4QRTA

Crystal structure of hla b*0801 in complex with eln_yym, elnrkmiym
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
276
structure length
275
Chain Sequence
b'GSHSMRYFDTAMSRPGRGEPRFISVGYVDDTQFVRFDSDAASPREEPRAPWIEQEGPEYWDRNTQIFKTNTQTDRESLRNLRGYYNQSEAGSHTLQSMYGCDVGPDGRLLRGHNQYAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAARVAEQDRAYLEGTCVEWLRYLENGKDTLERADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, B-8 alpha chain
publication title Molecular imprint of exposure to naturally occurring genetic variants of human cytomegalovirus on the T cell repertoire.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 82
structure length 275
sequence length 276
ec nomenclature
pdb deposition date 2014-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4qrtA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4qrtA01
1UXSA 3KPNB 5T1KD 2NY1B 3O9WB 4OZGB 5I1GH 2K3TA 3MCG1 1QEWB 5EG6C 1C5CH 4UTBH 5DQ9A 4GLRI 3IJHB 1N2RB 5EU3A 3UTSD 5HGDB 4QXGL 4PGEB 4TRPL 4O2FA 3L3KA 5DJAA 1MCWW 5DJ2B 5I19L 1JNHA 2XTJB 3DSNA 3MV7E 4BZYA 3AB0C 4FQJH 3GSNL 4RAUA 4JVWA 2F53D 4DUVA 1GPOH 1OT2A 2AKRB 3WFDH 1AGCB 4NP4H 2DJ4A 4PJ9D 3EYQC 4NQDD 5C0CE 5MP6H 3MFFA 3MXVH 4HXAL 1SJEA 3U79A 3M1BB 5DK3A 2WMPA 3JWOL 4P2YA 3QXUA 1G9MH 3EYSH 1ZOXA 4LAQL 4MZ3A 3HCVA 4QRQA 4TULL 3D2UB 3NA4A 3EDKA 3OSKA 1IRAY 3VXSD 3Q6FB 3DX7A 2XYCA 4GRLD 5SV3A 3W0WE 5JNYA 5IG7B 4M6OH 2NY3C 3TO4B 3DHJA 1ZGLA 2XZCH 3MLTB 5TQ2H 5I1LB 1EXUA 4JREC 3DPBA 2CLRA 4JRYB 3RL2A 4OM1H 2WINA 2ZNXA 1I3GL 1CXKA 3VH8A 1Q9KB 1X5KA 2PCPB 4PJXE 4Z7UF 5JIHA 4DWHA 5FHAL 4ZXBB 2X05A 3V0VA 4JQIH 5JA9A 3EO0A 1A6VH 3FAWA 3T09A 3ZKMD 3HZVA 4N0UB 5F9AC 2OMNA 4RGOL 5E4EC 3QDJE 1OAQL 1LEIB 5EPMA 3ROLB 4H26A 3ETBF 5I76A 4MB4A 5CIPA 5I2IB 3S5LA 5I0ZA 5HHPB 4Y2OA 1LDPL 3BVNB 3VWJA 3BHBB 3BZ4A 5C9JA 4UILH 5D96C 2AXFB 5FK9A 3VXMA 3OF6D 1LNUB 2D3VA 1NFIA 2W9LA 1QFUL 3I85A 4L3CB 1T0NB 4TSAL 4U1NB 3FMGL 1BMGA 4ODHH 4MNQA 3VXPA 4RCAA 4LLUA 3H9ZA 4OTXL 4HLZH 5EZIL 4OM0H 4RGMC 3G5ZA 1DQJB 3KPMB 2DD8H 4ODXB 3THML 3RRQA 1W0WA 3QYCA 5CEYA 4MA8L 2NX5E 5KSBE 2HLFC 4PJFF 4XP4L 2W9EH 1OD7A 5EOCJ 3NAAH 3ARDA 5GS1B 4LHUB 1EO8H 3RWEB 4EVNA 2BNQE 3IDIB 1HHGA 4XPGL 4PRNA 5A16A 3BDYH 1NH6A 1JI1A 1A9EB 3ZYJA 4PGDA 2O61A 3QZWA 2R1YA 3O6ML 5FYKH 4HPOH 5ANMA 3PDOA 5GGRB 4P23D 5AWNL 3BYTA 5EB9A 4LIQE 2A9ML 2WUCH 4MQXC 4WNQB 5D9SA 1KCVH 2J8UA 5JXED 1VPOH 3B9VA 1OB1A 4YX2L 3VG0H 1YMHA 4QXTA 5AYUL 3T0WA 4P2QA 5F8QC 1XGTB 4KY1H 5L2KA 2EZ0C 2CXKA 3LH2H 3ARBA 5ACMA 1TZHA 5KVDH 4R7DA 2EDDA 4LPTA 3FT4B 3DXAA 2ARJB 1SYSA 2AERT 2DWEA 4J1UB 3TBWA 4JANA 1IAIH 1SVCP 1JYVA 2YUZA 2G60H 1AXTL 4ORZC 5E2UH 4IMKA 3MRRB 1MCCA 5ERWA 4FG6C 4G8IA 4WI7A 2GJ6B 3O11A 5DJCB 4R90L 2VQ1A 1A5FL 1V7ML 3KAAA 4M61A 4ZUVA 2C4FT 1OSPL 2AXHA 3IDYC 1P4BL 3VXRE 4BFIA 1MRCH 2GTZA 3EKCA 1QYGH 4N0CA 3TV3H 4HKXA 1UWGL 1NSNL 1KNOA 3VA2C 5K93A 4Y8AA 2R23B 4R8WL 1S9YA 1NDMB 3EYUL 1IAOB 2WANA 4AQ1B 1G0DA 3QPXH 4NO5A 4HCRL 3X12A 2OL3H 1I7ZA 4TQEH 3IDNB 2F9BT 3RP1A 4U2YA 4CVZA 4PRIA 2R8SL 3U4BL 2AK4A 4HJGB 5I1HH 5C2BL 4M6MH 4Z5RA 3RWIA 3S6CA 3A6CH 2FEDC 4KI5D 2V5TA 4OCXH 4KFZC 5CBEA 5J89A 2X4SA 5I73C 1FGVH 4JGJA 4YHYC 1KF9B 4X7CC 1J1PL 4ELMB 4NZUH 3WUWA 4CBPA 4M9OA 4QT5B 1RMFH 1DQLL 1CL7I 4XRCB 4ONFL 1ZT4A 3I50L 3U2SA 1EERB 1QRNE 1HXYB 4FP8L 3QFDB 4A2LA 1T4KB 4M5YH 4R0LB 3L3JB 3V6FB 3T77B 1M6OA 3FFCE 4X7TA 5EBLA 3X3GH 1CD1B 1JWMB 5JHDE 2J2ZA 4YBLC 4HDIA 1C08A 3QULB 1ADQL 4PBVC 4PJIB 1INQB 2FNBA 4NHCH 4NM8H 4HK0B 1MWAA 4OQ1A 1C8PA 1JTOA 4X6CE 4IIQA 4NCC2 2ZUYA 2YPLB 1F11B 1PG7W 1GC1C 1RHHA 5IFHL 5ICXB 2XQBL 3NCYS 3PWPB 1K4CB 1BVKA 1I7UA 4OCRH 4UI2A 3LN4B 4JFDB 2A2QT 4WW1B 3AMLA 1CYGA 1BIIB 3KHQA 4KXZI 5BMFL 1UB5A 4QXGH 4TRPH 3K2MC 1AHWC 1I3UA 5K9QI 3AFLA 4GXUM 1MCSA 5DDHA 3VRLE 4AG4L 2X40A 4LVOC 4Q9QH 1UQSB 5I19H 1I4FA 3GHBL 3VFMB 5ECJE 3GSNH 3OKDB 5D1QA 3TCLA 3QUYA 4JG1L 2BVYA 1FZJB 5DK0A 2H32A 5DQJB 2L4OA 5FYLL 4LKCB 4E0RB 1PX3A 2CLVA 3ORJA 1INDL 1VGEL 4DKFL 4O00A 2AJZB 4HXAH 1CGSH 2HVJA 1AGBA 5IMKA 4PV8A 3MLRL 1JHTA 1F13A 3FB5B 3SGEI 3JWOH 3G04B 2XTLA 2A0LD 4HUNB 4Q2ZA 3GMNB 4K9EC 4TULH 4H20L 4LAQH 1FGNL 4IOSD 1MVFA 3TT3L 1KYOJ 3VDBA 5IMLA 5C0JB 3TJHA 2JIXD 3DUHA 3D9AL 5D6DC 4MD4B 5C0NC 3O4LB 3Q5YA 1E4KC 2FSEB 4PGCB 1FHGA 1Q72L 5JORA 4UDTA 3RJQB 5EIIB 1U36A 4L4VD 4WWID 1BOGA 1I3GH 3D18B 3I3BA 4YDLC 1TFHA 2ZCLL 4XVTH 5D7KE 2YA0A 1TJHH 5F97E 5GGSY 3MCKA 2BSTA 3STLB 4OFKA 5FHAH 2PXYA 4MJ4A 4PBXA 1NGXB 4PLKD 4NCDA 3FTGB 3GNML 4X6DB 3RDTD 4HWZA 4X9IA 5EOTB 2CKNA 1U8LB 4I5BA 2EDNA 3L1OL 5C0EA 3TNMB 4AQOA 4F7TA 5D2NB 4JVPA 4JN2A 2WW8A 3B3IA 1MF2L 3FZUD 3JV4B 4PP1D 3EJYC 3MR9A 4UQ3A 5D93C 3KPPB 4WI6A 4WJ5A 1LDPH 2FRGP 5DMGC 3QXWA 2VLRA 1OSZB 5A3ID 2FD6L 4G42A 4LEOB 4Q6IB 1QFUH 1RULL 1QKZL 1NKOA 5IT2L 1J05B 2K7PA 4TSAH 2YC1B 3FMGH 4BSWB 2AJUL 3QIUC 1HI6A 4H8WL 5B39G 4XNYH 4P4KA 1I9EA 3QPQD 4L8SA 4DGYL 4Y1AA 4OTXH 5EZIH 4HIIB 2A74A 3THMH 2X1QA 3M8OL 1YEFL 3H6JA 5D7LA 4MA8H 1KXVC 3CLFL 5GZNC 4XP4H 3F62A 5HVFB 2X4RA 5EWIL 4I3SL 5HHXL 3ZE0E 3SKOB 5GSRB 3TO2A 1TQCC 3MV9A 3O6MH 4NQDE 4ZTOL 4JGMA 2EYRA 3GSOA 1NGWA 5AWNH 1DVFB 4LP4A 2A9MH 1H8NA 2P8PA 4ZS7L 5FM8A 5GS2D 3VGAB 2YMXL 5TDPB 4O2CB 3C8KA 2Z8VC 5BRZB 3S7GA 3T1WA 5F9JB 5AYUH 2Z31A 2NTSP 1CU4L 4KKNA 3FHAA 1JZ8A 3U6RB 3IS1X 4JLRB 3PP3K 1L8JA 1S8DB 4NDMB 1CE6B 1GGCL 1Q9WB 4Q9BA 3OTTA 4R2GD 1CT8A 4PLJD 3U48A 1G7MB 3V4UL 3TFKD 4H0GA 2W0FB 2OI9C 3LKQB 4E42B 2Y36H 3LKSA 4LQFL 3DIFA 1P4IL 4L9LC 2KDGA 2ORBL 3O4OB 5IJVB 4ZFOB 4WWKC 3TZVB 4OFYD 4MMZC 1AXTH 1NCNA 1TCMA 2PW1B 5L2JA 2OX5A 2CDEB 3WLBB 1NGZA 4Y5XB 3HE6D 4JKWA 3PL6D 1A5FH 1V7MH 3K80A 5E99L 7FABH 2ADJA 1OSPH 3MUGA 1P4BH 2C3VA 3CC5B 3INUL 5HJ3A 5EFIB 5F9DC 4M8QA 5I6XC 2MQ0A 3F5WB 5D1ZA 3BGMA 1UWGH 1NSNH 1K8DB 5BS0E 4JCLA 1HHIB 4R8WH 1YPZE 3EYUH 5DFTA 2ATKB 5D7IE 2YUVA 3O3DA 4KRNA 4HCRH 4F7PB 1U91A 1HHJA 3H9SA 3U4BH 3UROR 4J4PC 4X9FA 5C2BH 5IB3B 2WK2A 4MNGA 3VWKB 1B6DA 3HMWL 1TZGL 3CFBB 4JFEA 1G84A 1J1PH 3UJJL 3I9GL 5T3ZE 1JHLL 1DQLH 2DTML 3P4OA 4JB9L 4ONFH 4RAHA 3I50H 4LFHG 3HPJB 4P46B 5IB4B 4UZGA 1CDIA 1CDYA 4XBPB 4FP8H 2UY7A 3DETC 1FNAA 4Y5YB 2XNAA 4YDKH 1D5XA 3NTCL 4CADB 5JUEL 2PW2A 1T6WA 4KKBC 4U6VL 3QO1A 3EDFA 3N1QC 3MYJA 1ADQH 3JUYA 1I85A 2D7TL 2CIKB 4IOFD 2CLZB 1SQ2N 2BSSA 2J5LB 3TN0A 1CCZA 2JB5L 5T3XD 2YEZA 2LU7A 2VUOA 1AR2A 5ESVB 1WIPA 1RZJC 1UWXK 1CIUA 3EYQD 4UV7H 1Y18A 4HIJB 5CJOL 5IFHH 4AL8L 1MHEB 4PJCA 5DJXB 2XQBH 2HVKB 3QDME 2DBLL 4OV5A 1VKXA 1ACYL 5DXWA 4DZBA 5DC9B 3U83A 2Q8BL 4N9GB 5GGRY 3C09B 4X9BA 3I75A 5D70L 5BMFH 3S34L 1DBML 3MV8D 4YHMH 4Q58C 1QD0A 2Y72A 1EH9A 4AG4H 5GGUA 3MOAL 3QNZA 3GHBH 5J7CC 4PRPB 1X6LA 3FO9B 1NC4D 3QUXB 4DVRL 5HHMA 1V5JA 4JG1H 4OF6A 2KBGA 1CD9B 4WW2B 5FYLH 1A3QA 3WFEL 2DRUA 1INDH 1VGEH 3ROOB 1INEL 2EDEA 3EOTL 1IKNC 3BUYB 1RY7B 4JFPB 2P24B 3JTSB 2P4AB 4BZ2L 4GQ9L 3UDWC 3G9AB 5HPOA 2V2TB 3MLRH 5T33L 3RZCB 4OCYL 1PKQA 3KPSD 5DJ6B 5JO5A 1TVHB 4YHIA 3HR6A 3HLAB 4H20H 1YNTB 1X5IA 1FGNH 1BX2A 2UVFA 5ICYA 4OI9A 1NCTA 4Q97A 1WBXA 1UH3A 3PHSA 3D9AH 4JPIA 1P7QA 3D0VA 1J10A 2FCBA 3IVKB 1OWWA 5F1IB 4O51A 2XPGA 5I8CB 1Q72H 3BI9X 2PTUA 5JW5B 1G7HB 5SWZA 2FJFA 2YKLH 4W6XB 3HFMH 1S5IL 3T2QA 3LZFL 1F4WL 2Z8RA 2ZCLH 2I9TB 3WNPA 4GXVL 3ZLQC 3SDDA 4YFDB 1IAKB 3HHRB 1UKQA 7CGTA 1DUZB 3GNMH 4P2OD 4NZRL 3LKPA 1QBBA 3R4DA 1RIHL 5ESAB 1D5IL 1HH6A 2MHAA 1A3RH 3DO7B 1MF2H 4TPRL 2W59A 4X0KA 3MJ9L 2X4OB 4AMKL 1ZS8B 1NGPL 2EEBA 1IEAA 2KL6A 4X8JA 5GHWL 2DS4A 4GRMA 1LEGA 3PNWA 5FA4A 3BRDA 2VE6A 5EU7E 5T1KA 2XG5A 1NBYA 3SBWA 3ALXA 2FECI 2ZUVA 1FPTL 1CICB 1UXWA 1ZTXL 1Q0XL 2FD6H 2LAGB 1QKZH 5C3LD 1N3NB 4BSJA 2PYFB 5IT2H 3DBXB 5HYQA 5ITFA 2YD6A 4HWNA 4KROD 3OHXA 1H0DB 3WLWC 1M4KA 3PQYD 4MSWB 2DL2A 2X2YA 2AJUH 4LSTL 5I1CL 1BFVH 1PEZA 4J3TA 3HMXL 1KULA 3MSPA 2WWKT 1T80A 4YZFE 4H8WH 1MCOL 4I18A 4IMLB 3ZDZE 3HG1B 2F53A 4YNYB 3UJTL 2DJUA 4GMTH 3AROA 4KGJA 5SX5K 5E03A 4BH7B 2D9QB 2AEPH 3VFVB 5D2LB 3JV6B 5IEKA 1FVEB 1OAKL 2YD4A 3M8OH 4ETQA 1UA6L 4X83A 3QQ9C 1XH3B 2D0FA 4XBGA 5HDOA 3SE3C 3RBGA 5EU7C 3CLFH 3W11C 4B7LA 1E28B 4N1CA 1RIVL 1WTGT 2NXYC 5EWIH 4I3SH 3TJEL 5HHXH 3F12A 4Y4HD 2WBJD 4FN0A 3A67L 4UT6L 1D6EB 4GG8B 1J9CT 3BH8A 5F7EH 3NPSC 2OXHA 3VXSA 1MUJB 5IVXB 1RSFA 5HHOB 1FJ1B 4YIQB 4RX4D 4GRLA 1RJYA 5EIVA 1J86A 4G8EB 2GKIA 2VLKD 4RDQG 4ZFOL 4EOWH 2CJUL 4ZS7H 4JZJB 2YMXH 1TMCB 1CFTB 3GBML 4LPWA 1B2WL 2FYYB 4YHPB 5TGBB 2I60L 4Z7WF 3SDXA 1U58B 5L9DH 5LAXB 1A7BA 1R24A 2LTQC 4I9WE 1G7IB 2ICWA 1G9MC 1MHCA 3F7RA 3G6JB 1CU4H 1S7VA 3KLSA 5IVZB 3U0WL 4ERSL 1GGYA 1GZPA 3QJFB 4G7YL 4X6BB 3B2UC 1GGCH 5DRZA 4QRUB 3B9EA 1QR1A 4X6EA 3QUMB 3V4UH 1FVDB 3MXWL 1I1AA 3HI6L 1HYSC 3EYVB 1ND0A 4LQFH 4TVSa 1P4IH 2ORBH 2VZSA 1PGRB 4D9RD 3FL7A 4X5LA 3S5LG 2FJGB 3AM8C 1GRWA 4PD4J 4DFHA 1LK2A 4Z76B 1FBIL 3DX9B 4LSPL 1BD2D 2OXGA 4GW5A 4JFHD 3VGDA 2NXZD 3UZVB 5I16B 2BY0A 4JZOB 3OF6A 5E99H 5ISZB 1CQKA 3P40A 5E2WL 3INUH 5DHVB 2IMMA 2BVOA 2R2BB 4NBZB 3WEXB 3EW3B 4EN3D 3FOLB 5JLZA 4LLQA 1CTOA 2Q7NA 4RMTA 4U1GC 1KLGB 3EOBB 3TPUE 4DK6A 4OSUH 4L8CB 4HUXA 4Q0XL 3L3OA 4WDIB 3T4AB 1XF1A 5HD8C 3MGTB 3N1GC 1S7SB 5CEXB 4OZIA 4U6HB 1WFNA 5C0DA 3MRBB 2EO1A 4MCZB 4D3CL 3UMTA 2J3SA 3ZE0F 3DRTB 1AD0B 1E27A 1IGJA 2E7LA 1A6TB 1MCQA 1JPFB 2XRAL 3HMWH 2JCCB 4XMKL 4FZ8L 3IGAA 1Q38A 1TZGH 1B4JL 5F3BB 2OJEA 2NY6C 3MLWL 2EH7H 3V4VL 2AS5M 3KYKL 3I9GH 3UJJH 5FYKE 5B22A 3EUUA 1JHLH 4HUMB 1IGTA 1IAII 2DTMH 2GUOA 4D94A 5IW1A 4CW1A 2JB6A 1ES0A 5BXFB 4URTB 3CH1B 4GS7B 3D0LA 5B38A 1K3IA 3ARRA 4ZFZA 5JIPA 5JUEH 1AFVH 4FTVE 1F6LL 4I77H 4WU7B 3DX8B 4U6VH 1SMOA 3WNKA 4RWYH 4L29B 3VFPA 4Y2DC 1IC1A 1KJMA 2Q7YB 3S96B 1FN4A 2H6PA 4HD9A 4LLVA 1XGPB 3TVMB 1JN6A 4K71B 4U1MB 8FABA 4QF1A 1KIRA 1RK0B 3BQUB 3SPVA 5JPMA 2IGFH 2I24N 5CJBA 4V1DD 2DL9A 4ZUWB 3VRJB 1KLUA 4LK4A 1SEBA 3S3SA 4BM7A 1X5XA 1HSAB 1RUML 2GCYB 3CPLB 4JFFA 3SE4A 3GSXB 4AL8H 3MA7A 4WEBL 4N8VG 4PLNC 1ACYH 4I3GA 2DM7A 3UPRA 3SDAA 2YK1L 4NYLB 2Q8BH 1PQZB 3X11B 1L0XA 2X4UA 5EBMB 2P5EA 4AYFA 4JRWA 5D70H 1DQTA 1KXTB 2V2WA 3S34H 1DBMH 2ITCB 3H42L 2RB8A 1WIUA 3LAFA 4MAYA 4ZUSB 3UTOA 4G8GD 1MQ8A 4LRNL 1E4WL 5DRWA 4WEUD 4LF3A 3I6LD 3MOAH 4NC1E 5F7DA 4EBQL 1YMMD 1YPZF 3MRMA 4DVRH 5IBUB 1NGQL 3GMOA 3KXFA 2E6JA 2E8YA 3DX6A 4O5LH 1HIML 4F7EB 2LVCA 1Y6MR 4Y5VA 3WFEH 3GI9L 4WI5A 1HDMA 2XN9A 4X7FC 4CU6A 1INEH 3EOTH 4BZ2H 1NFDE 1XFPA 4GQ9H 3QCVL 1E4XH 5A43C 5IM7B 1N59B 2R2HB 4Z7QF 4HS6A 1EEZB 2Z92A 4LVNB 1ZHKB 5EBGA 4OCYH 4OI8A 5BW7C 5I9QB 4L8BB 4GKZB 2NYYD 5KS9E 4HWBL 5DWUL 1ZA6A 1VFAB 3NZ8B 1QHOA 5ACZA 3DO3A 5D71L 3D3VE 1AKJD 3MNVB 3HAEB 4OZIF 3OR6A 5KZCD 4K3JL 1GZQB 3TF7C 1R5VB 3ARED 3BUTA 3QQ4B 3V5DB 4QGTA 1S5IH 3LZFH 1RZIB 4X4YB 1FLRL 1UM4L 3RAJL 2ERJB 4B0MM 4GXVH 5TDOA 1DP0A 5EC2B 4XCYB 3TBTA 2FJHB 3CGTA 5I71C 4ZG1A 3R8BB 1T7ZA 4Q9CA 1DEEB 4NKIL 3V5KA 1QBLL 3ISWA 4OKDA 3NN8A 1NEZG 4NZRH 1JF5A 2ITDB 4RMWA 2XG4A 3GIVB 1XEDA 1SBBA 3MRLB 2C1PA 4KJQD 4OGAD 1T89C 3T1FA 3QFJD 5TF0A 3O6FD 4RZCA 5EU6B 3FO2B 4TPRH 3NGBB 3MJ9H 3CXHJ 3HZYB 3ILQD 4PV9B 4AMKH 5CUSL 1NGPH 3GMLA 5GHWH 3DMMB 1WISA 5EU5A 4BFEA 3RFZC 1MI5A 3WO4C 1S7WB 5DJ0B 3UYRL 3VFTB 1FPTH 1ZTXH 1Q0XH 2OSLB 4ISVB 4KK6C 3RIFK 3O8XB 3QEHA 4WUUB 3CSYB 4L4TB 4UIMB 4ZSOB 4K8RD 2W60B 4GAGL 1FSKB 3QSKB 1MCOH 1I7RA 3CDGB 3QDGA 3C5SA 3UJTH 4QRPA 4HC1A 3H2WA 3VGBA 1OAKH 3QHZL 4Z7UB 1UA6H 5LCVL 3WXVL 3MV8E 3BZEB 4AM0A 4YGVA 4P2RB 5C1MB 2P8MA 5C0AD 2A6KB 3TJEH 4Y7MA 5IMMA 4ODSL 3GSVB 5HI3C 5I17A 2V7HA 5GGQL 3QUML 3SDCC 1G6RA 1LO2L 1DBBL 2Q6WB 4MX7B 2BVQB 3T4YB 5I1DB 1QSFA 2I25N 1FYTA 4EJ1C 4Z0XB 5E5MB 4WWKD 2CJUH 2NW3A 5IHZB 5E8EB 4BQ8A 1AGFB 4KI5F 1LEKA 3GBMH 1B2WH 4MD5A 4L4VA 3JWOC 1ZE3C 5DJDA 5J56B 1AH1A 4TUOA 4UIKL 4ERSH 1CFVL 1UC6A 4AENA 4G7YH 3QRFM 3RDTA 5DQ9B 4NOFA 5JZ7D 1JL8A 3RNKA 5EU3B 4I0KA 2NY4C 3QI9B 3WIFA 3K4ZA 3MXWH 4GRWH 4XCNA 3CDYA 5DJ8B 4PB0L 1VB9A 3HI6H 3L3KB 1Z2KA 5DC0A 3ZDYF 4NNYA 4KDWA 1JNHB 2ESVB 2AQ2A 4WU5A 2ZG1A 5EO9A 1FBIH 4J6RL 4LSPH 4PJFB 1TIUA 4JJ5A 3STZB 4M7KL 1FIGL 1WVZA 4EQ3A 2QHRL 4WFHD 1YY9D 4JRXD 4PJ8D 2IWGA 2ZG3A 5E2WH 1JZ5A 1SJEB 4PJGA 4U49A 4P59L 3DYMA 35C8L 3U82B 3BFOA 3EYOA 4QOKD 1K3ZA 1M05A 4KUZL 4NJ9L 4N8PA 5KANI 1V3KA 4QRQB 2UZXB 4Y16D 4Q0XH 5DEFA 1BQHG 3DX7B 3C5ZC 5E9DD 1R6VA 1EAPA 3N85L 4JFDD 4JPVL 1FZOA 3UBXI 3VFGL 4APQD 4HAGA 4JFXA 4D3CH 1EXUB 4NWTL 2CLRB 3IFNH 3RL2B 1F3JA 2WINB 2XRAH 3W5NA 1J1OH 1UJ3A 3VH8B 4XMKH 1B4JH 5K9OA 3MLWH 1CN4A 3V4VH 3KYKH 5J9PA 2ICCA 5CFHA 5DD1L 3C6LD 3DGGB 2YPVL 3EO0B 2VR9A 5C0BD 3KPRB 1GGUA 2I5YH 1J7VR 5FO8A 3HZVB 3ARGD 5F7HA 1N0XL 3ELAT 1ZEAL 4N68A 5EPMB 1WWWX 1FIEA 3ZDXF 5I76B 3AGVA 2DQDL 4Y4KC 5CIPB 1WWAX 5LGHL 3S5LB 5LWYL 5F1KC 1PG7X 5FF6A 1LE5B 4PG2C 3VI4F 3VWJB 1JRHL 4MQ7A 4Y19E 5C9JB 4HUUB 2M26A 1M7DA 2HJKA 5FUOL 4LNVA 4HS8L 5FK9B 3SGDI 3VXMB 1NFIB 1HKFA 1U8OB 1U8NB 1RURL 4QHUA 2ARWA 1SM3H 3D25A 4P9HL 2AVGA 3T04D 2P5WE 2V17L 4FZEL 1B0RA 4TSBL 3BAEH 4MVBC 2YK1H 4WENB 3T8XA 3TH2T 4MNQB 3I6GB 3MRGA 5DHYA 3H42H 3B9KA 1BWWA 3LV3B 5DYOA 3L7FA 4LRNH 1Y0LB 1E4WH 3HE6A 3PL6A 1IKFL 1J8HE 3G5ZB 4XNZC 4FQXD 4D0DA 5F3HB 3OKEA 1W0WB 4EBQH 1KB9J 1XR9A 1GIGL 1NGQH 1ZT1A 2XIDA 4ODUB 1QPPA 1HIMH 2HKHL 3EDDA 3QH3A 3GI9H 3LS4L 4JM2D 1GGTA 4U7MA 4K94H 1HHGB 4PJGF 5DGQA 4PRNB 4HFUL 5LG1A 3QCVH 1SY6A 2O61B 4XWOD 2VYRE 4JFHE 4QXWA 3QZWB 1F4AA 3QWRA 4LLAA 5ANMB 2FO4A 4R4FL 3DSFL 3PDOB 2HMIC 2ATPB 5HGAA 4PJHA 5ALCL 3S3PA 2NPLX 1QFWM 5DWUH 1T1ZA 4HHAA 1MNUL 1VA9A 4ZQKA 4YBHA 5D9SB 2Q3ZA 1TLKA 5D71H 5FCUL 1OB1B 2IPUG 2DLHA 2G2RA 4QXTB 2IFGA 4P2QB 4JKPH 3ESVF 5ACLA 4OZGE 5KG9A 3D39A 1PBYA 2X9XA 4OIAA 5L2KB 4DEPB 4LCCC 1FLRH 1UM4H 1BHGA 2IFFL 3RAJH 3ARBB 2IH3A 1LO4L 5C07A 1A0QL 1TZHB 2H1PL 3O3BA 5F72S 5EN2A 1BFOA 3TIEA 1NCWL 3DXAB 2K7QA 3CVHA 4NKIH 2DWEB 2XTJE 3WLWD 1QBLH 4YLQT 5C6PB 4JANB 3OJMB 3WJJC 1TVDA 2MPAL 2GYSA 5JDSA 4BKLA 2R4SL 3IDGA 4Z7VA 1MJ8L 1P7KB 2EICA 4QGYA 5ERWB 1RV6X 4CJ0A 5I75C 4G8IB 2AXGA 1XGRB 5CZXD 1B9ZA 2VQ1B 4ZUVB 1FFNA 5CUSH 1DVFD 3SKMA 4X4ME 2NY1C 2GTZB 3O9WC 4HKXB 1KNOB 3UYRH 3MLSL 1S9YB 5DA0B 3OR7A 1FG2A 4FQ1L 3X12B 1I7ZB 2VZTA 3GO1L 2FGZA 1XT5A 4CVZB 4LCUA 4PRIB 4F8QA 2XTJC 2Z93A 2GITA 4GAGH 3WKMH 1OOAA 3NA9L 2AK4B 1EGJA 1OGTA 5B8CB 2LFGA 4FNLH 4Z5RB 1DBAL 1NC4A 3RWIB 3KPOA 3MV7A 4JRYE 1NFDF 3SY0A 2H2PC 3TYFA 3ES6A 5MERA 4C57C 4KK9D 4KK5C 5K9QG 3NIFE 1X5HA 1YEDB 2X4SB 1N5YL 2RJMA 3KYOA 1HHKA 3QHZH 1QQDB 1MFDL 5DUML 3WUWB 3WXVH 3QISA 4YC2B 1S9XA 3FQNA 3KPTA 5ICZA 2PF6A 5CZVL 3KPSA 1CG9A 3H7BB 1YMME 1HWHB 4ODSH 4N0UE 1M6OB 4BUHA 4V3DB 4IHOA 4PJDA 3HE7D 3RL1B 3QUMH 4X4ZA 4F33A 3IDJA 1DBBH 4XC3L 1V3JA 1HYSD 4J3UA 3TO4C 3C60D 1YN6A 3PGDA 1X5FA 1MWAB 5HYJA 4LAJH 4M02A 1HNFA 2IAMD 4FFWC 2MTPA 1NDGA 4IIQB 3NPZB 5L6YL 4FFEX 2IANB 5E6ZA 1CK0L 1U8MA 5F1OB 1BJMA 4L3ED 3DI3B 1L7TL 4ZXBC 3F8UB 1FL3B 1C12A 2FL5B 4WHCA 3D85D 1BEYH 1JYWA 1CFVH 5D7SH 5DHVH 1BVKB 1I7UB 4ODTL 5C71A 3VI3E 4JY6A 1D5ZA 4P2OA 2EYSB 5H2BA 3F7VB 4FQLL 4X7DC 5A2JH 2H3NA 5C0CB 4GKNA 5HYSG 1UB5B 4PB0H 1KYOK 5DEGA 1OGAD 1OTTC 1QSED 2XZAH 2RGSA 1I4FB 1NCDH 3U7WL 4U1SA 4Z7VF 1EFXD 2VWEE 3WCYA 3TCLB 3QUYB 2DOCA 2RFXB 4KRPB 3PGCA 4M7KH 1FIGH 2CLVB 5IVNA 3WDJA 2QHRH 1F02I 3CSGA 1GOHA 1NANH 1XIWD 2VQUA 5C0RH 1AGBB 4OCSL 3V7MA 3VXUB 1ZSDB 2NY6D 5IMKB 4PV8B 1QFWL 2YRPA 1JHTB 4YQXL 1U8QA 35C8H 3BN3B 3OAYK 1KPVA 3OX8A 5DMIL 4JO3H 3ULUL 4XVJH 4KUZH 4NJ9H 3M07A 2KQNA 1HILA 3ZTJG 5IMLB 2AJSL 3AY4A 2EKSA 2MCPL 1P9MC 3HUJA 2IH1A 4HIHA 1ZHLA 1T7XA 3N85H 1CFQB 4JQXC 2BSED 3VFGH 1FG9C 2FR4B 5F6IB 2VWEC 2F54D 1I8LA 1BGXL 5JORB 4UDTB 4NWTH 1L0QA 1S5HA 5GS1C 3EJZC 5KSBA 1BOGB 3P4NA 2FATL 5CD5C 1MAJA 4OFPA 4WV1A 2Z35A 3MCKB 2BSTB 3MROA 5GIRA 3QIBD 4FQCL 5GRWA 2UY6A 2PXYB 2C1OA 3IB4A 5DD1H 4H8WC 5JXAH 4KJPD 2G75A 2YPVH 5FECA 4PDCE 5F9OL 4RX4A 3P4LA 3O3AA 5F1NA 3WIHA 3UPAA 4TTDC 4PJDF 4F7TB 2GJ6E 1ZEAH 5I74C 3SE8L 3B3IB 4QWWD 2DQDH 3MRPB 5LGHH 4I13B 1HQRB 4UQ3B 5AEAA 5LWYH 2HTLC 4WJ5B 5B3JF 2PTVA 2BVTA 2H9GA 5I8EA 5FUOH 2BRRL 3OXSB 1DZBA 1J0YA 2VLRB 4AK1A 3P0GB 1RURH 2XT1B 4E41D 4L4JA 1G7JA 4P9HH 1FVCA 3BJ91 4M62L 2NX5B 2V17H 2FLRT 2PYED 3IF1A 2BOCA 4M00A 4TSBH 2R15A 1AO7D 4U0RB 4P4KB 1T21A 2D7NA 4ZPVA 4L8SB 3GMQA 4Y1AB 1NBZA 1BD2A 1ERNA 3E3QC 4NRZB 1IKFH 1D9KB 1AP2A 3BN9D 1BQLL 2HFEB 2MNUA 1GIGH 3HAEH 4FFYL 1ZKAA 4LSUL 3VMOA 1K9TA 2P1YA 2HJFA 3RGVB 2HKHH 2QQLL 1S7TA 4G6FD 5DR5L 2ZG2A 4J3WA 2VABA 4QRRD 2Z8SA 3LS4H 1JF1A 1T2XA 3MNWB 3BIBX 3LS5L 4XX1E 1PFCA 5IHUL 3MRIA 3DLQR 4N5EC 1VADB 2WAHA 2EYTB 3GI8L 3MV9B 4PJIE 4DCQA 4JRXE 2X1PA 2EYRB 3DSFH 2OR9L 1NGWB 3GSOB 3OG6B 4R4FH 5KOMC 2DLTA 1TTFA 2P8PB 4HFWA 4KMTL 1JMZA 3GM8A 2BY2A 1MNUH 3HUJF 1LMKA 4GG6A 2AV1A 3JWDL 5FCUH 2R69L 2YHGA 2YPLE 2R9HC 3VXQB 1N7ML 3NFPA 3VFRA 4LCYA 3ALPA 3A6BL 3MBED 3BPLB 4IRJB 3PWPE 4NKMA 1X5ZA 2Y5TA 4JFDE 2Q86A 2GTWB 2IFFH 3FAXA 5DD0L 4R0LC 3NMEA 1A21A 2YA1A 1LO4H 2V5RA 3RWHA 1CT8B 3O45A 2NW2A 1A0QH 4I0PD 4H1LA 2B5IC 2H1PH 4KK6D 5DUBB 3P4MB 2IQ9H 3FQUA 3LKSB 4FQHB 2BNUB 4LLYA 4EUPG 3UCRA 1NCWH 3DIFB 5FGCB 2YOCA 3WN5A 1MIML 2YPKA 3RWDA 1AHWA 1MVUB 2NY2D 2MPAH 3I6KA 2HJLA 2R4SH 1NPUA 5L2JB 1MJ8H 2H2SC 1FZKA 5J12B 2BSRA 1XF5A 4OJFL 4MA3A 1XGYL 4M4PA 4NOBA 2ADJB 2GT9A 3MUGB 5TE4L 2E7BA 3LKRB 4KJWD 2HT2C 3MC0A 1NKRA 5HJ3B 4M8QB 2C3GA 1X7QA 2ICEA 1S7RA 4GAYA 1N5AB 1EEUA 3BGMB 1PYWA 2PN5A 1ZHNA 2A9NH 4H0IA 1DBKL 3FQRA 1GOFA 3MLSH 3HC0A 3RUGA 4A6YB 4AT6A 5IMOA 1JNLL 3FO1A 4J3VA 1BJ1H 3VXTA 3QA3A 3O3DB 4ZDHA 4OCNC 3ULVD 3U4EA 1T7VA 2I9LB 2QQKL 4OCMC 1ZLVH 1WITA 4G8GA 4U1IB 1WGOA 1HHJB 3H9SB 3NA9H 3QNXA 1TJIL 2JJVA 4MNGB 1YUHA 1YN7A 4CN4A 3C6SB 3MRJB 1MWAL 3RWGA 1YY8A 1WFOA 3RNQA 5DZOA 4CDHA 1RJCA 4JFEB 1MFDH 1FYHB 3ARVA 1A6AA 3OAUL 1T1XB 4YHNA 5DUMH 1LP9F 5C09D 4M6NH 4YDJA 3P4OB 4HGWA 3LRGA 4X6DE 1HQ4B 5E8OA 3RVXC 1AC0A 4AY0A 2XNAB 3LRSA 1D5XB 2F15A 3MZTA 4P5TB 4NQVB 5KVEL 4EDXA 2PW2B 5D2NE 1JGDA 4PJAA 5DMKB 4OFDA 3IT8D 1FFOA 3QO1B 4R4BA 2B7DT 5GS0L 1RZ8B 5MI0B 4TVPD 1AKJA 1MLCB 1OAXL 4CU8A 5IBLD 3RI5F 3O41B 2BSSB 3BKYL 1KGCD 1DSFL 3AREA 5JOPD 1C5DA 4KV5F 5L6YH 2YEZB 3L5JA 4GG6F 4HKZA 3KS0J 2AGJL 5SWSB 2QR0A 3RPIB 5KSUA 1KCRL 1XAUA 4MQTB 1Y18B 2GK2A 2IC2A 3TESA 3OJDA 1T1WA 1VERA 1RHFA 3RVTD 4Y89A 1BECA 1VKXB 4DZBB 1IC7H 4ODTH 4KC3B 4N0FA 4RQQA 3BPCA 4LCWA 1KTDA 5CSBA 5KSVB 4I4WA 4FQLH 2R4RL 3QIUA 3T2OA 5D2NC 4FXLA 4FOMA 4WFEE 3QFJA 3O6FA 5GGUB 1XGQA 4LMQI 2FIRT 2X89D 5HHMB 2M1KA 3MRCB 2M2DA 2V6HA 3ZO0A 3WL9A 3AS0A 5IJKA 4J12A 4X5WA 4Q6IC 4JG0L 2YN3A 3S4SA 4LPYA 1UZ6E 3LRHA 3QXTA 4OCSH 3BJLA 1JPSL 3F6IA 3M17A 4WTZG 1QFWH 4B5EA 4OLVL 4YQXH 5AUMA 4LGSB 5JO5B 4N1EA 3QIWC 5D8JL 3RUGF 4ZFFA 1DLFL 5JW4R 3S3JA 1BX2B 5E70A 2CR6A 2RAMA 3GGWA 5FM5O 1A7RL 2AJSH 2MCPH 4JPIB 4HH9B 1I9IL 1P7QB 3D0VB 5BRZE 4LMQE 2Y9RT 1L6XA 5H35B 4HWEL 5C9KA 4Z7WB 5DVNA 4ONGL 4NQCD 4K7FA 5GGTL 4Y88A 5LXGL 1BGXH 2FJFB 2JJWA 5SWZB 4C56D 1U92B 4J3OC 2ZSVB 1U2HA 2FATH 2K9UA 5DK2B 2DQEL 3GB7A 5C0AA 4OQTL 4MJID 5ID0B 5HY9B 4HX1B 3WNNA 2G9HA 4FQCH 4GKSA 1OLLA 3VW3L 3L7EA 2OI9A 3RWFA 5F9OH 3EJJX 3B5GA 1Q9OB 4IRSB 3LKPB 1H3UA 4L9LA 1JWUA 1JK8A 2X44D 3MJ7A 4WWKA 4PJAF 1VFBB 4G8FA 3VGAC 1FFRA 4AEFA 1HH6B 4L5FL 3SE8H 1BBJB 2BHZA 1JTPA 2W38A 4YXHH 2VL5A 4GRMB 1XGUA 4NWUL 1JHKL 1KIUA 5FA4B 3OMZA 3L5XL 4R4ND 4XVUD 4Z6AT 2EIZA 5EU4A 5T1KB 1MCKA 1NBYB 2FIKA 2BRRH 1CFNA 1UXWB 1ORSB 3O2VL 4LARL 1S78D 5HYQB 5ITFB 3UTSB 3OHXB 4M62H 3ILPA 4CVXB 4U0QB 2MFNA 2XWTB 3FONA 3KR3H 3O4OC 4F8TA 4ZUTA 3TZVC 4UTAH 3DRQA 4I18B 3IKCA 5EUKB 2F53B 3O0RL 4Y5XC 4HQQL 3SQOL 2A6DA 3PV6B 2OJZH 2FZ3B 1FFPA 2R1WA 1W2KT 3FO0L 4PYGA 1WJ3A 4PJ9B 1BQLH 2ZCHL 1U41A 4NQDB 4PB9L 2VDKL 1F2QA 4N0RA 4FFYH 3QQ3A 2B1AL 4LSUH 4BELD 5DR5H 4OZFG 4NFDA 3LQZB 1MHHA 5J3HC 4RMRA 3F12B 1KT2A 3DMMD 5BS0A 3BP4A 1BWMA 3LS5H 2BY1A 2CR3A 3BH8B 4ZOBA 1KFAL 5EZJB 3VXSB 4KQ4L 5D7IA 5E9DA 2C4FU 3GI8H 4QO1A 4GRLB 1PJ9A 1O5DT 2HA1A 4ALAL 4S10A 2OR9H 3BEVB 3RKPA 4NQED 4RFNC 4ZS6D 4DGVL 3VWKC 4KMTH 4PD4K 1NC2D 4EI5D 2YXMA 3BEWA 3V79C 3ZE1F 2VN4A 1GVIA 5J13B 3JWDH 2R69H 1S9WA 5J6GA 3SDXB 4AEIL 5FGBA 4EXKA 3E6FB 1N7MH 5T1LD 1R24B 2ICWB 5F7YC 1DQDL 1UACL 1JGVH 1U8JA 4P46C 4M9PA 1GZPB 3AS3A 2OZ4A 4F58L 2Q20A 3QNYA 5C0BA 2NTFA 1C1EL 1FQ9C 3MUZ1 2QKIB 3WNMA 4A6YL 1EX0A 5ENWB 4PRAA 1ND0B 1A14L 4NKOA 2YRLA 1F58L 4PRPE 3DUSB 5GRUH 4XCEA 2A1WL 4JFYB 2WIIB 2JLLA 4TSCL 1T20A 1ZAGA 5E7BA 5ID1A 3T2NL 4OJFH 1XGYH 5FYJU 1K2DA 1CDJA 2EIEA 4JO4L 3WIIL 5TE4H 3J8F7 2BVOB 1C7SA 5JLZB 4NBYB 5TQ0L 3UDWA 3PWUA 1DBKH 5IESH 2BOBA 1I3VA 2BCKB 3C09C 1T7WA 1JNLH 3G6AA 4HUXB 2MCG1 4P5MA 3L3OB 4FXGA 1A64A 2GJZA 2QQKH 1NBQA 2J12B 2O5ZL 4OZIB 3QUXC 4M5ZL 4U2ZA 5C0DB 1TJIH 4WW2C 1A7OL 1E27B 1IGJB 1GL4B 3QJHA 1QSVA 1MWAH 4FFWD 4GW1A 4G5ZL 3IGAB 3Q48A 3KLHC 4JM2A 1Z9SA 1PZUB 3QO0A 5DEZA 2OCFD 2X1OA 3PWNA 1NGYA 4GBXD 5GZOD 1IEHA 1IGTB 3RZCC 5IW1B 3QEQA 4CW1B 5F44A 2W9DL 3D0LB 1I3RA 3HKFA 1ED3A 4P23B 4ZFZB 5KVEH 5C70A 3VFPB 5FYJL 3B6SB 3PGFL 5GS0H 3FQWA 2GFBB 2UWEA 3G5XA 5I0DA 1U8KA 2F5AL 4RNRB 5E5UB 2YUXA 4M43H 3WMSA 2JJUA 5HVWA 3BKYH 1DSFH 1JN6B 3TBYA 2Q76A 4K94C 4PP8C 3QCUL 3BIKA 5JPMB 2BNRD 2XWBB 3SPVB 5FUCC 2AGJH 5CD3A 2ZKHL 4XBEL 3ZHKA 1SEBB 2NR6D 1KCRH 2XA8L 3JTCA 2UZYB 5GRZA 4XVSL 1BZ7A 4JHBA 2X4UB 4XPBL 1KB5B 4XPTL 2G5BB 3HG1E 5B4MD 2R4RH 4QEGA 2EDRA 2V2WB 4JE4B 4YHOL 3N06B 5D2LE 4LF3B 2W0LA 4DJMA 4MDIA 4POZD 3N1MC 3JVGA 3GMOB 3KXFB 1DQQA 4XAWL 5EIQA 4NO0D 1CICC 1A1MB 2ZUSA 5CILL 2YD9A 1JPSH 3CDCA 4OGXL 5IVXE 1RUQL 4OLVH 2Z92B 1T0PB 4E5XA 4NRYB 5D8JH 1S7UA 1AJ7L 3T0ED 1DLFH 4HMEA 5IEHA 5E0QA 3N50A 5EC1A 1SJHA 1A7RH 1LILA 1I9IH 5ACZB 5DO2C 5LGKA 5FO7A 1Z9OA 3OR6B 4HWEH 3CXHK 4ONGH 3G6JE 3QUZD 5GGTH 4PRBA 1YZZA 4XT1C 4M1GL 5D6CB 4LHJB 4PTUA 4N90E 4XI5C 2D03H 4TNVK 1G9NL 1W72H 2DQEH 3B5TA 4KKAC 4OQTH 4U05A 5TDOB 4JM2F 3FB8B 3D1MC 4JY4A 1YYLL 1WWBX 3FRPG 2EXWD 2BFVH 2WNGA 2RHEA 5FB8B 4C4KT 3HE7A 3ARDD 3VW3H 3JBG7 4BUGA 1J0HA 4XXCC 2C1PB 1PLGL 1KBGL 2CKBA 3ZTNL 1Q8MA 3AM8A 4JZJC 1NANI 4L5FH 4W4OC 5ISZE 4EZMA 1WAAE 2UWEF 4NWUH 2DN7A 1VEPA 4B41A 5EU5B 4EIZC 3L5XH 4L3EA 2B39A 4ZUUA 1AD9A 2E6QA 3NIGF 5JDJA 3D85A 1PY4A 3MCLL 5CJ8A 3I3EA 4LNRB 4M7ZC 4LASL 5T5FL 3O2VH 4LARH 1T03L 5JOPE 4POUB 4C59B 3VGFA 1OGAA 4N5ED 4LSVL 3L3GA 3ARBD 1QSEA 1UZ8A 4ENEC 3WHXA 1I7RB 2C3XA 2CK2A 1EFXA 1JFQH 3O0RH 4HQQH 2EDQA 3QG7H 4PYHA 1R0AL 2XKSA 2JCCE 4EI6A 4UOW0 1M7IA 1WV7T 1AXSA 5TFSL 4K55A 4S1SL 3FO0H 1ZT7A 1XIWA 2ZCHH 1MJ7L 4PB9H 4M3JA 2VDKH 3DGCR 1NLBL 2BMKB 2B1AH 3OQ3B 1ZVYA 4LVEA 5E00A 4AM0B 2A6JA 4YGVB 2X7LA 2MJWA 1R3HA 2I27N 4KK8C 1ODAA 5IMMB 5GRXG 2Y07L 1JNNL 5I17B 4N0CD 4U6XA 4UMGA 1IGFL 4KQ4H 4F37F 5HGBA 1WIOA 3OKKA 3IXAB 1JRHI 5HPMA 1LD9B 4ALAH 4MA1B 4DGVH 3UTTD 2CQVA 2F54A 3RY6C 3CUPA 5J4MA 1LEKB 3MLUH 5FIEA 4MD5B 4L4VB 2BVEA 3UTQB 2HLAA 3OAYH 3WFHB 5DJDB 3UBXG 3V6ZB 4LPXA 5GSVA 4TUOB 4JFZL 3QIBA 1UACH 5EULV 1XCTA 4AENB 5DUPH 1R3LA 3O2WH 3UEZA 1P6AB 4NC2B 3REVB 4GS7C 3RDTB 1PY9A 4LVHB 1C1EH 4OLUL 1BVLA 3WIFB 2DDQH 2Q1EA 4A6YH 5AG8A 4HZAA 3SKNB 3U9PL 3WJLC 4AH2A 1A14H 3RJDA 1F58H 5IB5A 5EO9B 1J1XL 2A1WH 2X4QA 2WP3T 3ARUA 3TVMC 5IROC 4K71C 4JJ5B 4TSCH 3BQUC 4FQ2L 2H26A 3BP6A 5IR1A 5I66B 4JO4H 3GSRA 3WIIH 4PJGB 3ARTA 4E41A 3WD5H 2X6MA 5TQ0H 1U3JA 3EYOB 1M05B 2PYEA 3H9HA 3HI1A 5E2VH 1S7QA 4YEFA 3CLEL 5BW7A 3AU1A 5DEFB 1X44A 1NEUA 5I1IH 1EAPB 2Y7QA 2O5ZH 2P45B 4HK3N 1FZOB 5MEQB 4M5ZH 1ZLWK 1LE9A 4JFXB 1HZHL 4G6MH 3BH9B 1IL1A 1A7OH 1KEML 2D2OA 4N0YL 2ZUUA 1UJ3B 1NAKL 1I8MB 4P9HC 3BO8B 1CFSA 4G5ZH 4OLZL 2HTKC 1HKLL 4QRRA 2WIMA 3RVWD 5D1QD 3QUYD 3PWVA 1F4HA 4H88L 2X70A 4LVNC 5E24E 3CDFA 3DV4A 5E6ID 2VLMD 2YUWA 4GKOA 4XH2A 5I9QC 3STBA 5BCAA 4FQQA 3V6OE 5FO8B 1YQ2A 2DQFA 3KWWA 3N1FC 1IGYA 5HHQA 1KB5L 1YEHL 5EU6E 4M8VA 4XNMA 2NY7L 5KS9A 5FYJH 3PGFH 4NZTL 3CMOL 4JFOA 4YJZL 3V8CA 1HEZA 4GW4B 3BD4A 3MLYL 1KB9K 3EGSB 4MQ7B 3W9EA 3MBEA 1WUNT 2HJKB 3VRIA 2QADD 4LLWA 3QCUH 3OKOA 1CI5A 2XQYK 1NCCL 1WBYA 4KVNL 5E94A 6FABL 1G7QA 3DJ9A 4XPHL 2R0ZL 2F8VA 5DFVD 1T83C 2XA8H 3T08A 2F8XC 3D25B 4R2GB 5T1DL 4W6WB 5KOVC 5BJTA 4XVSH 4WUUE 4L4TE 3OKMB 4ZSOE 1B0RB 3QIWD 4XPBH 1QLFB 3MRGB 2CH8A 2J8OA 1A6PA 1TDQA 1IQDB 2PXYD 5DHYB 5IW6B 5DYOB 2A83A 4YHOH 3HE6B 3PL6B 4Z78A 4IS6A 4D0DB 4Z7UE 3UAJC 4H5SA 1MAML 3SGEH 2AJVL 1ZT1B 5J1TC 4XAWH 5A2FA 2JE8A 5IK3A 5JQ6L 2NNAA 3OG4B 5CILH 4XTRD 5KSAC 4JHAL 1MFBL 3O8XC 3WSQL 3AAZA 4HS3A 5JPNB 4D0CB 4ZODA 5IF0A 1FSKC 2FO4B 1AJ7H 5FHBH 5HGAB 1OQOA 3GSNA 4PJHB 3C2AL 1XR8A 2QSTA 1Q1JL 3V5HA 4ZQKB 3MUHL 4UDUB 5C0FA 1J87A 3KDMB 5HDBF 1T7YA 1QRKA 2G2RB 5CINL 3BP7B 5F9WB 5C09A 3QAZC 2KUTA 2B0SL 4M1GH 4G9FA 1T5XA 4ZTPL 2FHBA 2IH3B 3Q6GH 3F7YA 4UUJA 1A7PL 5D7LD 3O3BB 4DK3A 1YYLH 1WICA 4XWGL 1BFOB 1BJ8A 4KHTL 3TIEB 4RISL 2AI0L 2GSGB 1BM3L 3RX8A 2ESVE 2WY3A 2KPNA 5JDSB 4BKLB 5GRVL 2FECL 4Z7VB 1PLGH 1KBGH 3JTTB 3ZTNH 2VIRA 3AB0B 5TE7L 3ZTJH 4XHJC 2HT4D 2X4NB 1QG3A 1FFNB 3LEXA 4KAQL 1D3CA 3SKMB 5K33A 4LOUC 4RA3A 4MXQD 4HUKB 5HI4D 3NCJL 1D5BA 4F7CB 3MCLH 4LHUG 1CBVL 1I1FA 4LASH 5T5FH 4S1RL 4PJ7F 2DF3A 2NY5L 3PV7A 3QI9C 4QHLB 4P57A 1T03H 1XF2B 2Z31D 1FAIL 3CVIL 3MV8B 3IU4L 1BFSA 1L7IL 4LCUB 4LSVH 2Z93B 2AK1L 3VFNA 1IM9D 2J6EH 1RJLA 3L6FA 2CD0A 1OGTB 1KEGL 4D9QD 4Q6YA 2X89A 1NC4B 1QUNA 4F2MA 3BKML 4WHTA 3SY0B 3TYFB 3MODL 3ES6B 4NHUA 5IVXF 1YEKL 3FT3A 5GJTL 3TYGL 2OR8A 1I7TA 3KYOB 5TFSH 4S1SH 1MJ7H 4J8RA 2BP3A 3GJFB 1P6FA 1NLBH 3ULUE 4P5KA 5HI5D 4CRPA 3FQNB 1KIQA 5IB1A 4OBRA 3NBNA 1F45A 15C8H 3MA9L 5ICZB 4XP9L 3T65A 3DECA 3KPSB 3HB3D 2Y07H 3BD5A 1JNNH 5D1ZD 1HXMA 4PJDB 2J1KA 2WQ8A 1IGFH 3ULVF 4F33B 2GK0B 1CDBA 1B6UA 1ZXQA 4YXKH 2A6IB 1FL5A 1YN6B 1MLBA 4NQCA 4WO4C 5HYJB 4C56A 1F3DH 3VXME 5LGJB 1KJ3L 1BJ1J 5FUZL 1U8MB 2ZJSH 5IIEB 1P7HL 4MJIA 4I3RL 4C58B 4X5XA 1RPQA 4JFZH 1C12B 5DI8A 4MNQE 1D5ZB 4JFED 4P2OB 1WAAF 5H2BB 4MVBA 2H3NB 4OLUH 4XZUA 4CN6A 4GKNB 2IPTL 4OD1L 4YK4B 1X5JA 3U9PH 1U2CA 4YDVA 1EDQA 4FFVD 4RGMB 3QCTL 1J1XH 2F58L 4XPFL 1FH5L 3HPLA 1KC5L 3PGCB 5E8NA 5IHLB 1ZA3A 4FQ2H 4M1CC 3UTPE 3NABH 1B0WA 4QYOA 5GGSA 5JW4N 3TN0D 1YDPA 3GKWL 4OZ4B 1MQKH 1L4IA 1U8QB 4KROB 1MCNA 1KPVB 5ANME 3PQYB 3REWA 25C8L 1HILB 3CLEH 1CF8L 1NLDL 4XX1G 3ZKXB 2EKSB 2J8UE 1H5BB 3HUJB 4JAMA 2IH1B 2R29L 4HIHB 4JGUA 1ZHLB 3FB7A 2PKDA 1A3LH 4P2QE 3CFDA 3VFUA 2IALA 1HZHH 2LQRA 1N6QL 2DB8A 1S5HB 5L2KE 1KEMH 4HKBA 4ZYKB 3NCEB 2QHLA 3L95A 1H3PL 4S0TD 3P4NB 1NAKH 3R0MA 4KKLC 4WV1B 4LCCA 4Y4HB 2Z35B 2EO9A 2WBJB 4LSRL 3RHWF 3MROB 5GIRB 1OAYH 4H88H 4PRHD 2C1OB 3DXAE 4QCIB 1FL6B 4NUJA 5FECB 1P84J 2NCMA 4PG9A 3O3AB 5F1NB 2VDOH 1BIHA 3DYPA 2VLKB 3WJJA 4NQEA 4MXWL 1KB5H 4KUCD 1NC2A 1YEHH 4HK3J 1A6WL 2PO6C 4RWHA 3TM6A 3EO1A 1RZ7L 5DT1L 2NY7H 4NZTH 3CMOH 3RY4A 1WFUA 4RGNC 5KAQF 1CR9L 1P2CA 2H9GB 3MLYH 1QPXA 5T1LA 1HHHB 4YO0B 1B88A 3KPNA 2NY0C 4DEPC 4OZGA 5JMOC 4LKXA 4KVNH 1NCCH 6FABH 4UQ2A 4XPHH 1A4JA 4F15B 1AI1L 3IJHA 5T1DH 4RFEA 3HNTL 4PRIE 4PGEA 2EDOA 2IEPA 1SY6L 3IF1B 2BOCB 4MGXA 2AK4E 3LCYA 5DJ2A 3IFPA 1T21B 4ZPVB 3SDDD 3SDYL 3JWDC 3GMQB 3F65A 3MFGB 1NBZB 3NVQA 1BD2B 2JF1A 2AKRA 2VO5A 3EHBD 4LRIC 1AGCA 3ZSSA 1BF8A 1AP2B 1A7QH 2NXZB 2R0KL 1MAMH 4UAOB 2AJVH 4FMFA 1EJOL 1LP9B 2OTWB 1T66D 1MHPL 4G6AD 3EFFA 1I9RL 4EN3B 3M1BA 1S7TB 2VABB 5JQ6H 4XI5D 5E8PA 5CBAA 4JHAH 3RTQD 1MFBH 4X99B 3VGEA 3RKDD 1A02N 1ORQB 3V2AR 2CO7B 5IV2B 1JYXA 4F9LC 5CGMA 2ADIA 5B8CC 3MGOA 5C0GB 3ECBB 3K4DA 3C2AH 5D5MA 2B1HH 4HFWB 3TO4A 2VXQL 4JZNB 2FX8L 5CEZL 2IANE 5I1LA 4GG6B 4JRYA 2AV1B 1JZ4A 3I3DA 4JDZA 1IVLA 3C08L 5T3XL 5CINH 3NFPB 4LCYB 4YC2C 3VG9B 1JZ2A 2B0SH 5F7UA 3SEPA 4ZXBA 4GBXA 4JHWL 2Y5TB 4PREA 4ZO6A 5DURD 2Q86B 3VJ6B 1Q9LB 4ZTPH 4L1HA 2X1XR 5IFAL 1A7PH 4D9LL 5FV1L 3FQUB 4WFGD 4XWGH 3LY6A 5JMRA 1IBGH 1NL0L 4LLYB 3GHEL 4KHTH 4RISH 2AI0H 3TBVB 1BM3H 3KJ4B 3WN5B 2YPKB 3ROLA 2AQ1A 3RWDB 1AHWB 4GAJL 5I2IA 1UCTA 5E08L 3OGCA 1EGJL 1FZKB 4QHNB 4IIQC 3BMWA 4ORGB 5TE7H 2XFXB 3Q5TA 5ESQA 4J23A 5E4IA 4CU7A 2BNRA 4KAQH 4V1DB 2OS7A 3VXUE 2LU3A 1X7QB 2ICEB 1S7RB 3BDBA 4MJ5A 1N6VA 3W9DB 1OTUC 1MREL 3U0PA 1ZHNB 1AIFA 2E9BA 3WS3A 4U1NA 5MENA 2DMBA 3FQRB 3MLVL 3HC0B 3RUGB 2D31A 5IMOB 3FO1B 1DFBL 1QA9A 4S1RH 2NY5H 3VXTB 3QA3B 5C86A 5GS0C 1FAIH 3U4EB 3CVIH 3IU4H 1L7IH 1QNZL 1KSRA 4G8GB 5H94B 4DW2L 1BQSA 2AK1H 2KZ1B 3QNXB 3QWOA 3HRZB 3LIZL 1YQVL 1KEGH 3KPMA 1YMMB 1I1AD 4JQXA 3BKMH 1YN7B 3M45A 4KRPC 3MODH 4YDIL 1YEKH 3F7QA 2OMBA 4QTIL 1DJSA 4NO0A 5GJTH 3CFEA 3TYGH 3ZHLA 3QDHA 1WZMA 3A6OA 5GS1A 3U7YL 2DQUH 2DI8A 3IDIA 4YDJB 5F7LB 3UO1L 4HGWB 5CP3H 3WFCL 3CFKA 3MA9H 3GRWL 4TUKL 5E8OB 3U30B 3T0EA 3TJHC 4U3XA 4JFQA 4PJAB 3CD4A 3MPCA 1V3MA 4O2EA 4NN5B 4ZOAA 1EVTC 4WNQA 3VE0B 2V9TA 5F6IC 1AKJB 5D5MF 5KZCB 3EOYG 3I02B 1VFOA 4TTGA 1MPAL 1KJVA 3QUZA 3AREB 1C5DB 1OTSD 3BW9A 2VLRE 43C9B 1IEBB 3FOMA 5FUZH 2QR0B 4YPJA 4PJ5D 5KSUB 3EAKA 3OJDB 4FABL 1MRDL 3TA3C 4HZLA 4N0FB 1AQDA 2WSKA 4RQQB 4LCWB 3FT2B 4OD2B 4OZFH 3S36L 2HAZA 3LPWA 2IPTH 4Y1AE 1H15B 4OD1H 4Z0BL 4W4NA 3SGKC 3QFJB 4WHYG 3O6FB 1XGQB 5ELIA 3LSOB 3HTLX 1P1ZA 3PG2A 3E3QA 3BSZL 32C2B 1P53A 2F58H 4XPFH 1FH5H 1KC5H 1A6UL 3E2HC 4J3XA 3LEVL 3P0YL 4X5WB 1JPTL 3S4SB 2ENSA 2R23A 3CFJA 1G7LA 3SJVD 1NDMA 4FRWA 4NQUA 1OP3K 1MCBA 4RSVA 3GKWH 2WWMC 3HZMB 4JHZA 3MV9E 5JOEA 1U3HC 2YD8A 5AUMB 4N5EA 4U0RC 4RRPA 4ZFFB 25C8H 1TQCB 1PZ5A 1CF8H 1NLDH 5C8JA 1NMCB 4HJGA 4JFFD 4O4YL 3P11L 3WIHL 4QHKI 4X9HA 3ULUF 3SDAD 1D9KC 3L9RA 2R29H 4U1KB 5GS2H 1T1YB 2CDGB 2P5ED 2YD5A 4K7FB 3KLAA 4PP2B 1CZ8L 4ELMA 5B21A 2O26U 4MAYD 3RGVC 1HH9B 3OB0H 4U6TA 3IETA 1FNSL 3GB7B 5AZ2L 5C0AB 4Y4FD 2E6PA 3MREA 2XZQL 2P42B 4CN1A 2NZ9D 2G9HB 3KXFD 3L3JA 4HULB 5FGCE 3L7EB 1CDHA 1CD1A 2XN9D 3FCTB 1CQYA 1JWMA 1MCPL 4R7NA 2VLLA 3G08A 1JWUB 1JK8B 4NJAL 3MJ7B 4WWKB 5CSGA 2F74B 4MXWH 4G8FB 5CHNB 3UTTA 5C0IB 1A6WH 4HK0A 4U1LA 2CRZA 5ALBL 1RZ7H 5DT1H 3OGOE 5CJ5A 1K6QL 3WUZA 4ELKB 1CLZL 3J7HA 5B3NA 5J06A 5D7JC 4BZ1L 4PFEA 5DS8B 5KN5B 1KG0A 3BPLC 1WEJL 4OV6F 1CR9H 2EIDA 4IRJC 2EIZB 1F11A 5ITBL 3BGFB 3JUZA 5I6XB 2HYMA 3PWPA 1A4KB 1OQXA 5BZDB 5FXCH 1H8OA 4PRDA 4ONOA 3K1DA 2WM0A 4WW1A 5C6TH 3RIAK 3HNTH 2UYLA 4R6UA 3ILPB 3FONB 1SY6H 3H9SE 1VEMA 3DRQB 2V7NA 3SKUD 3PIQA 1UQSA 3P73A 4MNGE 4WEMB 1WK0A 3VFMA 4LL9A 4OD3L 4FQIL 1CTNA 3SDYH 4HMDA 1K4DA 2YA2A 4KU1A 1FZJA 3WNLA 2A6DB 4XNQB 1IGCL 2DMKA 5DQJA 5CGYD 4LKCA 3RVUC 1FFPB 2AEIT 4JFEE 4MQSB 4JRXB 2R0KH 3KPQA 4NC0B 4PJ8B 3VFSA 5IUSA 1EJOH 1LVEA 4LQ1A 1XCQB 3QQ3B 1DBJL 2YZ1A 3K8KA 2YN5A 1W8NA 2J8UF 3FB5A 4OUUA 2D7OA 2D4FA 4QOKB 2Q8AH 1MHHB 3G04A 1NUDA 1OLZA 4ODVH 1KT2B 3W82A 3BP4B 3IRZA 1BP3B 3X14A 5EORL 4Y16B 1MI5D 3DHMA 5E9DB 3V95A 1VACA 1NJ9B 2E9WA 4ZO8A 5EZOL 4YH6A 3O4LA 2FSEA 4APQB 3UYOD 2VXQH 1FZMB 3BEWB 2FX8H 5SWSE 5EIIA 4KQ3L 4QXUL 3IAQA 1S9WB 3C08H 3D18A 5T3XH 3RGHA 2R2EB 2OK0L 3QDGD 4PJCE 5INCA 1U8JB 4BYHA 5IOPA 3RPKA 4QRPD 4JHWH 4PPTA 4G80B 5CKAA 3C6LB 3LB6D 3EO9L 3GMMB 3QNYB 5E6IA 4DAGL 5C0BB 3PDGA 4LSQL 5E2JA 3FTGA 4X6DA 4MS8C 1JUFA 1AXIB 3BPNB 3OB8A 2VUYA 4P5TC 5IFAH 4D9LH 5FYJE 3VD7A 3ARGB 1D6VL 4NFCA 1ZLWH 1FNGA 3VCLA 1KCKA 4P9ML 3TNMA 4WFFD 1ZLUH 5D2NA 4YBQD 5MI0C 1I85C 5HHME 4GAJH 4XCEB 2ZNWA 1A1OB 5INDB 1EGJH 3NFNA 1LK3L 1MCEA 4GMSL 2QJDA 4Z7OE 1BBDL 1QSFD 1FYTD 5ETUA 1K2DB 5EUOA 4Q6IA 1IARB 1OP5H 1MREH 3W81A 3GJFH 3PWUB 2YC1A 3MLVH 4WIQA 2VZVA 2BOBB 2C4XA 4NCC1 3IXTA 3WDIA 2VNCA 3WE6A 3VD4A 2CMRL 1DFBH 3QIWA 4P5MB 4FXGB 2GI7A 2QL1A 1RJZB 3MRDB 2QQQA 3NH7L 1TITA 1QNZH 3K0WA 3MJ9A 4DW2H 2IBZX 4Z7WE 4FQXB 3ZYZA 3G6DL 2P48B 3LIZH 1YQVH 1TJGL 5SWZE 4ZNEA 3HNSL 4KKCD 1KJ2A 4RGOH 1OAQH 2XA3A 4WO4D 4YDIH 3VMNA 3OKNA 4QTIH 1R5IB 3Q0HA 4JPKL 4X4XA 3U7YH 4JM2B 3PWNB 1NGYB 4CL7A 2DAVA 3QEQB 5GSRA 3WFCH 3GRWH 4UBDC 1J18A 3FRUA 3LHPL 4TUKH 3I84A 1OWRM 1I3RB 4HJ0D 1ED3B 4MXVF 2CPCA 2E8ZA 3ARWA 2BJML 3WXWL 2FEEI 4LCIL 1EUTA 1F3RB 2UWEB 1FCGA 3G5XB 1U8KB 4O2CA 3B4NA 5IWLA 1MPAH 3MUY1 2D0GA 4S1DC 3TBYB 3QXVA 1O7VA 1P5UA 3BIKB 5DHXB 1NBVL 5CD3B 1BLNB 3U6RA 3SO3B 1S8DA 5AG9A 3UTSE 1DN0A 1G7MA 5IQ9A 4FABH 2BC4B 4NNPL 1MRDH 3GJEA 4IRSC 3BISA 1NMAL 4ZFOA 4Q9RL 2F53E 4XPGH 5BO1L 3S36H 4K8RL 2PW1A 5DMJB 4Z0BH 1A47A 1T2QL 3UPCA 4MDIB 1U0QA 4PJEA 3BSZH 1ZHBB 4XAKD 2ICWI 1PKOA 4PGZA 5I15L 3MRKA 1DQQB 4MXQA 1Z5LA 1A6UH 3P0YH 1JPTH 3U7AA 1B3JA 1K8DA 4YX2H 4XP6L 1HHIA 3K8LA 3ARYA 5EUOF 3SCMC 4KKLD 2QSQA 3VXSE 4AIZA 1T22B 3V4PL 3NPSB 1KCGC 3T0VA 1S7UB 1R3JB 4Z95L 1IM9A 2DMCA 4I18C 3ZSTA 4O4YH 1SJHB 3U9UB 4RBPK 4JR9L 2PO6D 2CRMA 1GHFL 1YEJL 2AW2A 4PJ9C 5FO7B 3SDXE 1ROWA 5FCSH 3QHFL 4PRBB 3ZYIA 1X3DA 2VAAA 3B9KD 1CZ8H 4RGND 4LEXL 2VOTA 4PTUB 4R90H 2NY0D 4C54A 5CSZB 4F57L 4K3HA 4P46A 1FNSH 5AZ2H 4LDLB 1OVZA 2XZQH 4NM4L 4Z7NE 2WLYA 3PABA 4JY4B 4DN4L 2FX9L 3ARPA 2VB5A 2BHUA 3HE7B 4LDOB 4GRLC 5GJSL 4NO2A 4ZAKD 4AZ8A 2ZUQC 4M7LT 2APBA 1MCPH 3MNZA 3SGDH 1EEYA 3X13B 3BDXA 3C60B 3OJVC 4IDJL 4NJAH 1RFDL 5KAQG 1BZ9A 2CKBB 2CIKA 4ESKA 2IAMB 5J13C 3QWRD 1K6QH 2R8SH 3OKYA 5ESVA 3IYLW 1CLZH 4BZ1H 2V5YA 2F19L 1CD0A 2Y06L 4L3EB 5IBUG 1WEJH 4Z7QE 3OPZL 3UP1A 4TOYL 3OAZK 2XKNA 1MCLA 3I2CL 3D85B 1Q94A 5F7MC 1U42A 5DJXA 2IBBA 2DLFL 3IJSA 2EH8L 4U1GB 5D1XD 3ZKMC 4N9GA 4G6KL 4GO6B 5E8DL 3TH3T 1MJUL 2EDKA 3D39D 4NN6C 2LVEA 4CGTA 4OBSA 4RMQA 1OGAB 2VKXA 3L3GB 4OZIE 1QSEB 1UZ8B 5C07D 5TPWL 3WHXB 4PIRF 4OD3H 1EFXB 4FQIH 3FO9A 3QUXA 2E7LE 3IDXL 4EI6B 1UCBL 4WW2A 1M7IB 2YD7A 4WI8A 1S7XB 3HAEG 1IM3B 5CEZD 1ZT7B 1YC7A 2EDWA 3LD8B 1XIWB 4NZJA 2UUDH 3KJ6L 4NN7B 3CU7A 3BUYA 4JFPA 2ZUXA 2E7CA 2BY3A 1MY5A 5BZWA 2NY6B 1DBJH 5E00B 4JY5L 2X7LB 1ZVSA 4JCMA 5DJ6A 3GSUA 3U46A 1TVHA 2OZ4L 3HA0A 4GRWF 3HLAA 1ZV5A 5EORH 3V8OA 4U6XB 4QNPF 4ETYA 1GOGA 4B50A 3IVKA 3ZKNC 3BKCL 3TNNA 5F7FA 3CAFA 5DMYA 2F54B 5I8CA 2E7LC 3CUPB 3JXAA 1RUPL 3S35X 4MCYB 5HGHB 2B4CL 4KQ3H 4OIIL 4QXUH 1UB6B 3RWCB 3T3MF 2NY3D 2OK0H 3HZKA 3MV7D 1AGDA 4OCWL 3O3EB 2CSPA 3QIBB 3LKOB 4PRHA 2EC8A 2N7AA 5EA0L 1OTUD 1R3LB 3EO9H 4DAGH 5DVLA 4LSQH 1DUZA 4DKFH 4P23C 1LQVA 1OF2B 1V7NL 1BVLB 3AXLA 3DUUB 5HHNB 1D6VH 5HDQL 2Y6SC 4AH2B 4PGBA 4P9MH 4NO3A 5JXEC 3MRFA 5IB5B 2XKUA 1KTLA 2YD2A 2IADA 2X4OA 1PEWA 2X4QB 3KXFE 2ICWJ 3TT3H 1X4ZA 1J0KA 3PWLB 1LK3H 3BWAA 4CVWA 2MQCA 4GMSH 2XN9E 1BZQK 4HW6A 4BSVB 1BBDH 3BP6B 3F58L 5IR1B 2ZPKL 5JQHC 3W0WD 3GSRB 1L9MA 4E41B 5HYJD 3MRQB 5IP4A 3DBXA 3QP3A 2GAZB 3O2DL 1H0DA 4CJ1A 1TTGA 2PYEB 3H9HB 3HI1B 4JDVA 4UNVA 5FKAA 5A1AA 1F3DJ 2CMRH 1AO7B 3LMJL 3AU1B 2VISB 5KJRL 4KI5E 1UEYA 3ARXA 2Y7QB 5C08A 3G6DH 5JIKA 4BH7A 1OCWL 1RVFL 1J0ZA 1LE9B 1TJGH 5DFWH 1QVOB 3HNSH 3L1OH 1IL1B 4FFZL 4DUWA 1XH3A 1V05A 4HH8A 3PHOA 4PR5A 3QDJD 1CFSB 4G6FB 4JPKH 4QRRB 5KW9L 1LDSA 1F6AB 3IU3B 5F21B 1N4XL 3PWVB 3AMKA 5SV4A 3RTQA 5AYQA 1XF4A 2OTUB 3ZDYE 2OP4L 2HLFD 5EO0A 4HPYL 1MUJA 5I71B 3LHPH 5HHOA 1FJ1A 4YIQA 4FQQB 3TA3D 1GGBL 1RULH 3KWWB 4YPGA 3RHWK 3N1PC 2ZOKB 5BVPL 5HHQB 2VC2L 4XXCA 4KI5C 4PJCF 3TPKA 5IB2B 3B8SA 2BJMH 4XNMB 2PR4L 2OTPA 3WXWH 6CGTA 4LCIH 1YJDL 1TMCA 1CFTA 4JFOB 1FO0B 5F88A 2VXVL 4RMSA 5I8KL 5TGBA 1HEZB 5F71A 1FAKT 3W9EB 3MBEB 4DGYH 1G7IA 3T0DA 1OAZL 3VRIB 5IFJA 4MQXD 3A0OA 3OKOB 1NBVH 5IVZA 1WBYB 4DFIA 1G7QB 5L8LB 4OFIA 2VZOA 2V2XB 1YEFH 4PJ7B 4X6BA 5A2IH 4QRUA 4I0PB 1X6NA 5BJTB 1FVDA 3FHQA 2WWMD 3MJGX 1WCBA 3EYVA 1U3HD 2DTSA 4I2XA 2EZ0D 1HYRC 1KACB 1NMAH 4Z7OF 3GFUA 2NY2B 1LO3L 4Q9RH 3QDGE 2BVPA 5BO1H 4K8RH 5B39A 3L3DA 5J8OA 4JVUA 2BNQD 4R97B 4QRPE 4QKXB 4Z76A 1ONQA 4KUCF 2A83B 4NRXA 1NAMA 1P69B 3WFDL 4NSKB 3KPLB 4QHMB 4ZTOH 2JTDA 4JZOA 5MP6L 4NZDA 4CDGC 5DHVA 3WEXA 4FG6D 1QLEL 3VD9A 3MRNA 5J1AA 5IK3B 3VH8G 5LJYH 2NNAB 1KLGA 3EOBA 4R26L 4XP6H 1S9VA 3CZFB 4XC1L 3S88L 4L8CA 3S9DB 3ZDXE 1ZK9A 3V4PH 4X98B 4HS3B 3DURA 3VXNA 1N26A 5TH2A 5IF0B 1FYTE 3KNBA 4Z95H 4LLMA 4DKEL 3VI4E 1XR8B 5CEXA 4U6HA 3ZT5A 3LN9A 4ONHA 5C0FB 1QBML 2CKBL 4JR9H 4P4RB 4L4VE 5TF1L 1A6TA 3RY6A 1JPFA 1YEJH 2ZSWB 4N9OB 5F3BA 2DQTL 3QHFH 5DTFB 3ZT7A 5C09B 3VXOA 1WT5A 4LEXH 1H3WM 4QTHA 2NY5C 5DJYA 2FEDD 1S3KL 2A0LC 4F57H 1A6VL 1TCRA 5GQBA 3TBSA 3F7YB 3QXDB 4U4BA 4NM4H 4DN4H 5F7KC 3VXRD 3K4AA 2FX9H 1MFAL 3VFWA 2AQ3A 5GJSH 1J0JA 2P43B 2ID5A 4MA1C 4IDJH 3KS0H 3S96A 4LBEB 4GJTB 1OL0A 1XGPA 5D4QA 3TVMA 3E6HA 5IROA 4U1MA 3LEXB 2VJXA 3BQUA 4K2UL 4PJGE 4PJ5A 3ZZ1A 2F19H 2Y06H 3P77A 1VGKB 3OPZH 1HSAA 1O0VA 4TOYH 2GCYA 3CPLA 2IPKA 3OL2A 3I2CH 4PLKC 2AJXL 4ZFGL 1I1FB 2DLFH 4LVHC 4H25A 4NYLA 3EDEA 4G6KH 3X11A 4P57B 5E8DH 4M93B 3S37L 3LN5B 3MACL 4JB9H 2ITCA 3QZWG 3FZUC 4WHDA 1LO5A 4PP1C 3VFNB 4OM0L 1FV1A 1RJLB 3L6FB 1QRND 1WZLA 3CK0L 2VITB 4M4RA 3QHTC 3GM0A 4F2MB 3NTCH 4WHTB 5FDWA 1J12A 5DQDL 1A6ZA 3FFCD 4NHUB 4Q74A 3IDXH 4OKVB 5M95B 3CMGA 4D8PB 5JHDD 4R96B 1OHQA 1EVUA 5CJQL 3SJVA 5CLWA 2D7TH 3KJ6H 4BK4A 1ZLVK 3QUKB 1G1YA 1KIQB 5IB1B 4JY5H 4S1QL 3AUVA 2JB5H 4MD0A 1ZHKA 4RRPG 3BPOB 2OZ4H 4ODWB 3SDXF 4L8BA 2DIBA 5HYEA 3QPQC 4GKZA 1H3VA 5CJOH 2DBLH 1VFAA 3NZ8A 3MO1B 4M3KB 3BKCH 1FL5B 1MLBB 3G5YA 2F8OA 4NQCB 1U95A 4WVRA 1GZQA 4Z7NF 4C56B 1RUPH 1OP3H 1UJ3C 3C5JB 2B4CH 3V5DA 3W2DL 4OIIH 1GJIA 1RZIA 1EUUA 1EK3A 2VDLL 4OZHA 5A40E 5C0ND 3LH2L 4MJIB 4Y4FA 4OCWH 1LGVA 5DI8B 3HR5B 4XCYA 5KVDL 2FJHA 2ZOLB 5EA0H 1UVQB 4E9LA 1U3YA 4JKMA 2APTA 1CGTA 1WSST 2ITDA 1V7NH 4XZUB 1QP1A 1EMTL 3ZYOA 1EIBA 3MRLA 5HDQH 5T33H 5JOFA 1CGVA 3QEUA 3OBAA 3HPLB 1OW0A 3KYMA 1RIUL 3TV3L 4XP1L 4NC1C 3EJYD 4R2GC 4PLJC 2OSLA 5HBBA 3TFKC 3WUWG 1U8HA 4PS4L 4QYOB 1YDPB 4XNXL 3RU8L 3VU2A 4CUCA 4FMKA 5KSAA 5F96L 3O2DH 5DMGD 3O8XA 3CSPA 5CGTA 1F4WH 2VTFA 2EE3A 4PJHE 1G0XA 1P84K 2A73B 2W60A 3LMJH 4BH8A 5I1HL 4R3SB 4JM4L 5DD5L 5KJRH 3CDGA 3HE6C 3PL6C 2EC9T 3DROB 4Z8FL 3FB7B 3BXNB 4LCWD 3O81A 1OCWH 1RVFH 4YHZL 3CFDB 5IHBA 3QIUD 3VFUB 3IJYB 4LU5L 3V0WL 1FO0L 4Z7UA 4F9PC 1RIHH 1D5IH 2AXJA 1RMFL 3QQNA 2RBLA 1VFMA 2W0KA 3GK8L 4P2RA 3R1GL 5FM4A 2EE9A 5KW9H 1N4XH 1EV2E 2OQJB 1XZ0B 2OP4H 4HPYH 5GZND 5CEZE 2D4DA 4Z7VE 1GGBH 2BVQA 3T4YA 4NQEB 4Z0XA 4XHQA 4OB5L 1L0YA 5BVPH 3BRGC 2VC2H 1NC2B 4EI5B 5T3XE 3EO1B 5IHZA 3P2TA 1YJDH 1AGFA 4LSTH 5I1CH 3HMXH 3ZKQD 2VXVH 4JO1L 1HINL 5F9WC 3D6GA 5KVMC 1P2CB 5T1LB 1CS6A 1NCBL 4ODBD 1OAZH 4RAVB 4LKXB 4UQ2B 2FGWL 4OCRL 3G5VB 1A4JB 4OZHF 1DQML 5J1SC 2L7JA 4S2SB 4RFEB 3SCMD 3C9NA 3QI9A 5DJ8A 2X4TB 1RIVH 3ULVL 3IFPB 4Q9QL 1WZ1L 1LO3H 2ESVA 5HVHC 3A67H 4UT6H 4IOFC 1IQWL 1KPUA 3DVGA 1PW3A 3N0PB 5MEOA 4PJFA 3L5IA 3NCMA 5T5NF 3STZA 2X5PA 1JPST 3C2SA 3CFCL 4H0HB 3HRPA 1CGSL 5ILTL 4OT1L 3EFFB 3KPSE 3LPGA 1QLEH 1VHPA 5E8PB 1MH5B 5HXMA 4R26H 2I60H 5CBAB 5C3TA 4XC1H 4PJDE 3S88H 1UXSB 1SMAA 3U36A 5J11B 3U0WH 1F8TL 2Y5EA 1A9BA 2ADIB 3WFBL 3MGOB 5B3JE 5D5MB 4DKEH 5HYJE 3CU1A 1DEDA 4O2FB 4TVPL 5SWQA 5DJAB 2BRQA 1QBMH 2CKBH 5TF1H 4WO4A 2AV7A 2C5DC 4JDZB 4WHYH 4XVTL 4RAUB 2DQTH 1TJHL 1U8PA 4J4PD 4GBXB 2EDLA 2ADFL 1JJUA 4PREB 1S3KH 4JPWL 3DGGA 5AAMA 1UKTA 3KPRA 4P49A 3MFFB 2N1KA 4L3AA 3PJSA 1KLFA 4UU9A 1MFAH 5KVFL 1OD9A 1OPGL 3FN9A 4YAQA 2Z4QA 5BS0D 3NACL 1UG9A 3HCVB 3DETD 3OGCB 1ULVA 1LE5A 5E95B 3FJTA 5ESQB 4HUUA 4KKBD 5JNYB 2BNRB 3R0NA 4NQSA 2X10A 4K2UH 2LE9A 4PJBA 1ZGLB 3FQTA 1U8OA 1DN2A 1U8NA 4MJ5B 3WKNA 2BHYA 3U0PB 3BT2L 1AIFB 3PQYE 3WS3B 5MENB 2AJXH 4ZFGH 4P2OC 2D31B 4FZ8H 1UM5L 1QA9B 2VLJA 3I6GA 4XNYL 4YK4C 4KH2A 3S37H 2VRAA 3HUJE 3V0VB 3MACH 4G43A 5T3ZD 2DI9A 3DV6A 1CXEA 1W0VA 3LV3A 3WFZA 1Y0LA 4ZMAT 4K3DL 3QWOB 3CK0H 2A77L 5F3HA 3BZDA 3DTXA 5FO9A 3ZKND 1HWGB 2VXTL 5DQDH 4BQCA 4UNTA 4H26B 4NO0B 4ODUA 2C3WA 3CFEB 3LPFA 4ZOEA 2DLEA 3Q5OA 2DYPD 4JQVC 5CJQH 2R2CA 5MHSD 3V7AE 4KROC 3BZ4B 3CFKB 3QDAA 4S1QH 1KXQE 2WV3A 4BQ6A 4DGIL 4CMHB 2VLKE 3T0EB 5IVOA 5IKCA 2HWZL 2ATPA 3AY4C 3ZKXC 4JFQB 1RUMH 5ADOL 1H5BC 4WEBH 4O2EB 2Y6SD 3QDMD 3MLPA 2PO6A 5I74B 3VXPB 4IEFB 4LLUB 1I8LC 1KJVB 1JI2A 1UENA 3QUZB 4RDQF 5TE6L 4ZOCA 3BW9B 4HBQA 2CRIA 1PVHA 3FOMB 3W2DH 4WV1C 3HS0A 4Y4HC 2VDLH 2WBJC 3FQXA 5CEYB 2AJ3A 3ARFC 3VFOA 1K85A 5DZLA 4DVBA 4U3CA 3JSSA 2Y36L 2XWJA 4HZLB 3ARDB 4N8VA 4D9RE 1AQDB 3NIDF 4ZAKA 4RBPH 2FWOA 1WC7A 2E9JA 4EVNB 4DQOL 4P3WA 5A16B 1EMTH 1BD2E 2R39A 1ZGLM 2DI7A 3QEQD 1P7KA 4PGDB 2EKJA 2OLDA 1CD8A 3CX2A 2R1YB 1XGRA 1P1ZB 1GCFA 5FGSA 5TDNA 7FABL 4LRIA 1DUYA 1LP9E 3RIFF 4HWBH 1E6OL 5FOBA 1RIUH 2J8UB 3ZT6A 4XP1H 1CLCA 3CFJB 4F15C 1G7LB 4PJBF 2DICA 4OLWL 1YMHB 4K3JH 5DD3L 2H8PA 5DD6A 3WS6A 5D1XA 4PS4H 2JJSC 1CGYA 4XNXH 3RU8H 5F96H 4MZ2A 1YA5A 3QB7C 5JW3L 3T3PF 1PZ5B 3CZJA 4F9LA 5C8JB 5B8CA 1U8IA 2VL4A 4P3DA 4R7DB 4JM4H 4KV5E 5DD5H 4K23L 4GG6E 3L9RB 5I1AA 4Z8FH 2NXZC 1SYSB 3EFDL 2X42A 3OAZH 1MELA 2DQJL 3TBWB 4UAOC 1QFPA 1YEDA 4YHZH 4HF5L 4LU5H 3V0WH 1CGXA 1FO0H 3KLAB 1QQDA 2DLIA 4EN3C 3QR2A 3O11B 1ZANL 3V0AC 3IETB 3TH4T 4M61B 3GK8H 3R1GH 4F7MA 3MREB 4YDKL 3H7BA 1TXKA 3HC3L 4BFIB 1CDCA 3QQ9D 3VGHA 2B5IB 3RL1A 3W11D 2DM3A 1Z6JT 3L5WA 4R7NB 2P7TA 2VLLB 3G08B 2NXYD 1NEZA 3BD3A 4KTEL 4NO5B 3K8MA 1BQUA 4OB5H 3UTTB 4U1LB 4P2CG 5GPRA 2C7UA 2JKXA 3IAPA 2IANA 4V1DE 4JO1H 1HINH 3VG9C 1KG0B 4WGWB 2P8LA 4UV7L 1NCBH 5CMAA 1FL3A 2Q3AA 2FB4L 2FL5A 3RUGE 5CBEB 1AQKL 4N5UA 2VDQL 2FGWH 2P49B 1DQMH 3VA6A 5EH1A 2W65A 4PRDB 2HN7A 2EYSA 5LCVH 3F7VA 2UYLB 1JWSA 5C0CA 1ZT4B 3KJ4C 4G8GE 3ARQA 5T1MA 3WN5C 3U2SB 2V9RA 4YHML 3I6LE 3ULVH 1I8IA 2V7NB 3PIQB 2APXA 1WZ1H 2GIYA 3P73B 1IQWH 3B2UD 4X7TB 5EBLB 2CIIA 1TETL 5GGQH 1K4DB 4L1DA 1E4JA 4XCCL 3IAGC 2RFXA 1LO2H 1C08B 2ED8A 4HDIB 2IG2L 3GSQA 3L3IA 3KPQB 12E8L 4PJHF 3RVVC 3VFSB 3W0WA 3CFCH 3FB6A 3WHE0 5ILTH 2VZUA 4OT1H 3VXUA 1ZSDA 3JV5A 4OUUB 4WI9A 1IGIL 4UB0L 1MCDA 3ARSA 1N64L 1YEEL 3X14B 4PJAE 1RHHB 4JKLA 4MJ2A 4PJXA 4UIKH 4I9WD