4QRTA

Crystal structure of hla b*0801 in complex with eln_yym, elnrkmiym
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
276
structure length
275
Chain Sequence
GSHSMRYFDTAMSRPGRGEPRFISVGYVDDTQFVRFDSDAASPREEPRAPWIEQEGPEYWDRNTQIFKTNTQTDRESLRNLRGYYNQSEAGSHTLQSMYGCDVGPDGRLLRGHNQYAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAARVAEQDRAYLEGTCVEWLRYLENGKDTLERADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular imprint of exposure to naturally occurring genetic variants of human cytomegalovirus on the T cell repertoire.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, B-8 alpha chain
total genus 82
structure length 275
sequence length 276
ec nomenclature
pdb deposition date 2014-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4qrtA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4qrtA01
4G6MH 5IROC 4M61B 1OAXH 2BJMH 2K1MA 1G7HB 2NXZD 4OAWB 5T1KB 2HJLA 1I7ZA 4ERSL 5GGQH 3MRRA 4OFYD 5F93C 3QPXH 3NCYP 1K6QL 3WLWD 1EMTL 1UEYA 5JOPE 1EMTH 5F7DA 1JTTA 1SJVA 1U91B 4QXGL 2CKBL 1G7PA 1DFBL 3VDBA 3TFKD 3MJ7A 3FZUC 1J1XH 4K7FB 4NCC2 4YHZL 2OSLB 5L2KB 3WJLC 1D5ZB 1B4RA 1F4AA 4EUPA 4E0RA 3BXNB 1W0WA 2AK4B 1A7QH 1IAOA 1JPSH 1MJJA 1T5WB 4JN1L 4LVHB 4RMUA 5KTEL 2EC9T 2HWZL 4JO2H 1EVTC 1J1PH 4MA8L 4AENB 1MQKH 4UIKH 1OGAB 4XVJL 5EULV 3LKQB 1HYSD 4JG0L 2RFXB 3PJSA 5CHNA 2FATH 1HHKB 2Y5TB 5F7MC 2KL6A 3TN0C 3NMEA 4HPOH 3IYLW 1WWBX 1DUYB 1PYWB 4XCEB 3W0WE 3C60D 2W38A 3BFOA 2CKBA 3QUYA 1UQSB 3P40A 5B38B 1XGUB 4GRWB 4PY7B 1YEFH 5ALBL 5INCB 4Z9KB 5SWSA 3GDBA 3HI1A 1MCHA 2PO6A 4GW1A 1I3GH 4O4YL 1FZOB 4D9LH 4JFFE 1YQVH 2LE9A 4M1CD 3VJ6A 1M05B 3F7YA 5BV7L 4JM2C 5K33A 3DXAD 5CZXD 3UTPD 4BH7B 5DRWA 3BSZH 1MSPA 3WUZA 1RZ7L 2VIRA 4NC1E 4EVNB 5J0BA 1M6OA 2CO7B 4NHCH 1AGCB 4LCUA 1V5JA 2I9LB 3MLWL 1CLYH 4GRMA 4PJHF 4M3KB 1WWWX 4KK9C 5IMKB 4HBQA 5L2KE 2N7AA 2D7NA 4KH2A 1KJ2A 1VEOA 4GLRH 1R3LB 1BX2A 5HDBE 1MLCB 4ZXBC 4EQ3A 3T0VA 4JY6B 2Q20A 5ID1A 3EZJB 3MRGB 4L4TD 5GGQL 1UG9A 1KIQA 4ZUVB 4ZOEA 3WNPA 1DQDL 4NC0B 3VXUD 2VITA 5C0EB 4YC2B 1KXQE 4N0CC 3W9EA 3E6FB 2Q8BL 4K3HA 1LO4H 5D7JA 4ZFOB 4ZNEE 4EI6B 4U6XB 1C1EH 4TPRH 2Y36L 1UB5B 4JB9H 2HKHH 2DQCL 3FQXB 3MBEA 5IW1A 1HSAA 1HDMA 3HUJE 2QQLH 4ZDHB 4UBDD 2HLAA 3WIHA 5BZDA 3F12B 5K59F 2YPKB 3MROB 1A7OL 4NOBA 2AV7A 2EDJA 4LCWB 3UTPE 3VI4E 2AJUL 3S3SA 1QPXA 3F58H 5JO5A 1QSED 1Q8MA 1C08A 3GHEL 2FR4A 5DFTA 2VQ1B 1EJOL 1BFVL 3MACL 2VXVH 3NAAH 3OB8A 2HRPL 4K71C 4LCCB 3OR6B 4QHLA 3H3PH 4WFED 4FMFA 1U95B 2XICA 5GS2H 2DQGH 1KXVC 1BZ9A 1OT1A 4MXVE 2FIKB 3NIFE 3GK8L 1H8OA 1V3MA 3OKDA 1IC7L 3VRLE 3Q1SH 3T3MF 1X44A 1S9WB 2FJHB 3CGTA 4IMKC 5KS9F 4L9LA 3VFVB 2YRPA 1CVSC 3UEZA 3QUML 3PXJA 2YD4A 3SCMD 4HIJB 1T7WA 4RFNB 3UBXA 4DKEL 4XNXL 2XA8L 2G60L 3KXFD 4PJGE 1CDYA 4X7EC 4PJ9C 3WN5B 4PRPD 1IC4H 1Y0LA 3H9SD 4BFBD 4JFEE 3WNLA 3DPBA 2P8MB 1T04B 1CGSL 5C0IB 3RPKA 5MEQB 4HF5H 5IB2A 4PTTB 5I1EL 4X6CB 1CE6B 3SO3B 2X4SA 5EU6E 2R8SH 3FCTA 4J3OC 5GJTL 4KTEL 2H45A 1QSEE 5KW9H 1FIGH 1WTLA 3QISA 3QIWD 3LEXA 5D7LE 3SDCA 3CFBB 4LKCA 1CGXA 1WEJH 1R3HB 2A9MH 3BPCB 2ARJQ 3O8XA 4YFLI 5SX4H 1RJYB 5I8KL 1U6AH 3MMEB 3VXRB 1SEQH 4CU8A 3IF1A 3OKOB 1MWAH 3MV9D 4K94C 5L6YL 3C6LB 2WINA 4NRZB 4PJ7E 4TTDC 3WDIA 1CD1B 4EUPG 3BW9A 3SKMB 3HNSL 1NAKL 2JB6B 4ODUB 5HGBB 5DRZA 5EBLA 4YGVB 4J8RB 5ID0A 1DVFD 1I9RH 3LMJL 2XZQH 3T04D 2DMBA 3OBAA 1X5YA 3EBAA 3RWDA 1F8TH 5E6IB 4MMXC 2FGWL 1L9NA 2BNUB 3L3IB 4TVPE 5MP6H 4KQ4H 4U7MA 1P2CB 1YY8B 4H1LA 2OTWA 2Q6WB 4JDTH 2VLLA 1ED3A 3B9DA 3RHWF 1FHGA 2IMMA 2OZ4L 3FRUA 1QQDA 1P7QB 4M7KH 3VGFA 2R4SH 3H3KA 1IQDA 1N6UA 5FYJD 4K9EH 3VDAA 1R5WA 1H5BC 1II4E 2HTKC 5TJWK 3QI9B 3ZYJA 5BV7C 4ZUTB 4TUKH 4UQ2B 2YRLA 3G5VA 1CZ8L 2P4AB 2NTFB 5DK3A 5HPMB 4OZHA 2C9AA 2FEEL 1N8ZB 3BN3B 5D7JB 5DVNA 3TT3L 2EXWD 1CTOA 3TT3H 5T5FH 3VFOA 4FZEH 4GOSA 5BQ7A 4OGYL 1I1RA 3S3PA 3CX2A 4HK0A 5SWSD 1J1XL 3LH2H 4RMQA 5GGUB 3O8XC 5MERA 1MJ8L 2NY5L 2PTTB 4PLJC 2DMKA 2X4TB 2J8UB 4L1DA 1MCQA 1MRFL 5ITFA 3PWNB 2YXFA 2BERA 2NY5C 3RGHA 1ZEAL 1VACA 4LSSH 1KBGL 4XNUL 3GSNA 5TFSH 1I8LA 5FO8A 3QCUH 5GPRA 4OQTH 1BZ9B 4ONGL 2J5LC 1F6FB 4YDVB 2JJTA 2X4PB 4NT6A 4HWEL 4WUUD 4Y4HD 5T33H 4S11A 3FO9B 3VFGH 1JGEB 4CL7A 1Q9LA 3FB7B 4X80L 3O3BA 2H2SC 4FG6C 4Z7VE 3VFVA 1RZKC 1Q72L 2KBGA 1BBJB 2JELH 4BK4A 3TA3A 4FABH 2DJUA 1UC6A 1CXIA 2VDLL 3ZDYF 4YXKH 1HXYB 3H9ZA 3WN5A 5HI5C 3EO9L 5A2FA 3P9MB 5ACZA 5JNYA 1KJ3L 4FQHB 4Z6AT 4YLQT 3HPJA 2XIDA 4PLJD 5JLZA 5D2LA 5KAQG 5F9AC 3MJ9H 4X5WB 3RVUC 2X4OB 2GFBA 5J6GA 4X6BA 4PJEB 4F7MA 1ZMYA 4MNHA 5KN5B 5E08H 4S1DC 1T5XB 4PGZA 3IS0X 4NN7C 3BIBX 3KJ4C 4YXLL 2NY0C 1XGYH 1YUHB 5HI5D 4WUKL 1NH6A 3X17A 2F53E 2ARWA 3BUYA 3GSOA 5IEHB 3PWVA 2XY1A 3OB0K 5HHOE 1FGNL 5EZIH 4GXUN 4J1UA 3Q6GH 1HH9A 3RWHA 1X6NA 4EIZC 5A2IH 5J1TC 5JIPA 5KTEH 4PGEB 3FQWA 3ARGB 4KGLA 3CSPA 2VDOH 3MLTB 3TGXA 3SDDC 3FQUA 35C8L 4LU5H 1L7IL 1FL5B 4UQ3B 4A6YH 1NCWL 1MFDH 5DK2A 1WBZB 4V2CB 4U1HA 4NKQB 3SEPA 4CJ0A 5I17A 3CD4A 5L0QC 5D72H 3TIEB 1H9VA 2PW1A 1JTOA 3WFEL 1OCWH 5F9WB 1QKZH 3EOTH 4G6JL 5I18L 4DEPC 3O8XD 1DVFC 1TQCC 3OHXA 1CIUA 4AT6A 1EHXA 1HH6B 3RY6C 5A43C 4NKIH 1JHKH 3C2AH 4PRNB 1QSFB 5HXMA 2DQJH 2W65A 1P7QA 5I1GH 1J88A 4L8DB 2DLFL 4NWTH 3QUMH 1B0RB 4CN1A 1HDMB 1SYVB 3MLXL 5HPOA 2KZWA 2QQQA 3HC3H 2VLRD 1GPOL 1MFEL 1PX3A 4LLDB 4I18B 1FCGA 2C3VA 5GSRA 3SJVD 5IFJB 1OAKH 3EW3B 2HRLA 3MLSH 3ALWA 3IJHB 4WFHE 1JGDB 2IFFH 1G7JB 1NBYB 4M48H 1Q9OA 2QADD 3RL1B 1XT5A 1KT2A 3MOQA 1JMXA 2NX5B 4G5ZL 3ULUF 3L7FB 5GS1C 1M1SA 1NGXA 1OB1B 4NM8L 4ZODA 4DKFL 3ZKXB 2W92A 2VZOA 1N64H 5AZEH 4XHQA 4PJ9D 4I77L 1KIUA 2V9QA 2K9UA 4S0TD 3LKSB 4YBQC 4H5SA 4GQ9L 2VXVL 3AS2A 1T7ZA 5IJKC 3UBXB 3D3VB 5DQ9B 3IDYB 4ZS6D 3CMOL 5IW6B 1RV6X 1K3ZA 4LGPB 4P4KB 4KKLD 1QHPA 2B1AH 1MAMH 4AJ0A 3DETC 1TMCB 4UTAH 4Y5VC 3U0WL 5KVFL 1V7MH 3TPKA 3L3DA 3UROR 1QRNE 3LSOB 3GHBH 4PJIF 3UYRL 4UDUB 1A7RH 5KS9A 5DWUL 3VG0L 2DL9A 2ITDA 3ERYA 3CDFA 1JNLH 2DRUA 2R56L 3TA3B 2NNAA 5ANMA 1OP3H 4FQIL 3FCTB 4KZDH 1LE5B 3BH8B 5C9JB 4X6CA 1OGAE 1B0WA 2XA8H 3KPRE 5HVHB 2N7BA 2V5YA 1ZHKA 5I8EB 2MTPA 4FTVB 3LD8C 1IC5H 2OR9H 4HQQH 2A2QT 3BOVA 4G8GD 4LBEB 3U9PL 3FN0L 3P0VH 3BI9X 3MUGB 2BSTA 4JVPA 4JPVH 5E5RB 2I60H 3O6LH 2DD8L 5JW3H 4JY4A 4MDIA 3RA7L 4XVUC 1E28B 4ONHB 4OZHE 5D4QA 4XBGA 4IOFC 1RZKL 5HTSA 5DQDH 5CIPH 3CSBA 4TTGA 4MXVF 5B22A 3ESVF 1VHPA 4R2GB 2Q8BH 5J3HD 2ICCA 3MLPA 2R69L 4RAUA 1OSPH 2IGFL 4PRDB 5FGCE 1MCOH 3QCTH 3QCTL 3EOBB 5IJKA 3QUXD 1KLGA 5FYKU 5F6IB 4NO2A 2FD6L 4I0PD 4I5BB 2VUOA 2F58H 1S7QA 3MRNA 4UV4H 5DMIH 4I13B 1YMHA 4U1KA 4IDJH 1D5IH 4G6JH 4Z7WB 4WV1A 3MLVL 4NFDA 4NM8H 4EN3A 1I9JL 1UCBL 4NC1C 3TPUB 1JFQH 4QTHA 4JGMA 1I7RA 1ZVSA 3QNZB 3S37X 2YPKA 3OWEA 4K7PX 1OP5K 4HKJA 5F6HI 3GEWB 1EFXD 4LCIH 4FFWC 3BE1H 4LPCA 4ODWA 5FYJH 2ZSWB 2I9TA 3MXWH 2VN7A 1S5HA 4JFEB 3T3PF 4HHAB 4UU9B 1DN0B 1EFXB 4Z7UB 3FB8A 1NMBH 2R4RL 1B0RA 1ZLVH 1TDQA 1AGBA 4UINL 4QHMB 5IKCB 3G6AB 1U3HD 4N5UA 4BQBA 5DO2D 4LPYA 4A6YB 3NIDF 2C3VB 4CUCA 4NKDA 3BO8B 4FHBD 4G5ZH 1YNKL 2BHZA 4PYGA 2B4CC 2GTZA 2XKNB 2ATKA 1B2WL 4MS8C 5H94A 3VXMA 4HAGA 2DWDA 2H2SD 5CLTA 2QHRH 2H3NA 3GMLA 2YWYA 1PZUB 4NFCA 4OCYL 1ZHLA 4XWGL 4LSQL 5EA0L 4YIQA 3DGGA 5GRWA 4PV9A 2WW8A 5GHWL 4OV5B 2VE6B 1LEGB 4PRBA 4WGWB 1MVUA 2VR4A 2EYRA 2XWJA 1R5VA 3BN9D 3RBSA 4FFZH 3ZKNC 2YA1A 3O3BB 1XF2B 4PTTA 4DKAA 4HAFA 5E08L 3T1WA 5CSGA 4IMKA 2VDOL 3P73B 4WV1C 5JA8B 1Z9MA 3L7EB 4NWUH 3B6SB 3ETBF 1N26A 4KDTC 4OCSL 2LV4A 4EJ1C 3RDTC 2ZJSH 4I3SL 3DJ9A 3DWTA 2I07B 4MQTB 2H8PB 4WI9A 4MB5A 3C60C 4KZEH 1SJHB 2FNBA 3ALPA 3BZ4A 3FT2B 4TQEL 3S4SB 1YPZA 1BPVA 1IE5A 4ZAKC 4F7EB 1NCBL 5IGXL 1U8JB 2IPKA 1BGXH 3V5DA 2X9XA 5ERWA 1ZOXA 2XYCA 2PF6A 5DJAB 3BUYB 5IEHA 3VFWB 1JL8A 2YBRA 3IJSA 2V17H 5EOCH 5I1CH 1GGBL 4OTXL 1RJZA 3ARED 3B3IA 5FO9B 1FG9C 5IG7B 4G42B 2YEZB 4OUOA 2HG5A 4X6EB 5KSAD 4LGSB 4UTBH 1JZ4A 4XP1L 4XPFL 5DMKA 4G6FD 2ED8A 4RGMB 3WD5L 1I8LC 43CAA 1BHGA 2QJDA 3HB3D 1OOAA 5I74C 1A9EA 4TUKL 4I0PB 3QIWB 3A6OA 2J12B 3KHQA 3GBNL 1A1MB 4KXZI 3MV8B 4WTZA 3MRQA 4NNPL 5DT1H 3VH8G 4R8WL 1I7TB 1T2XA 5CJOL 2HN7A 3LKNB 4LHUB 4PRAB 4XCCL 4LU5L 1XGPB 4D2NA 4TUOB 5FHBH 5LBSL 5EB9A 3X14B 3TJEH 3IU4L 2NLJA 1A9BB 1QFWM 1I8KA 4MQXD 2BSSB 2CGRH 3RWJA 4KKBC 4JHZA 1F4XH 2J8UA 3GSNL 3IFLL 3RZCB 4HUKB 3T0EA 3WEXB 1NFDB 3PWJB 4YEFA 1BEYL 1QFWI 1F3JA 2DM2A 4LAQH 2VYRE 3MLXH 1T7YA 2AABL 3EO0B 2F8OA 3I84A 3Q2CA 5I1AA 5DJDA 4GAJH 3T08A 4GAJL 2WP3O 3HFML 4UT6L 5TE4L 3AS0A 5B8CC 3B5GA 1VDGA 1D3CA 4APQC 1JGEA 5I1LA 3BUTA 2FR4B 5C6TH 4YE4H 5T5NF 5T1DL 5IVZA 4AH2B 5IIEA 4IOIA 1DSFH 4EQ2A 4ZOBA 2AV1A 3BZEA 4NYLB 4LSTL 3BDXA 5TQ0L 5F71A 2DQIL 2NZ9D 2VDNH 1EX0A 1BJ1J 3QUXA 4ZO8A 3HTLX 1KPUB 5IB4A 3GMLB 4QF1B 1K3IA 4DUVA 3K8KA 4ORGA 3V0WL 4XMPH 3KPSB 4HGKC 4U1MB 3FAXA 1M71B 1A6TA 2BNRD 1FNLA 4MXWL 1J8HA 3NPSB 3A67L 4ZG1A 4I1NB 5I73C 3ZDXF 2YPLA 4Y5YB 4GRLD 2VXTL 5DEGB 3LVEA 2R2EB 4OF6A 2BHUA 4UBDC 3HA0A 2CKBB 5F7WC 5HBBA 1MFNA 1P4IL 3GRWH 4AMKL 3ALXA 1T1ZB 1Q9WB 3P77B 4JKWA 3UBXG 2ZOKB 5DHVB 2GJ6E 1CTNA 4KJQD 1ROWA 3DROB 1EJOH 3QDJE 3DBXA 1T6VN 1SM3H 4NQDD 2QSTA 4PJBF 3FQUB 2O61B 5E2UL 4KKNA 4OCWL 1T0MA 4JDTL 3DX8B 1RUPL 3PQYA 4CADA 4M7JH 4BH7A 4KKAD 4XNYL 3P30L 3V4UL 5D1XD 1JJUA 2YEZA 3DNKA 3MMEA 4IMLB 3RY5A 4QRRA 3CFKB 3SDAB 2ZWLT 1NFIB 4XBEL 4ZSOA 1IC5L 4L29B 5DEZA 2ZCHH 2D0FA 1QSVA 3ARFA 4CNIB 4UTBL 2R39A 5E6IC 3HUJB 4RBPH 3SDXE 3MA7B 4QHKJ 2CUMA 4MD5A 3C5JA 3FOMA 3EZ8A 4TNWF 3T0EE 3UTSE 4Y19D 2C1OB 1H8SA 4JM2D 2AEQH 2PKDA 3ARUA 3EIFA 3GNMH 4DKEH 3GI9H 2YD1A 3EHBC 1FVEB 4KTEH 5C0CE 5HGAB 3WMSA 4LK4A 4FZEL 1FN4A 4NZUH 4OKVA 3OZ9H 3EYQC 7FABL 3RZCA 2Z92B 4DCQB 4QRUA 5DD3L 5J12B 4OZIF 1PZ5B 4TOYH 1MRFH 2CQVA 1LE9A 4G9FD 1EO8H 5JO5B 1UJ3B 3LKSA 3BH9B 5TE4H 4ELME 3ULVH 2RBLA 2FJFB 4OI8A 2XQBH 2R1WA 2P1YA 3DMMB 1NLBH 3G6DH 1YPZE 5FA3B 4R97B 4M93B 4JDZA 3OAZH 1VFBB 1S9XB 2NX5E 5IB5B 1NSNH 3ZE1E 1IEAA 5F7HA 3SKNA 5HDOA 3JWDL 2EDWA 3ZHLA 1HN1A 2PXYB 5E00B 1HQRB 3JTTA 3ZO0A 1AD9B 1MCEA 2A77L 4GKSB 4HC1L 4EEEA 4WI5A 3LMJH 5D1QD 4YUEH 1KEGL 3QHZL 3UTSA 4TNVK 3WJLA 1A14L 3FO9A 1U3HA 5FYLD 1FC1A 1HSBB 5HHMD 4F2MB 2P7TB 1FFOB 5TF0A 1UZ6F 1BVLA 4MB3A 4FQQA 1DE4B 2YC1B 5I1KL 3B9KB 4HDIB 4JO2L 5C3LD 1NCTA 3KYOB 4OBSA 4I8DA 4OGAC 4LLAA 4S2SB 1FQ9C 3O9WD 4Z76B 5BO1L 5CBEB 2F9BT 1S9VB 4G9FE 5TDOB 5D5MA 3C09B 4QHUB 1FP5A 4O58H 4EN3D 3EJZC 4N90D 3U0PB 1OTTD 1CXHA 1FNEA 1T1XA 3PNWA 1VPOL 2CLZB 5F7LB 4NQSB 3IXTA 1NMAL 5A2KH 1PQZA 3DBXB 4G8FA 5KSUA 2ZUSA 5DA4A 1N7ML 5TH2B 1JCKA 1NFDE 4ZPTA 1MPAH 1NC2B 4JQXC 1UWXK 5EUKB 5I66A 1NCWH 2IH3A 2YUZA 3RGVB 4HC1A 1UXSB 3BE1L 3HE7B 2A6DA 5D7IB 4IDLA 5BRZB 4YHML 1IAMA 4DGYH 5IB1B 1JV5B 4XC3L 4N5EC 1D5BA 2CUHA 4GBXD 1OP3K 4X5XB 1TNMA 5D7KD 4ZS7H 4ETQB 4N8VG 4PJ8D 5CWSB 1U8LA 4OJFL 4YNYA 1BEYH 1XCTA 1P7HL 2BSRB 1ZVYA 5J57B 2B2XH 1MCPL 2CDFA 4HX1A 5K9OA 3QXVA 3QNYB 4ZUTA 4CVZB 5CJXA 3QEGL 1R5WB 3BWUC 3PF2A 2AXHA 3R1GL 2HTLD 5GS0C 2EDOA 3VXQB 3QJHB 3GMPB 2VTFA 3KPPA 2H41A 3C8DA 2FWOA 4M7LT 4PJDA 3MGOA 5GS0L 4WHDA 3RX5A 4I4WA 1FORH 5TE6H 3T09A 1XZ0A 2K3TA 2C7UB 3TM6A 2YUXA 4OB5L 1FN4B 4D9QE 1AGFB 4PS4H 4QTIH 5CSZB 4XP5H 2YA2A 1FZJB 2VLKD 3BPNB 4UV7L 5GGUA 3NACL 4OV5A 4L5FL 4EUPB 4E0RB 1IVLA 1S7TA 5FYKL 1LD9A 3F58L 1YMMD 1A6WH 2WLYA 5EIVA 2GJ6B 1ZSDB 4L4VA 4OT1L 3HR6A 5IVZB 1RJLA 2H6PA 1OAYL 4M6MH 4ODHL 3QDHA 5FV2A 1EUTA 5KSBA 5L7XH 3V0AC 1S7UB 4N0UA 1YDPB 4ORGB 1JNNH 4PP8C 3PP3K 3FTGB 4KV5F 1UJTA 2V9TA 1FL6A 4LNRA 3GZKA 5IMLB 2GUOB 2PXYA 3P9LB 3RWEB 3FQNA 1NMCC 2W91A 5EFIB 3KYMA 4MAYD 3RWGA 1D6EA 4Y7MA 3GMOA 4QRRE 4G9FA 3HC0B 4PJ9A 3O11B 1OF2A 5IMMA 3V7AG 3DX6A 1RUMH 4Q9CA 4F58L 4R2GD 3ABZA 3I02B 1OVZA 2ZKHL 3SDCB 3MBEC 4XCNA 3CLFH 2DKMA 3DHMA 2A0LD 5HVWA 4P5KA 2YUVA 1RULL 4RFOH 4BM7A 4X4XA 5ECJE 4Q9BA 5EN2A 5I15H 2P8PB 3LD8B 2NY3C 1EFQA 3AY4A 1WBYA 4N9GB 2GKIA 3BQUC 3CFDB 5K93A 5ACLA 4F3FA 2ZNWA 4WU5A 1PKQA 2PN5A 5D8JH 1KIPA 1T2QH 3DUHA 4Z7OE 4H0HB 2YD5A 5C7XL 5C09B 2HP4A 3ARGA 4X9IA 1QRKA 1HQ4B 4WCYH 4WO4A 5KSBE 2D9CA 4PP2A 4P59H 4XWGH 3VJ6B 1C5DB 3RNQA 5HYJD 3QWRD 4EI6A 4RIRB 1CD9B 1B0GB 4P46B 1WBZA 4IJ3C 3VW3L 3L3JB 4GAYA 5ADPL 3W39B 3GRWL 3K74B 1U2HA 5D7LB 3LAFA 3QIBB 1PBYA 4B5EA 1JWMA 3T8XB 4OZ4A 1PG7H 3QNXB 4WUUB 4U05A 4U1JA 4Y4HB 1TJHH 1GC1C 1TJHL 2VDQL 2E7LA 4LLYA 5GISL 3ARFC 3MJ6A 2E3VA 4PJAB 4CGTA 3NFPB 4WWKA 5IR1A 5IQ7H 3O2DA 1BZ7B 3DRTB 1KTKE 1LHZA 4FNLH 5DFWH 1LK3L 3LHPL 3FN9A 4HK0B 1P7KA 1UZ6E 4DFIA 3MLYL 1YEJL 2AI0H 4V2BA 4ZAKA 4I18A 1KJ3H 1DQMH 2Y1VA 2Z93A 4F9PC 5LGJB 4QCIB 4I4WB 3REVA 1JHLL 4HHAA 4UU9A 1MUJB 5LXGL 5LXGH 3T0EC 4PJ5D 4JRYA 5A3IC 2NY0D 3D18A 1KG0B 2B5IC 4L8BA 3VCLA 3OXRB 1IGML 2RCSH 1FSKB 3K81A 3LQMA 2FJFA 4IRSA 3HG1E 4MX7A 4OZGB 3LH2L 2OXHA 2OTUB 4MWFA 3KR3L 1KEML 4Q9RH 1I1FB 5IESH 4R7NB 4Q74A 3LS5H 4ZNCD 2F53D 1OB1A 2KQNA 5FDWB 1E4KA 1QUNA 2R8SL 4HUXA 4HIIB 3D3VA 1JYWA 1URLA 2DM7A 1A02N 3V6BR 1CLOH 1W72B 1CL7I 2IG2H 3X3FL 3LPFA 5C7XH 1QACA 3AXLA 3HMXL 1NCNA 1JRHI 4P3CL 2HFGH 2Q86A 4OCSH 3ZE0E 3U46B 5ESQB 3WHE0 5EO1A 1KCUL 3AMLA 4WW1A 3TJEL 3LN9A 1ZT4B 4RRPG 4KPHL 4MJ6B 5FM5M 4AG4L 1QBAA 3IVKA 2EXYC 2XZCH 1OF2B 3QDMA 5CIPA 3QQ4A 5DZOA 2E27H 5FCUH 4WEMB 1TPXB 1N7MH 1JIBA 2PTVA 4J8RA 4ZOCA 1AGEB 2V17L 3KPOB 1ZVHA 3PV7A 1H0DB 4YDIL 4U3XA 1NC4D 1WZ1H 4IMLA 4P49A 5FYJL 3MV7D 4KMLB 3S4SA 1EDQA 3RUGB 3E2HC 5TDNA 1WBYB 4P2CG 3P4NB 4RDQF 2VL5A 3KLHD 4XP1H 4WFFE 2EXWC 2I5YH 4QYOA 4X4YA 1W72L 2GHWB 3OG4B 4G8FB 4LDEB 2JCCF 5SWZD 4D0BA 1Z0MA 2HJFA 3FRUB 3CSYA 1M6OB 4WDIA 1UVQB 4PJXB 3WFCL 3UTTD 5GXBB 3DX7A 1P69B 4KUZL 2CMRL 3BGMB 4GSDH 3VW3H 5D8JL 4KXZH 3VGGA 1Z3GL 3AREA 4LVNC 1TZIA 4KMTH 3P3YA 1C5DA 4G7VH 5FYKH 1FVEA 5E56A 1W0YT 2VDKH 5B39A 3DV4A 1CGSH 1NANI 1U8KA 3GI8L 3S5LG 4PIRF 5ENWA 2ZPKL 4QRPD 3CCHB 5FOJA 4I3SH 5GHWH 4Y2DB 2WWMC 4Q2ZB 5F7EH 4JFDB 4UV4L 3LKPA 5JIKA 4IOFD 1I1YB 1LEKB 4ZFOA 2HLFC 3OX8B 2ZCLH 3V95A 2I9TB 2YD8A 4YBLC 3VXME 2VLJD 1EV2E 2MPAH 3QJHA 4JKPH 3C8HA 3IFNH 1XGRA 2BNQA 1DDHA 5F1NA 1OW0A 5CJ8A 5AAWA 5I1HH 2E7BA 4NWTL 5FGCB 4GUPB 1P7KB 1MQ8A 4NN5C 2ZUTA 2G75A 5ANME 2ITCB 4UAOB 3QWOA 5CJQL 4Z7UE 3QIBD 2IPUK 1AGFA 1QR1A 4UOW1 4W70A 4OIBA 3RNKB 2ZUUA 4FQXC 1NMBL 2R4RH 4WI4A 1K4DA 4PJDF 3EFDH 5C0FA 1H3WM 1C5BH 4RNRB 2ATKB 4D9LL 5IVOA 1OSZA 1YQ2A 3ES6B 3VE0A 4U3CA 1AD9A 5JOFB 3V8CA 4J4PA 1H15B 1IEBA 3G5YB 2ESVE 3FT3B 1PY9A 3WYRA 3L6FB 1UM4L 4DJMA 4Z0BL 1IMHC 2Y6SC 1G9MH 2HT4C 1HSBA 3MRPA 5AYUL 3B4NA 5C07A 4HUXB 4TVPD 1ZXQA 4HKZA 3CFIC 2NYYC 1LEGA 1CG9A 1UWGL 4K3DH 2VISA 3KYOA 4QWWC 4GJTB 3RKPA 2MCG1 1NGWB 2VWEC 3HE6D 3U46A 5E5MA 2OI9B 5D6CA 4I2XE 4OZFB 5E1HB 1MFAL 1MFAH 3RAJL 1FNSH 3UO1L 1ZHNA 5TDPB 2R2CA 4JQVA 3TZVC 3W5MA 3JWOH 4F37F 4JR9H 4XWOC 1TVBA 4OF7A 2PO6B 4J7RA 4PJ7B 1KSRA 3LS4H 2DBLH 4HCRA 3K3QA 2BNRA 2HKHL 4FQXD 3H3PL 4OQ1A 4YZFE 4F3FB 3D85D 1AQDB 5BS0B 3LZFH 5DRWB 2H1PL 1VA9A 2UZYB 3VH8B 2EYTA 5EH1A 5ISZB 4U1HB 3EO1B 2XQBL 3PE9A 5DD5H 3RFZC 2BJML 3BX7C 4AM0A 1JHKL 3C2AL 2JIXA 3GBLA 2E6PA 3R06A 4M00A 1RJZB 2WBJC 5KVGL 3SGJA 1UZ8A 4NZTH 3SBWC 4HWEH 2JCCE 5DHYA 2HH0L 2CDEB 2OM5A 3K0WA 3RVTD 4J12A 4HLZG 3PUCA 3MXWL 3MZGB 6CGTA 4GS7B 5SWZB 5BW7A 3LEVL 4LPTA 4YE4L 4NO5B 4R96B 3TLRA 4X5LA 3JTSB 4YDJB 12E8H 3IAGC 1L7TH 2VAAB 5DA0B 1CICC 1B6DA 2BZDA 3T8XA 1JI1A 2J7LA 4I2XA 5HYEA 2AXFA 1X7QB 1XCQB 3K4DA 1I3RA 1DN0A 3O6KH 3D9AH 3BD3A 1BFTA 5F89B 4L3EE 3QI9A 5E1AA 1AC6A 1J11A 1MEXL 3S35H 3T4YB 1JGVL 3CLEH 4HZLA 4WUKH 5F9OL 2CRIA 2DQUL 5DMGD 2JK5B 5I1HL 3GI8H 1KXTB 2NY4D 3OGCB 5DD6B 5KSVB 5BS0E 4PGDA 5CJXC 2BK8A 5H37H 4GBXB 3BPLB 3ILQC 3IDNA 1V8HA 5DTFB 5CEYB 3RHWK 2BX5A 5CGMA 5LGHL 3SOBL 3SO5A 2FL5B 2QSCH 4JM4H 1JGLH 4K2UH 3VWJD 2NY4B 3MR9A 2APFA 2VZ3A 1I1AB 1DLHB 1YEGH 4LNVA 1OTTC 3ZL4H 2D7OA 4G8GA 4LSRL 3HE7D 4JFZL 4NUJB 4OZGF 2A6IA 1LVEA 1KF9B 2DQEH 2F74B 3V6ZB 3TBWB 2OTUA 1F8TL 1WWCA 1RVFH 2H32B 4N8VB 5D70L 4XAKD 2EYRB 2XWJB 3BH9A 3K1DA 2AEIT 2AK4A 4EOWL 3G5XA 4HS8H 1OAQL 1QA9B 3O9WC 3RL2A 3I50H 4PD4J 1P4LB 1TJIL 3VE0B 2MHAB 3SDXA 3HKFA 3OJVC 4FNLL 3BEVA 1XF1A 4GW5A 3EFDL 1P9MA 4APQA 3X13A 3G04A 1UWGH 2B4CH 3UJTH 4ISVB 3ARBA 1XFPA 4KFZC 3SKUD 2YPLD 1QEWA 3KLAA 3JTTB 2O5YL 5EZLA 4PY7A 2C3HA 1R3KB 4F7CA 3MV01 4OIIH 1S8DA 3VFPA 2X4SB 1S5IH 4C59B 2ZUQB 4KY1H 4LSPL 1MREL 1AR1C 1G7LB 4XMLL 2VSDA 5CEZH 3HPJB 2D7MA 3U30B 2VLJA 3DSFH 4P59L 1BOGA 2R2HA 3CK0L 2NXZC 5EOTB 5KJRH 1FFRA 4RGNB 4BJLA 1BQHG 3E6HA 3BWAA 1C7SA 5FF6B 3P0GB 1ZLWH 1YN7B 1BFOA 2VMFA 2MOVA 1U36A 2J8UE 3G5ZA 4G9DA 3KG5A 1IGJA 4H88H 4Z7QF 4KRPD 5TDOA 5T3ZL 4U6YB 2Y4SA 1NGZB 3KDMB 4V1DE 3KJ6L 2I25N 1WV7T 4PJXA 5SWSB 4H8WH 1NKRA 1AXTH 5GGRB 4NQSA 5TPWH 5I19H 5I9QC 1KTDB 5TPWL 3MRDA 5L2JA 1JYVA 3S6CA 3HRPA 5L8KB 5E2VL 5I66B 4HZAA 1BAFL 3NPZB 2IPTH 3DYOA 4L3EA 3GMNA 1PKOA 3PQYD 3DXAA 2CK0H 2OQJA 4PJIA 4KAQH 1U8HA 3QDGE 1A2YA 1NBQA 5GJSH 1T66C 5C0BA 2DYPA 1JV5A 3H2WA 3NOIA 3FB5B 3QUKB 1AJ7L 3LOWA 1MAJA 1INDH 4OZIE 4JRXA 3C60A 2X89A 5CGTA 1X9QA 1KCSL 1RUKH 2GK0B 4G8EB 1DSFL 3K8MA 1DQQB 1X7QA 1Z9SA 5EO9B 3VWKD 4HS6A 3VI3E 5I8OL 3HG1B 3KGRA 3DGCR 2EDQA 3FONB 3LIZL 4OZGA 2IQAA 3LIZH 4X99A 1CU4L 1T89C 3F6IA 4PJ5A 5EBWA 4YIQB 5EU6D 4JANA 2P5WD 1O5DT 2WBWB 4S0UC 3V0VA 3VFNA 4GW4A 1TTUA 4Y8DC 3WO4C 1NBVL 3SDXF 1UM6L 5DJCB 3MBED 5EUOF 4XGZA 1G9MC 3ECBB 4G6AC 3PQYE 1XH3B 4K71B 2IPUG 2H32A 3CH1A 4ENEC 3QDGD 5K9JL 1DL7H 1GZPA 1IGIH 3QUZC 3S36H 5ICZB 4LEOA 5KANG 4WEUD 1NCDL 1NGYB 3RY4A 2DWDB 5AZ2H 4HKZB 4TSAL 5D2LF 2D4FA 3TJHA 2DBJA 4JPKL 5CIPB 2Y9RT 4NQDB 1F3DJ 4AIOA 3V5KA 3DO7A 4EI5C 4IRJB 4K3GA 4GKSA 2FX7L 4L3AA 4LASL 4R0LA 5D6CB 2HFEB 1KNOA 1HCFX 3P9MA 1NMCB 5E2UH 1NGWA 4JO4L 1I9EA 1CR9H 4ELKA 3F7RA 1LP9A 1MREH 1ZAGA 4PRPB 4YAQB 4YJZL 4U1IB 3QCVL 1EHNA 3CVIL 1OTSC 4PJ9B 4X0KB 1A5FL 5ISZD 3ELAT 1HZHH 3S98A 3D48R 4Z76A 5EPMA 1KELH 4NQEA 1ES0A 3UTZA 2D0GA 4HK3J 2FEEI 4PJXE 4U2ZA 4ZO7A 3ULUL 1BOGB 2R2HB 4FXKA 4YHYC 1T2QL 4U2YA 2BSTB 1FG2B 2PYEA 5H2BA 2IQ9L 4WI7A 1HHGB 4NQXB 5HHVH 3TBVA 2DS4A 3KPTA 1FNEB 1T1XB 4UOJA 2FJGB 2XKUA 1OPGH 5HHXL 2XN9D 4KROC 12E8L 1U8OB 2AJSH 3IGAB 1RY7B 4HV8B 4HG4J 2VN4A 3PP4L 2X41A 2DQFB 5HHQB 2BNQD 1R3HA 3GJFB 4M9PA 1O7VA 3ZDZF 1E4KC 2R2BA 3WIFA 3S37L 4LCUB 3CXHJ 4LSVL 3U4EA 5AZEL 5T3ZH 1OL0A 5F88A 5IHZB 3C8KA 4V3DB 4R26H 5IB3A 4OT1H 3QFJA 5MEND 1JYNA 4QRPB 5EU4B 5HPMA 3NAAL 1KJ2B 4PJDE 1KN4L 3MV9A 2ZZUT 4EOWH 3D1MC 1IFHH 4KJYA 2IALB 3QHFH 3RVVD 3R1GH 3E8UH 4L1HA 1KIQB 3N1GC 3CPLA 1K4CB 1LGVA 2EDHA 3PL6C 1T66D 4GFTB 3OGOE 3QJFB 1F4WH 1M7DB 2JTDA 5CZXC 1N3NB 5DYOB 4Z7WF 4CN4A 4DGVL 5DUPH 5I1LB 4Y16D 1S78C 4S1RL 3KPNA 2HMID 3BP5A 4HJ0C 1JUFB 1UYWL 3EUUA 4HFUL 3DTXA 1ZLWK 3T65B 1RPQA 4P2OB 1H15A 1IEBB 2VXSL 3L1OH 4C56A 3ZTNL 5CILH 5K9KA 1G7MA 3VXTA 3QUXB 5E03A 1EEYB 1MEXH 3RI5F 5DJ6B 1AQKH 3WLBB 4OAWA 5F44A 2B8OT 3OKKB 2F74A 1TETL 4WU7B 5EU5B 5AWNH 5IB5A 4DOHE 3T0EB 2QQNL 2MFNA 1H3PH 5F3HA 3REVB 3DECA 2GTZB 2DQCH 3SCMA 1U91A 5SWZE 3NGBB 4B0MM 4ZAKD 4KRLB 4U7SA 3MQIA 1ZSDA 3DVNB 4ZUSA 1Q0YH 2YPLB 3P11H 4LP4A 3QH3B 3CUPA 5FOBA 1B88A 4XXCA 2F54E 3CXHK 4KK5D 4XCCH 3VA6A 2VLRB 1FBIH 3ZYIA 5L8LB 3V5HB 1LO5A 2B1HL 5IIEB 2OJZL 1PG7L 2FJHA 4ODVL 1TTFA 1UXWA 1NGYA 1T1ZA 4DVRH 1XF2A 2UY7A 2IEPA 4BZYA 5EU6A 1FLRL 5D72L 2XV6B 4G9FB 3RVWC 3ARYA 3OKNA 2NY1B 4QRPE 1HK6A 2DQTL 4PG2A 1U8NB 3O45B 1AD0A 1RMFH 2Q86B 4QF1A 1Y0LB 2ENYA 1RK0A 1XF4B 1SQ2N 3UMTA 1OAXL 3I02A 1I8MA 1AR2A 2GCYB 2L0DA 4WFGD 5FYLL 3ET9F 1KCRL 1NFKA 1RFDH 1MJ7L 1KJ2L 4F9PA 4CVUA 5HJ3A 4JRYE 5MEOB 3O81A 4LSDA 4JM2B 3INUL 4HUVA 1CE1H 3NTCL 1BVKA 4GKZB 3E6HB 3BKYH 1GC1L 4Z8FL 1U8PA 4HWZB 1LMKA 3LEXB 4HJGA 1IBGL 3U79A 3KDMA 1JYXA 5DI8B 3E2HB 1HILA 5D2LE 3QFJE 2FLRT 2VXQH 4KUCD 4X4MA 5E94A 2NW3A 4NN6B 1HHHB 3SDYL 4M62H 4BZ1H 1JF1A 3VXSE 2FJGA 4FQ1L 1D5IL 2CR3A 4NJ9H 4QY8A 4W6XB 4YH6A 1MCJA 1P53A 4M02A 1JRHL 2QR0B 2I24N 3IFPB 4XVJH 4PJ7F 5F9JA 5GGTA 5BRZD 5T3ZD 1AQKL 4RZCA 5DGQA 3L3JA 1J1OH 4GAYB 3P2TA 3UDWA 3SDDB 3DLQR 3MV8A 5HGGS 4QRPA 1Q1JH 4Y8AA 8FABB 2B1AL 3ULVL 2HN7B 2WUCH 3NA4A 3WSQL 4JRXB 2F54B 2X4QB 4KHXL 2O5XH 2D9QB 1MHCA 1UB6A 4UT9H 1L8JA 4PLKC 3VFMB 1T20B 3N9GL 1RURH 2Z31C 3PWUA 4KJYB 3HG1A 4ZUUA 2E7CA 1OAYH 4HMCA 2OJZH 5EO9A 1KPVB 2P43B 2PW1B 1G7HA 3FAWA 1YC7A 3OPZL 5D6DA 1YNKH 5J3HC 5EU3B 3ZKMC 1CBVH 2WY3A 1CBVL 4CU7A 3MLRL 1J5OL 1NGQH 3PIQB 2DQTH 1DDHB 1KLFA 3T2PA 3KPQB 3DTXB 4PG9A 1NUNB 2ZG3A 4JRYB 3MUJA 5D96B 3K2UH 2DQIH 1KJ2H 3VXSA 1ZA3B 5ABDE 3O6FC 3NZ8B 4NQEE 5DJXB 3RNKA 3VRLF 4YHPA 2MQ3A 4NQUA 2GI7A 2NW2A 1QNZL 5HDQL 3P11L 4Z0XA 1MVUB 1T0NB 4X8XA 2X89D 3B2VL 5EZLB 1OSPL 4GG6A 1S9KC 1KCVH 5FGBC 5JOFA 43C9A 1VKXB 2DAVA 5D7LD 3KAAA 5F8QC 3D69A 5HYQA 3ARQA 4YPJA 3IKCB 2MWCA 4IRJA 1AXSB 1EHLL 4QGYA 1QVOA 4V3EB 1YEFL 1J0HA 4OZHF 4YAQA 4NNPH 5DT1L 4HPYL 4O5LL 5EWIH 5JIIA 4ELKB 3ORJA 4KK6C 4K94H 3RRQA 4DZ8A 4GRLA 3MYJA 3HE6C 4G7VL 5FYLH 3AAZA 3ARTA 1JF5A 1KB5L 2DN7A 1AGDB 3IETA 2FEDC 1HKLH 2Y5EA 2BP3A 5T33L 4QKXB 2DQDH 4GO6B 1IARB 2C3XA 4N9OB 5EPMB 4IOSD 3C08L 3TN0A 5A1AA 5IQ7L 2PO6C 1RZJL 4JZJA 3MRBA 4Y5XC 1AGEA 1W72H 1NCDH 5HVHC 1KTDA 2APXA 5IBLD 3QEHB 2BC4A 1YEEH 3KNBB 1HZHL 1CK0H 1EHAA 2AI0L 2HYMA 5HDBF 2RJMA 2BVPA 1EJ6A 2UYLA 2VC2L 2BVOB 4WFEE 4MNGB 1V3JA 5EIQA 1N59A 1ZS8B 1CFTA 1M7XA 5J1AB 1P1ZA 2E7MA 1EXUA 4MQXC 3GIVB 5IM7B 5FB8A 4QXGH 1J87A 5FO7A 1LO2H 2EDRA 4MAYB 4G6KL 4JFDE 3VWKC 2YD7A 1I75A 2HJKA 1D5MB 1JTPA 3QNZA 1ZWIA 4ODTH 3WHXB 1WFOA 4HJJH 5DHYB 4M7ZB 3DURA 3UPRB 1P2CA 4OLUL 5HHPB 4Y2DD 4LLVA 1DQML 1EO5A 5IK3B 4YBHA 4HFUH 4YFEA 5SWZA 4JFPA 3ZT5A 5TGBA 3ULUE 3H9SE 3MRFA 5BV7B 5EC1A 2C4FT 2ZCLL 5LCVL 5INDB 3C5JB 3FOMB 2APVA 5B38G 4KTDH 1KLGB 3CCHA 1M7DA 4I77H 4FXGA 4JR9L 2DQEL 1UWEH 1NSNL 3MO1A 3WFHB 2XKSA 4K7PL 1YY9C 1TQBB 2OJEB 1JPFA 4QRQB 4NO3A 4U49A 1TITA 5LQBL 1NC4B 1EBPA 1P5VA 2AJXH 4D9RD 1JE6A 3QDME 1EEYA 3M1BA 4MYWB 5DJDB 4XGZB 2CJUL 4Y1AA 3QXUA 3LV3B 1I1AD 1NDMA 4BH8A 1AH1A 4RNRA 4PRIB 4LSUH 2VDNL 3X11A 3SPVB 4PR5B 4V1DD 2JELL 3NIGE 4M61A 1AXIB 3ULVC 3HC0A 2AJYL 3KPSD 1RZJH 1JK8B 2BY3A 3FOLB 1I7UB 3L3GA 5CP3H 3BZDA 1B3JA 2PTUA 4MJ5B 4UUJB 5EO1B 2KH2B 2JE8A 4Y4KB 3MYZA 4K8RD 1DQDH 4QGTA 1JMZA 1WAAE 5DSCB 5IW6A 4XXCC 3UTTE 1CF8H 3TH2T 3V4VL 4QRTA 1HWGB 3G08A 3WS3A 1JRHH 4E9LA 5CCKL 3TNNA 3I6LD 5ILTL 4Z78A 1HIML 4UILL 4UNVA 1IQWL 4FQLL 4NFBA 3IJSB 2FD6H 3JXAA 4L4TB 3AAZB 3GMQB 1KPRA 3H7BB 2NY0B 4N0YH 1LP9F 4DFHA 6FABL 3MFGB 3T77B 3MRIA 1HHKA 1W8NA 5GRVL 1DEDA 2W60A 2EICA 1JPGB 4LHJB 4F7PA 2W59A 3D39E 3JWOC 4NGHH 2AK1L 5CSBA 4LQ1A 4LAJH 2HJFB 4P0DA 1GCFA 1T6WA 1YQVL 3MC0A 1GH7A 2EECA 1FJ1B 5EOTA 5C2BH 2AKRB 3CFEA 3W0WB 3SHSA 3T0AA 5MEPB 4CW1B 2NW3B 5E94B 5AEAA 5EU4A 4K55A 3RTQD 3QXAA 3CFDA 3BGAA 1R5IA 2ICES 2Q7NA 3MOAH 5EUKA 1XGQB 3GB7B 2ICWB 4RCAA 2GY7B 1XF3B 4EDWH 4GH7B 4WUUE 4F37K 3B3IB 1SMOA 4PV8A 2HTKD 3QWQB 4TYUA 1TFHA 1A7PH 4RGMC 4ZO9A 4XX1E 1A7QL 4JN1H 4POZC 1RZIA 4MD4A 3QRFM 1S7VB 3V0WH 3U6RB 3DVGB 4I0PC 3TCLA 1YY9D 5DMJB 1JGVH 1I3RB 3CLEL 5F9OH 1BQHA 3EDFA 1MRDL 2JB5H 1NGPL 2Q1EA 3HI5H 5EA0H 4H20H 4BSJA 4Y1AE 3EYOB 3I6KA 4MJ2A 1JN6B 2EH8H 3MCKB 1XR9B 1FGVL 5D1XB 5I1KH 2P5EA 3MODH 2BOCB 4DKFH 1S5IL 4TNWK 4PBWD 4AH2A 4RQQB 3JUYA 1F11A 1OWRM 4Q6IA 2WQ8A 1G7QB 1OTUC 1GL4B 2FL5A 5GS1B 5E2WL 4GXVH 3RUGF 5DD1L 3NCEB 1U0QA 2EEBA 3AGVA 5FKPA 3PV6A 1GAFH 3QZWB 1I4FA 2RR3A 3L95B 4H8WL 5DUML 4HBCL 1I7ZB 2QSQA 3G6JA 4NQDE 4M8VA 1A8JH 2ZKHH 3O4LA 4Y19B 1G6VK 3BEWB 5FM8A 2F19L 4XPTH 3SE4A 3SPVA 1RJLB 2H6PB 5H35B 3VXMB 4XTRC 3GGWB 5DVMA 4P4KC 4NBYB 2DD8H 2VB5A 3EO0A 4LIQH 4Y5VB 5DMYA 1RFDL 5J6HA 2DLFH 4LAQL 2VAJA 4MWFB 1KN4H 1OTUD 1YC8A 4MCZA 2OTPA 4GRWH 1H3TA 4M5ZH 5C8JB 5DZLA 3NTCH 3IJYA 1BVLB 2X4RA 4PJBB 2AV1B 1MHPH 4WWKC 4RMSA 5IVXF 4ZS7L 3MJ9A 3GMOB 5B3JF 5CMAA 3M17A 5T1MB 3O6LL 5GZOD 3V6FA 5H8DA 1MCNA 5KVGH 2AJVL 4RA3A 4ZPVB 3IDGB 1U8PB 2A83B 3QT2A 2J1KA 3BP4B 2KUTA 3OKEA 5EBMB 2WIMA 5I2IB 4XCEA 2Y6SD 3QXDA 3RY6A 4QHUA 4Z78B 5ADOH 1ETZA 4GMTH 3T0XA 1J05A 1DFBH 1GRWA 4JZJB 3C5ZC 3ZE2F 5C86A 3PWPA 1VFAA 2Y36H 3GJEA 1FZOA 2BVOA 2UY6A 1KB5A 2XN9A 4PRHD 4HKXB 4M43L 1F4HA 2XXCB 1KIPB 3BHBA 3EDDA 5C0BE 1YJDC 1WC7B 2B0SH 4PJGF 3FB6B 4P2RB 3EYSL 3HS0A 4O00A 4L5FH 4KI5E 5FK9A 3G6DL 3SDDA 1JFQL 2BFVL 3NN8B 5GRJL 5BZWB 4ZFFB 3OKOA 4CMMA 2NY6B 3MRDB 4MXQD 1X3DA 5F1KC 4I5BA 1X5IA 5GRYA 5JQ6H 1CS6A 5A2JH 2NCMA 3DURB 4ERSH 3UPRA 4ONOA 3ZYOA 4DN4L 2OR8A 32C2A 3QXTA 4XNXH 4KRPB 3W39A 3QPQD 2PCPB 3I50L 4XAKE 4JRWA 3UJIH 3ZTNH 4PJCA 4LCWD 1ZV5A 5A2LH 3U0WH 2VDLH 5K9OB 4JEGB 4QRSB 5ESAA 4X98B 3FN0H 3QHZH 5C0RL 1LO3L 5J13C 1RULH 3L3IA 3KR3H 5HI4C 4AQ1B 4PJFE 3J7HA 5DUPL 1FRGL 1RZIB 2BHYA 1KGCD 1ZLSL 1KCLA 5ICYA 1WJ3A 3DV6B 4JQIH 1M4KA 2JCCB 4M3JA 4KZDL 1IAIL 4Y88A 1KJMA 1T4KA 1FO0L 1RUML 5HHNB 5GRUH 4XPHL 4Y16B 1BM3H 3CJJA 1EEZB 4ZQKB 2V2TA 4I9WD 1MNUL 5T3XD 3W82A 2DYPD 1REIA 1BF8A 3QO1B 5KBNC 1MRDH 2G5BB 1Y18B 5J9PA 3GSUA 3RTQC 1WIUA 1N0XH 3KJ4B 43C9B 3DUUA 3B9KD 1CXEA 2VKXA 1WAAF 5C0AA 1BQLL 2X09A 5KZCB 3NFNA 3ULVE 1CIDA 4LCYB 4RX4A 3V4UH 5I75C 4CVWA 1KLUB 4N0UB 2YK1L 5B4MD 3O4LB 2J8HA 2OL3H 3TN0D 5DJZA 5ICZA 1CFVH 1T83C 4ODXA 4XNZC 1NKOA 2UWEA 2VLKA 4PJCE 4Z7OF 5C0JA 2P24B 4NP4L 4QNPF 2VSCA 3VFSB 1YMMA 4XPBL 3QQNA 3F5WB 3VWJB 5M95B 3DO7B 5MHSD 1EAPA 4UT9L 2R29H 3VDCA 3G08B 1P9MC 1ADQL 2UZIL 1EGJH 3IJYB 4PJBA 5ISZA 3QIUD 5F9WC 1T04A 4QXTA 4ZXBA 4I3RH 3QEQA 3S4SG 2CLRB 1TQCB 4NNYA 2IF7A 2CD0A 4B41A 5INCA 3KNBA 1Y6MR 3RVWD 4OD3H 3HFMH 4UT6H 3BP4A 3O2DH 1R6VA 4U1NB 1UKSA 4HC1H 4YXHL 2XACC 3C5SA 4ZO6A 4WGVB 3IDJB 5IFHH 4YHIA 3UAJC 1CWVA 2EC9U 4MVBD 1ETZB 2DMCA 2DM4A 3OKMB 3ULVD 1FG2A 1F3DH 2PYEB 5TQ0H 1MFBH 5ICXB 3ISWA 2LTQC 5CKGA 1QLFB 4GMSH 4AK1A 1DLFL 2D2OA 4LSSL 3KVQA 4X4YB 2HVJB 1CL7L 3FFCD 1QSFE 4O02L 2GITB 4FZ8H 2I26N 2LVCA 5CZVH 3QDGB 2H26A 2OQJB 3CC5A 1HILB 2P5WE 3Q6FB 4PJIB 4PJEF 4QXUH 4R26L 3U2SA 3DYPA 2V7HB 3K4ZA 5DD3H 2VR5A 1AHWC 1WITA 3ARDB 5GISH 5BJTB 5EOQH 2VITB 3VRIB 4HXBL 5BW7C 5CJQH 4OZ4B 1MCLA 2J5LB 2M2DA 1JNNL 4MJIB 1RIHH 3UCRA 3O4LE 2HMIC 3OR7B 2HT3D 4L9LC 2BOBB 2IAMD 3RGVA 5IBTH 4HS6B 3QEQE 2C1PA 1IILE 4NCC1 2V9RA 3ARBD 4FQIH 1NBVH 5F1IA 3T3PE 4IS6A 3F62A 3MROA 1JWSB 5BVPH 3F8UB 4KK6D 3VFMA 5SX5K 5E5UB 1UKQA 3LRHA 3TT1H 3WDHA 3VFNB 5KZCD 1KG0A 2LQRA 1F11B 4G8GE 4NPYA 3AU1B 2ID5A 3BEVB 4FQ2L 1JWUB 2YN5A 3TWCL 3LB6C 3WV0A 1K8DB 1XIWD 2KDGA 4LFHD 4WU7A 5CBAA 4Z5RB 4FQJH 4H1LG 2OXGA 1A6ZB 2ADIB 2GYSA 1QNZH 3QEGH 4MHHG 1IGTA 3HR5A 5JQHC 1YYLH 3WCYA 1A7NL 2CRYA 4OCRL 3KXFB 1SBBA 3FB8B 4P9HH 2JJUA 3CVIH 4HWBL 4HULB 5T1KA 3RVXD 1MFCH 1KLUA 3NZ8A 3JWDC 3KPRB 1EGJA 1VFBA 1QSZA 4BSWB 3PDOA 4OLXL 1JNHA 5FHAL 1MCFA 1LD9B 3O0RH 1NAKH 15C8H 4XC3H 4GSDL 1LP9B 3HZMA 3EOAB 4Q58C 5I18H 4E41D 2EO1A 1PG7X 4QOKD 2F5BL 2AJUH 3S37H 4LKXB 3MRLA 4ODXB 5FFLA 3BT2H 1SVCP 5L2KA 1VFUA 2WQRA 1YJDH 2OCFD 4L3ED 4Z7NF 4L9DA 3F5WA 3OB0H 3H42L 2JLLA 3QXDB 1WIPA 2EDDA 3D0VA 5EFIA 3ZT7A 2D0HA 4OD2B 2IH1B 5GGRA 4JM2A 4HIJA 1NCBH 1ITCA 4LRIC 3MV11 1KB5B 3B6SA 1VSCA 5C08B 2RFXA 5E4EC 4LBEA 2AJVH 1VFAB 2GT9B 2MKWA 4ODSL 4X6DE 3WFDL 1MCWM 1Q0XH 1BOYA 2DTSA 1MJUL 4PLOB 2M8XA 3BHBB 2V5RA 2IBZY 5C0BB 5AAMA 1NCAH 1TJGH 2ICWJ 4QY8B 3RVXC 3Q5TA 3L5XH 3NN8A 1NFIA 5BZWA 3OL2A 3V5DB 5LBSH 3TCLB 1J1OL 4HPOL 4PGBA 4N0CD 4BUGA 3S34H 4YEEA 2DDQH 3PGCB 1EHLH 1NAML 1FO0H 2XZZA 3CPLB 1EEQA 4JAMA 4XHJC 3UP1A 1SJEB 4M7ZC 3EOBA 3LB6D 5CZVL 3LQZB 1WLHA 2VAAA 4P2YA 1T3FA 5FUCC 5BJTA 3JWOL 5IFAL 5IMOB 4MVBA 4B7IA 1U8QB 5C92A 2F54A 3NA9L 5E2WH 2V2WB 3BP5B 1BX2B 3U7YH 3DXAB 1RZGA 2NX5D 3QWRA 3F7VB 4O2EB 4WW2B 4WV1B 3V9FA 3ZMRA 5DJ2B 3TO2A 3ZZ1A 2QTEA 1A1MA 1G7MB 3VXTB 4IRSB 4YXKL 4JVWA 4RGOL 5B39G 4JZNB 5KSVA 2GJ6D 3C9NA 3JTCA 4WY7L 2WUBH 3UC0L 2VUYA 2Z8SA 5T1LB 2WBKA 1QYGH 3FQXA 2VZUA 1G6RH 2VABB 3T2NL 2NXYD 1CFVL 3RWFA 2BY2A 3MFFA 1OT2A 4U7KA 1IGCL 1HEZA 3MLWH 1FNFA 2AV7B 3BZFB 4LCWA 1JF6A 2YD2A 1QSEA 3QG7H 2HLAB 5BZDB 2Q7YB 2X40A 2AK4D 2WNGA 4HSQA 3IDXH 3NCJL 4OJFH 2D31A 3VD9A 3A6BH 3V0VB 2NPLX 1TNNA 3MCLL 4GKNB 4UV7H 4XCYB 4DW2L 1CDJA 4QHNA 4KU1A 4UUJA 3VXSD 4H25A 4MVBC 1IM3B 4L4JA 2R2EA 4XAWL 1TJGL 3RU8H 4PJ8B 1IBGH 1SBSH 4FXKB 2IFFL 1QEWB 4HCRH 3VMOA 1UWEL 2NXYC 3LS4L 1S7WA 4CVXB 1QVOB 5C2BL 1FORL 5TE6L 3GSNB 3QQ9C 1PLGH 3ZSSA 3EGSA 1JPTH 4U31A 3O41B 4R3SB 4X6FB 3SDYH 4X6DA 4HMDA 1LO0L 2CPCA 4S0SD 3BH8A 1LK2A 2I07A 3VMPA 3H6JA 5CBEA 2COQA 7CGTA 3V4PL 3V4PH 1NLBL 4NOFA 4OFYA 2AQ2A 5SWQA 4D0BB 3BGFC 3VGDA 3LRGA 2H8PA 4JFZH 2DQUH 4D3CL 3QUYB 1T2JA 5EORL 4GAGH 3D0VB 4Z77A 1CE6A 3GSRB 3ZDYE 5J89A 4D8PB 3QQ4B 4Z95H 3AM8A 3RKDC 1WQVT 4N8CH 3SOBH 4ZTOH 5HVFB 5DUMH 4N8CL 4NC2B 4M6NH 4ZD3H 5F9JB 1FZMB 3TPUE 4UQ3A 1HXMA 1WFUA 2H2PC 2UVEA 4LGRB 1CK0L 4Q9QH 4RAUB 4NQTA 4AYFA 3AS1A 1G0XA 2ZG1A 3HZKA 2WINB 1G6RL 2OR7A 5FO7B 3VD5A 3VXRA 1CDGA 1RJCA 1RZFH 4XCFH 3GSWA 1CD0A 5GRUL 3NFSH 4R0LC 1P7QD 1S78D 2HWZH 3ILQD 2ATPA 3PWVB 1FNGA 1T20A 2BY0A 2IG2L 5TE7L 1N5YL 4OCNC 4WDIB 3OZ9L 5I6XC 4OCRH 4GLRI 3R8QA 4FS0A 3BJLA 4HLZH 2DLGA 3FN3A 1RIUH 4YC2C 2WLZA 5DMGC 5I71B 2GIYA 2B7DT 2EE2A 1T22A 3MGTA 3U7YL 1T0PB 2D7TL 2L7UA 4AG4H 4LLDA 4CMHB 3LN5B 2W0PA 4FQJL 2JJWA 3F65A 3GRWA 4MQ7B 1TTGA 4MNQD 4XP5L 2AJ3B 4DK6A 4XVTH 4L3CA 3MSPA 1YEGL 4BK5A 4MA1B 4UDTB 4M6OL 5F6HJ 1QQDB 4M6OH 4ZDHA 5HI4D 4FP8H 4P9HL 5D1XC 4ORZC 2XRAH 4NHUE 1L4IA 4UNUA 4XNQA 4HCRL 4KDTA 5D9SA 4JM2F 1BFVH 3MACH 2P45B 4HWBA 4Z5RA 2X44D 3FFDB 4PY8I 4HS8L 2FYYA 3O2WH 4FTVD 1TVHB 3DI3B 1IKNC 2Z93B 1LO0H 3PWLB 1OGAD 3RWFB 1RZ8B 5BXFB 3WL9B 4L8DA 1N2RA 4NN5B 3CVHB 3LHPH 3UTTA 2PUQT 2BNQE 5GSVA 5AG8A 1YMMB 2AEPL 5D71L 2ADGA 3K7UA 1XF5A 5DC0A 4ZFOL 3O3DA 5GZNC 4MJ5A 4IOIB 2CRZA 3BJ91 4XH2A 1IFHL 3GSVB 1UEMA 1B90A 2NR6D 4E42B 2BSED 3SE9L 3NBNA 3LEVH 3BP7B 1OTSD 1ZANH 2BVYA 3UJJH 2IANA 3FT3A 1OD7A 3DMMA 5J6HB 4OGXH 1JNJA 2YUWA 3CDCA 4XWOD 4H25B 3EOYG 4P9ML 4G8IA 3FRPA 5HVGB 3NH7H 1IEAB 4JFQA 5F7EL 4LHQB 2P5EE 1J8HB 1ACZA 3WJJA 3VGAC 5C9KA 4NNXA 5CUSL 4EI5D 2P8MA 4M7LL 1C12B 3SKOA 3MTRA 3OAYK 4G3YL 3T77A 4AL8H 5DLMH 3PNWB 4U1GC 4QWWD 2D03H 1K8IA 1CLCA 2IMNA 1RHFA 5FYJU 3HRZA 2WK2A 2F8XC 4WWKD 3BIKA 3TO4B 2YZ1A 1CXKA 3D0LB 4JZJC 4X6BB 2BDNL 4Q0XH 3T0BA 1KB9J 5GGVY 5B3NA 4JREC 4H1LH 1WUNT 3W2DH 5HGDB 4D8PA 4F57H 1MCBA 2V7NA 3C6LC 4X83A 3GSOB 4Q97A 4PB9H 4L8CB 2AGJH 1I8IA 3QDJA 3D2UB 5TQ2H 4YHNB 4I2XB 1U42A 5IEKB 4M8QA 4KKBD 3OSKA 1CT8A 1X5XA 2FBOJ 2WBJB 1ERNA 1GOHA 5F89A 3CDGA 4CDGC 5I1JL 4CMMB 4C4KT 3PG2A 3NCBB 1JWMB 2KQMA 1T7XA 3I2CH 5KVDL 4YFLF 1NGPH 3HI5L 3IFPA 3K2MC 5AYQA 2WM0A 1YEKL 3LS5L 4PD4K 3IDNB 5D1ZD 1IQDB 3EFFB 5CD5C 5JORA 3DV4B 3U7WH 1SJXA 3ZKQD 3O6MH 4DGIL 4AIZA 1BQHB 2A6DB 2Z8VC 1JWUA 4Z7UA 5D93B 2Q8AH 2Q8AL 3SGDI 3TIEA 4OIIL 2EDBA 3VD3A 1DLHA 4HD9A 2DWEA 4WHYH 3SE9H 5IOPB 4LVOC 3PWPE 4UQ2A 1F4YH 1A1NA 1CLZL 5DS8A 4P3CH 4H8WC 5GRVK 4QT5B 2PR4L 4NKOB 1JN6A 4RWHA 1I3UA 1S3KL 3ARWA 3VMNA 1FBIL 3FO0L 3O3EB 3IDIB 1AI1H 2ERJC 4GG6B 1M7IB 2IJ0C 4RAVA 1U92B 4MA3A 1F3JB 1HEZB 5DURD 5AUMA 3W0WD 4E5XB 2IAMB 5JTWA 4DQOH 1IAIM 3CFCH 1BD2A 5E1AB 5SV4A 3KPRA 1QBBA 2ZCKL 1P6AB 3WXWH 3L3GB 4O02H 3RTQB 5IGXH 3O2VH 3A6CL 1KULA 5SX4I 4KHTH 1ZT1B 4H88L 2BXZA 5TF1H 4MCYB 3VD4A 3KLAB 4P46D 5I30H 4LSUL 1F97A 5L6YH 4LLMB 4OF0A 5D1ZB 3CVHA 4S10A 3IT8D 3UTTB 3GSQB 2GSIA 1AXTL 1UADC 5D7SH 3THML 3RI5K 4JM4L 4P23A 1MHEB 3RPIA 5JPMA 4OLYL 1SEBA 1KIRB 2J8OA 5C8JA 5EZOH 5C3TA 5EG6C 4PB9L 4MCZB 3KWWB 4UI2A 5L2KD 4L8SB 1X6LA 3ULSA 1KPRB 3H7BA 1IAII 4P5KB 2VISB 1E4WH 1WBXB 4KI5F 4LSTH 2KZ1B 2BMKB 3QEHA 3WFDH 4F9LC 4X7TB 2IANB 2OSLA 2X9YA 1JHLH 5CUSH 3O6KL 1JPGA 4F7PB 2P7TA 4NQEB 1AXSA 4Q7DA 5F7YC 5HDLA 5ITBH 3GO1L 1KC5H 2QHRL 4MD0B 4N0CA 2GFBB 2FGZA 3MV7B 4J3XA 4U6HA 5D2LB 2ENSA 1R5VB 3CFBA 4LKCB 3TH3T 1A22B 1HHGA 1IAOB 1MJJB 3KYKL 5C09A 4TSCH 3JV0A 1IL1B 3QIUB 3TO4D 3S96B 3DROA 3TYFA 2IBBA 1DLFH 4Z18A 1WT5C 1DUYA 1RIHL 1YECL 4F57L 1IM9D 4FTVA 1KN2H 3K46A 4P2QE 2RQ8A 4U6TA 1FVDA 1A4JB 5IK3A 5DHXB 4DWHA 1EAJA 4P3DA 4RGNC 3VFUB 1JZ8A 3EO1A 3S36X 1DANT 1UVQA 35C8H 1UJ3C 5B3JE 1TCRB 4M6ML 5IVXE 2P8PA 2Q87A 3QG6A 4I48B 1ACYH 3O4OB 2WBJD 2XNAA 3QDJB 1F42A 4KQ3L 1X4YA 3Q6GL 2IPKB 4NRYA 4UTAL 2QR0A 3VFRB 3VXPB 1JGUL 5KVFH 5LQBH 1C5CL 4TQEH 2DI9A 3LCYA 4YHOH 2PYFB 1P1ZB 1CLOL 5FB8B 5IM7A 5EWIL 5L0QB 3ARDC 1A6VH 1E27A 5KVDH 5HHMA 3UJTL 1XIWA 1EGJL 4UB0H 2XRAL 3I6KB 2VDRL 4JQIL 1DVFB 4FN0A 3WIHL 4X8JA 3OAYH 3DRQB 4P4RA 1WZMA 5DVLA 3BAEL 1CLYL 3DV6A 4AY0A 2ADJA 3KPNB 2MMXA 1AO7A 3GM0A 4BFGA 3B2VH 4JFFD 4Z7WA 2VNCA 4JFYA 3MRFB 3JVGC 3TBTB 1ODAA 2A6JA 3Q5OA 5JUEH 3DXAE 3WN5C 1LEIB 2ITCA 2EDNA 3MRQB 3A6BL 4LL9A 1EA9C 3GMPA 4JJHA 1WVZA 4B7LA 2PW2B 2F58L 3IXAB 3GBNH 4QT5A 1F45A 1GPOH 2EIZB 3L9RA 5CD5D 2C7UA 4LSPH 2NY3B 1DQQA 3SN6N 1BIIB 3GGWA 5CSZA 2V5SA 1A6WL 5FA4A 3LN4A 4LFHG 1INEL 2R23B 3N50A 2HT4D 4OCXH 1XMWA 3FHQA 1I9IH 4HUUB 1ZA3A 2FATL 3VWKA 1AI1L 1BD2B 4NKDB 4LSQH 1NFDF 3GMRA 2XN9E 4PB0H 2ADGB 3FQTA 2R0WL 5MENA 4PDCE 3VXUE 1A1OB 3WFEH 3JV5A 2QKIA 4XVTL 3U7AA 3ULVF 1HKFA 4KHXH 1A7RL 2ZP0T 3O41A 4R3SA 1NLDH 4X6FA 5D5MF 3IAPA 3MRIB 4L4VE 3FOLA 4EXKA 1KCRH 4R7DB 1OGTA 4OM0L 4XI5C 2A73B 4P4KA 5KANI 2A74A 1FDLL 1ZTXH 4JPIA 4JQXA 1H3UA 5CD3B 4J2XA 3ECBA 1I1FA 5IVNA 5SWQB 4BUHA 1N6QH 4M43H 3DGGB 3KYMB 4BFIB 3OKDB 2J6EL 3OXSB 3LZFL 3FQNB 4QXTB 4HIEA 4ZXBB 1PEWA 1FAIH 2YC1A 1MRCH 3BZEB 1F90H 1MRCL 1XAUA 1MH5B 2P47B 3RUGA 2VO5A 3OAUL 1OAZH 2Y25A 2YSSA 3QHTC 4RWYH 5E8DL 1RU9L 1HNGA 2Y7QA 1ZHKB 5I8EA 3WS6C 4AEFA 4X9FA 4B53A 4I3GA 1F58L 3N06B 5GGSB 1C16A 5CP7A 2MKLC 1RZ7H 5CEXB 2X4UB 1NAMA 3PHSA 3QI9C 3QIUA 3UJIL 1EZVY 1LP9E 5CLWA 2QADC 3GSXB 4FFVD 1EO7A 5IB3B 4DAGL 2VDML 4K3JL 4XPGH 2FX8H 4N9GA 1TETH 1Z6JT 3U6RA 4RFEB 4JFFB 2ZPKH 2ED9A 3BPNC 4ZPTB 1DBKH 3QDGA 2NR6C 1G1CA 5D2NA 5H2BB 3WNNA 4PRPE 1V7ML 5F6IC 5C0AE 1Q0YL 4TVPH 3MLVH 3MJ8B 4DKDC 2VL5B 2MPAL 4JKPL 1BQSA 1B0GA 3KS0H 4NRZA 4NM4L 4F33B 4GQ9H 4LVHC 1S7QB 2YOCA 4DVRL 1GAFL 3CSYB 3I6LE 3ZE2E 3D5OF 3PP4H 4P99A 2WWMD 5C0EA 1BREA 4OUUB 4UT7H 4XPAH 3U9PH 3SE8H 4M6AA 4CVZA 1A1NB 1FO0A 4RFNC 4AEHH 4QLRA 3GBMH 1A14H 5SV3A 1QBLH 4M9OA 4W4OC 4NKIL 4DCQA 4NRXB 4PRAA 1BZ7A 4BSVB 1RK1A 4JFEA 2HAZA 3QDJD 5IF0A 5I76B 4JFYB 1DCLA 3HZVA 1J8HE 2AEPH 2ADFH 3JZ7A 3SY0A 1G9NC 3RA7H 3QQ3B 5HHOB 1U2CA 3RL1A 4MAUL 3S8WA 2J6EH 1U92A 3G6AA 3TVMB 1BFSA 1DBJH 1UGNA 3MLZL 2VH5H 5DD5L 1SYSB 2NMSA 5E9DD 1NFDA 1QZ1A 3TBWA 1IKFL 4WRLA 3BMVA 3WEXA 2EE3A 3UTQA 5D2NE 3PABB 2GJ6A 1GHFH 5E8OB 2QQKL 4Y2OA 3LKRB 5J56B 5HHOD 2CMRH 2XFXA 3PV6B 4OLVH 5BOZG 1NAMH 1QFOA 3NCFB 4MX7B 4NJ9L 1F13A 4XZUA 4DN3H 1RUQL 3MRCB 2IAND 5FYKD 5ITFB 3DVIA 3RUGE 3L5XL 2UUDH 3ARGC 5HYIA 1J05B 4NBXB 5T3ZE 3LKQA 1HWHB 4NKMB 4XP6H 2R1WB 4OGAD 2W1NA 5J7CC 4AENA 4XVSH 2LAAA 4NT6B 1X5LA 4JY5L 5FUZL 3HNSH 5ESQA 4BFIA 5FECA 4X6DF 3ZHKA 1E4XL 1CDIA 3CIQA 4NGHL 2IFGA 1S7RB 4XMKL 4IHOB 5SWSE 4MNQE 2XWTA 2OL3B 5GRJH 3ZDXE 2K7PA 4TSAH 2Z9TA 3ZSTA 3W81A 3MJGX 4PLNC 2HT2D 1QD0A 4A6YL 1CQKA 1O7SA 3FZUD 4JY4B 4MDIB 3U9UA 4KI5C 1WZ1L 2ZUYA 2GITA 1G0YR 4YO0A 1AO7E 1N5YH 2VIRB 4EVNA 2X4UA 3RIAK 32C2B 4LCCC 4ZFZB 1C16B 2GAZA 5CP7B 5HGHB 3L3KA 1BJ1H 2V7HA 1ZA6B 4N0RA 4X6EA 1JPST 1N4XL 4C56D 4GG8A 4M4PA 3U4BH 5IG7A 4OZIB 1WF5A 1VGKB 3IGAA 5EOCL 3NABH 3QFDB 2X70A 3JV6B 5HHPA 1GGYA 4I48A 4MLSA 2RGSA 4TVSa 4ETQA 3VG9B 2GK2A 5DRZB 2DL2A 2XZAH 1NCAL 4RISH 1CYGA 2R4SL 3H9YA 1KJMB 1T4KB 1PFCA 4JY6A 2FX8L 5D2NB 4AM0B 4HEME 1MI5D 5I15L 4PGEA 5HYSG 3VU2A 1WZKA 3MJ8A 3OJDB 4JCMA 3ARFD 1F3RB 1CICA 3MRMB 2V2WA 4ODWB 3QUZA 3RAJH 3QYCA 3HUJA 4K3EH 5K59E 3ILPA 4RZCB 4EUPH 3DARA 4X9BA 3TJHD 2XTJE 3DUUB 1CFQA 2PCPA 3D2UD 1I8KB 2BRRH 4OSUH 4KMTL 3WUWG 5EZJA 4U6VL 3DRTA 1MCWW 2D03L 3D6GA 3JTSA 3HPLA 3PL6D 2C3GA 3AB0C 3N1FC 1UM6H 1I1YA 5F96H 4BSVA 2NTFA 3MRJA 1MOEA 2AXFB 2W0FA 4NDMB 1U8LB 1BD2D 3W2DL 4FABL 5FCUL 3IFLH 3BYTA 5GS1A 5IVXB 4JLRA 5T1DH 4HUUA 4OGXL 1QSEB 3EAKA 2I27N 4APQB 3QSKB 3RPIB 5JHDB 5JPMB 3PDOB 1K4DB 2AXJA 5GGVH 1Y18A 1Z9OA 2C4FU 5FGRA 3ARBB 1OARL 3Q5YA 1ZKAA 1I1CA 3D25A 4BQ6A 1X5GA 1JZ5A 3OJMB 2LVEA 3CH1B 4LOUD 5EUOA 1OM3L 3B8YA 1NPUA 3L6FA 2QKIB 4WO4C 3DX9B 5EC2B 4W4NA 2XFXB 4MHHI 1ZT7A 3MOAL 4Y5VA 2B4CL 3GJFH 4PJHB 5KSAB 4G8GB 1A6AB 4JFDD 3OF6D 1BWWA 1G7LA 1IGFL 1Q9LB 4R2GC 1FCCA 4TSCL 3GSVA 3GKWH 1A6TB 2FSEB 3FO2B 3N85L 4U1MA 5DQ9A 3U82B 4GRLC 2BCKB 1INDL 1RUQH 1DUZA 5C0CD 5FM4A 3EYVB 4LOUC 4NSKB 4ZPVA 4FP8L 1H3GA 3LSOA 2RIKA 5K9QI 1U6AL 5DJ8B 4D0CA 2X4OA 4D9QD 5A16A 1BP3B 2YD3A 5KAQF 2ZOKA 5DHVA 2E7HA 1H0DA 2ARJB 4ELMB 3O8XB 3V6OE 1CGWA 5C9JA 3F6LA 1S8DB 3QG6B 3P0VL 4GBXC 5ANMB 1T0MB 4J4PD 1F6AB 5MI0B 5F3BB 2NQCA 5DQJA 2O61A 5DEFA 5CEZE 3UTSD 2YD9A 1UA6L 3PGDA 5I30L 2DICA 2ICWA 4YHIB 4UMGA 5KVEL 4WTZG 4L3EB 4JPWH 4RMRA 1UFUA 2L7JA 1ZA6A 4WJ5B 1GGBH 1Z5LA 4FQCL 1KCGC 3D3VE 3C08H 4TUJA 3FT4A 4OLZH 4WVRA 4NO0D 5KSUB 2WMPA 3C8KB 3FB5A 1A21A 1BFOB 1U8QA 3IXTB 1I8IB 4AEHL 1VEPA 2P42B 4O2CA 3NIDE 1ED3B 2ATPB 4WO4D 3UPCA 3RIFK 5I1EH 4PGJA 4PJAA 5IR1B 1FIEA 3T0DA 4MD5B 2WWKT 1UWXH 3MPCA 4QRSA 3G5VB 4EKXA 1XIWC 2FBJL 2BSSA 3RWJB 4HW6A 2HFFA 2WANA 2EH7L 4OFIA 3JBG7 1ZANL 3UJJL 1QBMH 2ADIA 5JOEA 3LQAL 4AT6B 5ICYB 5HGAA 3ME0A 3FQRB 3MRGA 5JR1H 4OD1H 4Q6IB 3ILPB 4HX1B 2E9BA 1V7NH 2R9HD 1U8HB 1XCTB 3LQAC 3CMOH 4EN3B 3QQ3A 2A38A 4YK4B 4P5TC 3CZFA 1KPVA 4PS4L 5DVOA 3ARZA 1CFNA 5D1QC 3WLBA 5IQ9B 5D9SB 4GXUM 2Y07L 3JUZA 1TXKA 1T89A 3WFHA 1N64L 1NBYA 2NXZB 3L3HB 4GBXA 3AY4C 3IJHA 3FJTA 1GGCL 3D3VD 5FO8B 4HIXL 2DJSA 3LKRA 3VRJA 1HSAB 1YA5A 3OKLB 3ZT6A 4J3SA 4FMKA 4OF5A 3WKMH 1QLRB 1MF2H 1NL0L 2AXGA 2ORBH 3GK8H 3DO3A 1D6VH 1X5KA 1E4XH 4JANB 3RL2B 2XG4A 2E6QA 4U1LB 1HQRA 3MRRB 4H5SB 4HIEB 2ICEA 3N9GH 4LLMA 2FB4H 1YEJH 5JW3L 1JNLL 3PHOA 3M17B 5T1MA 1PJ9A 4H0IA 1MHEA 1JZ7A 4JO1H 4MDJB 3ULUC 4JFQB 5FYJE 5ACZB 5JPNB 4JG0H 1RIVH 2BCKA 3REWB 1DE4A 1LQVA 2PETA 4JFXB 1CGYA 3MBXL 1C12A 3NCCB 4BQ8A 5L7XL 1FGNH 1K8IB 1FL3A 2X10A 3GJEB 1FYTD 3PL6A 4FQ1H 5KW9L 1U58A 2Y23A 4PJXF 3DX6B 2WUCL 3ARVA 3ZKND 3C5SB 5D5MB 1AY1H 4ZUWB 4WEBH 1FNSL 3UO1H 3CSGA 4WEBL 1HCVA 4L4TA 2MJWA 1NUFA 2IGFH 1OPGL 4H0GA 4PV8B 1QFWH 3ESUF 1MPAL 3T1FA 1K9TA 2VLJE 3OKYA 4WCYL 2L4OA 2G9HA 5DJYB 1O0VA 3QFDA 3TIDB 1IT9L 1DBAH 1FLTX 2R0WH 1U8JA 5FUZH 1TZIB 4M7JL 4YGAB 3QA3A 1IJ9A 1ND0B 1U3ZA 1G9NH 5J1AA 3ARGD 4HT1H 2EDTA 3G9VA 4M8QB 3O4OC 3KLSA 5C6WH 2EDYA 2OS7A 3HAEG 2YS4A 4OM0H 2V5TA 3WNKA 2BVTA 5IB1A 1ORQA 5AG9A 3MX0A 3QUZB 1MCRA 1LEKA 4HUWA 4OCLC 1UH3A 4MAUH 1RZKH 3OJDA 5DGRA 4MB4A 3SY0B 5EUOE 4M5ZL 1IGYB 5HY9B 3V4VH 1QKZL 1DQLH 4MSWA 4EI5B 5TGBB 3PWUB 1ONQA 4NZRH 3N1QC 1EEZA 4ZQKA 4XBPA 1A64A 4JFED 4N1EA 3MNZB 1ZVSB 2JJSC 3VXQA 5DK0A 2LU3A 1R3IH 4AIXA 5GSRB 5IFJA 2GJZB 3CXDL 1X4ZA 3GI9L 1D5XB 3FHAA 4DVBB 1PZ5A 4AZ8A 3SCMB 4NO3B 3U30C 1UT9A 2GK0A 3MGOB 5DF0A 1Q9OB 2CR6A 4PG9B 4JJ5A 3BT2L 4PJ5B 2D7PA 3EYFA 2BVQA 3FO0H 5IVXA 4A6YA 1FDLH 4QHNB 1K2DA 2EE9A 3A67H 5IJVB 3TV3L 3MZTA 4O58L 1PY4A 1T0NA 3QUZD 2ZSVA 3KPMA 3RVTC 2YKLH 3H0TA 3MODL 2XKNA 2VQ1A 1X5JA 4OSUL 2AJZB 4MXQC 4NO0A 1J12A 5KS9E 3W11D 4NM4H 5I1AB 4LPVA 3T3ME 3JWDH 4MNQB 3BXNA 1CDHA 3FTGA 4DEPB 5J1SC 3QUMB 5JHDD 3WIIL 3MNVA 1AJ7H 3G6JE 4JVUA 4NQDA 4PG2C 5H35A 2YD6A 1BLNB 3NZHH 1CFSB 1C5BL 1BVZA 3PJSB 5CHNB 2IBZX 5BV7H 5JW4M 4HKXA 4PJFF 3TZVD 3HCVB 3R0NA 3GMMA 1Q0XL 3CFJA 4KQ4L 3OTTA 2W9DH 4ELMA 1J0ZA 1ZHBA 1CG9B 5C07E 2X2YA 3WJJC 3DI2B 4X0KA 2DTMH 2C3WA 4KTDL 2QV2A 4ZFFA 5C08A 1H8NA 1WCBA 3CVHL 3N0PB 5GZOC 4MNGA 5EBMA 3R8BB 3PGDB 2GCYA 3IKKA 4P2OC 4LHUG 1ZE3C 3CX5K 4PRDA 4OCMC 3HNVL 3ZKXC 4FQXA 3KXFE 4MAYA 1KJVB 1RUPH 3VFUA 1MVFA 2VDPH 3IF1B 3ZDZE 3UYOD 4YHOL 4XNUH 3QUYD 2BXYA 5F7FA 4GMTL 5TFSL 4XI5D 4YDJA 4POYA 3QDAA 1DL7L 1TIUA 1A7NH 1T1YB 4YR6B 2D3VA 3X3GH 4KHTL 5JHDE 3LQAH 1AQDA 3AREC 5B8CB 3DX8A 3VFRA 1CFQB 2EIBA 1HHJB 2YXMA 4R4ND 2CIIB 1OAQH 3UXFA 3STBA 4OLXH 3FFCA 3V7AE 2NY6C 2AABH 1GIGL 5HI3C 2OZ4H 4NZDA 3QNYA 2DOCA 1UH2A 4IS6B 4PBXA 2R0LH 2OK0H 2EIEA 5C6PB 2PXYC 4WIQA 3LKNA 4P2QB 4JPKH 4CNIA 2YRZA 3C60B 4UOW0 2ZSWA 3DMMD 2MQCA 2NY1C 1LQSR 1TVDA 3RDTD 2FLBT 4ZSOE 3DVFA 2YPLE 3MNZA 5I1IH 5I1IL 1AR1D 3NPSC 4NO5A 4JZOB 4OBRA 3H9SB 2AERT 4YDLB 1FYTA 1MHPL 1S9YA 1CFNB 4YHPB 2EC8A 2LFGA 4ONFH 5C0NC 1SBSL 5KG9A 2VABA 2FO4A 5D7JC 2OMNA 3EO9H 5EOCJ 5J06A 2X4NA 2GTWB 3KXFA 5ALCL 1VB9A 3BESR 1P4LA 1B9ZA 3GM8A 1G0DA 3N85H 2BVQB 2AXGB 4M1DH 1LE9B 4Z7VB 3STZA 5I16B 4LDOB 4QRUB 1P4IH 4AMKH 3X3FH 3AC0A 4NNXB 4U0RB 3KLDA 4LQFH 5E9DB 5DR5H 3LEYH 4YWGH 3CUPB 4YWGL 1MFDL 2CH8A 3NFNB 5IB4B 4HXBH 1D9KA 1VFOA 3E1F1 3MLUH 4NSKA 1MAKA 4Q0XL 4MJIE 2XZCL 4PP1D 1VPOH 2R15A 5DJZB 4ZTPH 3V5HA 1DJSA 4CKVX 4UIMB 4U6VH 4LP5A 3FB7A 1BGXL 5TQ2L 1WIOA 2AGJL 4JCLA 2P8LB 4KI1A 5C0IA 2QEJA 2YZ8A 3U4BL 4HKBB 3MXVL 2VDQH 1ZLVK 4WI8A 5EN2B 1RK0B 1QLFA 3S97C 3WIIH 1X5ZA 3ZLQC 1HXYA 3PXHA 4XPHH 1VADA 4XRCA 1EEUA 2Z31B 5E0QA 3QDMD 1OWWA 1NJ9B 5E8PB 5E4IA 1MCIA 2VERN 5CEXA 1A4JA 4OIAA 3AVEA 4F2MA 4RGNE 3EYUH 4FXLA 4MNHB 3SJVE 4EDXA 1VEMA 4K9EL 3TWCH 1YEKH 4C55A 1TZHA 4XP9H 1AGDA 3IETB 1FVCA 2E9WA 2W9DL 4J6RL 3SBWA 2ESVD 3X12A 2AEWA 5JMRA 3GIZL 5HHQA 4R8WH 5HHMB 1HHHA 1H3VA 3R06B 4ZFGH 1OLZA 4J1UB 1EZVX 1W8OA 1YN6A 1QFPA 3RX7A 3ZTJH 1T03H 1KJVA 4Q9RL 5F88B 1ORQB 4JB9L 3DMMC 3IU4H 4Z7QE 4R97C 4HS3A 5EO0A 5ESVA 3VXUA 4TUOA 2ZUWA 2W0LA 1AY1L 3TEUA 1T21B 2BY1A 1G9NL 1FPTH 3NACH 1MLBB 3QCUL 2OK0L 4G8EA 3HUJF 2R29L 4Y5YC 3L5WB 2E5EA 1P5UA 2FECI 5JXAL 2C1OA 4KGJA 3W9DA 1HHIA 4G80B 3HNTL 3CU1A 1U9KA 4ODVH 2HRPH 1KTLA 4LLVB 2X4QA 1QO3B 2AAVA 2EIZA 3L9RB