4QRTA

Crystal structure of hla b*0801 in complex with eln_yym, elnrkmiym
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
276
structure length
275
Chain Sequence
GSHSMRYFDTAMSRPGRGEPRFISVGYVDDTQFVRFDSDAASPREEPRAPWIEQEGPEYWDRNTQIFKTNTQTDRESLRNLRGYYNQSEAGSHTLQSMYGCDVGPDGRLLRGHNQYAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAARVAEQDRAYLEGTCVEWLRYLENGKDTLERADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, B-8 alpha chain
publication title Molecular imprint of exposure to naturally occurring genetic variants of human cytomegalovirus on the T cell repertoire.
pubmed doi rcsb
source organism Homo sapiens
total genus 82
structure length 275
sequence length 276
ec nomenclature
pdb deposition date 2014-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4qrtA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4qrtA01
1OB1A 4FQLL 1BQHB 4MB3A 3FT3B 2VQ1A 2DOCA 2CIIA 3U2SA 2C3VB 5FYLD 5T5NG 4NQED 1FFNA 3MRFB 3O2DL 3ES6B 1NCBH 3JXAA 1D5XA 4PGEA 2G9HB 4M6NL 1MCPL 1RUKL 4XP1H 5JPNA 1EEZB 4CNIA 1XF5A 4X6CB 1PG7L 1M4KA 4HIJA 3UPAA 5C08B 3VXTB 3GIVA 4CDGC 3F7QA 2R29L 1IAOA 1BP3B 1A9EB 3REVB 1CXEA 4YHMH 3VGAB 3B9KB 1NGXA 4NCC1 4PRHA 4M5YH 5F7FA 4PFEA 2I60H 5HGDB 3KPSB 4LLVA 2CDGB 2W0LA 5EOQL 5KVDH 3LSOA 4L4JA 4FQXB 4YDJA 5L9DL 2BCKA 4NHUA 1EK3A 5DFVC 2VZ1A 1CFVH 3T4AA 3QFJE 4ODVL 1LD9B 5DHYB 5BV7L 4UMGA 2C26A 3OR6B 3VXSB 2NNAB 3WE6B 1G0DA 1CDCA 1CS6A 4KKNA 5JXAH 1IGMH 4KI5C 4NC0B 3DX7B 5EU5B 1ULVA 4TNWF 3MRMA 3BUYB 4OT1H 1NC4B 5CKAA 1C5BH 5D72L 3CUPB 3MJ6A 3VFGH 4OZFB 1LO5A 3U36A 3LZFH 1EERB 4QNPE 5FYLL 3LB6C 2GTZB 2Z8RA 4IRSD 5C0JA 1HQ4A 4Y19E 5DZOA 5EUOF 5C09A 4PJEE 1QEWB 5DD6A 3QCUL 1NSNL 3GMLA 4KK6C 4R4FL 5D6CB 1JK8B 4NC1E 3V0VA 2PCPB 1FNSL 4OZHB 3TFKA 2ICES 5J6GA 2W0PA 4A2MA 1HSBB 2ZUSA 2VLMD 3WFEL 4UUJA 1E6JH 4PRDB 5F21B 1C16B 5DZLA 2Q87A 1E28B 5IBUB 3P9MB 3FT4A 1U8JB 5C0AB 2ZJSH 3QUYA 4FXKA 4XP1L 4WI8A 3UZVB 1IKNA 1PKQE 1TNMA 3OF6A 4YLQT 3TA3A 4KJPC 2IAMC 4MX7A 4ZNEE 2IQAB 3K2MC 3MV9A 1EO7A 5CS7A 4YHML 4MA3A 1NC2D 2I60L 4LEXH 1RZFH 5GJSH 1OW0A 3MO1A 1G6VK 5FYKU 1MIEH 3BE1H 5C0IB 2NY2D 4XI5C 3C60C 3QDHA 5HVWA 2KBGA 5GGRB 3IDIB 3PF2A 5JXAL 1IGML 2BMKB 3RGVA 2X4SB 3OMZA 4Z7WA 4QHKJ 1CDUA 3IGAB 2ZWLT 5ESVA 3EUUA 1S9VA 2HN7B 3QO1B 5IBLD 2F8XC 4DFHA 5JDSA 4CUCA 1JTPA 1P1ZA 3T8XB 4BSWA 4R3SA 4BUGA 4OLWL 1BVLA 4QT5B 3U0PB 1G6RA 5LCVH 2VJXA 4BUHA 1P6FA 1V7NH 5E7BA 5F70A 3V4UH 3BDXA 1SY6A 5IJVB 1IC5H 2LQRA 1CF8H 2EXWD 3TPUB 1RIUH 5DRWA 1NH6A 5IFAL 2WY3A 2X05A 1E6JL 3EDKA 3D9AH 3PJSA 1G7LB 4YHLH 1LVEA 1T03H 2ZJSL 4MXVF 1R3KA 2F53B 3B6SB 3WN5A 2FECL 4H1LB 5DT1H 2R1XB 3NFSH 5IT2H 2R2EB 2ZUWA 4H0IA 4JM2F 4N0CC 4TPRL 5FKPB 1CT8B 3ORJA 4XCNB 1ZHLA 2BSTA 2QR0A 4XHJD 4LEXL 3VG9C 4GAGL 3QB7C 5T1KD 2HG5B 4U1SA 2PO6D 4PJFF 5C0BA 4MQSB 1MIEL 5HJ3A 5IHUL 3H7LA 4HS3B 4HXAL 5MERB 1YY8A 1T89A 1FAIL 4LSSH 5M95B 4NJ9H 2WSKA 5LAXB 2CDEA 4XMKL 3IU3A 4X8JB 1FYTA 2FJHB 3HFMH 4FZ8H 3TVMA 1J87A 5DS8B 1Y18A 3EHBC 3HE6A 4Y89A 3SDDA 4HHAB 5F7YC 3VI4E 1RZGA 4GKSA 2VZUA 3V4VH 3O45A 5CILH 1HHGA 1NBYA 1U92A 3TT1L 1KCLA 1E27A 3VG9B 3C6SA 4OM1L 5HYSB 2B20A 3UYPA 2XZCH 1SJEA 5ALBH 4RAUA 3ZE0E 1J5OL 5F3BA 1U8KA 1V7NL 4NYLA 5F1KC 3V4UL 3DMMB 2PNDA 1FO0L 1TTFA 4RA3A 5CCKH 1XGTB 3V52H 3ARGC 3QFJD 4E5XB 1QBMH 4KKBC 4BZ1H 3O4LA 4JDVB 2CGRH 5D7IE 2G75B 3BH9B 4XBGB 1Z6JT 5DQ9B 4X9IA 1RHFA 1OAUH 4OKVB 3D9AL 3QYCA 4NNYB 3KPRB 1PEZA 4IDJH 4YHLL 3M1BB 5E2WH 3MJGX 5HDBE 1BWWA 4UV7H 2ICWB 3V5KB 4Y19D 4PJ7A 5F6IC 1HCVA 3DTXB 1AXSB 3AM8C 4H88H 5DT1L 43C9B 2QADB 3K1KC 3ARGB 1J1OH 5IT2L 4CVXB 3HN3A 1ND0A 4JFYA 4WUUD 4UIMB 4NCDA 1JYVA 1U8OA 1RV6X 3GMNA 2C1OB 3CC5B 4PGBA 4X4XB 5D7JC 3OB8A 1Q9KA 4P23A 1F3RB 3ARDD 2H2SC 4M61B 4XGZA 1GGBL 3N1QC 4FZ8L 1BQLL 3S96B 1DQLH 3QUKA 2G5BB 5F6IB 1YYLL 4L8SB 1MVFA 3MLTB 1VGKB 4G8IA 3PIQA 4FFWD 3GO1H 4PJDB 1Q9OB 4FQCL 2YUVA 2ESVA 5CILL 3V5HA 5IQ9B 2V2XB 3ULVH 1MI5B 5IIEA 3BN9C 3GSXB 5IESH 1OQXA 3KPQB 1BVZA 5D7JB 2XZCL 2OR7A 3OKNA 4FOMA 4XVTH 4JFXB 3NIDF 3KPPA 1JRHI 3RWJA 1H3GA 1EJOH 3IAQA 5ECJE 3QO0A 5CSBA 4PGDA 5CCKL 4LKXA 5IW6B 4UTBH 4QRSB 3V52L 2F54E 3VXNA 3LCYA 4ODUA 4KJQD 1WVZA 4BZ1L 3F5WB 8FABA 5MHSD 5T1LB 6CGTA 2GJZA 3DIFB 5E4EC 3S97C 3ULVD 2EDQA 1R5VA 5IR1B 3VFWA 3TBYA 5BRZE 1JFQL 1ZT4A 5C6WH 4PTUB 4HZLA 3RQ3A 3GSUB 2OP4H 2NY1D 1Q9LB 4TUOB 2EEBA 3RNKB 3L3HB 4JPVH 3MLYL 1KCVL 3DUUB 4ZUSA 1BAFH 4JFOB 4AL8L 3UBXI 4NPYA 4WIQA 1T0MB 4YDVB 3ZZ1A 3WJJA 3STLB 1DR9A 1IILE 4P2QA 4F7CB 9CGTA 3DUHA 3GMQB 5E4EB 4YUEL 2NX5D 3CLFH 3MPCA 5J1TC 4UU9B 1AP2B 4PLJC 4RFOH 4Y4HC 4PJIB 2PETA 4IBLT 1YEDB 5J4MA 4HGWA 4FG6C 1CXIA 5E8PB 1EFXA 3SGEI 2WWMC 3F12A 4PJ8A 4IIQA 4N0RA 2P43B 4EI5D 2KKQA 1H0DA 1B0GB 4YHNA 4QLRA 3GO1L 2P45B 5IOPA 1DQJA 1EA9C 4Y4FB 4RWHA 2AQ3A 3ARFA 3TBVA 3ULVL 3KLHC 1YA5A 1YPZA 2E9WA 4JFEE 5IESL 1U8PA 3T2QA 3WKML 2CLRA 4F33B 5BMFH 1EVUA 2Q8BL 4XVTL 4Z7OE 4DVRH 2NY5C 5GZOC 3STZA 1Q9WA 3A6CH 3MJ7B 1X5YA 3OL2A 5JW4R 4I3RL 1JPGB 1QBLL 3RIAF 4NM8H 3QIUC 5KSBE 3NAAH 4KJWC 4LGPB 5F93C 5B38A 2R1YB 4OIBA 1X5JA 3DX9B 1XMWA 1YDPB 5E94B 3RY5A 3MFGB 1TFHA 4JY6A 1AR1C 4M03A 5C0CE 2VLKE 4G5ZH 3V7AG 2OLDA 3NTCH 2Y6SD 2I9LA 2YPLB 2DQHL 4OZIB 1A1MB 3RZCA 1JWSA 3BEVA 2W9DH 1ZVSA 5AAMA 3ZKMC 3DUSB 1TDQA 4GSDL 2XN9B 4JVWA 1I9IL 3N0PB 5GS0C 3GBLA 2JELL 5EIVA 4DKAA 2Y5TA 3CLFL 4Y16B 3SCMD 2RHEA 5DD3L 1C5CH 3PP4H 2DQUL 2X5PA 3LN4B 4Q74A 4YHZH 1CFBA 5F7LB 1CK0L 2IANE 2CO7B 2ZUQC 4CJ1A 5I74C 3QEHA 3U6RB 4HIEB 1KB5H 4DUXA 4GG8A 5ESQB 5GGVH 2Y25A 4HXBH 5F9JB 2CQVA 4S11A 2B4CH 3EYVA 4NKMB 5HYQA 3D6GA 1KJ2A 2R0ZL 3EDEA 2X1OA 1MHHA 1AGEA 2EIEA 4P5MA 2AXFA 5BMFL 2YEZB 2FBOJ 1R5IA 4OFYD 2NTFA 4DVRL 5HGBB 4KK9D 4KGLA 3BPLC 3L5WB 4YGVB 5L6YH 4LLDB 1DUYA 4WI2A 2ADJB 4MVBD 3QIBD 5ICYA 4Z7UE 4TTGA 2CRYA 5EIQA 4LPYA 3V4PH 4OLYH 5DC9B 2FYYA 4KDWA 4FHBD 3QCTH 5KN5B 5ERWA 5ICXA 4OFVA 4PJHB 4L4VB 3BEWB 4YBHA 3ESVF 3WIIL 4TSCH 5HHOB 2FH6A 4UQ3B 5F9DC 4U1HB 1KIQA 1S5IL 3SDCA 4B50A 2EH8H 4CRPA 3AREC 3BPLB 4WENB 1IGYB 5I1AA 2VL4A 1FH5H 4P2OA 4LMQI 2F54D 1GGCH 2X4PB 2ZNXA 4ELKA 3NH7H 5DI8B 4BFEA 4KFZC 4M5ZL 4JPWH 4JFZH 1J8HB 4XNMB 4AIZA 1QYGH 3PP4L 1AD9B 2HT2D 2OTWA 5BRZD 4MDIB 5HYIA 4M02A 5FO9A 5D71L 4K71B 3TH2T 5CD5D 1QVOA 4PP1D 4HK0B 1UXWA 4I18A 5DK2A 1KB5L 3QWOA 5GGVL 4X98A 3VGHA 2B4CL 3VXUB 4GW1A 2AJVH 4K9EH 3VFMA 1A6AA 3D48R 3K81A 4UNUA 4WI6A 1KPVA 3DVFA 1LEKA 5TDOB 1VEOA 1ERNA 2LU7A 2DMCA 3BT2H 4X6EA 2ENSA 2IMMA 3EJJX 3ZT7A 1U95B 1S7UA 3EO0B 5L6YL 5E5MA 4LL9A 3QCVH 1RUPH 3GHEL 1ZSDB 4LBEA 5TQ2L 4LP5A 4KUZL 1YQVL 5C0GB 2C4FU 2J1KA 4OV5B 2ZCKL 4XCCH 4NKOA 3AC0A 4MMZC 3IS1X 4FQHA 1EO8H 4JFED 5CHNA 4HDIB 4N0UE 4G80B 3PQYB 3L5HA 4JFFE 4RBPH 1HXYB 2VL5A 5J8OA 2EH8L 4UDUA 5LVEA 3EDFA 1ORQA 4O2CA 2MNUA 3KWWB 5C2BH 3OG6B 1CWVA 4UQ2B 1GGCL 4QHNA 4WUKH 1JF1B 3SJVE 4RZCA 4LLUB 3GEWB 5FYJH 1NGYB 5D2NE 2M8XA 2FWOA 3G6AA 3NCCB 4FFYH 1QYGL 5LGHH 3C6LD 3QG6B 1MY5A 4ISVB 5C0CD 5HI5D 5CGMA 1ZA6A 4G59A 2DDQH 2VLKD 4GO6B 1Z5LB 2XYCA 1K8DA 2XWJB 3MYJB 4XVSL 3UTZA 5CJQH 1XR8B 1JWUB 1C12A 2CUMA 4MD4B 2OR8A 2A6KA 3ZKXC 3RWHA 1QRNE 2AJVL 3FL7A 4H5SB 2X09A 5FYJD 4KRPC 5H94A 3GI8H 5DMKA 7CGTA 3LHPL 1R3LA 3MFFB 3BT2L 5EU7E 4HFUL 4YNYA 2GY7B 3MX0A 1IKFH 3KDMA 1LK2A 1ZLUK 1SEQH 1RUPL 4ZMAT 1G7JB 2IAND 4QTHA 4S1DD 2KZ1B 4YWGL 5HD8C 3WHE0 4LKCB 3VXQA 3AXLB 1P7QA 1UVQB 2EYRA 4XX1G 3ZKXB 4WWKD 1CDHA 4R4NC 3PHSA 3BMVA 4GKNA 2L7JA 3OKEB 4XCCL 3AROA 1KEML 3PWLB 4H0HB 4PV8A 3D39B 1DANT 1JRHH 1CFSA 5HBBA 2NW3A 4ZAKD 3U9UB 3U0TB 3CH1A 3ZLQC 1YMMA 1ZHKA 3KGRA 5I8EB 4MWFA 3RRQA 3LKOA 4N5EA 3MV01 4UTAL 3UPRA 2C5DC 1NMCB 4XAKE 5FYJL 3SO3C 1ZA3B 3GJFK 4F57H 4C59B 4FFYL 5LGHL 4NHUE 1MFDH 3QIWD 5DHVH 5C0EA 5JW5B 2DDQL 4PYGA 5I1JL 2OJZH 3VGBA 1A14H 5CJQL 1PW3A 2ATKA 4OBRA 3I50H 4A2LA 3IXTA 2DQFA 3LMJH 1RJLB 1F58L 5L2KE 3TT3L 3WBDA 3JWNC 5FK9B 1XF2A 4Z78A 5ESAB 1TETH 2R9HD 2P49B 1T5WA 2D31B 2IBBA 4OQ1A 3MRCA 4M4PA 5C09E 4L8DA 4PG2C 3VD3A 4J4PD 3GGWA 3SGEH 1OOAA 1IKFL 3WNNA 2VZ3A 4OIIH 1RMFL 2IH1A 1QFWM 1YPZF 2VXVL 1MVUB 2NYYD 5CINH 1L0XA 2CLVA 1TZIB 4NQCE 4JQVA 2IBZY 1BEYL 4G6KH 3RZWA 4LFHD 4UIKL 1JRHL 3AMLA 2CMRH 1RU9H 1MRDH 3RX5A 4U6HA 2CRMA 4D8PA 4JPIB 3RIFF 3RAJH 3LKRA 1KCUH 4WGVB 1LEGB 5DUMH 3MV9E 4GW4A 3RNQA 4LAQH 1X4XA 2D9QB 1KPRB 1H5BB 1AQDA 2BJMH 1BZ9A 5F71A 5H37G 3JV6B 3C2AH 1T1YA 4NBXB 4KAQH 3FN3A 3LKPA 1BX2A 4P46B 1DVFA 2OJZL 1MWAB 3RUGB 3GBMH 1A14L 1X7QB 2HRPH 4L8BB 5JMOC 4JFFD 1XAUA 3DRQA 3LMJL 4Z7WE 1X6NA 5E95B 4LGRB 4OSUH 5HI3C 1KIUA 3MLWL 1TETL 1X5FA 4M7ZC 4U1KB 3KPTA 3SJVD 3WKNA 3MREA 5KVGL 2EKSB 2GUOB 5A1AA 4HFWB 1J0YA 1UFUA 1QSFE 3FZUD 2BY3A 1WISA 2PW1A 3DVNB 2AP2A 4OIIL 3FCTB 2JJTC 5C0DB 1L9MA 3QUXB 5KOMC 1I8IB 4Y4KB 5CINL 4XNQB 4CVZA 5DF0A 1J9CT 4OAWA 3WFBH 4QHLB 4WU5B 1NCWL 4GBXA 1IARB 2W65B 3PL6C 4LVEA 2F5BH 4MXQC 3SHSA 3TNMB 1B4JH 4PJ5A 1BOGA 3G9VA 1MCIA 3QDJA 2CMRL 3CVHB 5F7EH 1RU9L 1MRDL 2BERA 1G1CA 4JRXA 1P84J 2Q7NA 2EDRA 3HKFA 4U1JB 2ZPKL 1XZ0A 1CICD 1W72B 1KCUL 3R1GH 2BC4B 5C0FB 4QKXB 3L6FA 5DUML 3B2UC 1PG7X 4P59H 4LAQL 4PBVC 5DEFB 2P42B 3MBXL 3GHBH 2BJML 1BFSA 3U9PH 2XA3A 1E4JA 3P4MB 1A0QH 4TTDD 4D0DA 3CZFA 3U83A 1ZLWK 1JF5A 4JCLA 3KPNB 5SV3A 1CLZH 3O8XA 4KAQL 3QXVA 2XKUA 2J6EA 1SJHA 3GBML 4GG6B 2HRPL 3GMMB 4B41A 4NNPH 4F80A 5EA0L 3GJFB 4PJBF 4Z7VF 4RMVA 3W0WA 3LRSB 3ULVF 1ED3B 3MV7A 3MRGB 4KTDH 4GRLC 4D3CH 3V2AR 4JEGB 3KS0H 2P5WA 4FTVA 5GIRB 3TO4A 4B7IA 2IPUG 4HUNB 4ELMA 4PGCA 4OFDA 2NY3D 4HS8L 3KYMB 4XAKD 3RJQB 1XFPA 4RMUA 3QPQC 3NPSC 3BGFC 5LGJA 4DN4L 3WUWG 2DMBA 3MBEA 3ZKSD 4ACPA 2X7LA 2JIXD 1YMHB 3AY4A 4W6XB 3T0EB 4RMTA 1HQRB 2X4NB 3HR5A 5HHPB 3QRFM 1D9KB 2QQLL 1XGPB 1SM3H 4DCQB 4BFGA 4GRLB 5HTSA 3BGMB 5L2KD 2N56A 2F5BL 2Z35A 4LHQB 4RGNB 4Z7NE 5D7SH 3WYRA 3KLAA 1TJHL 3KPLB 2D03H 3LQZA 4XP9H 4UT7H 5GRZA 1RURH 5J12C 3G9AB 1ZV5A 4OI8A 2K7PA 5EO0B 2A1WL 4PJ7E 3NPSB 3BGFB 4OJFL 1LP9A 5BVJA 5GGVY 3R1GL 3BPNB 1T2JA 3TYFB 3BP5A 4JZJA 4A6YH 1T2QH 2G60H 4G42A 4JY4A 4P59L 5KSAD 5FO8A 2FIKB 4DQOL 3MLUH 4KVCL 1S7QA 4TSAH 2H3NB 3GHBL 4JREC 4S1SH 4NQCD 3U9PL 2DICA 4ZFZA 1UZ8A 5F88B 1GC1H 3JTSB 1FORH 1CLZL 1T4KB 5DK3A 4P4RB 2YRPA 5CP3H 3UYRH 1OTSC 4NNPL 2YUZA 1G9NH 3QUYD 2WIIA 3VI4F 1LNUB 5ADPL 3SO5A 4GOSA 2J88H 2DYPA 3FO0H 4KTDL 4LCYB 3TA3D 2PYED 4D3CL 3O9WC 1R6VA 3A6OA 4PR5A 1ZXQA 5GRUH 1AKJA 3GUTA 4JREB 4POZC 4RAVA 1D6EB 1K3IA 4IRJB 1KOAA 1YY9D 2BSED 4LF3A 3OKLB 1UB5B 3BO8A 1N5AB 5DJ6A 3UMTA 4O2EA 2I5YH 1GOGA 2XZZA 4KHTL 4P5TA 3MUGB 3V0AC 4HG4J 5E8NB 1J11A 4XXDA 5D7IF 3KNBA 2GAZA 4WW2F 3VXRB 4PJ9C 1SM3L 5E4IA 3RGVD 1S9WB 4DTGH 1QBBA 3O9WB 1YNLL 3UTOA 1ZGLM 4U1IA 1U8HA 1A1NA 1SEBB 1OGTB 3IAPA 4HKJB 5D7SL 1YEFH 1ZHBB 5IB5B 4Z76A 4ENED 3RDTA 4M4RA 2D03L 1RURL 3T09A 3KXFB 3I6LE 2QTEA 5J1AB 4X7DC 2GYSA 4LLMA 3OGCB 4CMHB 4ZUTA 3ZTJG 1QSFD 4UINH 4PP2A 5HYEA 3BP6B 2DWDB 4HWBH 1I1YA 1IQWL 5E9DB 4LSQH 5C0NC 4H26A 2XOTA 1T2QL 2G60L 2VIRB 2YKLH 3IDMB 3MLUL 1JPFB 5KANG 2PTVA 3MUHL 1PQZA 4PJ9B 2A38A 4HUXA 5ANMB 4S2SB 4AM0A 3UTSE 1RK1A 1OGAA 5FUCC 1TVHB 1WIPA 2EXYD 5GS3A 1JHTA 3BDYH 3IDJB 2BVQA 3MSPA 2BSRB 3UYRL 3ZMRA 1S9XB 2WP3O 1VB9A 4FQ1L 4MXWH 4X6DF 5DVOA 4C57C 3NMEA 5BS0A 5B3NA 3CDFA 1V05A 5FYKE 4NWTL 3N85H 3ILPA 4OZ4B 1YEHH 5ETUA 3FO0L 5EZLB 3S34L 3V6ZA 3CXHK 1Z2KA 4JN1L 3D3VB 4OGAD 4OD1H 5GRUL 4JKPL 5HY9B 4HPOL 3HPJB 3QEQA 3PWUB 1P69B 1UM6H 1XT5A 4NRZB 2C9AA 3OAUL 2IFGA 2ZCLH 2N1KA 3Q6FB 5BJTA 5D93B 5GSVB 1G6RL 1H9VA 4PRIE 5F7KC 4IMLB 1HN1A 1DEDA 3C5JB 4NN7B 2H9GB 5DD5L 4JDZB 1T7ZA 2E6JA 3MGOB 3S88H 3SDDD 1MQKH 2Y72A 4U6XA 4DTGL 3JWOH 3WJLA 3GI9H 4BFBD 2V7HB 1T66C 3AMKA 1YEFL 3WNKA 1U8MB 1UH2A 4NHCH 1Q0YH 4F9LC 5B22A 1EVTC 2FX8H 3OXSA 3PDOB 2J4WH 2JB6B 4U4BA 2UY6A 1WLHA 1TVBB 5LJYH 3F7VB 3IF1B 3HLAA 2AV7A 3THMH 4HWBL 1WTLA 2CPCA 1AHWA 3VDCA 3MRDA 3FO1B 2D2OA 4LSQL 4ONHA 4G9DB 1JGLH 2YKLL 3IB4A 4B0MM 4QCIB 1DFBL 4B5EA 1V5JA 5ADOH 4KY1H 1NDMB 3SN6N 1D7FA 1IGTA 3U4BH 1T21A 5CIPB 4LOUC 1DLHB 1FVCB 3VGEA 1KIRB 4AEEA 4NKDB 3EJZC 4H25B 2C3HA 4NIKB 3VJ6A 5EO1A 3N85L 1Q0XH 3P11H 1TCRB 3DX6A 2DI9A 1CGYA 2FSEA 4AEIH 3H9ZA 4F58H 4HH9A 3NCMA 3RWFB 1TVDA 2F58H 4Z7QE 4JFDA 1LO2H 1YC7A 4BM7A 4QRPE 1CZ8H 2ZP0T 4JFHD 2HFFB 5I1GH 1KENH 4LQFH 5IJKC 5KSBF 1C5DB 2NY6B 1X5HA 5E56A 4Z77B 1W0WA 3P9WB 4URTB 4A6YA 3S88L 5CSGA 1G9MH 3DI3B 1P84K 3CSYB 3VFOA 1U3HB 25C8H 5J3HD 2JCCE 3OKOA 1EAJA 4NHCL 1F6LL 4FNLH 5C1MB 2J4WL 3SDXA 1BQHA 5HHME 4Y8AA 3FT3A 4L5FL 2C3VA 3LPGA 3MRFA 5CP3A 4LNRA 4IS6A 4K3JH 2G9HA 4IOFD 2R0LH 3ZDXE 1EEZA 1E6OH 1JGLL 4X6CA 3MZTA 4KKLD 2VSDA 4P9HC 5C08A 3TBWB 3VXTA 4JAMB 3WEXB 1I1AC 1JGUL 1A9EA 1AXTL 3REVA 2AV1B 1T5XB 3B9KA 4L3AA 4R0LB 5F8RC 2XXMB 3B43A 5HGDA 2YOCA 3KPSA 2CDGA 5TF0A 3U4BL 4P2YA 2IBZX 3FKUS 4FQXA 3LVEA 4MLIA 5IHBA 1GHFH 2ED7A 2VWEE 3HAEB 4JY5L 3MJ9H 5IW1B 3QJFB 1LD9A 1QOKA 5DHYA 5AYQA 5FYKH 5F72S 3OR6A 3VXSA 1QRKA 5DZNA 1CGSH 2NNAA 3WE6A 3G5VB 4XPAL 1F4AA 1IJ9A 3DX7A 3U0WH 4MCYB 3BUYA 2EE6A 1NC4A 1KF9B 1CD0A 3CUPA 4RDQF 3UTSD 4OZFA 3ZL4H 4MJIE 2GTZA 1CZ8L 1OWWA 5EORH 2EH7H 5EUOB 1A7OH 1QEWA 4J6RL 1IM9B 4Z7UF 4MD5A 1JNLH 3LS5H 6FABL 5D6CA 1NCUA 1MCNA 4OGYL 5FYKD 4PJ8D 2PCPA 4M6OL 1EDQA 4OZHA 4KTEH 1UEMA 1DJSA 2WUCL 1HSBA 2CKBB 1G9ML 4U1MB 3T0XA 2FB4H 3VI3E 5TF1H 4PRDA 1C16A 1AH1A 4LHUG 4XP6H 1E28A 5D1QD 3P9MA 3NFNB 1KFAL 3JVGC 5I1DB 1SYVB 4DK6A 1U8JA 1T80A 5C0AA 3WMSA 4K3JL 4PRID 3ZHKA 2R0LL 1KNOB 1JV5B 5DVKA 5F7HA 3QRGH 2OL3B 5FCUL 4F37K 2IQAA 1UC6A 3SKMB 1R5WB 1ETZB 5ELIA 4QWWD 3T3ME 2EDLA 1JI1A 3I6GA 5CJBA 3BYTA 1GHFL 1OM3H 3O3AB 4LARH 3MJ9L 5KS9B 3IJHA 1JE6A 3DO3A 1IBGL 5FYKL 4NUJB 2D7PA 5GGRA 3IDIA 2P8LB 5D2LF 1JN6A 2BMKA 3C5SB 5JZ7D 2X4SA 5FA3B 4Y2DC 3IGAA 3U0WL 4HKXB 3MLPA 1LO4H 2HN7A 5CZXD 4NZTH 1NBVL 2WBWB 4S1QH 4HG4K 1CU4L 1RZJC 1YUHB 5EOTB 3T8XA 3ZL4L 4FQPA 4EUPH 1KT2B 5DJXB 1HHHB 3G04A 4QT5A 2EH7L 5EORL 3U0PA 3B8SA 5CJXC 3FQNB 4LQ1A 2P24B 1ZHNB 4K94H 5IJVA 1A6UH 3P30L 1NANI 3TPUA 1J88A 3LV3B 1ZOXA 4JM2C 5JA9A 3W39B 4W68A 3H7BB 2FB4L 1Y6KR 2NY0D 3FHAA 1T7XA 4Y2DB 5I1CL 2Y36H 4V1DE 1FZJB 4XP6L 1NDGB 2ARJQ 1G7LA 1UM4H 2P47B 1EAPB 3TNNB 2MFNA 3RTQC 2Z31C 4QRPD 2F53A 1FGNH 4OGXL 3QUZC 4KZDL 4H1LA 4LCCB 2R1XA 4JR9H 4P2RB 2W59A 3CZJA 2R2EA 1MIMH 4ZDHB 5FKPA 3T08A 3SDYL 1CT8A 3K80A 4XCNA 3AFLA 4AMKL 4LPVA 1IRAY 5A3IC 1QSZA 1DLFL 2HG5A 1MFAL 2Z92B 5KVFL 4CU6A 4AENB 5HHMD 1JZ7A 5MERA 5L8KB 1OD7A 3SDCD 4Y8DC 3RTQB 2VLJB 2Z31B 4GKZB 3DRTB 3MNVB 5LAXA 4QYOB 4X8JA 2FJHA 5TE4L 2ZZUT 5DS8A 4XVJH 4LU5H 2OI9C 4HHAA 1MFEL 3TN0D 1T1ZB 4U1NB 4XH2B 4N1EA 1F90H 1LO4L 4NZTL 3V6OC 3GKZA 1GH7A 2CKNA 4LGSB 4QOKE 1A7PH 3P0YH 4EI6A 5HYSA 35C8L 1V7MH 2RR3A 1ITBB 1FFRA 1P4BL 3X14B 4J12A 3U7YL 3M8OH 4K94L 3QQNA 3DMMA 1A6UL 1XGTA 1T1WB 1JTOA 4JDVA 3WHXB 4RNRB 2OI9B 2G75A 3Q6GL 3BH9A 4XBGA 5DQ9A 4MQXD 4OKVA 4NNYA 4HJ0D 3KPRA 4QXWA 1UM4L 1EGJH 3NZHH 3M1BA 3MODH 1IFHL 4MJID 2A9NH 3A67H 2ZG3A 5EC1B 5K59E 3V5KA 2VE6B 1FGNL 4WY7H 3DTXA 1MF2H 1YNKH 1AXSA 3S35H 4JR9L 43C9A 1XF3B 3ARGA 5EH1A 4CVXA 5DO2C 1X6LA 3A0OA 4UIMA 2C1OA 2VXUH 5SWSE 3CC5A 4X5WB 4FQ2H 4X4XA 1ZLSL 4HIXH 2Y1VA 4GAFB 4OCNC 3BKCH 3B83A 2YSSB 1BFVL 4M61A 3SOBH 3DJ9A 2Q8AH 2VN7A 2BNQE 1A3LL 1N0LA 3S96A 5GGTH 1BD2E 2G5BA 4G9FB 4L9DA 4L8SA 4LU5L 1CD9B 3MLTA 3FB6B 5J6HB 3NACL 4NFDA 4XWOD 1HYSD 4XPBL 2H26B 5C3TA 4PJDA 3O6LH 1Q9OA 2XQBH 3P0VH 1A7BA 2IPUK 2JF1A 4GRWE 5IQ9A 2V2XA 4M7JH 4P3DB 3T77B 1JHKH 1MI5A 5DFWH 5DJZB 4ZPVB 3GSXA 3KPQA 3P0YL 4L9LC 1CDBA 3JV5A 5D7JA 2DQCH 4JFXA 3FB8B 3GB7B 1CGXA 5EOCH 2OCFD 2DQIH 5JOPE 4QRSA 5DYOB 3ARXA 3T04D 1WFOA 4P2CG 3F5WA 2A74B 5T1LA 4S0SD 5JLZA 1JHLH 2BVOB 3DIFA 4PJXB 1T83C 2Q76B 4LPTA 3RI5K 1YN7B 5IR1A 5F7NC 3CLEH 4HLZH 4K3DL 3VWJB 2A6IB 4JRXE 3SDAD 1EGJL 1YZZA 3NZHL 1RZKH 3MODL 4PTUA 3GSUA 2IFFH 4MJ6B 3PWNB 2ZUTA 3A67L 3PWJB 4CBPA 1Q9LA 4OUUB 4TUOA 1FGVL 4MNQB 1OP9A 3L3HA 1QR4A 1MF2L 3OKYA 3S35L 3DUUA 3DLQR 5E6IC 3SDXF 4JFOA 3QHTC 1U91B 1T0MA 1U3JA 4NGHL 4YDVA 4C54A 3L9RB 1RAMA 3STLA 5EU4B 2X9WA 2CR6A 4F7CA 3MOBL 3GMQA 4FQ2L 2HFTA 4UU9A 1AP2A 3G6JB 4HIXL 5DMGD 4V1DD 3BKCL 4PS4H 3J7HA 4JKMA 3MLSL 4M62H 4PJIA 5GGRY 3SOBL 1YEDA 5JTWA 5E2TL 3W0WE 1HKFA 2Q8AL 5T3ZE 5E8PA 1EPFA 3MV7E 2FLRT 3NCYS 3T4YB 5GGTL 1WTGT 3T2NH 3OSKA 1RSFA 5JHDE 4PTTB 2P5WE 5E6IB 1LE5B 1B0GA 1X4ZA 2XQBL 1EEUA 1JNHB 4Y4FA 1OP5K 1AR2A 3F7YB 5ITFB 1JUFA 4F33A 4XC3H 4XAWH 4LVHC 3WSQH 3DSFH 3MJ7A 1GPOH 1WFTA 1PZ5B 5GRWA 5IG7B 2HJKB 1JPGA 2HFGH 4GQ9H 2H6PB 3TO2B 3NCEB 2R1YA 3DX9A 3H3KA 1YDPA 1GGTA 2JB5H 5E94A 4LVOC 2UZXB 5SWZE 3QNYB 1RZKL 4QOKD 2YPLA 2VDQH 2HYMA 4OZIA 4M1DH 1J86A 1EUUA 1A1MA 4LVHB 5LBSL 3I6KB 3DUSA 7FABH 2XN9A 3VMPA 5EN2B 3I3BA 2QL1A 5B39B 1BZ7B 4J8RB 4NJAH 1DN0B 4Y16A 3WO3B 3P9LB 5IGXH 2HWZH 4LVOB 2DQDL 1IGFH 4NOFA 3LN4A 1AO7E 2YD3A 2DKUA 4APQC 4QHUB 3KLDA 4PD4J 5DLML 3U6RA 2QBWA 4DGVH 4W4OC 4HIEA 3CFDB 4NNXB 4G8EB 5DD0L 5ESQA 5F9JA 4OZGE 2H2PD 3W2DH 2ATPB 3X12B 3ZDZE 1I9RH 2P8PB 4BH8B 2HTLD 4NQUA 1HKLH 3O2WH 5SWSD 1RI8A 5K93A 3ZYJA 3WSQL 5HGBA 3DSFL 1DEEB 4YGVA 3K1DA 3LS4H 3VD5A 4APQB 3LEVH 4LLDA 3MLZL 2BNQD 3WD5L 5JW3L 3VFUA 2ADJA 3WUWB 3GKWH 4HCRA 3ISWA 1U8LB 1BD2D 3C5ZC 3CSBA 4GLRH 3B5HA 4U1GC 5KW9H 4BK5A 5LG1A 3C08H 3QP3A 3GSNH 5HI4D 5D5MF 5KN5A 1QP1A 5DUBB 3WN5C 4PJHA 4L4VA 5I19H 1TZGL 3BEWA 5DMIH 5HHOA 4UQ3A 3UTTB 4U1HA 5C07B 2VDQL 3RJDA 3VFTB 1N5YH 3W82A 3TJHC 2AERT 2DB8A 2BHZA 1IGYA 5JOPD 3HMWL 2ADGB 4WHTB 7FABL 5E6ZA 1RK0B 3VXMA 4U0RC 2AJ3B 2X4PA 2ZKHL 1OWRM 3C5ZB 3UBXG 1DSFH 5H2BB 5JXED 1X9QA 5DI8A 3NIFF 5JIKA 4QXTB 3WS3A 5IGXL 3HG1B 4H8WC 4XNMA 1J8HA 3TVMC 3HE6C 4TQEH 3N1MC 4WHYH 5BV7B 1AD9A 1TJGH 1U8QB 4HC1H 2QKIB 3HZKB 4MDIA 2J5LC 3MUZ1 2HP4A 4HK0A 4UB0H 4XBPB 2PTUA 2EDKA 4YC2B 4NC2B 4LLWB 5HYJE 2J8OA 4KGJA 4L1HA 5DJCB 4HGMA 3VXUA 5FUZH 4NQEB 3W2DL 4YO0B 1OAQH 1GZPB 3K2UL 5JHLL 2AK4E 3EFFB 5AG9A 4PG9B 4Y5VB 5TDOA 1X5IA 1KCSH 1U95A 3HNTL 3EO0A 2UZYB 1F4XH 3S8WA 2J5LB 3Q0HA 3W0WD 5T3ZD 1ZSDA 3GKWL 4BZYA 1EEQA 3IDXH 3MUJA 4IRSC 5KW9L 4EIZC 5JHDD 5FGCE 1IC7H 2OZ4H 5C0GA 3TO4D 1S78D 3GSNL 4OV5A 1T7VA 3RIFK 1MHEB 5HHXH 3FRPG 1WBZB 3X3GH 2EO1A 3M17B 1PD6A 4JQIH 4HDIA 3MRIB 2X6MA 2GITB 2CH8A 4G80A 3PQYA 2R56H 1HXYA 1OTUC 1QSVA 3MBED 4JGMA 2HJLB 1SVCP 3TZVD 4WTZA 3MNWB 2EC9T 3DX8B 3KWWA 1WZMA 4UQ2A 3UDWC 5ALCH 5LGKA 2X9XA 4IRSB 4MD0B 4RX4D 1ZLUH 1JF1A 3VGGA 5L2JB 5IB1B 4LLUA 4OLUH 3Q1SH 4O58H 1NGYA 4Y0GA 5TE6H 3MMEB 3S4SG 3QG6A 1TJGL 4ISVA 4HC1L 3RWCB 1TQCC 5SWZD 4RGOH 1Z5LA 2LTQB 2VDNH 1L9NA 2XWJA 1GZQB 3MYJA 2ICCA 5DURD 5T3ZL 1JWUA 4L1DA 1I4FB 3QXTA 4RWYL 4HEPG 4I3SL 4N8VG 4MD4A 4TUJA 2APVA 4O2FB 1NBZB 1FNEB 4H5SA 1ES0B 2V17H 4PGZA 4YAQB 5FA4B 4JFDE 4OCSH 5TFSH 4DGYH 3MFFA 5KG9B 3E6HB 1DANU 1HH9B 5HHQB 1W8OA 2KUTA 3AB0C 1TQCB 5IBLC 4LIQH 1AO7D 1LK3L 2GK0B 1K6QH 1SBBA 1NC2B 1G7JA 2A0LD 1JZ2A 3UZQA 4F15C 1VA9A 1UXSB 5FGBC 1MLBB 3BN3B 4LKCA 1AIFB 3AXLA 4EXKA 4YR6B 2E3VA 2OZ4L 1UVQA 2QLVB 2NY2B 1MUJB 4V2CB 1OARH 1WCBB 3OKEA 5HHXL 3T3PE 2CK0H 3X3GL 3PWLA 3BD5A 4YXHL 3D39A 1VDGA 1MCLA 3PWVB 3JTCA 1MPAH 5I1LB 5E1AB 5GZNC 1QSED 1J0ZA 1CLOH 5E2UH 3PV7A 3U9UA 2QQNH 3AB0B 3U0TA 1ZGLB 1O7VA 5I8EA 4YFEA 3WFHB 1MCJA 4WEBL 1M05B 5ALCL 4FFVD 3IFPB 1BM3H 1INQB 2YWYA 2X4OB 3KPSE 4O58L 1ZA3A 1GIGH 3VH8B 5TE6L 1O0VA 3P2TA 4H20L 1WSST 3D69B 4G6MH 1WAAA 4RGOL 2YUWA 3BQUD 4U6YB 2DQGL 1I85C 2CIKA 2VDNL 3ARFC 5DJDB 1P6AB 1P4IH 3OKMB 5ENWB 1QQDB 4KQ4L 3C09C 3MV8E 4OKDA 1RJLA 4XNUH 3Q3GB 5FK9A 1SBSH 2FX9H 5SV4A 3OZ9H 4LCWD 4PJIF 3F8UB 5ESAA 1FIGH 5KSUB 2D31A 3SY0B 3IKKA 1MAMH 5TFSL 4DGYL 4FQIL 4BFIB 1FFPB 1FO0B 1TZHA 3L3GB 5CEXB 4TVPE 2Y7QB 4YFLF 4K23H 1OSZB 2DLTA 3KPOB 1MJUH 3SE9H 3FONB 1AJ7H 1MVUA 2ZSVA 3MGTB 5T1KB 2R2BB 3C09B 1TZIA 5HYJD 4KI5E 4ONFH 2PO6B 3KJ4B 2OM5A 1NJ9B 3RZCC 1OARL 2R4RH 5TDPB 4DJMA 4LPCA 3ZDYE 2DF3A 3QZWB 1QUNA 4YHKH 1MPAL 2YK1H 2AK4D 1KJMB 1EZVX 5GHWL 4JPIA 4UOJA 1S7WB 2APXA 3MC0A 4NO3B 1CLOL 4ZO9A 5E2UL 1K3ZA 5IK3B 4LVNC 1LEGA 1IAII 3LH2H 3OB0K 3QXDB 3LN5B 3WFCH 2O5YH 1BM3L 1KPRA 1RY7B 1H5BA 4PD4K 5JA8B 4PB0L 4XHQA 3INUH 1VEPA 1W8NA 5I16B 3BRFA 2D7QA 4GS7B 3JV6A 2CDFA 2EDFA 3PP3K 3QFJB 4NC1C 4XPTH 4HAGA 2G5RA 1MWAA 4LRIC 3RUGA 4BZ2H 4ZO7A 1X7QA 4L8BA 4F3FB 1P4IL 4QRUB 4LVNB 5INDB 2R2CA 1T7WA 3ARDC 4XNUL 1SBSL 2FX9L 4ZPTA 1CN4A 3OZ9L 4PJCE 1A3RH 4JHAH 3S36X 1VEMA 4U1KA 3T0VA 1FVEB 1MAML 2EKSA 2GUOA 4Y19B 5E5UB 3ULSB 2FRGP 4HFWA 5LQBL 5IEKB 2L0DA 1WJ3A 4DN3H 4G7YL 4XRCA 3I85A 2X10A 1A7NH 3WFZA 3DVNA 5KAQF 3HMXH 3CIQA 3FCTA 4WUUB 4K23L 5C0DA 2HH0H 3QUXA 1MJUL 1I8IA 4XNQA 4ONFL 4QHLA 4WU5A 1JZ4A 5D1XD 2EZ0D 3ARDB 4QHMB 2W65A 3TNMA 1HOCB 1XGYH 2R4RL 2X1XR 4KJYB 1K4DB 4J1UB 4P2OC 4YHKL 4LSTL 3CVHA 3QI9D 1HHJB 4V2BA 2OMNA 2DBLH 2YK1L 2VDPL 4XWGH 4U1JA 2NXZD 1W72A 3BWUC 3ULVC 2BC4A 5C0FA 5HHNB 2UUDK 1J7VR 4Q9QH 5AYUL 2O5YL 3QQ4B 5DEFA 5AZ2L 1MNUL 2JJVA 3INUL 3P4MA 4NKQB 4MXQA 4NQSB 2X44D 3KPNA 5IHLB 2CD0A 4M3JA 5IFHL 4XPTL 1NAMH 5KJRL 3PNWB 3U82B 3S9DB 4BZ2L 4DOHB 5HPMB 4GG6A 1D5MB 2VAJA 3GMMA 3GJFA 1X3DA 1CQKA 4PJAE 4PJBB 4Z7VB 3LRSA 4ZUWB 1DN2A 1ED3A 4OLVH 5TE7H 3PGCB 3MRGA 1NCAL 5D70H 2Y06L 1ZEAH 2FLBT 3AGVA 1A3RL 2L4OA 4JHAL 1N2RB 5GIRA 2NY1B 5I1HH 4EXPX 4Q2ZB 3GNMH 3KYMA 3KPSD 4XC1L 1BHGA 4DN3L 2F8OA 5GGSY 1ZKAA 3VRJB 3ILQC 1H3PH 1A9BB 1A7NL 4X7TB 4TVPH 2G2RA 3HMXL 1KLUB 4GMTL 1YMHA 3T0EA 2XRAH 1HQRA 3H3BC 2X4NA 4G43B 5HHPA 2NX5B 1XGPA 1OHQA 2W9EH 3MV8D 4DCQA 4GRLA 3BGMA 5AEAA 4HWZB 1XGYL 1G7QB 3WNMA 4D94A 2EIBA 3KPLA 5GGQH 3LQAH 2OTUB 4C56E 1F2QA 3MLVL 2DBLL 5EO0A 4EI5B 4AYFA 1KN2L 5E70A 3SKOB 1VPOL 4TVPD 5DFVD 2WK2A 12E8L 3TM6A 4PJGF 1D6VH 3TYFA 2DLIA 1Y6MR 3SBWC 2FIKA 2VXTL 2H3NA 4GXUN 1PG7W 1KULA 4P4KD 1D5BB 5F88A 3JTSA 1CLCA 1T4KA 3H2WA 2R0WH 1NAML 1FZMB 4ZTPH 3FTGB 1LNUA 5LXGL 2AJZB 3SCMC 3QHZH 4OLVL 2BNRD 1SMAA 4LCYA 5FKAB 4KK6D 1ZEAL 5D1ZD 3CDGA 1MI5E 5I1HL 3D0LB 3CK0H 1IE5A 4AQ1B 4YEFA 1D6EA 4IRJA 2D3VA 1DBJL 4ZTOH 3OKLA 1UB5A 3BSZH 3O2VL 1N5AA 1H3PL 4TVPL 1PY4A 1Z3GH 3MUGA 3FQTB 1EUTA 1HDMB 5E8NA 5TH2B 5D7IB 2WBJD 2IMNA 1BGXL 3SCMB 4XBEH 1F45A 3VXRA 1LO3L 4WW2B 2C3WA 2W9EL 1S9WA 4KJPD 3O9WA 2IAMD 4KK9C 4HKJA 1SEBA 1OGTA 1ZHBA 2IEPA 3TV3H 5IB5A 5GGQL 5EBLA 4TSBL 4BK4A 4XCYB 1DBAH 1F5WA 3RP1A 5A2KH 1ROWA 1ZT7B 1BBJB 3KXFA 4Q7DA 3R0MA 5J1AA 1SQ2N 3OGCA 3JWDH 1OPGH 4JG1L 1CG9B 5JIPA 4XI5D 3BP6A 2DWDA 3C60D 4HIIB 4X9FA 5E9DA 3FJTA 2VIRA 3IDMA 4AH2B 4X9HA 1JPFA 4PJ9A 3BAEH 4S2SA 3O41A 2F19L 3PG2A 3BIAX 2APTA 2COQA 4XX1E 2HT3C 1TVHA 3EFDL 1BF2A 2P5ED 4EQ2A 1KB5B 4ZTPL 2BSRA 2NY7H 1S9XA 3T65B 3QIBB 4X6DB 5EZIH 1M7IB 2FEDD 3EJYC 2DIAA 3QHZL 4OZ4A 4OIAA 2R8SL 3LD8C 2VKXA 1DBMH 5EZLA 3FO2B 3C2SA 3D3VA 1K2DB 2JK5B 3IAGC 5GPRA 4MJ5B 3HPJA 3PWUA 4PP1C 4NRZA 2YZ8A 5I73B 1L7IL 5B38G 4X6BB 2XPGB 1JCKA 3RPKA 4JFQB 4YX2L 2F54B 4JQVC 4IMLA 1K8IB 4TUKH 1Z3GL 2E7BA 3C5JA 2H9GA 2X1PA 4JDZA 3QUMA 2Y07H 3MGOA 2VQUA 3LD8B 4RRPA 1U6AL 2V7HA 4E0RB 3MRHB 5BRZB 4MMXC 1U8MA 4NRYB 4N0CD 3TV3L 1LQSR 1FFOB 2GQHA 2JB6A 3PDOA 5JUEH 2VLLB 1DBAL 2K7QA 4GAJH 2YPLE 4EKXA 1NCCH 3K8KA 1RFDL 1TVBA 3X3FL 4OZIE 3F7VA 2XG5A 1I8MB 1OPGL 3IJSB 3Q5YA 4K9EC 2DLHA 3K4ZA 5D96C 5ACMA 3FO1A 4G9DA 4KXZI 4QCIA 2YMXL 3VD4A 3OX8B 3MRQB 5F7UA 3LKNB 3MZGB 4EOWL 3F65A 4JG0H 5T5NF 5CIPA 2RQ8A 3R06B 5GRVK 3DVGB 1C08B 5C6TH 1MCFA 3CJJA 4C56D 2X4UB 1DLHA 1FVCA 1KIRA 4NKDA 5EZIL 4H25A 4PUBH 3RX7A 1KEGH 2FL5B 5EU3B 1F8TL 5DWUH 1MCQA 1TCRA 1F3JB 2B5IC 3OAZH 2XY1A 5HI5C 4JFEB 4KKBD 3ALXA 5B21A 4OCWH 3RWFA 2D7NA 3IJYB 1KC5H 5DTFB 3ZHLA 3WXVH 1JPSL 4XMLH 5GRJL 2HFFA 5IVXF 3GIZH 1G7IA 5ISZD 3UJIH 1VKXB 1C5DA 1HILB 5F6HJ 5KSBB 4Z77A 3FQWB 2W0FB 1I8LA 4JVPA 4XCEB 3C6LB 5EU6D 3CSYA 3WUZA 1U3HA 3U7AA 2VLRD 3Q5TA 5C0CB 2VLKB 4PJHE 4L4VE 1WZ1H 4HT1L 1MCEA 3BWAB 5JUEL 3CAFA 4S1DC 4JQXC 1I3RB 5F7DB 5D7JD 1NCCL 5CJOH 4JGUA 5DC0A 2AEQL 4FXLA 5IJKA 3VXME 5T1DH 1ZVYA 3S35X 4X5XB 3TBWA 3BGAA 3KYOB 4JAMA 3WEXA 1CGWA 2V5MA 1T5XA 1FN4B 1QFPA 1UJ3C 4ZAKC 1J8HE 2DJUA 2ZSWB 5MEOB 4QTIL 3MUY1 5E24E 2IJ0C 2IANB 1C8PA 5KANI 1FCCA 1NLDH 4F7PB 5TGBB 1FNLA 3WIHH 2FD6H 3HAEA 1I1CA 4PUBL 1RQ5A 5F9AC 1KEGL 2DJ4A 5IW1A 3QJFA 3L3JB 4OZGF 4WWKB 1IAIL 1NFDF 2DQTH 5DWUL 3ARBD 3ZDZF 4G8GE 4U6VH 3G5VA 3Q48A 1JF6A 1IEAB 4MCYA 1YNTB 4GG6F 3AY4C 3VFPB 1UJ3B 4P9ML 4ZAKB 3KHQA 4YPGB 32C2B 3EOAB 2CRZA 3P73B 3WXVL 2FX7H 1BOYA 2A77H 4XMLL 3OWEA 3GIZL 5EUOA 3DHMA 4FQJL 5CUSL 3UJIL 4D0CB 1IM9A 4Z7UB 1Q1JH 4HMDA 2FDBP 4DFIA 1AGFA 4G6FD 2CKBA 4U1MA 1QLEL 2WINB 3QIWB 3EO9H 1CGTA 1GAFL 1YN6B 4M1GL 5L88L 3AAZB 1FVDB 4HD9A 3P77B 3N50A 2VERN 3CPLB 3NFNA 4L3CB 5I1DA 1SYVA 5KTEL 1CLYH 1JPTH 3BXNB 4Y4HD 2RBLA 3L5IA 1KNOA 4XNXH 1JV5A 5T1DL 4KK5D 1I3VA 1VESA 2AQ1A 3BD4A 2WWMD 3GBNH 2OL3A 4R9HA 2DI8A 3GSQB 3SKMA 5DHVB 1ETZA 1H8OA 1KELL 2E8YA 5AG8A 3KLHD 1EV2E 1CTNA 2JE8A 5DSCB 5J7CC 3UBXB 3WIHL 4LPWA 1FC2D 2YPLD 3O3AA 5GZOD 5KS9A 1A47A 3VW3H 2DQTL 4NUJA 4ZFOL 2P8LA 1MJJB 5D2LB 4U6VL 3C5SA 5FA3A 3QIUD 4HKZB 4HKXA 1Y6NR 2DQJH 3WIFB 4MAUL 3S6CA 4K7PL 4MJ4A 2BSSB 2XZAL 2C1PB 5EOTA 1YUHA 2XACC 1F97A 2M26A 5SWQB 1KT2A 5DJXA 4JDTL 1A1OB 1HHHA 2FX7L 1Q94B 4N9GB 2RB8A 3EYFB 5H37H 3FQNA 1FCGA 2P24A 4LSVL 1ZHNA 1H8NA 2B1AH 3CXDL 3TC9A 5DC4B 5D2NC 2DM7A 1VGEH 3ZKMD 3LV3A 1AGBB 1N0XL 3AUVA 3W39A 3FZUC 3EO9L 1IAMA 5GS0D 2MMXA 2BY2A 3ECBB 4Y2DA 4N0UB 1FZJA 4JFFB 2BK8A 2DTMH 2XZQH 5I1IL 2WW8A 1NDGA 4KH2A 3HZVB 1EAPA 3PXJA 3TNNA 1HXMB 5GGUB 4JM4H 2HKHH 1CLYL 2NY5L 1CBVH 2VR5A 5CJXA 4NCC2 3V0WL 4XNXL 4M7KH 1YEEH 2OXGA 4LCCA 3SJVB 2WLZA 1KTKE 4P2RA 5D2NB 1S9KC 4ZDHA 5EU7C 4Y5XB 4HV8B 3SQBA 4S0UC 2ZUYA 5EZJB 1CICC 5ICZB 4WJ5B 3WNLA 4L4VD 2Z92A 4E42B 3G5ZB 3UZEA 1WAAE 1ZANH 1L8JA 4AENA 4Z8FH 1QFWH 4POYA 1CXKA 1CXLA 1MSPA 4I77L 3VFNB 3RTQA 5F44A 2OYPA 2VLJA 3QBTB 2Z31A 4MAYC 4GKZA 3DRTA 3MNVA 4QYOA 4TTDC 5MP6H 3D85D 3L3IB 1ZWIA 3QUZA 2IQ9H 3VXMD 4U2ZA 1WWWX 1T1ZA 4IOSD 4U1NA 4XH2A 5GS0L 3V95A 5JQ6L 3MRKB 2AEPH 1U36A 5D7LB 1CICB 5K9KB 2GK2A 1J8HD 1Z9LA 3SE3C 1A64A 1X5XA 3NBNA 2E7CA 3X14A 4LSPH 2DTSA 3NGBB 5IB4B 2FCBA 4NBYB 3NZ8B 4MAYB 3U79A 3TESA 1T1WA 2H1PL 4RGMC 4MGXA 3ARED 5E1HB 4M6ML 1VGEL 4HCRL 3F6LA 3WHXA 3T3PF 4RNRA 2OI9A 4G8GD 3GRWA 4ZNCD 5F1NB 1G7MB 3DNKA 3V6OA 2DTML 4CNIB 4L3EE 2FNBA 2BNUB 4YXKL 1SJXA 1U8NB 4NZUL 3VD9A 1UWGH 3MXVH 5KVMC 5EC1A 1NMBH 2VE6A 2VITB 3KYNB 1E4XI 2XFXB 4M7KL 2X41A 1XF3A 4OI9A 1MHPH 2NY3B 1NEZB 3HUJE 5CSZB 2GJ6E 3O2DH 1KCKA 2XKSA 3KR3L 3NCFB 1J0KA 4X5WA 2JIXB 1MCPH 1RUKH 1ZANL 1DQQB 3AS1A 5KSAC 1RULH 5B8CC 3RUGE 1J0HA 2XV6B 2YSSA 5IKCB 2R29H 2GY5A 3FMGL 5IW3A 5L2KB 1XGQB 2EDYA 4KXZH 5ID1B 1K5NB 1RPQA 2F9BT 4G9FA 4GXVL 2NW2B 3FB6A 5J6HA 1INDH 5EOQH 4ESKA 2H26A 5L9DH 2OQJA 4CJ0A 3FO9B 2EDXA 2AEPL 4R90L 3BKJH 4P3DA 5DJZA 2GCYB 1RIVH 4ODVH 4ZPVA 1UH3A 4WI3A 5I9QB 5ACLA 5BV7H 3ARSA 3V0VB 5M94B 4I0CC 3FB8A 5KSAB 5B8CB 4Q9RL 2LU3A 3FFCA 2B2XL 2V5RA 2I24N 4NQCB 3PWPE 3CU7A 4S10A 5DYOA 1GC1C 3OKKB 2Z93B 4Y5YB 1KUMA 2PTTB 2A74A 5F9WB 2BVOA 4OFKA 1G9NC 3TF7C 2Q76A 3CMOH 1ODAA 1YN7A 3VWJA 4YHIB 2A6IA 4R4FH 4UAOB 4ZODA 4U7SA 1FNSH 2PYEB 1PX4A 2EC8A 4I0PC 4MJ6A 3PWNA 3D2UB 1OP5H 3PWJA 4MX7B 3VGAC 3B9KC 4OUUA 5IROA 5IQ7H 1EBAA 4EN3D 3QDGE 4MNQA 1JPST 4RA0C 3L5XL 3SGKA 3K74B 2J12B 1VADB 2BVUA 2DKMA 2XA8H 4OCXH 4MS8A 2VN4A 1U91A 4FQXC 4X6FB 3L9RA 5EU4A 3HCVB 4LSDA 3HNVH 1T83A 1FBIL 4KRPD 1A4JB 3G6JA 3I3EA 3E3QE 1RULL 4NDMB 5AWNL 1CFNB 4PB9H 3RGHA 2N4IA 3EDDA 4I0PB 4RISH 3T4YA 5CEYB 4PJCF 5CFHA 2EXYC 5FV1L 4U7KA 4MNHB 4PTTA 1BFOB 5E6IA 3ZTJH 1LE5A 1INDL 1X44A 5HD8D 1U42A 1BVLB 1JNHA 3BKJL 1QSFB 1RIVL 3F7YA 1W0VB 4NQXB 3S3PA 5ITFA 5E00B 3KG5A 1FYHB 4ODSH 3RHWF 2AJSL 2YHGA 4OGAC 2NLJB 5JPMB 1PZ5A 5IG7A 2HJKA 1WGOA 4KVNL 3BKML 2H6PA 1FDLH 1RUML 3MQIA 4CADB 4PLKC 4OLWH 1JGEB 3CMOL 3N1GC 3MRBB 1ZT1A 1R3KB 1BJ8A 3I9GL 4HLJA 4LAJH 3LIZH 2ARWA 4HSQA 5IQ7L 4OQTA 3VDBA 5IFAH 4L8CB 5HVFB 3I6KA 2JJUA 2D7MA 1OF2B 2XA8L 4OCXL 2WIMA 5EN2A 5IB2B 3QWRA 5B39A 1H3XA 1BZ7A 4HMEA 4J8RA 2B1HL 2C7UA 1DN0A 3HNVL 3P9LA 1FQ9C 1IM3B 2P8MB 1DQML 4PB9L 3JWOC 4L3ED 4IRZL 3SDDB 1KXQE 4QHUA 4HJJL 1FHGA 4RISL 4TPRH 2A6DB 3R0NA 3CFDA 4G8EA 2WBKA 4GAGH 5C0RH 4M7LT 3TJEL 3CX5J 5EO9B 1AD0B 2YD4A 3DGGB 3EYQC 5IHUH 4HXAH 2ATPA 3X12A 1FAIH 1FNFA 2P8PA 4D9LH 5KS9F 2GJ6D 4ZOBA 4XMKH 4BH8A 5HGHB 2FO4B 4ODSL 1OAXL 1G0YR 4LDEB 3TPKA 1DEEA 3L3DB 5DD1H 4APQA 1KTLB 4PY8J 1BVKA 4I2XB 4W4OA 1FDLL 3TT1H 1FIEA 1U8LA 3NCBB 4OM1H 4OCRH 2DM2A 4QRRE 3ABZA 1G84A 3O2DA 5DK0B 5H8DA 1NAKH 4X99B 1QR1B 1J5OH 5D5MB 5DUBA 3H8NA 4PJ7B 1FO0H 2VZSA 3LIZL 1DDHB 4JKKA 5C07A 1RZ8A 3VFTA 3B5GA 4NP4H 1ND0B 2HAZA 1DZBA 4DW2H 2YXFA 2M1KA 2ADGA 4WHTA 3PWPD 1RK0A 1GGIH 4JO3H 2AJ3A 4KK8C 3OAYK 4R96B 3C5ZA 4E41E 1UA6H 3G08B 5HI3D 3VA6A 5H2BA 1FE8H 1YEJH 4QXTA 2A2QT 5HPOA 3O11A 5EULV 3HG1A 4JVUA 4KKLC 4LSUL 2B0SL 2J8UF 1ADQL 1U8QA 2QKIA 3HZKA 2MKWA 3ET9F 4UOW0 1OP3K 3PDDA 1NGWB 5IWLC 3RL2B 4XBPA 3P0GB 4HIHB 3TJHA 4LLWA 3QDGD 4RQQB 1M7DB 4ZFGL 4Y1AE 5C0RL 1J05B 4OLZH 5DJCA 3ZE1F 3BUTA 2UZIL 2D4FA 4NQEA 5CLWA 3GSWB 4PGJA 4YO0A 2M2DA 3DMMC 4D9LL 5MENB 5FUCE 1GZPA 3F58L 3PL6D 1GGBH 2LAGB 4LKXB 3WFDH 1BQLH 3EFFA 3TBTB 3G5XB 4Y5VA 3CVIL 4UILH 1YYLH 3PGDB 3OTTA 1J0IA 5DD1L 3BVNB 2R1WB 1UZ6E 4FQCH 4XPHL 2EC9U 1Q72L 4HK3N 3VFSB 4OCRL 1DTUA 1ZT4B 3FAWA 3W11C 1NAKL 3I2CH 4Q6IC 1QACA 1WBZA 2QADC 2Z8SA 3M17A 2VH5H 3OHXB 4J3VA 2GITA 1WV7T 4NP4L 2HJLA 3KPMB 4DW2L 3MNWA 1JWMB 3UJJH 1UH4A 3DX8A 4P5KB 3RWIB 2E5EA 1GGIL 4AQOA 3T1WA 4Q9CA 3UTSB 4JO3L 1JFQH 4IRSA 4J7RA 1UA6L 4MD0A 1MCDA 5L2JA 5IB1A 1J8KA 3MRNB 2VRAA 1FE8L 1EO5A 1YEJL 3N9GL 1X5KA 3MMEA 3TLRA 2V6HA 4L8SC 3MLYH 4Q6IB 1KCVH 5CBEB 3L3OB 4AL8H 3JTTB 3RWCA 2GSGB 3QPQD 4M8QB 2AGJL 2DLFH 1JMZA 1GZQA 4FXGB 3DXAE 2KQNA 4YBQD 3TBVB 1I4FA 1KLGB 4OLZL 4YUEH 4F2MB 4F37F 2E8ZA 4O2FA 2I26N 3K4AA 1PFCA 3MRLB 1NBZA 5D1QB 1FNEA 3UDWA 4Q0XL 1ES0A 2ICEB 1PJ9A 4YAQA 5FA4A 4PRIB 1G0XA 1PEWA 1AFVH 3WFDL 2Y4SA 4HKBB 4UILL 5KG9A 3E6HA 5JZ7C 1E4KC 5HHQA 3BZEB 1YECH 1BQHG 1UM5L 4ODHL 5CZXC 2GK0A 2OMBA 5DA0B 4LHUD 1UWXK 4HGKC 1NC2A 1QKZH 2O5ZL 1UXSA 1MLBA 3WKMH 4XCFL 1AIFA 4GXUM 4YR6A 2Q8BH 4PIRF 1DE4B 4M93B 5JOEA 2O61B 3I2CL 1UWEH 2VC2L 2H32B 1HE7A 2MQ0A 2VH5L 4I3RH 3PWVA 1QBLH 5E08H 4U05A 5I1LA 5E1AA 2NY0C 4CDHA 1PYWB 5GS1B 4OTXH 4PJXF 1T7YA 3UJJL 4OGZA 4ONOA 4PRNB 5EDXA 1ZGLA 2BOCA 2N7BA 5E2JA 3WFHA 2OXHA 4G3YH 1M05A 5FGBA 3HZYB 3IFPA 3LKQA 1INQA 5DVLA 1QLFB 2X4OA 2YR3A 3F62A 4QRRD 3BZFB 2DQHH 3VH8A 4NQDE 4MCZB 4ZS6D 3WDIA 1F00I 5F96H 1XIWD 2AABH 2OJEB 3S5LG 5K33A 3ULUE 2F74B 1WZKA 3DURB 3D69A 4GSDH 4ZYKB 4FZEL 1I9IH 4LCUB 4OZFG 4U6YA 4Y4FC 5DJDA 2DLFL 4AEHL 4Y7MA 2NY0B 3WXWH 5HYQB 2JELH 3OKMA 5ENWA 1QQDA 4L29B 4UI2A 4PRPE 3G6JF 4WTWA 5DD3H 5BW7A 3Q3GA 4EUPB 2YD6A 1Q38A 3NN8A 3VRLE 2DQUH 1A21A 5KSUA 4C55A 1HSAB 3SY0A 4QRPB 3WNPA 4E41D 1CK0H 4WW1B 3OB0H 3IU4L 1AFVL 4YFDB 4BFIA 1FFPA 1FO0A 2PXYD 3L3GA 1EHXA 5CEXA 5EUOE 1P5UA 2Y7QA 1YECL 2KZWA 2GI7A 4IHOB 2NCMA 4I1NB 5CGTA 5IBUG 2AVGA 1I85A 1B6DA 1OSZA 1QKZL 2R0ZH 3KPOA 3PP3H 4JFPB 5HSFA 2JCCB 3FONA 2AJYL 3MGTA 1UEYA 5T1KA 1MFCH 5C0ND 2R2BA 4Y1AD 2PO6A 5HHMB 1NJ9A 4WFEE 2VWEC 5TDPA 1UWEL 3SDCB 3QZWA 4L4TE 4CN4A 1EMTH 4YEEA 5E08L 4OF5A 4KUCD 1KJMA 3TCXA 1FJ1B 3ALWA 3TN0B 1S7WA 3M07A 4NO3A 2BZDA 4OTXL 5IK3A 2A9ML 3PHQB 1QHPA 4Y16C 1VHPA 3DROB 4G3YL 3QXDA 1II4E 3LN5A 3WIIH 1MFBH 3J8F7 4GRMB 1S5IH 4TRPL 5T5FH 4JKWA 4I4WB 5F96L 2AABL 5DUPL 3QFJA 3CX5K 15C8L 2VXSH 4QF1B 2FGZA 4QRUA 4R26H 3WXWL 4F3FA 4HBCL 2P1YA 4TN9A 4X7SL 5INDA 5GJTH 4M5ZH 2YBRA 3W5MA 1I7RB 3E2HC 4MJIB 2UUDH 5D71H 4J2XA 3RWDB 5A2LH 1FVEA 4Y19A 3ULSA 3IS0X 4YHPB 5IEKA 2J8HA 5FHAL 4C4KT 4LPUA 4BQCA 2XY2A 1T3FB 4WUUA 4LRIA 2GIYA 4M9OA 4WFGE 2DM4A 2QQQA 3QUML 3DXAD 1MFCL 4DKFH 4BQBA 3ARDA 4QHMA 1GOHA 4H1LG 3DO7B 4LNVA 3AU1B 3V5DB 1HOCA 3E2HB 4KJYA 1K4DA 1YQ2A 1H8SA 1EMTL 4J1UA 1L7TL 3GHEH 1HHJA 4LDLB 4MXVE 1G7HB 4YBLC 3L1OH 4B53A 3UCRA 5TQ2H 4KUZH 1YQVH 1IAIM 4OD3L 4CMMB 5CZVH 3EJZD 4ZNEA 4FS0A 1WF5A 1U8IB 2ZCKH 3IETB 4HBQA 3QQ4A 1MFBL 3R4DA 4K71C 4ETYA 1FV1B 5T5FL 3RI5F 3MROA 3PXHA 2VDML 5FO7A 4PJFE 4K3HA 1A6WH 2VLJE 4J3OC 1TQBB 2PYFB 3PNWA 3ULUH 2VXSL 4F7TB 5HPMA 5FCSH 1D5MA 4YBLB 1GGYA 4R26L 2X4TB 5HYSG 4PJBA 4Z7VA 3WL9B 4ZUWA 5JW4Q 2E9BA 3PGCA 5GJTL 1IGJB 1MHCA 3FN0L 4HWNA 4OFIA 2WQ8A 3SDAB 2QV2A 3MA7B 1N2RA 4B7LA 5EWIH 1X5GA 1Z9SA 5DVNA 4XVSH 4NQDD 3FFDB 5DJ2B 3MACL 3VRJA 4OUOA 4M00A 3ULUD 4FFZH 1A9BA 4X7TA 4BSVB 1H15B 1KLUA 5T33L 3UXFA 5CKGA 4G43A 2I07B 2EEAA 2IGFL 1JI2A 2NX5A 4DKFL 3FQUB 4YHYC 4NFCA 4PRPD 4V1DB 3LHPH 2VNCA 1F4HA 4JRYB 4LASH 1I1AD 3ZYZA 4HWZA 4HFUH 1G7QA 5DDHB 4V3DB 2OTUA 1OQOA 4NRXB 2R4SL 4D0BB 2I9TB 3L1OL 4YWGH 1FZKB 4EI5A 3SKOA 5CZVL 5L7XH 3PV6B 3MCLL 5L0QC 1WICA 3QR2A 2FR4B 4PJGB 4KV5F 1UCTA 1KEMH 3H9SE 1MJ7L 4YHYB 2E7HA 3B2VL 1H3VA 5JNYB 4AIOA 4NO0A 2WM0A 1D5BA 5I30L 3LAFA 1QO3A 5FFLA 5C9JA 1A6WL 4L4TD 1FZMA 1QPXA 3ULUL 2EDJA 4XPGH 4UTAH 4EJ1C 3U46B 2AJZA 1TJIH 3IXAB 5FKAA 2YD2A 5TJWK 4N0YL 5L0QB 2AK1L 3BRDA 3SBWA 4U6TA 4QOKB 5EWIL 5I1JH 3D0LA 3LN9A 1DQDL 4LDOB 1XGRB 1I8KA 1B6UA 3NIDE 3O6FC 4ODBD 5ITBH 3GZKA 1QG3A 3RVVC 3FFCE 1F58H 4FFZL 3TT3H 2YA1A 1VFAB 2O26U 3EIFA 3FQTA 1HDMA 4MA1C 5TH2A 5D7IA 3BP7B 3SCMA 2WNGA 4WW2A 4XMPL 1KCRL 2UWEE 1NFIB 3EYOB 4LASL 4HPYH 1JJUA 4N90E 3ZO0A 1OTTC 3QJHB 4M43L 5GGSB 3BESR 4XCYA 1ZMYA 1P9MC 1RMFH 1ZT7A 1BBJA 1T0NB 4Z5RB 2VDKL 2VXVH 4XTRC 3O6FB 1NMCC 1CG9A 5L7XL 5HI4C 4HIIA 1HHIB 3GK8H 4ODTL 1BEYH 4MA1B 2P46B 4G6AD 4AH2A 4UIKH 5SWSB 1L4IA 2VDOL 4OFYA 3QQ3B 4M8VA 1F2XK 2BNQB 1KB5A 4HULB 4MVBA 3T65A 3QIBA 4XPGL 1BD2B 4X6DA 3BW9B 2YC1B 5DXWA 1M7IA 4PRHE 1B88A 5JXEC 1TJIL 4JKLA 1I7UB 3FO2A 4K8RH 4AJ0A 1I1RA 1K2DA 2JK5A 4MJ5A 1MLCB 4JM2D 1PSKH 4KROD 1R0AH 3JSSA 1FG2B 4ERSL 3QDMB 3AS0A 1TITA 4X6BA 2XPGA 2RAMA 5ITBL 2VDLH 4JFQA 1KJVB 2F54A 1K8IA 4OI7A 3RTQD 5F6HI 3MLWH 5IVZB 2O93L 2IF7A 4OF3A 3X13B 3GSNB 4U49A 5KVGH 3QXUA 4X9BA 3QUZD 5E5RB 2O5XL 4K8RD 1L6ZA 5EBMB 4E0RA 4HPYL 3MRHA 2Z4QA 5BRZA 1XF4B 4NRYA 5BZWB 2DLEA 5F89B 1FFOA 3H9YA 2VLLA 3UAJD 1BFTA 4M1CC 3ARTA 4YQXL 2R23B 4GUPB 4NQVB 1I8MA 3GSVB 2AEIT 1H5BC 3IJSA 3VWKD 5B3JE 1NCWH 4NZRH 3VMOA 3GK8L 43CAA 3QFDB 4P46C 2Q3ZA 2QEJA 4LLYB 3OX8A 3MRQA 3TZVC 5DJ8B 2ZPKH 1BJ1J 3LKNA 5KZCD 2VZVA 2CJUH 3W0WB 3R06A 3DVGA 1C08A 4NN6C 1J10A 5I2IB 4JN2B 2X4UA 1X4YA 4ODXB 5JHDB 3MBXH 4KDTA 2FL5A 3VFRB 4DZ8B 3KYAA 1YJDH 3TWCL 5EU3A 4PGCB 2PN5A 4K8RL 1A6TA 1F3JA 4WFHE 4JFEA 1PSKL 3ZT5A 1R0AL 3H9SD 3H6JA 1WWBX 4I3GA 3QUXC 5EA0H 2LABA 3TZVB 5J11B 4POUB 4Y4KC 1OL0A 5DTFA 1IC4H 2VDLL 4EDXB 3LOWA 4NKIL 4NN6B 5IVXB 1VKXA 5FHBL 1HILA 5KSBA 4QNPF 3KVQA 2ZOLB 5GRVL 3WLWD 1WK0A 3FQWA 4HS8H 4PJEF 2EIZB 3FB5B 4XCEA 4QXUH 5C0CA 5SWZB 4DN4H 2VLKA 5DO2D 3EZJB 4WV1C 3BWAA 3L7EB 4CN6A 3HZMB 5INCB 4RSVA 5DURB 5F7DA 1XR9B 4PDCE 1DQTA 5DVMA 2QQLH 4JZJB 4LLQB 2X9YA 1OSPH 5E7FA 3FFCD 4NZRL 3LEYH 3RKDC 1QRND 4DKDC 1TJHH 2ENYA 4X5XA 3KYOA 3ZKND 1J1XH 2FHCA 3HRZB 4Z9KB 3KHOA 5DGQA 1FN4A 1U2HA 2A1WH 5EFIB 3VG0H 4OJFH 2ZSWA 1AO7B 1RHHB 5MEOA 2CJUL 4WV1B 4PV9B 2IANA 3HE7C 4JO1L 4JQXA 4F7PA 5TGBA 4NWUL 1NUGA 5CGYC 1SYSB 3BISA 4DQOH 4HLZG 4KVCH 1RZ7H 3L3JA 1YYML 4WWKA 1YJDL 4OZGB 5I17B 2BHUA 1NFDB 3T2PA 4OLXH 5C0BE 1Y0LB 1D5ZA 4PRAB 1IEAA 2W1NA 4TVSa 1YNTA 5BXFB 3VFPA 1QSEB 4K7FB 1IEHA 1FYTE 3T0EC 1UJ3A 4ZAKA 3EW3B 1D9KC 4YPGA 5ADPH 2VR9A 1IC4L 32C2A 3EOAA 3P73A 3P4NB 1ZTXH 3HE7B 4O9HL 1B0RB 1FNHA 3TCLB 4UZGA 2V5SA 4RGNC 4D0CA 4Z7UA 1A1NB 4PRHD 4R7DB 3EBAA 5E6ID 4WTZG 1BIIB 2WINA 1I3GH 3QIWA 4QXUL 2I25N 1YN6A 2HMIC 3AAZA 3BPNC 3BQUB 1KIPB 3P77A 4KHTH 3HI1B 1LDSA 4NZDA 1N6VA 3CPLA 3O4LE 4L3CA 1HINH 3BXNA 4C83B 1OSPL 4JGJA 1YNLH 4LCWB 3LEYL 5E8DL 5K9QG 1J1XL 3SQOL 4UBDD 3GSQA 4P49A 3DPBA 5DHVA 4J4PA 5AZEH 5C09D 3VG0L 4WTXA 4TNVK 3PGFH 4YXLL 2OTPA 5DSCA 5ETUB 1IQWH 3VXPB 5I71C 4N9OB 3UBXA 3TFKD 4X83A 3UX9B 5HYJB 3U7WH 1RZ7L 3WLBB 3QNZB 4I13B 3WS6A 5EZOH 3BJ91 3MJ8B 3JV0A 4IRJC 3RVUC 1KTDB 4OLXL 1MJJA 5GS2D 5D2LA 4QRQB 2QSVA 5DRNB 1FL6B 4HKZA 3EYSL 4HS6B 2AK4B 3WIFA 4FQ1H 2BSSA 1OAYL 2C1PA 2EDNA 4NWTH 1HCFX 3RVWD 5SWQA 5F97E 1NCDH 1A1OA 3IKCA 1Q94A 3OF6D 4N9GA 1ZTXL 3EYFA 3S34H 5I71B 4JN1H 4U6XB 2ESVE 3MV9D 4JKPH 4HPOH 4FA8A 1BWMA 1HWGB 4V3EB 2HLFC 2J3SA 5FGCB 3OAUH 3OXSB 5FDYA 3U4AA 3ZE0F 4TOYL 1AGBA 1SMOA 1I3GL 1WEJH 2RJMA 3BYYA 3K8LA 2AAVA 4CMHC 1G6RH 4NO5B 4ORGA 4WFHD 3ECBA 2AJUH 3HLAB 4N0UA 3RBSA 5DR5L 4RAHA 4JFFA 5DD5H 5J13B 5HXMA 1SY6H 2ADIB 2FIRT 4W70A 3HZVA 3IDYB 1FL5B 1HXMA 1HINL 5GGUA 3ZTNL 3BD3A 3HC0B 3DOSA 5D1XC 3GMPA 3ME0A 4P3CL 1MCRA 3FRPA 1L6XA 2JJSA 2WWKT 5IMMB 5HDBF 3QI9C 5D2NA 2IG2H 1MFNA 4GMSH 4HV8A 2NXZC 5EZJA 5AZEL 3PGFL 5ICZA 4WJ5A 4E42A 3G5ZA 1LMKA 5JORA 4I48B 5FM8A 2Z9TA 2EKJA 1DFBH 3O4OC 3U7WL 4P2QE 1T22B 3B3IB 3VFNA 5D1XB 5EZOL 2YA2A 1A3QA 3Q2CA 3L3IA 5D93C 4XNYL 3DWTA 5FOJA 3FOLB 1GCFA 3QI9B 3RHWK 3MRKA 5KSVB 4NN7C 5D7LA 1LWRA 2NXZB 1CICA 1TXKA 5K9KA 1NCDL 3QEGH 2AEWA 5FAAA 1P4LB 2L7UA 4YPJA 5E6YA 5IB4A 1MY7A 1MJ8L 3O4OB 4D9QE 1YPZE 1R3JB 2X4QA 3NZ8A 3IFNH 4MAYA 3TJHD 4MHHI 5IVOA 1QD0A 5D6DC 1WEJL 5C0BD 1NMAL 2AJUL 2FHBA 5F1NA 4O02L 1G7MA 4LNRB 4IS6B 5GQBA 1SY6L 1MCBA 1FYTD 2BNUA 3TVMD 3FHQA 1U8NA 3HE6D 3RY4A 3SE3A 1P7HL 2E7MA 5IUSA 2VITA 3KYNA 4IJ3B 2MQ3A 2XFXA 4QY8B 2EYSB 3WDJA 1NEZA 3U48A 2IG2L 1ZGLP 3CFEB 4L5FH 4GMSL 5CSZA 1NAMB 3ULUF 1CDJA 2FEEI 2VXQL 2OS7A 1FLRH 2JIXA 5FEBA 5EOCJ 1DQQA 4LSRH 2CLZB 4EBQL 2ITCB 1MCOL 5IKCA 3O4LD 3K46A 1JGUH 3MV8B 5T1MB 1AXTH 3BZ4B 5L2KA 1XGQA 4P4KC 3AS3A 3S5LB 5ID1A 3LQAC 3VRLF 3HA0A 4QO1A 1K5NA 2NW2A 3CFKB 1CYGA 1NKOA 4NT6B 4PRBB 3FO9A 1PLGH 4JY5H 2NY6C 1A5FH 1L0QA 2GCYA 2HVKB 1KG0A 3UC0H 4MD5B 1ZAGA 3QEGL 4J3UA 1I8LC 4H8WL 4PLNC 2HFEB 4QRTB 4JHWH 3LKSB 5D1ZC 1U3HC 5KSAA 4WUUE 1FAKT 4XPAH 5B8CA 3HI5H 1OTUD 4NQCA 1QA9B 3IFNL 4Z7OF 3MCG1 4P4KB 3OKKA 2Z93A 4Y5YA 3CNKA 4P23D 2PTTA 3UO1H 5IFJB 3CH8A 1IVLA 3CCHB 5FM5O 4M3KB 2WQRA 3MXWH 2LV4A 4PP8C 2EDOA 2HVJB 1NCBL 4J6RH 4X80H 1OLLA 2FJFB 2WBJC 4YHIA 6FABH 2XTLA 4OGYH 2BNRB 4M6OH 3FQRB 2J2ZA 2PYEA 4JHBA 3CSGA 3D2UA 4CVUA 2WUCH 3PE9A 5FGRA 4R0LC 1KSRA 1I7ZB 5D1ZB 3CGTA 2P48B 2D0GA 5DJYB 2ESVD 1VADA 2ADFH 4KDVA 2JLLA 4M5YL 3OPZH 3BPOC 1WT5C 3QAZC 2NR6C 4X6FA 5KVDL 3I6GB 4F7MB 5BZDB 1QNZH 1IGIH 1KFAH 3IDUA 1VFOA 3ES6A 3HCVA 3OAZK 5ACZB 1TTUA 2Z0BA 1CFVL 1FLRL 5CD3B 3TF7A 3IJHB 1A4JA 4LSRL 1ZVHA 1S5HB 3GSOB 4WGWB 2VMFA 2WBJB 4NDMA 4DOHE 5MHSE 1CFNA 1N6QH 2Q7YB 1JN6B 3P3YA 5FCUH 4PJBE 4MA7H 4Z7VE 1RZIB 4I0PA 2Y9RT 2IAMB 3ULVE 5CEYA 4JANB 4OT1L 4PJCB 1C5BL 4AY0A 3VFGL 4MNHA 2GHWB 3BH8B 1BFOA 2LE9A 3LZFL 1VACB 4RCAA 1IL1B 3BPOB 4BSJA 3QAZB 3JUZA 1PLGL 4LP4A 3JWDC 1H3TA 3G04B 2YD5A 3I6LD 1GYAA 1A5FL 2FEDC 4MA8H 4WO4C 1QSFA 3O3DB 5AAWA 4ZO6A 4P48A 1W0VA 1F4WH 3C60B 4NQXA 3UC0L 4R6UA 1IBGH 5E00A 2WMPA 4ZOAA 2PW2B 3QULB 1HIMH 1KYOJ 4JHWL 3TIEB 2NLJA 5JPMA 5EPMB 3HI5L 5EU5A 5GZND 4PY8I 2NX5E 4P2QD 5K9OB 1NBVH 4X4MA 5MEQB 4U1LB 1CU4H 1TNNA 3UO1L 4CADA 4X7FC 2P5EB 3MXWL 3GSRB 1FNAA 1JGEA 2CK2A 4U33A 3MRBA 4X80L 3MR9B 3D25B 1EFXD 4HWBA 5TQ0H 4WO4B 1JK8A 3P30H 1A2YB 4CL7A 1QFUH 3UTQB 5A40E 1WBYB 4L8CA 1HNGA 2ADFL 2EDWA 3ARFD 1OF2A 3OPZL 4D9QD 2XICA 5I1CH 1RZFL 2HT4D 1EHNA 5GJSL 3HB3C 5IB2A 3HC4H 5E8EB 1QNZL 1IGIL 1A6ZB 3BE1L 3F6IA 3ROLB 1P7KB 5IP4A 3CFJB 2B7DT 2OBGA 1IQDB 1OCWH 2K9UA 2H32H 5I76B 4OGXH 1IM3A 2P8MA 4KZDH 4PJAB 3NFPB 1N6QL 4MA7L 4ZXBC 2A6DA 1N64H 1QZ1A 3SDYH 3ZE2E 4AMKH 3MTRA 2WANA 1DLFH 1MFAH 3QDAA 5KVFH 4EI6B 3EGSB 5EO9A 1AD0A 5C0IA 3DGGA 4MA8L 5LCVL 3K4DA 1F4WL 3RZCD 5HGHA 2FO4A 1IC5L 3OAYH 1CF8L 1HIML 5TE4H 1RIUL 5IMOB 1MFEH 4N1HB 1BECA 2A73B 3H9HB 3L3DA 4S0TD 5FECB 4IMKC 3QO1A 1KJ2H 1KTLA 1VSCA 4ZXBB 2FZ3B 4AG4H 4I2XA 1OP3H 3GDBA 35C8H 4C56B 1T03L 5BQ7B 1P4BH 5DK0A 4X99A 3U7YH 1QR1A 5D5MA 4FRWA 5TQ0L 4LCCC 3V9FA 1CGVA 1DDHA 1QFUL 3T0DA 3NFSL 1CE6B 1UCBH 3Q6GH 3W9EB 2IH3B 3B9EA 3OJDB 2AKRB 4JHZA 3HC4L 4R96A 2RFXB 3G08A 1IFHH 4LSSL 4NJ9L 5ISZB 1OCWL 1YMME 3EOBB 3B6SA 3HFML 2J8UB 4X6DE 4F7EB 3ZT6A 1T6WA 4XNZC 1NGWA 2VB5A 5EU6B 3RL2A 1N64L 3V4VL 1MH5B 2DRUA 2VLRB 4HIHA 5J06A 4RQQA 1M7DA 3GMOB 3U30C 2XI9A 1J05A 1ZLSH 4R97C 1WCQA 4HS3A 3GSWA 5ALBL 1BFVH 3HC3H 5MENA 4K07A 4RRPG 4CAGA 1A3LH 4HUUB 4JJ5B 3TBTA 3ARBC 3G5XA 1QBML 4ZSOB 3PGDA 4P2OD 4M9PA 3NACH 1EBPA 2CGRL 3OJVC 3BVNA 1UQSB 2R1WA 3QA3B 4XPBH 5JLZB 1CIDA 1SVZA 2XIDA 4XNZB 1KJ2L 1XGUB 2UWEF 5IWLA 2ITDB 4PLOB 3QISA 4AG4L 2Q6WB 1OAUL 3VFSA 2NXYC 2Z91B 2ZUXA 4IDJL 4WNQB 1GSMA 3U30B 4R97B 5E2WL 4UV7L 4NN5C 5HVHC 4AT6B 1V8HA 4E5XA 4H88L 3OHXA 3ARBB 1J1OL 3DETC 5I18H 1UCBL 5I66B 3BPCB 3D5OF 3KPMA 3L5JA 1JWMA 1G1YA 4P5KA 4ETQB 1F3DJ 3RWIA 3OV6A 1WWCA 4K3DH 3UTSA 2APWA 4NUGH 4WRLA 2NXYB 1UWXH 3MRNA 2ICWA 2R2HB 1FGVH 2PF6A 3MJ9A 4N1CA 1CE1H 4KK5C 1JYWA 4Q6IA 1DQLL 5CBEA 4NN5B 3L3OA 4ZFOB 4DUWA 3JTTA 5HVHB 4G6FB 2GSGA 4M8QA 4NGHH 2EE3A 3ARRA 2V2TB 3ILQD 4FXGA 3HHRB 2DD8H 3HTLX 1KLGA 3MOBH 4F2MA 4OF6A 3IT8D 4RMSA 3PDGA 1JUFB 2YN5A 3MRLA 5D1QA 4ZUVB 3MLSH 3HC3L 4Y4HB 5E2TH 1EJOL 2ICEA 4NO0D 5JR1H 3V79C 4PRIA 5BOPA 4CGTA 4UTBL 3RA7H 4HKBA 1UJTA 4PY7B 3VE0B 1KN4H 4J3WA 3BZEA 4HJGB 1VGKA 4HK3J 3VWJC 4P99A 4JO2H 1CVRA 4I5BB 5CJ5A 3VGDA 3QNXB 2CUHA 5IROC 2OP4L 4X4ZA 1DE4A 1O7SA 5L8JB 2RIKA 3SGKC 2O61A 4JO4H 1JZ3A 4JPVL 2H32A 5IW6A 5IHZB 1M71B 4MS8C 5B3JF 1BAFL 5DMYA 5I18L 2GSIB 1E4KA 3ARWA 3QIUB 1PYWA 5FYJE 5GS1A 1OY3B 4PJ5E 2MTPA 3QEUB 3JBG7 3D1MC 4PRNA 5JO5B 3HAEG 3QDJE 2H8PB 3LPWA 1QLRB 5IMKB 1IEBB 5C92A