3O8XA

Recognition of glycolipid antigen by inkt cell tcr
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
273
structure length
268
Chain Sequence
NYTFRCLQMSSFANRSWSRTDSVVWLGDLQTHRWSNDSATISFTKPWSQGKLSNQQWEKLQHMFQVYRVSFTRDIQELVKMMSPKEDYPIEIQLSAGCEMYPGNASESFLHVAFQGKYVVRFWGTSWQTVPGAPSWLDLPIKVLNADQGTSATVQMLLNDTCPLFVRGLLEAGKSDLEKQEKPVAWLSSVPSRQLVCHVSGFYPKPVWVMWMRGDQEQQGTHRGDFLPNADETWYLQATLDVEAGEEAGLACRVKHSSLGGQDIILYW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The V{alpha}14 invariant natural killer T cell TCR forces microbial glycolipids and CD1d into a conserved binding mode.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords Antigen-presenting glycoprotein CD1d1
total genus 77
structure length 268
sequence length 273
ec nomenclature
pdb deposition date 2010-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3o8xA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3o8xA01
4XNYL 1J8HE 1Q72H 1TPXC 4AIZA 4WI4A 1KCKA 5KSAB 1E0OB 2R2HB 4WY7H 1WGOA 2AEQL 4TSAH 5BJTA 3VRIB 3S34H 4MSWA 2C3GA 2UZXB 4IJ3C 3UYRL 2I24N 4UTBL 1YEFH 1ND0B 1KCGC 2GIYA 1BX2A 3LKRA 1U93B 1BD2A 4WWKD 3QO0B 1WFTA 5A2FA 1RZ8A 3BW9B 2DQCL 5ICYA 1K8IA 1YN7A 1FNFA 4IDJH 2BOCB 5F7UA 1JNLH 1H3UA 3VGFA 3MRQA 4N0CC 4U1IA 1TIUA 4WUUA 1JIBA 4PD4J 5F97E 3DYOA 3WUZA 4CMMB 3WYRA 3MRLA 4CADB 4WI9A 4YHLL 5JW5A 4PRPB 1OAXL 1FL6A 2EYTB 1N6UA 5D2LB 4KMTH 5FYKU 1JNNL 2JJSC 5ALBL 4NZUH 4I3RH 2YUXA 3MV9E 5EU4A 1AIFB 4KI5E 2XA8H 1I9JH 4GW5A 5AZ2H 4UTAL 4Y88A 1BBDH 4D0DB 5C07E 4AYFA 3O0RL 5D7SL 3TVMB 2AKRA 3G5ZB 1B4JH 1AQKL 1T4KB 1ODAA 1K3IA 5M7QA 1NGYA 4MQSB 3VFMB 1LD9A 4NSKB 4FNLL 3OAUH 3U4EA 4UNTA 1TJGL 2J1KA 3UPCA 5C2BL 3RVTC 5L2KA 4R7NB 2NY2C 2Q86B 3NGBB 4NQCD 3V4PL 3QXTA 4F2MB 2X4QB 4FXLA 2GW5A 3ARXA 4Y5XB 3C8KB 2VUYA 3WJJC 3ZKXB 1RURL 1U8KA 4GW4A 5HYJA 2Y7QB 1IZKA 4M4PA 1U8JA 1YQVH 5ACMA 3DBXB 4OD1L 4FOMA 1UEYA 4L8DA 3VXRA 1AH1A 3WO4B 4M43L 3QUKA 4Y5VB 5IM7B 1NC4D 2AXGB 5L6YL 4DEPB 3CFCL 1U8MA 4FFVC 5JXED 4O51A 3IDGA 3GSOA 4G9DB 4JRYE 4G59A 4NQXB 3OKLB 5DK0A 1JF1A 2PCPA 3U30C 5DJDB 1EX0A 2V7NB 4N8VA 3VA2C 2AJZA 1L0QA 3A6CH 3EJZD 5I1JL 1CICA 3SDCB 4PJAF 43CAA 4LVOC 4XP6L 3O3AA 5SV4A 1IBGH 2D0HA 4TTDD 4ZXBD 2V6HA 1J8HB 2IQ9H 3IJHB 1H3WM 4GAGL 2PCPB 1JPSL 3DX8A 3QPQC 4RMVA 3T0BA 3OZ9H 4GRLD 1QFUL 1RHHA 4W4OC 4GRWH 5JIPA 1SJXA 4ELKA 1P9MC 3BPOB 5F96H 3HFMH 3MGOB 4FFWC 4F33B 4QHNA 2J5LC 1J10A 5DJ0B 4QTHB 5EBWB 5L8LB 3DBXA 3WN5B 5IW3A 1W8NA 1DN2A 3F6LA 2A2QT 3ARGD 4U49A 5EULV 4GFTB 5I1KH 2J8HA 1YEEH 5LBSL 4MGXA 4WFED 5MI0B 4YFDB 3M8OH 3IFPA 1QLRA 2APFA 3TZVD 3MBEC 1RJCA 1QO3B 5C0AA 3B6SA 2IPKA 4D3CH 2R1WB 5F1SA 4ZOCA 1A9BB 2C4FT 1ZLWH 2OZ4L 1LP9E 4NKIL 1CDYA 4B53A 1Z6JT 1OP5H 25C8L 1DE4B 5DC4B 1ZVYA 1X5AA 4AEHL 4WU5A 3O6ML 3OXRB 1WBZA 5TDNB 4G9FB 4HWNA 5T1DH 3AB0B 1QBMH 3OKKB 3ULVF 4Q9CA 4LVNB 5EBLB 4ETQA 4EUPG 1NAMH 4CRPA 3PP4H 1A1MA 4ODSL 5D2LA 4DKEL 1NUGA 2JJVA 4S11A 1FFRA 2B5IB 4OFVA 5EU7C 1IAKB 1VACA 4ONHA 4BK4A 3GM8A 3DUHA 2HT4D 5GGUB 4GAJL 5DZLA 1Q9KA 4AQOA 1QBLL 2OBGA 3TBYA 1MHEB 3U2SB 3ZZ1A 1MVUB 4GS7B 5D8JL 3H2WA 1N6QL 4ONHB 1L7IH 4LCWA 1HYSD 5BS0B 3MRRA 5IKCA 5HGDB 4HV8A 1YMMB 4AH2B 4Z76B 3V4VH 3WCYA 4EBQH 2APBA 3CDYA 4KZEL 3CFEA 4UU9A 5J6GA 4MJ6B 4HIXH 5HVFB 3QYCA 1HSBA 3R4DA 2D7MA 5GIRA 4XXCC 3WIIL 5JOEA 4H20H 5EOTB 3ZKNC 2P8LB 4O2FA 3WFEL 3PUCA 1J18A 3R06A 1OF2B 1NANH 4YHML 1CZ8H 2DQEL 3QJFB 3T0EE 3QCUH 1HKLL 3UJIL 3KPPB 3VWJC 5DRWA 4YO0A 5FM4A 1CFQA 5C0RL 1I9IL 2YPVL 3ZE0F 4ZG1A 5KSAC 3HZKA 3GRWA 4H8WH 2BVQA 2CDFA 5KVFL 3F7VB 4LEXH 1SMOA 2D7TH 3LKOA 4A2LA 1EO8L 3ZMRA 3B5HA 1ZEAL 1PYWB 5F71A 2X7LB 4MA1B 4FZEL 5LAXB 5I18H 4A6YB 4MVBD 5L88L 1M7DB 2ATPA 5L0QB 2XY1A 3KPNA 5FYLH 4LCUA 4QRTA 2A73A 5GISL 1CFBA 1QPXA 4MZ3A 4UZGA 3U0PB 4Z0BL 2FECI 2KBGA 2V17H 2IGFH 4AT6A 5EORL 1IEBB 2ADJB 5JNYA 4LLWB 4PY8I 5FOJA 2ZOKA 4PG2A 3FO2A 4QXUH 1CICB 5DQDL 3W39A 3RAJH 1XF4A 1A4JB 2UWEB 4FTVB 3GJEA 1RZIA 5J6GB 1PZ5A 4PDCE 4G6KL 2YD4A 2HT3C 1Q9LB 3B5GA 1XGYH 5H35B 4F9PC 1H8OA 3BIAX 2WV3A 2R4SH 3N85L 1HH6A 1PLGL 1KPUB 3DYMA 5BXFA 4HKZB 1R3KB 1KIQA 1A6VL 1CDHA 2G60L 3RY6C 1BIIB 3BXNB 2ITDA 2AJ3A 1SQ2N 2GJ6A 5KSBA 4PV9A 3TIDA 2WUBH 4OCXH 3AXLA 4S1RL 1RUQH 3C6LA 2J12B 3F62A 3QULA 5JQHC 5HDBF 4HXAL 2XG4A 1H8SA 4Z77B 3EYFB 1SJHB 1T1YA 1I9RH 4NKQB 1IL1A 2FJFB 3RVVC 2WWMD 4P46B 2VDPH 3I3DA 4LAQL 3O6LL 2OQJA 5ICXA 5EIIB 3STZB 1KTDB 3BT2L 5GGQH 1FZJA 2WBJC 1ACYL 3CCHB 1MI5B 1JWUB 1ZMYA 3FQWB 3CU1A 3SE8L 3FT3A 1ONQB 1GOHA 5FB8A 4PRHD 5IVZA 1FYTB 5ABDE 1RHFA 2K9UA 5TF1L 2HJKB 1VPOH 5IUSA 5GGSY 5HVGB 2RFXA 3O6FA 3QNYB 1FZKA 1UWGH 4D0DA 1NGZA 2VR5A 1T21A 1CDUA 4PREA 2OR9H 4XNQB 4JG1H 1I3UA 4BFGA 3C8DA 4NWUH 5D1XC 1ERNA 1U95B 1CLYL 2CK0H 3TYGL 1QA9A 4RWHA 2BXYA 3MBEB 4MD5B 3RVWC 3KAAA 2NR6D 3A6BH 4PJIE 1IC1A 1QLFB 5JA9A 2J8OA 5F9OH 1B0RA 5SWSD 2O5YL 1SY6H 4Z7NE 2MJWA 2NY2D 4KK6D 5E9DA 4KVNH 4M6AA 1CIUA 2L7JA 1BFSA 5C6WH 3NCJH 4PJ7A 5SWSE 1FAIL 5E8OB 1EGJA 4JRXE 3X3GH 5E2TH 3NZ8B 4F58H 4D0CA 2HP4A 3ZL4L 1ND0A 1MRDH 3GMPB 4KV5F 4X6CB 3RBSA 1K3ZA 2DL2A 3C9NB 1UYWL 1BGXH 1IQDA 1PGRB 5IVZB 2DDQL 5FB8B 1QKZL 1ONQA 1ZWIB 3I84A 1Q72L 4D8PB 3O3AB 5HHME 1F42A 2V2WB 5E99L 4NRXB 1NDGB 5D1XA 1FZJB 3UAJC 4UV4H 4NHUA 3SQBA 5D71H 3UTTB 3MFGB 1U2CA 5JTWA 4Y16C 3DROA 3V6FB 1YEFL 1J1OL 3VRJB 1BVKA 1U8MB 2R1XA 1JPTL 2YN3A 4M3KB 3JWDH 3V7AE 5T3XE 4G42B 4TVPH 4CBPA 2VITB 3I85A 2JELH 3OHXA 5F3HB 3PP3H 3SBWA 2EIDA 5GRWA 4LQ1A 4MXVE 2CIKA 1OWWA 4WCYH 2C4FU 5CSGA 3LMJL 5HY9A 1EAPA 1LO3H 3GSRA 5AG9A 2IFFL 1WZLA 5DJ2A 5HPMB 2ICEB 1OAXH 3LV3A 4WW2C 5JNYB 2B20A 3OR6B 1VENA 4JKKA 4I3RL 5E8DH 2QQKL 3QCVH 2AXJA 3RNKA 2E5EA 1Q94A 1T7XA 1BBDL 4OLEA 1JN6B 3IRPX 4FP8L 3KPSD 1B4JL 3B9KC 4HIIA 4RMSA 4KJYB 4A6YA 3JTCA 3CH1A 3SKOB 1KBGL 2FX8H 1UM4H 3PDOA 3DURA 2F8OA 4RAVB 2ZWLT 2BXZA 2X4RB 1EERB 3OPZH 4Z7VE 1G7IB 4JDVB 4B5EA 4PG2C 4OF6A 3N50A 4JFEB 1DBKL 4KK5C 4XC3L 4CADA 5E4EB 2E7LC 3DXAA 1JZ6A 2ERJC 1RUAH 1GZQA 4I5BA 2PYFB 3SDAB 3QDGE 3UTQA 4GS7C 5A1AA 1XIWB 3WLBB 1BZQK 4KC3B 4JJ5B 1FZOA 5CSZA 4U1LB 3BWAA 5EBGA 1FH5H 4OCYL 1JYVA 4FQLH 4WI6A 1V05A 4L4TB 2XZAH 3QEQE 3CFIC 1HSBB 1OM3H 5TDOB 5IEKB 2WMPA 5I1EL 2IANA 4MJ6A 2H3NA 1WFUA 1P6AB 1K8DA 4HUWB 4ODUB 5D70L 3PWUA 2X1PA 4JFEE 4JDVA 4HWBH 2XZCH 4XTRC 2FEDD 4HC1H 1CF8H 3V6ZB 1QR4A 4LL9A 1QSEB 3H3PH 3ZE2E 2WLZA 5TPWH 3QUML 3S4SB 1JFQH 3VFSB 3SDXA 2H1PL 4CUCA 3X13A 4PS4L 4NM8H 3ZYJA 2WINA 1MFAH 3RGVC 1WF5A 1FV1B 1WWWX 4N0RA 4XGZB 5BV7L 1QSFB 5F96L 4IRZL 3TFKD 4J4PA 4RA3A 1RZJL 4PJHB 1HCFX 2DQUL 3F7YA 3MLRH 4TUJB 1EXUB 3N1PC 5F3BB 2NXYD 4G6JL 1AXSB 2P46B 1C12A 2BJMH 1FO0B 1G1CA 1AJ7L 3JTSB 1ES0B 3FTGB 1DBBH 2DRUA 5C0BB 3ULVE 2VJXA 2CIKB 3LKNB 4M6MH 5IIEA 3GSUA 3L3IA 3TV3L 3M07A 1ZKAA 1I7UB 1OPGH 2QSVA 4YXKL 3EGSA 3VXRE 1IM9D 2ITCA 4M7LH 3V6OE 4NUJA 4N90E 2X4NA 2VLRB 5F9WB 1VFUA 5LG1A 4YDVA 4ZFOL 3LEVH 3O6MH 3EJYD 5CIPB 2YEZA 5E5RB 4KTEH 3MJ9L 4M7ZB 3RVUD 1CGSH 2ZSWA 4U6VL 5C9JB 3BZFB 4RZCA 2VDRH 4CAGA 1LK3L 5EBWA 4EI6A 1ULVA 1NAML 3PHSA 2O5ZL 4JKPH 2V2WA 5I71B 5DS8B 5JMRA 3WO4C 4P9HC 5KW9L 3QJHA 4MJID 5J11B 3CDCA 4EDXB 3LRGA 4UBDD 1A64A 4X6CE 2LE9A 3RPIB 1GGBH 2F5BH 1J87A 4MB4A 4XCYA 5EU6B 1CGUA 1TJIH 4NO5A 4KMLB 4GKZA 7FABH 2MQCA 4Y5YB 4LVOB 5I1CL 4Z7UB 4B0MM 3DNKA 1ZVSB 1P7HL 4EIZC 5LXGH 3W9DA 5AD0A 5I74B 1NAMB 3ZE1E 4KY1H 3PDDA 1Z9SA 3GSNB 3OQ3B 4YHYB 4M8QB 1MOEA 3L5WB 5HHQA 4ODTH 3L5HA 3MCKB 3FMGL 3UTSA 4PPTA 2QQNH 4N0FB 1T0NA 5D5MA 3EAKA 3WIIH 1KT2A 4FABH 3DWTA 4N68A 3UC0L 2WBJD 4OD2A 3H7LA 4I1NB 1CS6A 4L8DB 4UOW0 4X4YA 3NACL 4M6OL 5DD5H 1J0JA 2AK4E 3AMKA 1E6OH 4YHMH 2R0WH 2AK1L 3C6LC 4U1JA 4JFFD 1BOYA 4D0BB 1LE5A 5F9DC 4N8PA 5DTFA 5JW4M 1U95A 4F3FB 5C0RH 1INQA 2Y06L 2E9IA 1ZVSA 2XFXA 5DGQA 5GGRY 4MYWB 1UCBL 4Y4FC 3JV4A 5E6YA 1XEDA 2JCCF 4G8EA 1NGPL 1ZEAH 4YDLC 1E4JA 1XIWC 1IAIM 4FZEH 4XPBH 1FFNB 4P5KA 1MLCB 4JVPA 2BRRH 2XQYG 3G6AA 1PJ9A 1LQVA 3A67H 4ZPVA 3QUMB 3AS1A 4I0KA 1A7NL 4WTZG 3EJJX 3AC0A 3MRMA 3L95A 4QXUL 5EC1B 3EDEA 3OGCB 3F7PC 4OFPA 1FVCB 3EYOB 1JYNA 1UG9A 4NIKB 4LSPH 2YSSB 1IVLA 4OKVA 2F54A 1JL8A 2VLRA 3ORJA 5GS0L 5TDPA 4FTVE 3W39B 2OP4H 2MNUA 2X70B 3Q0HA 3AXLB 3NA9H 1IEBA 2G60H 5DFTA 4JFFA 3L7FA 1I7UA 4IOFC 1OGAB 2CRMA 4BSJA 3LHPL 1SJVA 1BF2A 5JOPE 3BZ4A 1D5MB 3S35H 2P7TB 3W0WD 1H8NA 3QG6A 4HGWA 4TSBL 5I0DA 4LCUB 5BXFB 3D3VB 3UAJD 4HXAH 2EYSB 4QYOA 5MERA 5C0BA 1I9RL 2GJ6D 2XKSA 2XRAL 4XWGH 4GXVH 4PJXB 1NCAL 3P11L 2DN7A 5DJ8B 5I1IH 3C2AH 3P40A 2AVGA 2ZPKH 5EOCL 3CK0H 1ACYH 3E6FB 5ADOH 1OAKH 2JJSA 3OG4B 1K4CB 1RJZB 1ZV5A 1IGJB 2CKBB 3WKML 1ZGLB 5DO2D 4JZNA 4HMEA 5ITFB 4JPVL 1J0KA 3TNNA 5EUKA 3S88L 4CJ0A 3Q6GL 1IGJA 3I6KA 3NFNB 2FYYB 4TULL 2BNQB 4APQC 1IGML 2DQJH 3H3KA 2ADIA 4LIQL 3HE7A 4D94A 4OZIA 3D0VB 2CDFB 4Q6YA 4PLJD 2ICES 1EFXD 1JGUL 3M17B 4F57H 1CLYH 1U3HD 4XZUA 3CZFB 3BKMH 4F15B 1CXKA 3KYNA 4P2QD 1JZ3A 4Q97A 4CVZA 1UC6A 5B22A 4RRPG 2JJTC 3MJ9A 4JREB 3KYAA 5E8PB 4KHXH 2IJ0C 3DMMA 4P2QE 4QY8A 4LCCA 5AWNL 4OGXH 2NX5E 1YMME 1I1YB 4R26H 4U6XA 1YUHB 1LK2A 2GJ6E 4HG4J 1DR9A 2OM5A 4P48A 2J6EH 5E2TL 1MIEH 3CDFA 3ZL4H 2BVOB 5JDSB 1ADQH 2FH8A 4PRDA 3C5ZD 5GRXG 2LV4A 4LLVA 2AV1B 1UYWH 1W0VA 3F5WB 1NMBL 1TCMA 4NDMA 4Q2ZA 3OGCA 3FQXB 2MHAA 1AP2B 5HHOE 4R90H 3TT3L 5ID1A 1Q1JH 3MRJA 5F9JA 3NAAL 1S8DB 3VG0H 4U2YA 4OF7A 4L8CB 4I0PC 2CXKA 1JI2A 4OGYL 3QIUA 4ONOA 2W9EL 2IAMC 3HR5B 4JY6A 4HMCA 5J1AB 3PV7A 4L8BA 1DE4A 1IM9B 4CU6A 1GH7A 3O2WH 5GS0C 5H37G 3JBG7 4NN6B 1AQDB 1X3DA 4KRNA 1I8LC 2P49B 2GAZA 5F7EH 3DMMB 1I1RA 2XICA 5EBLA 2CLVA 4LSTH 4YGVA 1H3GA 2NY3B 3EOBA 3SN6N 1ZS8A 3O3UN 4ZAKA 2BY3A 3P4MA 1WBZB 1U3YA 1KEGL 3U48A 2KDGA 1BOGA 3QQ9D 5CJQL 3I02B 3U9PL 2R8SL 4UQ2B 2C3HA 1RZJC 4N5ED 1X4YA 1J5OH 5IQ9B 2VISA 5FGBC 2BNQA 2D9QB 3MLPA 4X99A 4LDEB 5T5FH 3VD9A 3TN0C 2R1XB 5AEAA 3IDJB 1ZT4A 4JM4H 2ATKA 3GSNH 2VXSL 3UCRA 1UWEL 1ZANL 2N7AA 5KTEL 4K7PX 4BK5A 4PGZA 3HI6H 4HMDA 3TFKA 3NH7H 1QBAA 4RQQA 5HDOA 1D6VL 1RVFL 3AM8C 4O5LL 5D2LF 2VDLL 4JHAH 3PG2A 4QHKI 2RIKA 1WCQA 2HAZA 3OKLA 2JCCA 1FLRL 5DK0B 3L3OB 5GHWH 3F58L 2Y5EA 2EE9A 4Z7QE 1RHHB 4RSVA 5DGRA 3H42H 2DBJA 3EYSL 3IDGB 1JGLH 4MNQB 4PP2B 3D3VA 5HHOA 3DRQB 3GMOB 1T7WA 3HZMA 4Y4HC 3L7FB 5FIEA 4O02L 3VCLB 3THML 2EXYD 1DLFL 3VD3A 4E5XA 1UACH 2XWBB 4OV5B 3QSKB 3E3QE 5AYUH 2FGWH 2OJEA 4LASH 5IROA 1U8KB 1A6WH 2B39A 5DJYB 3SKMA 1YYMH 3CLEH 4HWBL 4OUUB 4KAQH 4JR9L 3WFBL 2C3VB 4X98A 4YC2B 3QUMH 4YHZH 2H1PH 4QLRA 5K9QI 5HYJE 4M00A 1M4KA 4PS4H 1FGNH 5C2UB 1WWCA 5IB1B 2XQBL 1MFAL 3W9EB 5B3JE 2OK0L 5FF6B 4WHTA 2BOBB 2YD3A 4WUUD 4I8DA 3IB4A 4A6YL 4YGVB 3MR9B 2EZ0D 2CKBH 3MRIA 3G6JF 2HMID 2J7LA 3L3JB 1DANU 3X14B 1G7QA 1KLUA 2MPAH 3CD4A 3MACH 3N1MC 1INQB 4LSUH 1SEBA 3QHTC 3VXTB 1GC1L 3MV01 2OQJB 5ICXB 4OQTL 1RUPL 1IL1B 3KG5A 1FV1A 3VFMA 2ADFH 5INCA 4NJ9H 2I60L 4GKSB 3QULB 3ZDYE 2H32A 1S5IH 5FYLE 4IRJB 1JPGB 3VRLE 3LKPB 4PV9B 3TV3H 4JZOA 3RU8L 3CSPA 5IK3A 2NMSA 1LVEA 1MHCA 2G75B 4AZ8A 3QG7H 4HFWA 4PJGE 5C07D 5J3HD 4AEEA 2OJEB 2ADGB 3O2DH 1OSPH 3TLRA 1T7YA 1X5LA 3HC4L 1BM3L 1WVZA 1CGSL 3OKNB 1KENL 1AD9B 1NBQA 3MV7E 2EIBA 2OMNA 3ZE1F 4ZFGH 4EDWH 4R3SA 1BF8A 5C0CE 3HHRB 4I13B 1CXLA 1LDPH 1CL7L 2EDLA 2F54D 3EFDL 2JF1A 1BX2B 3BUTA 3L7EA 4JZJC 4FQ2H 5DJXB 2RAMA 5EUOE 4MHHG 3TBSB 5IG7B 1UZ6E 2VLKB 3VFPB 4OM0H 1I7TB 4UB0L 3QHZL 5CMAB 2FR4A 5E08H 1N3NB 4JPIB 3R1GH 2X4RA 1AGCA 2ZKHL 5ALCL 1R5IB 1OQOA 2RGSA 3DXAD 2ZSWB 1A47A 1R3HB 3BP5A 1QSVA 1SBBA 4UDTA 4ODTL 2Y6SD 1IGYB 3TNNB 4D9QE 3G5YA 3MRDA 4ISVA 3M1BA 1V3KA 1TJGH 4L3AA 4E9LA 3QI9A 4YPGA 1WC7B 4M9PA 4E41A 1RIHH 1OWRM 4FA8A 3HI5L 3NCEB 4YHKL 5DVKA 4QWWC 4P4RA 1B0GA 4LSRH 4P5TB 1BIHA 4WI7A 4R2GC 3NCMA 4HK0B 1MFCH 3UO1H 2CIIA 4M8VA 3GHBH 4Y1AA 3T0EB 4PJFB 3JWNC 1KTKE 1UADC 2BMKB 3BMVA 1N59B 1NGQH 2VLLA 3TO2A 1G9NH 5C0NC 3B2VL 4HV8B 3OHXB 5CHNB 5F7DB 4OCMC 1CL7I 2IG2H 3GMLA 1MJUH 3QDMA 4PGBA 1L7TH 1WBYA 1NGPH 4ZNEA 4P2RA 3IDMA 1R3LA 2XNAB 2EDOA 3QCTL 1MHEA 3WIFA 3SHSA 3PDGA 2A9NL 1C1EH 2E27L 4ZUUB 3UZEA 3D0LB 1P9MA 3HRPA 2FATH 5IJVA 5C0EA 1CYGA 1N26A 2BZDA 2JIXD 5F9JB 2NY6C 4MMZC 5FUCC 5I2IB 3HI1A 3P2TA 3FQXA 3KPQB 1YNTA 1UB5B 5EU5A 1KNOB 1RUKH 1JWSA 1QYGH 5DEGB 4UNUA 3SDDB 2BVOA 5JDSA 4NZTH 3IF1B 1HOCB 4F7EA 3PWNA 3KPRB 2NZ9C 2NY0D 3VMNA 2XTJB 5T3XH 2P1YA 1YDPB 4H8WC 4TVPE 2DYPA 3VFUA 1ZA3A 5T1MB 4GQ9L 3VJ6B 4RFOH 5KVGL 5TF0A 3WLBA 3VI3E 3G5XB 2DKUA 1UA6L 1CBVH 1FNLA 5JQ6L 4JO4H 2VL4A 5DJ6A 4NRYB 2APVA 3U4BH 4MD5A 1NCAH 4G9FD 2VDKH 3OJMB 1A3LH 1QP1A 2P43B 4PD4K 4X0KB 5AUMB 2UUDH 2YC1B 2JB6B 4X4YB 4E0RA 2ILLA 3HE7C 4D3CL 1KIRB 3WE6A 2NY1B 3BQUB 3DX6A 3E8UL 2YPKA 4N8CL 3RJDA 5SX4I 5DT1H 2HFGH 3RDTD 4MA8H 2EDFA 1A7PH 2AABH 4N0YH 5C08D 4NQTA 3EO1B 2K1MA 4UV7H 3UTSB 2NY4C 4Z7OE 4Y1AE 4M8QA 1FIGH 2KL6A 4Q6IB 4J4PC 4QXGL 4KDVA 2CKBA 5IB3B 3IJYA 3O8XB 1QBML 3Q6GH 3QQ9C 1NAMA 5FA3B 1T5WB 1A7BA 1YNKL 3PP4L 4LIQH 1HXMB 1YY8B 3LEYH 2X10A 4DKEH 2Z31D 5D1QA 4PLKD 4OJFL 3VD4A 4YUEH 1TPXB 1J88A 1H5BB 1MCEA 4NO5B 3U1SH 4CN1A 3MO1B 4GAJH 5E6IA 5EUOB 3W0WA 1UM6H 4XC1H 4YR6B 4UIMB 4U6TA 3GI8L 3S98A 1D5ZA 2FJFA 5DSCA 4WUKH 3OV6A 1RZKC 4R0LC 5IM7A 5DEZA 4AG4H 3BEWB 2VITA 4JO1H 5ETUA 4G42A 3QZWG 1Y6MR 4LRNH 4O9HL 5IEHA 4JGUA 2VWEE 4X6FB 1A4KA 4OCSH 1U8JB 2BVYA 3QIUC 1RAMA 2WY3A 2DM7A 1QNZH 5CBEB 2AJXH 3UTTA 4YDKL 3C8KA 4DTGH 5E8EA 4R90L 4YXLH 3TT3H 4H20L 4FG6C 4V3DB 1S9KC 1GPOL 1INDL 5D7KE 4Y8DC 1MCFA 3X17A 1DQDL 4Z0XA 3BQUD 3QQNA 3ALWA 1F3JA 3MRBB 1CZ8L 1H0DA 2DQEH 3TBVA 4R96B 3UJIH 5DSCB 3KNBA 1UH3A 4Z7WA 4PJIA 3AS3A 5LCVL 3GDBA 3MO1A 1NBZA 3LKOB 1VSCA 3DV4A 1S7WB 3MXVL 2BSED 5E9DB 2VSCA 1OAQL 4RDQG 2FCBA 3WEXA 5B39B 3G04B 1SJEA 1I3GL 3O2VH 1MFEL 1A6AB 4FRWA 1D5XB 3FFDA 3RWCB 2GI7A 2YPLB 2Y9RT 2M2DA 4GUPB 4JKWA 4LF3A 5F9WC 5GISH 4DJMA 2NLJA 3QUXC 4PB0L 5ADPL 5CZXC 3U9UB 5HHMA 2V17L 5EORH 2A1WL 5EPMB 5C08A 5C8JB 4MDJB 1PEZA 1G6RL 2RFXB 3QNYA 1RULL 3OAZK 2OTUB 1OT2A 5IB4B 5K59F 4K94L 1T20A 3HCVA 4XMPH 1Q8MA 4DK6A 3CSYA 1MCOH 1RIVH 1IGFH 2QR0A 3W9DB 5IMOA 4NPYA 4GKZB 4GRLA 1X4XA 3SDCC 1NLDH 4UDUA 1YDPA 2G2RA 3N1GC 4XCYB 1F5WA 1RUQL 3FQTA 1ITCA 3RPKA 3PE9A 1FLRH 3P0GB 4NNXA 2VLKE 2AI0H 4NO3A 4LVHC 4JFDA 1SJHA 1T1YB 3H42L 1JGLL 2HKFH 2MTPA 5DEGA 4HCRA 2O61A 1U8LB 1QFOA 4NCC2 3PHOA 5LGJA 5GGUA 3ARGA 1DQJB 1DQQB 1DTUA 2Z91B 3HI1B 5CD3A 2A74A 2VDNH 4TPRL 5C0CB 5HBBA 4KKCC 2DQHH 3QQ4A 5FAAA 1DLFH 1CQYA 1A2YA 3SE8H 3G6JE 4NJAL 4QHMA 3L3KA 4NN5C 1U8OA 1QSZA 3DIFA 5AYUL 4P46C 2FB4L 1T2QL 2FGWL 2AW2A 2IAMB 1M05A 1NBVL 1A4JA 4XMLH 1XGRA 1YZZA 5DLML 4RMQA 4NO2A 2GJJA 1JNHA 1IC4L 2NY7L 3K80A 4RGNB 3L5JA 4X7CC 5FUOL 3S36X 4HJJL 2VXQL 2X4OA 1YECH 1G7HA 4QOKB 2EYRA 5B3NA 1I1AC 4XHQA 2CK0L 2FDBP 1C08B 1CDGA 4X9BA 2CIIB 4X4ME 1JRHH 2DWDA 2HVJA 1DN0B 3A6BL 4P2OD 1P4BH 4U1MA 5CJ5A 4X7TA 5DQJA 5KOMC 2CKBL 1JYWA 1XF3B 1NL0L 2IPUG 1AGBB 3GRWL 4FXGB 4KVNL 1JGVL 3HZKB 3FB7A 5DD0H 2CR6A 1J0ZA 4P2RE 3PHOB 2VWEC 5DDHA 1BQLH 3QI9B 4CW1A 3CUPA 3IAGC 1RUPH 1I1FB 3QAZB 5DRWB 4TTDC 2Z8WC 2O5XH 4I48A 4KKLD 1NC4B 2P42B 5FYKE 3VXUE 1PX4A 1QKZH 1FGVH 1KJMA 2DICA 4HUMB 5IV2B 5EUOF 1IE5A 3WD5H 4X6DB 1V7NL 4JN1H 1S9XB 4XNZC 4PGJA 5I76B 5KAQF 5FYKD 4JFQB 2BCKB 4ZODA 1KCLA 3OF6D 5E6ID 5LJYH 5FHBH 5IJKA 3R8BB 3C9NA 4X80H 4YBQC 5IEKA 2CDGB 1BM3H 4U1KA 3VH8B 2OTUA 2AERT 3VFOA 5J6HB 5E8OA 3SGDI 4IIQB 5I17A 5M95B 3DHJA 3HC0B 1NFKA 4LSDA 4NQSB 4P2QB 3ZDXF 4M48H 2IH3A 1ITBB 2WWKT 5ANMB 1P2CA 3L5XH 1MHHB 4HKJA 4GUPA 5CZVL 4KI5D 4J8RB 3BPLC 1KJ2H 1QLFA 5FFLA 4FQ2L 5TGBB 3REWA 4MNQE 1Q9KB 4LFHD 5GSVB 2JJTA 3VGEA 1IAKA 3BKJL 3KYMA 1YN6B 3MJ8A 5D6CA 5EZOH 4DKAA 4L29A 1SVCP 2HFFA 1FPTH 5A2JH 2YD2A 2QQKH 3FN9A 4YHNA 3VFRA 5FUZL 3C08L 3SCMB 4PRHB 1CIDA 5DFVC 3MREB 5GS1A 1J86A 2QHRL 4LLQA 4JEGB 2Q6WA 1R5VA 3GI9L 4DGVL 2HJKA 1P53A 5IFAH 1KBGH 4PJCE 5DD1H 1RSFA 2X1OA 1IAIH 2R0ZH 4X98B 3OPZL 4XVUC 5ERWB 3QH3A 3HI5H 4MAUH 4X5WB 5FKPA 3WHE0 4Z18A 1S7WA 1G0XA 2J4WH 1WZ1L 5HPMA 5IMMB 3I6LE 2BOBA 1FN4B 3UXFA 2YXMA 3UO1L 2HA1A 3BUYB 5LQBH 4AJ0A 4GAYA 4RIRA 2AJSH 3ROOA 4HAFA 1I8KB 2HTLC 4P3DA 3LB6C 5ETUB 2EDWA 4OCWH 1WT5C 4FQLL 4JM2B 4JPWH 5DJZA 4G8FB 2D7QA 5TH2A 1ZLWK 2XZAL 5J8OA 1U93A 4ELMB 4LSVH 2GITB 4NHCL 3V95A 3E6HB 4N1EA 5I15L 1GXEA 3PL6A 1X44A 4XPFL 1AC0A 4JRXB 3V5DA 1BD2E 5HHPB 1XF4B 2XZCL 3UZQA 4ENEC 4LLWA 1ZHNB 3KLAA 4WTXA 4GAFB 2GT9A 1NMCB 3B4NA 5ESVA 5HSFA 4J3TA 1OW0C 4JFZL 2HVKB 1SYVB 3RDTA 4QRTB 5BMFH 3FFCA 5C86A 3GMMA 1EHAA 4NM8L 4XPAL 4MNQA 4PP2A 5BZWB 2XTLA 2XXMB 4LARH 5IBTH 5C09B 3NZ8A 3GSXA 4E41D 2CO7B 5BV7H 4JFED 5EN2A 2ESVE 5D7JA 1RZJH 5T3XL 3AUVA 1ZGLP 3DX6B 4UT9H 3TH3T 3ES6B 5FO9B 2R0KH 4E41E 3MYJB 5GGRA 3I6LD 2VAAA 4GQ9H 4K9EL 1P4IL 1FDLL 3W2DH 4ODVL 5ECJE 2LABA 3MLUL 1F4XH 1S7VB 4JO4L 3AY4A 3QXUA 3DUUB 2Y7QA 3L9RB 5FDWB 3ZDYF 4GW4B 5D93B 1AO7D 3C5JB 3ILPB 2VDKL 5KN5A 5ISZB 2XN9B 4Y5XC 5D1ZA 3PQYE 3ULUD 1I1AB 1T66D 5J11C 5C0AE 3NCYS 1A6PA 2DYPB 3VFUB 5D2NB 4K3GA 4EI5B 2J2ZA 2Q86A 1HQ4A 5C0AD 1MIMH 2R0LH 1A6UL 1N6VA 2AABL 4MD4B 1TQCC 1NFIB 5FO7A 5BV7B 3Q1SH 1XAUA 1T89A 2N7BA 5E1HB 5C09D 1A3RL 3MJ9H 4OGAC 2VXTL 1NBYB 4U6VH 4K8RC 1D5IL 3PL6C 5CJBA 4EQ2A 5E00A 3QIBA 3G6JB 4G80A 3GUTB 3LD8C 1P4LB 4OJFH 4XNXH 1I3RB 5KW9H 1TENA 4RFEB 3WFCL 1J0HA 3QXDB 4JFDE 1FFQA 3CVIH 5J1AA 2EECA 3PJSA 3U0WL 4I77H 3QRGH 5IWLA 5SWQB 3FRPA 5M94B 3MROA 4PGEB 1UZ6F 3GMLB 4W81A 5I74C 3VGAC 1I1YA 1AC6A 4AEIH 4XX1E 1X5XA 5DMIL 2FIRT 4LVNC 1CICD 3KPRD 3MRJB 2NTSP 4ZXBB 4BH7A 2NXZD 4XCCL 4ODXA 1LO4H 3I75B 1P1ZA 4N5UA 2BY0A 5JPNB 1F90L 4OCLC 4B7LA 2P5ED 1FL3A 5D7IF 3TPUB 3ULVC 2C3WA 5TDNA 5JPMA 2CLRA 4LPUA 2UWEA 2BNRD 5I73B 3VRIA 4P5TA 3CZJA 3FB6A 1MH5B 4YXLL 4OBRA 3RVWD 2ADJA 5TFSL 2BNRE 2H9GB 3MLTA 4MXQA 1C5BL 2R1WA 3BN9D 5I8KH 3G9AB 2XACC 1QFPA 4KJWD 4RGMC 5C0BE 1YNLH 3QUYD 1U8NB 4XXDA 3VWJB 4OZGB 4YHIB 1Q38A 4LP5A 4ACPA 4KJPC 5JORB 2Y5TB 3HUJE 1W72A 4H25A 3MXWL 4ZTOH 5ITBL 4NKDB 3J7HA 3D39A 4MXQD 3S96B 4KV5E 1AKJB 1LP9A 2XTJC 2FGZA 1OP3K 3V0VB 4DCQB 1HINL 4L3CB 3W5MA 1WWBX 1XGPA 4HBCH 4ZUVB 1QSED 4KDTA 9CGTA 5MENA 3P3YA 3KPOB 3DX9A 3T0VA 1DZBA 1DBAH 1QSEE 5FM5O 4GXUN 5FM5M 1OGAA 2X9XA 4MXWH 4HD9A 1MI5D 2FECL 3R8QA 4NO0B 4HIHA 1KN2H 2NW3B 3NA4A 1AD0A 3G9VA 4HUVB 5I1AA 4LSPL 3NVQA 3O6KH 4EKXA 1MCOL 3QEQB 1JPST 3OTTA 5BVJA 2VUOA 3K8LA 5EWIL 3JSSA 3O41B 2XA3A 1NFDE 5C0IA 1YMMA 3ZSSA 5I75C 3KR3H 2R2EB 1JZ7A 3QUKB 3CGTA 5C0BD 4Z7UE 3BGMA 4TSBH 4RCAA 2X70A 4LLDA 4C56E 4LPWA 3C87A 5E6IC 2DIAA 3MMEA 4UT6L 2Q8BH 3E2HA 4Y4KC 2HKFL 3AU1B 3AVEA 2Q7YA 3MJ7A 3PV6A 1H15A 3RP1A 1G6RB 4HQQL 1LDSA 4R97B 4MD0B 4NQED 1KEMH 5HGHB 3RA7H 5TE4H 4ELME 4PBVC 5D4QA 2ZPKL 3MRMB 5EOCH 1CD8A 4JCMA 3NCFB 1WUNT 3CFDB 2VDNL 2VN4A 4TPRH 4QTIL 5A3IC 3MYZA 1HEZB 1N5YL 1WK0A 2CJUH 3BD4A 5D96C 4ODHH 5ENWA 5K33A 2OS7A 1G84A 4NJAH 3BP4B 4LNRA 1YC7A 1MCPH 2X09A 3QXWA 4NSKA 5MEOB 4YAQB 2A6IB 3TVMC 2D9CA 3GBNH 3B5TA 3TZVB 4HX1A 1NFIA 5FO7B 3VU2A 4XMLL 4MD4A 1HHHB 5GS1B 5J13C 4GW5B 4HS3B 1MCSA 1JGDA 3JUZA 3OXSA 1AR1D 2LTQC 3KS0H 2UYLB 2DQGH 3BPOC 5ID0A 4X6BA 4LPYA 3O45B 1L9MA 4CJ1A 1YEHH 4PJCB 2YA2A 4C59B 3OKDA 4ONFH 4D2NA 1MRFL 5DTFB 3IFPB 5CS7A 2Q7YB 4Y19D 2LU4A 3BKML 1JRHL 2Q3ZA 1S7VA 2HT3D 1G9EA 1BJ1H 3QEHA 5F7LB 3MLYH 5GRZA 1GZPB 3P0YH 4PB9L 2XT1B 3PXHA 1QEWA 4HJGB 4PGCA 5IFHH 3SEPA 4H1LA 3GRWH 1RFDL 1ZHKA 1FP5A 4OUUA 4Y4FA 4K55A 2IQAA 3GBMH 5AZEH 4ZFFA 4KHTH 3D69B 1MIEL 4HT1L 1AXIB 2O5XL 3QIWD 4R8WH 3GMMB 5CGYD 1YEIH 4XPTH 4WJ5B 3JWOH 3LKSA 3UTSD 2AV7B 2ZUQC 3GKWH 2MQ3A 1FJ1A 3QWOB 2D03L 1X5KA 2ZCKH 4QT5B 1FFPA 5IBUB 4XMKL 4HBQA 3ZTJH 4AIZB 4G8IB 3GIZH 2J8UA 4JFYB 4RZCB 2ARWA 1T83C 3FFCE 4L8SB 4S1QH 3NIGE 3RZCA 3DUSB 3PL6B 4OGYH 1NC4A 4O4YL 3UDWA 1CGXA 1DSFH 2XV6B 2V2XA 1TLKA 3TT1L 3EIFA 5E0QA 2P5WB 4IEFB 1U8HB 2COQA 4BZ2L 5L2JA 5C6PB 3BPCB 5HYIA 4ZYKB 4MS8C 4EI6B 1VFBA 3N06B 1GZPA 4KK8D 1BOGB 5JR1L 3TA3B 1KJ2L 3VA6A 2DQFB 3U46A 1ES0A 5D93C 4OZGA 3NIDE 4NYLA 1SM3L 2IF7A 4XAWL 3IU3A 3RVUC 1HILA 2HRPL 4EI5C 2NZIA 1PX3A 4R0LB 5E9DD 3SE9L 3HB3D 5FUZH 4MWFA 5KVDH 4UTAH 2PYEA 1IM9A 3P30H 4HS8H 3C8HA 5SX5H 3D85A 4O58H 3SKNA 2IH1B 4U6YB 1Z3GH 1ORSB 2A0LC 3PGDA 4F9LA 4OIAA 4FNLH 3HI6L 1BVLA 5DA4A 2EDJA 3VFRB 4NQEA 3RL2A 2DF3A 5C2BH 5DD1L 3VW3L 4QOKE 4GKNB 5EO1A 1ZT7A 3V6ZA 2X4PA 4LIQE 4O5LH 5GQBA 1AY1H 2RBLA 2VDLH 4PRPA 4S1DD 4MD0A 4W6XB 4OT1H 3WHE1 5ICZA 4PRIE 2H2PC 3QAZC 3PJSB 1F3DH 5TDOA 3ZTNL 1UQSA 1A1NB 3PIQA 3DMMD 4OGAD 5IMLA 1QSFD 4XCEA 1XR8A 4YE4L 1V3JA 4YH6A 1UJTA 3DECA 2FLBT 5E56A 2CDEA 2WW8A 1OW0A 2V5TA 3O4OC 5ID1B 4NUGL 2X89D 4OI9A 1I7ZB 4XVJL 1UB6B 4F15C 1V5JA 4MJ2A 1JHKL 2UWEE 3HNSH 1IGCL 1A6WL 2W0LA 4F9PA 3A6CL 4YC2C 4KTDH 4JFQA 1HZHL 4S1SH 5KSAA 2BSSA 3SJVA 2CMRH 4U6XB 4U7MA 2XPGB 4M1CD 4Y19A 1IBGL 2QL1A 1Q9WA 4HDIA 4YHZL 4LCCB 5IMKA 3DURB 5HHMB 1NSNL 5CAYB 1CWVA 4IHOA 3SBWC 5I6XB 4JFZH 5I19H 3CFBA 2W59A 4GG8B 2WANA 3PWPB 2UV3A 5BZDA 3C6SB 4Q9RH 3RWDA 3M17A 4W6YB 4IRJD 1F13A 3MV11 3HFML 3ROLA 3LN5B 5BS0D 1LO0H 2R0KL 1EMTL 4D9RD 1YPZF 1VFOA 4IIQC 1G7IA 1S7QB 1YEGH 4LPVA 3KLHD 1GC1H 3QUXB 4PJ9D 5EN2B 4HHAA 1F4XL 3MFFB 1T80A 3GSXB 4Z7WF 3MLWH 3GSVA 5DD6A 1GHFL 1NC2A 1CK0H 4JZNB 1F3JB 1QZ1A 3VXQB 1GGIL 5J9PA 2R39A 1I7RB 2EE2A 4JCLA 3TBTB 3DXAE 4NKIH 1WEJL 5K9KB 3QG7L 5CJ8A 1XMWA 1CT8A 4LCYA 5MEND 1WBXB 1KOAA 4R4BB 2WBWB 3O2DL 4P4KB 4TYUA 5CUSL 1JF6A 3D2UD 2K3TA 4QHMB 6FABH 5T1DL 5AG8A 4NCDA 1RQ5A 2HKHH 1NANI 3IDIB 4K7PH 1TMCA 4KKAC 1UXWB 1LEGB 4ODSH 2A74B 3AS2A 5D9SA 2BK8A 2XIDA 3KLSA 2FZ3B 3BO8B 4KXZH 4MNGA 3RIAK 2MMXA 1X5JA 2Y72A 4JRYD 4X7FC 3PWJA 1BVKB 4GAYB 5BCAA 4YIQB 2UY7A 3RNQB 2V2XB 4I77L 2P24B 2AEPH 2FX9L 3MOAH 5DO2C 1RZFH 4ZOBA 1N6QH 1EVUA 4LAJH 1VFMA 3GJFA 4Q9QL 3FRPG 4R4FL 1JVKA 3RKDD 2DIJA 3LPFA 4PP1D 3I2CH 4GQPH 2H26B 4UUJA 3SDXE 3WS6A 5FA3A 3KGRA 1ZWIA 3E0GA 2IPTL 3FAWA 3TWCH 5J0BA 2VZ3A 1FFNA 4EN3D 3MNVA 4EUPA 3B2UC 2KH2B 3HMWL 3JV5A 2A6DA 1DP0A 2X9YA 4WHDA 4P5MA 4U0RC 3O4LE 2JTDA 2MCG1 4JHWL 2LTQB 4KUZL 1C5BH 3D6GA 3WE6B 3T3ME 2XFXB 4WO4A 5INDA 3AM8A 5DC9B 3KYMB 2E6PA 4XPHH 4PJXE 5T1KB 1GCFA 2X4TA 1KJ2B 3Q5TA 1NCCL 1JWMB 2R56H 2JKXA 3EJYC 2ENYA 1I9IH 3CIQA 4WI8A 1G9NL 4G8GB 4HF5H 3L3HA 3OSKA 3MXWH 4ZTOL 3TN0A 2IAND 3U0TA 1JGDB 2IG2L 1JHTA 3HC3H 3HC0A 5KVFH 2VL5A 1EO8H 4YK4B 5IBUG 5DJCB 2BHZA 4S10A 5F88B 1HN1A 1YPZE 3CNKA 3TZVA 4IOIB 4Z77A 1H0DB 2A9NH 4JFDD 4V1DE 4WFHD 2E27H 2HVKA 4LP4A 3V6BR 1FYTA 5FYKH 4TUKH 4RGNC 1DBAL 3D5OF 4MXWL 1U91B 1UXWA 4DVBB 3P9MA 1D6EA 3EDFA 5C08E 4MA3A 3RAJL 3W0WE 1TZGH 1A21A 1AI1L 3H9ZA 1QYGL 1PKQA 3ARTA 2DQTL 2FO1A 3VWJD 2NXZB 4LCYB 4LPXA 1C5CL 2QADB 3VG9C 3MBXL 1PLGH 4LCCC 4PJBA 1OD9A 1PSKL 2IALA 1I7RA 1RIUH 5D7IB 1QFWM 1A5FH 1TMCB 2APXA 1P6FA 1GOFA 1SMAA 4DZ8A 5JQ6H 3BE1H 2EDDA 2HVJB 4U3HA 4LAQH 5D5ME 4H5SB 3HG1A 4ZUSA 4PBWD 4NO0A 3WDJA 1X7QB 4G8GD 4QTIH 3T65A 1A7OH 4ZMAT 2VH5H 4X6CF 4B41A 3I6GA 4N0YL 2W0FA 4LGSB 4XRCA 4X4ZA 2I07B 3GBNL 4G9FE 4CVWA 3X13B 5HHVL 4OI7A 2X7LA 4OZFH 1A1OA 4PRPD 1YMHB 4WTWA 3TM6A 1X5YA 2KQMA 4PBXA 3HE6A 1YEJH 5CJXA 4MZ2A 2PO6A 5JW3H 1TDQA 4KZDL 5D6CB 4JG1L 1FBIH 2VABB 4K3JH 5FECB 4I3SH 4PRPE 4DW2L 2E8YA 4YUEL 1JP5A 3NGBC 4F7PB 1K4DB 1EZVX 5DRXB 1UM6L 1JK8A 2VLJA 2GTWB 4WWID 2H2SC 4BQCA 1BQUA 4ZFOA 2O26U 5JIHA 3TPUE 4YGAB 1PZUB 5F9OL 2DMBA 4NC2B 2WUCH 1DDHB 3JUYA 3F12B 5IB5B 1S7TA 1SY6L 3RVXC 4AH2A 3L1OL 1B2WL 4JO2L 1EDQA 1FCGA 4N1HB 3S9DB 1Z5LA 2V9QA 3GBML 2E7MA 3HZYA 3QEGH 1J05B 4F58L 1NMAH 1C7SA 4F37F 1MRDL 3U2SA 3ZT6A 5ELIA 3BMWA 4O2EB 3VFNA 3ARFD 4HAGA 4AIXA 3N9GL 1UEMA 1CFTA 1QVOB 4JFEA 3LN4B 2DQDL 4MDJA 1HKFA 1L6ZA 1GPOH 2D03H 1KCRH 2VQUA 5C0EB 4GMTH 4WNQB 3VWKB 4RX4A 2VXUH 3MV7B 1YMHA 2EH8H 4MJ4A 4HUXA 1XIWA 4ZUTA 4XBEL 5D1ZD 4KRPC 4P4KC 1OARL 5GS2H 3WUWA 1DSFL 4PRIB 1UJ3A 4WU5B 1GSMA 1R3LB 3GMRB 1WITA 4U7SA 5T33L 4HH9B 2EDEA 1DBML 1BEYL 4OZHF 3V0WH 5E2VH 1JZ8A 4DAGH 4XBPB 5CHNA 1HILB 5FO8A 1X7QA 4OCRH 3PGCA 1DVFA 3G6JA 4G80B 3WNOA 1FHGA 5E00B 1CTNA 2GSGB 1MF2H 3IETA 4NYLB 2AK4A 1MFEH 3QFJB 4G9FA 2DQFA 3OG6B 5F7HA 1C08A 1EHNA 2HTKD 4ZOEA 1WZMA 5T3XD 5KVEL 4K7FB 4QGYA 1BWWA 3BPCA 3K4ZA 3FQRB 3SKJL 1A9BA 2FD6H 4HGMA 2A1WH 2L4OA 1KLGA 1X4ZA 3MRDB 5HI4D 3P30L 1RULH 2YKLL 5FYJD 1JGEA 4XMPL 3T4YB 1Z3GL 2C7UB 3L9RA 5FDWA 1QRNB 1NCBL 5HGGS 5HGAB 2CGRH 1VFBB 4WW2F 4X7EC 1U92B 3I3EA 4HUKB 3JVGA 2VSDA 3K3QA 2EDQA 1S7SB 3SDAD 2IADB 1EEZA 1NLDL 5HTSA 4ZS7H 5DJDA 2EDXA 4I0PD 1AHWB 4NRZB 2C1PB 3HNVH 1RUAL 5DRNA 3ZE2F 4D9LH 3VXOA 1P7QB 2OX5A 4NBYB 3MC0A 2EXWD 2CH8A 3ALPA 3FFCB 1C7TA 3IJHA 1PD6A 2E6JA 5GS0D 2AXGA 4YE4H 4WEBL 1BMGA 4GRLB 1WIUA 4FFVD 4U7KA 4XBGB 4AQ1B 4GBXB 4TNWK 2KPNA 4MNQD 2HJLB 2B4CL 43CAB 3VG9B 3QZWA 4Q7DA 4L9DA 1IT9H 5LVEA 3H8NA 3MBEA 4OFIA 3MZTA 1QA9B 2X4TB 4ALAL 4Y16B 3NZHL 4PJCA 1NPUA 2DM2A 5IVOA 4ZXBC 1XGTA 4RGMB 5D70H 2EH7L 1HZHH 3CU7A 4HC1L 5HHXH 2I27N 2AXFB 4YBLC 5IQ9A 3QNZA 5FUOH 4HJGA 4X8JA 1NSNH 1KLFA 1FZKB 2EC9T 1EEYB 1FVDB 5E1AA 2QADC 3VXUD 4EUPB 5J12C 5EZIH 4FFWD 1Z9OA 2XWTB 1TNNA 5F89B 4Q9RL 1VA9A 3P77B 1CFNB 5MP6L 3U7WH 3B2UD 2CLVB 3EYQC 3WEXB 1T0MB 3T08A 1IQWH 1LO0L 2DKMA 3HAEH 3DOSA 3VJ6A 4P23A 3TCXA 3MLRL 3QH3B 4BUHA 1FL6B 2EYTA 5DD0L 1MCJA 5I75B 4OFDA 5HGHA 1ADQA 1DJSA 1QHPA 1QR1B 4V1DA 4PJEF 2BVTA 2FX7L 3WUWB 4U1IB 3BRDA 1E6JL 1TZIA 4RGOL 1V3MA 1GGCL 4OB5H 5L2KD 3B83A 3TCLB 1KNOA 2APTA 1H9VA 3CX5K 1FGVL 4YHNB 1RZKL 4LGRB 5EU4B 1LEGA 4KGLA 2R2EA 1C16A 1P7KB 3SKMB 1XGTB 4GBXD 4M7LL 2F15A 2JCCE 3C60D 1OGTA 4PJEB 1IEAB 4O2EA 2A6KB 4CMHC 2FIKB 4FTVA 2OL3H 2IEPA 4L3ED 4LLDB 2HKHL 2ZOKB 5JHDE 1MHHA 2VDRL 4HKJB 4K7PL 1N2RB 4JKPL 3C09C 1W0WA 1OHQA 5GS3A 3QISA 1JNLL 3Q6FA 4QRPA 4LKXA 2RHEA 4BFIB 5KG9B 4IRSC 2ICWI 1CG9B 3VH8A 4PYHA 3T0EA 3PHQB 4DN3H 2HFEA 2VE6B 4DCQA 5B3JF 5EUOA 2F5BL 5F7FA 3QT2A 1XR9A 1TJIL 5EZLA 3B8YA 4OFYA 2OR7A 3VMPA 2I9TB 7FABL 5I1CH 1JNNH 4PJXF 5ALBH 4X7SH 2OZ4A 1MREH 2ICWB 4C4KT 1A8JH 5JHLL 3I6KB 3KS0J 5F1IA 1CFQB 5AZ2L 3MV7D 1VCAA 3TWCL 1A1OB 5JUEL 1KPVA 1IGYA 1AQKH 3GI9H 4DGVH 1XGPB 1TVDA 2XWJA 1FO0L 1MCRA 4NKOA 1FG2B 3UPRB 4RAUB 4K8RH 1BJ1J 1F2XK 3C60A 2NY3C 3RTQC 2QTEA 1Q9WB 4HDIB 4FABL 5J4MA 2DQIH 4OLUH 1ZA6B 1OGAD 3LN9A 1QRKA 2J4WL 4J1UB 3NACH 5EZLB 5DJ8A 3ZKMD 3S36H 1MCQA 5KJRL 1FL5B 3DYPA 1T04A 5KG9A 1T1WB 3FOLB 4KDTC 4QRPB 4WFEE 4OD1H 5C1MB 5D7LB 5T1MA 4BQBA 4JFPB 4PLNC 3JV0A 5FK9B 4RAHA 3DSNA 3O9WD 1BECA 1I75A 3ARDB 3RVTD 5IJKC 5GJTL 1NCNA 3CFCH 3FZUD 5HPOA 1R5WA 3D3VD 4FFEX 4IDLA 3NCBB 4PJEA 4ZSOB 1JWSB 1BFVL 2ADGA 4XPFH 5MI0C 5CKAA 1U41A 3UYOD 2H6PB 3MGTB 5JHDA 3D3VE 3MV7A 2BRRL 4K7PY 1D6EB 2P5EB 3HZVA 3P9MB 2VDOL 4I4WB 4JO3L 4PJDE 2P5EE 2BVEA 3B3IA 2ICWJ 4P2OB 2CD0A 4POUB 1ZHBB 2IQ9L 4Q2ZB 1BVLB 1TCRB 3LQAH 1XGUA 1ORSA 2XI9A 4IOIA 1DQLL 5GS0H 1BD2D 4WWKA 5EZJA 1C5CH 3WFHB 1KN4H 5B8CB 5BRZA 3FT4B 4NZRH 4UT9L 3P4LA 2C4XA 3QDJB 2YMXL 1PSKH 4LOUC 2PR4H 5DRZA 1RIUL 1GJIA 4K9EH 3QNXA 1N59A 2VLLB 3EJZC 4N5EA 2WWMC 5FV1L 1FC2D 1T04B 3BVNA 2XRAH 4HK0A 4P9ML 3GK8L 3LDBC 3SGEH 3VGBA 5K59E 3V79C 1S9VB 2CQVA 4J3VA 2ESVD 4LDLB 3F65A 4WIQA 5DJ0A 5J56B 4YDJA 3G5VB 2VAAB 4X8JB 5KS9E 2VABA 3MSPA 2MKLC 5L2JB 1DVFC 1WC7A 1A7OL 3IVKA 1FG9C 2R0LL 1OOAA 3FOMA 1CXFA 5ISZA 1OAUH 3ARUA 3DX8B 4PRNA 1UJ3C 3S88H 3PQYD 3VFTB 2X05A 4TUOA 1NEUA 1G7MB 5EOQH 4TULH 3T65B 2GK0A 3IFLL 3MRNB 4Y5YA 5IVNA 4KU1A 4XH2A 4KFZC 2E9JA 3O8XD 1JGUH 4F57L 1KV3A 1NKOA 4Z5RA 3RI5K 4NHUE 1QBLH 1REIA 3STBA 5SX4H 5DJXA 4QYOB 3QP3A 4X9IA 2NXYB 3MRBA 2DI7A 4QF1B 5C0GB 4P3CL 1V7MH 4KHXL 2NZ9D 3GMQA 5I1LB 5L8KB 4C56D 3WNPA 5AWNH 2M1KA 3LIZH 3SJVD 1E4WL 1WFOA 4R26L 1N2RA 3ESVF 2ZNXA 4P3DB 5IBLC 4MQXD 4Y2DD 4LVEA 5BOZG 3TO4A 1LO4L 1FNEA 2ZUYA 3LRSA 3E2HC 4JRXA 5CLTA 1JHLL 4OSUH 5KBNC 5DK2B 12E8H 2QQLH 1CT8B 5K9KA 3TH2T 4BELD 4F2MA 1EBAA 3SOBL 3NPSB 3TYFB 5TFSH 1I8IB 3MNWB 3RUGB 3VH8G 5J9PB 1YQ2A 3NIGF 1JPGA 3TO4D 3MGAA 4N0UB 3PNWA 3OX8A 4PLJC 3FCTA 2ZOLA 4WVRA 3G5ZA 5F6IC 4DQOL 4CMHB 4Z8FL 2F53D 5MEOA 2MCPL 5F88A 1EO5A 4LU5L 4PJDF 5BVPH 3RTQA 3BPLB 3EOBB 1DBMH 5KVMC 4XVTH 3RWGA 1AXSA 1G7QB 3HLAA 4JAMA 4DAGL 1HEZA 4H8WL 3O4OB 4P99A 4P23B 3TC9A 4AY0A 2ORBL 4Z7VA 3OKMA 5FO8B 1KJVA 4BH8B 3RWEA 4G7YH 4JREC 1H15B 1U8QA 5B21A 4HBCL 2VLJE 5KZCD 3JV6B 4QO1A 1H5BC 1HNGA 3JWOC 4XXCA 5E2JA 1K8IB 1YN7B 4GO6B 2C3VA 1IGIL 2UZYB 4IOSD 2FD6L 1FVEB 1JZ2A 2R69L 5EA0H 4U3CA 5T5FL 1JMXA 4JE4B 5B4MD 1E27B 2H8PB 1UZ8A 2PYEE 4R9HA 1N7MH 5TGBA 1P84J 5DXWA 4OV5A 4MSWB 4WUUB 3HE6D 3WL9B 2Q87A 1UB6A 5EWIH 3LOWA 2BY2A 4CL7A 1W0YT 2DLTA 4HGKC 2Q3AA 4OF0A 4Y5YC 5F93C 3DRQA 3GMOA 3KWWB 3DX9B 5GRJH 1CD0A 1N5AA 4K71B 3HNVL 2KZWA 3IF1A 4CVZB 4M7KH 5DRNB 3L3OA 1EAJA 3JXAA 3KXFB 3MRHA 2F53B 4X83A 2VERN 3QFDB 3R0NA 5BJTB 3EYVA 3DXAB 3RA7L 1UB5A 4L4TE 3KPQA 1G7PA 5GGQL 4G6AC 5T1KD 1AGBA 5FECA 4N5EC 2ADIB 1N5YH 2BDNL 5IV2A 5IJVB 1NUFA 2J8UF 2ZCLH 2HG5A 3V7MA 2ZCHL 4GLRI 4ZUUA 4Z7UF 4KTYA 3K4AA 4FQXC 4EIGB 4IRSD 4LASL 3NZHH 1T1ZB 4NQEE 3IDNA 1UWGL 2WNGA 3H0TA 4P2RB 3MLZL 2LAAA 4CGTA 1N0XL 4X99B 4AM0A 5EO9A 3ARDC 4JVUA 5HHXL 3OR6A 5CZXD 1TTGA 4FXGA 3X3FH 1XF3A 3VXQA 1NDMA 2PNDA 1HHGB 4P2RD 5SV3A 1S7RA 2FHCA 4JFXA 3TYGH 4KQ4L 3S37H 2VC2L 5EZIL 5I73C 2DWDB 2XQBH 4XNMB 5HY9B 2HJFB 4NGHH 3CX5J 3V52H 5GZOD 1ZTXH 5FM8A 3OGOE 1QG3A 1FYTD 3BDYH 3WFZA 4OLZH 5F3BA 2O5YH 4H1LH 4UIKL 4KROC 5IFHL 1KB5H 2I9LA 3INUL 4LCWD 4ZQKB 4EOWH 3S5LB 4PRAB 3UROR 3ARGB 4LSUL 1FAIH 2PO6D 2EXYC 4YPGB 4QRQB 3VXSD 5GXBB 3ZKQD 3QWRD 4HT1H 4MLIA 3BI9X 2F54B 2ADFL 4NO3B 2A77L 4NJ9L 4R8WL 4JM2D 4RGOH 1NCDL 4HUXB 1BGXL 4FXKB 3QI9D 1G7LA 3RWFB 4W4NA 3RU8H 1S8DA 3GKWL 1XCQB 3NIFF 4NN6C 4YHPA 5E99H 4D8PA 1G7PB 4Z7NF 1WISA 4E42A 2OTWA 1CLZH 1MLCA 2VDQL 4O4YH 4HCRL 1K85A 2R29L 4D0CB 3T2PA 3HZYB 3V4UL 3CXHK 5CKGA 3JWDL 4UQ3A 4L4TA 2G2RB 3TNMA 2WK2A 3P4OB 1CGVA 3Q5YA 5K93A 1RJYB 5T1LD 5HYQA 2CKNA 3FN3A 4Z78A 3GZKA 2CK2A 3ARED 2OLDA 1GZQB 3AMLA 1JWMA 1OCWH 1CFVH 1LO3L 4BYHA 4N8VG 2F5AH 3E1F1 2V7HB 3NPZB 1CGTA 1U8QB 3U6RB 2BFVL 2ED8A 4IS6A 2BX5A 4RNRA 4HFWB 4OM0L 5C8JA 1RU9L 5CP7A 4ORGA 2HRPH 2PETA 1ZE3C 5LGHL 4OZ4A 3NFNA 4LOUD 4M6NH 3QCVL 5DZNA 5JHLH 2X4UB 3S3SA 4PRBB 4GXUM 3X12B 4PJIB 3HMXL 1JZ4A 1NLBL 4GKSA 1BAFH 2W0PA 2NYYC 5EBMA 4YAQA 4WV1B 5HDQL 4OM1H 3BP4A 3IFOB 5IF0A 5L2KE 43C9A 3RWEB 1CVRA 3QQ3B 1RI8A 4QHLB 1MJ7L 5DJAA 4NQDB 4FHBD 1KGCE 2I5YL 5E5UB 1Y0LA 5DA0B 1HIML 1DBKH 3ECBB 3KXFE 5CZKA 3MLVH 2P5WE 4K94C 4J23A 3D25A 5KJRH 3E2HB 3TIEB 3LRSB 4DZ8B 3L3DA 5C7XL 1S9YA 4QOKD 1NGQL 3BZ4B 3ULVD 5CILH 1G9ML 3BO8A 3QUZB 1N4XH 2IALB 1SEQL 2NY2B 5D9SB 1VGKB 1ZHLB 2FL5B 4FQHB 5GJTH 4TSCH 2EIZB 1L7TL 3V5KA 5CEZH 1NEZG 2YSSA 3IGAB 1JHKH 2GYSA 1WV7T 5EFIA 3K2MC 2VAJA 3HNSL 4OV6F 3EYUL 2PTTA 2ZG2A 3W0WB 4D9RE 5F6IB 4U1GC 2Y6SC 4KJWC 5CJXC 2X4NB 4HIEB 1TXKA 4AIOA 5A2KH 2EIZA 3MX0A 2FATL 1WWAX 4JY4B 5HGBB 1LEIB 2CMRL 3H3PL 3WIHL 3EGSB 5DWUH 2BNQD 1B4RA 3BEWA 5A2LH 2E7LA 2EC8A 4WJ5A 1ORQA 4QWWD 5I19L 3ZT7A 1RUKL 3U4AA 2DOCA 3DTXB 4GG6E 1MCWW 1AGEB 1DQLH 3SKUD 1A0QL 5E6IB 5GGVY 4WW2A 3VFGL 2PTVA 1XF2B 2NPLX 2NY5H 3BP7A 3HKFA 3F7VA 1P7QD 4P23C 2JIXA 4H1LB 4NT6B 3OMZA 2D7OA 4NKDA 1NH6A 2D31B 1T5WA 4XI5C 4O2CA 5MEPB 1YEGL 2YZ8A 5FGCE 43C9B 2GHWB 4G6JH 5KVGH 2Z31B 1K5NA 2BJML 1UA6H 3TPKA 1AJ7H 3TO4C 1OP5K 4D0BA 1KJ2A 1YA5A 1GIGH 3S3PA 2PW1A 3U4BL 4P9MH 1ZT4B 1EUTA 3QHFH 3T77A 4M6ML 1CK0L 1OF2A 4NN5B 4JB9L 4PRBA 5DVLA 4TVPD 1GGIH 4NKMA 5CBAB 5DRZB 3BSZL 1RJYA 4DGYH 1I9EA 3MBED 3LB6D 4YEFA 3ULSA 4ESKA 1WEJH 4MA8L 5LKNA 5L7XH 4AL8H 2CLRB 1NFDF 5JPMB 4X4XB 3GSNA 4E42B 2BVPB 5JZ7C 5C0JB 5EOQL 2YUWA 2HLFD 2D4DA 4BQ8A 4Y4KD 2EDKA 3LEYL 3HS0B 3CVHH 3MRFA 4LCWB 3ULUE 4MAYA 4WGVB 2D7PA 5EIVA 2X44D 3ALXA 4XC1L 5A3ID 1A1NA 4L8BB 3BJLA 1FAKT 5FHAL 3S35X 2HWZH 1R5WB 4CDHA 1AGFA 2NTFA 4Y2DB 3T3PE 4J3XA 1RZFL 4KK9C 4P3CH 5I1GH 2CXGA 2LAGB 3PWLB 5F7DA 3BDBA 1PG7X 5CCKL 3HE7D 2YHGA 5LXGL 3TO2B 4JGJA 1FIEA 4LNVA 1T1WA 3FOLA 3CDGB 1GL4B 2UZIH 4ZS6C 1QNZL 5F1KC 4LQFH 4KJYA 2JK5A 4OSUL 3HR6A 2KZ1B 3GM0A 3G08A 4YDKH 1DEEB 3HMWH 2XZQL 2PYEB 2GJZB 1IRAY 4YNYB 5I8EB 1KCSH 3SO3C 1NEZA 4M6OH 5DD5L 4LBEB 4ISVB 4QRSA 2YBRA 3O3BA 5MEQB 4P49A 4XPHL 3ARQA 1BVZA 4PJAB 1D9KB 3O6FD 5DUML 2HJFA 1JPFA 1IKNC 2M8XA 1FE8H 3L3KB 1A14L 2DI8A 1R0AH 3MUJA 1D5BA 4HF5L 5D7LD 1AKJA 1LP9B 4TUJA 1OTUC 4ZYKA 3T2NL 3HE7B 1UT9A 1OAQH 1M6OA 4XP5L 3BZEB 3HC3L 1A7RH 5IVXE 4G7YL 4AMKL 5FYJL 5LGJB 4HK3J 4BFBD 3NN8B 5JO5A 1QTYT 4Y1AD 5B38A 3I50H 4NM4L 4NNXB 3PWPA 3SCMC 1IEHA 5FYKL 4L8SA 1BQHB 4PB0H 3BKYL 4ZO8A 4NRXA 1QSEA 2R69H 5CMAA 2FR4B 4U1NA 1MH5A 3H9SD 4NFCA 1G6RH 1TZGL 2NXZC 1IQDB 3Q3GB 2IANB 2Y1VA 1BQHG 2DD8H 5T1LA 4MA1C 2DQTH 1MCIA 1T20B 3TBWB 4NNYB 1QQDA 4KK8C 4PP8C 4ODXB 2OCFD 4AENA 1WIOA 2GITA 3Q6FB 1MHCB 1FZMA 3NA9L 5TH2B 1G7JB 4KPHH 5IKCB 4R3SB 3LHPH 1QEWB 2NLJB 1I8KA 4XCEB 1M1SA 3OKNA 4U1GB 3QUYC 4M7KL 1A6AA 4QRUA 2C3XA 2FWOA 3P11H 1KLUB 2BNRA 1MFBH 5ID0B 1VKXB 2A0LD 5EO1B 4ZPVB 1CLCA 1EIBA 2BDNH 5HHOD 1B9ZA 4NBZB 1HHKA 2ZCLL 1T21B 1NBYA 1BFOB 4J7RA 3MCLL 2XOTA 3DVGA 4L4VB 4IOFD 2EDYA 3W9EA 2FB4H 2IH1A 3QPQD 4X5XA 2XXCB 5I6XC 3BH8A 1QR1A 1A6TA 3VXMA 2YA1A 3SCMA 2VQ1B 3T09A 3MNWA 1N0XH 15C8L 4PTUB 2AXFA 3ARPA 3X14A 1DQTA 1IC4H 2NY7H 3PWVA 6CGTA 3TYFA 1MI5A 4WRLA 2D3VA 3TA3D 2HT2C 1Q0XH 3STZA 3C5JA 3ILPA 3UDWC 4KQ4H 1LEKA 3S37L 2E6QA 3RWIB 3MODH 4JKMA 4PTTA 2XWTA 1INEL 1FNEB 2ZOLB 3V52L 3VGHA 5C07B 1OP9A 4J8RA 2WUCL 4X9FA 2BOCA 4HXBH 5IEHB 2QV2A 1NL0H 1U0QA 4JO2H 5ICYB 3FB8B 1U58B 5AAWA 1BQLL 5DUBA 3QEGL 5AYQA 4FMKA 3C5SB 1FSKB 3DROB 3D39D 4LSQH 2OL3A 2JCCB 1K6QL 3GJEB 3N9GH 2GT9B 3QXAA 1Q1JL 3WD5L 5K9JL 3QIWB 4Z7UA 4XBGA 4PJ8A 1GAFL 3HZMB 5DMGC 2AQ2A 3GMQB 5I1LA 5HHPA 3VFTA 5FGRA 1S7XA 5J13B 3MPCA 2HT4C 4NFBA 1M7DA 2ATPB 4P5TD 1OARH 1T2XA 4FQIH 2OTPA 2ATKB 2W9EH 3GSOB 3IDJA 3TVMD 3OKOB 5F1NA 2L7UA 2X1XR 5T33H 3K8MA 3LPWA 4HKXB 1LHZA 5TE6L 3SO3B 4CW1B 2EKSA 2HH0L 3CC5B 3BQUA 1EV2E 4JG0L 1MAMH 3MV9A 4M48L 3VXRB 4E0RB 5F7EL 1A22B 5T3ZL 1OAZH 3SQOH 3P73B 3BHBA 5I8CB 3VXNB 4LSTL 1MF2L 4P57B 5C07A 4OF8A 4U3XA 4LMQI 2UWEF 3GB7A 2YD6A 1OCWL 1BQSA 1QFWL 3NFSL 4M03A 3FL7A 3U9PH 2R8SH 2UYLA 1NEZB 5HHMD 3WKNA 5K9OA 3D39E 4M6NL 3WLWC 2ZUQB 1A6TB 3K74B 4JY5H 4HH9A 4YEEA 4M5YH 5IESH 2XY2A 3HMXH 2DTMH 2QLVB 3GSNL 1UWEH 1ZANH 4FQXA 4HJ0D 1BLNB 5DMKA 1IM3B 3M45A 4DOHE 5HDQH 4DUXA 3CFJB 1IKNA 3PABA 1FO0A 2H32H 4JRWA 2GSGA 2X6MA 5KSAD 1D6VH 1RVFH 1F02I 4K07A 5C0CA 5HYFA 5CD3B 4RBPK 3RZCC 1WZ1H 4DN4L 3D0LA 2J88L 3EFFA 3PV6B 4ZTPL 2NW2B 4XGZA 5GHWL 3SDXF 4IMKA 3BH9A 4PY8J 1MCWM 4D9LL 1AO7A 1K9TA 5LQBL 1BZ9A 2VLME 3DETD 5DYOB 3NABH 4J12A 5C7XH 4RFEA 4KI5F 3QDMB 2AJSL 3K1KC 3RL1B 4WEBH 1G9MH 1QACA 5DF0A 1G7JA 1A1MB 1S7TB 5E03A 2J8UE 1KIQB 4IIQA 3QIBB 4XNUH 4FFZH 5CP3H 3QDME 2VO5A 4R4NC 1RZ7L 3K4DA 2C26A 3KYOB 1IM3A 1TVHB 4ZFOB 4LLVB 4ZSOA 2GCYB 4JFOB 1PZ5B 3EYUH 2VZOA 3OXRA 3LSOB 1LNUA 5IT2H 3I3BA 2GSIA 3WFDH 2D0FA 1YYML 2EH7H 5DVMA 1IC7H 3D0VA 3QPXH 3WIHH 4ERSL 4U2ZA 4XVUD 3KDMA 3C60B 3O81A 4RDQF 3BYYA 4JZJA 3KPSB 2NY0C 4G3YL 3MTRA 2DTSA 4GSDL 1FGNL 1B88A 4ZFZB 3WNKA 3EUUA 1JYXA 3WJLA 5FA4B 5C0FB 4A6YH 5KSVB 2E3VA 3HUJA 1YYLH 3U7WL 3VFGH 1N64L 4TNVF 2Z31A 2NY5L 5D1QD 5GZND 3RIAF 3H7BA 2NNAB 1A9EB 2ENSA 4OGZA 3TEUA 3MV8B 2CLZB 1PG7W 3PP3K 3MACL 4ODVH 1D5BB 3CC5A 2BHUA 4RGND 3ARBA 3VXSB 3ZYOA 4OKDA 5FA4A 5C0FA 4S1DC 1RK0A 3BGFB 3TBSA 3MUZ1 4NQDD 3ERYA 1V3LA 4YLQT 2FX7H 1D9KA 1GIGL 3ZHDA 1AXTL 2H2PD 1PEWA 1G6VK 3P0VH 4JZJB 4QRSB 5H8DA 5D96B 3I6GB 5F1IB 1RZKH 1W0WB 3QDMD 4M1DH 3MLTB 2NQCA 4MQTB 4DGYL 1XF1A 2NY4D 3T3MF 1ZHNA 1M71B 3FB6B 3V6OC 2ZUTA 3MRCA 3Q1SL 5GS1C 1AO7E 4H88L 4UU9B 1J9CT 2E7BA 1OSPL 5JPNA 1FNSH 1FVCA 4YZFE 5MERB 2VXTH 3BRFA 1D5IH 3DGGB 5HXMA 2NR6C 3DI2B 4LLMA 2G75A 3EKCA 1LO2H 4HGWB 4Z76A 3QQ4B 1EHLH 4FQHA 1C16B 3RY6A 4ZFGL 3UYPA 4EDWL 1VGEH 2Z91A 4XNXL 4KK6C 4RBPH 3GSWA 2ZSVA 1AGFB 2NTFB 4Y2DA 5TDPB 3L3DB 4Y89A 3CVIL 4JFDB 2MKWA 2A6KA 2BSTA 1T22B 2A9ML 3E3QC 4GG6A 1CQKA 4H26A 5JA8B 5DJCA 3RX8A 5DHYB 4MAYB 1MWAA 3TJHC 1MEXL 2C1OA 3A6OA 4UDUB 5I8OH 5SWSB 3ARWA 3TN0B 2X4QA 5E08L 5DMIH 2AXHA 1MREL 4NQDE 3MRIB 1VFAA 2Z4QA 4M62H 4ZO6A 4EXKA 5L2KB 2A83A 2ID5A 4PJHF 3U4EB 1F90H 5JUEH 2UZIL 1F3DJ 4LQFL 2D4FA 2DMKA 5GSRB 3V8CA 1CXIA 4Y16D 3RKPA 3LQZA 2EEBA 4K8RL 5BQ7B 4OD2B 3F7QA 4HLZH 2VL5B 4EI5A 1RIHL 1CD1A 4BQ6A 3O4LA 3PQYB 5FOBA 1T0NB 5D5MB 4P9HL 1T0MA 4FQPA 4LSSL 3N1QC 1KUMA 3D18B 2YPLA 3FHAA 4YXHL 2BRQA 3DSFH 4KKBD 4BKLB 5DUMH 2V7HA 3UZVB 3O3EB 4F7TB 1B90A 2D0GA 5F7NC 4XP9H 3GHBL 1R0AL 1LO5A 3FO1A 3B2VH 3IJSB 5FEBA 1YEKH 4LHQB 3L6FA 4M7LT 4XNQA 4XNZB 1A7RL 1E4XH 3P4OA 4BSWA 1A02N 5C09E 5IB2A 1D9KD 3O6FB 4Z6AT 4U1KB 4YIQA 3RNQA 3MNVB 4WI2A 5BZWA 5T1LB 2Y4SA 3MOBH 4R2GD 4WENB 2X40A 5EO0B 3RWJA 5D72L 3BKYH 2YD1A 3FQWA 4JO3H 1TTUA 4XVSH 4OFKA 3RKDC 5JXEA 3SDCA 4GRLC 4DGIH 4DKFL 4X7DC 4MDIA 5EU6A 1JF1B 4L5FL 3LQAL 2OL3B 3H6JA 2FRGP 4A2MA 3UEZA 1KCVL 1IZJA 3RPIA 2BSTB 4YDVB 4BZ1H 4L9LB 4JPKH 1QBBA 1NUNB 1KN4L 4YX2L 4X6FA 5GRUH 3MLXH 4HUUB 1CE6B 3ARGC 4KPHL 1SVZA 2PR4L 35C8L 4G8GE 1OTSD 1J1PL 1U92A 4K7FA 4Q6IC 5E2WL 4FQQB 3RFZC 2MSPA 5J1SC 5DD6B 4PJ5B 3UMTA 2BSRA 3TIEA 3W11C 4Y1AB 4N9GA 3QFJA 4HPOH 4UIMA 1P5UA 3GK8H 1J8KA 1ZSDB 1N8ZB 2B0SH 4H1LG 1T0PB 4OLXH 3W82A 1TZHB 3HG1E 1NDMB 4X5WA 5FKPB 1HI6A 4M61B 4DZBB 2GQHA 5HD8D 4QHLA 3DGCR 1PDKA 4P46D 5EO9B 4ODHL 3HG1D 4NO2B 4WO4C 2HFGL 2A73B 4G6FD 3MCLH 3H9SB 5BZDB 3KPNB 1LE9B 4HW6A 4LK4A 3TVMA 2WINB 3V8OA 1U6AH 4EUPH 2APWA 1R3HA 1PYWA 4OZHE 3FO0L 4P59H 1U8PB 15C8H 2DBLH 2ED7A 3SGJC 4PJHE 4NC1C 2ZZUT 2W38A 2YC1A 3PWUB 3LN4A 3PWLA 3S6CA 3BFOA 2EC9U 4UINL 3KPRE 3A0OA 2NXYC 2UVFA 5ESAB 3C6SA 4Q58C 4XT1C 4LHUD 3GI8H 2F53E 4NRYA 4LLYA 5F70A 4WUKL 4NP4H 3GJFH 3P0YL 4QRPD 3P9WB 2OSLA 5L9DH 2HLAB 3UBXI 1K2DB 3DVFA 3UBXA 1F4HA 5FV2A 3ARBC 3QO0A 5FUCE 1MAKA 5E8PA 5AZEL 4OCSL 5CEZE 4F8TA 1NQBA 4OTXL 1XCTA 2X5PA 4L1DA 3WBDA 1EEQA 2AJXL 2GCYA 2OMBA 3GHEL 4JFOA 3WS3A 3KJ4B 1OB1B 4XPTL 3UBXG 2XZZA 2QADD 3DETC 3JWOL 2W9DL 2BCKA 2CRIA 5C08B 2X4PB 3EOAA 3OAZH 1CI5A 1MQKH 1INDH 1TNMA 3BWAB 4MJIB 1KELH 1DQDH 4XWOD 4YBQD 2E7HA 2VXVL 3GIZL 3LZFL 4S1QL 4YBHA 3T0EC 4UT7H 4QHUA 2WAHA 5FYJU 1BZ9B 5L0QC 4DQOH 4Z8FH 3D85B 2MCPH 3SKNB 2WQ8A 5LCVH 3TT1H 1B0WA 1OSZB 5KAQG 1K4DA 5DRXA 5L8JB 4G7VL 1K5NB 2QHLA 1SEBB 5E5MB 3UTTD 5T5NG 5F6HI 2I9LB 1UKQA 4DZBA 2R1YB 4GKNA 4NNPL 4J2XA 1GC1C 1I3GH 2H41A 5FKAB 4FG6D 4ODWA 5JR1H 3CH1B 3SKOA 1S78C 1WSST 1HSAA 2EYSA 4PJ5A 1QFWH 3MJ6A 3TBVB 3VXUA 3NFSH 2X4OB 4PJ7F 1ORQB 3F7RA 4XAWH 1JTPA 5ADPH 2R2CA 5FGCB 3B9EA 2Q20A 5EA0L 4NC1E 5CGTA 3IU3B 1IGTB 2UY6A 5KVDL 4JVWA 3IDNB 4HS8L 1M05B 4K94H 5DJ2B 1G1YA 4N9OB 2PTTB 1PKQB 1RIVL 4JRYA 5EC2B 3K46A 2V9RA 3TA3A 3R0MA 3VW3H 3BHBB 2FL5A 1SYSB 32C2A 4QHNB 1VHPA 2V5MA 1DBJL 5D6DC 5HJ3A 3ABZA 1EJOL 2GY5A 3ULUH 3QUXD 5C3TA 2J88H 3KXFA 4OT1L 2CUMA 3RGVD 1I1CA 2AI0L 4GT7A 4Z7QF 3L7EB 5D7JD 1JTTA 3QIBD 3DUSA 4NHUB 5ESQB 4FZ8H 3SDYL 1JHTB 4F8QA 3MRNA 4HWZA 1HXMA 1YY8A 4QCIB 3ZSTA 2DQHL 2OXGA 4EI5D 3VDCA 4NUGH 1NC2D 4FFZL 8CGTA 5EU6D 4GLRH 4CVXA 2F74B 2QSCL 4DVRH 2P8MA 1MCBA 1LE5B 1T2QH 3SE4C 3O11A 1T89C 3SE4A 5AAMA 1NBVH 5T1KA 4O51B 3WFDL 2A6JB 5DUBB 3QWQB 3MLZH 3T2QA 4KTDL 5KSBF 4NQCB 3OXSB 5GRYA 1U42A 3X3FL 1MLBA 3WXWH 4HJJH 1WFNA 2EIEA 2YPLE 3L3HB 2PXYD 3AFLA 1NGZB 4MXVF 1HHHA 4ZOAA 3CX2A 1DQML 1LO5B 4RWYL 4OZFB 1GVIA 2VC2H 3QEHB 2I25N 4C54A 3AY4C 4F7TA 3LCYA 1P4BL 2F74A 4K23L 4M7JH 3W5NA 4ETYA 4Z78B 4QCIA 5E9DE 1W72H 1KB5L 5C6TH 2BNUB 1EA9C 1EMTH 1JV5B 3INUH 4PY7B 1JGVH 3CSBA 4EOWL 1CD1B 1OT1A 4G6ML 5D2LE 1EK3A 1NBZB 5IP4A 5ESQA 1YY9C 2VQ1A 1KJ3H 3WFHA 5B8CA 3MMEB 3KNBB 3T4AA 4HEME 3FQUB 3OX8B 1FYTE 1NCDH 3OB0H 3P0VL 1GHFH 2HN7A 2EXWC 1BFOA 3KVQA 3QJHB 3BGAA 1HHKB 4FS0A 2Y07L 4Z7VF 3RX5A 1SYSA 32C2B 1YEDB 2NX5A 4I4WA 1HWHB 5HVHC 4UNVA 2AEQH 3AAZB 5JW5B 3PL6D 1CLZL 2VDQH 3ARFA 2BVUA 3IGAA 4X80L 1T22A 4UTBH 5CINH 1EZVY 1RZIB 3V4UH 4W6WB 3CVHB 3CXDL 3GSWB 3IU4L 4KKLC 1RPQA 1TFHA 1WCBB 4NZDA 2ITDB 4JQIL 2DQCH 3U0PA 5C0IB 4HKZA 4WEUD 4KXZI 1HSAB 3G6DH 3C5ZC 3JTSA 4XZUB 1U36A 3NIFE 2FX9H 2BFVH 3GGWA 4YHLH 1WBXA 4XH2B 4Q9QH 3BKJH 4HC1A 4J1UA 1RMFH 4KMTL 3I2CL 2C9AA 4OZIB 3JTTA 1ZA6A 4RQQB 1QRND 1D7FA 2BHYA 2Y5TA 2IPTH 1XIWD 1RK1B 3C08H 1OTSC 5I1HH 1KIPB 3ZDXE 2QHRH 5IW6A 4RX4D 2XWJB 3RJQB 2W92A 2PN5A 1BAFL 2AGJL 1FNGB 5B38B 2QSTA 3EO1A 2IAMD 4OZHA 5LAXA 3OAUL 3TJHA 3L5IA 4KK5D 5DK3A 1F4YH 1J0YA 5EOTA 1DUZA 3EZ8A 4KKAD 4KUZH 3V4PH 2I26N 3H7BB 2EEDA 3I02A 4H25B 4P9HH 4M1GH 4FQ1L 1DL7L 4IS6B 3O3DB 1NCCH 3O2DA 1XCTB 1OAYH 4LKXB 1N5AB 1FLTX 1FFOB 1YQVL 5C71A 3DX7B 4BA8A 5HHNA 5IMKB 4HKBA 1K2DA 3UBXB 2HFTA 1N4XL 2HLAA 1SEQH 2XTJE 3HAEA 5EU7E 4C83A 2BSSB 1XGQA 4TSCL 4LCIL 5C0ND 4C55A 5IVXA 3LVEA 1XF5B 2YZ1A 4TQEH 3RGVB 4LVHB 3SDDA 2FIKA 1NCWH 2JK5B 4OIIH 2FEDC 1OGTB 3VWKD 1F00I 1R6VA 1X5GA 4KJQC 5EU3A 2R4RL 4LKCA 4HUNB 4TOYH 2ARJA 4XVSL 2CDEB 5IK3B 4DFHA 4DGIL 4MA7L 4K3HA 4FN0A 4PLOB 3RL1A 3KLDA 1HXYB 3U30B 3B9AA 4GAGH 4PR5A 4HPYL 2X1QA 5BMFL 1JPSH 4FQXB 1MJJB 1YC8A 5GGSA 1AGDA 1OLZA 1TQCB 4BZ1L 1VEOA 1XF5A 3QXDA 2IBZX 4MWFB 1F97A 1AHWC 3EFFB 4PGBB 1FRGL 2Z8RA 1LK2B 3C2SA 1LP9F 2YRLA 1YUHA 4U1HB 4C83B 5FK9A 3TF7C 5K9QG 5ILTH 1A5FL 1T83A 1FFOA 5DVOA 4WDIB 2P44B 1N8ZA 5I1KL 3PABB 5F89A 3VI3F 3BE1L 3KYNB 5I16B 3PGDB 3CZFA 4LHUA 3M8OL 5MENE 4HPOL 1CE1L 3O3DA 4FQCL 1IKFH 5FXCH 4YK4C 2YUZA 3NTCH 4Z95H 4YQXL 3BSZH 5KS9A 1PVHA 1R24B 2DLEA 3BP6B 4OAWA 1VB9A 5D7JB 2WSKA 3IDXH 2VH5L 1P84K 5FDYA 5D1ZB 4XPGH 1UKSA 2N1KA 4JLRB 2XG5A 2ZNWA 2PW1B 1A3RH 3GB7B 2VIRB 4CU8A 5F8QC 5HHVH 2XWBA 3EW3B 3WN5C 2FO4B 3BJ91 2QQQA 4P57A 4YDLB