4QRTA

Crystal structure of hla b*0801 in complex with eln_yym, elnrkmiym
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
276
structure length
275
Chain Sequence
GSHSMRYFDTAMSRPGRGEPRFISVGYVDDTQFVRFDSDAASPREEPRAPWIEQEGPEYWDRNTQIFKTNTQTDRESLRNLRGYYNQSEAGSHTLQSMYGCDVGPDGRLLRGHNQYAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAARVAEQDRAYLEGTCVEWLRYLENGKDTLERADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, B-8 alpha chain
publication title Molecular imprint of exposure to naturally occurring genetic variants of human cytomegalovirus on the T cell repertoire.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 82
structure length 275
sequence length 276
ec nomenclature
pdb deposition date 2014-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4qrtA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4qrtA01
2D0GA 1IGFH 1PJ9A 1RZJL 5JZ7C 3UJJL 1I9JH 5EOTA 3CMGA 5CKGA 5HGAB 2C5DC 3MUZ1 2GSGA 1AJ7H 3QXAB 3MA9H 4QHKI 1JGLH 2VWEC 2ITDB 2R0KL 4R7NA 1BQSA 4UV4L 5JXEA 4PJGF 3LS4H 1NAMB 5H94B 4KFZC 2R69H 4P23C 4NO3B 1DVFC 1CDUA 5C6TL 2F74B 2FWOB 5H2BA 5CILH 3NA9H 2QADC 4WU7A 5MERA 1BAFL 1INDL 5I1DB 5ACZB 4XGZA 4KH2A 2JJSC 1JWUB 3CH8A 1IRAY 2XI9A 2NY4B 3WEXB 5MEQB 5CZKA 25C8L 1YYMH 4Y4HA 1U8LA 3P0YH 1FDLL 3Q3GA 1CZ8L 3STLB 4XXDA 5FYJL 2BRRH 2BSSB 3SGJC 1CF8L 3PGFH 5E4EB 3T0DA 1XGTA 4WY7L 1BFVL 3QEHA 3DUUA 4LCCC 2G9HA 2OXHA 2PF6A 1RUMH 1U93B 4X5WB 4KQ3L 1IC4L 4GXVL 4H1LG 1ONQA 3OR6A 4G8EA 3HKFA 3TWCL 4PRIE 4PY8J 4AIXA 5AYQA 4WHTB 1FFNB 1R5IA 3DHJA 3RKDD 5D1QA 5I8CB 4M61B 3CSPA 3MFFA 1KJMB 1B4JH 2X5PA 4WUUB 3GHEH 2P4AB 4YGVB 2X9YA 2LVEA 4XWGL 4WENB 1ZLSH 1G7LB 4XI5D 5IVZB 1YDPA 4ZPTA 2RGSA 4BFEA 1JFQH 4OIBA 3DGGB 5FO7A 4FQXC 4U6TA 1YNKH 3NBNA 2EE6A 3QUZA 5DJ6A 4Y4FB 3KPQA 2DIBA 5FOJA 4M3JA 2P8MB 1I1FA 4UBDD 5HHXH 1T0MA 1CDGA 3K74B 4LCIH 2EO1A 1Q1JH 5EOTB 4HS3A 2GSGB 1U9KA 4OJFH 4QRPD 3GKWL 4IMLA 4R7NB 4Z6AT 4UILL 3M8OH 3MA7A 2ZUSA 3UEZA 1TNNA 3X3GH 2DQJH 4Z0BH 4PYGA 1WF5A 3FRPG 5H2BB 5D2NE 2R0ZL 4WU7B 5MERB 3ZTNL 3G5YA 2D9CA 1K5NA 1DZBA 2X1XR 5IW3A 2XZAH 5IJKA 1AE6L 4TSBL 4XGZB 3WDHA 1LO5A 4PJ7F 1DFBL 1VSCA 2VXQL 5SWZA 1EO5A 5DC0A 2OS7A 1TQCC 4PJHA 4Y4HB 3DV4B 1U8LB 3Q3GB 4XXDB 4HKBA 1RZFH 4UIKH 2E7LE 1DSFH 2YUWA 3ALWA 1WZ1L 1JGEA 4LQ1A 1XGTB 1IMHC 5F3BA 3QEHB 3DUUB 1F13A 3GDBA 4WFHE 4ZNEE 4U3CA 1KPRA 4TNWK 2G9HB 3QB7C 2FH6A 4WV1C 1I85A 1KJ2L 2EYRA 3ORJA 5I17A 4CN4A 5J11B 4X4ME 1AY1H 1ONQB 3NCEB 3WFCH 4G8EB 4ZO7A 5EFIA 4PRHB 4UT7H 2P8LA 4ENEC 5AAMA 1YC7A 3G6JF 1TZIA 1JUFA 3MRIA 1YEGL 5ITBL 3WIIH 4CNIA 3L5IA 3LQMA 2X2YA 4J4PD 5AG8A 12E8L 1R5IB 4KMLB 4KDVA 1U58A 5D1QB 4K71C 4N8CL 5GZNC 4PJDA 4YDKH 3MFFB 4KZEH 1LQSR 1NL0H 4LSDA 2A0LC 2HKFH 4YFLI 5DMIL 1I8LC 2X44D 3OKMA 1BBDH 4LLYA 3TFKD 1KB5B 3CFEA 1YDPB 3HC0A 3KWWA 3MLZH 4ZPTB 4DOHB 4ZFOL 3MV11 1PFCA 4APQA 1CBVH 3OJDA 5FO7B 4XNXL 1OAQH 3V8OA 3QUZB 3UJIL 5DJ6B 3KPQB 1TJIL 2FJGA 4JM4L 5TDNA 1HXMA 1MIEH 1I1FB 3FO0L 1T0MB 4MXWH 3MCLH 5KS9F 5A16A 3QI9B 5F1NA 8FABA 2AK4E 2LV4A 4HS3B 3UTTD 5ECJE 1ZGLM 4OLZL 4HAFA 4IMLB 5CUSL 2VERN 2Q86A 1JV5A 1M4KA 2MWCA 3MA7B 4HXBH 4J3TA 3OKEA 1IAOA 1E4XH 5DVNA 5TE4H 1V7MH 3SKNA 5AWNH 4F7CA 3D0LA 1QFPA 3G5YB 1K5NB 4M48L 4HEME 3SDYL 2FEEI 3W39A 5D93C 5GS1A 1TPXB 3SKUD 2D4FA 1BP3B 1LO5B 3WFEH 4YX2H 2DF3A 4WUKH 1I9RL 4YPJA 5SWZB 1IBGH 4PJHB 2D0FA 3HMXA 4QY8A 4FTVA 4L4TD 3CDGA 4HKBB 3BSZL 4D0DA 1JGEB 1MHCA 5FHBH 3VD5A 5F3BB 3TT1H 2VLKD 1KPRB 4L9LA 3D2UD 2OBGA 4LU5H 2EYRB 2HFEA 3ZL4H 5I17B 3VXQA 1HSAA 1HHJA 4GKNA 4FQCH 2EDXA 4NC0B 5IEKA 1MCOH 5EFIB 4JG0H 1NUNB 1ZTXL 5C0CD 3TBYA 2P8LB 4M00A 5IVNA 4PRIA 1TZIB 1JUFB 3MRIB 4DAGH 1YEDA 4JFDD 4CNIB 1QKZH 2DMBA 2HT3C 1M6OA 1OP5H 1CFSA 3HNVH 3W9DA 3V5HA 1U58B 3NZ8A 5EOCH 2OI9C 4PJDB 3WDIA 1UM4L 3NACH 1NCUA 4W4OA 2R2BA 3FMGH 1EHLL 2D7PA 15C8H 4O9HH 3KJ6H 3OKMB 1IAMA 1ZV5A 3N06B 4LLYB 1AXSB 2YK1H 4NJ9H 1JE6A 2CRMA 2DM2A 3WN5A 3CFEB 3KWWB 3HC0B 1GC1H 3BGFB 4APQB 3T4YA 3OJDB 3HUJA 4YHLH 1KJVA 2DQGL 2AABH 2FJGB 5TDNB 1O0VA 1HXMB 1GL4B 4DQOH 4DN3L 3RTQC 4BSVA 2CPCA 4ZDHA 3MXVH 4C4KO 4G6MH 1U8QA 4M1DL 4QTIH 5A16B 2XKUA 2ARJQ 3TVMD 5F1NB 8FABB 3ULVE 4ORZC 4HHAA 3EAKA 2Q86B 1JV5B 5IBUG 4PJBA 3OKEB 1QLFA 1IAOB 1OGAD 1CT8A 1HOCA 3PG2A 1NMBH 4LSUL 4JQIL 1U8KA 1AH1A 3D0LB 3W39B 5D2NA 4FFEX 1BD2E 4R8WL 3WFDH 5GS1B 2J1KA 5IK3A 4J3XA 4L3ED 1P6AB 4IRSA 4X7FC 4OTXL 2NXZC 3GKZA 1VA9A 4QY8B 4NKIH 1K2DA 4FTVB 3CDGB 4JRYE 1RIUL 4D0DB 1MHCB 3CSGA 1CLZH 1WIPA 5D1XA 2I24N 4UINL 3QIUC 5HHPA 4XX1G 4KK9C 5EBMA 1X4YA 4R2GD 2O26U 4L9LB 3PP3K 2HFEB 2XXMB 1OY3B 1HSAB 1HHJB 3VXQB 4GKNB 4RSVA 4LPTA 3NPSB 4LLWA 4Y0GA 3JZ7A 4X4MA 5IEKB 3KYMA 4CDGC 2XRAL 3BZEA 3ZO0A 3DX9A 2I26N 1A0QH 5D7SH 5F1SA 4PRIB 1YEDB 3D25A 2JE8A 2X40A 5DURD 1M6OB 3SKMA 1CFSB 3BDBA 4EI6A 3W9DB 3B8YA 1YYLL 3V5HB 1BOGA 3NZ8B 3WFBH 5DTFA 4NKOA 5DD5H 4OFYA 3DNKA 2R2BB 3MX0A 1PAMA 1KIQA 1AR1C 1N8ZA 3SGKC 3RIAF 1AIFA 4HUUA 4ZAKC 5C3LD 1I3GH 3WN5B 1TLKA 4LMQE 3T4YB 5DMJB 4N9GA 1E28A 3HUJB 1EJ6A 3TEUA 1KJVB 1EX0A 4D9LH 4LRNL 3EJYC 2C9AA 1MFCH 1UKSA 2IQ9L 5D7LE 3CAFA 4BSVB 4ZDHB 3BPOB 1J10A 1U8QB 2CGRL 2L7UA 2BY1A 4JO3L 4JPKH 1IT9H 2ADIA 2X6MA 4TOYL 1H3PH 3QXVA 1DLFH 1P7QD 5DZLA 5I9QC 1P7KA 4IMKC 4HHAB 3GO1H 2VRAA 5D8JL 2VJXA 1IC1A 2IF7A 4WGWB 4Y5YC 3VE0A 1I8KA 1Z9OA 4PJBB 1QLFB 2NY0B 3P4MA 5KW9H 3SDXE 1CT8B 1HOCB 3ARFC 3CPLA 2K7QA 1MFNA 2B1HH 2FRGP 5SWSE 1U8KB 2DQTH 5JIIA 1DBAH 2GUOA 4QNPF 1LWRA 5HI5D 5D2NB 3U2SA 1OF2A 3ZKNC 3CVIH 4P5MA 5DZNA 5GGQL 1EA9C 4IRSB 2IAMA 4KDWA 5EUOF 4O02L 2N7BA 4P2CG 1K2DB 3BDYL 4XNZC 3H9YA 1WBYB 1MI5B 5TE6H 2MOVA 3LD8C 1JGUL 5D1XB 3V4VL 2HFTA 3QO1A 5HHPB 3FOLA 5EBMB 1IGIL 1P5UA 4JG1L 3PL6C 1H5BC 3J8F7 1KIUA 1KPUA 1MRFH 4LLWB 3CDYA 1NH6A 3KYMB 3BZEB 4U1GB 1HKLL 4HC1A 2EE2A 1CD8A 2DMKA 3DX9B 3JXAA 4G8GA 5ETUA 1CGTA 4JPVH 2IH3A 4HCRH 4JJ5B 3VFGL 1GSMA 2BP3A 3D25B 3RVVD 3KPSA 2ZCLL 4H26A 4PRPE 3SKMB 1RUQL 3PNWA 4EI6B 5JPNA 5J1AA 4HWUA 1BOGB 4G7YH 2DM3A 3KXFD 5DTFB 1WISA 2DD8L 4NKOB 1J5OL 4UNVA 4LHUG 4G9DA 1KIQB 1SBSH 4LAQL 1N8ZB 1NUDA 2PYEE 1AIFB 1U3HA 4HUUB 1KCRL 3LN4A 4I77H 4QGYA 1Y6KR 3SPVA 2D7TH 3I50L 3IFLH 2QLVB 3ZLQC 4N1HB 4XBGA 3MV7D 4N9GB 1E28B 4I0KA 1UZ6E 2NXYD 2LTQC 1AXTL 2VLLA 3LMJH 3MRCA 4M6ML 3KHQA 3A6CH 4YFDB 4Z7WE 4S1RL 4TTDD 5L2KA 2HN7A 1F3DJ 4Y5VC 3QISA 5TQ0H 1VB9A 2COQA 2NR6C 2E27L 1Q0YL 4L5FL 4H1LH 4UMGA 1KYOK 4Z7VE 1P7KB 2VZVA 5F9WB 5HYIA 2KH2B 3BIBX 4UQ3A 2W0KA 1NSNH 1I8KB 1NGPH 3RGVA 3VE0B 1NCTA 2BVYA 3P4MB 1MWAL 3CPLB 3F7QA 5DVMA 3TO4D 3HG1E 5B3JE 1UM5H 4Q2ZA 1DBJL 3UTPD 2GUOB 4KQ4L 3U2SB 1OF2B 3A6BH 1CFVH 4KKBD 4P5MB 4AJ0A 2FX7L 5TH2A 3Q5OA 4XHJC 4YHYC 5ICXA 2IAMB 4LGRB 3NTCH 5DUPH 1R5WA 3FQTA 2O5XL 1UH4A 5DFWH 4MJ6B 5K9KA 3NMEA 5EU5A 3V9FA 4MJIA 4JRYA 1Q8MA 2FATH 3QO1B 3FOLB 1EK3A 4PJ5E 1LO2L 1KJ3L 4XCFL 4FFVD 3IJHA 4NFBA 1KPUB 2BSTA 1QRND 1TZGH 4LVHC 5IB4A 1NGZA 3C5ZA 1UWXH 4G8GB 2VE6A 3DSFL 5ETUB 2IH3B 1YJDL 1XGYH 2QQNH 4IDJL 3KPSB 4H26B 2I60H 1FVEA 3PNWB 5JPNB 3RY6A 5J1AB 1L7TH 2W9EH 5JOPE 1GIGH 1BVZA 2ZPKH 4G9DB 4OZIA 3P11L 4I0PA 4UIMA 3T77A 2IH1A 1KCUH 2FBJH 4YHKH 1ZA3A 3SPVB 3DX8A 5T3ZL 1NBVL 4LLUA 4P4KC 4XBGB 5L0QC 4J8RA 3HB3C 1V3MA 1WBXA 4A6YH 2VLLB 1SEBA 3MRCB 5E9DA 4M1CD 4JHBA 5L2KB 2HN7B 1FL3A 5IHLB 3K2UL 2H2PC 1MLCA 3VH8G 3L5XH 2EKSA 5I1GH 1HINL 5JIHA 4YHNA 5GHWL 1F00I 3OG6B 3RPIA 5FKPA 4UQ3B 1DBKH 3RGVB 4KVNL 3VG0H 4F7MA 1VERA 1YY9C 3LKQA 4LCWA 4Y16D 3SDXA 1F90H 4Q2ZB 3VGFA 5F96L 1PD6A 5CEZE 3WO4B 4X9GA 1YA5A 2Y23A 2NY2D 5TH2B 4P2OA 5ICXB 1ZT4A 4EN3A 1DEEA 1R5WB 4MAYD 3FQTB 4TSCL 1HE7A 3R8BB 5I16A 4MMXC 5K9KB 5JNYA 1R3IL 5HHVH 4MJIB 4NNXA 1P84J 1F42A 1N0XH 2ADFH 2MJWA 4ZFZA 1FH5H 2VDMH 3CK0H 1NCWL 2WSKA 3IJHB 2VL4A 1U8OA 2BSTB 4XC1H 2I9TA 5IB4B 3PWPE 3C5ZB 1CI5A 1PSKL 4NZTL 2VE6B 5DQDL 5E6IA 3UJTL 2B7DT 1K85A 2CJUH 3MV8D 2V17L 1JK8A 2F19H 2EXYC 1FCCA 5E56A 1FVEB 3CC5A 4C55A 4AMKH 4AK1A 4PJIA 3MOBH 4OZIB 3TIEA 3UTOA 4I0PB 1OM3L 4UIMB 3T77B 4DUVA 5K9OA 2IH1B 1G7PA 2HFGL 1ZA3B 2BNUA 5E7BA 5DFTA 4HWEL 3DX8B 3D3VD 4LLUB 3CUPA 4J8RB 2M2DA 1OAZH 4YXLL 2AJ3A 4IRJA 1WBXB 2J4WL 3O8XD 4HPYL 1SEBB 4WWKA 5E9DB 2JIXD 5EH1A 3GFUA 1FL3B 1SEQH 4Z7WA 4Z5RA 4YBLB 4OSUH 1MLCB 2EKSB 1D9KC 4YHNB 1JHTA 2NY7H 3OXSA 4ZD3L 1D6VL 3RPIB 4YAQA 4P59H 5FKPB 4Z7VA 4OLEA 4WHDA 2FL5A 2DQUL 5TJWK 1BJ8A 4RCAA 3HI6H 1S9VA 1RU9H 3LKQB 4LCWB 4PB0L 3VI4E 2CLVA 5DFVC 5E8PA 1NMAL 3SDXB 3B4NA 2HLFC 3HG1A 1NC2D 3PWNA 3JV6A 4WJ5A 3UTSD 3TF7A 4JFFD 2FB4L 4YHOL 1PEZA 4P2OB 1CXFA 5FYKU 1WT5C 1YJDC 1ZT4B 4WW2C 1NGWA 2M26A 4EN3B 1DEEB 3IU4H 4WEBH 4GRLC 4PR5A 5I16B 4RFNB 4G3YL 2YD9A 5JNYB 4NNXB 5D7KD 4DZBA 5B3NA 4ZFZB 1B90A 4PJ7E 3IS1X 3GSWA 4PUBH 4PJ5A 1S7RA 2QQKL 2VMFA 4RZCA 2D03H 5MI0B 2RJMA 3KPMA 3LS5H 1U8OB 4D9QD 5CCKL 2I9TB 3ZDYE 1N64L 1P1ZA 5E6IB 5F1KC 4WHYG 4N0YH 3KS0J 1JK8B 2V2WA 4UTBH 4OQTA 3RZCC 2YA1A 2YD5A 3CC5B 1Q72H 5C70A 3B9KC 1HIMH 4X80H 4XPBH 3MLWH 2RHEA 2F53A 4PJIB 3VDBA 2LQRA 4PIRF 1PLGH 4KGLA 3O45A 3TIEB 3VGEA 4XCEA 5F21B 4FQLL 1PG7W 5DEFA 1JGVL 1G7PB 4XP5L 1QUNA 2BNUB 3WNMA 4AEHL 3G6JE 4JKPL 4LBEA 1BZQK 1FCGA 2E7MA 3CUPB 1S7SA 1AXIB 3ARBD 3VFMA 3L3OA 2AJ3B 1F11A 4IRJB 2ZUWA 3LQAC 2FX9L 4WWKB 3HA0A 4OCYL 3NABL 3VFPA 4Z18A 5GJSL 4Z7WB 4PRDA 4Z5RB 4OB5H 4NUGH 3K8KA 1JHTB 1F8TH 3OXSB 1UACH 4MAUH 4ZMAT 4KV5F 4YAQB 5GGVL 2DQCH 2FL5B 1K4DA 2AJXH 1OW0C 4WW2F 5CP3A 1S9VB 4K2UL 5ITFA 4XPFH 2D7QA 4Y2DC 5E8PB 4U2YA 3CXHK 3V4PL 2FZ3A 4EI5C 1J1OL 3HG1B 1LE9A 3NCYP 3ULSA 3ALXA 5FUZL 5KS9E 4KUZL 3VWKD 4EOWH 1SMAA 3JV6B 4WJ5B 1FG2A 2E8ZA 4HEPG 3S88L 1IC5L 1EZVX 1NGWB 3QQ4A 4MS8C 3BQUA 4KJYA 5DJ2A 4P46A 4PR5B 6FABH 3MLRH 3GSNA 4PJGA 3U7WH 3UTTE 3D85D 1QQDA 2IJ0C 4R4FH 1QFWI 2VXTL 4BZ2H 2C1PA 4DZBB 1OP9A 4YDVA 2BVEA 2GKIA 3GSWB 1YNTA 4PJ5B 5E8DL 1S7RB 2D7OA 5C0IA 4RZCB 3UO1H 3KPMB 5CD5C 3NH7H 1A7OH 3EYQD 4WI2A 4FRWA 1P1ZB 4BUHA 1F58H 3PWPA 2BRQA 4RFOL 1AKJD 2P1YA 1S9XA 2V2WB 3TV3H 2M8XA 5EU6B 2CMRH 4S0TD 3RL1A 4PLKD 3I9GH 1WIUA 4CN6A 4JRXE 5KVDL 3D18A 1QBBA 2F53B 4GRWH 1SHMA 3O45B 4U31A 2BNQD 3N85H 4XCEB 2HWZL 1A7NL 3UYRL 5DEFB 1MREL 4P9HL 4YHZH 4FQIL 2EEBA 1IKFH 4DUWA 1ZHNA 4LBEB 1BGXL 2LU7A 1IM9B 1S7SB 2OR8A 3UROR 2X89D 5C0CE 1EO8H 3VFMB 3L3OB 3SOBL 1F11B 1CTNA 3U0WL 5JORA 5EOQH 3BZDA 4JFDE 5IBLD 2X4TA 4ZOAA 5E00A 4JZJA 3RDTC 5DD3L 3MGOA 3ARVA 3VFPB 3PE9A 2P49B 4PRDB 1J87A 2DQDH 4QGTA 1WAAE 1JYXA 4LARH 4BELD 3T0WA 4MB4A 5F7UA 4H88H 3D9AH 1K4DB 2JELH 2ICWA 3HPLA 4I2XE 2DQFA 2FLBT 3SJVE 5ITFB 4CADA 4P3CL 4KROC 1N3NA 2FZ3B 2XTLA 4P23A 1LE9B 3BN9D 3ULSB 1DVFA 5E5MA 2G5BA 5D7JC 4K8RD 4KRPC 4O2CA 1OQXA 3QCTH 1O7SA 5I66A 5DO2C 3WNKA 3VXRD 3QQ4B 4ZUWA 3BQUB 4KJYB 5DJ2B 2XTJC 3GSNB 4PJGB 1LGVA 3HE7D 2EEDA 3TNMA 1QQDB 1W72L 4J12A 4PBXA 4MCZA 3N1GC 3OKOA 4LCYA 1FP5A 2BOBA 3HNSL 2C1PB 2X4QA 3OWEA 3MYJA 3SGJA 1OGAE 5L88L 4YDVB 5DJAA 4NBXB 4NWTL 3AXLA 1YNTB 3QEQD 5C0IB 4PJ7A 1BVLA 3TN0C 3BP6A 2XXCB 4LCCA 3FFDA 4HMEA 5LCVH 4PJ8D 3EYUL 1RJZA 2NY1C 3VD7A 4L3EE 3EDEA 3TA3C 3PWPB 1UZ8A 3VFWA 1BWMA 2R29H 1S9XB 1PKOA 2WV3A 4NNPH 4J7RA 1RVFH 3RL1B 4FMKA 5BV7L 4FFYL 2ED9A 4JQVC 3D18B 1PZ5A 3FZUD 3LRSA 3NFSH 1KELL 4U7MA 1AD9A 3DVGA 2H32H 2GTZA 1XZ0A 4OCWL 1E6OH 3QUYC 1MCPH 3G6JA 3EO9L 3GMNA 1OL0A 4KI5E 4DKAA 5JORB 2ZNWA 2X4TB 5E00B 3PABA 5I1HH 4FQXA 4HBCH 3QUMH 3MGOB 4AG4H 2ZOKA 4G6AC 1GGBH 1ADQH 1V3KA 4DVRH 1FV1A 2WUCL 4Q9QL 2W9DL 4TRPH 2IFFH 3MODL 5C3TA 4XMKH 2ICWB 5I71C 2FGZA 3HPLB 4OZHF 2KBGA 2DQFB 2W65A 1LK2A 4XI5C 4FXKA 4CADB 4RX4A 1EPFA 4Q6IC 4YDIL 3V4UL 1N3NB 4P23B 3GSQA 3O4OC 1DVFB 4Q9BA 5E5MB 2BJMH 3KGRA 1T7XA 2G5BB 2APVA 1QSEE 4S1QL 1A47A 5SX4I 2QADB 1GVIA 4O2CB 1ZLVH 5KS9A 4GS7C 3F6IA 4U6VH 5I66B 1GGTA 4NRXA 1W2KT 4ZUWB 3N9GH 4NOBA 4F37F 1JJUA 4JANA 4RGOH 1MAML 4OCRH 3TNMB 3OKDA 3QDJE 3WD5H 4MCZB 3OKOB 3TBSA 5AEAA 4HUVA 1CDYA 2BOBB 1JF5A 3MLUL 1C7SA 2AQ2A 2X4QB 4AYFA 3U0PB 4NQEE 4JFQA 3MYJB 5T3XH 4LSQH 5KVFH 3R1GL 4P9HC 4XVSH 5DJAB 3AXLB 4FZ8H 4JY5L 4PJ7B 1BVLB 1U0QA 3BP6B 1H8NA 3MLYH 4LCCB 3FFDB 5D1ZD 5FYLD 5DJXA 5EUOE 5L6YH 1RJZB 1JGLL 4WV1A 4N0FA 4WEMB 1MFBL 1QBMH 4NZJA 5HDQH 1UZ8B 5H8DA 4P2RE 3VFWB 4LPWA 5BO1L 3PV6A 5FDWA 3T0XA 2F8XC 3WJLC 5AZ2H 1KLUA 2BSRA 3S7GA 3WMSA 1T89C 3U9PH 3AB0C 2AKRA 1AGEA 1PZ5B 4ZFGH 3E1F1 3MJGX 4OI8A 1GGUA 3LRSB 1FZKA 5IBTH 1UA6H 1J18A 2JJVA 1AD9B 3DVGB 1DQTA 1T4KA 3VWJD 2VITA 2GTZB 1XZ0B 4JB9L 2BRRL 3LZFL 1I8LA 3G6JB 3GMNB 3BPLC 4XC3H 4ERSL 5C0BA 3PABB 2W0LA 3EKCA 4FQXB 3KPTA 2QV2A 4W6XB 5MEOA 4GW1A 2ZOKB 2XG4A 3E2HC 2WUBL 1VEPA 1KC5H 3QZWA 4XP9H 4G9FE 1FV1B 2F15A 4D94A 5T33L 3O3EA 1F4YL 3CSBA 1Z0MA 1LK2B 1YZZA 3O2DH 1P4IL 2W65B 3VD9A 4FXKB 4YWGH 5ADPH 3P4OA 2BFVL 3B2VL 3GSQB 4UT9H 5C08D 4MA1C 4U6YA 1KEGH 1KT2A 3MC0A 5GRVL 1ORSA 3LEXA 1FRGH 1R3LB 1ULVA 5KS9B 3H9HA 2EH8L 1J88A 4L8CA 4PBVC 4NRXB 7FABL 2WP3T 1JWSA 4JANB 4H8WL 5FGSA 1OTUC 1I3RA 4U1LA 5BV7C 3OKDB 1TQCB 2J7LA 4RGNC 5TE7L 3TBSB 4HUVB 3L5WA 4F8TA 4GLRH 4JFQB 2ZJSH 4DGYH 1ZSDA 1Y6NR 1X44A 1GGIL 1GGCL 4HMCA 3QEUA 3X12A 3U4BL 3SQOH 1EGJL 5DJXB 4WDIB 4G6FB 4WV1B 4N0FB 5KVMC 5IG7A 1T2XA 3ARGD 4OFVA 4ZYKA 2B4CL 3PV6B 5FDWB 4GRWF 1CR9L 1C8PA 3VXSD 1KLUB 2VH5H 2BSRB 4MNGE 4FQ2H 2AKRB 1AGEB 4HJJH 3HC3H 3NCYS 3QWQB 4N8PA 2OI9A 5CGYC 4K71B 1FZKB 2W07A 4GG8A 4AY0A 3MCKA 5IQ7L 1H3VA 5IMOA 1T4KB 3PDOA 1C5DA 2VITB 4NJAL 4YHML 3HTLX 1U91A 5BS0E 1NCDL 4P0DA 1A02N 2V2XA 4N5ED 1F2XK 3BP5A 4NO0A 5C0BB 4JVPA 3JWNC 3OBAA 4XAWL 5MEOB 4GW1B 1LK3L 2YZ1A 3JWDL 3QZWB 4MCYA 1ODAA 4KHTL 4LHUD 3RTQA 4XCYA 4F15C 4MSWA 1JL8A 2XN9E 4KPHH 1T6VN 1S78D 3O3EB 3S35L 5CZXC 3MXWH 4ZO8A 1BM3H 4NHCH 3KS0H 4WHYH 5C09D 4BK5A 4N0CD 1F6FB 3P4OB 4KZEL 5CLWA 4U6YB 2VR9A 4PP1D 4D3CH 1KT2B 2WQRA 1ORSB 3LEXB 5HPMA 5JXAH 1QSEA 3DUSA 1AO7E 3H9HB 4POUB 2C3VA 5D93B 4L8CB 5GJTL 1ZXQA 2ZG2A 5DEZA 1JWSB 1I3RB 4U1LB 3TVMC 2MPAL 2YPKA 3QDJA 3L5WB 5DS8A 4HJ0C 4ACPA 1EJOH 1MELA 1GOFA 4EBQH 3O6KL 4XBEH 1L4IA 5HHQA 1ZSDB 2J6EH 1L7IH 3QEUB 3X12B 3QIUA 3IYLW 1PX4A 1TDQA 3EYFA 5EA0L 1YEHH 4K94H 3IRZA 5EUOA 5IG7B 1T3FA 2VZOA 3BMVA 2NZ9C 1FL5B 4U1JA 5DYOA 4ZYKB 1E4XL 3GBMH 4N5UA 4NQCD 4P2RA 4M4PA 3MJ9H 5AWNL 2OL3L 4RAHA 1UJ3C 1YQVL 5E94A 4HUKB 3IKKA 5HYSA 4NFCA 5FK9A 3GMLA 4WI7A 1DQDH 1VFAA 2OI9B 4GG8B 1A7QH 3P9MA 3MCKB 5IMOB 4G6KL 1C5DB 1J1PL 5LXGH 4TSAH 3SGKA 1VEOA 3H3BC 1R0AH 4ZAKA 1U91B 2XA8L 5LQBH 3DX7A 2V2XB 1WZMA 4LSRL 2QSQA 3BP5B 4NO0B 2O5YH 5IHBA 3E6FA 4I4WA 5GIRA 4S0SD 3SKJH 5F7HA 1H8OA 1QZ1A 4MCYB 5KSUA 3RTQB 4TVPD 4N8VA 2IG2L 2RR3A 5A3IC 4XCYB 2IPUK 2UY7A 4HT1L 4G9FA 4MSWB 3WNNA 1LO4L 4IMKA 5EOCL 1N5YH 3QBTB 2OSLA 4AQOA 3FMGL 3ARFA 2E7HA 3LH2L 4FQPA 4U4BA 5TQ2L 3R0NA 4PRNA 5HPMB 3MLXH 4NJ9L 1FPTH 1QSEB 4H0HB 4MJ5A 4BYHA 3MRLA 2C3VB 2AGJH 2B4CC 3VXME 3BKCL 1NCCH 3C60C 3TZVD 3C08H 3BRGC 4FOMA 2NXZB 2YPKB 4LDOB 2WY3A 4JHAL 3FTGA 3QDJB 2GSIA 5DS8B 2Q7YA 1QD0A 4HS6A 5HHQB 4OUUA 2ENSA 4P2QA 4PJXE 3QIUB 3CLEL 1JHLL 3L3JB 3EYFB 1NAMH 5ANME 3PL6A 1H5BA 2GY7B 5EUOB 1U2CA 2Y36H 1T3FB 1NFDE 1QPPA 3LB6C 4ZFOB 2Q6WA 3UTSE 3DECA 4U1JB 5DYOB 1J86A 4XB7A 3BX7C 4P2RB 2ZCHH 4S1DC 2G5RA 1NEZG 3P0GB 1GPOL 4KKNA 1Q94A 2EC9U 1FBIL 5E94B 4MNGA 2Z8SA 5D7KE 4LASH 5HYSB 1F4AA 5FK9B 3GMLB 1VFAB 1RZ7L 2Y6SD 3P9MB 3AGVA 4KC3B 5CZVH 5JO5A 1XGRA 1Z5LA 4PBWD 1GAFL 3NIGF 4ZAKB 2X05A 1Y18A 3DX7B 2OR9H 3B3IA 4KMTL 3BPCA 4MDIA 1YMME 3O6FC 3NCCB 5L9DL 5I15H 3DX6A 1ACYH 1MJ8H 4LNVA 4JEGB 1NANH 3E6FB 4I4WB 4LSPL 5GIRB 5F7EL 1CS6A 3JV0A 3MOAL 4OCMC 3VGGA 3RWGA 5KSUB 1TITA 4J6RH 4N8VB 1AQKL 4Z7OE 4G9FB 1CN4A 1MFDH 2XN9A 5ERWA 5I9QB 5I1LA 4KKCD 5LG1A 5I1CH 3ET9F 1YECH 4DWHA 3LEYH 2K3TA 5J3HC 2OSLB 4Y5YB 1V05A 1CXKA 4DKFL 3ARFB 2XQBH 3SE9H 5C92A 3BJ91 4DN4H 3DPBA 4PRNB 4RRPA 2F54E 3P4NA 5JUEH 3MRLB 3ULUD 1AO7A 1TQBC 2O93L 2H26A 3QCVL 1M7XA 3FTGB 4HXAH 1N6QL 2GSIB 2Q7YB 5KSBF 4NPYA 1KCGC 1F02I 4XNZB 4JHZA 1T5WB 2AV7A 2QBWA 1IGML 4HS6B 4OUUB 1ZGLP 1P9MC 3QQ9D 3JBG7 3C9NA 3LD8B 4P2QB 4X4ZA 4IM8A 1IT9L 4BKLA 2EIZA 2DDQL 1EAPA 3KPPA 3H9ZA 3PL6B 1H5BB 2Q6WB 43CAA 1RV6X 3S4SG 4HUXA 5AZEH 1NPUA 4JKKA 3GHBL 1RJYA 4K94C 4KWUA 5TF1H 2NCMA 3JWOH 5I0DA 4Q9RH 3ZE0F 2X1PA 3NCJH 1Q94B 1ZANL 3K8MA 4ZOBA 4QOKD 1FYTE 2AEPH 2N56A 3WFHA 3QG6A 2DI8A 4ZXBC 5A1AA 4GKSA 3VU2A 2F9BT 1OLZA 4XMLL 5JO5B 1XGRB 1KCVH 1Z5LB 4KTEL 4Y8AA 5GRYA 1C12A 3MJ7A 4U2ZA 3MROA 5KVEH 1Y18B 3HI5L 1SM3L 4E42A 1T1XA 3B3IB 3BPCB 4P4KA 4MDIB 1EEYA 3EO1B 1OTTD 3GMRB 5DSCA 2VDLH 3DX6B 2V9QA 2LTQB 4JM2C 4LRIC 4EIGB 5IB3A 2YD3A 5EC1A 3LOWA 2WINA 4JFZH 4FFZH 3RWGB 4Y5VB 2UVEA 3N1MC 2QHRL 1CFQA 2YZ8A 5ERWB 4TPRH 1KLGA 3K8LA 5I1LB 3SDDC 1JPST 2YKLH 5KG9A 4G7YL 3ZYOA 2M1KA 3WXVH 4NM8L 1KB5H 1RIVL 4LMQI 5CSZA 1J1XL 1YY8A 3P4NB 2WK2A 1WCQA 1MFEL 1AO7B 4L1DA 4B0MM 1T21A 3E0GA 3VXMA 2H26B 4YHYB 4NQTA 3TT3L 1S5IH 3DI3B 5EN2A 3VXTA 3PWVA 2BOCA 4NPYB 3U7YL 5JW4R 2AV7B 2MSPA 4Y4KD 3BKJH 3C9NB 3BDXA 3K1DA 1CDBA 5FGRA 2FEDD 1UKTA 2EIZB 1P53A 4BKLB 1EAPB 1PG7H 4LDEB 3CGTA 4JPWH 5L7XL 2WWKT 1ED3A 1MFAL 2YN5A 4FQ1L 5E8OA 5ANMA 3RWFA 3QDMA 4I48A 3RVXC 3NIDE 4YXHH 3VFNA 43CAB 3QWRA 4LVHB 4PG2C 2NY2C 3VXRE 1NFDA 1CGYA 4HUXB 2RB8A 1RJYB 2C3GA 5E2UH 2Y07H 4Z77A 4MAYC 4XVUC 3T2OA 1KBGH 4HS8H 4YJZL 3A6BL 4HKZA 3DVNA 3CZJA 1UWXK 5F70A 3MTRA 2O61A 5B8CC 3LKNA 1RZGA 3GMQA 3QG6B 4M7KH 3T2NL 3QEQE 4JM2F 4GKSB 5FUOH 1FIGL 4Y1AE 3BP4A 2DQHL 5A2FA 2FATL 1C12B 3MJ7B 4R90L 3WLWD 4M6NH 3MROB 4E42B 3CMOL 1MWAA 1T1XB 2DAVA 4P4KB 2AXFA 5L0QB 1EEYB 5E2TL 2HP4A 1MCHA 1VACA 1YMMA 5FYKL 5DSCB 5IB3B 5EC1B 4JCLA 2WINB 1OCWL 1CXEA 2WWMD 4WEUD 4FNLH 5CGTA 1T1YA 1NQBA 5DHYA 1CFQB 1T03H 3O3UN 1CVSC 1KLGB 4K3GA 1PY4A 5KG9B 1X5ZA 5C7XL 5ADOH 1HH9A 4ALAH 5DHVH 4YXKH 4EUPA 5FV2A 2OYPA 3S3JA 5CSZB 2DBJA 4FZEL 5K93A 1YY8B 4Y19A 1UENA 3D1MC 5H37G 2F54A 3PP4L 1T21B 3B5HA 4OZHE 3RVUD 3QHFL 1HWGB 3VXMB 4JO1H 3QCUH 1WZLA 3QFJA 2EO9A 1WT5A 4WW2A 2XTJE 2MKLC 4XZUA 5EN2B 4GRLA 3VXTB 4YK4C 1I75A 3AC0A 3PWVB 2BOCB 5DD0L 1LO3L 4QTHA 2E9IA 1EEZA 1CYGA 3MQIA 4OD3L 1MSPA 5JW4M 1TIUA 3ALPA 4K3EH 1ED3B 3MV9D 5SV3A 1QBLH 4K3DL 4DUXA 5E8OB 5ANMB 3RWFB 3QDMB 3VFNB 1DBKL 5FO8A 1M05A 5AYUL 1ZS8A 3W2DL 4BSWA 1UG9A 1WFUA 4Z77B 1A1OA 1INQA 1KGCD 4HKZB 3DVNB 1T66C 3O2VH 3RZCA 4OBRA 2O61B 2A83A 1YEKH 3LKNB 3HMXH 1RZGB 3B9KA 4XPHH 3BPNC 2EDTA 3GMQB 5KJRH 4JN2A 4K7PY 5EZIL 2ARWA 1UFUA 2YS4A 4XH2A 3T3PE 3BP4B 3FHAA 4MJ4A 2R23A 1FNEA 1KCKA 4OZFA 2NY6C 4K8RL 5E4IA 4Z8FH 3RNQA 3MNWA 4W4NA 1MWAB 3D87B 5I74C 2AXFB 3EDDA 2YHGA 2ZUQC 1D5XA 1K4CA 1G6RL 1JP5A 4N90E 1VACB 3DOSA 1YMMB 1RUKL 3AM8C 4XC1L 1KB9J 1DBBH 3OGOE 1JPSH 4NQDA 4FABH 1CE1L 5EO0A 5A2KH 4XX1E 5J1SC 3OL2A 1T1YB 5DHYB 2DIJA 1D9KB 1D5BA 5C86A 3HS0A 3HR5A 4MXQD 1D7FA 4I9WD 4Y4FD 1UGNA 3CFKA 1HH9B 1URLA 3G5XA 4TNVF 1OW0A 4DKEL 2P46B 4AIZA 4A2LA 4WFED 5HD8C 4HPOH 4EUPB 1JYVA 2DLEA 1F2QA 3RA7H 1T80A 2IBGA 1BJ1J 4NO5A 4Y2DA 5EBGA 1J0JA 4EI5A 2W9LA 4Y19B 4X8XA 2V5TA 3I2CL 4Q6YA 4J3VA 2F54B 5JXED 3DYOA 4LSTH 4PRAA 3QFJB 1CLYH 1DP0A 4G42A 2D9QB 4WW2B 4XVTL 5HYJA 4XZUB 3W11D 4MS8A 2ICCA 4GRLB 4XMPH 3GBNL 4QXGL 5K33A 2FBOJ 2IBZY 3RJDA 2V9RA 1TCMA 4QTHB 5I1EH 1SEQL 1EEZB 4OF3A 1CLOL 3MLSH 1NBYA 1TVBA 1FL6A 1GOGA 3GSRA 4Y4HD 1C5CH 2X9XA 1JPTH 5JQHC 1IAIH 2AXJA 5FO8B 3P40A 3IU3A 1M05B 1ZS8B 5CJXC 1CGSH 4BSWB 4HD9A 4EVNA 1CXIA 2X4OA 1A1OB 2ERJC 2C26A 1INQB 2OJZL 2VISA 1TENA 3RZCB 1FFRA 2A83B 5I1IH 3QP3A 5HVHC 3B9KB 2FEEL 4FQJL 2V6HA 4JN2B 3UZQA 2VXUH 1IGCH 2A6DA 1CGXA 2APXA 4XH2B 5DC9B 1FLRL 4OZFB 2R23B 1FNEB 4Y1AA 4GRWE 2B39A 3TYGL 2B0SH 2PN5A 1QR4A 1IQWL 3RNQB 3MNWB 4MYWB 1A6UH 1UB5A 4PTTA 5D1QD 1OP3K 1K4CB 3TNNA 5GRJL 1MCWM 5EZLA 3T8XA 3QPQD 4WRLA 3LS5L 1CK0H 3BO8A 2BMKA 1MEXH 4NQDB 2B8OT 3FT4A 3HCVA 3EIFA 4POZD 5EO0B 3RDTA 4WTWA 2VAAA 2WWKO 3EDJA 1NFIB 3REWA 5C2BL 2VDKH 4I3SH 1H3TA 4XB8A 1H3WM 1D5BB 3HS0B 3HR5B 3QUZD 1Q72L 3OB8A 5FYLL 5KOVC 3G5XB 4HQQL 1JHKL 2CD0A 1FGVH 4D8PA 4AIZB 4XPAL 5D70H 1PLGL 4UAOC 4GMSL 4U3XA 5J1TC 2VO5A 4Y2DB 1OAYL 1ZLWH 4EI5B 3DYPA 3Q6GL 1X5AA 3O2WL 5D7JA 2HMIC 1U3YA 4OD1L 3ZKMD 4ZOCA 1JNNL 5IB1A 4PRAB 5C0AE 4G42B 4OZHA 3S36H 5HYJB 2HH0L 3MBXL 5C09E 5IEHA 4POYA 2VL5A 3BZ4A 2EIDA 1I7ZA 3V0AC 4HIHA 5DD1L 2ORBH 1NBYB 1TVBB 3CDFA 3H3PL 1FL6B 5HGGS 5SWZD 5IESH 2B2XH 3GSRB 2DQCL 3TN0A 3BT2H 1WK0A 5I8OH 3FAWA 1TTUA 3IDXL 5FM5M 2BDNH 1EO7A 1I9IH 3IU3B 3SO3C 3TA3A 1RZ8B 3RWIA 2R1WA 4MWFA 4EVNB 2X4OB 4KDTC 2CRIA 1CU4H 2AERT 5KTEL 2GW5A 2VISB 1A7PH 4FQQA 1UT9A 3K3QA 1JNJA 2VN7A 5J12C 5J13C 2IALA 4KI1A 1UCBL 3MLRL 2EDYA 4NGHH 2A77H 2EYTA 4Y1AB 4KJWD 4PJ8C 1VPOL 1BZ7A 2GYSA 3QUYA 1UB5B 4PTTB 3DV6A 2ZCKL 5I75C 3TNNB 2HYMA 3WIHH 2L7JA 5EZLB 2NMSA 3T8XB 5J8OA 4LLDA 3BO8B 3NZHL 2BMKB 1JZ3A 2IC2A 3FT4B 3HCVB 3RDTB 5HHOE 1OWRM 4DGIH 2ICWJ 2FGWL 2VAAB 1RZKL 3RWDB 1WV7T 1F4XH 4APQD 4CW1A 3REWB 2YRLA 3NPZB 4JLRA 2ZKHL 2NNAA 4PG9A 1G9EA 2C3XA 4JFHE 5GPRA 4D8PB 3UBXA 1BQLH 5C0ND 4Q6IA 4KROB 2V9TA 2CRYA 3PHQA 2R0WL 3SE3C 5I76A 4DW2L 4BUGA 5BOPA 2XZZA 3MGAA 2GAZA 5D7JB 3REVA 2OK0L 2XNAA 1K6QL 1QACA 3QIWC 5EO9A 4KRPB 3AUVA 1JGDA 5IB1B 3AREC 4GAYA 5HI4D 5HDLA 4JGMA 4OZHB 4ONFH 5JMRA 3PUCA 5GZOD 2XTJB 4MVBD 1WTGT 1L9NA 4PLJD 4EJ1C 5HYFA 5IEHB 3WSQH 3S34H 4NZDA 2DQDL 2VL5B 3BZ4B 1OSPH 4X8JA 1I7ZB 1LVEA 5EZOL 4HIHB 3WS3A 4LARL 4EIZC 4OM0L 3RI5F 1IC7L 5IKCA 2D31A 4I3RL 5TFSH 2Z8WC 3TN0B 3PHSA 4RDQF 3O6LL 5T3XE 2NY1B 1U42A 2C4FU 4DK3A 3TA3B 3HNTL 1UYWL 3RWIB 2R1WB 4MWFB 5C6WH 1VEMA 4LIQH 3T3ME 2OTUA 1CDHA 2W1NA 5FM5O 3WJLA 1QG3A 4CRPA 4FQQB 4GQ9L 5M95B 1T89A 3TLRA 1U3JA 3U79A 1XMWA 2IALB 3PXHA 1AGDA 5AUMA 4YFLF 3X3FH 3L1OL 4K07A 4DTGH 1S7UB 3AU1A 1MPAH 4OLWH 5FGCE 3UPCA 4PRID 2EYTB 4CJ1A 5D1ZC 4GAGH 4QRSA 4LFHD 1BZ7B 1UADC 4JN1H 5DHXB 4M8VA 1HQRA 3QUYB 1E6JH 3DV6B 3FCTA 3GMMA 5BJTA 3QULA 3BMWA 4G6JH 3UYPA 2XZCH 3SGEH 2G2RA 5MENE 5DJ0A 4U6XA 2PKDA 4M4RA 4BM7A 1MQ8A 3E2HA 1MIMH 4X6DF 4CW1B 1FFPA 2YXFA 4HKXA 2UY6A 4JLRB 1RVFL 1W72A 1KFAH 2NNAB 4PG9B 3V6BR 4M62L 3UBXB 1QYGL 3FFCE 2C1OA 4Q6IB 2OM5A 3PHQB 4LPCA 5I76B 1YEFH 4RAVA 3O4OB 2F5AL 2GAZB 3REVB 2GITA 2XNAB 1SJHA 2YC1A 2ESVE 5H35A 1JGDB 4GS7B 3ZT7A 4GAYB 3IVKA 4NN7C 2NY0D 5C0AA 2R2EA 1P4BL 2V7NA 1ZLVK 4PP2A 1AGFA 1T1WA 1YEJH 4X8JB 5MEPA 1GH7A 1OTSD 1QSVA 3OPZH 2FHFA 3WS3B 4O58H 1KCLA 4IRSD 1A6PA 1ZVHA 5IKCB 2D31B 5F89A 4NC1C 3EOTH 3RWJA 3PIQA 3ZHLA 4XMKL 5BMFH 3ESUF 3EZ8A 4EQ3A 5KSBE 2DRUA 1XGQA 5D1XD 4MA7H 1HN1A 4NC2B 3ZT6A 4X7EC 2OTUB 5IVXF 2KDGA 4WFHD 4TVPL 5TDPA 3SE4A 5IFAL 1BIHA 5DR5H 1V7NH 1RZKC 2QQLL 3AB0B 1JRHI 3QXDA 1EVUA 3N0PB 3P30L 1AGDB 5AUMB 5H37H 3N9GL 4HMDA 5ALBL 5GGTH 3AU1B 2VLKA 2VDRL 1INEH 3WD5L 2F8OA 3RX7A 4KRMB 4QRSB 2Y06H 4LL9A 4GRWB 2IBBA 3ZE0E 3CU1A 5GS0L 1HQRB 1F4WL 3RQ3A 2DQIL 3A0OA 3FCTB 3GMMB 4AEIH 5BJTB 4AEFA 1DQLH 3QZWG 1AHWC 3QULB 4OFYD 3BPLB 3IDIA 3R06A 4PGZA 2G2RB 1D5ZA 3DXAE 4ZO6A 2V2TA 2P43B 4ZG1A 4QOKE 4V2CB 5DJ0B 4U6XB 3DVIA 5HHOA 3E2HB 4U6HA 4M5YH 2I5YL 1FFPB 3RL2A 4HKXB 4OLUH 5EORL 3QUMA 5B4MC 1W72B 5D72L 3LEVH 3V52H 2LFGA 2VDNL 1DN0A 4X9HA 1KTKE 2PR4H 1JPGA 2C1OB 5A2JH 4MA1B 4RAVB 2CDGA 1FNLA 2GITB 3RP1A 1SJHB 3OB0K 2YC1B 3MACL 5H35B 5ABDE 3OMZA 1A9EA 3IVKB 2R2HA 4WO4C 1A6WL 1DBMH 5HHNA 3QR2A 4ODHH 5C0AB 2R2EB 2V7NB 2MCPH 4PP2B 1AGFB 2BCKA 1T1WB 1S78C 5BV7B 4RGNB 3JVGC 5MEPB 2ZUVA 2DBLH 2GHWB 4PTUB 4F58L 1SMOA 3BAEL 4XP9L 5F7NC 4FMFA 2IAMD 4HDIA 5F89B 3C6LC 3RWJB 5CJQL 3PIQB 4WHCA 2AAVA 4ETQA 3CU7A 1TJHH 4ODSL 3GIZL 5DA4A 1UWGH 4V2BA 3EDFA 1XGQB 4ZSOE 4H20H 4DK6A 5CJOH 4LNRA 3CFCH 4KUCD 5T5FH 5TDPB 3WS6C 2J3SA 3I6GA 1HYRC 1UJ3A 3OF6A 4KJPC 1T20A 3QXDB 1ROWA 1EBAA 3NFNA 3FT2A 2VLKB 4OFKA 4GSDL 5IFJA 3PHOA 3KPSD 5IVOA 1A5FL 4ZQKA 4DGYL 1DL7H 3EYSL 1QFUH 3WKML 3FN0H 3ULUL 3IDIB 3R06B 1D5ZB 1U3HD 5E2JA 4CU7A 3I3EA 2Y72A 4OGXH 5HHOB 2UZIL 3MRJA 4OQTH 4U6HB 4JFEE 4MHHI 3RL2B 1CL7H 2DLFL 1XH3A 3QUMB 4C83A 2PO6D 3FKUS 4F15B 3G9VA 5B21A 5F3HA 5D71H 2VXSH 1RUAH 3B9VA 1RULL 4FQ2L 5ID0A 4JDVA 1DN0B 3MLPA 1JPGB 3O6ML 3C87A 2JCCF 2OR7A 1QNZH 4N0UE 3FFCA 4ODTH 1JWMA 2GTWA 2CK0L 3TPKA 4PGEA 2BVTA 2CDGB 3LPGA 1QBAA 4UUJB 3B5GA 3D0VA 5KZCB 3ULVD 5F9AC 1KACB 1SY6L 2A9NL 4OFIA 1HH6A 2R2HB 2ESVA 1MLBB 3RGVD 5HHNB 2PCPA 4ZUSA 3C60A 1RQ5A 2BCKB 3H7LA 5FHAL 4PJFF 3INUH 4HIXL 4I0CC 1PDKA 3WLBA 1BD2D 1EUTA 4HDIB 1FGNH 2PXYC 2DOCA 5C0GA 3T2QA 1DANT 2K9UA 5GS0C 3V0WH 4ETQB 2E5EA 4EKXA 1OT2A 1N7MH 2B1AL 4P9MH 1HZHL 4OCXH 4JRYD 3AY4C 5KSBA 5HYSG 4LNRB 3BZFA 3QRGH 4D3CL 2NY3D 2YA2A 3I6GB 4NCDA 3RU8L 1UJ3B 4MXVF 1T20B 3GSNH 4OGYH 5ESVA 3C5ZD 4W6WB 1FO0L 4IOSD 5CSGA 1YEEH 3NFNB 3FT2B 5ALCH 4ZTPH 5I1KH 4D0CA 3EBAA 5FGCB 5IFJB 2HT2D 4EDWH 5IFHL 3CXDH 1YN7A 4NIKB 3U1SL 4P48A 3KR3H 4ZQKB 2MTPA 3C2AH 4N8VG 1C5BH 4I0PD 3O6FA 1YEHL 1FE8L 2UYLA 4L9DA 3DXAA 3VFTA 1I3UA 3MRJB 2VLRE 3EJZD 4ODVH 3QIBD 2EEAA 1XH3B 4E41E 1QFWM 4C83B 2ICES 4L29A 3TJEL 3C6SA 4M1GH 3S37H 5ID0B 1UWEH 4TQEH 4JDVB 1OPGL 1A7QL 4HK3J 3MV7A 3RHWK 4Z95L 1JWMB 2GTWB 4WUUE 2FH8A 2DLIA 4MMZC 4PGEB 1KOAA 4NRYA 5JR1L 3D0VB 3SDCD 3FHQA 1R0AL 4M7LT 1HH6B 1UC6A 2ESVB 3IF1A 1A14L 1IGTA 2PCPB 2E6JA 4ZUSB 4OM1H 3C60B 3B8SA 3HZKA 3QDAA 5JW3H 1EEQA 2OL3A 4TUKH 2AI0L 4QXUH 1EFXA 2YMXL 3EO0A 3F58H 5SWSD 3SE8H 4I9WE 4HF5H 3FQRA 4NZRH 1ES0A 2I27N 4KKCC 3WLBB 3LSOA 1G7JA 4LPVA 4YBQC 4Z7NF 4CU8A 5FO9A 1P9MA 4P2OD 4JR9H 4EN3D 1RMFH 1TJGL 5C0GB 3ZYZA 2EZ0D 4ESKA 1QSFE 4W68A 5FA3A 2VDQH 3O0RH 2J6EA 4HWBL 3ZE1F 1MHPH 3U83A 5KSBB 2GK0A 4ZSOA 4V1DA 2BX5A 3M17A 1MCJA 4QCIA 1QHPA 4UT6H 1AP2A 4R26H 4K7PH 1MNUL 5ESVB 2R4RH 3WIFA 3BKYL 3MJ9A 4N9OB 4IOFD 3CFDA 4E0RA 3G6DH 4XNUH 4ZXBA 3ZKSD 2NY5L 3HFMH 2DI7A 2AJVH 4KGJA 1YN7B 4R3SA 1U92A 3JTSB 3Q1SH 2E3VA 5AG9A 4PRPD 1QRNA 4GMTH 1KENL 1E4WH 1PKQE 1QFWL 1RI8A 4QXTA 3Q6FB 3O6FB 3VXUA 2UYLB 3VI3F 3DXAB 3ZT5A 3VFTB 1LD9A 4KY1H 4JM2A 1B2WL 4LRIA 2ADGA 1NKOA 5EC2A 3GSXA 4LEXH 1FVDA 2CIIA 3NA4A 4PRHE 4JFEA 1LO0L 5J06A 5ILTL 4LSVH 5IMKA 4L29B 3C6SB 4M5ZL 3ARTA 4YH6A 3LDBB 4WWKD 2AJUH 4RRPG 4LGPB 3SDDA 2WQ8A 1OAXL 2K1MA 4U33A 3MV7B 4MD4A 3KYKH 3ZSSA 3ETBF 4N0UA 4NRYB 4LPUA 1HYSC 3BRDA 1XF2A 1QLEH 3LHPH 3IF1B 4HBQA 1IGTB 4DOHE 3T0EC 4JFOA 1YNLL 3MRPA 3HZKB 3WYRA 4KK8D 2OL3B 3NGBC 1EFXB 4NZUL 2H1PL 3EO0B 3HG1D 3UCRA 4WWID 3FQRB 1ES0B 2BVQA 5IT2L 2JJTC 4ELMF 3LSOB 1G7JB 5FO9B 2WIMA 1VESA 3ARZA 4XTRD 1CD0A 4G5ZH 3WE6B 4JO2H 3MLVH 4NM4L 5FA3B 4LCUA 4OLVH 3LEYL 2NLJA 2GK0B 4S2SB 4PG2A 4ZSOB 4V1DB 3M17B 3GRWL 2EYSA 2PTVA 4DN4L 4QCIB 4PJ5D 4MAYA 1AP2B 1NDMA 3B5TA 3WIFB 2FIKA 1EV2E 5B8CA 3CFDB 4E0RB 2FEDC 5JHLH 3GNML 4G7VH 4KHXL 4ZXBB 3L3IA 4R3SB 4NNYA 1U92B 3QQ3A 2D2OA 3QUXC 1QRNB 5DUML 3ILQD 2F53D 4QXTB 5JOPD 1MH5A 4YUEL 2NX5A 4PGCA 3VXUB 2IGFH 5DK2A 3PJSA 2XA3A 1LD9B 4JM2B 1BEYL 2ADGB 5F9OL 5EC2B 5AZEL 4KAQL 3GSXB 4F57L 5CINH 5T1KA 1FVDB 4Q97A 2CIIB 2VLRA 4JFEB 2YPLA 5J7CC 5IMKB 4IOIA 4Q9RL 4E41A 3CFIC 4WFFD 1RZJH 3QAZC 4M7LH 5DQJA 5EWIL 3SDDB 3UJJH 5EBLA 4H25A 4CVXA 4PJDE 4OT1L 2X42A 3D3VA 4MD4B 5TF0A 2R0KH 4UV4H 3RX8A 4N0UB 2BVOA 5ICYA 4MA8H 4KJQD 4KK5D 1XF2B 5C6TH 5KVEL 2BHZA 2B5IC 2WWMC 4ONHA 4JFOB 3MRPB 4HFWA 5F7YC 1BAFH 1INDH 4OLYL 1CGWA 2H2SD 1G9NL 2BVQB 5BVPL 3FQWA 25C8H 1JZ6A 5CEZD 4R97C 5IB5A 1FDLH 1CZ8H 5CGMA 4PJEF 5FYJH 1CF8H 3BQUD 2NY5C 4P46D 4WY7H 3ARDC 1BFVH 4PY8I 4ZFFA 2DIAA 1RHFA 1P7HL 4LCUB 1JIBA 4MA3B 1K3ZA 1QSFA 3S9DB 4K7FA 3T08A 4QLRA 2NLJB 4JFFA 2Z8VC 3OX8A 4KQ3H 1IC4H 2EYSB 4GXVH 3GUTA 5F9DC 4MAYB 1JZ5A 3I75A 1NDMB 1WGOA 1AQDA 1FNHA 1HI6A 4MZ2A 2FIKB 3PWPD 5CLTA 3GI9L 5B8CB 3B2UD 3KYNA 3UAJD 1JRHH 4ODXA 3AFLA 3L3IB 2CO6B 3DV4A 3GIVA 4FTVE 4NNYB 3S5LA 2QEJA 3QQ3B 3LY6A 3AS3A 4XCNA 3QJHA 5DI8A 5BRZA 4XWGH 1HCFX 3V6ZA 1MH5B 1PKQA 2HTLC 2NX5B 4PGCB 5FUCC 5DK2B 5CJ8A 4C4KT 1KYOJ 3PJSB 4KKLD 3KPOB 3MRQA 3AM8A 2LAGB 4RA0C 3FO9A 5T1KB 2Y07L 2VLRB 2YPLB 3A67H 4PRHA 4IOIB 4EUPG 4E41B 35C8L 5LGHH 4LOUC 4DCQA 4YHPB 3N1PC 1ZAGA 4ZS6D 5DQJB 2JKXA 4Q74A 5EBLB 4JHWL 4H25B 3V5DA 1DQML 1RFDL 3FN3A 4CVXB 4NKDA 1JYNA 3GKWH 3D3VB 2L4OA 4NQXA 3ZHKA 4UILH 5GGVY 2BVOB 5I1JL 5ICYB 3HC4L 2OTWA 2R0ZH 3B43A 1B0RA 1KB5A 4ONHB 3MO1A 4HFWB 1EMTH 1AE6H 4TSBH 3HUJE 4P23D 4Y88A 1DFBH 1DVFD 2VXQH 1AFVH 4MXQC 4YK4B 3FQWB 3OAUL 2QADD 5DC4B 5IB5B 1MAJA 5BOZG 4XVJL 4OZGF 4TULL 1KTRL 4YEEA 1WZ1H 3SGDH 4ZFFB 1OAKL 2YN3A 3MRBA 3QI9A 1YUHA 1QSFB 5ADOL 1XAUA 4ALAL 4K7FB 1KJ2H 4PJBE 2D7NA 4JFFB 1F5WA 4WNQA 1FNSL 3OX8B 5CJXA 3W5NA 3GUTB 3W11C 4QRTA 3I75B 1AQDB 1HI6B 2JTDA 4OZFG 2C7UA 4XNQA 1OQOA 5IR1A 1YEGH 5ITBH 3KYNB 1Q0XL 3QCUL 3BPNB 1MRCL 1U6AL 1JI2A 4ODXB 1UH2A 5F7DA 3VMOA 5SX5H 4N8CH 3GIVB 3S5LB 5IVXE 5D2LF 4RGMC 4QYOA 4GG6F 4XCNB 1MI5E 1C16A 2R15A 3QJHB 5IOPA 5DI8B 5DMIH 2NY6B 5BRZB 3BOVA 5F7FA 2HRPH 2F8VA 1PKQB 3V6ZB 1HQ4A 4EZMA 5I74B 1AKJA 2BY0A 4PD4K 5MP6L 2ZUQB 1KXQE 3EYOA 1OAUL 3MRQB 2WBKA 1NGQL 1A6VH 2FJFA 2DN7A 4U1MA 3P2TA 3DLQR 3KPRE 3UJIH 3FO9B 5AAWA 1TJIH 3JTTA 1W0YT 3N1QC 4JM4H 4QHUA 4C54A 3NCFB 3M07A 3FO0H 5K59E 3L7FA 2V5MA 1VGKA 3S8WA 5EBWA 4DCQB 3O2VL 4FQXD 3MUGA 4Z7UF 2OZ4L 1DE4A 1BF2A 3HMXL 3PGDA 4TYUA 3V5DB 4NKDB 4AL8L 5CUSH 1RZJC 3FONA 4NQXB 2XIDA 3SN6N 2FDBP 2OCFD 3QPQC 5LJYH 5DA0B 1FORL 5FIEA 5DHVA 3ILPA 2OTWB 1AXSA 1B0RB 3E3QC 3MO1B 4M48H 3SDYH 3MRMA 3VXOA 3D39E 3DETC 3VGBA 5JDSA 2EDQA 3C8DA 1I9RH 2JB5L 1OSZA 5I30L 4HK3N 1I8MA 3G5ZA 4O4YL 1TETH 3BSZH 3T0AA 2R56L 4NC1E 4LHQB 3MRBB 1YUHB 3HE6C 5E08L 1RIHH 3ZKMC 1Q9WA 1XCQB 2R4SL 4WNQB 1G6RA 4QRTB 1FHGA 2ERJB 3R8QA 4M7JL 1ZTXH 2C3HA 3P0VL 3H3KA 2C7UB 4G6FD 5FAAA 4XNQB 4DGVH 5IR1B 5GRXG 1IL1A 5HVHB 4MNQE 5F7DB 1CXHA 4OGAC 1JZ7A 3TBTA 2R8SH 4ENED 1UM4H 3HR6A 4QYOB 1EHLH 4PJ8A 4XPTL 1C16B 5KOMC 5IOPB 4JRXD 1RK0A 1HQ4B 5I8EA 3FB7A 1AKJB 5GZND 4JO4L 1FZMA 2BNRE 3EYOB 4KKAC 4GAJL 1I85C 2A0LD 2FJFB 4OF5A 4U1MB 4DJMA 4YIQA 2DQGH 3AS1A 3JTTB 4PGBA 3FQXA 2F58L 1CGSL 1QR1A 1BWWA 2XZQL 4QHUB 4G8GE 5I8KH 2ZG3A 3GEWB 5CBEA 4DN3H 5M94B 2RBLA 4Z7QF 3L7FB 1VGKB 5EBWB 5C0BD 4QRRA 3KLHC 1CG9A 4M1DH 3KPSE 3MUGB 1DE4B 1QSZA 3PGDB 3RIFK 1Y0LA 5GS2D 2X41A 3FONB 3C09B 4UAOB 4JY4A 4YDJA 1CICC 2ED8A 3SE3A 5DHVB 3ILPB 3O4LA 5FYJD 3QIWA 3WUZA 3MRMB 4R8WH 3SJVD 1PEWA 3AREA 3VXOB 4PGJA 4HSQA 1VGEL 5JDSB 1MEXL 4RBPK 4HULB 2Q3AA 5HYEA 1IKNC 1OSZB 3PQYA 1I8MB 1QP1A 5L2KE 4K3JL 3G5ZB 4YQXH 2CSPA 2VDKL 1RIUH 1OD7A 4UINH 3BYYA 1B9ZA 1LP9F 1P2CA 4FG6C 4RISL 5FEBA 5DRZA 4PJFE 1FGVL 1FVCA 1Q9WB 1O7VA 1T2QL 3GM0A 3SO3B 1G6RB 5DXWA 2XRAH 4MVBC 4HFUL 1WIOA 2H6PA 5KSAC 4U1HA 4ONGL 4LIQE 1LE5A 1CQKA 1IL1B 2XWBA 2X4SA 2NW2A 5J12B 2WIIA 5J13B 4UZGA 3TBTB 2VQUA 3BIKA 1NFKA 4P5KA 5D1ZA 5IVXA 4PJ8B 2DYPA 2X1WL 4MJIE 1GOHA 2HT3D 4Z0XA 1WBYA 3PP3H 1RK0B 4HUWA 3QDGA 1MI5A 5MHSE 1LQVA 4DKDC 5I8EB 2DL9A 3FB7B 2B2XL 2ZG1A 4IJ3C 4F9LC 1HEZA 5I75B 1FZMB 4QWWC 5I8OL 2EDDA 4X4YA 3AMLA 4YIQB 3E6HA 4PGBB 3FQXB 3KPRA 4LRNH 3UBXG 3V6OE 1QR1B 1G9ML 3SBWC 2IQ9H 5CBEB 1FNGB 4JJ5A 4NO0D 4QRRB 3CXHJ 4KZDH 1CG9B 3MZTA 4KI5D 4JO3H 4TOYH 4XP4L 3VXPA 1QTYT 1Y0LB 3VGDA 3GI8L 5BZDA 4PJCF 3RTQD 4JY4B 4OZIE 4YDJB 2W60A 3THML 1JI1A 1NEZA 1CWVA 1IFHL 4X6DB 5GISH 3O4LB 2LE9A 4XP6L 4OKVA 3QIWB 4TUJA 4G8IA 3AREB 3MBEA 5DRXA 4X9IA 4ZTOH 5IIEA 3D39A 4HC1L 5GGQH 2XYCA 2DJSA 3P73A 4XWOC 5DLML 2DQEL 3Q2CA 4O02H 5E9DE 3PQYB 1QSED 3BDYH 2Q87A 1H3XA 2UZYB 3BEWA 2RCSL 1C1EL 5C0RL 1JGUH 2Q20A 2VXVL 3V4VH 5FM4A 5I18H 3ELAT 1P2CB 2AW2A 1IGIH 3QDJD 3OKYA 5DRZB 4JG1H 1FVCB 5ISZE 3CH1A 2A6JA 2QKIA 4NQED 4LCWE 2R1YA 3Q0HA 1ZOXA 4HJGA 5T1LA 3QIUD 3N50A 1HKLH 4FFWC 2H6PB 4U1HB 4YE4L 3VFGH 1LE5B 3I6LE 1SQ2N 4HWZB 3CVHL 2XWBB 2X4SB 2NW2B 4NP4L 4TNWF 4MNQA 3ZE1E 2WIIB 4P2RD 2DD8H 5IMMA 1J5OH 1OARL 2VSCA 3BIKB 4P5KB 5D1ZB 5IVXB 4LAQH 4MJ6A 2DYPB 4Z0XB 4HUWB 3QDGB 3ULVL 1KCRH 2E7LC 1HEZB 3I50H 3QHZL 4X4XA 1AHWA 3W5MA 4HX1A 4Z76B 2BNRA 4BZ1H 1AR1D 4X4YB 1NCAL 4JPIA 2QSTA 3VXSA 3E6HB 1CD9B 1AXTH 4ZAKD 4XP1L 3KPRB 3WIHA 3RX5A 4Q58C 3BISA 5JHDA 5F71A 1X3DA 4S1RH 4XHQA 3VFOA 3OAZH 2E27H 1Q0YH 4L5FH 5IGXL 3VXPB 5JQ6L 3EJYD 3S4SA 1IQDA 3MNVA 3MJ8A 5BZDB 3UC0H 4PJIE 4DTGL 2VZ3A 5C07A 2OQJA 2W60B 5IM7A 1NEZB 3B9EA 1WVZA 4G9FD 5J6HA 1SJVA 1MWAH 1DBJH 4OKVB 4TUJB 3OZ9L 4IRZL 4KQ4H 4G8IB 3MBEB 5DRXB 1ZHBA 4WO4A 5IIEB 3D39B 4NN7B 2FX7H 1ITCA 4F7PA 1YPZF 1D6EA 3ARFD 3P73B 5FCUL 3MRNA 2O5XH 3JVGA 1WEJL 1CCZA 3BEWB 5DD6A 5HGBB 5D6DC 3VXNA 3QUKA 3FT3A 1A7RL 3C6LA 4EUPH 1LO2H 3BD3A 3CH1B 1KJ3H 2A6JB 4XCFH 2QKIB 4PJFA 4ELME 2R1YB 5T1LB 3TYFA 4HJGB 4A2MA 1LDPL 2HT4C 3DSFH 2VLJA 3BVNA 1BZ9A 3PL6D 3WS6A 2RQ8A 3IS0X 1YJDH 4HGWA 4AM0A 1G9MC 4IDJH 2VOTA 4MNQB 5EU7E 3LN5A 3GK8L 5IMMB 1Z3GL 1EHAA 3P11H 2YPVL 3MJ6A 4O58L 3WDJA 2FO4A 3QNZA 2DTSA 2EC8A 4MD5A 4X4XB 5T3ZH 1AHWB 3T65A 5HVGB 1NBVH 4HX1B 3W0WE 3J7HA 4BZYA 3RFZC 2BNRB 3SQBA 4K9EL 3ZDZE 4JPIB 3VXSB 5BMFL 1PG7X 1MOEA 1I3VA 3TH3T 4BK4A 5JHDB 4RMRA 1QOKA 3V6OA 2YD7A 4G80A 5BS0D 1I7UA 2YEZA 3VFOB 3GM8A 5EU6E 3K2UH 3LCYA 3FJTA 4JAMA 3P4LA 1HINH 3VW3H 3S4SB 1IQDB 3MNVB 3MJ8B 1IEAA 2F53E 1M7IA 4OZFH 4U3HA 5C07B 2OQJB 5IM7B 5J6HB 1WICA 2OP4L 2XN9D 1U3HC 2OLDA 1PY9A 5F96H 3LQAH 1ZHBB 4WO4B 3CZFA 1VHPA 4F7PB 1GYAA 3UX9B 1D6EB 2JCCB 4WFFE 2PO6C 4PJ9C 4TSCH 1UXWA 3MRNB 1L0XA 3MUJA 4UTAL 1GHFL 1Q9KA 1OGTA 4FS0A 3L7EA 5DD6B 1AO7D 1R3IH 3MLTA 4XHJD 1WWBX 2I9LA 3VXNB 3ARSA 2B20A 1N6UA 3FT3B 3QUKB 3C6LB 2PXYA 3CX2A 1KB9K 4OF6A 1NCWH 3EOYG 2Q8AL 4PJFB 5ISZA 3RGVC 3QPXL 3TYFB 3AY4A 3C5SA 1Z0NA 4XXCC 1PSKH 1JZ2A 4PJEE 2H8PA 4MGXA 5A43C 5E1HB 1BMGA 5DQDH 2VLJB 3BVNB 3NAAL 4OLXL 3UJTH 1BZ9B 3BRFA 3RNKA 3T1FA 2V17H 4HGWB 4LHJB 2PW2A 4AM0B 1XCTA 2ZUXA 3I6KA 4KUCF 3EFDL 3LN5B 5HSFA 1T7ZA 1I4FA 2MCPL 4FP8L 2MCG1 1W0VB 4PJGE 1MVFA 5DWUL 5BZWA 4GLRI 1X5HA 1NLBL 4BA8A 3TC9A 3TH2T 1QFOA 5GGTA 2HFGH 2FO4B 3QNZB 1WTLA 4NYLB 4HWEH 4MD5B 3T65B 2EDHA 1U36A 5E2VH 2A1WL 2NY3C 4YXLH 1ZEAL 4N1EA 1DEDA 2J4WH 2P5WE 4BQCA 1D5IL 4PLOB 4HPYH 3PWJB 5EO1A 3D48R 1JTPA 3BE1L 4G80B 1I7UB 2YEZB 4P4KD 3VFVA 1L6ZA 4KVCH 3EJJX 4JAMB 2HT2C 3MRDA 4QO1A 4ZD3H 1D6VH 2BVUA 3BI9X 1IEAB 2ADJA 1M7IB 1NCBL 3U4EA 1MJ7L 2DQUH 2VC2L 5GGUA 2H2PD 2P45B 4PB0H 3BD5A 1NMAH 1QFUL 2Z31C 3EJZC 4RMTA 1G0XA 1SYVA 1OVZA 3CZFB 3QIBC 2OMNA 1YY9D 4WCYL 4YHOH 3BGMA 2IMMA 1UXWB 2MFNA 3GJFA 2FR4A 4IDLA 1Q9KB 1OGTB 4TN9A 3L7EB 2VN4A 4G3YH 3MLTB 1L0YA 1CGUA 3VXMD 1K8IA 2I9LB 4UOJA 1WCBA 1RUAL 3KJ4C 2PXYB 3K46A 3V5KA 5EIVA 4NHUE 3SDCC 2QQKH 4R4BA 4LF3A 5LBSH 5ISZB 1W8NA 2VWEE 1N64H 3C5SB 2X09A 4P5TC 4ELMA 2PTTA 2H8PB 4K9EC 1EVTC 3I02A 4UB0L 3CLFL 1AC0A 4WU5A 3RNKB 3T1FB 2PW2B 3FO2A 3QDMD 4LSSL 2XV6B 1EHXA 1XCTB 3QWRD 3I6KB 4MQXC 1I4FB 3RAJL 5BZWB 2IPTL 2GEEA 1TNMA 4JVWA 2EXYD 5HHMA 3QG7L 4FQLH 4S1SL 4ISVA 4Y7MA 5I6XC 1JGVH 1AI1L 1AGCA 4XP5H 3WXWL 4JKPH 1WWCA 3C8HA 3KYAA 4CGTA 5L8LB 1FGNL 3P9WB 5FUCE 4YHIA 3W0WA 3ZMRA 1GXEA 1SY6A 5L2JA 2DB8A 2FX9H 5D2LE 1U8MA 5DT1H 5EO1B 1XR9A 5CEZL 4OCYH 3NABH 4L8SA 3V8CA 5GJSH 3VFVB 1T2JA 1YMMD 3MRDB 5EU6A 2P5EE 4OGYL 2EE3A 4GBXC 2DTML 4JQXA 2P44B 5GGVH 2ADJB 2GCYA 5BCAA 1YEEL 3DGCR 3RGHA 3U4EB 4DEPC 5K9JL 1VCAA 1I8IA 5GGUB 5CBAA 1I1RA 2WBWB 4K2UH 3KPNA 3CXDL 1KCSL 3V4PH 3MOQA 3VCLA 1J1OH 4B53A 4BH8A 5FUZH 4KUZH 4Z7UE 1SYVB 1X4ZA 1IM9A 1JMXA 3T0EA 3BGMB 2H45A 1IC5H 1NGYB 5DFVD 1U8IA 2HLFD 3GJFB 4Y19D 2AEWA 2FR4B 3ABZA 1T7WA 2F54D 1FO0A 1P69B 2JJTA 2FSEA 1K8IB 5E1AA 1WCBB 5CP7A 3GSUA 4M1GL 4GRLD 3S37L 3V5KB 5IJVA 2FHBA 5E8DH 4AENA 4YLQT 1MJUL 3UDWC 4R4BB 4LF3B 4ZS7L 4ELMB 1A3LH 2PTTB 4RFOH 4KK8C 1A6TA 3I02B 4PJEA 2HKHL 4WU5B 1MCDA 3CX5K 4KTYA 1XIWC 2WLZA 5I19H 3FO2B 5T3ZD 4AQ1B 5EOCJ 5GGSA 1MCEA 2X70A 4CJ0A 5KVDH 3S36X 5HVWA 1FJ1A 2HWZH 5HHMB 1A7NH 3UYRH 3RZCD 1MREH 4ISVB 4P9HH 1TTGA 1AGCB 3R0MA 4FQIH 3QRFM 5K9QG 3B9KD 1FYTD 3QUXA 1G6VK 1I1CA 4M9OA 1I1AA 1BGXH 1RMFL 1L9MA 1T7VA 3SDAC 1KEML 3IFOA 4YHIB 4UU9A 3W0WB 1FAIL 1DLHA 3SOBH 3EHBC 4R0LC 5L2JB 4KTDL 5JA9A 4Z78A 3NCMA 1J8HA 3SCMC 2PNDA 1U8MB 2P5WA 5DD3H 3H0TA 1XR9B 2CKNA 5EUKA 2AJYH 5C8JA 1A21A 4L8SB 5J57B 1R3KA 3DMMC 1ETZA 1CQYA 5FV1L 4PB9L 2HFFA 1S7TA 2GCYB 4LP4A 3ILQC 2HJKA 1I8IB 2DLHA 5CBAB 1MCFA 3G6DL 1BFSA 3IAPA 5HYQA 2AEQL 2L0DA 3KPNB 1UZ6F 1HHIA 4P3CH 3HFML 3GMPA 5D96C 4K23L 3VCLB 5E2WL 4HWBA 4BH8B 1NUGA 3WHE0 2QSCL 4M6AA 3E3QE 3BFOA 2EDRA 1HWHB 3T0EB 2ZUYA 4Y2DD 4Z7VF 5C0BE 2AJSH 3NGBB 1NANI 1U8IB 4ODUA 3TJHC 1RJLA 4FA8A 3OAYK 1FO0B 1W72H 3EW3B 4UDTA 5DVOA 2FSEB 1N4XL 3HNSH 1B3JA 5E1AB 3O9WD 5CP7B 4X9FA 1S7VA 3GSUB 5L88H 5IJVB 3ARDA 4XNYH 4NWTH 5FYJE 4O5LL 4AENB 4TUOA 5F8RC 5IROC 1ZA6A 4NHUA 4U7KA 1X6LA 2F5BH 3EYUH 2AJZA 4MNHA 1X5FA 2AXHA 3H42L 1NJ9A 1A6TB 4HWNA 4PJEB 4OZGA 2H2SC 5EZJA 5A2LH 1ND0B 5CD5D 2X4RA 4HIIA 2VUYA 5GGSB 2X70B 4FFYH 5BV7H 5TPWL 1B6UA 3TESA 2JJSA 4P46C 3JTCA 5HBBA 1AR2A 3E8UL 2CO7B 3MV9A 1FJ1B 1KELH 2UUDH 2DWDA 1X5YA 3ZZ1A 3QUXB 1JMZA 3U0PA 4F7TA 4OCWH 1I1AB 1NC4A 4D9RD 1F3DH 2VDPL 3IFOB 3U82B 4UU9B 1HXYA 3VFRA 3LIZL 1DLHB 3V7AG 4Y1AD 3ARYA 4XPGL 3T0VA 4Z78B 5IWLC 1J8HB 4RWYH 2P5WB 3H0TB 5EUKB 3DTXA 4L4VA 5C8JB 5D2LA 1ERNA 1X5KA 5I0ZA 1R3KB 2ATKA 1ETZB 2LVCA 3BN3B 3LAFA 2WUCH 2PUQT 4Q9QH 2HFFB 2P5EA 1S7TB 2W9DH 3RDTD 3QAZB 1YEIH 4E9LA 2CKBL 5FF6A 2HJKB 3BKML 4JKMA 3AMKA 1J0IA 3CSYA 5C9JA 5IB2A 5HYQB 4AH2A 1HHIB 4YDIH 3GMPB 1DUYA 1NLDL 3V4UH 3TPUE 3B6SA 5C0EB 5CD3A 1MQKL 4S1QH 4Z7UA 2B5IB 2AK1H 4BQ8A 3GRWA 2VLME 4D0BA 2IQAA 1QA9A 4OIIL 4NCC2 4KROD 4O2EA 4ODUB 4JZJC 4ZO9A 4ZS6C 1MAMH 1RJLB 4FXLA 4MXQA 1A64A 5D7JD 3HMWL 4LVOC 4KRPD 4UDTB 4R97B 2VDOL 3MLUH 3RKDC 5DO2D 2G60H 4WI8A 1S7VB 3MREA 3KAAA 2XTJD 3R1GH 3ARDB 3SO5A 4M7LL 4TUOB 4JY5H 1ZA6B 4NHUB 2CQVA 5SWQA 1DTUA 2GJ6A 4PS4L 2AJZB 3QWOA 5DVKA 4MNHB 4M43L 1MFBH 1NJ9B 3PV7A 4ODBD 4Q0XL 4OZGB 2J88L 4MA8L 5BO1H 5EZJB 3ROOA 2Q8BL 3TN0D 3S5LG 3U7AA 1R3LA 4LPXA 2X4RB 1A1MA 2NY1D 4HIIB 4WTZA 43C9A 1HHHA 3TA3D 4NDMA 4UBDC 5FGBC 3BUTA 1FC1A 2O5ZL 3MV9B 1ZE3C 2HAZA 2XQYK 2DWDB 2LABA 2R0LL 1A3RH 4QNPE 2BHYA 4IHOA 4JB9H 4F7TB 3LZFH 1DQQA 1NC4B 1IGFL 5SV4A 1E4KC 4Y89A 1HXYB 4HGKC 1I9JL 3VFRB 4NOFA 1AJ7L 2FYYB 4ERSH 3MA9L 4WDIA 3WHXA 3DTXB 3LS4L 3QUYD 4L4VB 5D2LB 2R69L 3MGTB 4WIQA 4GG6B 2WUBH 2ATKB 1EUUA 3LKOA 1MCBA 4ORGA 1MCWW 5CILL 4N90D 3NA9L 4CVUA 1LMKA 1D5MA 2P5EB 5FF6B 4ZODA 5T33H 2VR5A 1F4YH 4G6AD 4QHKJ 1FIEA 1JRHL 1N0LA 4WW1A 3CSYB 5C9JB 5IB2B 1P4IH 2BK8A 2LAAA 5FDYA 4AH2B 1IM3A 1JNLH 1YYML 1DUYB 2BFVH 3B2VH 3P0YL 4WTXA 3VDCA 2D7MA 3B6SB 4KXZH 3LN9A 5CD3B 3PGFL 4M3KB 5F44A 2BXZA 4Z7UB 3E3QA 4D0BB 4EXKA 2IQAB 2EH8H 1QA9B 1MUJA 2W0FA 7FABH 4O2EB 4H8WH 1RUML 2E8YA 2VTFA 1E0OB 2DMCA 2IANE 4J4PC 2YRPA 5T5NG 1DR9A 5TE7H 1NMCC 5EG6C 2VSDA 4JZOA 3VI4F 3A67L 3RIAK 1SVZA 5LGHL 3MREB 4X6CF 2EIEA 1GGCH 1GGIH 1YPZE 3U4BH 1VFOA 3HE6A 1EGJH 5E03A 5SWQB 2GJ6B 3DHMA 4HG4K 3TFKC 3QWOB 4Y2OA 1VDGA 3WCYA 5C9KA 1Q9LA 4JY6A 1B4JL 1H3GA 3RZWA 2J5LC 3GHEL 2B4CH 3ROOB 3RJQB 4PDCE 1ZLSL 1CR9H 2Z4QA 2QSVA 1A1MB 4LLQA 4RMSA 3FN9A 43C9B 2MNUA 1HHHB 1JTTA 4NDMB 3F12A 1EMTL 1LP9A 3VA6A 1JFQL 2VABA 1A4JA 1UCTA 2KL6A 1CTOA 1KTDA 1YNKL 4ELKA 1AFVL 5HY9A 3ZDYF 2EE9A 3ZSTA 5IQ7H 4RGMB 4OQ1A 4IHOB 5HHXL 1DQQB 4P2QE 4NJAH 5SX5K 4LCIL 4YHMH 1NCDH 1Q1JL 1BREA 4P3DA 4OJFL 3WHXB 1S8DA 4NQSA 5GGRY 4XAWH 3M8OL 3QEGH 1FL5A 3X3GL 1LK3H 3OR6B 2DQJL 3LKOB 4MD0A 3JWDH 4Z0BL 5DK3A 4ORGB 2YUXA 4KHTH 4OF8A 1H8SA 1D5MB 4GFTB 2XZAL 3S35H 4R7DA 2FECI 1F3RB 4WW1B 1PYWA 5JPMA 1IM3B 2YSSA 3VG9C 1CICA 3FRUA 1KV3A 4QXWA 3TPUA 1RZFL 4UIKL 1CDJA 1DSFL 1ZKAA 2HRPL 3RVWD 3QO0A 3VD3A 1YQ2A 4F8QA 1MUJB 5GJTH 1KLFA 2W0FB 4PJCA 3GSOA 4UI2A 1A6VL 2MPAH 1IKNA 1AY1L 3WFCL 1LEIA 4JZOB 4UT7L 3O6KH 4KU1A 5C0AD 2Z92A 5LVEA 2PW1A 1OTUD 3WIIL 3VGAC 4HKJA 3HE6B 4RGND 5DMGD 5EA0H 3X14A 3OKKA 3VGHA 4M6OH 1S7WA 2E6PA 2XACC 1Q9LB 4YDKL 4H0IA 4RDQG 1QLRA 4JY6B 1NL0L 4BJLA 2HKFL 5FXCH 3WUWA 1KJ2A 3DO3A 1ZLUH 4MVBA 1BBDL 4GH7B 4IS6A 2OL3H 2Z4QB 5KSAA 4LLQB 3K0WA 5EULV 3MLZL 1YQVH 3F12B 1LP9B 2VABB 1A4JB 4YEFA 1R24A 1CBVL 1KTDB 1OAQL 3O3BA 1XR8A 4ELKB 3HRPA 4I8DA 5HY9B 2OZ4A 1UEMA 4G6KH 5CAYB 1R3JA 1MIEL 1GJIA 1J1PH 4M03A 1TETL 4MXWL 3MCLL 3SY0A 5IUSA 2XA8H 1EHNA 5CGYD 4U1NA 4F9LA 2FX8H 1R6VA 3L3JA 2Z91A 1IAII 4P3DB 4LSRH 1RIHL 1M7DA 4NKQB 1S8DB 4NQSB 4URTB 4ZFOA 4HXBL 1OOAA 3TGXA 5F1OB 4MD0B 3SBWA 5TE4L 1V7ML 1G1CA 3QNXA 2IG2H 4HT1H 4DGVL 2YD8A 4R7DB 1J0ZA 5HHOD 1LO4H 2OMBA 3WFEL 2DM4A 4YX2L 1PYWB 4WUKL 5JPMB 5IQ9A 2WZPD 1IBGL 3CDCA 4NN6C 2YSSB 5DZOA 3K1KC 1CICB 2R8SL 4R2GC 3FRUB 2QR0A 2Y5TA 1OP5K 3TPUB 5CZXD 3LH2H 5TQ2H 5ESAA 4JFHD 5FHBL 3QO0B 1WAAF 3TT1L 5HI3D 4L3CA 4O2FA 4HLJA 3BKCH 4LU5L 5IV2A 4PJCB 3GSOB 5GXBB 1JF1A 4QRQA 3ZL4L 4KI5C 2AP2A 3ARWA 1A2YA 2QJDA 5JTWA 4FQCL 2WAHA 4PYHA 1PQZA 5KZCD 4JHAH 1LEIB 2IANA 2YWYA 1MCOL 4F7EA 4JG0L 1C08A 5I8KL 2V5RA 4H8WC 2Z92B 2PW1B 4DAGL 3F7VA 2CIKA 3CLEH 1QKZL 4HKJB 1JHLH 3F8UB 3X14B 1YPZA 3OKKB 3HNVL 4HJ0D 1S7WB 3S37X 3PXJA 1QLRB 3NACL 4Y5YA 2A9MH 3WUWB 2G75A 1KJ2B 15C8L 4O9HL 3KJ6L 4NBZB 4E5XA 3SKNB 4IS6B 4F7CB 3QJFA 1CDIA 5KSAB 2YK1L 1GPOH 5T3XD 4XAKE 5HXMA 1HKFA 1GC1L 2ZWLT 3NCBB 1R24B 2KZ1B 1FBIH 3MRHA 2NZ9D 3O3BB 2X4NA 4YHLL 1XR8B 3ARPA 5ENWA 4JDTH 2AABL 1LDSA 2YD6A 3HZVA 1RZ7H 3QXTA 1LEKA 3ARQA 3W82A 3OF6D 1R3JB 2WBJD 4DQOL 4YQXL 1T5WA 2KQNA 1OB1A 4IIQC 3MXVL 3T4AA 1MF2H 1GAFH 4G6ML 2E7LA 4QTIL 4CAGA 3SY0B 4IJ3B 4U1NB 5F9JA 2Z91B 4M9PA 4KMTH 4ZNEA 2BERA 3QDME 5T1DH 4I5BA 5HI5C 4G43A 1M7DB 5L9DH 4TVSa 5JW4Q 4LSPH 3EFFA 5F7EH 1NMBL 3MOAH 1KF9B 3ARXA 1ZGLA 4M7ZC 3QNXB 3TBYB 1AQKH 3HPJA 4HGMA 1WSST 2GFBA 3WFDL 3JWDC 1LILA 1HSBA 5MEND 4K7PX 3O81A 2APWA 1UB6A 5IQ9B 4KI5F 2E6QA 5A3ID 4NKIL 1V3JA 5M7QA 2QR0B 2Y5TB 4DKFH </