHB 4KUCD 5I8CB 3CFKA 3TO4B 1GPOH 4LOUC 4UI2A 2Y07H 3ZKMC 2LE9A 4XH2B 4HIEA 2UUDK 3HFML 4GT7A 5FA4B 5GGRA 4J2XA 3BFOA 4TRPH 5D1QD 5E5RB 3TV3H 1WZ1H 5E00B 1GAFH 3TVMA 1T0NB 4AT6B 1F45A 1CU4L 3ME0A 1CGSL 2ATKB 2W0KA 4KXZH 1X5YA 3UP1A 2E6JA 3TVMC 2QHLA 1MCFA 2BY3A 3CVIL 3MV7A 4FHBD 3HB3D 4F7EB 3SQBA 4U1JB 5J6GB 1K5NB 4F33B 3JWDH 2EO9A 5HTSA 3R1GL 5FDYA 3U0PB 4AEFA 2R29H 3LQAL 2R1XA 3PHQB 3NA9L 1B6DA 1T1YA 4FFYL 2FZ3A 4I3SH 3P0YL 4PRAB 4I9WD 1BECA 1S7SB 5HYIA 2AS5M 4OZIB 5KVEL 1TJIL 5D70H 5BV7H 1IEAB 4ODWB 2AJ3A 3QXDA 5BZDA 2G2RA 5AUMB 2HFTA 2IMNA 5E70A 5CS7A 1D9KA 3PABA 3QCUL 2I60H 3NABL 4PD4K 2JKXA 3QDJA 5CAYB 3X11A 1OB1A 2GCYB 5I75B 5I17A 1D9KC 3DTXB 1PEWA 3TT3H 3K4DA 4YHLL 3O41A 3HAEG 3L7EA 1NUDA 4U2YA 3WNMA 1YEHL 2UZIL 2ATPB 1VPOH 4F9PC 4FFVD 5JMRA 1WTLA 2BCKB 4PRPB 1HXYA 4NP4L 1CFSB 3UBXG 2GY5A 3QDGE 4JPVH 4MX7B 2UWEF 3MBXH 2Y4SA 4NN7B 5E2UL 1T5XA 2GJ6A 1OLZA 3S4SG 4YHYB 5AZEL 3IFLH 1YYLH 3LIZL 3LZFH 5IM7B 5D7KE 5IG7A 2XTJB 2XWTA 5C2BH 4P57A 3D85D 3DRQA 1OAZL 3HNVL 1A0QH 1XZ0A 4M5ZL 4PB9H 2HKFH 1WV7T 1V3LA 3QO1B 1KPRB 4QHLA 1FE8L 2IQ9L 3TC9A 4LPVA 5GGSB 4F15B 1BPVA 2D0HA 4DKDC 1UYWH 2VUYA 4KI5E 1I7RA 5ITBH 5IB4A 5DC0A 1IT9L 1RFDL 2D31B 5CHNA 3U7YL 3CZFB 3FO1B 3O8XB 5D7IF 2CK0H 3HNTL 3VG0H 1A1MB 4N0RA 3C09C 3QP3A 1F3RB 4QNPE 1A21A 1M05B 3RX7A 3DVGA 4NFCA 3T65B 5CZXC 3AFLA 1MLCA 4P2RE 2X10A 2WZPD 3QNZA 1JWUA 4XPHL 1FRGH 5HI5D 1CLYH 3M07A 4GKOA 4UB0H 5E08L 1CI5A 4GRLA 5ID1A 3DIFB 1JJUA 1JNJA 2A2QT 1FL5A 4HH8A 4WNQB 3FQRA 2V2XA 5SWZD 4PP2A 4DVRH 1J10A 4HJGA 1ITCA 2G5BB 2XWBA 2FEEI 5E4IA 4ONFH 5I1AB 3HE7C 1WT5A 4X7EC 4YXLH 3GJFK 2XPGA 2AJZA 3MLRH 5JQ6H 1S7QA 3ULVH 2VR4A 4YQXH 3RJDA 3RU8H 1WT5C 9CGTA 5E1AA 4K71C 2DQCL 2EEAA 4RGND 2GT9A 2XZAH 1BM3L 2DQHL 4NQEB 3L5HA 1KXTB 5J11B 5I8EA 4JM2A 2R9HC 5F9JB 4QTIL 1E0OB 1X3DA 2R1YA 1AFVH 3ULVD 3FO0L 2EDLA 1IC7L 4JM2C 4KDVA 3QISA 1ZHLB 4DUWA 4LL9A 2H9GA 3EOAA 4E0RB 1Z5LA 3MRNB 3P30H 4OBSA 5EUOB 2AJXL 1KIQB 3FRUA 4RRPA 3MV01 2GTWA 1KC5L 1T83A 1G7JB 1NC2B 4PJBA 5E8EA 4LKXB 4ZAKA 2FSEA 4YLQT 5DJ2A 2UZYB 2R0KH 3I84A 1RU9H 4Q6YA 4ZAKC 3OXRA 3PNWA 2VLME 3WLBA 1RJZB 3BW9B 4AENB 5D1XD 3ULUL 1FFPB 3LD8C 4HZAA 2K9UA 5E2TH 1A64A 5AAWA 4JO4H 5AZ2H 4XNUH 5JUEH 1YN6A 1IAIL 3MMEB 3JV6B 5F93C 1QLEH 4U1KB 1G7MB 4HJJH 2BNUB 1DQML 4OF3A 5E4EC 1MCKA 5C86A 1RIUL 1MRDH 4NO5A 1NAMA 2X4PB 3PDOA 4GMTL 4Z7VE 3DI3B 4GQ9L 5DMKA 3C9NA 3M1BB 4RGMC 1DEDA 4XCEB 4P2OA 3W81A 1EO8H 1JN6B 1U2CA 5C9KA 3GBLA 5C0CA 5HHNA 5KSBE 4IHOB 3D18B 3TH2T 2VABB 3DMMA 5T3ZL 3SY0A 1XGYH 3DMMC 4HIXL 4U6TA 2DKMA 4Y4KB 2NW2B 1DFBL 4DGIH 3OXSA 2XKUA 2VLJA 1UB6A 1NCBL 4KJPD 5HJ3B 1X5IA 2VTFA 3H9HA 3JV4B 5J57B 2PO6B 3R4DA 2VLKE 1ZHNB 3GEWB 1NCCH 1TJGH 1FDLL 3EYOB 1SY6H 2A6IA 5EWIL 3UJTH 1V7ML 1DEEA 2H6PA 1E4XI 3ARZA 4GG6A 3K2UH 1T03H 1GCFA 2PW2A 4XPGH 4FQ2H 5DJAB 5KW9L 1EZVY 5ILTL 4G6KL 3WUZA 1L7TH 4JFEB 4XI5C 2HWZH 3VD7A 2XRAL 2E8ZA 3QUMB 3VH8B 1EHNA 3KPPA 4JDTL 3HC3L 4Q9QH 2OL3H 1FVDB 3STLA 3W0WE 4K3DL 3PGDB 3H3BC 1KGCD 1NLBL 2L4OA 5J9PA 4A6YB 2BVUA 1F8TL 1RMFL 1LEGB 5E0QA 1AGFA 3KR3L 3GMQA 3WHXB 1JPGB 3RZCD 1KBGL 1T1WA 4FQPA 4NQUA 3RNQB 3PGFL 1UM5H 3IF1A 1KT2B 1QSEE 4P4KC 3DI2B 1ED3B 4DZBB 1JF5A 1KOAA 1YY9D 4XPTH 3BESR 4MXWH 3OKLB 4R8WH 1DJSA 2QKIA 4NNPL 4I18B 2ADGA 3LSOB 1ZWIA 3CMOH 4MA7L 3W11D 3QUYA 4HFWB 5BS0D 2KQNA 1HQ4B 1Y6KR 1OAXH 3L3JA 2P47B 4KUZL 1A1NB 1X7QA 5ETUA 1OAKL 3GSVB 2VDMH 2QSQA 3VXRE 5MEPA 3Q0HA 3B2VH 5DO2C 5MERB 1PX4A 1AGCB 1D5IH 4GBXB 4M1DH 4ZNEE 3VXUA 5CEZL 3BZ4B 2IEPA 4OD1H 2E7HA 3RKDC 1UT9A 2VQUA 5C0IA 4APQD 1T6VN 1IM9B 2ZNXA 4HT1H 2VZOA 4G8GD 1H3TA 1WFNA 3G9VA 3W9EA 1W72H 2V5MA 5BMFH 3STBA 5J1TC 3HZMA 3MUHL 3GSQA 4QXWA 2VOTA 4EI5D 2DQUH 1MJ7H 5D5ME 4JM4L 4KQ4H 5LKNA 5D2NC 3MRRB 4XP6L 2Z92B 3S5LG 3JWNC 1X5AA 3V4VL 2ESVB 2WMPA 3RY5A 3WCYA 1K4DA 1IILE 1B4RA 3SKJL 5D1ZD 2FRGP 3NFPA 4JHBA 5TE4H 3C8HA 5GHWL 3IFOB 3F7VA 2ZUQC 1TQBC 2N7BA 2J5LB 5J8OA 3SDXE 2GFBB 5IR1B 2X1XR 3KS0H 4I2XB 3W39B 4M6OH 4YFEA 1L6ZA 1TMCB 1NEZA 4S1RL 2LTQC 3P9MA 5C08A 5IHBA 5HPMB 1A7PL 1U91B 3HFMH 4EUPA 1EIBA 1QD0A 2EEBA 1N4XL 4OT1L 3LDBB 2VXQL 2WANA 3T0AA 5HHMA 4U2ZA 1NDGA 5ADOL 3QEQB 5DJDA 4L8BB 2WINA 2NCMA 1CG9B 4OD2B 3MV9E 4R96A 4UBDC 3LN5B 3MO1B 2IFFL 3NCMA 1VENA 3MV11 3K8MA 2H26B 3AS1A 3O45B 3PG2A 4JG0H 5CSBA 4F80A 4HHAA 5T1MB 5DI8B 4EDXB 1PBYA 5DF0A 1HHIA 3FFDB 5FKAB 1ZSDB 4RIRA 5SX4I 4Y5VA 1R3JB 3MREA 4QOKB 4M62L 5LG1A 5FUZH 4Y5VC 1TJIH 3HE6C 1HHKB 3CJJA 1TZIB 4X7DC 3WV0A 3RGHA 4D0BA 3TLRA 1KN2L 1ES0B 2FX8H 3Q6GL 1GC1L 2AEIT 3QCUH 4LOUD 1S9XA 5GRJL 3ZKMD 3NABH 2CLVA 4ODXB 1HE7A 5E9DB 4OLUH 4Z18A 4PRNB 5J1SC 4TULH 2WW8A 3VW3H 4JFQA 2LV4A 1YEHH 2UZIH 1E4WL 1ZTXH 4UINL 4L4TA 2ZG3A 4LLVA 5MENB 4Y89A 4G6JH 1H3PH 4BZ1L 1WC7B 3TVMD 4I3RL 1A1OA 3S96B 1NMBL 4JRXE 1MHEB 2ZUXA 1BQLL 5T1KD 3U30C 1NC4B 3KYNA 4NQDB 4JFYB 4WHTB 4FQHA 3P4NB 3MV7D 2WUBL 4TSAH 2BVQA 5AZEH 2CDEB 3VRLE 4EN3C 4EI6B 1CVRA 1EHLH 1KLGB 4DUVA 3ZKQD 3MJ6A 3VFWB 1U8QB 4OQ1A 3KYOA 4IMKA 1I7UA 3LCYA 4KK8C 2FBOJ 3N06B 3RTQB 3MRQB 4M5ZH 1K3IA 4IMKC 4U1LB 1AD9B 3I50L 3QR2A 3O6ML 4ZSOB 2EYRA 4QHKJ 2UWEE 3QDAA 2IQ9H 5D6DA 3C5JA 4ETQB 1HSBA 4MHHG 2FBJL 1D9KD 4P5MB 1RFDH 3UC0L 3L6FA 1LK2A 4D9RE 5GGSY 3WNOA 2QR0A 5ALBL 1N64L 4DJMA 4FNLH 4C55A 1FL3B 5KVDH 1CF8L 3HPLB 5F3HB 4OCXL 3U9UB 1ULVA 4QXTB 1NLDH 3H9SB 2Y6SC 5HDBF 3GKZA 3EO0A 3GMNA 2DIAA 2IBZY 3BVNA 1EFXB 1K85A 1N6QL 3ZE2E 4LCYA 1I3GL 1KIPA 1MCCA 1CWVA 5D7IE 2OSLA 5HHPB 4AEHH 2R4SL 3DWTA 2E3VA 5SWSB 4X6DF 4WW2A 2EDQA 4KXZI 3BQUC 2Y1VA 1F58H 3UCRA 1MI5D 3EJZC 3TA3A 3D39E 1MSPA 1CGWA 2YMXH 4LEOB 5A40E 1FV1B 4WW2C 4JN2B 1T7WA 4JLRB 3TA3C 4U1MA 3ZHLA 1H15A 3ALWA 2EIEA 4FOMA 3M8OH 3O6KL 4ZYKA 4NSKA 5TGBA 4CJ1A 4XPFH 4YHPA 2BZDA 1T1ZB 5I6XB 3UTQA 2DQCH 1C5DA 2B5IB 2CD0A 5L9DH 2NTSP 3QEGL 4O2CA 4KTEH 2A1WL 4U31A 3MRMB 1RJYA 3U46A 1HH6B 4OCMC 5ACLA 2CJUH 1UCBH 1PKQE 3MUZ1 5DJZA 3LN4B 4XMPH 2ICWJ 4HGKC 5CZXD 4U49A 3FOMB 1QBLH 2DAVA 3DV4A 3O3UN 3WJJC 4DVBB 1VFAA 3K80A 4YAQB 4NHCL 1LK3H 4ODHL 5IVOA 4G6MH 3CFBB 4ODUA 4M5YH 2X7LA 4DGYH 3MRJA 1ZT1A 2AJXH 5E2WH 4XP1H 3GMPA 3K1DA 1HDMA 3QWOA 5J13B 1KCSH 2DQGH 4L9LB 5DRXB 1KCKA 3OF6A 5I16B 4OAWA 4QY8B 1HN1A 1FYTA 3LKQB 5A2LH 3HE7D 3Q2CA 3QUZA 3ULUH 3BGFC 3QNYA 2GUOB 4X9IA 4DN3H 1X4ZA 1YN7B 1LE5B 2W92A 1XH3B 2VDQH 4MJ6B 3SPVA 3OPZL 4KH2A 2F8XC 1MFAH 1YDPA 1D5MB 1OARL 4PJ5E 3QNXA 1LO5B 1DQMH 2R9HD 4JPWH 4LVOB 2VXSH 5B4MC 4HULB 1SYSB 1BQHB 2YPLE 4MNHB 3LS5H 4O9HL 1X5XA 4M61A 5CINL 3EFFB 4JM2D 4ZFOL 2AXFB 1NANH 2YRPA 3U2SA 4DOHB 1FBIL 3NACL 4M6MH 4ELMB 4JFXB 3CH1B 4ZUSA 5M94B 2HRPL 2CGRL 1DQQB 3QIWC 1IBGL 2Z91A 5SX5H 1Y6NR 3LAFA 1JFQL 5I1KL 1F3JA 2YR3A 4JO1L 3RWIB 1T2JA 3G9AB 4AJ0A 4ZAKD 5SWQA 1UM4H 4Q97A 3HN3A 4OLZH 4HKJB 1WWAX 4K7PX 3T0BA 2FGZA 1BFOA 1A7RH 5F6HI 5BRZA 4J6RH 4KI1A 4Y4FA 1BFTA 1YEDB 3P77B 3VRJB 3MACL 3Q1SH 4OZIF 3ZL4L 1NAMH 4Y4FC 4JFOA 1UCTA 3I85A 5EWIH 5FYJE 1KENL 4UDUB 1V7MH 3KXFE 3MRLB 3CSYA 5C3TA 2G75B 3RL1A 1ZT4B 3MRBA 1DVFA 1MHCB 1JPTL 4BUHA 4LPUA 2VLRE 5F6IB 1D7FA 3VGAC 3F7PC 2E7LA 1BAFL 1DVFC 1DBAL 2IC2A 3KPNB 2XRAH 2O61B 3G5ZB 5C0CD 1CD0A 5JW4N 4K3DH 1NCAL 2VE6A 5EN2A 1KEML 3DMMD 2UVFA 3TZVC 1RMFH 4Q2ZA 4HC1A 4X0KB 5DJ0B 4FZEH 1MCOH 3WXWL 1KEGL 4AMKL 4X9GA 1D6VH 1U92A 3KPRB 5TF1L 4FXKA 3CLEL 2VLJD 1QFWH 3HAEB 5K93A 4U0RC 8FABA 4KV5F 3RWJB 3OAUL 1U93A 32C2A 2ZCKL 3G6DL 4MAYA 4E9LA 4N8CH 3PQYA 5JHDB 1F4XH 3EZ8A 2F74A 1S9WA 2VSCA 3AM8A 2IPUG 1QSZA 2IADA 4B7IA 2C4FT 4MAYC 1ZVYA 3S4SB 4JG1H 1I8IB 4GS7B 5JA8B 4UT9H 1ZK9A 1UH2A 5ESQB 1O0VA 1S7TA 5J7CC 1NFDA 1ZLWH 4ZPVA 4MA7H 4YPJA 1JI2A 2R2EB 4XI5D 3B3IB 1IQDB 4LBEB 4N0YH 5TQ0H 1QSFA 5IGXH 3QZWA 5E7FA 4KUZH 3QQ4A 4HC1L 4Z76A 4ELKA 2GAZB 2G9HB 1MVUA 1RJLA 3QEHB 3MNVA 4P99A 4B7LA 2DBLH 4KJWC 2UYLA 5HVWA 3WFEH 4PTUB 5TDPA 4B53A 1FH5H 1A4JB 3FB7A 4KRPB 2OK0H 1U0QA 1B4JH 2DYPB 2XWJA 4JZNA 4QRSA 3EDJA 2D9CA 1EEZA 3S3JA 3NCJH 1K9TA 2RJMA 3T1WA 4L8CA 4JM4H 5J3HC 4GOSA 4X80L 5I73B 3X3FL 4L1DA 4XP6H 5DA0B 3V4VH 4JO2L 3MRFB 3IDUA 4WI8A 4LCWE 1F4YL 4I0KA 1HINL 5T33L 4GSDL 1A7BA 4LSUH 3FOLB 5EBWB 1J12A 1EMTH 1HQRA 1QZ1A 4GAGL 2F53A 4OLXL 5DQ9B 2WLYA 1Q94A 3UJIH 4BKLB 3VXNB 2ZOLB 1CXKA 3G04A 4JDVA 5DO2D 1SBSH 1S78C 4R97B 4X4YB 4S1RH 1Q9OB 4AIZB 2I5YH 4MZ2A 3BGMB 4F7PA 4EJ1C 2FECI 3RKDD 3NTCL 4PJXA 5JXEA 3QIBC 2IANA 3S3SA 3VXUD 2YD5A 3X13A 5EUOF 1JYWA 1IVLA 1UACL 3SE8L 3BRFA 5JA9A 2P44B 4DZ8B 5JXEC 2Z0BA 3VMNA 1FIEA 2A6KB 1A4KB 1C5CH 2QSTA 3WFBH 3UTOA 4PJ8A 4NT6A 3QQ3B 5EIVA 1QFOA 1HNFA 1H0DB 3MOBL 1FN4A 5E5MA 4N5UA 4PJ8C 4QGYA 2P8PB 4IJ3B 3S35H 3TBTA 3QQNA 4L3AA 3IDYC 4PJIB 4KVNH 5DVKA 2PF6A 3FQUB 2J4WH 3B9KC 2PR4L 5DZLA 3NIFE 4B5EA 2EH8L 5F6HJ 3MRPB 1OP5H 3H7BB 3T0EE 4YDJB 2Y7QA 4XC3H 1ZGLA 4EUPH 3FRPG 1IZJA 3SHSA 3C5SB 3OR6A 5GRJH 3WHE0 4YBLC 3U4BL 3Q3GA 3T2NH 4ZFZB 4NOBA 1DR9A 1IAOA 4KMLB 3EYQC 4LVNB 1HOCA 4MQ7B 4WI2A 4JFZH 2BSRB 4JQIL 2FR4B 4HGWB 1E4WH 2BNRA 3KPOB 4FMKA 5HHMD 4UBDD 4XNZB 5DT1H 5FO7A 1I85A 4OM0L 1FAIH 2APTA 1I85C 4L8SB 2JELL 1DBML 4RNRB 2XZZA 1JL8A 1FZJB 1EEYB 4M7KL 1A7OL 1PAMA 1LO3H 5EZOL 5DWUL 1JNHA 3GB7B 3B5HA 3FTGB 4P3CL 1FNGB 3BPNB 4U3CA 1HILB 1QRNA 4HLZG 1A6VL 4JRYB 4Z0BH 1FGVL 3OGOE 2BMKA 4JKPL 5EDXA 4UQ3B 5F9DC 4EXKA 5EU6B 1XF2A 3HE6D 5B8CA 5DD3L 1A22B 4KHXH 4F7MB 3EYUL 5L88H 1JZ6A 3NPSB 1JFMA 2H32A 2D7NA 1DQLH 2VDNL 4R0LA 2FBJH 2HT4C 3O6LL 1JNNL 5KS9B 2FIKA 1EAJA 5A16A 2QLVB 2X44D 4JVWA 1CDJA 4XHQA 3TBVB 1FHGA 5D4QA 5ALBH 2D7MA 3D48R 2Z4QB 5F1NA 1K8DA 3F62A 5JORA 5GGTA 4WY7L 5DJXB 3SKNB 1GL4B 5ERWB 1CF8H 1S8DA 2OXHA 3B83A 4G8IB 2DMBA 1DL7H 2YD7A 5EIIB 1S9VA 3G5VA 4EN3D 1MY5A 1HNGA 4K23L 2EC9U 2BSSB 3B8YA 3K7UA 1L7IL 1MHPL 4KK8D 2X5PA 2R4SH 5FYKH 3KVQA 3B5TA 4PYHA 4H88L 1FZOB 5HI4C 1LDPL 1N8ZB 1JGEA 4HUKB 3HS0B 1J05A 2M1KA 2ZUVA 3V5DB 2N56A 5D6CB 5F7DB 5HDBE 4MA1B 2XV6B 5FYKD 3PP4H 2MKLC 5F88A 1JYNA 2BJML 3LMJL 3PWJB 2YPKA 1DE4A 4GW5B 1ZEAH 5J12B 3MJ9A 3QEGH 3VFRA 3WBDA 2A1WH 3MLTB 1EVUA 2XI9A 2EZ0C 3JTSA 4QRPE 4PGEA 4X6DE 5DS8A 2ADIB 2Y6SD 1PQZA 1YMMB 5IF0B 1GGCH 1XGRB 5FAAA 4GKZA 1RZKL 5E8PB 1DBJL 3L3DB 3K2MC 3LEYL 4GG8B 4WCYH 1CE1L 1CIUA 1OGAB 1GGTA 4WFHD 5I74B 3U4AA 1IAKA 1PLGH 2M8XA 4RMSA 1Q1JL 4OGXL 1RHHB 2BFVH 1QYGL 1NCDH 4PGBB 1D5ZB 1KCLA 1ZLUK 3BQUD 3VFTB 3RDTA 3EJZD 4MD0B 4LDEB 5HGDA 4BZ2L 3FO9B 5FO8A 4UAOB 4OFIA 1WWBX 3RDTC 5IQ9B 2VXTH 3TA3D 1KLUA 4JAMA 2DLGA 2YSSA 4CNIA 4N8VB 3BH8A 3TNMB 1FNEB 4N68A 2P7TB 4U6VL 4YXKL 1CQYA 1FZMA 4YHML 4KKLC 3TF7A 5CIPB 3P40A 4R7DA 3K81A 3NN8B 5E99L 5T5NG 5CJXA 1Q72L 2R8SL 1OARH 1JGVL 4N0UA 4HD9A 3TF7C 1C12B 3G5XB 3S5LB 2CO6B 5CJXC 3INUL 3MYZA 3D6GA 1FFRA 1IKNA 2HN7A 4UUJA 2CIIA 4HCRL 1NBZA 4LP5A 1FBIH 3GSOB 3A6BL 1IKNC 5DRNA 3W2DL 2CGRH 4JPIA 4PRHB 1J8HB 4OKVA 2KZ1B 3WFCL 3AU1B 4OIIH 2HT2C 5ANME 1I8MA 3HI1B 4MXVE 2P1YA 3ARYA 3PWLB 2YEZA 1EAPA 3RL2B 3OF6D 5T5FL 4JY4A 4LCCA 4JJ5A 1DLHB 1ZMYA 2A77H 2H8PA 5FK9B 2MKWA 2O5ZL 1FYTD 4MJIB 3DO7B 2DDQL 4LCCC 1A9BB 1ZOXA 3QUZD 3UYRH 5ISZE 1E6OL 2A83A 1F11B 3KPLB 1GGBL 43CAB 2XY1A 4Y5YB 3ZTNL 1TVHB 1YEIH 2PYEE 2NX5B 3GI9L 4OUUA 3REVB 1DUYB 5HYSA 1KIRA 2YZ8A 3FB8B 4OI9A 4ZDHA 4GMSH 3L7FA 1F6FB 1UZ8B 3QIWD 1F90L 3QG6B 4HPYL 2FJFB 2VQ1A 1XAUA 4O58L 3FQWB 1WQVT 3V7AE 2YN3A 1ND0A 4JFFB 1BWMA 2X40A 5H2BB 1KEMH 5F8QC 1R3IL 2NNAB 2OQJB 3MOQA 3NZ8B 4CVXA 1BX2B 1QA9B 3ERYA 3EDDA 5I1EH 1KEGH 3SDDB 4MNGB 3RBSA 5I1DB 1EBAA 3KS0J 4ALAH 1MHHB 4OZHB 1KB5B 4I4WB 3SCMA 2BY1A 2X4RA 4XXCA 3C8DA 1BGXL 4KROB 1AHWA 5C92A 3SCMC 3UEZA 3ZYOA 2ZCKH 2Q7YB 3OZ9H 1RURL 4Z95H 2DQIH 4WV1A 4Y4FD 4N1EA 4XXCC 4BQCA 3I6GA 1CD1A 4PRPE 1M71A 1WBXB 4KGLA 3VE0B 4Z7VA 1UXSA 3WSQL 4FFEX 1BBDL 1VKXA 4WV1C 3R06B 3O3BB 3TYFA 1K4CA 2A6JB 5KSBA 1KPVA 4YUEL 2R0WH 3MX0A 2ZSVA 1RZ8B 1WCBB 2AV7A 1A6PA 3BX7C 1T4KA 1DVFD 2XTJE 2XFXA 4XVTL 4BSVA 1RAMA 3KJ6L 5IFAL 4WU7A 2DKUA 1Z3GH 5F9AC 1I1FB 4FXLA 4NKOA 3T8XB 1LNUB 2EICA 2WWMC 3DROA 1IGTA 3VXPB 4HC1H 4LSPH 1V7NH 4QT5A 4U7MA 5JXAL 4KHTH 3S7GA 1PSKL 1ZHKA 2P5WE 4PJ9A 2VN4A 5FECB 2X41A 4AY0A 3BDBA 2VLKA 1P9MA 3RPIA 1OCWL 1NANI 1NSNL 3T0XA 3TM6A 2HMIC 5CFHA 4ZOCA 1D3CA 1P9MC 1MWAA 1L9NA 5KVFH 1NCNA 4OCLC 1CFVH 1T66D 5HD8C 3BPCA 1F2QA 2FD6H 4PLNC 4MAYD 3DURB 3PQYD 1UKSA 4Z5RB 4NQVB 1MPAH 5E8DH 3I2CH 5FYKU 4Z8FH 3O4LE 1F4YH 5EBMB 1HINH 2DI8A 3C6LA 5T33H 4GSDH 4LLQA 5FOJA 4JGJA 4G8FB 3W0WA 3QJHA 5D7LE 1DBBH 3V0WL 3SDAB 3C6LC 3WO3B 3F7QA 4OI8A 4LRNH 1QSFD 4Z7OF 1RZ7H 4K2UL 1Y18A 3MLUH 4KJWD 4M9OA 3ZDYE 3BPLC 4EIZC 5GQBA 1QSEA 4X83A 3NTCH 3UZQA 3WD5L 3HR5B 5CGYC 3P0VH 4RQQB 4QHMA 3SE8H 5KSVA 3S35X 2AABL 5DLMH 3OMZA 2C3VB 4PJDE 4PJAE 4NQEE 4V1DD 5ICZB 5J3HD 1N0LA 4YBHA 3BKJL 5EA0L 1TZHB 4OZGB 3BEVA 3GSXA 3MJ8B 3U36A 4PBXA 5EC1A 3E2HB 3RVUC 1M7IA 2P5EE 1Q0YL 2HFEB 2Q3ZA 3GI8H 1YEFH 1YNTA 3VXRA 2PR4H 1QFWI 5EZLA 1T1XB 4HIHA 4K9EL 4NKIH 1KTLB 3RWDB 1FFNB 5CJOH 5GS2H 5GS1A 1AH1A 1EX0A 3MGTA 1LO0L 4ZNEA 3EJJX 3O3AA 3LB6D 1S78D 5J1AA 1PEZA 3BKML 5GS1C 3E8UH 3U4BH 5GS2D 4LDOB 3QIBD 4ELMF 3OR7A 2MSPA 1U8IA 4WUKH 5EG6C 1RY7B 3RWCB 5H37H 5JXED 5D5MA 2X4NB 2IAND 1RULH 3NZHL 4OM0H 4J1UA 2OI9C 4FG6C 4G9FD 1QPPA 3S98A 2IFGA 2PCPA 3FT4B 4PJ8D 3FQTB 5EC2B 1HI6A 1A7OH 2X89A 3SDXA 1U8HA 3CCHB 2WM0A 3B9KD 1A6VH 5IFJB 3J8F7 5K9OB 3QUKB 1DQDL 4RGNB 3EYUH 4NKDA 2AGJL 1QQDA 4QRQB 1CDHA 1RPQA 1IAMA 5I9QC 3W9DA 3EYQD 3MV9A 2G60L 1AGEA 1KCUH 2VR9A 3LEVL 2GJZA 3OHXA 4MB5A 2ZUWA 4MZ3A 2BNRD 3ESUF 1MCSA 2CDFB 5C0NC 5LGJA 3U1SH 3Q6FB 2PYFB 2D7TH 3ZYIA 4GAYB 1D5BB 4MCZB 5FM8A 1AC6A 4LVHC 4MDIA 4G8EB 4QYOB 4GKNB 3T3MF 3BP5B 3TWCH 4O2FB 4S1SL 2DWDA 4JFEE 2DOCA 4YR6B 5D1XB 4D2NA 1IC5H 2XQBH 2VL4A 1ZKAA 4YNYA 4AL8L 2IPKA 2EDFA 4DN4H 2V5RA 2C1OB 4H88H 1LDPH 5JMOC 2H32H 3WE6A 3QT2A 5HVHC 3VFOA 1BBJB 1MAML 2LABA 3MNZA 4TUJB 4XNMA 4LLUA 3RA7H 3OKDA 2D7QA 1G7LA 1L4IA 4YHKH 4C4KT 1OP3H 5MI0C 3QSKB 2HT4D 1MCIA 4XXDB 1KELL 4FQJH 1Q9KB 2BJMH 5GGTH 4Q9RH 1R5WB 5A2JH 3OJVC 3RUGB 4JRXA 4RAHA 1QACA 2C3XA 5CWSA 2AXJA 4HMEA 2ZZUT 5HGHB 2FCBA 3KWWA 5ICXA 2X4UA 5DRWA 4WTXA 1TETL 4L4VB 2GSGA 4L8DB 4OI7A 1C16B 4XMKL 5E24E 4O2EB 5ADPL 1CE1H 4KC3B 2DD8H 4MA3A 2KKQA 2CUIA 2JCCB 2IF7A 2UWEA 2ITCB 5HI4D 1U8MB 2B20A 2ORBH 3GJFA 4HZLA 2QQKH 4NUJB 4K3JL 3PXHA 3X3GL 4E42B 2ENSA 3T4YB 1QEWB 3OKOB 4UTAH 3MJ9H 5EOTA 4CGTA 4U6VH 4ZUWA 1BF2A 4LKCA 2X70A 3EDKA 4HV8A 3HZKA 3SN6N 4S10A 4D9QE 4UIMB 5FDWA 2R8SH 1A3QA 1FJ1A 2NQCA 1JGVH 2EZ0D 2ZP0T 3QDGD 4POUB 3P9LA 4S2SB 3EAKA 2WSKA 4FXGA 4LCIL 3INUH 5FXCH 3V6OE 5C0JB 2X9XA 4ZO8A 2ESVE 1ZT7A 5IEKB 4OGYL 5D7KD 5D7IA 5F7MC 3NIGE 1N2RA 2VISA 1T5WA 4QRTB 3EYVA 3QG7L 5IBUG 1HHHA 2FX7H 4MD5B 3D39A 3WFCH 4R90L 5HHVH 1OGTA 4WO4A 5I19H 1ACYH 4WU5A 5DD5H 4OB5L 1P69B 4I2XE 3IDXH 4U3HA 1E28B 1QG3A 3BPOB 3TIDA 5T5FH 4HS6A 5KANI 1NCWL 3RDTD 4H5SA 4NIKB 4ORGA 2PXYA 3OJDA 2NY5H 2WAHA 5IIEA 2FLRT 4PJIF 5TH2B 1KLFA 1I7ZA 3HNSL 4PLKC 1GJIA 1IKFL 1OT2A 1AC0A 1B2WL 2PXYC 1IEBB 2VWEE 2BDNH 4KKLD 3TH3T 2W9EL 4X9HA 2BRRH 1RZGA 1MF2H 5BS0B 2HJKB 1PKQA 4O5LH 3KLAA 3HI5L 4NDMB 3ARUA 5C71A 4OZ4A 1X5JA 1EERB 2D9QB 3RHWK 2VR5A 1DANT 3LKPA 1ZLSH 2D0FA 2E9IA 3D25A 4P2RD 1MH5A 1JF1A 5HHXL 4TUKL 3VCLB 4JFHE 2H2PC 4ODTL 5KG9A 3WMSA 1GIGL 5JHLL 4JB9H 4HKXA 1P4LA 3SBWC 2Y06H 1AGDB 4LNRB 2VQTA 1CT8B 4APQB 4WWKA 4O58H 4QOKE 2HT2D 5DK3A 4PP8C 5SX5K 2X4TA 1NGYB 4G8GB 2NYYC 5I1IH 4FA8A 3D3VB 4J3UA 3E6HB 1A6UL 4WWKC 2OTUB 3V4PL 4XBPB 2CMRL 4EI5B 1ORSA 1TTUA 3FB5B 1MFBL 5K59F 3BP4A 3OKNB 3BDYH 2F54E 4JDZB 3OB0K 4PJ5A 3WO4C 1CQKA 1BGXH 3O4OB 5D1ZB 6FABH 3CNKA 5GGQL 2JB6A 1PY4A 4CW1B 2V17L 4DKFH 2YPLA 4ZUUA 3U0TB 2IH1B 4Y1AA 3CXDL 2ENYA 2QADC 1HIML 1N5AB 2LU7A 3GGWB 4XX1G 3M17B 4Q0XH 3V5KA 2WBJA 3VGEA 3MRDA 1JZ8A 4YUEH 2BXZA 5DRZA 1FPTL 4O4YL 5KS9F 3VFMB 5ALCL 2WBJC 1NJ9B 1TVBA 4JZJA 3HLAB 5IFAH 4H20H 5C0RH 3V52H 2CLRA 1G7IB 1KJ2L 5DHYA 1H9VA 4GAJL 4JZJC 4R9HA 4CU7A 4I0PC 2VL5A 5BVPH 5E8NB 3QEUA 1X5GA 2F9BT 3KDMA 4XVUC 2KQMA 3GMRB 2VLMD 2NTFA 1WUNT 2R1WA 1F00I 4AEEA 4WDIA 5DFVC 4N8PA 4PG9B 1FFQA 1KN4H 1YEEH 2KPNA 2DBJA 5ENWB 3ZDXF 1L6XA 1SM3L 1NSNH 3SCMD 3KXFA 3EYFA 3TJEH 5EO9A 4NHUB 3ALPA 2CK2A 1QPXA 2VLRA 2YK1L 2NY6C 3MBEA 1KPUA 3H9SE 4OCRL 3EO1A 4UT7H 5EZIL 2V7NA 3SQOL 3FB6A 2MHAB 3HI6H 2GTZB 5JPMB 4HXAH 4YK4C 1XFPA 1ZLWK 5HSFA 4UOW1 3CFKB 4HIEB 3UTSE 2HG5A 3TYGL 5GGRB 5SWSE 3ETBF 4TSBL 2E5EA 3AS3A 1M4KA 4K94C 3TVMB 3BE1L 1XCTA 4DW2H 5T1KB 4LPYA 1H3GA 2EKJA 2ZUSA 1MWAH 5C0AE 1XGTB 2LQRA 5K9QG 1JPSL 3MV7B 5EORH 3B4NA 3MODL 2HMID 3ZKNC 1BJ1H 2VLKD 2C1PA 4Z7UB 3BZFA 1T2XA 2AABH 3DXAB 2Q20A 4ZS6C 1UVQA 4KAQL 3PJSA 5HD8D 1T1YB 3TNNA 3LKSB 5FO9A 5L7XH 3BKJH 3NCCB 1MIEH 1RSFA 3SE9L 3RQ3A 4RGOL 2IMMA 2GHWB 4QCIB 1IGML 4JHAH 1WFOA 1Q0YH 1PYWA 1G6VK 1B0GA 5HPOA 1EZVX 4YDIL 3WJLC 1D9KB 1IM3B 3DO3A 3HMXA 4ZS7L 3T04D 3ISWA 3C6LD 1V3KA 3NFSL 3X11B 5JDSB 3KHOA 3G5YB 3I3BA 1NGXB 2B8OT 4OQTA 3EO9L 3L7EB 4OV5A 5DXWA 3BJ91 2V2TA 3QB7C 3WFHB 1XR9A 3O81A 1HXYB 1MCQA 2IAMC 5CGYD 1R5VA 2AK4B 3CFCL 1YEGL 1CZ8H 2D2OA 4IS6A 1FORL 4KPHL 5BZWA 1QSED 2APXA 3GHBH 3Q5YA 2PTTA 3I3EA 3RI5F 1UWGH 5EUKA 2CLZA 2PTVA 4NBZB 4K8RL 1INDL 3A0OA 4LCWA 4PREA 4YX2L 2VSDA 4P57B 2WBKA 1MI5B 4JKMA 5F1SA 1NQBA 4NNXA 2YUZA 3RVUD 1CFTB 1LP9B 1XZ0B 3MROB 5IKCB 4DOHE 4JVPA 2R69L 4ZO7A 1QR1B 3AUVA 4J3WA 4NGHH 3RPKA 5E7BA 3MFFA 5D72H 5TDNA 2YS4A 2R0ZL 1I7RB 3GMLB 3VXRD 1S5IH 5FOBB 5KJRL 5EPMA 1T04B 3C09B 3EOTH 2AGJH 5HGBA 3SO3C 5B38A 1Z0NA 4M6NH 2I07A 4JGMA 2Y72A 3WNPA 3V5HA 4C56E 3SKMA 1HZHH 1VFMA 3QCVL 5JW4R 25C8L 3LEVH 3PWUB 4ISVB 2VZUA 4HWEH 1MLCB 4DAGL 1NGQL 5KVGH 1N3NB 1JWUB 2GJ6E 3WIFB 3EUUA 5I76A 2IALB 1UJ3A 5IHZA 1X4XA 4OV6F 3LH2H 1RZJL 1A5FL 1VGKB 1UJ3C 2VMFA 5DJ8A 3FQRB 4W70A 2JB5L 4OZHF 4YEFA 3ARFA 1GGIH 4PP2B 3CDGA 2BK8A 4I5BB 4YE4H 3T0EA 3HE7B 1S7VA 2F5AL 4HJGB 4HGMA 2X89D 4HPOH 4OF8A 4X5XB 4LHUA 4PJ7B 1T20A 4EDWH 3HTLX 4K71B 2XPGB 4C4KO 2OP4H 3IDMB 1HKFA 3PWNB 1S7QB 3AY4A 3ROLB 5E1AB 1B0RA 4GUPB 1JWSA 2FJGA 3DETC 3WIHA 4LSRL 4YWGH 4C83A 3GMMA 3T3ME 3MLXL 4M7LT 3MXWL 4NQCE 1HYRC 5I8EB 4JM2B 5GSRB 4CUCA 1P2CB 3IFNH 2R1YB 5JQHC 1DUZB 3MV9D 1P1ZA 4M7JL 1INQA 1BOGA 2ZNWA 4LSVL 1I9JH 4IIQC 5LXGL 5C0ND 5JHDE 3QJFB 3EOAB 4J12A 2FH6A 5CUSL 1Z5LB 4HS3B 3ZHDA 4X4XA 5FGRA 5T1DH 1JHTA 3WNNA 3BKCH 1KFAL 3OKEA 4PJBB 5JOPE 1JWMA 5E8EB 4ZAKB 4DFHA 2FSEB 2CRZA 1A8JH 4XWOD 3O11A 4JQXA 1J1XH 1XGUA 3DV6A 3LD8B 1G9EA 3OXRB 4AQ1B 4OLYL 5FIEA 1U3HA 2VUOA 1CBVL 1JMZA 1I7TB 3S3PA 1IGCL 3CUPA 1U3HC 5C6TL 4IOIA 3CU1A 2CRMA 5CZKA 5E4EB 1ZGLP 3NPZB 2FX9H 4K3JH 3X3GH 4MQXC 4M8QA 3SE3A 3ULUE 5FCUL 5CEXB 2EDEA 5CJQL 1JV5B 3BYTA 4NUGL 3VD4A 1AKJA 2XA3A 3E6FB 3V8CA 4LF3B 3SE3C 4NO5B 3MA7A 3KPQB 2VC2L 1BFSA 4CVUA 4QRUB 3C9NB 35C8L 1DN0A 1OAYH 2FJHB 4OLWL 4JRXD 5A2IH 3QBTB 5HHNB 1FLTX 2C4FU 2DIJA 3QCTH 3LQMA 1AIFB 3GNML 5DD6A 1GVIA 1AQDA 1VB9A 2DLEA 5F1IA 3SY0B 1HHJA 3VFGL 4X7SH 5F9WC 4WFEE 4F7CA 5JOFA 1ROWA 3OXSB 3CFDB 2VLJB 1WEJH 3SDCA 3AMKA 1QBMH 5HVFB 5T3ZE 4OB5H 3H9HB 3MPCA 2XG5A 5BW7C 3SDCC 2X1OA 1LHZA 4OZGF 5DMYA 1NCWH 5FYLE 1MUJB 3L1OH 2H2SC 1NBVH 3S88L 4BA8A 5HI3C 3QAZC 1WWWX 1OAQL 1MEXL 3QHZL 1F2XK 1DEEB 1B2WH 2H6PB 5GRZA 4QRPA 4UU9B 4X6DA 4D9RD 4XTRC 1VEMA 5KVMC 2IPTL 2VIRA 3DLQR 4WEMB 3MRIB 4X5WB 1AO7B 1KV3A 4XAKE 1B88A 3F58L 4F7TB 1ZA6A 1MFEL 1ZA3B 2EXWC 2VNCA 3VI3F 5HHXH 3STLB 4MJ5A 1T7VA 4CMHC 5C09E 3BP6A 1JTPA 3SGJA 2IBZX 3ALXA 3GMQB 4R3SA 3NGBC 4P4KB 3LRSB 3SGJC 3STZA 3D39D 4GRWE 4AH2A 4ZMAT 2CMRH 2HP4A 2YBRB 3PHOA 4TOYL 2HLAB 1QHPA 3X14B 1LWRA 2N1KA 3H3KA 3HHRB 4GJTB 1I1YB 1R3LA 1YY8B 5CCKL 4OGAC 4ZD3H 1TJHL 1XGPB 4QRRE 4PLKD 3A67L 3U0WL 3MNWA 2CO7B 2Y5TA 4L5FH 4QXUL 4XB8A 2PXYD 2GEEA 3DUSB 3EIFA 2QKIB 3MGOA 4NC0B 2YA1A 4Z78A 5CJ5A 5DUPH 4MVBA 2DIBA 3D2UA 4CMMA 1TCRB 3BI9X 1X6LA 1RUMH 1TVDA 4MVBC 3SJVA 2X1QA 3PL6C 1FVCB 1VADA 4I48A 3TBYA 5JPNA 4ORZC 4OJFL 3NCBB 2GIYA 5BO1L 4X7TA 1P7QB 5DVOA 1X7QB 5ETUB 4JQVA 1FPTH 3VFNA 2H2PD 4MA8L 4N5EA 5MEPB 1G7HA 2BSED 4OZFG 5ANMA 5CD3B 4URTB 3IRPX 4X98A 4JQVC 1CGYA 3TBSA 4UNVA 4N5EC 3IJHA 4OUOA 2A9NL 4RSVA 1PZUB 2NYYD 4ZNCD 4GAJH 1UWEH 4HIIA 1OT1A 4WWKD 4XH2A 4EVNA 1GOGA 1YJDC 2ZOKA 3UTTE 1KCVL 5CEZE 3GRWA 4EBQL 2VZSA 3EKCA 5D2NB 2W1NA 1U8OA 5D93C 3GSQB 3TPUB 4AT6A 2EEDA 1R5IB 2ATKA 2RCSL 3SO5A 3SEPA 1DBKH 1SM3H 5E6IC 2AEWA 1NDMB 4Y7MA 1S7RA 4HUWB 2PYEA 2ZUQB 1TQBB 4M93C 4PJ5D 4U1JA 3NFPB 2CKNA 2OMNA 2OMBA 2QADD 4F33A 3K4AA 2YPLD 4IRSA 1QFWM 3SQOH 3U0PA 3PHQA 4NKQB 4YFLI 2APVA 2XZCH 3AS2A 2LTQB 2WUCL 4IRSC 1FZKB 4DQOH 4Y19E 1IGFL 1S7SA 2WBJD 5IK3A 1LDSA 1H5BB 1AQKL 3RUGF 2CKBL 1NEZB 3QFJE 1U36A 4XCFH 5FV2A 5LBSH 5IB5A 3WUWA 2JTDA 4R4NC 3WN5A 1FIGL 5CZVL 2VZVA 4EUPB 3TYGH 2O5YL 4TSBH 5DD1H 5HHMB 5CMAA 5FB8B 1RUQH 1X5HA 5DJDB 2J6EA 3WN5C 4JY5L 1BFVH 1J1PH 2WINB 2B7DT 4XVUD 2XNAB 1A3LL 1GZPA 3DTXA 4R96B 1A6AB 1PG7L 3FO2B 4FQXC 4U6HB 5GGRY 2ATPA 5DFVD 2MWCA 5C2UB 1QLFA 1W0WA 1WWCA 4PRPA 3NAAH 2JCCF 4FQIH 3ARPA 1SBBA 4WHDA 1CFSA 4MX7A 1OM3L 2P48B 3DPBA 4HHAB 5C6PB 1HHIB 5H35B 5FYJD 3DSFL 4P59L 4Y5VB 3KXFD 3HE6B 15C8H 1BEYL 2NY6D 5F21B 1Z9OA 3VGGA 1YMME 5IM7A 3S6CA 3IS0X 4YHYC 2VLRD 5H94B 3ARTA 1XIWC 5TQ2H 4B50A 4K94H 4D0BB 2EIDA 4NO3B 4YDIH 2Q6WA 2I25N 4MYWB 4MMXC 4KU1A 1NGZA 4JRWA 1LO2L 1FO0A 2CLVB 1H3UA 2P5WA 4JR9L 1ZE3C 4JFQB 3EO9H 3S36H 4Y16C 2HVKA 2NXYC 4KK9C 4YDKH 2D31A 3GBMH 3CZFA 3FO1A 3U30B 3BJLA 5DYOB 3CFCH 3CLFL 3VGFA 2DM3A 4F58H 3ZKND 4EN3B 2HKHH 1OY3B 1LEIB 1M05A 1OOAA 1DQTA 2BVQB 4ZS6D 3GSWB 4H1LG 4K8RH 3MJ7B 4YX2H 4XPAL 4MCYB 3VWKA 3MR9A 3O4LA 5E8OB 5DD0H 3HMXH 3VWKC 3IJSA 5D7LA 3DIFA 1BREA 3CFEB 4WNQA 1DCLA 5IBUB 4PRHE 3LPGA 3C5JB 1KJ2B 1QOKA 4XVJL 4OQTH 2EDRA 2R2BA 3GSNB 3DOSA 2G5BA 2Q1EA 3BN9C 4LIQL 4NZUL 2Q8BH 1LK2B 2ARJB 2YD1A 5GXBB 2QR0B 4ERSL 3KG5A 3UJJL 1UENA 1T2QL 4L4TE 2IAMD 5C07E 4TPRH 4LAQL 3HB3C 1M7DA 3VWJA 4PJDA 4PJAA 4PUBH 25C8H 4NQEA 3EOBB 1JGLL 3EO0B 5F9JA 3RRQA 3VWJC 3EW3B 1TCMA 1FFOB 3V6FA 2E6PA 4QXGL 2EC8A 2D03H 2P5EA 4LCYB 2NX5E 4F8QA 1ZHLA 3BQUB 1KIPB 2DKSA 3VD5A 2OSLB 3JWDC 3HPJA 4E0RA 4NZRH 5IT2H 4LCWD 5E2VL 3MRNA 4W4OA 4PY8I 4K3EL 4ZOBA 1KIQA 3TA3B 5TE6H 1G7JA 1YPZB 3EOYG 4LKXA 4MQTB 4W4OC 3WL9B 1AJ7L 3IKCB 4XWGL 1MFCL 2X9WA 5BV7C 4JFDE 4NC2B 4U1MB 1H15B 4PJHE 1IFHH 3O2DL 4IMLA 4WUUE 5T3XL 1MJ8H 2NLJA 2AJYL 1IARB 5DZOA 1RJZA 3BW9A 1J5OH 1FFPA 5DR5L 3WKNA 3BWAB 1RZIA 2RQ8A 4Z6AT 4O2CB 4MNGE 4MAUL 3MLXH 2B0SL 1RJYB 1SHMA 3MMEA 5F89A 2O93L 3U46B 4KQ3L 1NAKL 5L2JB 1G7MA 4OM1H 2BNUA 3ZE0F 4M7JH 2FH8A 3KYKL 1X5KA 1VFAB 3EZJB 2YC1A 2X4PA 4ODUB 4EKXA 2X7LB 4JN1H 7CGTA 5AD0A 1WLHA 4L29B 4F2MB 1ZT1B 3QIUC 3GMPB 1HDMB 3CXHK 4QTHB 5IB1B 4IHOA 2BRQA 1EGJL 2VABA 1ZHBB 3MRKB 2AQ3A 3BGFB 4H8WC 2RFXB 3F8UB 4UNTA 1AY1L 2NW2A 3QNYB 1JRHL 2NY3C 2DL9A 1IGCH 2WWKT 1WTGT 2X4QA 4XC1L 3WIHH 4LHUD 4JCMA 2Y5EA 5E2JA 5EBGA 4MDJA 4ZUTB 4LSQL 4NJAH 1OP3K 1YDPB 4XAWH 5FCUH 3V2AR 3QNXB 3F65A 5ID0A 2DJUA 5IJKA 3IFPB 3CSPA 4O51A 4BFEA 5IMMB 4HBCL 5K9JL 1YYMH 3GHEL 2GI7A 1WAAF 3B6SB 3SKUD 5IJKC 1RIVL 5K9KB 4OF6A 3QIWB 3U2SB 3CVHL 3MLZL 3P4LA 4PJGE 5I30L 1ADQA 4ZUSB 1A6WH 3EDEA 4J3XA 3EGSA 5B39A 2EXYC 2YWYA 2Z91B 4IRJC 4JFEA 5KSAA 3VXOA 3QUMA 3SDYH 2DMCA 1JHKH 1KF9B 1RHFA 3VXSE 1F3JB 4AYFA 5IV2A 5D9SB 5KSAC 4D0CA 4JO3H 5FGBA 1MAKA 4Z7UF 5JW3L 3BZEA 3W5MA 1SEBA 2P8MA 5FGBC 5FYJU 3HMWL 4YO0A 1LEGA 4PV9A 1T3FA 3WHXA 1J8KA 2EDYA 1U3HD 4RAVA 3I75A 3EYSL 2NY1C 4G7YH 4HQQH 3E3QE 1MCHA 4MQXD 4D9LH 3RNQA 2E7BA 4I77H 4RFOL 3T77B 1KT2A 2BXYA 4JFOB 4KDWA 1OAQH 3V79C 1OSZB 1ED3A 4P2QB 1U6AL 4DZBA 5CSZA 5DUML 2VDRL 4YHOL 1EVTC 5D7JA 3MRBB 2FYYB 1DVFB 2NY0C 4JFPA 4KRMB 1AKJD 3BIAX 1JPFB 5D7JC 1DDHA 3QPQC 3A6OA 4OZGE 2OJEA 3TZVB 1QO3B 3RBGA 5EOCL 1R24A 4XP4L 4A6YL 4UV4H 1A1NA 4CRPA 1AGBA 3RVWC 4MB4A 4Q2ZB 1YEJL 2DQDH 1JTTA 5DURD 5T5NF 2VXVH 4U0RB 5GJTL 5IJVA 2B2XH 4FXKB 3GIVA 1EEQA 4GBXA 3KPTA 3HRZA 3MCKA 2H1PL 5AWNH 4G59A 3SDCD 1N5YL 1RI8A 3BZ4A 5CGTA 3L3KB 1U93B 3TH4T 4PRBA 1LP9F 3JSSA 5I8KL 2H2SD 2WNGA 1CXEA 4MAYB 3BT2H 1QFPA 5HI3D 4UT6L 3CC5B 1XMWA 1S9WB 3ZSSA 1I3VA 4JREC 4XTRD 1S7TB 1PX3A 3MRRA 1NFDB 5HDQL 2BVEA 2IGFL 4QRPD 4GLRH 3V6OA 2ESVA 1A6ZB 3HG1E 5C8JA 4LNVA 4YXHL 1BJ1J 3JXAA 1JP5A 1TNNA 2EXWD 5BO1H 3DX6B 3IFOA 4ELKB 2HT3C 3PWPB 1MVUB 1KJVA 4LFHD 4TNWF 2GFBA 4XNQA 2K1MA 4LMQI 3LPWA 4I2XA 5GISL 2J5LC 1XT5A 2MPAH 1TMCA 1G9NL 3C08L 5TDPB 2Y36H 2OR9L 5C0FB 3FB7B 1CL7H 2OTPA 5HYJE 1MFNA 1TFHA 2DQEH 4V1DB 2NY7H 2XWJB 4JZNB 4QRSB 4ODVH 3KJ4C 4L8BA 3RAJL 4G6FD 2CSPA 1N26A 1CG9A 4NO2A 5GRVK 4FZ8H 4OD2A 4OGAD 4MMZC 4L8CB 1CS6A 3A6CL 3PWVB 3P73B 3MO1A 2VWEC 2W07A 2DQTL 2Q76A 4RX4A 4PJ7F 2H26A 2WV3A 4K7FA 2DRUA 3NCEB 3WFDH 4MVBD 3O45A 2DWEA 4P3DA 4G3YL 3D2UD 3PL6D 1XCQA 4EDXA 1G0XA 1QVOB 1YMHB 4KK5C 3FFDA 3VGHA 4X6EA 2W91A 3FN3A 1R3JA 5E6YA 3MLVH 3FFCE 1Q94B 4JM2F 5FHBL 4QOKA 2OL3A 1SQ2N 5GS0C 1P5VA 1UM6L 4JDVB 5L6YL 3QIBB 4N5ED 2NXZC 2B4CL 4F7PB 5JZ7C 4D8PA 4NWTL 2O5YH 2ITDB 3QPXL 3GRWH 4PJXB 1PZ5A 5EBLB 4ZFGH 2Q8AL 4ODXA 1U3ZA 2F54A 4IRZL 4RZCB 4PJBF 5D71L 1PG7H 2Z35A 5CILL 4G9FB 3RWEB 2HLFC 3CSBA 4PJ8B 5MENA 3KPSB 4NT6B 1MLBA 3GKWH 2YD4A 5E6ID 3GSRB 5LCVL 5ISZD 2P42B 3IDYB 5E5MB 1FN4B 4G5ZH 4M1GH 1CLOL 3D1MC 2XA8L 4ODBD 3BO8B 3B9KB 3TBTB 4PRIB 4LU5L 1IGJA 5E6ZA 3DSFH 4TVPL 2PYED 1BEYH 2CDEA 4EI6A 4FQ1H 5ITFA 1UB5B 4L4VE 1U8QA 1EK3A 5F9OL 2YA2A 5BXFB 4IRSD 3H2WA 4YBLB 2Y7QB 1ZGLB 3BD3A 3S37H 1MNUH 3OR6B 3RGVB 3MRQA 5IMLB 1KXVC 4U1LA 1LO2H 2J6EH 4R4ND 1G6RA 1FG2B 1MCLA 2C26A 1IAOB 4EOWL 43C9A 1YUHA 2E27L 4AZ8A 1IL1B 2WIIA 1KG0B 1UA6L 4PD4J 4P2YA 7FABH 4Q74A 4P5MA 4R4BA 5D2LF 5FO7B 3WKMH 3KGRA 4P23A 3V95A 4PGDA 3T1FA 2BP3A 4HUXA 3KLSA 1U9KA 4H25B 1E6JL 5F3HA 2JJSA 4P23C 3H0TA 3H9SA 1S7XA 3ARXA 3S9DB 2QJDA 2JJSC 1TTGA 3HZVB 1AR2A 2A9ML 12E8H 2BMKB 3IXTA 2XY2A 1GZQA 1XF2B 1I9RL 1FO0H 1XIWD 5HHPA 4J4PA 3UTSA 5SWSA 1A3RH 4F3FB 2CUMA 1QP1A 4J4PC 2H32B 3IJYA 2VDKL 3IETB 2VJXA 3MA9L 1RUAH 4LSTL 1VACA 5A16B 1UADC 1Z0MA 4LIQH 4NZUH 4KMTH 4W81A 1DQJA 2P5WD 5C0AA 3V0VB 4KK9D 5I2IB 1ZANL 2QQNL 3WXVL 1G7QB 3GSUB 3ZT7A 1T1ZA 4LAQH 4M48H 1JCKA 4NBYB 1S8DB 2C4XA 4KTDH 4GQPH 3RWFB 1CR9L 4NC1E 4PLOB 1S9VB 1CVSC 3PV6B 3G5VB 5I1GH 4UIKH 5GZNC 3FQXB 4DVBA 3UO1H 2MCPL 4P9MH 3AB0C 3H3PH 3FN0H 3IRZA 3ILQC 4OCSL 4W68A 4PJCB 5KTEH 3LQAC 3VWKD 4LHQB 1HWHB 4K3EH 5C7XL 3V7MA 3O4LD 2XZQL 5JOEA 2CKBB 4L9LA 1MRFL 5DRXA 1MIML 5D7LD 2BVOA 4YGVB 4NRXB 4G8GE 4XVSL 4L9LC 1MOEA 3D3VE 1J1OL 3DSNA 4HH9A 4U6YA 3IU3B 3BN9D 5IROA 2YPKB 3QDGB 4IM8A 4YHZH 1DE4B 1A2YB 1YN7A 4ONGL 1ZGLM 3FCTA 5IROC 1KCRH 4PGEB 5DS8B 1OPGL 1GHFL 1MQKL 1D5MA 1PQZB 1MCWW 1LO5A 4TSCH 4GKZB 3KYKH 2XT1B 3VWJD 4CBPA 1JZ4A 4HFUL 1SYSA 1BQHA 3NIDF 4MNHA 4NQED 1U8KA 3EFFA 4LVOC 1DANU 5INDA 2XOTA 2P5ED 4OZFB 2ZPKH 2YPVH 3MXVH 3RDTB 2V9TA 1BVKA 5FO8B 4GKSA 2DJSA 2WWKO 1KLUB 3H42L 4JAMB 1UG9A 5AYUL 1AY1H 2C3WA 2ZSWA 4X99B 3VMPA 4ZOAA 2ICEB 4HKJA 4TTDC 4NZTL 1FZMB 4C56A 1CLCA 4DUXA 1HKLH 1FL6A 1OTSC 1WBYB 3P77A 4KKAC 2LU3A 4P2RB 5ACZB 4UQ2A 4MS8A 4ENED 4HBCH 2HH0L 5BQ7B 3GHEH 2JE8A 4HG4J 2HN7B 4G6AC 4LQ1A 1ZAGA 2CIIB 3MRLA 3VXME 1G9ML 1XF5A 4M7LH 3MLZH 4NCC2 3GMOA 1MHCA 4H8WH 1JZ3A 4OKVB 3QIUD 1EJOL 2J8UF 3HCVB 4AG4H 1XR8A 2AEPH 3IXAB 4Q9CA 3LOWA 4XNXH 3G5ZA 3U48A 4Z7NE 5IVXE 2BOCB 3JWOL 3MRHB 3W5NA 1QNZH 4Q58C 1CGXA 4LCCB 1T7XA 2H8PB 2NY3D 1WAAE 2F58H 3CFIC 3VDBA 1NUGA 1PY9A 4NWUH 3KPRA 5C1MB 4NQCA 2QL1A 1CXHA 1LD9B 1ZXQA 2A83B 3HAEA 4NPYB 2ZJSL 5EU7C 5EU4B 4HX1A 1AXTL 3GJEB 4N0UE 4CJ0A 3UBXA 1KIRB 4WENB 5JHDA 2AV1B 2Z31A 4WGWB 3F12A 1ADQH 3U83A 4Z7UE 3MLWL 2IBGA 2DI9A 3DXAE 3S4SA 3L7FB 5IEHA 2Z31C 5JO5B 4J3TA 5ESQA 3QUMH 4WI7A 2EXYD 3FMGL 4IRJD 1BZ7B 2VQ1B 1ZLUH 2R2EA 4GRLC 1AE6L 1ND0B 3B3IA 5EH1A 3GO1L 3WEXB 4XP4H 4JFED 5KSAD 3MCLH 5F7EL 2F15A 3OGCB 1YEJH 3IU4L 3VXTB 1JGDB 3MLYL 2EIBA 4XBEL 3BSZL 3F6LA 4PG2A 4WHYG 1FSKC 5GJTH 1N7ML 5A2FA 1PD6A 1Y0LA 1UXWA 3SCMB 3UDWA 5LWYH 3JVGA 2NY1D 1JGUL 4PTUA 4NM8L 2K3TA 5DMIH 5I8KH 1HHGB 3LQZB 2EKSB 3TBWA 3ULUC 4WV1B 3VFPA 3JVGC 1CD1B 4N1HB 4UT6H 4OSUL 1UXSB 4JKWA 2AK4E 2YN5A 3TYFB 4FQCH 3THMH 3TGXA 2NY0D 4LCUA 4H26B 5KSBB 1KPVB 5HDQH 4H1LB 2ZSVB 2DQFB 5D7JD 3ULSA 1MRCH 1X6NA 3QPQD 1IQWH 4HXBL 4YXHH 1SVCP 1P4BL 2ICES 1MI5E 1UZ6F 5JIKA 1NCUA 1KJMA 3DROB 1IGTB 3IDJA 3FOLA 1LP9E 5IESH 3P11H 3IVKA 1T83C 1SEQL 4RMQA 1MAJA 1PFCA 3RVWD 5DQ9A 4JPKH 4YHIB 4BKLA 3VXNA 2ZOLA 3OKYA 5IMKA 4YHNA 1HH9B 1AI1H 3C08H 3LHPL 1Q9LA 2EIZB 2BSTA 1Q9OA 3RPIB 3NH7L 3BGMA 5J6HB 3QH3A 3VXQA 3QULA 1MWAB 4HG4K 3RAJH 2FEEL 2J88H 3C6SA 1H3VA 2HYMA 5IW6A 1MJJA 4D0DA 1YPZF 5J89A 4D94A 4YZFF 1CGVA 1UH3A 1JIBA 4NQSB 4JY6A 4D9QD 1BZQK 3BAEL 3QQ3A 2FEDC 3AVEA 3CVHB 4RWYL 4NN6C 4FQQA 3JTCA 4IOSD 4XMLL 4G3YH 4OFYA 1PVHA 2AJVL 3C6LB 1BLNA 4LLMA 4MQSB 2P8PA 4LLQB 4P2OC 4WHCA 3U9PL 4NCC1 3UTZB 5CKAA 3LY6A 4RWHA 1B3JA 2ESVD 4BZYA 1ITBB 5C09A 3U7WL 4BQBA 5BVJB 2QTEA 1WF5A 3FQUA 1DSFH 4P9HL 2HT3D 3BPLB 1UM6H 1SJEA 5FYLL 2GKIA 4UTBL 4YDJA 5KOMC 4MNQE 1F6LL 3SGEH 3P0GB 4PJ7E 2V5YA 1QSEB 4IDJH 1JHLL 3VJ6B 2IH3B 4ZFZA 1HEZB 1OAUL 4ONHA 4QHMB 5KSVB 4QRRA 4Z7WB 5IBTL 3L3GB 3RIFF 3I6KA 4XNYH 2BSRA 4LP4A 4E5XB 1YNKL 3AMLA 4NQXA 2FR4A 3KPOA 3U7AA 5MEOA 1FNSH 5LCVH 3CDYA 4AEIH 4XT1C 1MVFA 5EC1B 4TYUA 1CLOH 1IJ9A 2W9DL 1M7IB 2BVPA 2XA8H 2D0GA 4UILL 5GS0H 4RX4D 3C8KA 4LU5H 4L8SA 4TVPH 2FWOB 4JANA 1AD0A 2AK1L 4O02H 4RNRA 5FCSH 3SGDI 2F19H 3RIAF 4AM0B 4KK5D 3VXRB 4G80B 1NPUA 5EZLB 1YNLL 3I9GL 2F5BL 2A74A 1HILA 4JFHD 2IG2H 5GS1B 3MGTB 5JW5B 5GS0D 3O9WA 4UQ3A 3ZE1E 3BEWA 3BPNC 4G42A 2NXZD 5DVNA 4QOKD 3EHBC 1R3HB 5JZ7D 3O9WC 2BX5A 1B9ZA 3UTTA 2FB4H 3MLSH 4WEBH 4TNVF 3OR7B 3EFDL 4P0DA 1GH7A 2AJSH 4QHKI 5I8OL 3MRCB 4PTTB 5INCB 3O2WH 5D5MB 2OI9B 2HLFD 2X09A 3MSPA 2F54D 1K6QH 4J1UB 3P4OB 2Z4QA 5DTFA 1YECL 5FF6B 5DJXA 5ERWA 2EYTB 4O00A 2VITB 1NMAL 1S3KL 3SDXB 2KH2B 4LRIA 4G8IA 4PY7B 5EIIA 3L3HA 3QUYC 4X8JA 4GXVL 3N1PC 4Y19A 2ZWLT 3CK0H 1CL7I 1E4XL 3HC0A 4LRIC 3QFJA 4P4RB 2W65B 5I9QB 1G6RH 4KY1H 5D2LE 1QQDB 2N7AA 5GJSL 1N8ZA 4M6AA 1DLFL 1ETZA 4N8VG 4XPBL 1JBJA 4J3OC 3W9DB 5ICYA 5F3BB 1FLRH 4R26L 3MA9H 5D6CA 5F7DA 1AGEB 1U8NB 2V2WB 2PNDA 2MQ0A 5FM5O 3LS4H 3QO0B 2Z9TA 5IQ7H 5MEQB 3WXVH 2EH7H 3JZ7A 3DGCR 4LVHB 3D9AH 4GW5A 2ZCLH 5HDOA 3BUTA 3VGBA 3OX8A 4MDIB 3WDHA 2ADIA 4P23D 3ARRA 4Y5XA 2NW3A 4GO6B 1WIPA 1YMMA 2DWDB 3O6FA 4Z7QF 2VO5A 1BVLA 1AO7E 5IF0A 1GXEA 4Y5XC 2MCPH 3EJYC 2P4AB 3H9SD 2ZCHH 3L3DA 3O6FC 2AP2A 2ICWI 5HVHB 4YNYB 4OCSH 2IPKB 1URLA 5GIRA 4YC2C 3BD5A 3R0NA 2JJWA 3WE6B 5MI0B 1V3MA 4LLDB 1MREL 1GOHA 4S1QL 1OVZA 4XNMB 4PGBA 3S97C 2W59A 4LLUB 3S34L 3OKDB 1G7LB 3VI4F 5KOVC 4J4PD 3UTSD 1NFDF 3FO9A 4GW1B 5E5UB 2FATL 2AXGA 1S9YB 3T2PA 2W0LA 5F7HA 5IQ9A 4GFTB 1EO7A 3BIKB 1CU4H 3QWQB 1CGSH 1GC1C 4BQ8A 4UAOC 4JRXB 4ONGH 5K33A 2P7TA 2XN9E 3CVIH 5C0AD 2V7HA 5CIPA 1BJMA 3NN8A 5ICXB 4NJ9L 3R8BB 1F6AB 4E41E 5DFTA 3R1GH 2PW1A 3LQAH 2GSGB 1DP0A 3NA9H 3V8OA 1BZ9A 4FFYH 5GZND 1GGUA 4BUGA 3NBNA 3F7RA 3P0YH 4P2CG 2ZG1A 1TLKA 2GK0A 5T1LB 5KVEH 3L5XL 5EU3A 3G6JB 3ILQD 3GSOA 4PRHA 1W0YT 1YJDL 4BSJA 1NFIA 3GJFB 4HZLB 5C9JA 1C7TA 3HI1A 3MLPA 1AR1D 3IB4A 4FN0A 3PWLA 4A2LA 2P24A 1WSST 4YHLH 4HF5L 5SV3A 2P49B 4I8DA 5EOTB 2VH5L 3V6ZB 4DGVL 4ZUWB 3UTPE 3HC4L 1DLHA 4LKCB 5C07A 5KSUB 3GIZL 5JR1L 2X70B 3HZKB 1UJTA 3BP7B 4NP4H 5TF0A 5JIIA 2RIKA 1A9BA 4HS8L 3TPUE 2ERJC 5E2UH 3P9LB 5C3LD 1F11A 2NZ9C 1NEUA 4C59B 5A1AA 3T4AB 2HFFB 5LGKA 3KPLA 4XGZA 3TP4A 4Y5YA 3LIZH 1ZT7B 1A9EB 2NX5A 1DUYA 1NUFA 4PJXF 2D7OA 4Y5YC 1N2RB 2VISB 5BCAA 3EYVB 1OAZH 3HNVH 3BDXA 5JNYB 1UZ8A 4PFEA 1RK1B 3ZTJH 4YDLB 3RKPA 1FE8H 3QG6A 5F97E 2MJWA 3OKMA 3FQWA 4H0HB 4JFDA 4PJHA 4HS6B 4WUUA 2AI0L 1P4IL 5CSGA 1IC4L 4H5SB 5D6DC 1IT9H 2EDOA 4ORGB 3D0VB 2NNAA 1NKRA 2PXYB 3NZ8A 3OJDB 5HXMA 3QDJD 3U7YH 5IIEB 4GXUN 3HNTH 5H8DA 1I7ZB 4TTDD 4U6XB 4MNGA 5I1DA 2FGWL 3N1MC 2E8YA 2D7PA 4CN4A 1RZGB 4MXQA 3DECA 2J8UE 1OTSD 5DK2A 5IHLB 3KLAB 5GRUL 4KKAD 3U4EA 3MV8B 4C56D 1JK8A 4OZ4B 4CDHA 3G08B 3LRGA 1QFUL 4RISL 3MOAL 4XPHH 2X1PA 3VE0A 2DTML 4WI6A 1MH5B 4G6AD 2GJ6D 3R06A 5KG9B 5E08H 3TEUA 2XQYK 4HKXB 3CDFA 1RZ8A 4UV7L 4M4PA 4X6BB 4LEXL 4FP8L 3T8XA 1LNUA 2W38A 3PHSA 2A6DB 2X4SB 3VXPA 5IB3B 1ORSB 3FT3B 3BP4B 1N7MH 1KB5L 1IGYA 1FNFA 3HAEH 5FECA 1T22B 1FQ9C 4PJ5B 1K8IB 4NM8H 5TPWL 1BM3H 2DQHH 3VGDA 2JB6B 5IHUL 2QADB 3GK8L 3L3OB 1TZGL 3QXAA 2XIDA 4QTIH 4NQCD 1ZS8A 3FO0H 1IC7H 4H0IA 4V2CB 5KN5B 4PJGA 3N9GL 1F42A 2E6QA 5BOPA 2R0LL 5DRZB 4G43B 4ZFOA 2Z31D 1BQUA 5C0BE 1TVBB 4HXBH 4I0PB 1KC5H 1P4BH 3VXSA 5EBMA 4GRLD 4X6FA 1QBAA 5DHYB 5JOPD 5I66A 4ZODA 4G8FA 1F4AA 3QEUB 2Y07L 3MFGB 3SDAA 3TV3L 1WZ1L 2P43B 5IW1B 3P3YA 2FO4A 2NTFB 3P9WB 3SDAC 3E3QA 4WFGE 3QUZC 1IE5A 1IAIH 5C0GA 4WJ5B 3F5WB 4FQLL 5DVLA 3WS6A 3E3QC 3HR5A 3CAFA 4PJCF 2I9LA 3KXFB 3ULUD 1RIUH 5EO9B 5L2KE 4GMTH 2C3VA 3JWDL 4Y1AE 2VLRB 4YK4B 4GQ9H 3EO1B 5B39G 3FB6B 5ICZA 3BAEH 4FTVE 3UROR 5EFIA 1D5XB 1TZHA 4I3SL 4OZGA 2LVEA 3E2HA 1VEPA 3HR6A 4EZMA 3QXTA 5D70L 3U9PH 5BV7L 5GSVB 1I3RA 5T3ZH 2HFEA 3ZKXC 4HIXH 4YIQB 2I60L 1T1XA 1DFBH 3RWDA 4WFED 2LFGA 5FYLH 1NCBH 3KHQA 1YPZE 1EDQA 4YZFE 3TT3L 3KPMA 3DX9B 3E1F1 5T3ZD 5J06A 4LLWA 3OB0H 4FABL 1VPOL 1SJXA 2VB5A 3TCXA 2C1PB 1FDLH 2KDGA 3BZFB 4JPVL 4NNYA 3MBXL 2ZKHL 3QUXA 1UVQB 3WDIA 1YEKL 3TNNB 3T2QA 5FO9B 5KW9H 5ILTH 3QUXC 3LZFL 3HG1A 5D96B 2GQHA 3L5WB 4G6KH 2W9DH 1V5JA 2FEDD 2GY7B 3FQNA 5C2BL 3OAZH 4YFLF 4XAKD 3AXLA 1PYWB 3FT4A 1C08A 4QNPF 4P2OD 3N1FC 4JDTH 1A0QL 3HC3H 4XX1E 1JMXA 2E7LC 4PB9L 5JIHA 2HKFL 1YNLH 4OFYD 3DYMA 5DEZA 1F4HA 3CCHA 1NLBH 5F7WC 1F8TH 2HJLB 4GRWH 1UYWL 4LVEA 5C09D 2YUVA 1FAKT 3KR3H 5IFJA 1HCVA 2IAMB 1OTTC 5K9OA 5HGAA 1KBGH 5DK0B 5HYJA 4QRQA 2CK0L 3PGFH 3VG0L 3C2SA 5I8OH 4CADA 3K4ZA 4X4ME 1T66C 3BH9B 4QRRD 4NNPH 4BFGA 4PREB 1CDUA 1BD2B 1QLRA 1YECH 4N1CA 5EIQA 5GGVL 3AM8C 3WIIL 2M2DA 3Q6FA 2I24N 4NNXB 4X9BA 4UB0L 4MCZA 1ZVSB 5IVZA 3BMVA 4QYOA 4GKNA 3BP5A 4YDVB 5LAXA 1QTYT 3FFCA 4KJYA 5DC4B 3MFFB 1OAKH 4DVRL 3SO3B 3LEXB 3LN9A 1LILA 1VERA 2OZ4A 4ONFL 3L3IA 2C1OA 5CEZH 4YXLL 4BSWB 2BNQE 5EU5A 3EHBD 3MYJA 2IJ0C 3MLRL 3O9WD 1BBJA 3DX8B 5JQ6L 3ULVL 4YQXL 4TUJA 3RU8L 1CFBA 4YGAB 5JW4M 2R2CA 4M8VA 5DQJB 3UTTD 2XZAL 1OW0A 2SEBB 5DDHA 1R5WA 1K3ZA 5EZJA 3CMGA 1OW0C 5I76B 1UJ3B 5IHZB 4ZPTB 4P2QE 4UDTB 3ARBA 1T89A 3MUJA 5FA3A 3SKJH 4UOJA 5M95B 4TTGA 5DJ8B 5GHWH 3P30L 3ARBC 5GGUA 4L4VA 5JLZA 4L8DA 3QUYD 1MCWM 1S5HB 1S7UB 1S7VB 2OZ4L 4BH8B 2R0KL 3QDMB 4Y19D 1RU9L 3LB6C 2DM2A 2JCCA 1BQSA 3X12A 3QFJD 4PR5A 2ITCA 1A7PH 3PIQA 5DJYA 5HY9B 1N4XH 1U8MA 2KUTA 4OT1H 2VXQH 5KSBF 2ED7A 2LAAA 5E2TL 2FATH 4C83B 4JO4L 4NUJA 5AZ2L 5ADOH 3IDGB 5JUEL 3SKOA 5KAQG 2HFGL 3K3QA 4Z7QE 4LLYB 4MSWA 4IIQB 1QLEL 3OKOA 2IFFH 1CICB 4HJJL 1CFQA 1MRDL 4X6CB 4WTWA 4V3DB 3L95A 3H9ZA 4XP5L 4X4XB 3BUYB 4RFNC 1EO8L 3QXUA 3GDBA 4WWID 4RCAA 3VI4E 4BFIA 3RVXC 4PGZA 5C0JA 4BH7A 3DVNA 2Z93B 4M62H 5IEKA 3O11B 3EJYD 1V05A 2DLIA 2A73B 3DV6B 3L5XH 4Q6IB 1XGYL 5M7QA 3O6FD 1UQSA 4RMVA 1CTOA 4AIOA 4QRTA 4P49A 1BOYA 4MD5A 1KN2H 1I4FB 4DGIL 3PWPE 3Q6GH 1GC1H 3CUPB 1H3WM 2HAZA 5C08D 1NGWB 4BM7A 4GW4B 2E9WA 3CIQA 2NZIA 2IWGA 4R7NA 4UINH 1G1CA 3IAGC 2IBBA 1AKJB 1TJGL 4NOFA 1SY6L 3BPOC 4N9GA 5CIPH 5TH2A 4BZ1H 4K7PL 4V1DE 4I3RH 3UJTL 1NMBH 1IEBA 1DN0B 4WTZG 1BQLH 2FECL 1T03L 1BIHA 4U1HB 4XPGL 5EULV 4FQ2L 5EO1B 2HJKA 2OR8A 2WUBH 4GRMB 4RFEB 4NDMA 1VFBB 4NC1C 2HWZL 5ABDE 5DURB 3DBXB 4Q9QL 1TQCC 5JOFB 4JZOB 4Z7WF 4DEPC 3C87A 4U1IA 2F8VA 3SDCB 3BHBB 1EXUA 3I50H 1AGDA 3MUY1 4LNRA 3O6MH 4WEUD 5B8CC 4S0UC 4G8GA 3K74B 3UAJC 3D3VA 4PRHD 5F70A 1UM5L 1J88A 3UC0H 5B21A 5JW4Q 4XBPA 3FB5A 4R0LC 3OKNA 4OFKA 3O3EA 1N64H 3FT2B 4QRPB 4UZGA 4F37K 3MRGB 4MXWL 2VIRB 4L4TD 4R8WL 4OCXH 4G9FE 5C07D 2NZ9D 3CX5J 1ZA6B 4CW1A 3KPSE 3WNLA 3U0TA 3CMOL 3O4OC 2DLTA 4JCLA 1A47A 2DTMH 4CMHB 1X9QA 1N6QH 3GGWA 1I3GH 1D6EB 1SMOA 4MJ5B 4PRIE 1OAXL 2DL2A 3LKOA 3DARA 1FC1A 3NGBB 3B43A 5D5MF 2WP3T 2VDML 2JIXA 1RZKC 3DNKA 3B2VL 4UV7H 1HXMA 2FDBP 3KNBA 5F44A 2OTWA 1D5IL 1X5ZA 3STZB 1CCZA 4M1DL 2CIKA 1G7IA 4G6FB 4OD1L 3PHOB 2GSIB 5E8NA 2WQ8A 3O3DB 4JFDD 3O6KH 4JGUA 3ARDA 3ES6A 4L3CA 3SDXF 3VFVB 3L9RB 4WUUD 2Y5TB 5BMFL 3MGOB 3ARDC 4HK3N 2DQUL 1MJ7L 3PL6B 4OCNC 5IHUH 4PG9A 2DMKA 4KQ4L 5ENWA 1TZGH 2VAAA 4U1SB 4PGCB 1U8PA 1ZVHA 3VXMA 4LLAA 5LQBL 4NHCH 4ODHH 4ZXBA 5TE4L 5HHOE 2HVJB 4U1NA 2AEQL 1VHPA 5DEFB 3VFNB 5ANMB 4HCRA 4ZXBC 4X98B 5JPMA 3FAWA 5B3NA 2DM4A 2X4OB 4M6OL 5IVXA 4DTGL 1UEYA 4HIIB 3P4MB 1CDIA 1N59A 4EVNB 4PJFB 4KI5C 2ZOKB 2NMSA 1WAAA 5D93B 5AG9A 3NVQA 5E6IB 2ICWB 1U8OB 5ISZB 5F8RC 5E1HB 3VFSA 2H3NA 3OPZH 4M93B 1NBYA 3OBAA 1VESA 5T1KA 4FQLH 1S7RB 2DICA 2PYEB 1XGTA 2NY5C 4K55A 4JG0L 4Z7UA 4O9HH 3VFUB 5CINH 3SJVE 3DXAA 4IRSB 3TJHA 3LKSA 3NACH 2HRPH 3TJHC 2R2HB 2Q86B 5FUZL 1DN2A 1IBGH 5IK3B 4YPGB 5IB5B 2NY4C 4QCIA 1NL0L 1JFQH 3WUWB 5I1KH 3WN5B 5EOQL 4Z0XB 4JO1H 5ESAA 4PJCE 4LPXA 2FX8L 5HHQA 1IM3A 2EDKA 2DN7A 3VXSD 5CMAB 4YFDB 3VRLF 4FQXB 1IGIL 5JDSA 4OLUL 2BOBB 3G5YA 1GZPB 4HIJB 4F9PA 1NGXA 4TULL 1G0YR 4RDQG 3VW3L 5A43C 1UEMA 3SDAD 5EO0B 1ZTXL 2UY7A 2XG4A 4PRDA 4FABH 2AW2A 3CX5K 1II4E 1QLFB 3MACH 3WFHA 1W0WB 1YA5A 1SYVA 1H3PL 4G6JL 4HKZA 5DEGA 3ZL4H 3QQ9C 3G6JF 2AK4A 1C1EL 1KENH 2ZKHH 5TFSL 1YEKH 4FMFA 3NCYP 4ZOEA 4TSAL 1JPTH 3RNKA 2EDTA 1XIWB 1MCEA 3N0PB 1EHLL 5C0EB 4MD4A 5E94A 1BAFH 3UZVB 1DBAH 2YHGA 1MFDL 1MI5A 4U0QB 3WS3B 1CFTA 1LP9A 4U7SA 3MROA 2Q6WB 5IKCA 1NGZB 4OZIE 2W60B 1FO0B 1NCAH 1QR1A 2P5WB 4Y16B 2QHRL 2K7QA 2NXYB 3HZYB 4OF7A 3UBXI 4CVWA 4Y4HA 1F4WL 3WXWH 3G6AB 3GMLA 5FOBA 2ADFL 2HVKB 4AMKH 4LASL 3ZE2F 1WK0A 5TF1H 1T04A 3CLEH 3GBNL 4Y4HC 3RY4A 5FKPA 3OAUH 1SJVA 5FM4A 4FNLL 5BRZD 4KRNA 3G6DH 4L3EB 5ECJE 5KVDL 2ADJB 2HA1A 4MWFA 1AHWC 1NLDL 2D3VA 1CFNB 3PWUA 1LO4L 4ISVA 3FAXA 4PIRF 4CVZA 1N3NA 3QUXD 3VWKB 3WIFA 3MR9B 5GGVH 3O4LB 4RRPG 3WIIH 2IALA 2EDBA 1WIUA 1JI1A 3FN9A 3IJSB 5D7LB 1FNHA 3HG1D 5DHVA 4AEHL 5D1QB 3REWA 3V6BR 5GS3A 1VGKA 3Q5OA 4KV5E 1R0AL 1RVFL