3O8XA

Recognition of glycolipid antigen by inkt cell tcr
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
273
structure length
268
Chain Sequence
NYTFRCLQMSSFANRSWSRTDSVVWLGDLQTHRWSNDSATISFTKPWSQGKLSNQQWEKLQHMFQVYRVSFTRDIQELVKMMSPKEDYPIEIQLSAGCEMYPGNASESFLHVAFQGKYVVRFWGTSWQTVPGAPSWLDLPIKVLNADQGTSATVQMLLNDTCPLFVRGLLEAGKSDLEKQEKPVAWLSSVPSRQLVCHVSGFYPKPVWVMWMRGDQEQQGTHRGDFLPNADETWYLQATLDVEAGEEAGLACRVKHSSLGGQDIILYW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Antigen-presenting glycoprotein CD1d1
publication title The V{alpha}14 invariant natural killer T cell TCR forces microbial glycolipids and CD1d into a conserved binding mode.
pubmed doi rcsb
source organism Mus musculus
total genus 77
structure length 268
sequence length 273
ec nomenclature
pdb deposition date 2010-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3o8xA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3o8xA01
4AJ0A 1QLRB 4LSTL 1KN2H 4L8BB 4X6EA 5IMKB 5DK0B 4Y5XB 4DCQB 1Q0YH 4O2FA 2FL5B 2YD4A 3PGDB 3QI9A 3S88L 1RZGA 1JF5A 2CDFB 3VFWB 5CZXD 2BP3A 4HIEA 3TIEB 1UH4A 3AU1A 1TJIH 4O2EB 4HG4J 2XPGB 3BN3B 4GW4B 3VG0H 5CZKA 5I75C 4AL8L 4XXCC 2NXZC 1JYVA 2ZUQC 3H9ZA 2YPVL 4TNWK 2X44D 4H88H 4K7FB 3BZEA 1A1OA 1ITBB 5CS7A 4L8CA 1AIFA 3SPVB 1RUKL 5EU5A 2BCKB 1LNUA 3QQ4B 4UV4H 4V3DB 4PJCB 4Y19A 1HI6B 3I02B 2ADJB 1RIVH 4P9ML 4MWFB 2VERN 5ABDE 2VZ1A 1C8PA 2MJWA 2X4RB 4H1LG 3GMRB 1WGOA 3QQ3B 3JWOC 3TZVD 2HKHL 5CCKH 5FA3A 3RU8L 3U0PA 3DSFH 5FUZL 4PLJD 3O2DH 2B0SL 1RZJH 3F6IA 4UTAL 2H6PB 5EBLB 1MFCL 5DJXB 1FVEB 3REWB 5IV2B 1ZA6B 3DARA 4CKVX 3LPFA 5ITFA 2G5BA 1MCNA 3DTXB 1INQA 4F3FA 1CDJA 5J6HA 5DJYB 4LLWB 4XMLL 4M6MH 3NFPB 4I8DA 1I7TA 2XICA 4JLRB 4QRTB 2ZZUT 3ZKXB 3MLYH 3OWEA 3ISWA 1S7RA 5CJ5A 1N64L 2JIXD 2P1YA 32C2B 4JFQB 2EXWD 2VLRD 5F9OL 4IMLA 3ZE0E 4D8PA 1B0RB 2CLVA 4HZLB 2A9NL 1ADQA 1XIWB 4GKSA 2BSRA 4GQPH 5EWIL 1S5IH 4ONHA 3H3PH 1QUNA 5KVDL 1TZIB 3C6LD 1WTGT 3VXOB 3U82B 3Q6GL 4UNVA 1FORH 5T5NF 1OAQH 1JGUL 1T83A 3D85B 1JGLH 1FZOA 1MAKA 1BQHA 3JTSA 1CDUA 4LARL 5D1ZD 2ADIB 2CLZB 2Z4QA 3HZKB 5E2UH 1UM4L 5JPNB 4WTXA 2F8OA 2WBJA 4JFDE 3EYQD 4YDIH 1MRFH 5E8PA 5J9PA 3ZDXE 3ARSA 2P5WD 3ES6B 4HS3A 4NNXB 2D7TH 1OARH 3C5ZC 1FIEA 3GSVB 3WNMA 4POYA 5C9KA 2ITCB 5HHOA 5JPMB 1J8HD 2IG2L 1AXSA 1OSPH 2R0WL 1OT1A 1UWGL 4OZIB 4S1RH 3MR9A 2LV4A 5GXBB 3HC3L 4WUKH 1T7WA 3E2HC 2R9HC 1EGJA 5D70L 4MJ4A 3V0WH 4Z7UA 3V5HB 3F7YB 5E6IB 4W6YB 3TPUB 3QPQD 4M61A 3VCLB 4BH8A 3HA0A 5KOMC 4ELMA 3CVIH 3BZ4A 3MO1B 1AP2B 4L4TA 1I8KA 1VENA 3MLSL 4HUKB 4GKNA 2EO1A 5E2TL 2NLJA 3D48R 1ONQA 2BMKB 2VH5H 4KI5F 3MTRA 2PO6D 2XN9E 4LLVB 1X9QA 4MJ5A 3DO7B 1FJ1A 4LRNL 4Q97A 2FGWH 4LBEB 5J13C 3GRWH 3WEXB 5F9WC 3BPLB 2B7DT 1JZ6A 4XAWH 3OJDA 3LRGA 4TSAH 3L3IB 2X4TA 3CX2A 3WIIL 2DLFL 2C1PB 1BLNA 2R4SL 5EUOF 5CJQH 3KLDA 1XGUB 5DRZB 1T04A 5F3BA 2DQJL 3EGSB 3WHXA 4HAFA 2HT4D 4FQ1L 3MRCA 1DLFL 4PR5B 4KJYA 2VR4A 1BFVH 1QNZH 2LE9A 1YEGL 4L3CA 4HQQL 2E5EA 3RRQA 5SWQB 4NC2B 5E5RB 5GJSH 1IAIH 2BVTA 2FX9L 5DJ0A 3DO3A 4HGKC 4OZGA 5MEND 2LTQB 3VRJA 4ZTOL 4G7YH 1HZHH 2BY1A 3PQYD 5BS0B 3O41B 4U3XA 3QULB 4HXAL 4FQQA 2GSGA 4G6KL 3KJ4B 3FB8B 3OB0H 2J4WL 2XACC 4MAYC 4D9QD 5FDWA 4JZOA 1YNLH 4WI4A 5K9KA 3NIGE 1YNKH 5I76A 3GBML 1NGXA 5JMOC 3CXHJ 2AK1H 4X0KB 4WW2A 5FUCC 5GGTL 3O9WC 1D6VL 4PBXA 5F96H 4WVRA 3OX8A 3WNLA 3RWIA 2V2TA 3WXWH 4NKDB 3LQZA 4BK4A 1CXFA 2MMXA 2XZQL 1JPGA 3FCTA 4JFOB 4PUBL 1J0ZA 4ZUSA 4FXGA 3DX7B 1ZHLA 4TPRL 4PG2A 2FIKB 4ZPTA 2D31B 5A2LH 2HG5B 4U6YA 4M7LT 5DYOA 3LB6D 4BSVA 4CW1B 5AZEH 4BZ2L 4PJXA 5IMOB 3DLQR 3C2AL 1AGFB 5F1IA 5D1XB 5HYFA 5DMGD 3IU4H 4WFFE 2NMSA 5ADPL 1SJVA 3SO3C 3SE4A 4DK3A 2BOCB 1CS6A 1T3FB 4PRBB 1JMZA 2DKSA 5DMKA 4LOUC 1V5JA 1U8QB 3VFUB 2XY1A 5LWYH 3QDGD 5D9SA 5ENWA 4H1LA 3BP4A 1A6TB 3H42L 4NT6B 4ZO8A 3U4AA 1IM9A 2V2XB 2DLGA 3ZDYF 4LNRA 1VKXB 2X4QA 3GSQA 4O51B 4F7EA 2NY4C 1A7OL 3BUYB 1DN2A 1CICC 1H8OA 5ID0A 1A1MB 5HGAA 4TSBL 3MLTB 3S97C 2BRRH 2AI0L 4MVBD 1E4XH 1MLCA 3BRFA 1U3ZA 1IAMA 1YPZE 5HI5D 1OD9A 2V2WB 2G5RA 2IF7A 3O6ML 5DRXA 1HSAA 3SE8L 4HGMA 2B2XH 3EYFB 5DHXB 3VXPB 5BQ7A 3S96A 4WHDA 1EBPA 1MRDL 1NCWH 2Q86A 3EZJB 4RGOL 5D8JH 3W5NA 2YBRA 5BVPH 4APQA 2DWEB 1KV3A 3G6JA 4JKPH 4NZRH 2YUVA 3UPCA 1IFHL 4PV8A 4JM2A 5D7SL 3QAZB 3RAJH 2LU7A 3MUJA 3UP1A 3FFDB 4GRWE 5FHBL 3UDWC 3MPCA 3WIFA 4HUWB 5C0ND 1CGSL 5EIIA 1T2JA 4LCIH 1OTSD 1XR8A 2FH6A 1EEZB 5HHXL 2A77H 5I1JH 4Q9BA 1NCDL 1MHHA 3I2CH 1HH6B 2HFGL 4O58L 2YRZA 3BWUC 3PHQA 1HDMB 4NKIL 4Y1AD 1XH3B 3RWDA 3K2UH 5C0EB 3RX7A 1CQYA 1J9CT 2EEDA 3QISA 1N0LA 3U30B 2VDKH 4M1GL 4Z7WA 5DO2C 3BEWA 3BHBA 4YHLL 1ZA3B 2WV3A 3HZMA 1I1YA 1T1ZA 5FKAB 2XQBH 3RDTC 1A3LL 1W8OA 1IKNA 2P7TB 3SOBH 1PZ5B 2XKNA 5BW7C 1BFSA 3MUGA 5IMLA 4KJQC 2VNCA 4QTHB 3L5XH 1MHPL 4UT7L 4HAGA 4U1JA 5D7LD 4EUPH 5I15L 1BD2B 4F57L 4LSDA 2BNQA 3VXUA 2BC4A 4G9FE 3RX5A 2JJWA 2PCPB 2Z31D 4KXZI 3PE9A 5EUKB 1FL3B 3JSSA 5E8NB 2X7LB 4QO1A 4OLVL 4ZOEA 2Z92A 4FQJH 1MWAA 3B3IA 1S9KC 1A8JH 1BOGA 4MA1B 3WS6C 4GBXD 2R0ZL 5IJVB 3RP1A 2FEDC 1JN6A 25C8L 1IKFL 2PF6A 2VZTA 3R06A 4PB9L 2W65B 5KSVB 1FZKA 1B88A 1IQDA 1H15A 4LPXA 4YHPA 5AUMB 1KCVL 1ZHNB 1KNOB 4M7KL 1BVKB 3O6LL 1GVIA 1KJMB 4NNPL 1WT5A 3KPSE 2EKSA 4QRQB 5E00B 3ZE0F 1UYWL 2VQUA 1BOYA 4M7JL 3GSNA 3TBVB 3L3HB 4K9EH 2OI9A 1OM3L 3LH2H 3BMWA 2W9EH 1ROWA 2C4XA 3MRDB 1DVFA 3TNMB 3BO8B 4YX2H 1HHKA 4LPYA 1RK1A 3IRPX 4N0YH 2BVOB 2GAZB 3MV8B 4JRXD 1KG0A 4MZ2A 4XP4H 5EO1A 4LSRL 4JDZA 1I8MB 3L9RA 4QRRB 5DD3L 4J3SA 1KPUB 4JFYB 2VLJD 3MBEB 1OGAE 3D2UA 1DBKH 3DURA 3KPLA 3J8F7 4UV7H 4ZUUA 4RNRA 5DD0H 5IJKC 5T3ZE 1B0WA 3BD3A 3K46A 3ZDXF 2JJTC 3OPZL 5FAAA 4OF6A 2I24N 3M07A 3MQIA 1YDPB 4IDJL 3X11B 4LKXB 1NUGA 4L8DB 2B1AL 4WU5B 5HPMB 1MFBH 5D7IE 2LU4A 1T20B 4YNYA 3TBYA 3QB7C 1KJVB 1U6AL 1LEKB 5INCB 4I2XE 1XGTB 5HD8C 2IPUK 5GRUL 5E4EC 4X5WA 3RIFF 3MNVA 2GCYA 3SDCC 1EV2E 5DMIL 4C58B 3G08B 1QHOA 4QOKE 1Y18B 3MJ9A 1XMWA 3OSKA 1YQ2A 2C4FT 4XNYH 2O5ZL 1WISA 1AD9B 1YJDL 1EH9A 5E70A 4IRZH 5HSFA 3NN8B 3V4PL 2ZJSL 1C12A 1CGXA 3QIUD 3BE1L 4HK3J 3P30L 5DDHA 1U93B 2NY1B 2ICEB 1CL7I 3D0VA 3IETA 4XPTL 4F8QA 4D0CB 1S7SB 3KPOA 4NO3A 4XH2B 1IM3B 1JNLL 4I9WE 4L29A 4DUXA 4WI5A 3QEGL 1V7MH 1NKRA 3S88H 1AHWB 1Q9LA 1GHFL 2VN7A 2PTVA 3DXAA 4Y4HD 2AXGB 1ZT4A 5TDOB 2AP2A 2IH3A 1CD1A 4R4ND 3WKNA 1IILE 1W72B 4AL8H 4KWUA 1AY1L 1TMCB 2ILLA 1EXUA 1RUKH 2Q87A 3A0OA 2ID5A 3CH8A 2ESVA 4P9MH 2NY0D 4UOJA 3GUTB 2A38A 2HRPL 3RVWD 2WP3T 2EECA 2HKHH 2MOVA 3QXWA 3RU8H 1M6OA 5FUZH 4P2YA 2B0SH 4UTAH 4S2SB 1MFCH 1YC8A 4WI8A 2CLRB 4AM0B 2DLTA 5HGDB 2W38A 4DTGL 3S35L 3RWEB 1OWRM 1B6DA 4EI5B 5IEHA 1NC2A 3CCHA 5IB4B 5L2KB 2GUOB 5J3HD 4K9EC 2VSCA 3GMLA 1N64H 4LP5A 3GMQA 4ZXBD 5F9OH 5BV7B 2MWCA 4DK6A 3E6HA 2A9NH 3REVA 2N56A 2XWJA 3IU3B 5B38G 3VWJC 3RZCC 3EDDA 2F9BT 3BWAB 2PTTB 1CGUA 3AS1A 5KVDH 1S9XA 1FFOA 2LFGA 1TLKA 4M7ZC 4Z5RA 4HK3N 3C5JB 4G80A 3KYNB 1JGUH 3QBTB 4AENA 1R6VA 5DQ9B 3QPXL 1O5DT 4RBPH 4LARH 3V52L 4IRSA 1UM4H 1UGNA 1OPGL 4R9HA 1AGCA 4JY5L 3OAZK 3DI2B 1T6VN 4HUMB 2IADA 5I18L 3FQRB 5FGCE 3JUYA 4IMKC 3TA3C 3EYUL 3UBXG 2VB5A 1YN7B 4L9LB 1RJYB 4G8IB 3U7WH 3WNOA 1NDMA 2KZ1B 1O0VA 4G8FA 4Q74A 4UDUA 4OZIE 4PRIA 2IG2H 2R0WH 1OL0A 1UWGH 4Y4FB 2GIYA 1D5XA 5E9DA 5IROC 1UCTA 1U8NA 4FXKA 2EDRA 2VAAA 3SKJL 4YO0A 4QY8B 3HC3H 4WEBL 3MRGB 3TCLA 3WIHL 5JXEA 1FL5B 5D70H 3TPUE 4FQXA 1UCBH 1V05A 3O8XB 4W4NA 5KVEL 5A2JH 3QXDB 3U4EB 3M17A 3VFVB 3OMZA 3F62A 1YPZF 1YMMB 3I75A 2DM4A 4KRPD 4R0LA 1LO3L 3IJHB 4DUWA 3OV6A 2AEIT 3N9GL 2V6HA 3MLSH 4G6AD 5E2TH 4ZAKB 2X5PA 4Q9QL 3QFJA 4NN5B 3CVHB 1G6RB 2A73B 3U0WL 4AYFA 4GRWF 1WEJL 4HLZG 3G6DL 2FEEL 2MQ0A 3RGVD 3IGAA 2ZPKL 3GMPA 3UEZA 3VFTB 4LRNH 4F9LC 3E1F1 3LDBC 1OAXL 3GK8L 5C08E 3SDXA 4EZMA 1P4BL 1EO5A 3KXFB 4G8GB 3OHXA 4WWKB 1MCEA 2YA2A 5IWLC 3AB0B 1ZGLA 3WS3B 1A3QA 3MRMA 4JVPA 1F6AB 4OQTH 1P7QA 3WIIH 1QEWB 2DLFH 2WQ8A 3D9AH 2R4SH 5C09D 4YDVB 5CD5C 4Q58C 2DQJH 2UUDH 4C59B 2VITA 4R4BB 1OCWL 1FFPA 1QA9B 1MQKL 3C8KB 3TYFB 3NCYS 4FQ1H 2GFBA 4RA0C 5D1QC 3HRZA 3G5XB 3EYVB 4ONOA 5CWSA 1YEGH 4HQQH 4X4XB 2CDEA 2JJVA 4MNGB 3OKDA 3HB3D 5EOTB 4PGCA 1QD0A 2FX9H 4XCFL 3OQ3B 3ALPA 5BS0E 3EO0B 5C92A 4ZTOH 3THML 3TBSA 4QCIA 5IBUG 4HXAH 1FNSH 3JTCA 4G6KH 2J4WH 3RVVC 4C54A 3KLAB 3KPNB 4N0UA 2QSCL 3BIAX 1P9MC 5IB5B 1VEOA 3ARVA 2FWOA 5DVMA 4PG9B 2XG4A 5TF0A 3GBMH 2Z8RA 3QO0A 1MEXL 1TVHA 5GGTH 4NKOA 1D6VH 3T0EA 3OR7B 4U1GC 4POZC 3PP3H 4WFGE 5KN5B 3SKNA 5JW4R 2WNGA 4NQEA 4PJ8D 4JFZL 3MRHB 3IFOB 3G5YA 4X6CB 2AQ1A 1NFIA 3CSYA 5I9QB 2XZQH 4PUBH 4XCNA 2Y5TA 4BK5A 1I1FA 3LD8C 3AREC 3FHAA 5J6GA 4S0SD 4TPRH 4CVZA 4KJWC 4WGVB 1SEBB 5E2JA 1AGEB 2JK5A 3K0WA 3GO1L 2DIAA 4BZ2H 3FO9A 1JPFA 4KY1L 4ZQKB 1AO7D 3RTQC 4DQOL 5EOCL 2GITB 4PJAA 5ADPH 4XI5C 4ODXA 4X5XB 2EDEA 1TJGL 1NC4A 3RWHA 4KJPD 4OLWL 5I30L 3ECBB 3BH9A 3Q6FB 4LSUL 3WYRA 1OF2A 1AKJA 4X7TA 3FOLB 3QUKB 4KC3B 5I1KL 5D7IF 5EC1A 1KN4H 5DEZA 1I3RB 1A7OH 3AFLA 1H5BC 4HFWB 3IDUA 2UVEA 4TSBH 1T0NA 1FNGA 2AI0H 3A6CL 5B8CB 4MLIA 1OW0C 4WO4D 2H32B 1UXWB 1X5ZA 2NW3A 5ANMA 1H8SA 2D9CA 5EU7E 3OXSB 3UTZA 4PP1D 5FK9A 3O6MH 1VA9A 4PJ5B 3SE8H 1DQJA 5JO5A 3BP7A 3HI5L 3LAFA 4LCWA 4QF1A 3IVKA 2X4NA 3CFKB 5B38A 1J12A 2YD6A 5LGHL 1RUQL 3QDJA 1IFHH 5D7SH 2B4CL 5EBWB 5FHBH 5BVJA 4J4PD 1CGSH 4PJ9C 3WN5C 3FQUB 4YGVA 2E7BA 3OG4B 5HHXH 1NCDH 4G59A 3HMXA 2HFGH 3KNBA 5HY9A 3IF1A 4NKIH 1QHPA 1ZHBB 2FECL 3HNTL 4JRYB 5HDLA 3L7FA 4M1GH 3UBXA 1R3KA 3F7VA 1ZLVK 1CFSB 1JK8B 1DUYA 1WC7B 4NP4H 4YHLH 1LO4L 4XPAL 1LEIA 3F7RA 1A3LH 2DDQL 4FG6D 1OQOA 1BJ1J 2CD0A 2UZYB 4N0CC 1KB9J 5C08D 2L7UA 4E0RA 3QI9B 1MHPH 1FDLL 4UT7H 1RURL 1NFDA 3FN9A 3AC0A 1BD2E 1WTLA 5D2NA 1RZGB 3ARBD 2P48B 5I15H 4HIEB 4F57H 1GGYA 4U3CA 2YZ8A 3QIWD 4BQ6A 4HWBL 4APQD 3GHEH 4Q0XL 3HFML 2VLMD 2BVYA 4WFHE 5CIPA 4JM2D 4OLVH 5H2BA 3ZKND 2V7HA 4GH7B 2D7OA 2P5ED 2R0ZH 2NXYC 5KANG 3FT4A 3EJZC 5C0BA 3SDAD 1EPFA 1X5XA 25C8H 1A1OB 4L8CB 1IKFH 1AIFB 3LKQA 4PB9H 5ID1A 5EU5B 4ZUTA 4HGWB 4Y19B 1HNGA 1ZE3C 1KCVH 4OV6F 3GI9L 3O6LH 4J3OC 4R7NA 4NNPH 3QUYC 5EZJA 1UYWH 5FA3B 4JAMA 4M7JH 3U0PB 2Y36L 2VZVA 1CLYL 4OCLC 2AJVL 3MA7A 5ITFB 1ERNA 1FYTA 4X7DC 4CU7A 5F44A 1INQB 4P3DA 4F3FB 2FJGA 2R2EA 5J6HB 2Q7NA 4JY6A 3FKUS 5JOPE 3DMMC 1I7TB 4XXCA 5GRVK 1A1NA 6FABL 3V6BR 4QRRE 1EHNA 2Q7YB 3WL9A 2J2ZA 1MREL 4D8PB 4XVSL 2ITDA 4LIQE 1KJ2A 5DD3H 2AS5M 2CDGB 2BVEA 4XNMA 4XAKE 4GKSB 2BSRB 2BNUB 3OPZH 3MSPA 4YAQA 4IDJH 3QJHA 3X12A 3QIBC 2B1AH 2G60L 1R5WA 4JJ5A 4NC1C 2WLZA 3TH4T 5M7QA 3ULUE 4YFLI 4RQQA 4OZIF 4DGVL 1FZOB 1BQHB 4YR6B 2D9QB 3JTSB 1ZLUH 3DYOA 2Z4QB 5E2VL 1P53A 3T1WA 1A2YA 4KK5D 4MXQD 5GRUH 2FSEA 2WBJB 3NTCL 1R3HA 1JZ7A 1NAMH 5E8PB 3P4LA 5J9PB 3PXJA 2QKIA 5DMIH 2HTKC 3BISA 4HS3B 4RMQA 5DJDA 3MRQA 2O5ZH 4M48H 4L1DA 1YJDH 3QZWB 1ETZA 1MCJA 5HHOB 3BX7C 2ZJSH 1AXSB 3QHZH 4NDMA 5I6XB 2NNAA 4KZEL 3BE1H 1NGQL 4XHJD 3P30H 3MR9B 5EU4B 5F9JA 2YZ1A 1D5BB 1G1YA 2YPKA 5JW5A 2Q76A 4Z7UB 4P46C 4CDGC 4R3SA 2BDNL 4M61B 1JNLH 4BH8B 4ELMB 1UXSA 2WLYA 3QEGH 5KAQG 3GJFA 1SEQL 2YMXL 4L4TB 3EO1A 5DURB 3QYCA 4C56B 1LILA 3UZEA 2QEJA 4L8SC 3H9YA 1N6VA 1I8KB 5HYJA 1GHFH 5DK3A 3CFCL 4XC1L 1HILA 4GKNB 4QKXB 4J8RA 5E5MA 35C8L 2NLJB 5E56A 1ONQB 1FE8L 3FB7A 4UQ2A 2I9TA 1CFBA 4P5TD 3BMVA 5I8EA 4QTIL 4OTXL 3TCXA 4AIOA 1AY1H 3PWPA 2J8UB 2R2HA 1J11A 5I73B 2OLDA 3OG6B 3NPSB 5F97E 3E2HA 3OJDB 4KAQL 2HRPH 2DYPB 2QSVA 1OAZL 3PIQA 2X4TB 3B8SA 3QUZC 3BPNC 1NMCB 1BLNB 4M03A 3WXVL 3RWGA 1TITA 1T04B 5F3BB 4MJIE 3ARGC 2CRIA 4JGUA 1B9ZA 3WHXB 2YEZA 3SJVA 3D3VD 4DTGH 3S35H 1T03L 3BUTA 3MRCB 4NNYA 2NQCA 4KJYB 2AJ3A 4YDLB 1A3RL 2CJUL 3K3QA 5F8RC 3PWNA 5SV4A 1DEEA 3K8KA 4NQDA 3WDHA 2JE8A 4NQUA 5DJ0B 4K7PL 4OZGB 2DLEA 1F8TL 3GM8A 3VRJB 4D0BA 1N5YL 4FQQB 5EZIL 2GSGB 4YZFE 5IB1A 5CZXC 5DEGA 5FDWB 2NTSP 4JZOB 5K9KB 3CH1A 5I76B 4Q2ZA 1NGXB 2AQ2A 3HE6C 3QPXH 3QNZA 4WW2B 2ERJB 4HBQA 5HDQL 3V52H 3OX8B 1OPGH 3RWIB 2BSTA 2V2TB 4JY5H 1T21A 3RVTD 2H2SD 3EYUH 5CSZA 1NLBL 1JPGB 3FCTB 4LFHG 3BDYL 4WCYH 4ZUSB 1WBXA 1CD9B 4KQ3L 1ZHLB 4HIJA 4S1QH 2PW2A 4ZPTB 5DFTA 4XPFL 4U6YB 3K4DA 5AAWA 2EXYD 5DYOB 3ZTNH 3IXTA 1KXTB 4BSVB 4XWOD 3TZVC 3MV7A 1RJLA 4PJXB 4V1DA 1C7SA 5F1IB 4PLJC 4MAYA 4N90E 2OX5A 1BIHA 3SKJH 3TPKA 2VO5A 4WEBH 1U8OA 1HYRC 3B9KD 4LPUA 3WIHH 3F7PC 1IGYA 4XAKD 5KVEH 1MI5A 5I71C 1WK0A 2VE6A 5DR5L 2FR4A 4DVRL 3O9WA 3S36L 3PDOA 4RGMC 5D9SB 5ENWB 4H1LB 3BP4B 4QRUA 1LO3H 2WWMD 5J11C 4RRPG 1IM9B 2EXWC 4LNRB 5IB3A 4U0RC 2X4QB 3VXMA 3N9GH 4F7EB 3RNQA 2APFA 2GT9A 4OJFH 4JZNB 3TN0D 1E6OL 4ORZC 4KV5F 1BP3B 1Z0MA 4GRLD 3VU2A 2CIIA 5ID0B 5HGAB 3U0WH 1UENA 1WEJH 3G6DH 4WENB 1CDYA 3QWQB 4K3DL 1J0JA 2MCG1 3C6LC 3IDYB 4WW1A 2ZPKH 1MLCB 4NQCE 4PGJA 1OAXH 1JV5A 3ULVD 3Q2CA 2X4PA 4U1MA 3RL2A 4OD3L 3W9DA 3KXFE 4G8GE 1HSAB 5D1ZC 4LLAA 3NOIA 1KUMA 5BQ7B 2DLHA 4JO2L 3S96B 4IM8A 2YBRB 5GGSA 1GJIA 5E99L 3G6JB 3TFKA 4PV8B 4EUPG 5JXED 3WNNA 1GOHA 2F15A 2EH8L 3WIFB 1OCWH 4RGND 2BVPA 1MQKH 5EIIB 1VGEL 4NO0D 4N5ED 1XR8B 5FM5M 1K4CA 2QHRL 1CICA 3OZ9L 1T4KA 3VMPA 1MHHB 2D03L 4P2QE 4MNGE 3PHQB 3BIKA 4XT1C 3GGWA 8CGTA 2XG5A 4Z7WB 4XCFH 5IM7A 2JCCA 1WCBA 3CLEL 3EKCA 3HZMB 4PY8I 3THMH 1I1YB 3JVGC 1T1ZB 2V5MA 5DZNA 3NCMA 3TO4D 3BKYL 2HWZL 1RI8A 1XF1A 3VRIB 3MUGB 5IMLB 2QSCH 1Z9MA 2DJUA 3WSQL 4JB9L 3UDWA 3H9SD 4YEEA 2K3TA 1MEXH 2BNQB 3VXUB 2PO6C 3HLAA 2BC4B 2Q6WA 3GMMA 4NN6C 2KDGA 3T1FA 3C8DA 2XYCA 5AEAA 1FRGL 4X6CE 2ATKA 4XP9L 4JFZH 3L95A 5L8KB 3B3IB 4MJID 3EO9L 1K8IB 2E7LE 1BOGB 4RBPK 2NY6D 5MP6L 4PLKD 1JN6B 2YUXA 3BH8B 1NL0L 2BJML 3IS1X 4JFPA 1HNFA 3ZYZA 1FZKB 3FJTA 4KTDL 3RDTA 3GO1H 1IQDB 1H15B 1MCIA 4NUGH 5EBMA 4FQHA 4YHPB 4DQOH 1RHHB 5EOCH 3MODL 5BW7A 1PG7L 4FFVD 1X6NA 5KG9A 4NN7B 3FAWA 2EKSB 4PTUA 2HT4C 4P2CG 5F71A 1TJGH 1C5DA 2A9ML 3NCBB 4OLWH 4ZD3L 3B5GA 5I30H 3QHFL 4DVBA 2OI9B 3WFCL 4IOIA 2M1KA 2J5LB 3LQAL 4LSUH 4CDHA 4U49A 1CFVH 1DVFB 5GS1B 2EICA 1VFBA 4GOSA 1HHKB 3T2OA 2J6EL 1RK1B 3WS6A 3U2SA 1LK2A 3CDYA 1SVCP 5EO1B 2AABL 1NBYA 4JDZB 4B41A 5JIIA 1DQQA 1BEYL 5HHPA 3L9RB 2V9RA 5CP7A 5CLWA 3A6CH 3DGGA 5TQ2L 3D2UB 3DURB 3KPLB 4ZUUB 4RNRB 5GRZA 2EIBA 5TF1L 5IFJA 4CU6A 4PJ5E 3S37L 2QBWA 1IC4L 5L7XL 1T1XA 3HI5H 1YEHL 3O4OB 4YNYB 3TBYB 2AJZA 3QP3A 4I0PC 4D9RD 5LGHH 3MZGB 1B0GB 1RUQH 2B4CH 5E94A 4HIIB 3STZA 4B50A 2IGFL 3O3EA 4X5WB 2IANE 3MNVB 4ZSOA 1JNJA 3LB6C 1AI1L 3ZHLA 3UTTA 1CQKA 3LPGA 4JRYE 1PZUB 4X7SL 4JN1L 3HNTH 4U1IA 1QSED 4Y4KD 1C12B 5F88A 5TE7L 4DUVA 5IW3A 2JJTA 2XTJB 3NGBC 1LO4H 4HKJA 4XPAH 5DDHB 2G2RA 2YD7A 1MJ8L 3MXWL 3LN5A 3D0VB 3IETB 2DDQH 5F72S 4NKMB 3VA2C 4WI7A 4NQCD 1A64A 2P8PA 3KPOB 4JRWA 2OTPA 4NO3B 3TH3T 2QTEA 1P6AB 4L29B 1NCUA 5JDSA 4KVNL 1FDLH 1RURH 1QFWI 3A67L 2W92A 1Q9LB 4EN3A 1SJXA 3SDCA 4HWBH 2BVQA 3DXAB 3MLRH 4MVBC 3VXRA 1MF2L 4Q0XH 3HFMH 1NMAL 1ZT4B 4HV8A 4X4MA 2IH3B 1CD1B 1DDHA 5HI5C 4CMHC 4RFEA 4RRPA 4BSWA 1MFNA 4X9GA 1RD6A 2BERA 3EDKA 3PP3K 5AYUL 1S78D 3QO1A 3GSNL 4GAFB 4MA8L 1YEJL 1B4RA 3LRSA 3NCJL 4MHHI 5KSBE 4Y19E 3EJYD 4P2QD 1K8DA 3QEQA 4RDQF 4LK4A 3ARDD 1D6EA 3S35X 2ESVB 1HSBA 1G9NL 5I8KL 2NYYD 4K3HA 5ADOH 4ODSL 3GI9H 5MHSE 2P4AB 3ZKQD 4HWZA 2CQVA 3MMEA 1OTSC 4BZYA 1GZPA 1M6OB 3SCMD 2EDOA 2AJVH 1PGRB 4YZFF 4JZJC 3U1SL 5FO8A 1YEDA 2OZ4L 5EA0L 3KLHD 1N5AA 4OM0L 1UM6L 5IEHB 1NC2B 4EUPA 3CCHB 1SBSL 4KGLA 5LBSL 2IMMA 4ZO9A 3NH7L 1MJUL 3K2MC 3GMQB 5J06A 4KRLB 4XVSH 1NH6A 3E6HB 3UYRH 3REVB 2QV2A 2XWJB 2NY5L 2BY3A 1TQBC 4GSDL 1OGTA 4NZUL 1S9XB 4YBLB 4Z5RB 5INDA 3MLWL 1OVZA 3MRKA 2Z31C 2G60H 4LQFL 2APWA 4G80B 4DGVH 3UJTL 2XA8L 4UIKL 1OAUL 3OKEA 3LCYA 1DLHA 5E2VH 4IRSB 2B1HL 4GBXC 4TUJA 3BSZL 5IR1A 3I84A 2IADB 3NTCH 3DHJA 3T0XA 1XGRB 4R6UA 5T3XD 5IEKA 2F5AL 4Z0BL 4PJHA 5D2LA 4X8JA 2B4CC 2KH2B 3ZHDA 4PRHD 5F93C 1NDMB 5HHMA 4G8FB 4KK8D 4YK4B 1BHGA 4UDUB 2DI8A 4GT7A 4PRIB 1JNNL 3VWJA 3RZCA 5ILTL 4KZEH 1D5XB 5E9DB 1NGQH 4WWID 1U8NB 3O2WL 4FXKB 4DFHA 2PXYC 2VAAB 4YO0B 3MRLB 2WANA 4K3EL 3S7GA 4OZHA 4Z7UE 4B53A 3TCLB 1U3HB 4FQXB 4N1HB 4M8VA 4XB8A 2WWKT 4OF8A 4IBLT 3KPMB 2BDNH 3M17B 1I7ZA 3WFBL 4NWTL 4MQ7A 4L4TE 4IHOA 4C56E 2J88L 1SEQH 2YMXH 3I75B 1EAJA 4R0LB 1CBVL 1HE7A 4I0KA 3PL6D 1QBAA 4IMKA 4PRAA 3L3OA 4XC1H 35C8H 4M7LL 3QFJB 5C0IB 3ALWA 1FE8H 1DEDA 1MJ7L 3RA7L 1H3VA 2ZWLT 4K71B 1Q72L 1KGCE 3ROOB 2IAND 4I48A 4QTIH 3IGAB 5B3JE 2J8UE 4OTXH 1QFOA 5IROA 4G7VL 1LDSA 5FCUH 4PD4K 4RX4D 3FQWA 2VR9A 4KAQH 3OHXB 1CVSC 1KTDA 3DBXA 3VD9A 4RWYL 1OAZH 4NRXA 4PP2A 1ZGLB 3MRMB 4X4ZA 4U1SA 1P7QB 1VFMA 2P8LA 1ZS8A 1Q9KA 3WXVH 2EIZA 2VITB 1FFPB 5FYJE 1T03H 1NSNH 5FGBC 5CSGA 3HRZB 4OUOA 3MOAH 4LCCC 3QIUC 4OLXL 5CWSB 1G7JA 2C9AA 1ZV5A 2CJUH 1EAPA 4PJGE 3VI3E 3OKDB 4PGCB 4OZGE 1E0OB 4F9LA 5D96C 1ES0A 2QADB 4J12A 4K7PH 4JFED 1F8TH 3C5ZD 4D0DA 4X6CF 5L88H 1WWWX 3TBSB 5CD3A 1N5YH 1INEL 1BECA 4CU8A 4J1UA 1CI5A 5EZIH 2IEPA 4PJIE 5C8JA 3MV11 4NIKB 4XCYA 1K3IA 4N0UB 1FVDA 4TVPE 3LS5L 2AXHA 2YWZA 2FWOB 4Y4HC 4CJ1A 3ULVL 4X6FA 3T0AA 2FX8L 2BXZA 3QO0B 5JORA 3LKSA 3RWJA 1TVHB 5HDQH 4NKOB 3T0EB 5D1QA 1UEYA 2NTFB 1F2XK 3BKJL 3SKNB 1HH9A 4NQEB 3QDMA 4EXKA 3HE7A 2OL3B 1TTFA 3G5YB 3CSYB 1NFIB 1MVFA 1X5LA 2X9WA 1NLBH 3H9HA 3BDYH 4XCNB 4ESKA 4PJFA 2Y5TB 5FKPA 1I1FB 3V4VL 1EGJH 1MIEL 2NY0C 5JHDE 4CVZB 3RVWC 4XPFH 1WAAA 4PJXE 4YQXL 4P23D 5E8OA 2JK5B 2UZIL 1A7QL 4MS8D 3FO9B 1JPFB 4U6XA 4MAUL 2ADGA 4PJAB 3D18A 3RKPA 5LG1A 4CVXA 4HD9A 4CMMA 1A6UL 1P9MA 5DRWA 4ODXB 3BP6A 4IIQC 4ZNEA 1X6LA 3CPLA 1NC4B 3MGAA 1NCAL 1QO3A 3QUML 3BH9B 5DR5H 4DVRH 5J3HC 3AS0A 2Y4SA 4L4VD 3S36H 2IFGA 5C2UB 5FGRA 4NJ9L 1OF2B 1AKJB 4X7TB 1DBML 4ZXBC 5IKCA 5F7EL 5IVOA 5AG8A 1AXTL 3BQUD 4WI9A 5JW4N 3AREA 1ZHKA 3HZYA 4KROB 2E3VA 1E6OH 1XGYL 3WUZA 4N0FA 4LSVL 1FNGB 1FSKB 1IJ9A 3R8QA 4K3DH 1CGVA 4H8WL 1H3WM 3C6SA 1QSFD 4Y2DC 3UTSD 2NW3B 5ANMB 4P4KA 1JHLL 3O4LD 3UTZB 4OD3H 5FK9B 4KUZL 4KDTC 1DBBL 1DQJB 1IGJA 2HKFL 5F6HJ 2RHEA 3BP7B 5JO5B 5KANI 3MA9L 4LCWB 4QF1B 3IVKB 2X4NB 2LABA 1JPTL 4JO2H 4ZFOL 4KTEL 5B38B 4GG6E 4CBPA 4BKLA 5E99H 5C0FB 4QHKJ 5FCSH 3QFDA 3QDJB 2HN7A 1FZMA 2C1OA 3MRBA 2EDJA 4IOFC 5BVJB 3ZYJA 4YGVB 1VGEH 5T5NG 1U8MB 5SWSD 1MVUA 2QHRH 1U2CA 1EZVX 1H5BA 2MSPA 2EE2A 2D03H 3TNNA 1C5CL 3QWRD 4YXLL 3KNBB 5HY9B 3IF1B 3CX5J 4X6BA 5L8JB 1OW0A 1W0VA 3L7FB 4YHYB 2K9UA 4OLZL 3UBXB 1R3KB 3F7VB 4WHYH 5HTSA 1DUYB 3HCVA 3MJ6A 3CLEH 2R0KL 2DQCL 1LEIB 4RAUA 3BYYA 1TFHA 3CMOL 1H3TA 1KGCD 1VFOA 4OI9A 4Y8DC 3BKYH 2HWZH 1JRHI 5IBLC 1TJHL 1KBGL 3O6FD 2WM0A 5KSBF 4E0RB 5L6YL 3WSQH 4JB9H 4G6AC 1NFDB 1ZAGA 5D2NB 1DN0A 4OQ1A 1YEKL 3V6OC 1FNHA 2BNQE 4OT1L 4KQ4H 4PJ9A 3WN5A 4P2RA 3B6SA 3U36A 3KYOA 4JQVC 2EEBA 2MQCA 5CIPB 3RGVC 3VGEA 1FRGH 4XP9H 5H2BB 5EZOL 4MNQD 3RHWK 3EO9H 1A4JA 3BD4A 3FT4B 2I5YL 5MP6H 5C0BB 2X9YA 3LKQB 1NL0H 2BJMH 5ID1B 4ZUTB 4EI6A 4KTDH 5A3ID 1G9EA 3MV9D 1W8NA 2BNRD 5T1KD 4N0CA 3QRGL 3MODH 3VG9C 1KLFA 4R7NB 4PREA 3VXSE 1ZT1A 1E27A 5EZJB 4DEPC 5F3HA 4JAMB 3CVHL 4JG1L 2A9MH 1I9RL 2XWTA 1X3DA 4ZD3H 1N4XL 4AIZB 4TUOA 4TUKL 3WFCH 1ORQB 2BK8A 5CP3H 3MA7B 3GSWA 2EE9A 2C3WA 3LQAH 3HB3C 1D9KD 1FYTB 2DN7A 4P3DB 2FJGB 2R2EB 3IDMA 4JY6B 4E41A 5CGMA 3G6AA 2J6EH 5I75B 5GGTA 3SGEH 2VLLA 2NXZB 1LMKA 1A1NB 1FN4A 2W91A 3X13A 2AABH 5FB8A 5F21B 2X1WL 3WL9B 4ORGA 1BEYH 2ITDB 3ME0A 1KJ2B 3D1MC 5EU3A 2X70A 1LVEA 3K1KC 4XNMB 1CT8A 5ALCL 5TF1H 1CE1L 1YN6A 3T0BA 2D2OA 1BZQK 3A6OA 2J12B 3S37H 4YAQB 3QUYA 3QJHB 3X12B 4KHXL 4PY7A 5JHDD 1IC4H 1N6QL 1OT2A 4RAHA 4XVTL 5L7XH 2BY2A 4YHIA 1R5WB 1YEHH 3P4OA 4JJ5B 4MJ6A 3VFNA 3OF6D 2OS7A 4GQ9L 4RQQB 5IBUB 4P2OB 4PJ8C 4MXVE 3SGKC 3EHBD 1NJ9A 3U6RA 2H3NA 4PIRF 4KKCD 4P49A 2IQ9L 1A2YB 3DV4B 4Z7UF 2FSEB 2IGFH 2KZWA 3DMMA 5K9QI 4HWUA 3Q1SL 1SJHB 4PRPA 3TO2B 3ZKXC 4G43A 3V6FA 2QKIB 2YN5A 1AI1H 2X4SA 5EO9A 1KYOJ 4JKMA 4HULB 2QLVB 4I18C 5DJDB 5CUSL 4U6HA 4WI2A 5F6IB 4MD0A 4K07A 4P99A 4X7SH 3MRQB 4JN1H 2JF1A 4JFXA 4MQSB 4LLUA 4X98A 2XTJE 1ETZB 4N0RA 5ETUA 1PAMA 4NDMB 1Q8MA 5TE7H 5E95B 1GGIL 2NNAB 4XP1L 4KJPC 2Y23A 4HT1H 2VOTA 2W0LA 3QIBA 3MRJA 2MPAL 5F9JB 2BRQA 1HXMA 1MJ8H 1NCBL 1ZTXL 2X1PA 3MXWH 4WJ5A 2YPKB 5JW5B 5DA4A 2DQEL 2Q76B 2NCMA 3EYOA 2QQLL 4P3WA 2ZUYA 4W81A 5B3JF 1H3PL 1EEQA 4R3SB 1EHAA 2J8UF 5GZND 1MWAH 1NANI 4J3TA 4KVNH 1N7ML 3S5LG 4O5LL 1ZLWK 2HVKA 3GJFB 5J56B 3EO1B 4HX1A 3A67H 1HHHA 3DXAE 3CFIC 3LMJL 5HYJB 2BOBA 1QYGL 5A40E 1MF2H 1NMAH 5GHWH 4WO4C 4J8RB 5E5MB 3KYKL 3IFNL 1BAFH 4F7TA 4M9PA 4XP5L 3FB7B 4PP1C 4UQ2B 2I9TB 1U91A 4EBQL 5BOPA 5I8EB 5C2BL 2GKIA 2QSTA 3GSNH 3PWPB 4MA8H 1YEJH 2MTPA 2R2CA 3NCJH 1JHKL 2HJLA 2R2HB 3KS0H 2ESVE 3TYGL 4MD4A 5T3XL 3GSXB 3E2HB 1G9NH 5I8KH 3ZO0A 4ETQB 4ONGL 4PJGF 3VI3F 3MYJA 4ODSH 4LF3A 4P46A 1M71A 4OZGF 5ICZA 3PIQB 2BSED 4ODHL 4J4PC 2E6JA 4Y8AA 4PJEA 4NWUL 4U6VL 5KTEL 1A14L 5DQJA 3RWGB 2L4OA 1T5WA 2IBGA 4XBPB 3NFSH 5A16A 3O3UN 4K7PX 2VZ3A 2YEZB 2FJFA 4PJIF 3OKKA 3SJVB 3U1SH 4U2YA 4NNYB 3FB6A 2NY2D 2OZ4H 5EA0H 5E5UB 1CL7L 4OM0H 1UM6H 1U42A 4P3CL 2PUQT 1SBSH 5LBSH 4WW2F 5CBEB 3ARYA 1BBDL 5C9JA 4MB5A 3PWNB 2Y07L 3NH7H 1MJUH 3LQAC 1DEEB 4NQDB 1DP0A 4FG6C 5FUOL 1KIRA 5J12C 2A6IA 5J13B 1DFBL 5F9WB 2ZCKL 2IAMD 1F3JA 4JANA 1T66D 4D0BB 1TCMA 1U95A 1AE6L 3SKOA 2NY5H 4ODTL 3ARBC 4GSDH 5IB1B 4NZUH 5DEGB 3VFSA 3W0WD 3MLWH 3QIWC 4EEEA 1S9VA 4BFBD 3CH1B 4LQFH 4PJXF 4Q2ZB 3LS4L 4LCUA 4X4YA 3MCLL 3ZKNC 3UJTH 2XA8H 3P2TA 5GGUA 3QNZB 4UIKH 4F15B 3TM6A 4NYLB 4OGZA 4MA3A 3VXSD 3BSZH 1S7VA 2BSTB 1T21B 3SDAC 5C0AA 3TVMD 5TH2A 3L7EA 4AEEA 1CU4L 2F5AH 3CFDA 4Z0BH 2R15A 3S4SG 3UZVB 5DJ6A 1WBXB 4HIJB 2PW2B 3TC9A 2ZUVA 1NKOA 2JJSC 4PRIE 3IXTB 1T7YA 3S36X 3MV7B 5E9DE 2F8VA 1RJLB 1JNNH 4V1DB 3L3JA 4KKAD 5ILTH 4ZODA 1NEZG 3QG7L 4Y5VB 3EUUA 4MAYB 1II4E 4RZCA 4K3EH 3ALXA 1ND0A 3IFPA 1U8OB 3GSRA 1IGYB 4O9HL 2CIKA 5K9JL 1MI5B 3HE6A 2J8OA 2VE6B 2DI9A 2FR4B 3NCYP 3O9WB 3WFBH 4NWTH 4ELKA 1EHXA 3F5WA 3PDOB 4FFEX 4Z95L 4GMSL 1ZOXA 1F97A 1RUAH 4QRUB 1CBVH 4ZUWA 5MEOA 4UIMA 1JTPA 5IB3B 3VXMB 3QFJE 4K3GA 3RNQB 4GG6F 2F54D 5E6YA 2GT9B 4M7LH 5F6HI 3N85L 4MDIA 2CIIB 5I1HL 2AXJA 2EEAA 1EUUA 3CNKA 1MJ7H 3PXHA 3RA7H 2YXMA 1Q72H 3TZVA 5EUOA 5K93A 4WW1B 5DLML 5DS8A 1JV5B 3QXAB 5D1XC 2X4PB 5IG7B 1QACA 3UPRA 4U1MB 3RL2B 1GPOL 3SO3B 3W9DB 5HDOA 4Z7QE 1WLHA 1BWMA 1BVZA 1Q94A 5DJZA 4P59L 3RZCD 1K3ZA 4RWYH 4KK5C 4MXQC 2ZUXA 4U0QB 5GGSB 4K8RD 1MNUL 5SWZD 1FAKT 3SQBA 1G9NC 2JIXA 5E0QA 2VLRA 1V7NL 2BVPB 5DEFA 3Q0HA 2R23A 5HGGS 4F37K 1G9ML 1INDH 4ODUA 2NY4B 4NCDA 1K4CB 1DJSA 1CICB 1P7KA 1T4KB 1MCLA 5L2JA 4OLXH 3P73A 3BIKB 4XHJC 1LP9E 3WJLC 3GGWB 1RU9L 2Y5EA 3TA3D 3C6LA 3GIZL 4C4KO 1I3VA 1JTOA 2VWEE 3GZKA 1F45A 4XCEA 2X40A 1WBYA 3RNKA 4FZ8L 4L3ED 2JCCB 5IM7B 1WCBB 4CJ0A 5D1ZA 1INEH 5I17A 3IKCA 3KHOA 4JKWA 1P84J 4N0UE 2NPLX 1AJ7L 1X4YA 3BESR 2VXVL 3LS5H 5KSUA 1UM5L 2P5WA 3ULVH 3KDMA 3H7LA 3MCKA 4FFZL 5E1AA 2FX8H 2NY5C 1LO2L 5TGBA 3QEHA 4HJGB 1D5MA 5DI8A 4KGJA 2HRLA 3HLAB 4YE4L 4YFLF 2Q6WB 1MCSA 4P5TC 5DJ8A 4GKOA 2YC1A 3T1FB 1J8HA 3BKJH 1HKLL 1F58L 3S5LA 2ATKB 4UMGA 1PG7X 3O11A 5GRWA 1MHCA 3QH3A 5C0CB 4MMZC 4PLOB 1MIEH 4G9DA 5GGQL 4WI3A 4PV9A 2FZ3A 3ZKMD 3ZTJH 3JVGA 4YQXH 2UZIH 3RDTB 1A7QH 5EBMB 4AEHL 1R5IA 1OHQA 1T2XA 4FQHB 4U31A 1JI2A 3DGCR 3KGRA 2F19H 4MAUH 3N50A 4GG8A 5MI0C 5KG9B 3B9DA 1A6UH 5F7YC 4PTUB 1MCQA 3RWCA 3LKRA 1C5DB 3D39D 1NCAH 3NCEB 2ARJQ 1B3JA 3M45A 3QUMH 4YXHL 2P44B 1QBMH 4IOIB 2PO6A 5ISZD 3RY6C 3U9UA 4EKXA 4NJ9H 5CD5D 2R29L 1IGIL 1DBMH 4V2CB 1VFBB 1LWRA 3HNVL 5F7EH 3S37X 4MA7L 1AXTH 4MA1C 1LK2B 4MXVF 3CXHK 1G7IA 2G9HB 1NBYB 1DQQB 5HHPB 4LSVH 5CP7B 2Z8VC 5ANME 4H8WH 2MKWA 3EJJX 4QXGL 2ATPA 1I8IA 3BD5A 3HZVB 1JHLH 2NX5B 5EOQL 1I7UA 4EOWL 4LCWE 1DBBH 2HKFH 4JPVL 1T1XB 3MA9H 5HJ3B 1M05A 1QLEL 3RVTC 1JPTH 4KTEH 2AJZB 4HC1L 5BO1L 1DQTA 3EDEA 3UO1L 1HWGB 5IB2B 3JV0A 1U3HD 4LAQL 4NQXA 4I1NB 3WIHA 4PJBB 1UH3A 3STZB 5B39G 1R0AL 3O3EB 5MENA 1VERA 1MUJA 4ZSOB 2H9GA 2EXYC 5D71L 3PQYA 4XWOC 1JNHA 4POZD 1OD7A 1C5CH 4YXLH 1FL6A 3UTTB 2R1XA 1JZ2A 3IDGA 4Y7MA 2RBLA 4U1IB 1K5NA 4OLZH 3B9KC 3L3GA 3SN6N 2O5YL 3R1GL 2R0KH 4HKJB 2DQCH 1OOAA 1U8IA 5MEQA 2G2RB 3P4MA 2R56L 5MERA 3LN5B 3CMOH 4QRPD 4U6TA 3RTQD 1I1AD 1KBGH 2P8PB 4I0PA 1NFDE 1KLGA 4XI5D 1NEZA 4HPYL 5D2NE 5JDSB 5L6YH 4MDJA 4R90L 3TBWA 2VXUL 5BZWB 4G6FB 2VDML 3TN0C 3VRLE 4GRLC 4EN3B 2BY0A 1MQ8A 3SDCB 2ZSWA 3OJMB 2BVQB 3VXRB 1QQDA 1N26A 4HV8B 4K94H 4KH2A 3ULVC 1UKTA 4JEGB 3IAPA 4RFEB 5C0BE 4J3VA 1PVHA 2IBBA 3CFEA 2I5YH 3QO1B 1RV6X 3LRSB 4JO1L 1U92A 2NY1C 1K8DB 3QEQB 2ZNWA 4ERSL 4G42A 1D6EB 3QDGA 4QXWA 4H26A 2QADD 4XB7A 2O93L 5CEZE 5DFVD 1UQSA 3HPLA 4RGNC 4HWZB 3PWJA 4HH9A 4LSPL 3WFEL 3SKUD 3MMEB 4N5EC 3NZHL 4JGJA 4JG1H 1GZPB 4GJTB 1I9RH 3LEYL 4JN2A 4XBEL 4KDWA 1N4XH 4TUKH 2OTUA 5JXAL 1DBAL 1CZ8L 3VGHA 1FYTE 4MVBA 5JOFA 5FO8B 1YEDB 2DQFA 2ZOLA 1N5AB 2HYMA 4EUPB 3GKZA 4D9LL 1JZ4A 2WUCL 5EIVA 3TO4C 4U1NA 5LXGL 3RWFA 3HAEH 3AXLA 1Z3GL 4JJHA 3CUPA 3OXRA 5ALCH 1CE1H 3MNZB 4WU7A 1OGTB 1KACB 4KHXH 5INDB 4JQXC 5DHYA 1N6QH 3MRKB 2HTLD 4XVTH 4H8WC 4JPWL 4GQ9H 3HMXH 3V79C 4TULL 4Y1AA 1WV7T 4JZJA 2WP3O 3D69A 3KPRD 3W5MA 4TUJB 5IR1B 4CVUA 2IQ9H 2NY6C 4M6AA 1QSVA 3T2NL 4DKAA 1MCBA 5J0BA 3Q1SH 2XQYG 5DRNA 4JFFE 5IEKB 3QNXB 1SVZA 2YA0A 4PJHB 5D2LB 4X8JB 5BV7C 1PLGL 4WY7H 5TPWL 5HHMB 4U2ZA 5CINL 3NA4A 4WI6A 1FH5L 3VWJB 1F4WL 3FQNA 1GGTA 5D7LA 4HKZA 1GZQA 2OJZL 1CG9A 2UWEB 1KIPA 2MPAH 1ZTXH 4OZHB 1NCBH 2PYEE 3HN3A 2Z31A 2DQEH 2QQLH 2H8PA 1JIBA 1H3PH 5JA9A 43C9A 1TQCC 4YC2C 1KFAL 1I7ZB 3KLSA 4MQ7B 1N7MH 1EVUA 3FT2A 2ED8A 4GBXA 4IHOB 4O5LH 4MNHA 2H41A 4KI1A 4Z7QF 2DQDL 3K8LA 3LMJH 2E7HA 1QYGH 4RISL 2N7AA 3IFNH 3CK0L 2ZG3A 3GFUA 1S9WA 3DX6A 4XP5H 1IGTA 3CC5A 1KPRA 4EBQH 5C2BH 4I48B 4PRNA 5EU6D 3T04D 4F7MA 1JHKH 4MB3A 3FQWB 4OIIL 5T3XH 1LP9F 2DS4A 1KTDB 4ONGH 5E8DL 1CTNA 4RAVA 3DBXB 4NRXB 3DV6A 4PP2B 2VLKD 5F7MC 2Q1EA 4ODHH 1NCCH 4U1SB 4NWUH 2P49B 2P8LB 4U6VH 5C07D 1ZS8B 4ZTPH 5KTEH 1Q9KB 1A14H 1AFVL 4F58L 1WFTA 4JRXA 3ZE2E 5I8CA 1NBQA 2EIZB 1M7IA 4WUUE 1CF8L 2VLJA 1VFAB 3T09A 2HT2C 1CL7H 1A7BA 4Y4KC 4JPKL 2PKDA 3DVNA 3ET9F 2WIIB 1G7JB 3W39A 3EOAA 3P0YL 4G5ZL 5B39A 1IGML 1BBDH 1EAPB 4NQDE 4HWBA 2Y07H 4X9HA 3LDBB 4YLQT 2F5BL 4FQCL 1ES0B 5FUOH 3OGCA 1KEGL 1JI1A 4D0DB 3JXAA 2ZCKH 2QQQA 4U1HA 5CKAA 5CD3B 3BRGC 1JF1A 1CR9L 2D7PA 4J1UB 3NAAL 4WWKC 2W9DL 4ODTH 5C8JB 4XCYB 3RJQB 1A22B 1FVDB 3BN9C 5DMYA 3VW3L 1E4JA 1F4XL 1VCAA 5BJTA 3LS4H 3QCVL 4X6FB 3MCLH 5KZCD 5JORB 3LKSB 3RWJB 3ZYIA 3E3QC 3BGFC 3QQ9D 2L0DA 4CN4A 3WLWD 4XVUC 5D1QB 5FGBA 2DKUA 4LCCA 3MROA 3QIUA 1S78C 1HH9B 1QRKA 3QDMB 3HE7B 1UKQA 3EJYC 3F12A 2XXMB 2YPLD 4K8RL 3H9HB 2R8SH 5TQ0L 1CU4H 4I5BB 4OLUL 4PJFB 1ZEAL 4Z0XA 2NYYC 3MV7E 4V1DE 4FRWA 5E8OB 1YPZA 3ZHKA 5JZ7D 5HDBE 4U6XB 4LSSL 2VQTA 1R3JA 3VJ6A 3QG7H 2ADGB 3ARRA 3SCMC 4CVXB 4CMMB 2OR9L 2EYSA 3MGTA 1W2KT 3UTPD 5DRWB 1MI5E 3BP6B 4Y4HA 4O9HH 4PTTA 5FUCE 2EDLA 2FYYA 3CPLB 2VIRA 5IVZA 5K9JH 4CNIA 1M4KA 1YECL 4IRJD 1QO3B 3CIQA 2DBLL 1WIOA 3GNML 1XF3A 3QUZD 4I4WA 4Z95H 4GMSH 2P42B 1LEGA 3MRIB 1M7DA 3B2UD 3VXME 5JLZA 5HVWA 5F7DA 5IKCB 1MCWW 3ARGD 4UB0L 2EDYA 5I9QC 4X7EC 1MPAL 4FZEL 3LD8B 3AREB 1ZHKB 3HZYB 2XI9A 2YR3A 3N85H 5I1HH 1VACA 1IEAA 4TNVK 4N0FB 1QZ1A 1G7QA 3PJSB 5DLMH 1U58A 3C6SB 4WHYG 4JFFD 4P4KB 2ED9A 2IWGA 1GPOH 5L9DL 4HLJA 3B5TA 3DRQA 1IGJB 1FO0L 3SQOH 4P59H 1BQUA 4GXUN 3WO4C 5GIRA 3KPQB 2CO6B 1KTRL 1CLZL 4BKLB 3ZZ1A 2IPKA 3CDCA 3J7HA 3WHE1 3QFDB 2HN7B 4MLSA 1FZMB 2C1OB 2PYED 3MRBB 4MJ2A 2ICWA 5K33A 4ZXBA 5HYEA 1AGBA 1V7NH 4KI5D 3HE6D 3FFCD 1G9MH 4KK8C 1MVUB 3DUUA 2GQHA 1YEFL 1NFDF 1H5BB 4ZFFA 4TQEL 3TNNB 4Z77A 4W4OC 1REIA 1EFXD 4G8EA 1RU9H 1ED3A 5B8CC 3F65A 3VRLF 4X6BB 3GIZH 1B4JL 1W0VB 4Y2DA 2EZ0C 2JCCE 1QG3A 3MFFA 2KBGA 4LLQA 3VFRA 2W9LA 3JWDC 4FZ8H 1EHLL 1WJ3A 3HCVB 3LEXA 4DKEL 1T5XA 5K9OA 1PQZA 3T0WA 4KDTA 4RAUB 2GJ6D 3TLRA 5FXCH 2XRAL 3VFMA 2IH1A 1TDQA 2P24A 1JCKA 1AJ7H 5IK3A 3PL6C 2GEEA 5BRZB 2VXVH 4NCC1 1UM5H 4P5KA 4PB0L 4RSVA 5CJOL 4Z7VA 1FV1A 4GMTL 1LO2H 3BW9A 4PJ9B 1KF9B 4P2RB 3B6SB 2I9LA 3U36B 1HHIA 4BZ1H 3F7QA 4YE4H 3RGHA 1I3GL 2Z93A 3KYOB 3E6FA 4OCRL 1HKLH 1F58H 4GO6B 5D6DC 5C0CE 1YY9D 2VXTL 1A4JB 4HS6A 4TOYL 3K81A 2F53B 2CRZA 4WUUD 1WUNT 5GGQH 1CIUA 3GB7A 4EI6B 4Z7OE 3FB5A 3TESA 4AEHH 3O3BA 2CUMA 4PREB 1ZT1B 1E27B 4Y5YC 1OTTD 1QRNB 2QQKL 3FQTA 5F3HB 3V6OA 4GAYA 2XWTB 2W0KA 4I2XA 4KKLD 2DTML 4YXHH 4TUOB 4M43L 3V7MA 5TFSL 3SE3C 4JQVA 3GSWB 3RGVA 5IP4A 1IGIH 5T1DL 3IDMB 4UUJA 1UVQA 4NRYA 4E41B 3HNVH 5SX5H 3G6AB 4MA7H 1NGZA 5DUBA 2VLLB 2Q8AL 2NXYB 1F4YL 3X13B 5FB8B 4ORGB 3HG1D 4NRZA 5EU3B 2X70B 2NX5E 4EXPX 4JCMA 2AQ3A 5C09A 4QXGH 1CT8B 1YN6B 1D7FA 1I8LC 3CMGA 4MCYA 5EOQH 4LMQE 3QUYB 3BOVA 4EOWH 1KPVA 1M1SA 1P1ZA 4PY7B 5GISL 4X6DF 4JPVH 3P4OB 4MJ6B 5JIKA 3S3PA 4O4YL 4D3CL 1JGVH 4HC1H 5BO1H 3IDNA 1I85C 5HYQB 4PJBE 3UO1H 1NJ9B 3U6RB 2G75A 2H3NB 2XKUA 1K9TA 3I50L 1DTUA 4QRSA 3HR5A 4HZAA 5L8LB 3EZ8A 1R0AH 3DMMB 4CN6A 5LJYH 2E6QA 4RWHA 4NGHL 4XNZC 4PRPB 4P23C 4A6YL 4G43B 5D71H 1QFPA 3UTTE 3V6FB 4M1CC 5EO9B 4MS8C 3VD4A 1PD6A 3SPVA 4U6HB 1FG2A 4MD0B 4G6JL 5I19L 4JFXB 1G9MC 4X98B 3JV5A 5ETUB 2AJYL 5EIQA 2O5YH 3R1GH 5C0GA 4FNLL 5FEBA 1OB1A 4OGYL 4NM8L 3QIBB 3MRJB 2R56H 1HXMB 4WJ5B 3EYOB 1F4HA 4PJ8A 3SGKA 4HPYH 1N2RA 3H3KA 4R90H 3BQUC 2BVUA 3DTXA 2HVKB 3TT1L 2VXUH 5DD1L 3S8WA 2VDMH 4HX1B 2DMCA 1C7TA 3NFPA 4HDIA 3VXRE 2VUYA 2BOBB 5EFIB 3X3GL 2NY7L 4X4ME 4KTYA 5ICYA 4JREB 2A6KA 4NBYB 3NCFB 1AO7A 2HLFD 4I18A 5DD6A 1KCSL 4F7TB 3EFFA 2A6JA 1C08A 3ZE2F 4F33A 5GGRY 3KJ6L 1U91B 2Z9TA 3OKOA 3ZSSA 1Q1JH 1S7XA 5DF0A 4JO1H 2HJLB 2X1OA 3MREB 2ENSA 4ERSH 2ICWJ 1YYLL 4MD4B 3VXOA 1MCPL 5KSAB 3GJEB 4QLRA 2VTFA 1C16A 3MYJB 4P46B 4LF3B 2VDOL 2KUTA 3ABZA 3V0AC 2FEEI 1M71B 3LY6A 1G7LA 1ZK9A 4OFIA 2AJXL 4PJEB 4LSPH 3SKMA 3OJ2C 3NZHH 1SBBA 1T5WB 3LEYH 3TH2T 1KCRL 5A16B 5JXAH 1DBAH 1CZ8H 2COQA 4I0PD 2FJFB 3OKKB 3FB6B 4WFEE 4WO4A 3ES6A 3PV6A 2Y72A 1KB9K 3VMNA 2M26A 3L5HA 3SY0A 5C9JB 4D9LH 1FHGA 2VABB 4S0TD 3O3AA 4P48A 4YHNA 4DGIL 2WUCH 3L5IA 2A6IB 5KW9L 3O6FC 5LXGH 1F3JB 4JANB 4WIQA 1Z3GH 3SDDD 1U95B 3SKOB 3PWVA 4EIGB 5MEPA 2D0HA 2RCSL 3WLBA 4J4PA 4R2GD 4YHML 1CD8A 3VFSB 4ZMAT 3BPNB 1X4XA 2MHAB 1S9VB 3U83A 1AP2A 4YUEH 4LCUB 4S11A 4X4YB 1CFTA 4TULH 5HDBF 5GGUB 3U0TA 5ESAA 3B8YA 4C4KT 5HBBA 1G0DA 4MA3B 4KZDL 5HHQA 1S7VB 1BMGA 3T2NH 5C0AB 1X44A 3NZ8A 5TH2B 3L7EB 4QGYA 4XNQA 1A5FL 4S1DD 1F90L 3MLUL 4JFDD 5CP3A 3CFDB 3FN0L 4N1CA 3NIDE 5A3IC 2BZDA 2VKXA 4OD1L 5DJ6B 1PLGH 5TPWH 5HHME 4K3JL 4PBVC 5C08A 1QBBA 2J6EA 3P9MA 2E9IA 3HI6L 1FH5H 3L3JB 3IAQA 1F4WH 2UWEE 3ARBA 3L3IA 3ARUA 1A6VH 1UC6A 1ND0B 3QIWA 3WV0A 1D9KC 2CIKB 1KFAH 1JL8A 5KS9B 4ENED 4ELKB 2P5EA 3F5WB 2JELL 4WDIA 3MNWA 5TE4L 3SDAA 4ZUWB 5MEOB 2DQDH 1G6VK 4UIMB 1Q0XL 4X9IA 4RISH 1NUDA 3C60D 3QT2A 3CK0H 3NA9L 1JYNA 4MDIB 4UOW0 2GY5A 2JJSA 1NAMB 3TZVB 4XPBL 3ARWA 1DR9A 4JDVA 5DS8B 2XN9D 3QWOA 4MSWA 4B0MM 3UPRB 4HKBA 3B9EA 3SE4C 4OIIH 3MRPA 3EHBC 3AAZA 3INUL 1Q94B 5DJZB 2FX7L 4KKCC 2HFTA 2Q8BH 3B5HA 2JCCF 1HOCA 3QJFA 4CADB 5FV2A 1OLLA 4RGMB 3GSUB 1DBJL 4MXWL 3NFNA 1AFVH 4F58H 3CFJA 2YUWA 5J11B 2JIXB 4LHJB 2VLRB 1GSMA 4UU9B 4U0RB 4P57A 5DEFB 2R23B 4HBCL 1T7ZA 1PDKA 1XCQA 3ILPA 4ODUB 1P7KB 2Y6SD 3GBNL 4JPKH 5L2JB 3TJHD 3P73B 1YEIL 4G5ZH 1UADC 4OCWL 1IGMH 3C6LB 2X10A 4LHUD 2APBA 1NMBL 3FO1B 2F5BH 4XCEB 3ZTJG 4FQCH 1JZ3A 1WBYB 3RNKB 1WFNA 5KAQF 1KEGH 1T1WA 2VN4A 4FTVE 5DWUL 5GZNC 3LEVL 4V3EB 3CDFA 5D1ZB 1CR9H 2NZIA 3JV6A 4NCC2 3NAAH 5I17B 3IKCB 2W9DH 2RGSA 4MXQA 3GIVA 2PXYD 1JYXA 2ORBL 5KSUB 2VDPL 1CDIA 1WBZB 2P5WB 3V5KA 3VW3H 2AK4E 4FFWD 4XPGL 3KDMB 3O3DA 3MCKB 3QCVH 4Z7OF 1MOEA 5E1AB 2VL4A 5TGBB 3QEHB 5GRXG 1D5MB 4JHWL 5DI8B 1HIML 1P2CA 1HKFA 4RMUA 5DJ8B 3BUYA 3QDME 1J8HB 3S5LB 3HS0B 1PKQA 4CVWA 3O11B 4PJFE 1MHCB 3WJLA 3LKPA 3QH3B 4WHCA 4HJJL 4Y16D 4OLUH 4XRCA 2OZ4A 1ZEAH 5DGQA 1WAAE 2XXCB 3VDAA 4G9DB 5T1LD 3RVUD 3S9DB 4PV9B 2FZ3B 1U41A 1KB5L 1GXEA 5CILL 5DSCA 4O2CB 3P0VL 5I1GL 1ZGLM 1ULVA 1OLZA 4LSSH 4DZ8A 3Q48A 1L6ZA 4ZNEE 1URLA 4WFFD 1XEDA 1MIMH 2NY2C 4LGSB 4RDQG 1YECH 4OZFH 3K4AA 2DBLH 3GNMH 2PO6B 3EFDL 2R0LL 4P5TA 4NN6B 3U9UB 1K4DB 2MQ3A 3HHRB 3P3YA 5DZLA 1T0MA 3WNPA 2VXSL 2EH7L 4UB0H 3UYOD 1FYHB 1BX2A 2IAMC 1X5HA 3OJVC 1T66C 1DZBA 1MPAH 4FZEH 4OF3A 1G7IB 4PJBF 2OYPA 4UILL 1DQDL 5A1AA 3QCTL 4ZDHA 1I8IB 4LSTH 4H20L 1T2QL 1I7UB 5L9DH 4M93C 5FO9A 2R2BA 5D7JD 4KMTL 3D3VA 3FQXA 3NMEA 1FO0H 1CDCA 5IBTL 1M05B 1G7MB 4LKCA 4ZOCA 2XOTA 5F7FA 4ZFZB 2PTUA 1CLZH 3TVMC 1F2QA 5ITBL 2IMNA 2RB8A 3RY6A 4TN9A 1UKSA 4NQXB 5EUKA 1RZIA 1TNNA 2ICES 5GS1C 3CGTA 5MENB 5ACMA 2H9GB 1SJEA 3PQYB 1JNHB 1YEFH 5IUSA 1CN4A 2X41A 2VUOA 4KKAC 4TQEH 1KLUA 2YPVH 1FL6B 4M5ZL 4PGZA 4PJCE 3IDGB 5KSVA 4K7PY 2BHYA 1B4JH 4Z18A 3TJEL 1RIVL 1K5NB 3IJYA 3L3GB 1AC6A 1EEUA 2GTZA 1EHLH 3S4SB 4DKEH 1U8IB 5MEQB 3P4MB 5MERB 2X4OA 3G9VA 2XRAH 4XMKL 4OD2A 4TRPL 3QXUA 1RZJL 5BRZE 2BFVL 4X5LA 5FYLE 4GAGL 1IGCL 4JY4A 1NEZB 3LN4A 4MDJB 3TBWB 4PB0H 2DOCA 5CJOH 4P2RE 4GMTH 3BO8A 4YDJB 1IT9L 3NIGF 4XMLH 2ZSWB 5ESQA 3ARFD 1I3GH 1QQDB 3G04A 3L6FA 1A6AA 1VFUA 4G9FD 1B6UA 3VGAC 2F53E 2VXTH 1KPUA 3MLVL 4HFUL 1P6FA 4TOYH 3CFEB 3KR3L 2P46B 3B9KA 5AAMA 3ARPA 3RBSA 1WWAX 1QFUL 2XTJC 2EDXA 5EWIH 3HAEG 4K23L 3NGBB 1U92B 2RQ8A 4LKXA 2Z35B 1JUFA 4G42B 4K8RC 3QDGB 5EORL 1QFWM 2AVGA 4Y2DD 4H26B 3SEPA 3MXVL 2GJZA 3Q6GH 3MZTA 1QRNE 1PJ9A 3C9NA 1TVBA 1UQSB 3HPLB 4BSJA 2D0FA 4GUPA 2Y9RT 3PWJB 4HH9B 4FTVD 5E2UL 3NCCB 6CGTA 2QQKH 4EVNA 1NBZA 2WK2A 3GJFK 1LGVA 3KPSD 3AS2A 3TN0A 4JN2B 4GRLA 1OTUC 1RJZA 2DTMH 4YDIL 1J86A 1L6XA 4M43H 2ZCHL 1TNMA 4OF5A 5TFSH 5JOFB 2XZCL 3VWKD 3H7BA 2DQFB 2ZOLB 4E41E 4JFHE 5T1DH 2NY3D 4YBHA 5E8EA 4IOFD 2AK4D 5FOJA 3TWCL 1JRHL 2Q8AH 3O0RL 3KS0J 3RUGA 1F4YH 1Z9SA 4H5SA 3DVFA 1FCGA 1PX3A 1UWXK 1ODAA 1U93A 4U1NB 5I0DA 3RWFB 1Z5LA 2A6DA 3CUPB 3OXRB 1IE5A 1OGAD 1MCCA 3DWTA 1NBVL 2OP4L 5CJBA 3WHE0 3NIDF 5T3ZD 4H25A 5GGRB 3QDHA 1FPTL 4NO0A 5DHYB 3QUXD 5GISH 4N5EA 4PLNC 1LO0L 1TZHA 5JDJA 4O4YH 5IBLD 1FVCA 2FGZA 5FIEA 4Y1AB 4D3CH 3UXFA 2UWEF 2AKRB 5F7WC 5HGHA 4JZJB 3D69B 4YEFA 3I50H 4N9GA 5DVLA 4OFPA 4PRPE 2OCFD 3QUMA 3ZKMC 5DRNB 4NGHH 2DL9A 2CK2A 4UT9L 4A6YH 1KTKE 2OMNA 5H8DA 2R1YA 4UBDD 3TO4A 1BFOA 2FGWL 2GTWA 3NVQA 1A4KA 3GRWL 4G6JH 1JPST 1JWUA 2K1MA 3MOQA 4QOKD 5I19H 3UYPA 3Q5OA 1DANU 5BXFA 4U1KA 2FATL 4ZYKA 5J1AA 3FQNB 1TQBB 5D7LB 4HKZB 2H2PC 4FNLH 3H9SA 4N5UA 3I85A 4OGYH 4NM8H 4OUUA 1CG9B 3HC4L 5FYKE 1KIPB 4JQXA 1QPXA 4MX7A 2YHGA 2Z31B 2FJHA 2KPNA 2H8PB 43C9B 3G9AB 5GSVA 4MJIA 5HGDA 3CD4A 4W6WB 4YPJA 3RWEA 3FT2B 2HJFA 4GBXB 3MRRA 3TT1H 5DD1H 1DLFH 3IB4A 1OWWA 4I9WD 4MNHB 3AUVA 4JPIA 4ZFOA 3X3GH 2NY7H 3WFZA 1Y6NR 2IPTL 4EQ2A 2A0LD 1S9WB 5C86A 3DX6B 4L1HA 1IGTB 3CC5B 1KPRB 2M8XA 2XWBA 3KJ6H 4PRNB 4F7MB 1HEZA 1LD9A 1YY8A 4LP4A 1FCCA 1YYLH 1TETL 5D93B 1MCPH 1YNKL 1U3HC 2CKBL 3BZDA 4RAVB 1GGUA 2VDOH 4PJEE 3DV6B 3QSKB 4YIQB 4LLYA 2AJXH 2VQ1A 2YD1A 2EDKA 2OR7A 1XFPA 4JRXB 3T08A 5I8CB 2V9TA 4JHZA 1KCRH 1HXYA 1M7IB 4V2BA 2WWKO 2VLJB 5FYLD 3C09C 5I1LA 5LVEA 3DVNB 3CSBA 4IJ3B 4DGYL 3W39B 3EOAB 1I7RB 5FYKU 5B39B 5CGYC 4K71C 4MCZA 4JM4L 3KVQA 1KIQA 3V0VA 4DGIH 1I1AC 3C2AH 3IU4L 3OGCB 5KW9H 5SX5K 4U1HB 5E2WL 2F53D 3VFPA 2VL5A 2D7QA 1S5HA 4PJFF 1XIWD 4M62L 4XGZA 2RCSH 1CE6B 4QHNA 4YHMH 4S10A 1WAAF 5GRVL 5LWYL 1A9BA 2GW5A 2XIDA 4W6XB 1CTOA 1Q9WA 3QEUA 5BJTB 1NUFA 3Q5TA 3H42H 2VXQL 2D3VA 3D85D 3HMWL 4X9BA 5CZVL 3S6CA 1QRND 4ZOBA 5C0AE 2DD8L 1QSEA 4R97C 4Y4KA 3CVHA 5HXMA 4LCCB 3MROB 3QIUB 2NZ9C 4LHQB 3F12B 1A5FH 1I4FA 1F90H 1TPXC 3MLUH 3FN0H 3MGOA 5D96B 1Y0LA 5HI3D 4Z0XB 4R8WL 4GS7C 2QADC 2VWEC 4NQCA 4K3JH 5DFVC 3D87B 2LAGB 1XGPA 3HI6H 4G8GA 4WWKA 3VJ6B 1R3JB 1LQVA 3EOBA 3R0MA 3V9FA 1MRDH 3GDBA 4RGOH 2EYSB 2P43B 3HAEA 3MGTB 4XPHL 3WO3B 4Y4HB 4YDVA 3RIAK 1PYWA 4HK0B 4PTTB 2FYYB 5KS9E 1JP5A 4CNIB 3V5DA 5E6ID 3E3QA 1XF3B 2E9WA 4I4WB 2AJUL 2JELH 4LVHC 1LEGB 3BEVA 4KFZC 4LEOA 4TTDD 5JLZB 5F7DB 3DUHA 1RUML 4O58H 1Q0XH 1R3IL 4P2QA 1NUNB 3BRDA 2Y25A 3CXDL 3ARDA 3DSNA 4FHBD 2NY0B 2X2YA 1VACB 1IEAB 3UX9B 1G7QB 4XPBH 1U58B 2HTLC 4JCLA 4X6EB 3FMGL 3SCMA 3KLAA 1HQRA 1HHGA 4O2FB 4OF0A 3DRQB 3INUH 4PJCF 5KOVC 2FX7H 2YOCA 2WINA 3GKWL 3LKNA 5GIRB 4X80L 5HYSG 4EQ3A 3OB0K 1EJ6A 4FMKA 2IPKB 4KKBC 1CXHA 3AU1B 1WFOA 5FYKD 1DBJH 4M9OA 1KOAA 4MXWH 2VLRE 3IJSA 5HVGB 1JGEA 2V5YA 2ICWB 4ZXBB 3QZWG 1AGBB 3PNWA 3KG5A 4FQLL 5IGXL 3PABA 4HBCH 4HF5L 4UQ3A 3DUUB 4ZFFB 1UB5A 3GBNH 1XCTA 3HRPA 4FQ2L 2EYRA 1EFQA 3BZEB 1YEIH 1J05A 4Z77B 4OCWH 4G8EB 1X5IA 1LNUB 1ED3B 4DZBA 2VZSA 3FRUA 3MFFB 4LLQB 3VFRB 2F74A 1IZJA 2Q3ZA 1DCLA 1FFQA 3LEXB 4M7KH 1T5XB 5K9OB 5DWUH 1PQZB 3LEVH 4XTRD 5BS0D 4X5XA 3VFMB 2IH1B 4R96A 2P24B 2XY2A 3PGFL 5IK3B 3FRPG 3IDIA 3Q6FA 2P5WE 4AY0A 2YK1L 2ORBH 5KSAD 2DICA 1OM3H 1KCGC 2VDPH 4P5KB 4OCYL 2G5BB 4Z7VB 3K4ZA 1FV1B 2ZUSA 4YX2L 3BW9B 1AGDA 4PRHA 1HIMH 2I9LB 1HHIB 1J8HE 2Z93B 3MV8E 4N0YL 3E6FB 2WW8A 1I3RA 4OFYD 3T8XA 4LEXL 1S7RB 1UT9A 4LSRH 4WFGD 2XZZA 4IMLB 4W4OA 4HS6B 4HJJH 2CLVB 2H32A 5GZOD 2CUIA 1CD0A 3OXSA 2DQHL 5FOBA 4XX1G 4C83A 1LK3L 4ONHB 1KB5H 3GB7B 1S7WA 2B5IC 3P0VH 5I1GH 3AROA 5BZDA 3MRNA 4BJLA 1BFTA 5J1SC 4KRPB 1MFBL 3AY4C 3O3BB 5D1XD 3SGJC 3PL6A 1S3KL 1UJ3C 3N1PC 3KYMA 1YQVL 5HVHC 1U6AH 3FQTB 4GAYB 3AMLA 1U8JA 4I2XB 4ODWA 4L5FL 1RIHL 4YPGA 3LOWA 3EFDH 2R0LH 2VZUA 2IANA 5DVOA 3RGVB 2AEQL 4XC3L 2CPCA 5D6DA 2VXSH 2EH7H 4UUJB 1J87A 5JR1L 2O61A 1UVQB 4RX4A 4YH6A 5KVFL 1GGCL 1NGZB 5DUBB 4LVOC 4OI7A 4U7SA 1MY7A 1RPQA 2PW1A 3MJGX 2QL1A 1JJUA 3V4PH 1N59A 3IS0X 4WNQA 3V4UL 4UILH 3TBTA 3VD7A 4AQ1B 4NRZB 1DQDH 4KPHL 3WUWG 3QCTH 4AK1A 1UG9A 5GS0C 1UJTA 5C09B 3L1OL 2Z0BA 3OKNA 4MCYB 4XPTH 5HVFB 4H20H 3VG9B 1T2QH 1KC5L 2EC9U 1KPVB 1P1ZB 4Y5YA 4KMTH 3I6GA 1IC7L 3QQ9C 3B9VA 3WLWC 1V7ML 3H6JA 3BZ4B 3KPPA 4DEPB 5IBTH 3STLA 3TGXA 3TT3L 5IVNA 4MQTB 5KJRL 3IDNB 5ITBH 3SE3A 3BKML 3WE6A 2G75B 5CSBA 4QRSB 5MENE 3HR5B 4JFEA 3PQYE 3C5ZA 1Z0NA 4M6NL 5IFAL 1F4AA 5F7LB 4MJ5B 5JZ7C 4D9QE 1FJ1B 4M5ZH 1FG2B 4HGWA 4M3KB 1IAIM 5KSBA 3TJEH 5LAXA 5JW3L 4XHQA 4NZJA 1I8LA 4LDLB 4LPCA 5C0GB 4IRJC 4I3GA 1OB1B 4Q7DA 5C6PB 3T77A 1WFUA 4B5EA 2PETA 4TVSa 4XMKH 1RFDL 4GKZA 4BFIA 4TRPH 2BFVH 3B2UC 4PJ8B 4P2OC 3FTGA 4GAGH 1IGCH 3V2AR 1I85A 1N2RB 2H26A 1QR4A 4GRMA 1H3GA 1V8HA 1T89C 5L2KE 2EDNA 1IT9H 4HDIB 1MFDL 3T3PE 1BD2D 5T3ZL 4L3CB 4P23A 4PJEF 5ICYB 2A6KB 4MS8A 2Z8WC 2MCPL 1AO7B 2Q7YA 4I18B 5DD6B 4J6RL 3EFFB 4FA8A 5C6WH 4FS0A 2CDGA 2A6JB 1WIUA 4WFHD 5F6IC 1C08B 3MLVH 4HFUH 4F33B 3VGFA 4NZDA 3OKOB 3H8NA 3KR3H 2BNUA 3CDGA 5IIEA 1S7XB 1QFUH 5C0JA 2AV7A 2YXFA 3TIDA 4K23H 3QDGE 5TE6L 4L4VA 1L4IA 5EORH 3BVNA 2A1WL 1C16B 3MXVH 3CX5K 4RFNB 4KI5C 1G7LB 4YR6A 2ZKHL 3BQUA 3SKMB 3HI1A 4OV5A 4MZ3A 5T1MA 3HC0A 2ZCHH 3LQZB 4JVUA 5I18H 1NDGA 1A47A 1OP9A 1X5GA 3UAJD 5FGCB 4ALAL 2XZCH 5HYSA 4WO4B 1RZ8A 1QSFA 3PV6B 3U7WL 3UTSA 1FLRL 5JW4M 4FXGB 5DVKA 3TWCH 3O4LA 1JRHH 1S8DA 2CMRL 1TCRA 4NQVA 1A6PA 3SY0B 3QZWA 5JOPD 3T0DA 2FHCA 4YHNB 2DM2A 1OY3B 3O0RH 3O3AB 4HUXA 3MV8D 3V7AG 4ODVL 2EDQA 4QRRD 5EU4A 2DBJA 1D5BA 3MBED 3W11D 3BPOC 2VC2L 1TZGL 5LGJA 1EEYA 2HP4A 1A02N 1UCBL 3PWVB 1HN1A 1KJ3L 1NBVH 2OP4H 5MEPB 3WLBB 5DMKB 1FPTH 1YMME 3KPTA 2DQTL 2FBJL 5GGVL 5SWSA 1LO0H 4KMLB 1W0WA 4Y1AE 3ILQD 4C56A 3R8BB 1CFTB 3QWRA 3U0TB 3C2SA 5ESAB 4BQ9A 4QXTA 1YY9C 3ULUD 2MNUA 1NFKA 3GSQB 2V5SA 3FRPA 2I26N 5HHQB 3BDBA 1RSFA 4UDTA 4Q9QH 4Q6IC 2EIDA 3EDFA 1U2HA 3NZ8B 4XNQB 5KS9F 4UT9H 5DUML 2EIEA 3RI5F 2J8UA 5J12B 3GK8H 3O6FA 5E08L 1CCZA 5C08B 1V3JA 5FYLL 1P4BH 5DRXB 3P9MB 1OTTC 5D7LE 1IZKA 3FZUD 2FATH 2DYPA 3ARBB 5A43C 4LVNB 4KKLC 3HC4H 2Q86B 4OQTL 2NY1D 3QIWB 5C0RL 1UACL 3D9AL 1J0HA 4APQB 1BIIA 4BQBA 2AV1A 4X9FA 4HUUA 4JM2B 3VGDA 1GIGL 3UMTA 3V8OA 4MNQA 4F15C 2P5EB 5GJTL 4WDIB 1ZLVH 3MNWB 4QWWD 3QXTA 3SDAB 5F1SA 4QNPE 1RZJC 2C5DC 1CYGA 4GFTB 3RWDB 4HC1A 5JHLL 3DIFA 2IPTH 1FNFA 4PJGA 3MV9A 2BNRA 5T1KA 3P9LA 1O7VA 3BEWB 3O45A 3BHBB 2PR4L 5JQHC 1IL1A 4JDVB 2QSQA 4X99A 1FNSL 3QWOB 4MSWB 4Y5VC 4HKBB 5F70A 4PJIA 2XKNB 1DUZA 2OSLA 3VE0A 1KYOK 1TETH 3MRPB 4XNUL 3AAZB 4GW5A 1QR1A 3WUWA 2P8MA 1D9KA 2DQGL 2OJEA 2CKBH 4U1JB 1GH7A 3QJFB 1HOCB 2C26A 4N1EA 4XCCL 1S7QA 4JRXE 3NFNB 3CFJB 1SHMA 2HVJA 1E4WL 3PF2A 2VLJE 2Z92B 4P57B 1BF8A 4HSQA 1MWAB 5DQDL 5HHNA 3ILPB 1XCQB 5AWNL 5I1IL 2EYTA 2O5XL 4DGYH 4EI5D 4MYWB 2FLBT 3W9EA 1H3XA 4JKLA 5L2KD 3R06B 5JHDA 1NANH 4JM4H 4UAOC 1PX4A 4KY1H 3OF6A 1T1WB 1IARB 5E2WH 3JV6B 4M62H 5SX4H 2W60A 1YYML 1BQLL 5JMRA 3GSNB 3GIVB 3GMOA 1GC1L 2CXKA 2ZG1A 4YJZL 2KL6A 5I74B 3TFKC 1OQXA 3V5KB 3IYLW 4OZFG 3RFZC 3O3DB 2HLFC 2VXQH 3HMWH 4AEIL 5CZVH 1P2CB 5I1KH 1KN4L 2VSDA 3ULUF 2DD8H 4JZNA 2P47B 1KG0B 1PKQB 5EB9A 2APVA 1F3RB 3LKPB 5DJ2A 3SBWC 5FYKL 4XRCB 5D5MA 4R8WH 4X8XA 2AEPL 3EDJA 3RHWF 5DSCB 3P4NA 3HPJA 4ETYA 4ZPVA 4KKNA 4Y4FD 4DZ8B 1J1XL 4XPHH 4N90D 4GG6A 1PY4A 1CXLA 1BWWA 3O8XD 3RVXD 1TENA 4NHUA 1SYVA 2V17L 3DI3B 3M8OL 2AJUH 4P5TB 2GCYB 5J4MA 1CIDA 1YMMD 3CZFA 1T0MB 4C57C 3HNSL 1RUMH 2JLLA 1R3IH 2UUDK 1BX2B 3CXDH 4GLRI 5IQ7L 4URTB 4ZAKD 3SDDC 2HT2D 5IJKA 1BBJA 2OTWA 3RKDD 4NP4L 5C0DA 1QVOA 1CLOL 4R2GC 4YGAB 1XGQA 7FABL 4ZDHB 3ZL4L 2X89D 3FN3A 3VRIA 3FMGH 4OM1L 5MI0B 5FO9B 2R2BB 4X7CC 3D3VB 1JWMA 4J3WA 3FQXB 1R5VA 1U36A 4HHAA 4F80A 2FH8A 3KXFD 4G8GD 4NM4L 4WWKD 2VKWA 3GKWH 4LKCB 2W0FA 4X80H 1UWEL 4S1DC 3GHEL 4PJ7A 3MRFA 3BN9D 1QLFA 2KQMA 3OR6A 1RZIB 2H1PL 2J8HA 5IGXH 4FQLH 1K8IA 2YD8A 4HUVA 3DROA 5EPMA 2IAMA 4HF5H 5ESVA 1SJEB 4XVUD 4P4RA 4GXVL 1KLUB 4FQ2H 3BH8A 1EXUB 1ZWIA 5FM5O 3UTOA 3W0WA 1U9KA 3ZMRA 3T3PF 3UBXI 5CLTA 1RHHA 3IJYB 4LPVA 2GTZB 1H9VA 4U33A 1NPUA 2X42A 3OKLA 4ENEC 5IVXA 2X4OB 2ED7A 3VXSA 3QA3A 4EDWL 1F00I 4OD2B 1MJJA 3RPKA 2Y36H 3PGFH 2KKQA 1JE6A