3RWFA

Rhesus macaque mhc class i molecule mamu-b*17-qw9
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
276
structure length
276
Chain Sequence
GSHSMKYFYTSVSRPGRGEPRFISVGYVDDTQFVRFDSDAESPREEPRAPWVEQEGPEYWEEATRRAKEAAQTHRENLRTALRYYNQSEAGSHTIQKMYGCDLGPDGRLLRGYHQSAYDGKDYIALNGDLRSWTAADMAAQNTQRKWEGNRYAERFRAYLEGECLEWLRRYLENGKETLQRADPPKTHVTHHPVSDHEATLRCWALGFYPAEITLTWQRDGEEQTQDTEFVETRPGGDGTFQKWGAVVVPSGEEQRYTCHVQHEGLPEPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Major histocompatibility complex class I
publication title Structural basis of diverse peptide accommodation by the rhesus macaque MHC class I molecule Mamu-B*17: insights into immune protection from simian immunodeficiency virus
pubmed doi rcsb
source organism Macaca mulatta
total genus 71
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2011-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3rwfA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3rwfA01
5DLML 1F2QA 3PV6A 4KC3B 1FO0H 1UB6B 2XZQH 3BRDA 1WBZA 3KPLB 1UZ6F 2Y5TB 1QBLH 2DWEA 5HHNA 1YMMA 4L8DA 1BAFL 1U2CA 1UB5A 1JHLH 1AO7E 4Y4HA 4Z18A 1T04B 1XF1A 4X8XA 3MCKA 1P84K 1EXUA 3GRWH 4CMMA 2LAGB 2VLKD 2VQ1B 5M7QA 2DM4A 5F7DB 4MQ7A 5L0QC 1ZVSA 2BJML 2NY2B 4PUBL 2F19H 3VWJA 5KS9B 2AJSL 1F4YH 4NN5C 3KYOB 4L8CA 2WZPD 3ZE0E 3VH8A 5CEXB 3B2UD 3BXNB 1JWUA 1UADC 4OCSL 4RAUA 4POYA 4ZXBC 4K3GA 1HH9B 3DMMC 1AP2B 5CJ8A 3FO0H 1G84A 5F89B 4F33B 1MCQA 1WBYA 4X7DC 4M8QA 1OTTD 2KPNA 5JLZB 4YXKH 7CGTA 1QR1B 3HZKA 5I30H 3NABL 1VERA 1EUUA 2WBJB 1I75A 1Q9KA 1QFUL 4WO4A 3SKJH 1UVQB 1GSMA 3GHBH 3O6LL 1A7RL 3N9GL 4MJIA 3MBEB 2XFXA 4YH6A 5F7FA 4PJ5D 3IYLW 1OSPH 3ARGB 3Q6GH 1A47A 4BQ8A 3B83A 1VFBB 4ZTOH 4YR6A 1RZKL 2YHGA 4G7YH 1R5IB 1I1CA 2FIKA 3TN0B 5E0QA 1TVBB 3HG1D 1T89C 4JKLA 5EPMB 3VXMB 5EZOH 3D0VA 1YNKL 5HPMB 5K9JL 3O3EA 2ZUTA 4UINH 1AGEA 5CIPH 1CD0A 3CFBB 1KFAH 3MACL 3WIIL 2X89A 4X9HA 1ZA3A 3C2AL 1F45A 4JY6A 4FABL 3IT8D 3KPSD 2J1KA 5GRVL 3DI3B 5ICYA 3RI5K 1MAML 4Y5XC 5FYLH 4QXGL 2KDGA 5DUPH 4NSKB 5T3XL 1SYSB 1Z9LA 3CXDL 4ERSL 3V2AR 4OZIE 4HZLA 1AIFB 2JF1A 5AYQA 2PO6D 3WLWD 1NLBL 5FM8A 1N6QL 2XRAL 4K7FA 2MHAB 3MA9L 3QXTA 5D2NE 5KSVB 3SGEI 5HI5C 2CIIA 2EDHA 2WIMA 1ZEAL 2P1YA 3T4AB 1QKZH 3MRPA 4OGYL 1CXEA 1KN4H 5T5FL 4UQ2A 2IC2A 4UDTB 5EZIH 4HIHB 2GJ6A 4GBXB 1R5VA 3V6ZB 3RZCB 2BNUB 3T2NL 5CEYB 1NBZB 1QTYT 4KK6C 4AIXA 2W9DH 4F58H 1QSFD 5L2JA 4DOHE 4J3WA 4IMKC 4ZXBD 2Z4QB 3VMPA 5I0ZA 1K4CB 3FN9A 1C16B 2FBJH 2PTUA 4UILH 4NNYB 4X7EC 3UBXB 3IDNA 3MUGB 4XWOD 4AG4L 4JFPB 1ORQA 5DVOA 1Z0NA 1XIWB 5CGMA 2VXUL 1HXYA 1YEHL 1E4WH 2WBWB 4KUCD 4RGOL 1I8KB 5FO9B 1NKRA 4XP4L 1BQHG 1U8QB 3KLDA 2XZAL 4BK4A 3OAUL 4N90E 4RMQA 3KYMB 5JOPE 3B4NA 4Z7WA 1NUNB 2NZ9D 2J6EA 1P5UA 2PXYA 2GK0A 2OSLB 4NPYB 1I1FA 4PJ7F 4NC0B 5F3BA 1CT8A 3CVIL 3BPOB 4G6FB 5CHNA 5TQ2H 2VIRB 4HFWA 5IGXL 4K3HA 3EOBB 3MOBH 4GKNB 2OM5A 5IMMA 4S0UC 5C0RL 1FHGA 3IDGB 1LP9A 1SJEB 3MNWA 4MLIA 1AHWB 3BH8A 1WWWX 5F44A 1YC8A 3I85A 4WY7L 5D1QC 4OCXH 5JHLH 1DBML 4L8SA 2BHUA 3I75A 1FNLA 5LXGL 1C8PA 5E2TH 3ARYA 5D7IE 3W82A 3UTTD 1FDLH 2QSQA 3ULUE 1OGTA 3T0AA 3PWLA 5H2BA 1ZK9A 5FYKE 2X4NB 1HH6A 4HG4J 4WIQA 3QDMD 4B41A 4N5EC 2UUDH 4L29A 1KLGA 3HRZB 3S3SA 3I3BA 1NUFA 1B0GB 5HVFB 4M7ZB 3AS3A 4FXKA 2AXFA 3VE0A 3HZVB 5ABDE 5GS2D 5F7YC 3MJ8B 3ZL4L 1A7QH 4CJ0A 3ZTJG 5HI5D 5B8CB 1RZJH 2WUCH 1YZZA 4NFBA 1U91B 3A6OA 5JHDD 3PWPB 5HDBF 1C1EH 4XPGH 3K8KA 3RL1A 4OD1L 1JGEB 5ITBL 3GSOA 4A6YH 4HUXB 4OCWL 1LILA 4MD5A 2VXVH 1EV2E 5JXEA 3S5LB 2O26U 4KXZI 5K9KA 1UQSA 4JFZH 1C5DB 1NCBL 4IRJC 4ALAH 3DSFH 2EDXA 2OTPA 4KK6D 4PV9B 3Q0HA 4MB5A 5CD3A 3UDWC 2XIDA 4AT6A 4JFDD 1U93B 1QLEH 3QCUL 5EOTB 4JM4L 4LLYB 1YN6B 4Q58C 3DX8B 4XCNA 1TCMA 1ZLWK 3AFLA 4U2YA 4D9LH 5D7SH 4QHNA 4N9GB 2Y5TA 4PRNB 3OJMB 3SDAB 1N2RB 4XMPH 4XXCC 5CGYC 3VXQB 2COQA 2VISA 3TT1L 4Y5VC 4KI1A 5BVPH 2P5ED 4OM1L 1T04A 5JXAH 4AEEA 3MR9A 3UTOA 3FJTA 5JUEH 1NCTA 4MB3A 2XA8L 4KWUA 2VQ1A 2Q6WA 4GMTL 3DROA 3PWJB 1MHHA 3AAZB 4ZPVB 4U1GC 4NFDA 4HEME 5BOZG 2ZSVA 2OI9A 2ESVD 5D1XB 5KS9A 1MCBA 4FQJH 2CRZA 3OPZL 1I9JL 4JN2A 2DLIA 3BD5A 3IDYC 3QHZH 4RX4D 4P23B 5EU6A 3RVVC 5ERWA 4KKLC 4D9QD 5C0BD 5C1MB 3QH3A 4Y2DA 1EJ6A 2DYPB 4EI5C 4ZD3H 4AEHL 2GI7A 4PP1C 2FX9H 1QLRB 2XTLA 4UQ3B 2ITDB 4KRNA 1MCOL 1WZMA 4M48H 4KRMB 2Z8VC 3BEVA 3MV7D 5JLZA 5B39G 1QR1A 1U8NA 3BZFA 4WFFE 1L0QA 3V0VB 5F9DC 1OAUH 4LSPH 4C59B 3TNNB 2WBJA 4NN7B 3G6AB 3IKCA 3TH2T 4EDXB 2KQNA 4N5ED 1HWHB 2R56H 3HUJB 2KQMA 1G6RB 3ROOB 2D3VA 5MERB 3MBEA 4M61B 1FV1A 4Z8FL 3E8UH 2O5ZL 3OKNA 5JPMA 2YUXA 3P0YH 1EHLH 1OPGL 1IM9A 4FNLL 3RNKB 3VXNB 4ZSOB 5DVLA 1RU9H 1NEZA 1XZ0A 1MVFA 3S96A 1AXTH 3HE6B 4K23H 2VLKE 2YMXH 3TN0A 1S78D 5FHAL 4JO4H 1TVBA 4NHCL 1A4KB 1E0OB 4A2LA 5HPMA 5IB2B 4WU5A 3UYRH 4QCIA 2JIXB 2FX7L 4PY7A 3MOAH 2R1WA 4HKJB 2FNBA 4IRJD 3DVGA 4OLZL 1CFBA 2H26A 5ISZB 1RAMA 5AUMB 2FH6A 5JORA 2VITA 3EJZC 5I1KL 5CKGA 4HWBH 5L6YH 3T0VA 1IAKA 3DVNB 4AY0A 1EFXD 3BQUA 4FQXD 4NQUA 5GRVK 4NHUA 5IMKB 3ECBA 5I1EH 5ELIA 1JFQH 1UACL 5L7XH 3SDXF 3BGFB 4DFIA 1H3WM 5CGYD 1MCWM 4JQXA 4CVWA 5KG9B 3ARFA 4HD9A 4LCCA 1RIVL 1KPVA 2EDDA 1SJXA 3DXAD 3EYFA 4XNYH 5F7NC 2GEEA 5IVXF 2DQCH 3M07A 5IT2L 1QRNB 4PJ5E 3ULSA 4EQ2A 3RUGF 5EC1A 1HZHH 1BD2B 4JY4B 1OP5H 2NW3B 3OKKA 4G80B 2ZUQC 4L8BB 4KKLD 4M93B 2XQBL 2DTML 4DKDC 5HYSG 3HAEG 4OLVH 3UBXA 4EI5D 3HG1E 4L4TE 4JFPA 1CZ8L 2XI9A 4Q2ZA 4PP1D 4NJAH 1K6QH 1DDHA 1T0NA 2QJDA 1O7VA 1I8KA 3EO1B 1R24A 1W2KT 5FO9A 4L3EB 3KPSE 2CRMA 1IAMA 2D7PA 5TQ0L 1DJSA 3WNPA 1U6AH 5LGKA 3KYMA 2IPUG 3HNSL 4TSBL 4MQTB 5GGTH 1OOAA 1ORSB 2XPGB 1T20A 4DGYH 3VI4E 2HT3C 4NZTL 3SJVA 5EUOA 3O45B 1AHWA 4MAUL 4XAKD 1Y0LB 4ZFGH 2PR4H 4ZFFA 4KXZH 3O2DH 4GG8B 3VG0L 1IILE 4UZGA 3V6OA 3UP1A 3O3AA 3MLSL 3BE1L 4NT6A 4R4FH 4P5MA 3MZTA 1WZKA 5FUCC 1MCSA 4L5FL 5E8EA 2F8OA 4O5LL 1A7PH 1QSFE 2X4NA 3GSWA 1YECH 2A73A 4AL8L 4JJ5A 1JPSL 5DR5H 5F97E 5HHOD 1S9VA 3CUPB 1RZKC 4W4OC 3B3IA 1LWRA 3W0WD 3VFWA 5JR1H 4X98A 1K85A 2X4RA 3H7BB 1ZV5A 1CF8L 4G8IB 1G7HB 1MAJA 5ACLA 1RZ7H 2DQDH 5B8CA 5I1LB 4LSRH 4RISL 4HPOL 3X3FH 1ZGLA 3BD3A 1DBAH 3RKDC 5FF6B 3MCLL 3NCCB 5TF1L 5DHXB 5HXMA 3KPRB 1S7TA 3X14A 1FLRH 4KY1L 5E4EC 1AY1L 3U46A 3S5LA 1E6OH 2PCPB 4RNRB 4LNRA 1R3JA 2LQRA 1DEEB 4IHOB 3HR5A 5KANI 3PWUB 4URTB 1IGFH 4G8GD 4Q9QL 4M6NH 1WFTA 4LPWA 1U93A 4WV1A 3T2QA 5BOPA 1CGTA 5EOTA 1JZ4A 4I2XB 1U8HA 3ULVH 3I6GB 3TVMB 2J4WL 5C70A 2QADC 3WXVH 4KKAC 4WI4A 3IB4A 1A3RH 1E6JH 3UTTE 3UAJC 2DQTL 4PGBB 3SDAA 2HN7A 1B2WH 1JNLH 3F6IA 4MA8H 4GKZB 4ETYA 3QDME 1BJ1J 4UV7H 4JHWH 2ED9A 4HAGA 1OP3H 2GT9A 3EYOA 2VAAA 4K7PY 3AAZA 2H8PB 5MP6H 4YUEH 1CL7I 3CSYB 4U1LB 2HT3D 5C08E 4Z7NE 5D1XA 3BUYA 5IHUH 5M94B 4XPAH 4JCMA 5H37H 2BSED 5IHLB 2HTLD 4ACPA 4DAGH 4Q74A 1XMWA 3GEWB 1EO8H 3LKRA 5JHDE 4EDWL 1R0AL 2V5YA 2VLLB 2DYPA 1WIUA 5I66A 1NAMB 4NQCB 4ODSL 1N7ML 1A7OH 2EEAA 4HX1A 4ZG1A 4WTWA 4MLSA 1FNEB 3GKWL 5H8DA 1FL6A 4IDJL 1P7QD 2EE3A 3GSXA 2HMIC 4WW2F 1NGPL 2ADGA 3G6AA 2F74B 4U6YA 3ZSTA 3U6RA 1T22B 2C1OA 4Q9RL 3K1DA 4LMQE 1ED3B 5ANMB 1NFDE 4AEIL 1CFVL 2BDNL 5F88A 4U6VL 1OHQA 2YPVL 4YK4C 4XNZC 4QRSB 1MRCL 4MDJB 4P3DA 1CXHA 2V7HB 4ZTPL 1I7TB 1SHMA 3ZE2E 4G9DA 4XVSL 4RCAA 2P5EE 3RKDD 3O2WH 1FNHA 4JO3L 3BP4B 4WTXA 4MNQE 3MRNB 2FWOA 1XGQB 1A4KA 2CLZA 1LEGB 2ZUSA 4OLYL 2IJ0C 1OTUC 3IJHB 1C5BL 2JIXA 4R7DB 1RJLB 2ESVE 5IQ9B 3HLAB 3KYAA 4HF5H 5LCVH 3UC0H 4HKJA 4LCYB 3N85H 4GAFB 4MSWA 4NKQB 4K7PL 1L8JA 3R0MA 1U8PA 1MRDH 1E4KA 3SPVB 4G5ZL 2BRRH 5I1DB 1REIA 1V3JA 2AEQH 1J5OH 4D9QE 4LLQB 3OXRA 5TDNB 2FX8L 1X4YA 3WXWH 2GTZB 1LE9A 3DVNA 3KLSA 4LF3B 4Q9CA 3L3DA 3PGFH 1RULL 5C7XH 2QADD 3AXLB 1HHHB 3ARDB 2DQFA 3Q3GB 3MV7E 2J6EH 3UAJD 3G5VA 1IE5A 2OL3A 2A83B 4JFOA 2ATPA 4LRNH 4R97B 4WGWB 3PQYA 5HI4C 1I8IB 1IKFH 4UOJA 4F37F 3KWWA 4OQTA 1RZFH 4OZGF 1WF5A 2W92A 4QTIL 4KZDL 3G5YA 2NY0B 4R26L 3FKUS 3I3DA 1NCCL 1IQDA 3ARXA 5CJQL 4HIXH 4WNQB 3GJFK 3MROB 2XY1A 2H2PD 1BD2A 4JY4A 1J05B 4KVNL 3SO3B 5I15L 2NW3A 1KCSH 3EFFB 1BFVL 4KVCH 4WI3A 3DYOA 3BDYL 3BYTA 3NFNA 4HV8A 4HMEA 1JHTA 5D1ZB 4P0DA 3HB3D 2P7TA 3SCMC 2XNAB 3EOYG 3HR6A 4KK9C 2WMPA 3F65A 3O8XB 4Y16A 5E9DD 3T0EA 1JMZA 1P2CA 3Q5YA 3EO1A 4JRWA 1AJ7H 1MFNA 2AJXL 4CJ1A 5KW9H 3QEGH 1OM3H 5F9JA 2X1QA 3MODL 2HMID 3LH2H 3QUYD 5E6IC 2DM7A 3MLYH 3UPRB 4M8VA 4UTAL 1ORSA 4YHPA 2AV1B 5C0AE 3EYUL 1IGYB 4YX2H 2ICES 4HQQL 1EMTH 1WISA 2HVJB 3L5WB 4LPXA 5DD3L 4PJEA 4J2XA 1WGOA 2EKSB 1KIQB 3SDDB 2APTA 5CP3H 2OTWB 3WFCL 2EC8A 5KJRL 3O45A 4POZC 4IS6A 32C2A 2HT4C 1JL8A 4DVBB 2B2XL 2HFTA 5DRNA 1CD1B 2BVUA 4GW4B 5IBTL 1J8HD 3FAXA 4ELKA 4X6DB 1Y0LA 1J88A 4HJGB 4E5XB 1DQLH 3DXAE 4AMKL 5BO1H 5TGBB 1K8DB 4ZAKC 4EVNA 1UZ6E 5A43C 4GG6E 3RDTB 3GM0A 1XF5B 1W0VB 2ADIA 4EUPB 3HMXL 5FM5M 4IRSB 3WV0A 2A6DB 4LCIL 4ETQB 2ID5A 4D0CA 4LL9A 3FHAA 2K9UA 4NOFA 3FFCD 3MA7B 3QDHA 1VFAB 3PDOA 4F15C 5EZLA 5FO8A 3OR7B 2F53E 3DYPA 4X4XB 1JZ7A 3QUZB 1T66C 4Y5YC 3BVNA 1XFPA 3LHPH 4JN1H 4Z95H 5A3ID 4GRLA 3ZKXB 4R4NC 4UMGA 1Z3GL 2VLME 1P4BL 3DURB 4NQVA 4P99A 4AENB 3D0LA 4LARH 4BKLB 4EN3D 5D4QA 2B0SH 5DMKA 3UXFA 3B9VA 1RUMH 4ODWA 4M00A 3D9AH 5SX4I 1Q94A 3BP5A 2QQNL 1WIPA 2X4OB 2RR3A 3L3IB 3UZQA 1U8KB 3NAAL 3VFUB 3QRGH 5CBAA 3LAFA 2R0WL 4YHYC 1DEEA 4I3RL 5K59F 3IGAB 2IGFL 5ETUB 3D3VB 1LK3L 1I3VA 4XAKE 1MFEH 3FQXA 3SDXB 4NQDB 4GS7C 3CFEB 4GAYA 5FAAA 1CQYA 5HHVL 5HYSB 2DD8H 4LSTH 1J1XL 3TVMA 3SCMD 3FT4A 2Q86B 3OJVC 4KK9D 3MBXH 4KK5C 2IADA 3QXDA 3P30H 4DKFL 4RMVA 4UBDC 4ELMA 5IVXB 4YGVA 3SKOB 4LSSL 3AVEA 4XNMB 3MGOA 1D9KC 4F37K 4P4KC 1WQVT 1BQHA 1H0DA 1UWEH 4DZ8A 4NM8L 1X6NA 5DJ0B 5E6ID 5C9JB 4JKWA 3DGGA 5IMLB 4TSCH 3BHBB 5HHOE 4MXQD 2H8PA 3F58H 4JG1H 1TVHA 4IIQB 4JPIB 4J3XA 5I1IH 3FO9B 2EDJA 4OBSA 1TNMA 3BH9B 5SWZB 1KEGL 1NCDH 3L3KB 4POZD 5GRXG 3V52L 4D0DA 5ENWB 2HT4D 3PHOA 1JGVH 4UT9L 3OAYK 2Y4SA 2NXZC 1PGRB 3RKPA 4P5TA 4ZAKD 4NQCA 5C09B 3NN8B 3JV6A 2FB4H 3AGVA 2AEPH 2RJMA 3K3QA 4BH8B 1CN4A 4QY8B 1T7ZA 2ZJSH 3LMJH 4ODUA 1G1CA 4G8GE 5GGSB 1KF9B 5C0GA 5DJYB 2WWKT 1RK1A 1G6VK 4XAWH 2JE8A 1DE4B 3TA3C 5ANMA 2ICCA 5IW6B 2CMRH 4XCYB 1H9VA 1OT1A 3NCJH 4WW2C 5EN2A 5B22A 2DQUL 1I9RH 3IAPA 4HIEB 4YDKH 3OKEB 5IJKC 1MQKH 2UWEF 2V7HA 1I7TA 5GS3A 4R4ND 4JZJB 1CDGA 4MMZC 5FDYA 4LP4A 2EDBA 3MPCA 2HFFA 1A1MA 5DQDL 5I1JH 3P40A 5DA4A 3BP4A 5BMFL 3NCEB 3MRNA 1MUJA 5C0NC 5JMOC 1ODAA 4CNIB 4CN1A 4OT1H 2VL5B 1LEKB 4P2RB 1KTLA 25C8L 5JW4Q 2NX5B 4S0TD 2R15A 3NTCL 5I1CL 1MWAA 3VFMA 4TRPL 1B6UA 3MO1A 4XC1L 5E00B 3SPVA 5I1DA 5J13C 3T08A 3QULA 4FTVE 4PJ7E 1J0JA 4DTGL 1EHNA 3GGWB 4XGZB 3D87B 3MLVL 5HYIA 5TDNA 3HNVL 3MLUL 4BELD 4QHMA 4XBPB 4HBCL 1OAQH 2H9GA 4YE4L 3B8YA 1AO7A 3SDYL 2NLJB 4D9RD 4MD4B 3FRUA 3AXLA 2AQ1A 4NZRH 3Q6FB 3HI6L 2V2TA 1SEQL 5FUCE 2WWMC 43CAB 5D70H 3GJEB 1DBBL 4R7NA 3O6FB 3U4EA 4YC2B 2VKWA 4LPVA 2A1WH 1EO7A 3KYKH 2YEZA 5JW5A 3MLWL 2YUWA 4JFXA 5CLWA 4PLKD 5CZKA 1JNNH 4DUXA 3GJFB 1PYWA 4UAOC 5F3HB 1W0WB 1GZQA 1T2QL 1YEEH 1RHHA 4BUGA 4KAQH 4WNQA 3ZDZF 1NMBH 3VFPA 3QJFA 2J88H 3P4OA 4JZOB 4HWNA 4LSUH 1T7XA 4NKOA 3SQOL 3LKPB 3CMGA 1NANI 2YKLH 4ZO6A 2CR3A 4UT7L 2CUHA 1WAAE 1S3KL 4G6MH 1ZTXH 3A6BH 4QEGA 4DN4L 4WEBL 3DO7B 2V7NB 3C9NB 1F4WH 2NXZD 1PKQE 4MA7L 2HJKB 3C87A 3LRSA 1OF2A 2ZKHL 5T3XE 3FB5B 5E5RB 1XGTA 4TVSa 4JPWH 4NP4H 5CJXC 1JNHB 2EEBA 4FXGA 4YDJB 4ZO7A 1AH1A 5B39A 4MS8C 2AABH 4LFHD 4PJCE 5BVJA 2VDMH 1KJ2A 1UM5L 4X7SL 2R0LH 2MQCA 3UPRA 2GITB 2YPLB 1MIMH 2JELH 3P4NA 5I8EB 4O4YH 1T1YA 3BDBA 3TC9A 3H9SB 3TA3D 3L5WA 4LVNC 3WHXA 4HUVB 4WHTB 3U2SB 1EEUA 1KENH 3CAFA 4DW2L 3DHJA 4Y89A 1XCTB 3LD8B 4MAYB 1C12A 2VLKB 3VWKC 5LGHL 2QLVB 1WWBX 2L7JA 4GW4A 5SX4H 3PDGA 4X6DA 1I1AA 3ZDXE 1FORH 4D0BB 5FA3B 2YOCA 3D25B 4RGNC 5BJTB 4OKVA 3V5KA 3VG9C 5C0ND 3MRMB 4LHUD 2GY5A 3QZWB 4TULH 1JMXA 3GSNL 4NKMB 3L5HA 5FUZH 5IBUB 4C56D 1E4XI 3A6CL 3L1OH 5DHVB 2ZOLA 2VDKH 1CU4L 4KTDH 3TIDA 3OZ9L 3O4LD 1MLCA 3IFPB 2EC9T 1C08A 3IU4H 1A3LL 2P43B 2GAZB 2AGJL 2B1HL 3HCVB 1YEJL 2OMNA 1Q1JH 5D2NA 5E24E 1MNUH 3X13A 1P7KA 4I9WD 2GFBB 5DWUL 5F7LB 1WITA 5F9AC 4CKVX 5E9DE 3LOWA 5F9OL 1BGXH 1JTPA 1FYTD 1F6LL 3MJ9A 3LRHA 1H3UA 1DLHB 1JWMB 4LIQL 1BZQK 5HHXH 4Q6IB 1QYGH 4HSQA 1T0MB 4QOKB 5IJVA 3DBXA 1JGDB 3B2VL 1KPRB 1VFOA 4IOFC 4AM0B 4LU5H 1RZ8B 1F3RB 5F6IC 3LEXB 4U4BA 4M7LH 3HZMB 3BI9X 5GGVH 3IGAA 1IC7L 1UWXH 5KSAB 2D7NA 3HG1B 2AW2A 4KHTL 3TO4A 1J8HE 4XNQB 3OR6B 4YWGH 4JPKL 1TZIB 5HYSA 1PW3A 3HAEA 5I9QB 4PRPD 3F7VA 2G2RB 4ESKA 4LQ1A 4DVRL 4OZGB 4PR5B 4S11A 1LK2A 2BFVL 5KZCD 1GIGH 1P53A 3GMLB 1JUFB 5EZJB 3FOLA 4O00A 5FOBB 3G6DH 3E6FB 1N4XH 1G6RH 3T04D 1KYOJ 1AE6H 3VA6A 4XNMA 2DOCA 4KZEL 3BPCA 2PO6B 2VLJB 3D69A 4MS8D 1GHFL 3VRJA 5T1LB 1OP9A 1AQKH 1D6VH 2E9IA 4PJGF 1XH3B 2VLRB 3PXHA 1UYWH 2IBZY 4HHAB 4JPIA 5KVEL 5E08H 2JK5A 3UJTL 5HYEA 2I9LA 1NAKH 3FO9A 3KR3H 3ETBF 1H8NA 3C5ZA 4HCRA 3VWKD 4KPHH 1FFPB 1CGVA 4JCLA 4M7KH 1H3XA 5FOJA 3VD7A 4OIIL 2M2DA 2CRYA 4LCWB 4K3EH 4MX7A 4WVRA 4PJDF 4YXHH 1K8IA 4GUPB 2X70B 1HDMB 1MCPL 2NY7L 5C09A 2NNAB 3IDJB 2F15A 3WFHA 2DI8A 3QI9D 3RGVC 4QY8A 2EYTA 4WCYL 4JREC 2EC9U 5DEFB 5GGSA 3VFVA 5IVZB 4BH7A 2ORBL 4ONGL 4P3CH 3TH4T 4CN4A 5SWQB 1PAMA 1LDPH 4XCYA 1IFHH 4KDVA 4P46A 3LQZB 4PJAF 4U49A 2IAMA 4P5KA 3IRPX 1VESA 4L4VB 5KTEH 3SDCC 1U36A 5IWLA 3LKQA 2DTSA 2Z9TA 3WNLA 4L9LB 2P5WD 5EO9B 3U30C 2OJEB 3MJ6A 5I73B 1FO0L 4P9MH 4MYWB 3MMEB 2XZQL 4KGLA 2VERN 3C60C 4LLWB 1GPOH 2DBLH 4IOFD 1QBLL 4F3FB 5DJ8B 2I07B 2ZNWA 3K1KC 1JHLL 4QRUB 4C54A 1B3JA 2JJUA 3EDJA 1MI5D 3QR2A 2VH5H 3GRWL 4P2OC 3U0PB 4FQHA 2FCBA 3ZYOA 4I13B 1XF3A 3GGWA 4BQ6A 4Z0XA 3MC0A 2F19L 5CS7A 5KN5A 3V4PH 1F4YL 3QNXB 4XBPA 1ERNA 2P47B 1FPTH 3Q48A 3FO0L 3BJLA 3VFTB 1NDGB 4YDVB 1LNUB 1UH3A 3FO1A 3WDHA 4ZOEA 5E8DH 2HFEA 5L8JB 2NTFB 1NSNH 4NRXB 2VZ1A 2VUYA 1ZS8B 3F62A 5EOQH 1W0WA 2YD9A 4YXKL 3W9DA 1J1OH 2A77H 5LGJB 3EYVA 5I30L 5DO2D 1T1XB 5D5ME 4PS4H 4JGMA 3HFMH 5IG7B 4U7MA 4ZYKB 1T21A 3SKJL 2VMFA 3WJLC 3GHBL 2Y5EA 4NCC2 5D8JH 2R4RH 1G9NH 4F9PA 2V7NA 1M71A 3C9NA 4YXLH 5C0CD 1OSPL 2NY1D 3Q6GL 1EDQA 4DGVH 3PL6A 4ZTOL 4JFDB 4G7YL 1KCRH 3M17A 3P9MB 5EDXA 4Y0GA 5CAYB 1OTSC 1FVEA 4RWHA 3PGCB 1WZ1L 5EZOL 2GSIA 1T7YA 2EIZB 1T5XA 2BSSA 2LV4A 4UINL 1JPGA 4X8JB 1KFAL 4G9FD 4HUVA 1VKXA 2OZ4H 2HJLA 1G7IA 4GT7A 4D9RE 3HRPA 5JDSB 2VZUA 3WS6C 2VLKA 3S3PA 5FYLL 4PP2B 5DUPL 5GSRA 5BRZD 1NGZA 3BT2H 1ADQH 5GS1C 1H15B 2O5YH 2B5IC 4PJ8B 2JJVA 1VSCA 5CCKH 1MELA 3HI5H 3MRMA 5B38G 3WNOA 1Z2KA 3RA7H 3TPKA 2R1XB 1EO5A 1X5AA 4HKBB 2DLFH 1QKZL 1VEPA 5C0BB 1KN4L 1M4KA 2AKRB 1T83C 3IFPA 4AZ8A 2VTFA 4P2OD 4NQXA 2DI7A 2UWEB 5EZIL 2WIIB 4MNGB 3G04B 9CGTA 2GAZA 1CGWA 1BQSA 3BKMH 4IJ3B 3HCVA 4K8RH 4KMQA 5E5UB 5D7JB 1ZLSH 5I1AB 3REVB 5DD6A 3MV8D 3OWEA 2CKBA 3VI3F 1WIOA 4JANA 2W9DL 4F58L 1IQWH 4IEFB 4FP8H 1EZVX 1YEDB 5HYFA 3N1MC 2FBJL 4UILL 4ZOAA 5DYOB 4ZO8A 3SKNB 3TBWB 2BC4A 4WEUD 4PJ5A 1T0MA 5D2LE 4KDTA 3I9GH 1E4WL 1LQVA 1KPRA 4AM0A 4LP5A 1S7VB 4NKDA 1G7MB 2MPAH 1JV5B 3JXAA 1SJHA 3LEXA 1U58A 1CG9B 4F7TB 3HZMA 5C0EB 3IFLH 5DJCB 1NAMH 4NIKB 2VAJA 2PTTA 3HG1A 1RUKH 5IBLD 3R06A 1II4E 4B53A 2FO4B 2GJJA 5GS0H 3WIFA 4WFGD 5TQ2L 1NCUA 1JK8B 3MOBL 4M6AA 3KPSA 1CE6A 4PR5A 3VRIB 4C56E 5J1AA 3GMLA 5DMYA 12E8H 3SHSA 4P2QD 5FOBA 3E6FA 3O4LE 3QEHB 4OCXL 3FB6B 5JHLL 1OTSD 2PO6A 4FQXB 1FSKB 3VD4A 2IALA 1IEAB 5CSBA 2E27H 4KH2A 5E2TL 4LEOA 5EBWA 2A2QT 2NY6B 1N8ZA 4I9WE 1FDLL 2PUQT 4JG0H 3TO2A 1FZOB 1FYTE 1TJIH 2F5AH 4FQPA 3WFBH 1BJMA 1KCUH 3A0OA 3ZO0A 1LO4H 2HG5B 3OQ3B 1MCEA 2QTEA 4EXKA 1UC6A 1AXIB 2P8MB 3QNZB 4GUPA 1A7QL 4JKMA 1R3KB 4HK0B 3VXTB 1EBAA 2NNAA 4U6TA 1QSFA 1BQLH 1RZJL 2WUCL 4ZXBA 2H3NB 4JFYA 1KIRB 3WNNA 3F7RA 3EKCA 2H41A 2D7OA 4J6RH 1C1EL 4XPGL 1Y18B 4NNXA 4A6YL 5I8KH 4KRPB 5TF0A 3UPAA 2VXVL 4TTGA 3KYNB 3VXRB 4PRPE 4JFZL 1RIHH 3B6SA 4ALAL 3DSFL 2BNQD 3P9LB 4NZDA 3DHMA 4F7EB 1CK0H 2BNRE 2FJGB 4CW1B 5C0DA 4YQXH 1QLEL 4EIGB 1QP1A 4L9LA 3QEUB 5EO9A 1ZT7A 1HHKB 2V9RA 4MDIB 4PJFF 4HXBH 1DQJB 4D9LL 5D7SL 3ZZ1A 1X5YA 2C3HA 4MCYB 3BW9B 2OLDA 4XMPL 1K9TA 2I07A 4W6WB 5BVPL 4XPBH 5T1KD 5JXAL 1VGKA 5JUEL 2VDQH 3LKSA 1DQTA 2GJZA 3U0PA 4AG4H 2YD8A 4KTYA 3OXSA 4BFBD 1T89A 1FC1A 1I1YA 3BSZH 4PJHF 3RQ3A 3GDBA 3O9WC 1NJ9B 2ADJA 4RGNE 3UTTA 3U9UB 1JYWA 4FQJL 3NGBC 1FIEA 3RWEA 3W39A 3PNWB 3QHZL 2DN7A 5DMGC 3I6LD 1KJ2H 3QDMA 2A9MH 3BWUC 2Q7YB 4Y5XA 1N6UA 3QDGD 2XY2A 1D5BB 3WNMA 3DNKA 5C0FA 5ILTH 2V5SA 2QSCH 4NN6B 1NDGA 4YDVA 3SGJC 4ZD3L 3W0WB 3ZSSA 4QTHB 1MCFA 2FX9L 4CGTA 4HUWB 4NUGH 5F9WC 4M48L 2VWEC 1QEWB 5GIRB 2Z35A 2VQUA 1XR8B 1FFOB 1OAUL 4LSPL 4OUOA 5I74C 5JHDA 1I9EA 4P2YA 5HSFA 2ZZUT 3CU7A 2R56L 2I60H 2P5WE 3FQWB 1YY8B 3ZKQD 5BS0D 1AKJB 5IKCA 2EYRB 4U1NB 2E5EA 3E8UL 1AXSB 3CFJB 3VGGA 3P0YL 1PEWA 4F7MA 1EHLL 2HYMA 3IDUA 3INUH 1VA9A 1OSZA 2VKXA 4Q97A 1OB1B 4PYGA 5J56B 1RU9L 4JFDA 2P24B 4IMKA 1MI5E 3ZT5A 1AXTL 2NXYD 1EUTA 2YMXL 3QDAA 4JO4L 4OZHE 3LPGA 1F8TH 3QJHB 3MJ9H 1HI6A 4Y4FB 4H0IA 5FM4A 1XR9A 3MOAL 3KLHC 5K59E 2ZSWA 4PJDB 2HAZA 2AJ3B 2EIDA 3EDKA 2P5EA 1TVDA 4JR9H 3KPQB 1F6FB 1JF1B 1MEXH 4HWBL 3CH1B 5L6YL 3IXTB 3ERYA 1HINH 4I0PC 4RQQB 1A7NH 2ESVA 1U3JA 4X5LA 5C6TH 5I1EL 1JF6A 4G6AC 4Z7VE 4RX4A 1JFQL 3UTZB 5L7XL 4HKBA 2A0LC 2WW8A 1YJDH 3T4YB 4PJAB 5C0BA 4X5WB 2EDOA 3NH7H 4LRIC 3RY4A 2W60B 4XNYL 1J18A 5FIEA 4OGXH 1A9EA 3GBMH 1U8JA 4FN0A 3OKMA 2HVKB 3O9WD 2DQCL 5C0CE 3O81A 4RIRA 1VACB 4WHYG 3MV7A 4E9LA 4KI5F 2VSCA 1HQ4B 4LFHG 1DLFH 1IGJA 1HZHL 1JFMA 1GAFH 3GB7A 5DMGD 1XCQB 2ZUUA 4PRID 3UPCA 4N5EA 2QV2A 5I71C 1YEDA 4OLVL 5CUSH 1TLKA 2CRIA 3QA3B 2AV7A 2H32B 4NJAL 1K6QL 3TBWA 1LO3H 4HCRH 3O6MH 4DKEH 4G9FE 1ZLVK 1KG0A 4R4BA 1TIUA 1JV5A 3LV3B 3JV0A 1CICC 5EU7C 2X09A 3L95A 1CG9A 3I3EA 1U6AL 5ESAB 5AG8A 4LHUG 3PJSB 3OKLA 3WO3B 5GGTL 5BRZE 3ARBB 4LVOC 2N1KA 4X6EA 4Y19D 3WO4B 4I18C 4PJIE 4DGYL 3TCXA 5FYJU 2J8UE 3U79A 1I85C 5GZNC 2WP3T 5D7LE 1DTUA 2BVQB 5B21A 3C6LC 1BFOB 4HS8H 3GBNH 4IRJA 3VRIA 2Q7NA 4YHNB 1JZ3A 4P59H 3UDWA 1KACB 4OZFB 4ZFGL 3L5XH 1LGVA 2PR4L 5C0AA 3FB6A 5CD5C 3O2DL 3ZTNL 4KJYA 1EFXA 4FQXA 1CDYA 3U7AA 4GW5B 2FZ3B 1IEAA 3L3OB 5KSBE 4R4FL 1MCRA 3MV8E 3KLHD 4XXCA 1CFQA 4OCNC 4DK3A 2DKUA 4Y5VA 1FZOA 4WTZG 1VPOH 1A7PL 2E9BA 3AREC 1YECL 3S88H 3QUKB 3DXAA 1IM3B 1RQ5A 3MOQA 4BM7A 1ACZA 5IEHA 4WFED 4GG6A 1FL5B 5DR5L 3OJ2C 4OV5A 4WI2A 4UNVA 2OQJA 4OGAC 4OUUB 4I0PD 5JR1L 4WW1B 3ORJA 4C83A 2UUDK 4K9EH 3QNZA 3F12A 4S2SB 1X5FA 1RZ7L 2DQDL 4FMKA 4JAMB 2H2SD 4LSRL 3X3FL 3FT3B 5HYJB 3NCYS 3ARZA 3E1F1 3OV6A 1DBAL 4PRDA 4G6JH 1WUNT 2YC1A 4EI5A 1TITA 2UZIH 2F53A 3E2HB 4DQOH 2VSDA 1FLRL 3TESA 2A38A 3GSRB 2JJTC 1E6OL 2KUTA 4WFGE 1HXMA 4OFYD 5JZ7D 2BCKB 1VENA 5E2VH 3G5XA 4PGDA 1A3QA 4JHBA 5HGBB 4DUVA 4F80A 1NC4B 1ZWIA 2VDNH 3FL7A 3L6FB 3QUYB 3GJFH 4WU7B 1IGFL 2XTJC 4P2QE 4M6NL 2R2EA 3QEUA 1AQDA 3NZ8A 3ULVL 4RA3A 4WJ5A 3WXVL 1DQJA 4Z77B 1UENA 1QNZH 5DFWH 1A3RL 1S9XB 5FDWB 1E6JL 4JFEB 3BW9A 2DLGA 1B2WL 2E6PA 1JNLL 2BOBB 1KV3A 4MA8L 4UV7L 4JHWL 4H1LG 3T0DA 5MEND 5JIIA 2DQIH 1OCWH 3TF7C 5MP6L 4YUEL 5GXBB 2BVOB 2MSPA 5FHBH 5GZND 2Q3AA 2GSGB 4Z78A 3VXSB 3N1QC 5IHUL 4XPAL 3TZVB 2IFGA 3FFCB 5C6WH 5FEBA 3HA0A 1WFNA 5FXCH 4DAGL 3TWCH 1BF8A 3NIGF 3S37X 1EO8L 1U3HC 2FYYB 3QUMB 2G75A 4X99A 2DIBA 5JIPA 4OIBA 5HHOA 3WSQH 3DUHA 3WL9B 5CD5D 1QLFA 4BQCA 3W0WA 1UM4L 4X6CF 2YWZA 2GQHA 3L3GB 4NQEB 4DCQA 1A7OL 4FXLA 3RPIA 1SM3H 2JJSA 4NWUH 3MXVH 2V5TA 1NKOA 1QEWA 3DLQR 3QIBC 3DETC 1S5HA 1X4XA 1ZSDA 5HGDA 3CLEH 1FZKA 2FRGP 4KK8C 1KC5H 4JM2F 1UH2A 3ARED 4M5ZH 3CDGB 1A6ZB 2NW2B 4X6FB 1YY8A 1P69B 5GJSH 3O3DB 2VXTH 5DHVH 2LTQB 2EYRA 3GKZA 4U1NA 4G6KH 1KT2A 5E03A 3LN4A 2PYED 5T1MB 5B3JF 3NCYP 4G8GA 1K5NA 1OB1A 3O3BA 3MREA 2P24A 4ODHH 3ZDYE 4R96A 3BRFA 3O2WL 1DEDA 1UJ3C 4MXVE 1V3MA 3V5DA 3QDJD 4LPYA 3RNQB 2VC2H 3HMWH 1INEH 1G0YR 1V8HA 1HOCA 4YFLF 5MHSE 5HHMD 5FYLD 3HC3H 2WWKO 4HF5L 5LCVL 3UC0L 3IU3B 3D18B 4LNVA 4P48A 3N85L 4QRRB 2Z93B 1KELH 5D9SA 1MRDL 3I6LE 2BRRL 2A74B 3MCLH 2AEQL 4NO2A 2XTJD 1J5OL 1U8OB 1RZJC 4LVHB 3CVHB 3CH1A 3KJ4B 3IXTA 3KS0J 3JUYA 4M4PA 4RFOH 5EBMB 3WXWL 3PGFL 4PJ9C 3E0GA 5C7XL 3LKOB 3WN5B 4BSWB 1CGSH 1O7SA 2J6EL 3K4DA 2NY4C 3UTZA 4Q9QH 1ND0A 3UJJH 3FQRA 4YHOH 2V17H 4LRNL 2EXYD 4ONHB 5FGBA 1IKFL 2NCMA 4U1KA 3ULVF 4QRPD 4I77H 1RJYB 1RZFL 4BFIB 5DGQA 5I1HH 1YNTB 4PJBE 4HIXL 4PJFB 1NDMA 3D39D 4OI8A 1QQDA 1TZGH 5C07B 4OLXH 1P7QA 2HKHH 5DJZA 3WUWG 1ZHLB 2BVEA 4TQEH 5C0IA 1HHIA 5C2BH 2XKUA 2KKQA 1XCQA 2R1YA 5ICXA 1KCSL 4KVCL 4RGMC 1A1NA 1U3HD 3MJGX 1BBJB 4KI5C 3QBTB 1HILB 5I75C 5FGCB 4NRYB 5IHBA 3OAYH 1E28B 1OP5K 3QA3A 5DRZB 1D5MB 4DUWA 3BZEA 4WI6A 4PD4J 5D5MB 5D7KD 4WI7A 3SE9H 5FO7B 5DA0B 1WC7A 1AJ7L 2F8XC 3H9HB 3R1GH 5KW9L 1WAAA 3QEGL 3BWAA 2KL6A 1OM3L 4PIRF 3LH2L 1INDH 2W65B 1CXLA 1MCCA 5ESAA 1FYHB 3IDMB 2MJWA 5EU3A 3MLYL 4KRLB 3W5MA 3TBYA 1PKQA 3B9KB 4RWYH 2DI9A 4YX2L 1ONQB 2GY7B 3OHXA 1EMTL 3DV4A 2HLAA 2BVQA 1ZT4B 4J8RA 1T2XA 4N8PA 5ECJE 4J12A 1A14H 4G42A 4YHNA 2AK4D 4A2MA 5ID1B 4PJCA 2ICWB 5A2KH 1DQLL 4GKSB 5MEOB 2R69H 2DM2A 5BO1L 1QA9B 2D0HA 3CMOH 5TFSH 4F2MB 5JOFA 2BY1A 4IOIB 4R0LB 2Q20A 4EI6A 4H8WH 1JJUA 1MHEB 3RBSA 4LIQE 2FHBA 3U36A 3VFOA 2A6JA 2YN5A 4RMUA 5I6XC 2Y36H 3P73B 4QKXB 1G7QA 1JIBA 4PRIE 2FGZA 3RU8H 3PP4H 1KNOA 1N5AA 3CC5A 1K2DB 1IM3A 1BLNA 5EH1A 3TYGH 4S1SH 2AI0H 1F6AB 1YQ2A 2BOCB 3WDIA 2X1WL 3KG5A 5J6GA 2ZPKH 4PJ9D 2BSTB 4U7SA 3LHPL 3GMOB 4JN1L 2D31B 3G6JE 4Z95L 5MEPB 3T8XA 2VWEE 1T1ZA 5B38A 5GPRA 1I7UB 5DUBB 4N0CC 4N8VB 4JDVA 1P9MC 3FT3A 1W0YT 4YIQA 4LARL 4OCYH 2ZUVA 3K4ZA 3FTGB 4QT5A 2B0SL 2GTWB 5ITFA 3E2HA 1RUML 1GGIH 5HVHB 3ZYJA 3D9AL 5E9DA 2AK1H 1JPTH 3QSKB 4Z7WF 1BVLA 4K71C 5AD0B 2BCKA 3M8OH 1TDQA 3QRGL 3RVUD 3BP6B 1E27A 4NCC1 2Z31B 2MKLC 3QUYA 1MFEL 1FFNB 4TNVF 5GS2H 5D6CA 1LP9F 4PGJA 4HFUH 2AVGA 1PG7X 2VE6A 2DD8L 4LSTL 3VXPB 3IDIB 4HWEH 1DVFC 3MBXL 5ADPH 3V6FB 4Z77A 3P30L 2DQEH 1TCRB 4HDIA 1J0HA 3MV9E 3U48A 1PKOA 2FJFB 4J3VA 2Q76B 5E8PB 4LLMA 1J8HA 5EOCH 3QT2A 5L2KB 4OD2A 1UWEL 1AFVH 1HKLH 4WWID 1WFUA 4WFEE 3QEQD 4TSCL 2BY0A 4HUKB 3S35H 4JG1L 3F58L 3A67H 1L0YA 1S5IH 1B90A 3WKMH 3FO2B 3S98A 5I1IL 3CFKB 3KJ6H 2GSGA 2EYSB 4S1RH 2XXCB 1NCDL 4GQ9H 3FFCA 3T3PE 5INDB 1FRGH 3CZFA 4NM4H 3VRLE 2X6MA 4K07A 4N1CA 3WDJA 2UY7A 3FOMA 4HUUB 2FYYA 5D96C 2XWJB 3BPLC 4XVTH 5K33A 4KGJA 3L3GA 4APQC 2FB4L 5JW4M 1PY4A 2AEPL 2WUBH 3TCLA 3RP1A 4Z7OE 2ERJB 3EDFA 4HGWA 1ZA6B 3DIFA 4Z7UB 3RWHA 1ACYL 1A9BB 2JB5H 1GZPB 1OAZH 2ZJSL 3LMJL 3GNMH 4EN3A 3CDGA 4H20H 4XAWL 3FHQA 3OB8A 1KJVA 3MRLB 3K74B 4FFVD 2CMRL 2HRPH 2P45B 3JWDH 3Q1SH 3NCJL 1G0DA 1Q9WB 4JM2C 5JDJA 1GGUA 1I9RL 1OARH 4LCUB 1A1OB 3STZA 4PRHB 4V1DD 4PBWD 2XKNB 4JFFD 2WSKA 4YDKL 3WEXB 2CKNA 1MQKL 1MJJA 4GXUM 1U3ZA 3LB6D 5E2UH 5EU7E 1V5JA 4OJFH 5I1JL 4JO2H 1N26A 3UTQB 3SCMA 4JRXE 4OT1L 4QYOA 4HJJH 5DJXA 3OGCB 4M4RA 4NJ9H 1OGAB 4TUJA 3IU3A 3D18A 1BIIA 4KU1A 4XMKH 2O93L 4OM0L 2XN9D 5DEZA 1FGNH 3WE6A 1RD6A 2A74A 5KS9F 5E6IA 2V6HA 3TYFA 3D85D 5JNYA 2KBGA 4NO0D 1U8OA 5EBMA 1CDJA 5ACZB 3VWJC 1OAQL 2R0WH 1DVFD 3GMRB 3LKOA 2GUOB 4XRCB 4OZ4A 4EKXA 5D70L 3RTQB 1KPUB 1ZHBB 2UY6A 2A1WL 3HE7B 3KYKL 4N0UB 1MH5A 2HWZH 1EAPB 1JNNL 4YDIH 4ZAKA 5JA8B 3DRTB 2IANB 2VR4A 5F96H 1NGWB 4NRZB 1A6TB 1YEEL 4X80H 1YNTA 3QI9B 4KAQL 5F1OB 5IB5A 2NYYC 4TNVK 3CPLA 1NMBL 3ULVC 1HCVA 4KV5F 2PYEE 1ZHLA 2J88L 2FHCA 4LSUL 2UVFA 3W9EB 2YKLL 3VXUD 3RWFA 3EJJX 1MRFH 4OD3H 4G6ML 1ZTXL 3A6BL 2IQAA 1TMCA 4M62H 1JPST 4YDLB 1F4WL 3QDJE 2OCFD 2QKIA 1E28A 5KSUB 5HHME 1H5BB 5DRZA 3FMGH 4ISVA 2MQ3A 2IH1B 5D5MA 5FYLE 1KEGH 5I17B 3L7EB 3HPJB 2VR5A 4JPWL 4NP4L 5SWSB 1A6PA 1P1ZB 2Z91A 5IB1A 2AABL 2W65A 2XTJE 1KTDB 2VDML 4CVZB 2R0LL 5GGVY 4ZFZB 1MIML 2W38A 2JELL 4O4YL 1DN2A 2FO1A 4H26B 2E7CA 1FL3A 2EDFA 4NUJA 1KENL 3BUTA 4HGKC 4QXTB 4HK3J 3QIUB 4X6CB 1M1SA 1NCNA 3O4OC 5IHZA 2QSTA 2RFXB 2I26N 4WWKD 3WBDA 2HH0H 1DANT 1IARB 5JW4N 4TTDC 2ICWA 4YEEA 5HGAA 2UYLB 1FORL 1HHGB 5BZWA 3JWOH 3UZVB 1U42A 2CJUH 4QRPE 5E99H 4U6XA 4TULL 5EIQA 5FUZL 3PDDA 4XBGB 2NZIA 1XGUB 3L1OL 4E41E 2LFGA 2VDKL 3D39E 2R29H 4KTDL 2J5LC 4XVJH 4Y4KB 5J12C 1EH9A 3IU4L 1IGCH 4PJHE 5FA4A 3LN9A 1S8DB 2DQGH 3VDAA 1WBZB 1F6AA 4GXUN 4Z7VB 5CJOH 1UWGH 1MNUL 2ZOKA 1YMMB 2DIAA 4Y4HB 4G8EA 2YS4A 5D7KE 3MCKB 2K3TA 4CMMB 2ILLA 1BGXL 2D31A 3ZHKA 2XZZA 4BZ1H 2EDNA 4MQ7B 1I7UA 1ZVSB 3NMEA 4UTBH 3QWOA 3JTCA 5HHXL 1QYGL 1RMFH 1YYMH 2W0FB 2NY1B 1JWUB 1M6OA 4LU5L 3SQBA 1CGXA 1L9MA 2HT2C 2QHRH 4OKDA 1KB9K 4M7LL 2NYYD 4D94A 5GGVL 5DJDA 3ULVD 4TYUA 1GYAA 2AK4E 2CIKA 5EUOF 4YWGL 1CGUA 5E7FA 5D2LA 3RHWF 4MD0A 4R8WH 1KEMH 3TA3A 3VA2C 4HH8A 2PXYC 3BKJH 3NA9H 4S1QH 5CBEA 3VXPA 3IDIA 3QB7C 3QUXC 3RWIB 2Q3ZA 3EOAA 3WNKA 4ZNEA 1Q9KB 4WO4B 5D93C 4KROC 1GIGL 1BWMA 2ITCB 3RY6C 5EORH 3V5HB 3G6DL 2FJFA 1ES0B 1N4XL 4R90H 1G6RL 5E8PA 1CFTA 1AE6L 4X0KA 5F7WC 4J4PC 5EBLB 3M45A 2J8UB 1QO3A 2Z0BA 4LBEA 1AQKL 3EOTH 5J7CC 4M5YH 1D6VL 4LHUA 5DSCA 1UYWL 3UTSD 4C56A 4PTUA 5E08L 5HDQH 5C8JA 1NAKL 3QIWD 3KR3L 3O4LA 1L0XA 4R2GD 3LS4H 4FQIH 1UM6H 4KPHL 5GQBA 4M7KL 1N3NA 1DANU 1FJ1A 2CR6A 3D0VB 3IFNH 3CFIC 4TTDD 3MLPA 4EBQH 1DQDH 1AGEB 4K3EL 4CVXA 2XWJA 1ZA3B 3K8LA 4QXUH 4JY6B 1S9KC 1OWWA 4YXHL 1VGEH 1JN6A 1T6WA 2BVYA 4N90D 1TQCB 1FYTA 5EWIH 2LVCA 1AR2A 5FECB 1FE8H 1IAOB 4HZLB 4Z7UA 1YA5A 1TQBB 1NC2D 4JDZA 2YA2A 1JHKH 4GXVH 5I1GH 3DV6A 3ESVF 3VGAC 4K7FB 5DJ6B 4PLNC 4P3CL 1X5KA 2A6KB 3QXAA 1LDPL 4KI5E 2CIIB 4KQ4H 3RPKA 4U1JA 3GSVA 1IFHL 4XP1H 1Q9WA 3AB0C 1QZ1A 5ICZA 4CU8A 2Y1VA 1B88A 4UQ2B 5KTEL 1LO2H 3H9YA 1WEJH 3K46A 3QPQC 1R5VB 4I4WB 4XP6H 1IC5H 5T5NF 4P9ML 1YPZE 3BKYH 4PRPA 1D5ZA 3QEQE 4X4ME 1OW0C 4L4JA 1F4XH 1GPOL 2DBLL 4XCEB 1BOGA 2HT2D 4P2QB 2BNRA 4HKXB 1NCAH 3EBAA 2D7MA 3IDNB 2VH5L 1CFNB 4MS8A 2H32H 5JIKA 3QO0A 1HXYB 1Q9LA 1FFQA 4HK3N 3L5IA 4CMHB 4NYLB 2D9QB 2NY2C 3C5JA 3V4PL 4NBYB 5F8RC 3MRIB 3QUXD 2P49B 4XRCA 2VDOH 2ENYA 3VWKA 1FPTL 2EDEA 3HPLA 3ZT6A 5F3BB 2GK0B 1I1FB 1CT8B 1URLA 5DRWA 4J4PD 1NGQH 1WTGT 4HFWB 1TFHA 5E8DL 3M1BA 1NSNL 1LP9B 1F4AA 1Q8MA 1QBMH 3MNWB 4H1LA 3BH8B 4HMDA 5INCB 3WJJC 1NGWA 2X4PA 1NEUA 4OZFH 1J1OL 2A77L 3B5HA 4XNXH 3QI9A 2C3VA 4B7IA 4V1DE 4PS4L 2XQYK 3HFML 3QG7H 4L8SB 1YUHA 2WBJC 3RHWK 2E7BA 3I75B 3W9EA 2GKIA 3IAQA 1R3LA 5D8JL 2R4RL 1G9NL 1ZT1B 4YXLL 1QSED 4YZFF 3MBEC 1OGTB 1QVOA 4CRPA 3PWLB 5H2BB 4NO3B 2BNQB 1HH6B 3ARGC 2VDPH 5I17A 4L29B 4DGVL 2FECL 2VDRH 1FAIH 1KLGB 1CDHA 3HPJA 1KCRL 4MNHA 2P5WA 1RUPH 2OYPA 4GAJH 3TN0C 1KTDA 4CVZA 2G5BA 1ITCA 1E4JA 4H26A 1A6VH 2OZ4L 4XPTH 2YA1A 1MI5A 3KXFD 3ARWA 3RL1B 2PW1A 5DQJA 3I2CH 1CXFA 1PX4A 4OLEA 4MD5B 3BT2L 4OZHA 3THMH 8CGTA 1ADQL 3QPQD 1HHGA 5IMOA 2O5YL 5JQ6H 4MCZB 1UQSB 4O2FA 5LQBH 3DTXA 1F90H 5CCKL 3HI5L 2OP4H 4UV4H 4KKCD 3RA7L 5CD3B 3NFPA 2VNCA 1TETH 4XBGA 5KOVC 1XGUA 2DLFL 3QDGB 1EFQA 3O2VH 3NIDF 4XCNB 4JQXC 4Y7MA 2AAVA 4IRZH 1OVZA 3AMLA 1FZMA 5F7KC 3VXUE 1S8DA 2P4AB 3BKML 4QHNB 4K8RL 2E6JA 4Z7VA 1ZLSL 4HXAH 2NY2D 4GBXC 2VISB 1XGRB 1AD0A 3CX2A 3RZCC 3UZEA 2NY3D 3MR9B 5IUSA 1IQWL 4F9LC 2DIJA 2H45A 2ZCHH 3T2PA 4FP8L 2Q6WB 3SEPA 3DROB 1MREH 1MHHB 5BS0B 4J7RA 2DMBA 4YLQT 3C08H 1I8MA 2ZSVB 4PG2C 2OI9B 4M6MH 5C0CA 3ZHDA 3D6GA 1WCBA 2W0FA 4YAQA 4JN2B 1YC7A 3BYYA 1AGFA 3I9GL 1XIWC 5EU6B 3RVXC 2ARJA 4X9BA 5FM5O 2MPAL 5ERWB 3QUMH 5T3ZD 1S7UA 2BP3A 3CFDA 3QH3B 4Y2DB 2NXYB 3IFLL 5KBNC 1NAML 4PJEF 3WUWA 4EJ1C 1RUKL 1H3PH 4FG6C 3BGMA 2ZG2A 5GS0L 3BEVB 4G9FA 3MV01 1U8NB 3BZFB 3BPOC 1UWXK 3RWIA 5K9QI 3IKCB 12E8L 3ARGD 2ITCA 2O61A 1FNGA 1AHWC 3V5HA 4JKPH 1ES0A 5BRZA 3PUCA 1BVKA 1RK0A 3K80A 5ESQA 4KHXH 4PJIA 3IF1B 5EBLA 3VDCA 1FV1B 2J8UA 3OKNB 5JPMB 1KJMA 2VDLH 4N9OB 1WV7T 2H6PA 2E27L 1LEIB 1IM9B 3ARQA 4JVUA 3VXMD 2CH8A 1QFOA 1U8IA 4L9DA 1R6VA 1NEZB 4M1DH 1XZ0B 4JG0L 3S96B 4DN3H 1DR9A 1TJIL 2F5AL 2WP3O 1MLBA 4P2OA 3WFBL 1VCAA 1KCUL 4L4TD 5HHPB 1WZ1H 5C2UB 1LO4L 1MY7A 4QRQA 5KSBA 4WU5B 4QCIB 3NIFF 4DGIH 4PY7B 5CGTA 3CXHK 2R1WB 3MV8A 4QHLB 2HKFH 2Q1EA 5C92A 3DVGB 3FCTB 4M7ZC 2H26B 4XXDA 4PV8A 1BQLL 2EECA 1B4JH 5JORB 5CEZD 5B8CC 1LO5A 2VITB 5FECA 3LN5A 3CVHH 1IAOA 3ULVE 1IAKB 4J6RL 3BQUB 3B8SA 2P46B 1FVDA 5A2JH 3V79C 3T3ME 4NHUB 5I8KL 4BYHA 3ECBB 1KOAA 3GUTA 2ADFH 4LKXA 5DJ6A 2A6KA 2X1OA 4J23A 2QHLA 1IAIM 4MJIE 3QYCA 1RIHL 4GBXD 2OTUB 4AIOA 3RZCD 3ARFB 3MRDA 4LCCB 1KPVB 1LE5A 1CK0L 3EYFB 4Y19B 2W91A 4YQXL 3K0WA 4D2NA 2R2CA 3RWGB 4ELMF 4I4WA 1IZKA 3ULSB 4HXBL 5EC1B 3UTSE 1XIWD 3OKKB 4G43B 1FIGH 4XCEA 4ZQKA 4P2QA 3V4UH 3I02A 4HKXA 4Z5RA 1ZLVH 4XPBL 3SDAC 3DMMD 5CJBA 3O41A 2VDQL 3GO1H 1NBQA 1G7PA 4K2UH 1CFNA 4Q2ZB 3QQ4A 2IFFH 1Z9MA 1DDHB 1T0NB 3BSZL 4JEGB 4KJPC 4FG6D 2LU3A 3BZDA 1JYXA 3DGCR 4NYLA 1R24B 5EBGA 4RDQG 5LVEA 5F21B 1ZANH 3MRIA 4G6FD 5HYQB 5D1XC 1AD9B 1KJ2L 3BZ4A 1NGYB 3OJDA 4DKAA 1KN2H 2A9ML 3SE8H 3NZHH 1MCJA 1VB9A 2EDTA 4P23C 3VGHA 1T20B 4M6OH 5ILTL 5F70A 2QSCL 4ONFH 5GS1A 2AJZB 1FGVH 2OJZH 3EO0A 4V3DB 2NTSP 5F7HA 1NGXA 5EUOB 3SJVB 4NUGL 1LD9A 5HJ3B 4M03A 4U05A 4XCFH 3EZ8A 1U8LA 5I16A 2HA1A 5INCA 2GJ6E 1KLUB 1JP5A 4ZFFB 2BX5A 1T83A 1UT9A 4PY8I 3T0BA 2RAMA 3OX8A 4NN7C 2I60L 3O3AB 4NT6B 4P5MB 3EO9H 3CZJA 2VB5A 1ZT1A 2YPKA 5E8EB 3INUL 4NO3A 2BNQA 4GH7B 5LWYH 3GSWB 1VADB 1NMCB 2A73B 4JJ5B 3N06B 4XP9H 1MCIA 1S9VB 1BHGA 3DO3A 3EIFA 3MRFB 3HE6C 1MJ7L 2QBWA 3B3IB 4HWUA 3VFWB 3PWPD 4U3CA 4X98B 5T1DH 3QO1A 5C08D 2X4RB 1F8TL 3MJ9L 1ZGLB 5C86A 5T1KA 3TBVA 4JDTH 5TE7L 4JR9L 4QGYA 3CLFH 3VCLB 2EDWA 4P57A 5IM7A 1PSKH 4Z76A 1GOGA 1J1PH 1T6VN 1I3GH 2X41A 1S7TB 4POUB 3X14B 5MENB 5GGSY 1DN0B 1MEXL 4IBLT 3U46B 3WD5H 1HINL 4M02A 5E2WH 4LNRB 4MCZA 1A7NL 1EA9C 1R3JB 3HR5B 5C6TL 3MGTA 3BPNB 5KVFH 1GH7A 4ORGA 1FP5A 1KCLA 4MQSB 1CE1H 2Y7QA 1NBVH 2BZDA 4QRTA 1YJDL 3QDGA 4WV1B 3MRJA 1H8SA 3NH7L 1IGTA 3ZE0F 1UXWA 3BGFC 2VXSH 2VO5A 4XHQA 4ZUWB 4EEEA 5C3LD 4YHMH 1U8HB 1T5WB 1DUYA 5DURB 5C0JA 1FG2B 5HI3C 4RAVA 4ZUTB 5JW3H 2QEJA 3N1FC 4OGXL 3GBML 4YPJA 3LZFH 1QSEE 2HN7B 1XGRA 4YFLI 2F8VA 2PKDA 1DLFL 5HGGS 3QHFH 1GAFL 4AYFA 4JKKA 1AI1H 1ULVA 4MNQD 2GT9B 5IW3A 3CGTA 3EYOB 2VAAB 1FNSH 1EEYA 2F9BT 4P23D 5BS0A 1UG9A 1MCDA 5CUSL 4M93C 3GIVA 4OB5H 1SY6A 3BUYB 4PJBA 4XTRC 1LO3L 4HCRL 3X11B 3O6ML 4HS3A 4DKEL 2APVA 2X05A 1A6WH 5B3NA 3LKRB 1YDPA 5JTWA 5D1QD 3KXFE 2E7HA 3MRBA 5I66B 4F7PA 4GRWB 1LHZA 4WDIA 4HX1B 4LSDA 2XWBA 5EA0H 4S0SD 2R2BA 3P0VH 1P6FA 1FL6B 4HS8L 3GBNL 4X6DF 3GSXB 2OMBA 2ADGB 5L8KB 2DL9A 2R23A 2YUZA 1RFDH 2C7UB 2DICA 4U6YB 3MNVB 3U6RB 4P59L 2C1OB 5SV3A 2DRUA 4X5XA 3L5XL 3GSNA 4FQ1H 4PGEB 1F3JA 3IF1A 4MMXC 3HE6D 5F88B 2R4SH 4U7KA 2HJFB 4HIJB 4N0YH 3VH8G 2WY3A 1LEIA 3E6HA 4P3DB 2B20A 5ALCH 4G9DB 3CFCH 1BP3B 2DMCA 1CFSB 3H6JA 1G9NC 5KS9E 2EDRA 1S7XB 4OCMC 1VPOL 3RWDA 3S88L 4K3JH 3R0NA 2FWOB 2V5MA 5I2IA 5HHPA 2CLZB 2IPTH 5ISZD 3MJ7A 3O9WA 1PZ5A 4XMLH 1ZMYA 4CADB 2FD6H 3NACH 4QHLA 1DCLA 4MSWB 1T03H 4UUJA 3ABZA 1AGCA 1U8PB 4K9EL 3FCTA 5A16B 4PRIA 3LS5H 5T3ZE 3OXRB 3VW3H 2YD1A 3S3JA 3U0WH 5C0AD 4G6JL 5IV2B 3F8UB 4OF5A 2NR6C 1LE9B 3L3DB 1S9YB 2UZIL 4QHUA 5HI3D 4DQOL 2D7TL 2MQ0A 1GGBH 2DQFB 3G6JA 5FYJD 1J8KA 3G5VB 2OL3B 3BMVA 4KV5E 5E2VL 4JFOB 2OBGA 2ATPB 2OTUA 5BXFA 1QRND 1RVFH 3PQYB 5AZ2H 2VDNL 1Q9OA 5H37G 4PTTB 1QACA 4OLWH 3KWWB 2YRLA 1QBAA 4UOW0 4Y19A 3V7AE 2X1XR 3G5YB 4X9GA 3RWGA 1IQDB 1T7VA 4HLZH 1RJCA 2I5YH 5D71H 3TVMC 2WV3A 1QNZL 1EHXA 3VXME 2AK4B 4PJXB 4G43A 3V9FA 2EH8H 3RVVD 3RZWA 4K8RC 1N5YH 1FN4A 3FQNA 3NFNB 3L9RB 4HV8B 4YHZH 4QF1A 3ES6A 4K7PX 4L3ED 2ATKA 1JHTB 4XH2B 2MOVA 2P7TB 4MA3B 2F53D 3AM8C 2DQIL 4Y16B 1OCWL 3T0EB 1P2CB 1Z9SA 5FHBL 3EHBC 2VLMD 5F9JB 3BP7A 2OR9H 5HYQA 1I4FA 1AD9A 1NGYA 3TWCL 4ZUUA 4L3CA 5CILH 3ULUF 5CEZE 4YHPB 2NY5H 1C7TA 3IJSB 5MEQB 3WSQL 4XBEH 2AJZA 4PJEB 2AJVH 1P6AB 2EIBA 4I0PA 4CDHA 1I3UA 3H8NA 1I3RA 2DKMA 5ID0B 1SM3L 32C2B 4IS6B 4NWUL 5HJ3A 3MXVL 4HZAA 2P8LA 5DRNB 1KLUA 4ELKB 3CLEL 1CQKA 1KC5L 3ZTNH 4JFHD 4M5ZL 4EVNB 1ITBB 1IKNC 2A9NH 3DX9A 4YHIA 5J57B 2ADIB 3MRGB 1K3ZA 5GJSL 2JB6A 2XWTA 4ORZC 2VXTL 4DEPB 4OFYA 2P44B 4D0CB 4G6KL 1GCFA 3RRQA 4N5UA 1B0WA 1JNJA 1FO0A 4JRYD 1VADA 3VFSA 4RFNB 1B0RA 1CWVA 2W07A 4UDUB 1D6EB 3PDOB 1JZ5A 3OB0K 4ODHL 3TH3T 5EZLB 4K55A 3EJZD 4I48A 5FO8B 3JTTA 3MRFA 2NR6D 4ODXA 4KMTH 3E3QC 2VC2L 1CD8A 3HMWL 1X5ZA 1INEL 3BVNB 3GRWA 1P84J 3KPRD 4K3DH 5AAWA 4GRLB 5K93A 3MSPA 3HC3L 3T0XA 4RSVA 5E95B 2Y6SC 4NQVB 1CBVH 3MYJA 1KELL 4XCCH 3D0LB 5HPOA 1YQVH 1S7RA 3VCLA 3BDXA 3KPPA 3GIZH 5DMKB 3FAWA 1ZGLM 2BRQA 4E42A 3W5NA 4ODWB 5IQ7L 5MENA 1EX0A 1B9ZA 4XZUA 1DN0A 1Q94B 3BP5B 4RFOL 1NFKA 5DK2B 1GGCH 1I85A 5CBAB 3LEYH 2CLVA 1WICA 1CGSL 1MHCA 5HHQA 3HI1B 5EU4A 1K3IA 3FQXB 3ARDC 5C71A 5DFVC 3UJJL 1UEYA 4GAYB 4YHOL 2V17L 1J12A 4IOSD 1TPXB 4ZUWA 1T5WA 1EEZA 3FT4B 4R97C 2VOTA 5E6YA 4KTEH 1FG2A 4I77L 1GJIA 4ZUTA 2IADB 3QXDB 2D03H 4Q0XH 4ELMB 4YGVB 5I1HL 1MCNA 1X5GA 2P42B 1S7SA 2FEDC 2NY0C 4AQOA 1UFUA 3EHBD 1TZGL 3MGOB 4OLXL 2HKHL 4B5EA 1XGYH 4TQEL 1BQHB 1H0DB 4DZ8B 5C2BL 2B4CH 3PXJA 3AREA 5J11B 3ZE1E 3DGGB 3SO3C 1TVHB 3J8F7 3PWPE 3MUZ1 4XPHH 3FFDA 1YEGH 5D1ZC 4M43H 2AQ3A 1B6DA 4JFFB 5KANG 3X11A 2IPUK 3NPSB 3SE9L 4D0DB 2PYEA 3O8XC 3PHOB 4FTVD 3H0TB 4BQBA 3R1GL 4LPCA 5CIPA 3MRQA 43C9A 1INDL 3CXHJ 3QP3A 2HFGH 4P5TB 1UM4H 5J1TC 2YD2A 3QDJA 4DZBA 4RWYL 5LAXA 3JV6B 3PP3K 4X6BB 5HHMA 5IB4A 1FBIH 2BVPA 2C5DC 1A14L 1G9MH 2XN9B 4ODUB 1EJOH 3NVQA 3SDDC 1IAIH 5C0GB 2C7UA 1RK1B 4NOBA 3MNVA 3D85B 4LLDB 1FZJA 1MFBH 3OTTA 2BHYA 4PGEA 3MRKA 2R69L 1M7XA 5EN2B 2DQJH 1N0XH 5TFSL 3CMOL 4LK4A 3GSQA 3TIEB 3VGEA 2HJFA 4HIJA 3BX7C 3RDTC 1UGNA 5TDOB 3CH8A 4D8PA 2VYRE 4H8WL 4IRSC 1DQMH 3WFZA 5BZDA 2Y6SD 1CFSA 2HFFB 1A1MB 2Y36L 3RIAF 1S7XA 3RU8L 3PP4L 1MUJB 3TYGL 4QRPA 4S1SL 2AI0L 4U31A 2DS4A 4MA1B 3TF7A 1D3CA 4QNPE 1KTLB 5T3XD 5BQ7A 2AJYH 4CADA 2ZPKL 4G3YH 3QPXH 3D39A 1MWAB 3RIFF 3VFMB 1X5LA 4DK6A 3QUZC 3MO1B 5A16A 3QULB 4N68A 4PJHA 5C6PB 1S7QA 3ARDD 2JCCE 3CK0H 3OG6B 5E8OA 3ZKXC 5DFVD 1U3HA 1X5HA 5EO0A 2WQRA 2B39A 4QHMB 5IV2A 3CJJA 1X4ZA 4OCYL 3QCVH 2H9GB 1S9YA 1AO7B 1OWRM 3FRUB 1GGIL 3F7PC 2SEBA 4KKAD 4NQTA 4B7LA 2V2TB 3EAKA 3HUJE 1KIPA 2AK1L 1JPTL 3PABA 3V7AG 3RJQB 3M8OL 4R7NB 4WHDA 2NY0D 4X7FC 3U4EB 1RHFA 3VGDA 1CDUA 5BV7B 2YEZB 4OIAA 5JW5B 4JFXB 3ARPA 3BIKA 3GMQA 1PYWB 4PTTA 4ZSOE 4XP5H 4TVPH 5J9PA 5FKAB 5CSZA 4HFUL 4P2CG 1GZQB 4M9OA 2X9YA 3W81A 1YJDC 1V05A 1RHHB 1WBXA 4HWEL 1SBBA 5LKNA 5ADPL 1KCKA 5D1ZD 4LLVA 5IIEA 3VFPB 4WEMB 2DQEL 3QJFB 3P4OB 3T1FA 1F3DH 4NKOB 1WT5C 3O8XD 4WWKB 2AK4A 4PJXA 3ZHLA 3NOIA 2OR8A 5EOCL 3UBXI 1BOYA 3L9RA 2DJUA 2P8PA 1AFVL 4PRBA 1HKLL 4XH2A 3L3HA 3KPOA 5F1IB 4CL7A 1Z0MA 4MA3A 5ISZE 3LRSB 1OF2B 3GSUA 3S35L 1A2YA 1QOKA 3A67L 4I5BA 4ZUVA 1S5IL 3WKML 4TUKH 3KJ6L 4IIQC 3W2DL 1O0VA 1XGTB 4S1RL 2ZWLT 4FXGB 2V5RA 1X6LA 5B39B 4GQ9L 5GRJH 5IFHH 1JRHH 3SDDD 2B1AH 1FRGL 4NM4L 5BVJB 1KJ2B 3G08A 1ETZA 3P4NB 1T1YB 5D6DC 3ZKNC 3IJSA 5MEQA 1TTUA 3WHXB 4LKCA 5A1AA 2X4QA 4QWWC 4XVTL 4PJ9A 1MF2H 1JCKA 2PW2A 1C12B 5TPWH 5TE6H 5ID0A 4TSAH 5FYJE 3RDTD 4YBLB 2WUBL 4HH9A 2CPCA 3RL2A 4BQ9A 3NIDE 4ZFOA 4IRSD 4Y8AA 1I1AB 1QRNE 5I19H 2JB5L 4FFYH 4KUCF 2I9TA 1OAZL 3UBXG 2AXGB 3GNML 2IG2H 4OKVB 3UO1H 3V5KB 3CSGA 1BD2E 4H20L 1M05A 5F7UA 4JFQB 3MRGA 1OTUD 3GFUA 3VXOA 2HRPL 3JWDL 4OFVA 3Q1SL 2ZOLB 1X3DA 3O0RH 3TIDB 1MLCB 3HC0A 1OARL 2IEPA 4OZIB 1C08B 4IMLB 3VJ6A 3QUZD 5GHWH 5IB3A 1YN7A 2YD5A 3TEUA 4UDUA 1D6EA 5E2UL 4CN6A 5D2NB 1AR1C 4L3EE 4JZJC 3X13B 4OJFL 1P7KB 3QCTH 4JO2L 5JQHC 3SGDH 3X12A 4HWZA 4HKZB 4HJJL 3IS1X 1ZHKA 1F11A 3MRCA 3RIAK 2MNUA 4NJ9L 2BHZA 4LDOB 1A6AB 4OF0A 4TN9A 3BO8B 4XMKL 1OAXH 4V2CB 1SY6H 1FGNL 5HI4D 4U0RB 1JGUH 4GQPH 5B4MC 3QAZB 5IJVB 3DBXB 2E9JA 1YPZA 5KAQG 3D3VD 3QEQA 4G8FA 4X4MA 4XWGH 2X4TA 4J1UA 3ELAT 3RIFK 5DS8A 4ODTH 3TFKC 4NQDD 2UZYB 2X1PA 4DOHB 5DK2A 2FJHA 3QIWB 3MRHA 2YK1H 3KPNA 4Y1AD 2O5XH 4R2GB 1L4IA 1LMKA 4OAWA 3TO4B 3HI1A 4UIMA 5CFHA 3PHQB 4QLRA 1SMOA 3VFRA 3O6FC 4YC2C 1S7WA 3HAEB 4JFHE 2HWZL 1U8MA 3EJYC 4YDIL 3F7VB 2IPKA 3RBGA 1LK2B 5F96L 3FOLB 1PEZA 4X80L 3BPCB 4JRYE 3D69B 1DL7H 1U92B 1HQRA 1I8LC 1NL0H 1R5WA 2VABB 5F71A 3VRJB 2KH2B 3EUUA 5SWZD 1X7QA 5IR1B 2CXGA 1J86A 1MRFL 4OD3L 3NFSH 1KXVC 3ZKND 1HIMH 2JK5B 3EW3B 4M62L 3NBNA 2I9LB 2WAHA 1VFMA 4JHAH 4QWWD 3P11H 3FMGL 2CQVA 3KPRE 4V1DA 3C5ZB 4JFFA 1KUMA 4JQVC 2X4UA 4ZUSB 1V7NH 4HPYH 1MIEH 3H0TA 1P9MA 4MX7B 5D7IB 4PGZA 3ZE2F 1K8IB 5GGUA 3BGAA 2CK0H 4X6BA 3S4SG 1F97A 2DB8A 2VZSA 3WFHB 4JVPA 4I2XE 3P77A 4HWBA 2EYTB 1ACYH 1MPAH 2XN9A 3NCMA 3LD8C 4MAYC 3IAGC 2HH0L 1TJGH 3LY6A 3VFVB 3X17A 3IXAA 3D85A 4BH7B 4LLDA 1EK3A 5HGHB 1AC0A 2W9LA 1AR1D 5L88H 1MVUA 4NO0A 2MCPH 3JWOL 2CJUL 5E99L 4P46B 4LGSB 5JPNA 1T66D 1DVFA 4FQQA 2IAMB 4P5KB 5TH2A 3TIEA 4N0FA 2ENSA 4PB0H 4JZNA 5DC0A 1I7ZB 4JB9H 5TDOA 3LKQB 3OBAA 4P2RD 5CWSA 5EU5A 3UROR 2R29L 4XVJL 5GGQH 1QFWH 4W68A 1UCBH 1F2XK 4HS6A 2NX5D 3U0TB 1IGCL 5ALBH 1NFIA 5B4MD 2FR4B 4J3OC 2DQGL 2X10A 5CJOL 1UWGL 1OTTC 2VR9A 3TFKD 1W72A 3CDYA 1MSPA 4YHLH 4OM0H 5DJAB 3AC0A 4NQCE 4FQHB 4U1SA 3KGRA 4BZ1L 3FB8A 3FN0H 3GMPB 3CCHA 2G9HB 3VXUA 1TXKA 1XF3B 4Z0XB 2Q87A 2F5BH 4UTBL 1TTGA 3TP4A 3O6FD 5KN5B 2WLYA 1D5IH 1QSEB 1RMFL 1YYML 3EJYD 5IK3B 4Q6IC 4PPTA 2B7DT 3RVTC 1YEIH 3L3JA 4JLRA 4KK5D 2W9EH 2BVTA 2WQ8A 4KDTC 4TUOB 4UBDD 5GGTA 2QHRL 5ANME 5TDPB 1D9KD 4P4KD 3FO1B 2F54D 3C2SA 2HFEB 4I3GA 4WUKH 2RB8A 5KSAC 5FKAA 2IWGA 4R8WL 1KEML 2E6QA 4OCRH 3BKJL 3U4AA 5HY9A 3W9DB 3NA9L 4S1QL 3EYVB 3LDBB 3E3QE 3TBSA 4U6HA 3QQNA 3BISA 5I9QC 3O2DA 3QNYA 1T21B 4I0CC 5EORL 4WWKA 4R90L 2N56A 5ADOH 2VXQH 1M71B 3TGXA 2IBZX 5F1IA 3WLWC 2PO6C 2E7LC 1ZHNA 1KB5A 3EOTL 1JYVA 1CI5A 4M5YL 4C55A 1KCGC 2E8YA 4CBPA 1BEYH 5FK9A 4LASH 3PL6B 2YPLD 5HDQL 1QFHA 4GG6F 5HDBE 3H9SD 1F4HA 5EULV 3M17B 2CDFB 1FVEB 1FNFA 3LS4L 2JLLA 3DRQB 4FQIL 1UM6L 4MAYD 3IFNL 2GSIB 4X4YB 5J89A 1T5XB 1DQDL 2BSSB 4RFEB 1JPGB 4EBQL 1VKXB 1U3YA 1PQZA 2Y72A 4QXUL 2XG5A 5J8OA 2HJLB 1G7IB 4CVUA 2NY3B 1VGEL 4WHCA 4NNPH 4M3JA 5H35B 4NCDA 5IFAH 2ICEA 3ALWA 4ODVH 5EWIL 5GSRB 1NGZB 1BX2A 4FFZH 1FE8L 4FOMA 5MI0B 3LVEA 1JHKL 4GXVL 2AXGA 5I1GL 5EC2A 4XWOC 1CTOA 3V0WH 4JFQA 4KQ4L 3FB7A 4P4RA 3S7GA 4XP1L 2W1NA 3LSOB 4OZIA 4IMLA 4NQXB 1LO2L 1XF2A 2FECI 1WEJL 2FGWH 2NZ9C 4H8WC 4XP6L 1IC5L 4L9LC 5DD6B 2CKBB 1UZ8A 3BKYL 4JANB 5I73C 3GMNA 4OFDA 1F4XL 1RURH 4HKZA 3RVTD 4QOKD 3QWRD 1D5XA 2WWMD 1V3KA 3OKOA 5I76B 1NCAL 3IJYB 1A6AA 4HC1A 3ARTA 3BO8A 3AU1B 3ARSA 4MHHI 3MYZA 5I18H 2BC4B 4PJ5B 5KSAD 3MXWH 4XNUH 3UTSA 4X6DE 4NKDB 2WINA 3C8KA 1RPQA 1SJHB 1U58B 3QIWA 4XVUC 4QGTA 2VDOL 4NO5A 4GRWH 2PTTB 4L4TB 3R06B 2VQTA 3FRPG 3PHQA 3WIFB 4AH2B 1NGQL 4I3SH 2BMKA 2EO1A 4LLAA 2VLJD 1CE6B 3KPSB 1TTFA 1QBML 5HD8C 4NGHH 5T1LD 3C09B 5J1AB 1NH6A 2V9QA 2VLRD 2BNRD 3DJ9A 4XNXL 2QR0A 2M26A 1NC2A 3QG7L 5DDHA 1IL1A 1U92A 1XF4B 2VABA 4MHHG 2IALB 2DM3A 5IR1A 1JZ8A 5DHYB 1NLDH 4LEOB 5EBWB 4PRAA 5EUKA 3IETA 3IVKA 1N8ZB 1EIBA 4LCWD 2X2YA 3AY4A 3P4MA 4GJTB 2CO7B 3TO2B 4FRWA 3S34H 2VDPL 3S9DB 2VDRL 4ZUSA 1FAIL 3LIZH 1P7HL 1RUPL 5L0QB 3HZYB 4GAJL 4KQ3H 4RGND 5D7IA 1FH5H 3D3VE 4NN5B 1J0ZA 1NUGA 3SDXE 1Z5LB 1QSFB 4NQDE 1Q0XH 1A6VL 4O58H 4LDEB 4ZXBB 1NBYA 4JFYB 4XPTL 3RAJH 3DMMB 1GC1H 3C6SA 4Y1AE 1PLGH 2GCYA 3I2CL 4H5SB 4NNXB 2XKSA 4L4VD 5IVXE 2DWDA 3THML 1NMAH 5HGHA 5JQ6L 2OL3H 3RUGE 5LQBL 3GMMA 1F90L 2DLTA 3B6SB 5H94A 2OP4L 4PJ8C 4UV4L 3QUXA 4X7TB 2XACC 1TETL 2FIRT 4OQTH 1C5CH 2RCSH 1I7ZA 3RY6A 5C0DB 3DX6A 3BEWB 3O2VL 2YN3A 1ZT7B 2AJUH 3JWDC 4CUCA 4J4PA 4IRZL 3U0TA 5SWZE 2FSEA 3N0PB 2FR4A 4GFTB 1T4KA 5E8NA 1RV6X 4HXAL 4IJ3C 3JTSA 4OSUH 5D7JC 3QQ3A 4XPFH 5DD5H 5IVNA 4XVUD 1VGKB 5DJAA 3LKSB 2GJZB 5C09E 2ZCHL 4V3EB 3OXSB 1MREL 4U1MB 1I1YB 5GGRA 1UXSA 3GMPA 2G9HA 8FABB 4ZNCD 3WS3A 1KLFA 1SYVB 2ADJB 3C08L 3MTRA 2IF7A 3UTTB 4M6ML 2R0ZH 1WCQA 1QSEA 4LPTA 3W39B 3B5GA 3RWEB 1WAAF 5IK3A 5HD8D 4W4NA 3QDMB 4TUOA 4Y5XB 3QUML 5TDPA 5C0FB 2PF6A 4UOW1 5EO1A 1CR9H 1G7LA 4EOWH 5E70A 4RMSA 5A40E 3T1WA 2A6IB 3FQUB 4M1GH 5CP3A 2B8OT 1S78C 5C08B 1H3PL 5DD0H 3EGSA 1M7DA 2Z35B 3DUSA 4G7VH 5CP7A 4PJCF 5DI8A 2EDLA 4F7CB 2FATH 5JHDB 3KXFA 3TJHC 1SBSH 2X42A 1P4IL 4H0HB 4P2RE 5DMIH 4JKPL 1L9NA 5AEAA 2NX5E 4KHXL 1PJ9A 1U2HA 2WNGA 5IKCB 1WFOA 2VDLL 2R8SH 4FQXC 4F7MB 4XB7A 1OW0A 3ZDXF 1FSKC 1UB6A 1RZGB 1OSZB 1HN1A 4M1DL 3S4SB 3KPLA 4DN3L 2NY6C 2YBRB 4XB8A 3RGVD 2CDFA 4P49A 1NFDB 1X5XA 2CDEB 5DT1H 3DRQA 4PP8C 3JV5A 3AS0A 1HI6B 4OFKA 4X4YA 5HVWA 4RFEA 4DGIL 5F7DA 1XR9B 3X3GH 2HKFL 2ZSWB 5T33H 2P5EB 2IMNA 4PJ8D 4MGXA 3SDCD 3KYOA 4MNQB 5H35A 5CEXA 3BXNA 1B4JL 4JPVH 3CVHL 4FQ2H 2F54E 1HH9A 4UB0L 1AP2A 5D7LD 2ESVB 3SKMB 5F89A 2ADFL 5AZEH 4F33A 3C60D 4KRPC 3WJJA 3ME0A 4MVBC 1UKSA 2JCCB 5D1QB 5D7JD 3TM6A 5J3HC 3JWOC 3LSOA 5EIIB 1PZUB 5JIHA 1ZOXA 2MWCA 4JGJA 1A9EB 1UVQA 2AERT 1U8JB 2BXYA 3OKMB 5C3TA 3SGEH 4RIRB 2MCG1 3MV7B 4RZCB 3U9PH 5K9OB 1ZGLP 1BZ9B 3GI8H 2CGRH 2ZG3A 1IGJB 1HWGB 3JVGC 3GB7B 1A0QH 2YPLE 3ARGA 1FIGL 3H9SE 5I76A 2QQQA 3V4UL 1VFBA 3O11B 1CCZA 3IJYA 5FCUH 3IS0X 4Z6AT 3GO1L 3AU1A 1R5IA 4K2UL 4EQ3A 5BW7C 2Y23A 4L3AA 1ZVYA 2AV7B 2IFFL 1DSFH 3F5WB 5E6ZA 4EUPG 5EPMA 3VXMA 1KG0B 4R4BB 3V6BR 1ZANL 1YEFH 3CFBA 3L95B 3SE4C 4YGAB 2QL1A 4WUUD 5LBSH 3TJHD 1KN2L 3OKLB 2RQ8A 3SE8L 2BXZA 3NZHL 4L4TA 4X6EB 3FQTB 2DMKA 2HLFC 4M6OL 3JSSA 4ONFL 4NSKA 1FGVL 1SYSA 2OJZL 2WLZA 5SV4A 4AH2A 3OSKA 4NN6C 4JO1H 4NZJA 1AIFA 4IRJB 4XCFL 3U1SH 3DVIA 2JJSC 3MNZB 2YRZA 2MHAA 5KSVA 4S10A 2NY6D 5C0AB 2YZ8A 1MJ8H 3T4AA 4GLRI 4KJYB 1EFXB 1XF4A 3SGKC 5CZVH 4LSQH 4U33A 5DHYA 4UDTA 2L7UA 3EO9L 3BAEH 4HIHA 3ZTJH 1CFQB 4GBXA 3V6ZA 1PY9A 4Y5VB 3RZCA 2UZXB 2BNUA 4QOKE 5CEYA 5LWYL 1NBZA 3DXAB 2YZ1A 4F9LA 1SVCP 5IEHB 4GG6B 2ARJQ 4U1GB 4XP9L 4OV5B 3SE3C 2OQJB 3HZYA 2Z4QA 4MJ4A 1IT9H 1W72H 1K4CA 1C16A 2OS7A 4PG2A 3EFDH 3U4BL 1MWAH 4NNYA 5T1DL 3MUGA 5FUOH