3I0TA

Sulfur-sad at long wavelength: structure of bh3703 from bacillus halodurans
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
178
structure length
170
Chain Sequence
SLEKQIESYYQEIAQLIIDMIPEEWAEVRFYAQEDHDGWKIFFFHYLSASSDEWTKDIDIRDVIKVPQDEFMEKYNELSFCISDFRKDYAEAFGEPWMSFQMTFYASGKFNIDFYYDKNPFDTFLTRLAWQYEHFGTIPEDSFYKETLNEYLEEKAQGKRYPFLEPLHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Sulfur-SAD at long wavelength: Structure of BH3703 from Bacillus halodurans
rcsb
source organism Bacillus halodurans
molecule tags Unknown function
molecule keywords BH3703 protein
total genus 54
structure length 170
sequence length 178
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04634 DUF600 Protein of unknown function, DUF600
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3i0tA02
3.30.500.20 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 BH3703-like domains 3i0tA01
2HFHA 1IN8A 3LA2A 3HRTA 3GLXA 1X3UA 2Z33A 3GEZA 2H09A 2EFQA 3HYIA 3I5UA 2A6EF 1KQ9A 2YSRA 1BI1A 5DCMA 2XAGA 3ELKA 1PP7U 2W25A 5L3BA 1MDMA 2HYFA 5FD5A 1OPCA 4EVIA 1U5TB 1DPUA 2A07F 4U88A 2ISYA 2F5DA 5DCFA 4BH9A 2MBFA 4CO8A 3TDZC 2FOKA 3I0TA 3N4MA 5BMZA 1FPQA 4GXOA 3H3UA 1SMYF 5HLGA 2D2WA 4N9HA 3D0SA 4M9XA 1FYMA 1BI2A 5F1RA 1HKTA 1F9NA 4AIHA 1IXRC 3PFIA 4HX7A 4R79A 1MD0A 4G7HF 3HIFA 1MZBA 3TO9A 2IA2A 2L3DA 3JAMK 3FXRA 3LAJA 1J7KA 2HOEA 4UVAA 1S6LA 1XD7A 3NQOA 3I54A 4MEXF 3WTZA 2XAQA 4EV0A 2O3FA 4KN7X 4ZH4F 3IL2A 4WXCA 1BC8C 3HOTA 5DYMA 1T38A 3D5LA 1UB9A 4LD5A 5DUIA 1U3EM 3EETA 2A5YB 2M45A 2MA3A 2IJLA 5CLSA 1P92A 3WU0A 3KP5A 1BOAA 4ENNA 1J0RA 3QPHA 1G3WA 2L4AA 1IN6A 1FX7A 1YQAA 4LLGF 2MLKA 4ETSA 3CO6C 5DUKA 4HOBA 2W57A 3CLOA 1IXSB 1S8NA 3SHFA 1U6GA 4N9IA 2C6YA 2KRFA 5D8LB 2L4MA 3MAJA 1S3JA 3OV8A 2AXLA 3SZTA 3GFMA 4ENMA 2WC2A 2XRNA 5HS8A 5H20A 4ZYEA 1HBXG 4XSXF 3BOQA 2V6CA 2H27A 4PGGA 4YIIA 2FMLA 1S7AA 2HEOA 3KETA 5JVTA 1ZGAA 5D6EA 3GVAA 2DBBA 1YW8A 3RI4A 2GZWA 2D45A 1WKMA 2A61A 1DUXC 3ZMZA 2VOOA 5HDGA 3WGIA 2PMHA 2RKHA 4MHGA 4HW0A 2VODA 4KFCA 1NHAA 2GA2A 4MTDA 1LEAA 4GCVA 1XGSA 4EJUA 4A6EA 1YG2A 5DEQA 3T1BA 3CDHA 2M1BA 2OZ6A 2EFOA 4XLPF 5J8CA 3ZPLA 3BJOA 3RDIA 5DV5A 1W4MA 4O3MA 1RUOA 2VBZA 1O57A 3F6VA 4WWCA 1TW2A 3LA3A 1SFUA 4LG0A 3FM3A 3BJAA 5L3EA 1W7PD 2EB7A 1R1UA 3HOSA 2W24A 1QBJA 2STWA 3RKYA 3ECOA 1L3LA 2WTEA 3KE2A 2FBKA 3IWZA 4Q4ZF 2VE8A 5DCMB 2Z3YA 1B6AA 2OA4A 3QOPA 1CF7A 2ESNA 1F1ZA 3R0AA 4A2UA 3ZP5A 4UNOA 4P5OA 2VBYA 4F7ZA 2F5CA 3ISPA 2QUFA 3COAC 1B1BA 1TBXA 1LJ9A 4ZYGA 2DTRA 1FSHA 1AOYA 5FD6A 5LRSA 2CGPA 3RYPA 3BP8A 5ILVA 1TQPA 4MEYF 2ZBKA 2FMYA 1IN7A 4L18B 2KKOA 1SFXA 3RIRA 3GUDA 4CXFA 2Z99A 3H3ZA 4HAMA 2LF7A 4PZJA 1IN5A 5L3CA 3JTGA 4M74A 1PDNC 1Y0UA 2Y48A 4S05A 4WK8F 1QNTA 2DU9A 2ZCWA 3QP6A 5LBQA 4LFUA 1G6NA 5BOXA 1FNNA 1FYKA 2YPRA 2FSWA 5ICCA 5BPDA 4M9ZA 3WTWC 3KEOA 2FXAA 4KMUX 1XCBA 3U2RA 1B59A 5HOOA 3K1NA 3R60A 4KA4A 2FU4A 1O3SA 1KU3A 1DP7P 3O3KA 5LLQA 3V7RA 5K1YA 3KP6A 1W5SA 4RGRA 4A0ZA 1YLFA 3R61A 4AWXB 1T39A 1E2XA 1ZG5A 4OMZA 1WSUA 1W7PB 3TGNA 3F3XA 3L9FA 2O8XA 1IW7F 1T98A 4HV6A 3HHHA 2Q8KA 3RPQA 4UXNA 3ZMSA 3BPXA 3BWGA 3KP2A 3NRVA 3FWEA 1XSDA 4LB6B 4Q5SF 2W85A 3ABTA 2VT2A 3HSEA 3ZMDA 3WTYC 4BXUA 4ENJA 1USSA 1OYYA 1FZPB 2VN2A 4G7OF 3SXYA 3MQ0A 2E7XA 2FEZA 4G8XA 3L09A 2GQQA 2ELHA 1K7AA 2P8TA 4Y17A 3KZZA 3BDDA 4RB2C 2P5LC 3W6JB 2IT0A 4EJTA 2QYOA 1O3RA 5K5RA 2OQGA 3C7JA 1LEBA 3GO5A 1HW2A 3V8KA 1ZRCA 4Y15A 1Z05A 4EGYA 4IRHA 5CVUA 2CYYA 4A5NA 1JGSA 3R4KA 2ZJ2A 1U8RA 2EV0A 4O5VA 2A6HF 3E97A 3KP4A 1Z6TA 2CG4A 1R22A 4KT5C 1KQ8A 1ODDA 1R5GA 4KN4X 2KIFA 4HA8A 3ZN0A 3FMSA 3G73A 1P2FA 3IKVA 4M6YA 3TOAA 2BYVE 1FC3A 1I6XA 1LDDA 5JHUA 4OIRF 3PQKA 3JW4A 1D5VA 3C1DA 4O6JA 4UHTA 3QP5A 1E17A 2HQNA 2LSOA 4H0EA 4ZYHA 4LJZF 5LHIA 1TQMA 3L00A 2NNYA 3MFKA 2F5EA 2G7UA 1ZG1A 4PCQA 1MJ9A 4L9VA 3HHGA 3WE2A 3E6BA 1YS7A 4E70A 3E6CC 1JXSA 1Z91A 3FMQA 1ZN2A 2LDUA 4NB5A 1EH8A 2FQ3A 4L9JA 2NYXA 1P4XA 1H9TA 2YX7A 4ASNA 1SAXA 3I59A 2M8EA 1BJAA 1FBSA 4PDKA 3GFLA 2OAZA 2HKOA 5E8IA 2DQLA 2PLYA 5JFRA 2HTSA 3WG9A 4LK1F 3VODA 5A2QZ 1REPC 2XKPA 1O7LA 2NAZA 4HQEA 4HLYA 4PGHA 1ZLKA 5JR3A 3U1DA 2P7VB 1YO5C 1AWCA 3KP7A 3Q9SA 3F6OA 2RQPA 1GXPA 2DO7A 3RPUA 3ZMUA 3ECHA 1QZZA 4HF1A 1QO0D 1P4AA 3TOBA 1GVJA 2UWMA 5F6FA 5H6QA 2DT5A 1IXCA 4ZZLA 3IRRA 1ZH5A 1ON1A 2PEXA 3V8JA 5D5XB 2XVCA 3F21A 1PUEE 4OINF 1K79A 1BBYA 3GZ5A 4M73A 4EJVA 1G3YA 4FT8A 4RAYA 3L2CA 1SD5A 2V9VA 2LKPA 3ZQ7A 2XAHA 2HDCA 4G6DA 1FBUA 1ZREA 1RIOH 3ERED 3PQJA 3Q9VA 3HRMA 2BV6A 4S04A 3KLNA 3KEQA 2HZTA 3LFKA 1IZ1A 1H9GA 2QM3A 3V8LA 3R6SA 2HQRA 1GHCA 4KUMA 1RZ4A 4HX4A 4KIBA 5FB2A 5FO5A 2VXZA 3IRQA 4U7DA 4I98B 4I2OA 3DP7A 5L3FA 2L54A 2QENA 1XGMA 2ETHA 3LA7A 1FY7A 2CQKA 4BQAA 4M6XA 1HW1A 1I1SA 3JAMZ 1SD6A 3SZPA 5CVVA 1T6SA 4UUVA 4YFKF 2R7FA 5ERIA 4HF2A 4M72A 5E18F 3P7NA 4U0VA 1F4KA 2DAOA 2G7HA 3BJ6A 1ON2A 4B09A 2ZFWA 4WXDA 4RB3C 4IHTA 4GO1A 1XMAA 1DPRA 4OIQF 2XAJA 3GF2A 2X4HA 3KCCA 3LSTA 2FBHA 5E20A 3L7WA 4HDVA 1W5TA 2NNNA 3LWFA 2XASA 4KIFA 2PG4A 2HTJA 3F8FA 3P9KA 4MNUA 1QZYA 1UFMA 3SQNA 2QZ8A 4MQVA 5E8GA 1YS6A 3MEXA 3K69A 2CFXA 1R5HA 2BGCA 4EJWA 2HS5A 3QU3A 2MLGA 1OMIA 3GWZA 3HSFA 3VFZA 1Z9CA 2EWNA 3RKXA 2IP2A 1SFEA 3GXOA 1CF7B 2Y0MA 2EFPA 3O2PE 1ZARA 1ULYA 4HZFA 1LDKB 2JPCA 1BIAA 1FP2A 2GXBA 1BIBA 2QWWA 4ZZDA 4HBLA 4UV9A 4LLNA 3ZMTA 1Z1DA 5HLHA 3EDPA 3V7SA 1FSEA 5D6FA 1YYVA 2IW5A 4OIPF 3LQQA 4EGZA 4BHBA 1T0FA 4AIKA 1OYWA 5D8KB 3B73A 1WRJA 1V4RA 2ADUA 3GFJA 2OQRA 5LEJA 3WTXC 3T8RA 3ZN1A 1BM9A 1XSXA 2Z9OA 5IT9K 1R1TA 4NQWA 3B02A 5DDGA 5D5UB 1U5TC 3S2WA 2YR2A 5AIQA 1IUYA 2WWYA 2GA1A 1FBQA 3IHUA 4KIGA 3TO7A 5J6XA 5BQTA 1ZAOA 2KJCA 1TQIA 5HS9A 1TNSA 3F8MA 1QPMA 3K1MA 4GGGA 4GYIA 2JZYA 2CSOA 1R58A 4HQMA 3HRSA 4A0YA 1XSVA 2B0LA 3K1PA 2ZKZA 1EH7A 2BEOA 4HF0A 3WGGA 4WXHA 2IA1A 1RUNA 4RAZA 3FX3A 1KU9A 3CUQA 3HUGA 5D5WB 3M7GA 4HLXA 4RGUA 3O6BB 1BI0A 2XHKA 4A6DA 2XROA 3BZ6A 5LHHA 3GW2A 2L01A 2DK8A 2OD5A 1FT9A 4DNCA 2H94A 5D4RA 2J5PA 4CYDA 3VEPA 3MZHA 2P6SA 4LMYA 3K9TA 1D8JA 5L3GA 2DQRA 2STTA 3RKWA 4L0YB 2RC4A 2JSCA 2F5FA 1F5TA 4G6QA 4M71A 4K2EA 5BPIA 2M5WA 1EV7A 2MC3A 3E6MA 2P6TA 1IN4A 4HV5A 4RS8A 1ZLJA 5K5OA 3M8EA 3FZVA 1S7OA 2XV4S 4I0AA 2RVCA 3GX4X 4CICA 4EJOA 5HVQC 3GFIA 2HR3A 4EQQA 5LGNA 4WCGA 3ULQB 2DW4A 5ICEA 1STZA 4FX4A 2R7DA 1D8KA 3IC7A 2O03A 2J5OA 1I5ZA 2K02A 3E3VA 2VE9A 3TDUC 4YFNF 5L3DA 4UVCA 1J2XA 4Q47A 1QGPA 2VBXA 1J75A 4A12A 2FNPA 3E5XA 3EYIA 3CUQB 2P5KA 2NRAC 3FM5A 1JHHA 5ICFA 3WTUC 1USTA 3EYYA 4KMFA 2W84A 3VB2A 6PAXA 4R8HA 2ISZA 2IRFG 1ZG3A 2CO5A 3FXUA 3QU6A 3F23A 2GAUA 2YU3A 3DF8A 5FFXA 2PBIA 1U2WA 2D1HA 3V7CA 2GWRA 2CW0F 4WX9A 2F2EA 4XLNF 3MZYA 4DQ2A 2M30A 2FE3A 4UV8A 5LHGA 1IRGA 4IXAA 1UHWA 1U78A 5D4SA 4IRGA 3KP3A 3DEUA 2EA4A 2KJBA 5J8FA 4BHPA 2LF8A 3IWFA 4XBFA 4BHCA 1G4DA 4HYEA 1OYIA 2A68F 2MH9A 4R1HA 1KU7A 3CUOA 3I64A 1R7JA 3TKYA 3J80K 1ZGJA 1P6RA 4QLCU 3G3ZA 3I71A 2JT1A 3F8BA 2OZUA 4XSZF 3JSOA 4NHJA 3J81K 1BN5A 1V3FA 1BI3A 1ONVA 3RTRA 3CJNA 1VTNC 5A2QK 3C3WA 2UZKA 1UHMA 2Z5UA 3M9AA 4I0BA 3BY6A 4TV7A 1FP1D 4EMSA 5E1ZB 3WTSC 3MCZA 4KICA 3BROA 1R36A 1XGNA 5HS7A 4IJAA 2HKXA 4A0XA 1HKQA 2FRHA 2G9WA 1PP8F 3JTHA 2GIVA 3K0LA 1S29A 5CYVA 1MGTA 1SD7A 1WI9A 2VC1A 2QQ9A 4KNYA 1Z7UA 1IF1A 1JE8A 2O6GE 1A04A 1HKSA 2IVMA 4G94A 1XCVA 1MDMB 4OOIA 2PQ8A 4JK1X 4I01A 2HGCA 2KIMA 1QQIA 1ZRDA 3VOEA 2YX4A 2QQAA 3ZMVA 3DPTA 1B9MA 5ILUA 5ILSA 5HLIA 1DDNA 4YIFA 1UCRA 3F8CA 2O0YA 5FLXK 3T0YA 2P4WA 4EM0B 2GXGA 3FMRA 4Q48A 1P4WA 4LB5A 3DQVC 4P96A 2CWEA 3F8NA 1HSJA 4IF4A 2K4JA 2OU2A 1ZRFA 4MGRA 1ZYRF 1YTYA 3P9CA 1H0MA 2MH2A 2VT3A 5CVJA 1J9IA 2RNJA 4U0YA 3DPLC 1LB2A 2DFIA 1LNWA 1B9NA 3I53A 5EEGA 1R23A 2QBYB 4EM2A 4CDGA 1KA8A 1O3TA 1C0WA 1B4AA 4CHUA 1LVAA 3FF5A 1G3SA 4UVBA 4G7ZF 4ESBA 2ZMEA 1TLHB 1GXQA 3E5QA 2E1CA 2XIGA 3WTVC 2HWVA 4HDUA 1J59A 1XN7A 4Z2YA 2PMUA 2E1NA 2FF4A 4RB0A 4RGXA 4YG2F 1LDJA 1JHFA 3LQRA 1HW5A 4WF2A 3QRFF 2KIUA 2WV0A 2PFBA 3ROUA 4ESFA 2XAFA 2ZNZA 3I58A 4ON0A 4KDPA 2DLLA 2RDPA 3REOA 1TTYA 4MTEA 2V1XA 2ZMEB 2VC0A 3EUHA 2AS5F 4N0BA 2UXNA 3HTUA 4I02A 3RYRA 5K5QA 3J7AO 4IVNA 3TO6A 2QVOA 4G9YA 3KLOA 2EA2A 4AVPA 4OIOF 2H6BA 4LLLA 2R3SA 1YIOA 1FWZA 1Q1HA 1LQ1A 4P55A 2VOPA 2EV5A 5LRRA 5CJ9A 2ZO4A 2PJPA 1WWXA 3QAHA 2EFWA 5F64A 1IRFA 2RGVA 4JQFA 2RV8A 3CTAA 3F72A 5H6RA 1XDSA 3TQNA 1O7FA 4LGWA 4XRFA 3IKTA 2K4BA 1K6OA 3E6DA 4A5MA 1G3TA 1K78B 1XGOA 3HSRA 3WU1B 1FYLA 1FLIA 2XKOA 3J80Z 3EQLF 1XDUA 2JPBA 2EV6A 1FOKA 3T8TA 5TRDA 1O3QA 1SMTA 2Y75A 4I7HA 2IPQX 2EJRA 3J81Z 3GZ6A 1XB4A 1YW9A 3W6KB 3I4PA 1KYZA 3CUQC 5AONA 5FLXZ 5FFZA 5LEKA 3GYHX 2BE5F 3V4GA 4CGZA 4D0PA 4IHSA 3M8FA 1TW3A 2BBYA 2LNBA 1T2KA 1BC7C 2DPDA 1Z6RA 3WGHA 3WODF 3DFGA 1CGPA 1KU2A 5LGUA 4RGSA 3DXJF 2COMA 2PN6A 5KK1A 1K78A 4YFXF 3ML6A 2NS0A 2ACJA 1XMKA 1KGSA 5JI6A 3MWMA 2K27A 1HSTA 2RN7A 2FA5A 3K2ZA 2K86A 2DK5A 2EK5A 2XGXA 3R0JA 2DPUA 1YW7A 4LK0F 4CZZA 4ENKA 1U5TA 4L9TA 1EH6A 1MJAA 2V1DA 5E1XA 1RNLA 3Q5FA 4P9FA 3BPVA 1MJBA 1TNTA 4MQ9F 2IA0A 1MKMA 2H6CA 3HTSB 2QLZA 3QPTA 4L9NA 3KZYA 2E7WA 3AAFA 5DD4A 5IT9Z 2A69F 5D5VB 1W7PA 2V79A 3WE3A 3F22A 4FX0A 3DKWA 5CVRA 1SD4A 2ZXJA 3ABUA 1J5YA 3H92A 2HYGD 2MD5A 4B8XA 4L5IA 5HDKA 4JBAA 4U0WA 2D1VA 4KYWA 1RI7A 2M87A 2L02A 2X0LA 2JRTA 2OBPA 2P7CB 5E17F 4L5JA 4FHTA 2EFNA 3E5UA 4I09A 1R1VA 1I27A 3JSPA 2QQBA 3WTTC 5CVIA 4M9SA 4OU0A 2FBIA 4BAYA 4U7BA 2O61A 5ED4A 1R00A 4IPAA 2PI0A 4OMYA 1I1GA 5IT3A 2QBYA 2A3SA 4IRIA 5TJJA 4AD9A 5AIPA 5EEHA 3DV8A 1D3YA 4P9UA 5HDNA 3P9IA 5E1WA 4BNCA 1YFHA 2TDXA 5BS6A 3FHZA 3C18A 4ZYDA 3OOPA 1HQCA 2ZNYA 5KVRA 4AIJA 2FNAA 1IAWA 1KYWA 3FXQA 3M1EA 3I59B 2Q2EA 2DI3A 3HRUA 1HXDA 2Q0OA 2ESHA 1WQ2A 4HX8A 4EM1A 5LGTA 2P5VA 5ICGA 2JTVA 2UXXA 1OR7A 3LAPA 1KQ0A 1ZHFA 4L0ZB 3N97A 3T5XA 4GYGA 3SFZA 4Y13A 2K7LA 2VONA 4LG0B 4RB1A 2VBWA 1OKRA 3KFWX 4ESJA 3RJPA 5DD8A 5FGMA 1L0OC 3NEUA 2V1UA 2XUBA 4BYYA 3U9GA 4QWQA 3CO7C
chains in the Genus database with same CATH superfamily
3W0WA 2MD0A 2HFHA 1IN8A 1P4LA 3LA2A 1N78A 4HV8A 3HRTA 3GLXA 4XKWA 1VQ4I 1BOBA 3FQTA 4L9LC 4XKCA 3BHBA 3TBWA 1X3UA 5GTIC 2Z33A 5JLWA 1LE8B 3GEZA 1APLC 3RCOA 2H09A 2EFQA 3HYIA 3I5UA 2A6EF 1FTTA 1KQ9A 3M8JA 3OYCA 5HHQA 2YSRA 3P4NA 4IX7A 1BI1A 4V3EB 5DCMA 4QIWN 1T7YA 1W36C 2XAGA 3ELKA 3L3IA 3LV3A 5E8OA 1PP7U 1JT0A 5DM6F 3RUGA 2W25A 5L3BA 1HDDC 1MDMA 3DKXA 3OOUA 1V5EA 2HYFA 5FD5A 3S32A 3W3CA 1OPCA 3NARA 4EVIA 4MX7A 1U5TB 2E1OA 3VYRB 1EEZA 3I9V2 1DPUA 4F7MA 2WB1A 1KCGC 2A07F 4U88A 2ISYA 4N8VA 3TO4A 1VQMI 2F5DA 5DCFA 4F55A 1LVKA 2GXAA 3HGGA 4A3MJ 2IXSA 1Y8RB 4BH9A 2MBFA 4CO8A 1E3PA 3BZKA 1A9BA 2LG4A 3TDZC 2FOKA 4PJ0C 3I0TA 1T1ZA 3N4MA 3GLLA 1FPQA 4GXOA 2O7OA 3H3UA 5BMZA 2FOWA 1SMYF 1QRYA 2OV7A 2D2WA 4N9HA 5HLGA 3JRGA 3D0SA 4M9XA 1W0UA 1FYMA 1G2HA 4U1SA 1BI2A 5F1RA 3FXOA 1HKTA 3RQIA 3HOWJ 1F9NA 4AIHA 1IXRC 4L5EA 3PFIA 3FT4A 4HX7A 2YUSA 3O3BA 4KT6A 4R79A 1MD0A 5EFIA 3GSNH 3I55I 3E1SA 4ZAKA 4D7NA 4G7HF 3HIFA 1MZBA 2WAEA 4XORA 1SEUA 4BY1J 2XDVA 2CQNA 4M3EA 3OYJA 1UG0A 3TO9A 3J7YJ 3BTJA 2CUJA 3FHNA 4D9JA 1SC7A 3PUFA 1Y1VJ 3K4LA 2JN6A 2IA2A 2HN7A 2L3DA 4XONA 3JAMK 3FXRA 3LAJA 1J7KA 2HOEA 2M3AA 4UVAA 1S6LA 3WHCA 3HXLA 1ED3A 1XD7A 3KPHA 3NQOA 3MRKA 3I54A 5GSVA 3SDBA 5F1JA 3KZIC 1T1XA 3S15J 4MEXF 3WTZA 3PQYA 2FO4A 2VJJA 1NTCA 2XAQA 1TC3C 4EV0A 2YS9A 2O3FA 1GV5A 2A83A 3MREA 4KN7X 4FFEX 3SJMA 4ZH4F 1VI0A 4WXCA 4YRVA 3IL2A 4QPQA 1BC8C 1GDTA 3L3JA 3HOTA 4JX5A 3SDXA 5DYMA 3CQZJ 3BG5A 3HM5A 1T38A 2AV1A 2XPGA 3D5LA 3LL7A 1DUYA 3SDCA 1UB9A 4LD5A 5DUIA 1U3EM 2KP6A 2RREA 5IVXA 2DMQA 3EETA 4Z6YA 2DJNA 3HJEA 2A5YB 2M45A 2MA3A 3ZQHA 3CJQB 1YX3A 2IJLA 1ZT7A 3P5JA 5CLSA 2BVMA 2LVSA 1P92A 1KJVA 3WU0A 3KP5A 1KPVA 3RWEA 4HX1A 1BOAA 3SYTA 1J0RA 3QPHA 3FK6A 4ENNA 1G3WA 2L4AA 1HOMA 3KWWA 4M3BA 1IN6A 1FX7A 1YQAA 1VZ0A 2DMPA 4LLGF 1JKPC 5GPAA 2HJLA 4Y16A 2W7NA 4IIQC 2LY2A 2MLKA 3VSKA 4M3FA 1GZPA 2CW8A 3G08A 4ETSA 3M1BA 4NDLA 4RAFA 3ZQCA 3CO6C 5DUKA 4O2EA 4LCCC 1MHCA 3Q3SA 4HOBA 1A6ZA 3P9LA 2OTJI 2YPLA 5HHPA 1W72A 2W57A 5IP9J 2AHQA 3CLOA 5B1BH 1IXSB 1S8NA 3SHFA 1U6GA 4BBSJ 1BZ9A 2IS2A 1A36A 4MJ6A 4N9IA 3SKOA 2C6YA 2KRFA 5HGDA 5D8LB 2L4MA 2JVGA 3MAJA 3QPSA 2AK4A 1S3JA 3OV8A 4HEA2 1FFOA 5F08A 2AXLA 3SZTA 4UB8C 2EZLA 3GFMA 1IC8A 4ENMA 2C7UA 2WC2A 3GCMA 4IZZA 2E7LE 2XRNA 2FYYA 2L9RA 4CCNA 3FT3A 2R7ZJ 3PIOF 2XSDC 2O5NA 2V9KA 5HS8A 5H20A 3TJHA 3ROLA 4ZYEA 1MIJA 5CQGA 1HBXG 4XSXF 1I7RA 3BOQA 1L8JA 2V6CA 2H27A 2R7TA 2DA2A 1S7EA 4PGGA 4YIIA 1MWAH 2L0KA 4DYCA 1QEWA 3CF5F 4QOKA 3JRBA 4PJMA 2HQ5A 4UY8I 1JJ8C 2FMLA 1JF1A 1S7AA 3IH3A 2HEOA 2XF6A 4I48A 2ZSIB 4MLOA 4KITB 4NSKA 2ZJRF 3KETA 3MR9A 3MGTA 1YI2I 2CKBH 5JVTA 1ZGAA 2NS7A 3BZCA 4X1EA 3W2WA 5H2FC 3LKSA 3CD6I 2X4PA 5D6EA 3BR1A 3GVAA 3OYHA 1OCPA 2DBBA 3MRNA 4NC8A 1YW8A 2HQAA 3OYFA 1HHHA 1OJLA 4PJAA 3DTIA 3CCSI 1F43A 2AXFA 3RI4A 2GZWA 4DGWB 2D45A 1WKMA 2A61A 1DUXC 5LFAA 4ZUSA 2LC2A 3ZMZA 2VOOA 1OCOH 5HGAA 1I3QJ 4ZFZA 5HDGA 4A3EJ 3WGIA 2PMHA 2Q1ZB 2CIIA 2R92J 2BZTA 2RKHA 3OYDA 3AU1A 2IGMA 3ZQQA 3H7BA 4MHGA 4B48A 2XC7A 1MH3A 4HW0A 2VODA 3ABKH 2GUOA 1M1EB 1RR7A 4KFCA 5IB1A 5C08A 1OCZH 1NHAA 2GA2A 4RM3A 4BXFA 1FIPA 1LEAA 4MTDA 4CCOA 1FOXA 3RWGA 4GCVA 1XGSA 2Y31A 4A6EA 1YG2A 5DEQA 4EJUA 1JGEA 1R9TJ 3T1BA 3CDHA 3O3EA 3OR1C 2EINH 5C3EJ 3OIPA 2M1BA 2OZ6A 1LDPH 2DT7B 2EFOA 3A03A 4AVZA 4XLPF 3CCRI 5J8CA 2Z16A 4NQVA 1T1YA 4Y52J 2W1OA 3ZPLA 4F7EA 4D5CA 3BCAA 1ZK8A 1T80A 3QULA 3BJOA 3RDIA 4JFEA 5DV5A 1XX5A 1W4MA 1FOWA 4O3MA 3VFSA 1RUOA 2VBZA 2QGUA 2CQXA 1O57A 3F6VA 3AG4H 2FJ1A 4WWCA 4I76A 1TW2A 2DA3A 1S7SA 2X4UA 1X3ZB 3LA3A 1SFUA 3FT2A 4LG3A 4LG0A 3MN2A 4PGBA 1OGTA 1CQTA 3QI9A 4X6CA 3FM3A 3BJAA 5L3EA 1W7PD 3CMYA 4PSWA 2EB7A 1UXWA 4PR5A 1EKEA 1R1UA 2DOFA 2QA4I 4AUXA 3HOSA 2W24A 3BTLA 2P81A 3H3VK 2KPMA 3SDGA 3VWKA 1QBJA 1HYRC 3KYNA 1I1FA 4G43A 4PRAA 2STWA 3H0GJ 2LY9A 1DU6A 2YU9J 1RKTA 1AKHB 4XN3A 3RKYA 3ECOA 3X2QH 5C4JJ 1L3LA 3IH2A 3OL4A 2WTEA 1JKRC 3KE2A 2FBKA 3IWZA 4Q4ZF 2VE8A 1KJ2H 4X6AJ 1X1BA 5DCMB 2Z3YA 3ESWB 4W1UA 3IAS2 1B6AA 2OA4A 3QOPA 3BEVA 3D5RC 3CMAI 5K7ZA 1CF7A 2ESNA 4HPQA 1F1ZA 3R0AA 1QVTA 4A2UA 4Y7NJ 3ZP5A 5FKLA 4UNOA 1FZOA 4P5OA 1UZCA 2VBYA 4F7ZA 2F5CA 3VWJA 3ISPA 2QUFA 3COAC 4JYKA 5EF6A 2LD5A 1UXSA 1B1BA 2WY3A 1TBXA 2CUEA 1LJ9A 4ZYGA 4B3AA 2DTRA 2CQ7A 1FSHA 1AOYA 5FD6A 3FXKA 1VQOI 1B72B 2KZVA 2XPUA 5LRSA 1S9WA 3O3AA 5EOTA 3PNYA 2CGPA 3ASNH 3RYPA 3BP8A 5ILVA 1TQPA 2O5RA 5EU6A 2DYRH 4MEYF 3IV5A 1QPIA 1TVBA 3ZQLA 3B3IA 3BUYA 2ZBKA 3MRGA 2FMYA 3BWAA 1IN7A 3D2UA 3LNQA 4BS9A 2M34A 2M4GA 4L18B 2KKOA 1SFXA 4XLCA 4PJEA 3RIRA 3AKZA 4PJHA 5E3LA 3GUDA 4CXFA 3L2WA 1ACIA 3ZQGA 2Z99A 3CLQA 3H3ZA 1QLFA 2Y0SA 3TO2A 3GMLA 4HAMA 3MKYB 2AV7A 3S93A 2LF7A 4PZJA 1IN5A 5L3CA 1V54H 1RJZA 2UWEA 3BG3A 5TISC 2QEXI 5C4XJ 3JTGA 4M74A 1B8IB 4L4TA 1PDNC 3Q0VA 1Y0UA 3QQ4A 2LYCA 2ZOKA 2Y48A 4S05A 4WK8F 2HDDA 1QNTA 2DU9A 2VE6A 3LKPA 1JFMA 1SYVA 4WU7A 1Z5LA 3MA7A 3K6GA 4L29A 4NQDA 2K5CA 1FMVA 1G8XA 2ZCWA 3QP6A 1Y6IA 5LBQA 3G6EI 1JGGA 1FZKA 4LFUA 1G6NA 5BOXA 3IT8D 1FNNA 2KQRA 1FYKA 2CQQA 3CP8A 2YPRA 2FSWA 5ICCA 3VXUA 3X12A 3U0PA 4F91B 2CRGA 3S3MA 2DMTA 4PJ8A 5BPDA 4IOAF 1OF2A 3BH9A 2IEKA 2QF7A 3KLAA 4M9ZA 3WTWC 3DBXA 1QA6A 1HSBA 3G4SI 3UTTA 3KEOA 2FXAA 4KMUX 4NBQA 1XCBA 2X9DA 5F0FA 4AU7A 2V6EA 2K9MA 2M0CA 5L2JA 3U2RA 1B59A 5HOOA 3K1NA 1G59A 3VRJA 2O9LA 3HG1A 1RC9A 3R60A 2JVHA 4KA4A 2FU4A 2BY3A 1O3SA 4IHYA 2QSGX 1KU3A 1DP7P 3O3KA 5GAHJ 3DLAA 3RKQA 5DDHA 5EU3A 5LLQA 3V7RA 4GRIA 5K1YA 3KP6A 4BEHA 4PRIA 1W5SA 3MKWB 1TWGJ 2NXNB 3H9QA 4RGRA 3VXNA 2L5QA 4A0ZA 1YLFA 3R61A 3WG7H 4AWXB 1Y1WJ 2BW3A 3QWLA 2HPMA 1T39A 2R7XA 3CDGA 3O8XA 1N77A 3SZGA 1E2XA 4JRXA 3GSXA 3L3KA 3PWVA 1ZG5A 3W39A 4OMZA 4CZCA 1ZHBA 1AU7A 4FASD 1WH7A 1WSUA 3S16J 3E6FA 1W7PB 3K4JA 3TGNA 3JRCA 3HC7A 3F3XA 3JVGA 3H9HA 5FJ8J 1HLVA 1FZMA 3L9FA 5MENA 2O8XA 4F3QA 1AGDA 1IW7F 1T98A 1ZELA 2KRHA 3HHHA 4HV6A 2Q8KA 3RPQA 3CC4I 2MYSA 4U1JA 4XXCA 4UXNA 3ZMSA 3BPXA 3BWGA 3KP2A 3NRVA 2NW3A 5J4VA 3F0CA 1AKJA 1M6OA 2ZSVA 3GSQA 3FWEA 3FKJA 1XSDA 3D1NI 1N25A 4LB6B 4Q5SF 3QUZA 4L8SC 4BKWA 2W85A 2VKDA 3ABTA 4Y4RA 2VT2A 4CH7A 2Y9YA 2JWTA 3DU6A 3GBGA 3HSEA 3CCHA 1ORKA 1Z3YA 2QSFX 3A2KA 1T7XA 4NC7A 3ZMDA 3OXRA 3S3NA 3WTYC 1YJ9I 4BXUA 2LBFB 3P77A 5FDWA 5M5YJ 4PRPA 4ENJA 1S7VA 1USSA 3BGMA 1VQ5I 2IS1A 1OYYA 3A4CA 1FZPB 2VN2A 4G7OF 3SXYA 5J3LA 3MQ0A 5JLXA 1I6HJ 5SWQA 4JX4A 3HPJA 3P9MA 2E7XA 3VYUB 2FEZA 4G8XA 3L09A 1ZR4A 2GQQA 2VKVA 5SWSA 2ELHA 1K7AA 3CDLA 1ERDA 4BE0A 2GIZA 2P8TA 4Y17A 1VADA 4A3KJ 2XSJC 4QRSA 2B63J 2LP0A 4DYRA 4QRUA 3A01B 3KZZA 5BS0A 5FKMA 4RBOA 3BDDA 4MNQA 4RB2C 2P5LC 3S14J 1R5ID 2ID6A 3W6JB 2IT0A 1K4SA 4EJTA 4P1WA 2QYOA 1O3RA 3PUBA 5K5RA 2LR8A 2OQGA 4B43A 3CCLI 3C7JA 4BXXJ 1X1CA 1JPGA 3HE7A 1LEBA 3GO5A 3OYKA 1HW2A 3QZWA 3V8KA 1ZRCA 1NG7A 4Y15A 1Z05A 4BGDA 1B0RA 4EGYA 1YJNI 1QVUA 3EPZA 4IRHA 2CYYA 1OLTA 5CVUA 5K7HA 1QQDA 2VASA 4Y3OA 4A5NA 2VLAA 3PWLA 4FISA 2MW8A 1JGSA 3ARBA 3R4KA 3VFNA 1MHEA 2ZJ2A 1U8RA 2EV0A 4O5VA 1X7QA 2VLKA 2A6HF 3LSMA 4PFPA 4D0DA 3E97A 2P0WA 2VKEA 1Z6TA 1TWAJ 2CG4A 3KP4A 4Y4FA 1R22A 5E3OA 3TF7A 1SYSA 1T21A 4KT5C 5JHFA 3HOZJ 1KQ8A 5M5WJ 1X1PA 4QRPA 4NNYA 1ODDA 2AQFA 1R5GA 1UG2A 4KN4X 2KIFA 2QCOA 4HA8A 3ZN0A 3FMSA 4FQGA 3TBIA 2JA5J 1FEXA 5BRZA 1KONA 3L2UA 3G73A 1P2FA 1Z21A 1R49A 1XPXA 2OCCH 1NK2P 1MNMC 3FQWA 5C0JA 2V9PA 3IKVA 3GTQJ 3X13A 3H9JA 4B44A 4M6YA 3O9WA 5E6IC 3TOAA 2BYVE 3SEZA 1FC3A 2ZJQF 2OPTA 2VQLA 3MD2A 1BW6A 2Z2SB 2X6YA 5GAEJ 1FTZA 3MKZA 3UBXA 2W00A 1I6XA 1LDDA 5JHUA 1U9NA 3ABMH 3PQKA 4OIRF 4JX6A 3HOYJ 1HA8A 3JW4A 4C9YA 1ZT1A 3KPQA 4L4VA 1D5VA 3VJ6A 3C1DA 1D1BA 1ETKA 2EIKH 4O6JA 2ELJA 4UHTA 2R7VA 2BVQA 3AREA 1H89C 3EUHC 3QP5A 3D25A 3CCEI 2DFEA 1E17A 3TBSA 2EILH 2HQNA 2LSOA 4H0EA 2A5WA 4LJZF 4ZYHA 3RZCA 5LHIA 4BE1A 1TQMA 5M3FJ 3L00A 3AG3H 2NNYA 1OCRH 1S7TA 2Y9ZA 5GSRA 3I4NJ 1RESA 3MFKA 2F5EA 3ASOH 2FUG2 3OSFA 2G7UA 1ZG1A 4PCQA 3MROA 1MJ9A 5IOYA 4L9VA 2VQHA 2X1DA 4QRTA 1IJWC 3WS3A 3HHGA 3BLYA 5IROA 4NNJA 1HHJA 1AKHA 3WE2A 4XOTA 3E6BA 1YS7A 5MEPA 4E70A 3E6CC 1JXSA 1Z91A 3WS6A 4LCWA 3UR3C 3FQRA 3FMQA 3CH1A 5F0HA 1ZN2A 2CU7A 2LDUA 4U1KA 1JTXA 4NB5A 2CJJA 1EH8A 2FQ3A 4L9JA 2NYXA 1T08B 1P4XA 3LSKA 4UUTA 3FIWA 4FCYA 1X1AA 2YX7A 4ASNA 4A3IJ 1NH3A 1EA3A 1H9TA 1SAXA 3BTCA 3O3DA 3I59A 2M8EA 3ZR8X 1BJAA 1DU0A 4RMNA 5C0AA 3PSFA 3LOCA 2P5WA 1HC8A 3AL0C 4ONOA 2K9QA 1FBSA 4S0UC 4PDKA 5E9DA 3GFLA 2I5UA 4PJBA 2OAZA 2HKOA 5E8IA 1VGKA 3H5NA 3SEQA 2DQLA 3DWLE 2PLYA 2XB5A 1LPQA 5JFRA 2HTSA 2COBA 2JUGA 4MIMA 2GOXB 3WG9A 1RPWA 4LK1F 3VODA 5A2QZ 3MZ8A 1X19A 2K40A 4K71B 2AXGA 1REPC 2CUZA 3AL0B 3CC7I 3H9SA 2XKPA 1O7LA 4N4OB 2VAAA 1X4PA 2NAZA 2ZXWH 1LK2A 1T7ZA 4HQEA 3GIVA 4HLYA 3CCMI 4PGHA 2XGCA 2DA6A 1AHDP 1ZLKA 5JR3A 3U1DA 2P7VB 4ZTJA 1YO5C 2MC4A 2JA6J 1QVOA 3H36A 1AWCA 1JT6A 3KP7A 1BR1A 2VLJA 3Q9SA 3F6OA 4XN0A 2BHZA 3UTQA 1MMNA 1WI3A 2RQPA 1I50J 1X3WB 3OV6A 3K2AA 1GXPA 3OIOA 4BACA 4U1IA 5C07A 1EFXA 5INDA 2DO7A 2GJ6A 1JUMA 5J47A 4E7HA 3RPUA 2XPVA 2OL3H 3QYBA 4WWKC 2E5NA 5B1AH 3UNGC 3DBLB 3HEFA 3ZMUA 3ECHA 1QZZA 4AC0A 3K4MA 3N05A 3OYLA 2W48A 1QO0D 4HF1A 3ILPA 1P4AA 3E2HA 1TWFJ 4PJ9A 4JOMA 5DM7F 1KJ3H 1BL0A 4DYQA 2NVXJ 5IB2A 1ZGWA 3TOBA 3LN4A 1GVJA 5EU4A 3BR2A 1N75A 2UWMA 1ETQA 3VXOA 5F6FA 2VJIA 5H6QA 1HHKA 2DT5A 4V2GA 1IXCA 2TRTA 4ZZLA 3IRRA 2NX5A 5IM7A 3DBHB 1ZH5A 1BW5A 1ON1A 1KZHA 1OCCH 4CSWA 2GTWA 3VH8A 4PRBA 2PEXA 1A1OA 4HKJA 4BQQA 2F48A 3V8JA 3RSNA 5AD0A 4JRYA 2WY7Q 5D5XB 2XVCA 3RWDA 3BZEA 3F21A 1PUEE 4OINF 1K79A 1BBYA 3GZ5A 4M73A 4EJVA 1G3YA 4FT8A 4RAYA 3TFKA 3TBTA 2A6TA 3L2CA 1SD5A 4B4CA 1TWHJ 1FMWA 2DODA 2V9VA 2LKPA 4G8IA 3ZQ7A 4A3GJ 2XAHA 3QDGA 1Y56A 2HDCA 4G6DA 2HJKA 3FONA 3HKZA 1T22A 3MV9A 3BH8A 3RWIA 1FBUA 1ZAGA 1ZREA 4EEFG 2IS6A 1RIOH 4DIQA 3ERED 3PQJA 2PJRA 2YPKA 4PK4A 3BW9A 5IEKA 3Q9VA 2FD5A 3RZOJ 3HRMA 1IM3A 2BV6A 5CPRB 2HYJA 2QSHX 4S04A 1TVHA 3G1OA 3KLNA 5GPCA 3C9NA 2DA7A 4D7MA 2M2EA 2ZB9A 1ONQA 1YPZA 4ZUVA 3KEQA 3PIPF 2R7UA 1MMAA 2HZTA 3S17J 2B7EA 4FE7A 3LFKA 4I6ZA 1QRNA 1IZ1A 3PSIA 2EPFA 2XPWA 3BQZA 4M3GA 3VFVA 1ZKGA 4XM3A 2BOLA 2JUCA 2NS8A 2NVUB 2H1KA 1H9GA 1AO7A 2QM3A 1OR7C 2D5VA 4A93J 1S7WA 3V8LA 4MO7A 3R6SA 2HQRA 2WAFA 1GV2A 5K7FA 2JSPA 2HZDA 1P7JA 1GHCA 2Y0SN 3QUXA 3CCUI 2JA2A 3GTGJ 2HI3A 5B5EC 4KUMA 1ZQ3P 4NQEA 1RZ4A 4HX4A 3KXFA 4L3EA 1I3AA 4KIBA 5FB2A 1IGNA 2R7SA 1NAMH 3HLAA 5FO5A 2VXZA 1C16A 3IRQA 4U7DA 5EEAA 4I98B 3ZQFA 3HBLA 4I2OA 3DP7A 5L3FA 2L54A 2QENA 3TIDA 5E00A 1XGMA 2ETHA 3U1KA 3LA7A 5FLVA 4Z77A 1W36D 1FY7A 3IUOA 1POGA 1Z67A 2CQKA 4M6XA 1QHHD 2LKXA 4BQAA 4IOCF 3FTGA 3WU2C 2P5EA 3RPUD 1HW1A 1I1SA 3GSOA 3JAMZ 1SD6A 2KDZA 3PWJA 3K4KA 3SZPA 5CVVA 1T6SA 3K70D 3FQXA 1T56A 1X1DA 4UUVA 4EUPA 5F0CA 4YFKF 2VJ5A 1QHGA 1HF0A 2M9HA 2R7FA 3W2AA 3RWHA 2FQ4A 5ERIA 4HF2A 3G71I 2X4TA 4M72A 3FISA 3RQ4A 1D1CA 5IYBJ 5E18F 1E0EA 4HUUA 2VUMJ 3P7NA 4U0VA 1F4KA 2BVPA 2DAOA 3HOVJ 2G7HA 3BJ6A 3HE6A 3PWPA 4L3CA 1ON2A 4B09A 5FA3A 2ZFWA 4WXDA 4RB3C 4IHTA 4PUSA 4GO1A 2D31A 1LP9A 3CJTB 1XMAA 2Z1DA 1DPRA 1LFPA 2LRDA 4XL9A 1T8IA 4OIQF 5HODA 2CS3A 3CCJI 2XAJA 3GF2A 1WPKA 1WJFA 2X4HA 3KCCA 2GLOA 3LSTA 2FBHA 5E20A 3B6CA 3L7WA 3MYJA 4HDVA 1W0TA 1W5TA 2NNNA 4I99C 2X4OA 3DU5A 3LWFA 2DYSH 5EJCA 4MQ7A 2XASA 3TL4X 1WZ2A 3QUKA 5MEOA 2V2XA 4KIFA 2PG4A 1MNEA 1WJEA 2HTJA 3F8FA 3FRUA 3NWSA 3VRIA 2W4SA 3QDJA 3P9KA 4H4KC 2NOGA 2JMWA 4MNUA 1QZYA 1UFMA 1Z3XA 3SQNA 2QKMB 5C0CA 2QZ8A 3FXJA 5KCMA 4MQVA 5E8GA 2IBDA 1YS6A 3MEXA 2EIJH 4ZTFA 1AGEA 3VFPA 3K69A 4U87A 3SDDA 2CFXA 1MBHA 1R5HA 2ZXHA 4MXQA 2HU9A 3FFCA 2BGCA 4EJWA 1B72A 3W6VA 5HGHA 4HUWA 3DCFA 4MVBA 2HS5A 4PGDA 3GMNA 3QU3A 4HUVA 2F5VA 1RK1A 2FWOA 2MLGA 4U1HA 4RLQA 1OMIA 4BL0B 3GWZA 3HSFA 3VFZA 1Z9CA 2EWNA 3K4BA 3RKXA 2IP2A 1SFOJ 3AG2H 4AYBN 1G7QA 2FIKA 2O8KA 3ABLH 1SFEA 4E0RA 3GXOA 3ARDA 5INCA 2X70A 2ME6A 1CF7B 2Y0MA 2EFPA 1FOYA 3O2PE 1ZARA 5J6GA 1ULYA 1Z77A 4HZFA 1LDKB 3X14A 1KPUA 2JPCA 2RQQA 4XRMA 1T33A 1BIAA 4PJFA 4V3DB 1FP2A 1A31A 2GXBA 1BIBA 1ZTRA 2QWWA 3CF2A 2H26A 1FG2A 4ZZDA 2OUMA 3BCBA 4HBLA 2DA1A 2RAEA 4UV9A 3ZMTA 4LLNA 3HOUJ 1HHIA 1Z1DA 1EXUA 4Y4KA 5HLHA 2DN0A 3EDPA 3V7SA 1FSEA 1Q94A 2IGOA 3SJVA 3KPSA 4C2TA 3D5SC 1B3JA 1E28A 3HCVA 5D6FA 1YYVA 3VFRA 2X4RA 1PVEA 1MH4A 2IW5A 4OIPF 3SDAA 3FBNB 4NO2A 3LQQA 4XKBA 3OSGA 3X11A 3S1MJ 2GTZA 3GSUA 4EGZA 3LKRA 4BHBA 1MI5A 3D3VA 1LE8A 1T0FA 4AIKA 4HRIA 1OYWA 1IRZA 3DEWA 5D8KB 3B73A 4NQXA 1WRJA 4PJNA 1U8BA 4JFDA 1V4RA 5KNLA 2ADUA 1ZR2A 3GFJA 2OQRA 1T0FC 5LEJA 3WTXC 2KDOA 4EATA 1JI8A 3BR0A 3T8RA 2WV1A 3TW6A 3ZN1A 3KPMA 1UELB 5FLMJ 1BM9A 1X2MA 1XSXA 2HNHA 3QEQA 2Z9OA 3MRMA 5IT9K 1GVDA 4U1MA 4Y2DA 2A05A 1I4FA 1R1TA 4NQWA 3B02A 4FETA 4NC6A 4BY7J 4E7SA 5GADJ 5DDGA 5D5UB 1LEGA 3TBYA 1U5TC 4G59A 2CFOA 4ANJA 5B66C 3HGYA 3VPRA 4E5XA 1N59A 2ZXIA 3S2WA 2YR2A 5AIQA 4CCJA 1RJYA 2X1EA 1IUYA 2WWYA 3KYLA 2GA1A 3LKQA 1FBQA 3IHUA 1GZQA 4KIGA 4PJDA 3TO7A 5J6XA 1UQSA 1ZAOA 5BQTA 2KJCA 3QYFA 1TQIA 2ZSWA 2EZKA 5HS9A 1QSFA 5KAIC 1TNSA 3GTLJ 3FDYA 4F93B 1G7PA 2IGNA 3F8MA 1QPMA 2GBYA 3I6GA 3K1MA 4GGGA 2EQRA 2JZYA 4GYIA 3L1PA 2ZMEC 2CSOA 2MFZA 2VLLA 4PJCA 3D39A 5EYRA 3BP7A 3M3YJ 4NT6A 1R58A 1F36A 3M4OJ 4HQMA 3HRSA 3VYTB 4A0YA 1XSVA 2B0LA 4CUGA 1KBGH 3FXLA 3IAM2 4N5EA 1MMGA 3K1PA 4LIUA 4M6VA 2ZKZA 4BU2A 1WH5A 1QZEA 2R0QC 3IXAA 1M05A 4G12A 1EH7A 1LD9A 3DX7A 2BEOA 4J01A 5EZHA 5EZGA 4HF0A 3WGGA 4IHVA 4WXHA 1BQHA 2E1MC 1XS9A 2IA1A 1I7UA 3BXNA 4ZDLA 4GDFA 3A01A 4JFPA 3CDIA 1RUNA 4RAZA 4II3A 3LKNA 3FX3A 4DOZA 3QODA 5M3MJ 1GUUA 1ETXA 2CIKA 1KU9A 3CUQA 3HUGA 5D5WB 3M7GA 4E4HA 1SVLA 2DFHA 2L9SA 2E1MB 4HLXA 4RGUA 4BQOA 3WHBA 4GKSA 3OYAA 3O6BB 1ZHNA 1BI0A 2XHKA 2HPIA 5FKOA 4A6DA 3BZ6A 2XROA 4GFBA 3GJFA 3MMYB 5LHHA 3OS1A 5GTHC 3GW2A 3A02A 3CC5A 3RL1A 2EBIA 3ZQIA 1LFUP 2L01A 2DK8A 2OD5A 2ZJPF 1WVRA 1FT9A 4DNCA 2H6PA 2H94A 5D4RA 3MRRA 4ITVA 2KZGA 2J5PA 4CYDA 3VEPA 3MZHA 4RLFA 2FZ3A 2P6SA 2GM4A 4LMYA 1IG7A 3K9TA 2DA4A 1D8JA 4B3XA 1MBFA 4BJ5C 5L3GA 3A0BC 3O8GA 2DQRA 2STTA 3DX6A 3RKWA 2X48A 2VLRA 2LLKA 4L0YB 4C3IJ 1XZ0A 4LNRA 5J6HA 4F7TA 2XB0X 2RC4A 2JSCA 2F5FA 1F5TA 1EF4A 5DEGA 4G6QA 4M71A 2F4OB 4K2EA 5TGTA 3VWBA 5BPIA 2E2JJ 3DEEA 3ERYA 2L7ZA 2M5WA 2BY0A 1EV7A 2MC3A 3FOMA 3K10A 4N4NB 1YX5A 4FE4A 3E6MA 3O4LA 3G1MA 2P6TA 1IN4A 1WBXA 2EIMH 4HV5A 1YRNB 2DXIA 4RS8A 1VACA 2BW3B 2F4IA 1N3NA 2J8UA 3ERMA 2CH0A 1S7QA 3VFUA 4CVZA 1JKOC 1IV6A 4C2UA 3S1QJ 1X58A 1TWCJ 4G9DA 1ZLJA 5K5OA 4Y4HA 3AFHA 1XMXA 3M8EA 2I8DA 3QQAA 3FZVA 3F9KA 1S7OA 4PJJA 2R5YB 1HHGA 3ZRGA 2XV4S 4I0AA 2RVCA 3GX4X 3I6LD 1S7XA 2BVLA 4CICA 4DJAA 4EJOA 5HVQC 3GFIA 2HR3A 3OIQA 4EQQA 5IB4A 4QRQA 3RTQA 5LGNA 4WCGA 1JE6A 2MABA 3ES6A 2EZIA 2NOJB 2CV2A 3ARFA 3IP4B 4B47A 3DXAA 1MBKA 2F6CA 4CCMA 2VKHA 3ULQB 4U6XA 2DW4A 3GMPA 2K85A 4PJLA 5ICEA 1STZA 1JPFA 3MRQA 4FX4A 2R7DA 2BSTA 1D8KA 3HB9A 3IC7A 1UJ8A 2O03A 2J5OA 3K70C 4PG9A 1I5ZA 2XRLA 5B39A 4CYCB 1RRJA 2L9VA 2K02A 3E3VA 2VE9A 1T0MA 3TPUE 4BBRJ 3O8HA 3TDUC 4YFNF 5D5MA 1SVMA 1IDZA 5J1AA 4PJ5A 3W2VA 2Y2ZA 4XNFA 2PMZN 5L3DA 1HOCA 3TIEA 2K3PA 4KISA 5HLTA 1FZJA 4ZC3A 2K9NA 4UVCA 1J2XA 2JK3A 1TL8A 4XK4A 4Q47A 1QGPA 2VBXA 4QRRA 1VQLI 1J75A 4A12A 2FNPA 3E5XA 3EYIA 2LY1A 3GZNB 2LKSA 1VNDA 3CUQB 2P5KA 4V19K 2NRAC 3FM5A 1JHHA 4MS8A 5BJTA 5ICFA 3RGVC 3WTUC 1FFNA 2VPRA 1USTA 3EYYA 4KMFA 1VQKI 5HNFA 2W84A 1R6RA 3VB2A 2X4QA 6PAXA 2OI9A 4PV9A 4QTRA 3TEDA 4R8HA 1MBJA 1E3OC 2ISZA 3TA3A 2IRFG 4F7CA 3MRLA 1N2RA 5SWZA 1ZT4A 2DDBA 2V7FA 3P73A 1ZG3A 5FKKA 3J7ZI 2CO5A 2DDAA 5FRMA 3FXUA 4A3DJ 3BG9A 3QU6A 4BUPA 5LD2C 1A6IA 3F23A 1K83J 2GAUA 1S72I 2B9SA 2DTZA 1AGFA 2YU3A 3DF8A 5FFXA 2PBIA 1U2WA 3ECBA 1DE4A 3S2HJ 4XQFA 2X51A 2Q7YA 4X6EA 1D0ZA 5HHOA 2D1HA 3CPLA 2M4KA 3FKIJ 3V7CA 1JGDA 2GWRA 5JHDA 2CW0F 2DOEA 4WX9A 5KHDA 3C2BA 3OYIA 4MJIA 5FROA 1MSEC 1V55H 2YEZA 4IRJA 2F2EA 4XLNF 5D7JC 4O2FA 3MZYA 4DQ2A 2BXZA 3PNTA 2M30A 3BT9A 2VQCA 3ZXSA 3VXRA 2WAQN 2V26A 1FO0H 2E36A 2FE3A 4UV8A 4E7LA 5LHGA 1IRGA 4HG2A 3ZOBA 4IXAA 5FA4A 4HWZA 1UHWA 1U78A 5D4SA 3GTMJ 4AM3A 4EN3C 3TP3A 2BSSA 1T7WA 5KAFC 4IRGA 2VABA 2I10A 3KP3A 3DEUA 1B0GA 2EA4A 3KPOA 4JP0A 4I4WA 4CCLA 2KJBA 5J8FA 1YIJI 4UQ2A 2DMUA 5C9JA 4BHPA 2AXTC 1Q1VA 4XR6A 2LF8A 3IWFA 1OSZA 1VF9A 1WJAA 2DFFA 1JUFA 4XBFA 1RR8C 2X4NA 4BHCA 1G4DA 4HYEA 1OYIA 2RNGA 2A68F 1BJZA 2MH9A 3VXMA 1X2NA 4R1HA 1B8IA 2CMPA 3TW7A 1S8DA 2VB6A 1KU7A 1QO3A 3CUOA 3H5RA 3I64A 1HSAA 4LHUA 1R7JA 3TKYA 2R7QA 3J80K 1ZGJA 5C0BA 1P6RA 2VL8A 1YRNA 2WB1N 3PABA 5F7DA 5IB5A 2QKLB 4QLCU 3ZCOA 3G3ZA 2DJIA 3I71A 3KPLA 1YJWI 1UMQA 3G1LA 3S3OA 3GMOA 2WADA 4WU5A 4D0BA 2JT1A 2E2IJ 1T20A 1I39A 3F8BA 3MRJA 2OZUA 4XSZF 1PUFB 1WJCA 3JSOA 4NHJA 1RETA 3J81K 1WHUA 1BN5A 2CUFA 2KLOA 1WJDA 2E19A 3PM1A 1QR1A 1MW7A 1P7QA 1SFKA 4WO4A 1V3FA 1BI3A 4NO3A 4BDZA 1ONVA 3M1CA 4X6DA 3RTRA 2TCTA 2VJ4A 3CJNA 1VTNC 3KYOA 3QDMA 5A2QK 2R7WA 2PJRB 3C3WA 2UZKA 4E7JA 3UKGA 1DGWY 1Y39A 1UHMA 2Z5UA 3M9AA 4JFQA 4I0BA 3VSLA 3BY6A 1WBYA 4TV7A 1FP1D 1QSEA 4HUXA 3ONQA 5E1ZB 4EMSA 2HOSA 1ZHLA 2CLVA 3WTSC 5GAGJ 2WBMA 4A3LJ 3MCZA 4KICA 3BROA 1R36A 1XGNA 3HPGA 5HS7A 4G9FA 3LSPA 3CCQI 1HDPA 3OY9A 4IJAA 4BJ6C 3PL8A 5ISZA 2ZFUA 2HKXA 4A0XA 1HKQA 3S6CA 2X85A 2FRHA 2G9WA 1PP8F 2JA7J 4ZDPA 1BIIA 1X4OA 3JTHA 2GIVA 4BEHB 3PO2J 3K0LA 2R93J 1S29A 4Z76A 5CYVA 1MGTA 1SD7A 3NFNA 2BSRA 4IQ4A 4NQCA 1WI9A 4PG2A 2IGKA 2VC1A 2BY2A 5EO0A 2EH3A 2QQ9A 3DX8A 4KNYA 1Z7UA 2KISA 4DZPA 1IF1A 1JUPA 1A1MA 3I56I 2LH9A 1JE8A 5J1RA 2O6GE 1LKXA 4II2A 2L2OA 1A04A 2VI6A 3UPRA 1HKSA 1ZS8A 2KT0A 3BR5A 3V42A 2BNRA 2CV0A 5IYDJ 2IVMA 4G94A 1XCVA 4G6TB 5FKNA 1QU3A 1JHTA 2XGDA 4E7IA 1MDMB 3DMMA 4OOIA 2PQ8A 3BO8A 4JK1X 4FTHA 2M7AA 4I01A 3LSIA 1UHSA 3CZ6A 1AGBA 3FQNA 2HGCA 3L3HA 3CVHA 1T0NA 3KYDB 3DPUA 3TP0A 2LREA 1VQPI 2KIMA 2E5ZA 4PRDA 4PJGA 1QQIA 1U9OA 1ZRDA 3TBVA 3VOEA 4CYCA 2YX4A 1OFCX 1T1WA 2QQAA 3ZMVA 3DPTA 1B9MA 2XFXA 2L7FP 5ILSA 5ILUA 5GP9A 5HLIA 3MRIA 3PJRA 3OYNA 1D0XA 4GUPA 4PSXA 4PRNA 1A5JA 2NYKA 1DDNA 4PRHA 4YIFA 1RKWA 3JTTA 1UCRA 5IPAA 3F8CA 1KPRA 3M17A 4PJ7A 2O0YA 1T95A 3AG1H 3M07A 1WCMJ 4WJ5A 5E8PA 3E3QA 3PO3J 5FLXK 1TZLA 4DW6A 3T0YA 5DS9A 2P4WA 4EM0B 2GXGA 2R7RA 3CMEI 4CW1A 4PREA 3FMRA 4Q48A 3OYGA 1P4WA 2RFXA 3GTJJ 4LB5A 4XRSG 2MGQA 3DQVC 3MRHA 4P96A 2ME0A 2CWEA 3F8NA 1HSJA 1SVOA 3CP2A 5EDNA 3JREA 2XF7A 3JRHA 1VQ9I 5ACZA 1KJMA 2E35A 4IF4A 4ZJZA 4WUUA 2K4JA 2OU2A 5IYCJ 1ZRFA 1INQA 1E3HA 3VCLA 4MGRA 1ZYRF 5E79C 1YTYA 3P9CA 4IQJA 1ZSDA 1H0MA 2MH2A 2L9NA 2VT3A 5CVJA 2IS4A 5EO1A 3FK7A 1J9IA 1IUFA 2RNJA 4U0YA 1XH3A 4L8DA 2LMDA 4N0UA 3DPLC 1BD2A 3DTKA 2DFIA 1LB2A 4XICA 1LNWA 2K9LA 1B9NA 3OYEA 3I53A 1IDYA 5EEGA 1P1ZA 1R23A 3H35A 2QBYB 4CDGA 4EM2A 4BE2A 3GSWA 1KA8A 2VQGA 1O3TA 3WLBA 1C0WA 3GSRA 1B4AA 5EGOA 3QYEA 4ZUUA 2EZHA 2LBFA 1MNDA 2BVOA 4E7ZA 3JRAA 4CCKA 4CHUA 3HOXJ 2ICWG 1LVAA 3LSHA 4D5FA 3OYMA 1YHQI 1OGAA 3FF5A 1G3SA 4UVBA 1VFCA 2XGEA 5M5XJ 5JVGF 4G7ZF 4ESBA 2ZMEA 1TLHB 1BR2A 1GXQA 3E5QA 5J4YA 2E1CA 1LQVA 2XIGA 1YITI 3OYBA 5F04A 2ECBA 2CV1A 3WTVC 3BZFA 5D2NA 2HWVA 1R4MB 4BQNA 2E2HJ 4HDUA 1J59A 1VQNI 3I3LA 1JUSA 4LOCA 1H8AC 1XN7A 3RZDJ 4Z2YA 2V2WA 3MRDA 3ARGA 2PMUA 1SAUA 2E1NA 2FF4A 2K9SA 2M8GX 4RB0A 3VYSB 3WL9A 5BXFA 4RGXA 4MJ5A 3OR2C 4YG2F 3PFYA 3ZGKA 2ID3A 1LDJA 3C2HA 1JHFA 4APQA 3SCMA 3LQRA 4D0CA 1HW5A 2R5YA 4WF2A 3QRFF 4E7KA 2UV1A 1AA7A 2KIUA 3H5AA 2X4SA 4U1LA 2WV0A 2CLZA 2HOAA 2PFBA 4F92B 3HAEA 3ROUA 1XR9A 3P4OA 4ESFA 2X6XA 2XAFA 1Z7LA 1NG6A 2OCEA 2ZNZA 3I58A 5J1YA 3S1RJ 4HS3A 3SFIA 9ANTA 4ON0A 4KDPA 2DLLA 1XG1A 2RDPA 3REOA 3KIOA 1TTYA 1K5NA 1LEKA 4MTEA 2V1XA 2ZMEB 2VC0A 3EUHA 1UAAA 2AS5F 4N0BA 4K7FA 2UXNA 3HTUA 4I02A 3OS2A 3RYRA 1IM9A 1ETOA 5C0DA 5K5QA 3J7AO 3FOLA 4IVNA 3TO6A 1WJBA 2QVOA 4G9YA 4IL6C 1OQYA 1MBGA 3KLOA 2EA2A 4AVPA 1K4TA 1I1YA 1PUFA 4OIOF 1OCTC 2H6BA 4LLLA 1ETWA 2R3SA 3KPRA 3NWTA 1YIOA 2H8WA 5FRNA 2F74A 3V5HA 3OS0A 1FWZA 3BR6A 3E7LA 1T7VA 4OAYA 1R3HA 3BQYA 4Y33A 1Q1HA 4HSTA 4IRSA 3CJRB 4N0CA 1P7IA 4PV8A 1LQ1A 5CKTA 3UTSA 3BTIA 2E34A 1YN7A 2LOOA 2DT6A 2MG4A 4P55A 3D18A 3LKOA 4V2FA 2VOPA 2M7BA 1NANH 2EV5A 3JTSA 2UUZA 5LRRA 5CJ9A 2L7MP 3IH4A 1D0YA 5DEFA 1O4XA 5IOZA 2ZO4A 2PJPA 2F53A 1WWXA 2IAIA 3QAHA 2EFWA 2HDWA 1OISA 3OL3A 5F64A 4HNUA 1CG9A 2DMNA 1IRFA 5D9SA 2RGVA 2HVRA 4JQFA 2RV8A 2H8RA 4AYBA 4XIDA 3CTAA 4ELMA 3F72A 3DLLF 5H6RA 1XDSA 1E27A 3TQNA 2HXOA 1J09A 4HSRA 3RWFA 1ETVA 1O7FA 1EJ9A 4LGWA 3KEYA 4XRFA 3DKYA 1W0VA 3IKTA 5F9JA 2XAUA 2K4BA 3PNVA 3L2RA 3E6DA 1K6OA 3L3GA 4A5MA 1R71A 1G3TA 1K78B 2BHYA 3OWTA 1XGOA 3HSRA 1RK0A 3WU1B 5D2LA 1FYLA 5CQEA 1A9EA 3VFOA 1FLIA 4X6FA 2F4MB 2GITA 2XKOA 3QUYA 3MV7A 3J80Z 1W0WA 1N5AA 3MVPA 1CD1A 5L2KA 2LTPA 3EQLF 4EI5A 1XDUA 4X0GA 2JPBA 3A0HC 2EV6A 1FOKA 5ENWA 3KYCB 3SKMA 3T8TA 3U21A 3LFUA 5TRDA 1Z0XA 1DQUA 5E3NA 1S7UA 5D7IA 1WBZA 2KL4A 4JQVA 3H9GA 3CZFA 1O3QA 3S2DJ 2LFBA 1MMSA 4L8BA 1SMTA 3KX2A 3PWNA 3BP4A 1FIAA 5J1UA 1S5LC 3E6HA 2Y75A 5E3MA 4G42A 2HVQA 4I7HA 2DYPA 4PDCE 2IPQX 3GTKJ 1TT0A 1H88C 2EJRA 4UUSB 3JR9A 1PQZA 2BCKA 3J81Z 1AGCA 3GZ6A 4NUBA 1XB4A 1YW9A 1V5FA 4N0FA 3G2BA 3WUWA 5IEHA 1A6QA 3W6KB 2Y30A 4C3JJ 3I4PA 2DOAA 1P9QC 2K3FA 3B6AA 3JRDA 1FFPA 1MBEA 3MRFA 2E71A 1KYZA 3CUQC 5AONA 1ETYA 5FLXZ 5FFZA 1IO2A 5LEKA 3GYHX 1KTLA 2BE5F 1WFXA 3V4GA 5EG0A 4D0PA 4CGZA 1I7TA 2NVYJ 2R7OA 4IHSA 3M8FA 1BR4A 1TW3A 3FQUA 2GT9A 3RL2A 2BBYA 4XLFA 2AKRA 2LNBA 4JQXA 3MKLA 1T2KA 1BC7C 2DPDA 3HPHA 2VXDA 2DCEA 1Z6RA 2WA0A 3WGHA 4E6KG 3CMMA 3K7AJ 4CA0A 3LN5A 3TZVC 1EEYA 3WODF 2X1CA 4XKVA 3CCYA 3DFGA 1CGPA 4BDYA 2Q2EB 2ZOLA 4U6YA 4OAZA 3GSVA 3MRBA 2BNQA 1KU2A 4XLEA 5LGUA 4RGSA 4XOPA 3CESA 3DXJF 4YEJA 2COMA 3I4MJ 5C09A 2PN6A 5KK1A 1K78A 4JFOA 5C44J 4YFXF 3ML6A 2NS0A 2KFDA 2ACJA 1XMKA 1KGSA 1IV8A 4IHOA 5JI6A 3BVNA 3MWMA 4ZUTA 4DBQA 1A1NA 5EUOA 2K27A 1PJRA 5C0IA 3NAUA 1HSTA 2RN7A 3GMMA 2FA5A 3K2ZA 3LSGA 2K86A 5HGBA 3MGOA 2DK5A 2EK5A 4MFEA 3BEWA 2XGXA 3R0JA 2DPUA 3MV8A 1YW7A 1JTYA 4UUSA 4LK0F 3SPVA 4XLHA 4CZZA 4LITA 4ENKA 3OXSA 1U5TA 3K4CA 4L9TA 3LMMA 4IHWA 2W82A 3H0DA 2PYEA 4G59C 2AQEA 4W97A 5IP7J 4Z78A 1EH6A 3VFMA 1MJAA 1D5YA 3QFDA 4RA2A 4NO0A 4A69C 2V1DA 5E1XA 4HNVA 1RNLA 5HNHA 3Q5FA 1SANA 3BPVA 4P9FA 1MJBA 1TNTA 4QPOA 4M3DA 3L2QA 4MQ9F 1JJ6C 2IA0A 1MKMA 1GT0C 2JJ7A 1MMDA 3E0JB 3QOEA 1GLNA 3V5KA 5EGOB 1DGRM 2H6CA 2Y69H 4OWRB 3HTSB 2NVQJ 3GMQA 1S9XA 1TMCA 1ZVSA 3RWJA 2QLZA 3QPTA 5MERA 4L9NA 1JKQC 3KZYA 1WGXA 2E7WA 3AAFA 1Y8QB 2BXYA 2MHAA 3TN0A 4NHUE 5DD4A 5FKPA 3P4MA 2X6OA 5IT9Z 2A69F 2XF5A 3JRIA 5D5VB 3VFTA 3VFWA 3TVMA 4XMYA 1W7PA 4ABZA 4L8CA 2R5ZA 1XC5A 2V79A 3A1YA 3WE3A 1YN6A 4GKNA 4ZDOA 3F22A 5C0FA 4FX0A 3DKWA 5CVRA 1SD4A 3TMOA 4IKFA 4A3FJ 1XTAA 2ZXJA 1FJLA 3ABUA 1J5YA 2DA5A 2PX9A 4YELA 3H92A 2HYGD 1W5CC 1W1WE 3HL2A 5MEQA 2MD5A 4RAGA 4B8XA 1LUJB 4L5IA 5HDKA 3L2VA 3RWCA 5HHNA 3JCUC 3EUKL 4JBAA 3KPPA 1K8DA 5H94A 4U0WA 2D1VA 3LSJA 4KYWA 2M0MA 2JCCA 1ZHKA 1DP3A 1RI7A 4NNXA 3GMRA 1PYVA 2M87A 5BNGA 2L02A 5F1NA 2X0LA 2JRTA 4PJXA 4LIVA 5IY5H 3OMYA 1BA5A 1MSFC 2G0EA 2OBPA 4A3JJ 4RM2A 5E8NA 5EU5A 3MRCA 2P7CB 1VQ6I 1WJ5A 2R4GA 1S9YA 5E17F 4L5JA 3B6SA 4FHTA 1NEZA 2EFNA 3E5UA 4I09A 4WW2C 2E60A 3MRPA 4NO5A 1R1VA 2L7KA 2H1LA 1I27A 3DBRB 2ELKA 2QQBA 4QSHA 3JSPA 2BY1A 3WTTC 5CVIA 4M9SA 4OU0A 3LSRA 2HXIA 5DTDA 2FBIA 1CE6A 4BAYA 2HVSA 4U7BA 1YDPA 3AM8A 4XRSA 3CC2I 2O61A 3I6KA 3BR3A 3H1CA 5ED4A 3C8KA 1R00A 4IPAA 2PI0A 2KRCA 3L9RA 4WDIA 4OMYA 1I1GA 1LFBA 5IT3A 3REWA 2QBYA 1U0JA 2A3SA 4IRIA 5TJJA 2KHMA 2ZSHB 1S9HA 4AD9A 2JA8J 5AIPA 2MSYA 5C0GA 3HZJA 4G8GA 5J40A 3GMEA 5EEHA 2VPLA 2CLRA 3DV8A 5IB3A 1D3YA 3BG7A 3C2GA 4PFOA 4PP8C 3V5DA 2ECCA 2OF7A 4P9UA 5HDNA 3P9IA 1ENHA 5E1WA 4A3BJ 4BNCA 5B3SH 1YOVB 1YFHA 4C30A 2TDXA 4LCYA 5BS6A 2JRMA 4HNTA 3FHZA 3C18A 4ZYDA 4FTVA 4PGEA 1R4NB 3HG9A 3OOPA 4S0HB 1HQCA 4PJIA 2WY8Q 2ZC2A 2ZNYA 5KVRA 3CCVI 3HDDA 1I1AA 4AIJA 2FNAA 1VQ7I 1IAWA 4IEJA 2CW7A 1U58A 1KYWA 3QQ3A 3FXQA 3M1EA 3L3DA 5HYJA 2GOMA 3HUGB 1Y0NA 4O2CA 3I59B 2Q2EA 2DI3A 3QFJA 4B1RA 3HRUA 1G6RH 3HKZN 3J7AY 4C3HJ 4A3CJ 3HUJA 4DZJA 3ROOA 1HXDA 2Q0OA 4ZYAA 2ESHA 2GAZA 1WQ2A 3QPLA 4HX8A 4EM1A 2WAQA 5LGTA 2P5VA 2V1NA 4XLAA 1HCRA 4RDUA 1TT5B 5ICGA 4IO9F 2JTVA 3T8XA 4UB6C 2UXXA 5IP6A 5F27A 3DTEA 3FXMA 3VXPA 4PGCA 3FBIB 4MFDA 5B38A 1OR7A 3PWUA 3LAPA 1XR8A 1NK3P 1K6YA 3T1FA 2NVTJ 3Q0UA 4C2MJ 4UQ3A 2ESVA 3ILQC 1S7RA 1DUZA 1KQ0A 1ZHFA 4L0ZB 1VQ8I 2PO6A 1D1AA 2KIQA 2OTLI 3Q0WA 4BJTA 3N97A 4J19A 1DDHA 4JO8A 5C0EA 4ZUWA 2N8GA 3T5XA 4GYGA 3SFZA 3KPNA 4Y13A 4F7PA 2F54A 2K7LA 5D7LA 4BKXA 2VONA 1A35A 4LG0B 5HHMA 4RB1A 2VBWA 4D1QA 3JRFA 4U1NA 3VXSA 3S1NJ 2OC6A 2V4JC 1OKRA 4J00A 1ITYA 2AO9A 2KMUA 4JFFA 2VIXA 4DBRA 2HLAA 3KFWX 4ESJA 3S8PA 3EUAA 5EG0B 2FX0A 4KJZA 5DD8A 3RJPA 3GTOJ 3BC8A 5F1IA 2X6WA 5FGMA 1L0OC 4YIRX 3DTXA 2QQ8A 3NEUA 3OX8A 2V1UA 2XUBA 2LK2A 4BYYA 4IHXA 2JQ7A 4F52A 1IRXA 1YE9A 3U9GA 3JTCA 4QWQA 2HOTA 4MNGA 4NQWB 3VDXA 4CVXA 2PMZA 3BG6A 1K61A 3K4NA 2R5ZB 4AIDA 2OJED 3CO7C 3GTPJ 1V5GA 1TP4A
chains in the Genus database with same CATH topology
2HFHA 1IN8A 3LA2A 3HRTA 3GLXA 1X3UA 2Z33A 3GEZA 2H09A 2EFQA 3HYIA 3I5UA 2A6EF 1KQ9A 2YSRA 1BI1A 5DCMA 2XAGA 3ELKA 1PP7U 2W25A 5L3BA 1MDMA 2HYFA 5FD5A 1OPCA 4EVIA 1U5TB 1DPUA 2A07F 4U88A 2ISYA 2F5DA 5DCFA 4BH9A 2MBFA 4CO8A 3TDZC 2FOKA 3I0TA 3N4MA 5BMZA 1FPQA 4GXOA 3H3UA 1SMYF 5HLGA 2D2WA 4N9HA 3D0SA 4M9XA 1FYMA 1BI2A 5F1RA 1HKTA 1F9NA 4AIHA 1IXRC 3PFIA 4HX7A 4R79A 1MD0A 4G7HF 3HIFA 1MZBA 3TO9A 2IA2A 2L3DA 3JAMK 3FXRA 3LAJA 1J7KA 2HOEA 4UVAA 1S6LA 1XD7A 3NQOA 3I54A 4MEXF 3WTZA 2XAQA 4EV0A 2O3FA 4KN7X 4ZH4F 3IL2A 4WXCA 1BC8C 3HOTA 5DYMA 1T38A 3D5LA 1UB9A 4LD5A 5DUIA 1U3EM 3EETA 2A5YB 2M45A 2MA3A 2IJLA 5CLSA 1P92A 3WU0A 3KP5A 1BOAA 4ENNA 1J0RA 3QPHA 1G3WA 2L4AA 1IN6A 1FX7A 1YQAA 4LLGF 2MLKA 4ETSA 3CO6C 5DUKA 4HOBA 2W57A 3CLOA 1IXSB 1S8NA 3SHFA 1U6GA 4N9IA 2C6YA 2KRFA 5D8LB 2L4MA 3MAJA 1S3JA 3OV8A 2AXLA 3SZTA 3GFMA 4ENMA 2WC2A 2XRNA 5HS8A 5H20A 4ZYEA 1HBXG 4XSXF 3BOQA 2V6CA 2H27A 4PGGA 4YIIA 2FMLA 1S7AA 2HEOA 3KETA 5JVTA 1ZGAA 5D6EA 3GVAA 2DBBA 1YW8A 3RI4A 2GZWA 2D45A 1WKMA 2A61A 1DUXC 3ZMZA 2VOOA 5HDGA 3WGIA 2PMHA 2RKHA 4MHGA 4HW0A 2VODA 4KFCA 1NHAA 2GA2A 4MTDA 1LEAA 4GCVA 1XGSA 4EJUA 4A6EA 1YG2A 5DEQA 3T1BA 3CDHA 2M1BA 2OZ6A 2EFOA 4XLPF 5J8CA 3ZPLA 3BJOA 3RDIA 5DV5A 1W4MA 4O3MA 1RUOA 2VBZA 1O57A 3F6VA 4WWCA 1TW2A 3LA3A 1SFUA 4LG0A 3FM3A 3BJAA 5L3EA 1W7PD 2EB7A 1R1UA 3HOSA 2W24A 1QBJA 2STWA 3RKYA 3ECOA 1L3LA 2WTEA 3KE2A 2FBKA 3IWZA 4Q4ZF 2VE8A 5DCMB 2Z3YA 1B6AA 2OA4A 3QOPA 1CF7A 2ESNA 1F1ZA 3R0AA 4A2UA 3ZP5A 4UNOA 4P5OA 2VBYA 4F7ZA 2F5CA 3ISPA 2QUFA 3COAC 1B1BA 1TBXA 1LJ9A 4ZYGA 2DTRA 1FSHA 1AOYA 5FD6A 5LRSA 2CGPA 3RYPA 3BP8A 5ILVA 1TQPA 4MEYF 2ZBKA 2FMYA 1IN7A 4L18B 2KKOA 1SFXA 3RIRA 3GUDA 4CXFA 2Z99A 3H3ZA 4HAMA 2LF7A 4PZJA 1IN5A 5L3CA 3JTGA 4M74A 1PDNC 1Y0UA 2Y48A 4S05A 4WK8F 1QNTA 2DU9A 2ZCWA 3QP6A 5LBQA 4LFUA 1G6NA 5BOXA 1FNNA 1FYKA 2YPRA 2FSWA 5ICCA 5BPDA 4M9ZA 3WTWC 3KEOA 2FXAA 4KMUX 1XCBA 3U2RA 1B59A 5HOOA 3K1NA 3R60A 4KA4A 2FU4A 1O3SA 1KU3A 1DP7P 3O3KA 5LLQA 3V7RA 5K1YA 3KP6A 1W5SA 4RGRA 4A0ZA 1YLFA 3R61A 4AWXB 1T39A 1E2XA 1ZG5A 4OMZA 1WSUA 1W7PB 3TGNA 3F3XA 3L9FA 2O8XA 1IW7F 1T98A 4HV6A 3HHHA 2Q8KA 3RPQA 4UXNA 3ZMSA 3BPXA 3BWGA 3KP2A 3NRVA 3FWEA 1XSDA 4LB6B 4Q5SF 2W85A 3ABTA 2VT2A 3HSEA 3ZMDA 3WTYC 4BXUA 4ENJA 1USSA 1OYYA 1FZPB 2VN2A 4G7OF 3SXYA 3MQ0A 2E7XA 2FEZA 4G8XA 3L09A 2GQQA 2ELHA 1K7AA 2P8TA 4Y17A 3KZZA 3BDDA 4RB2C 2P5LC 3W6JB 2IT0A 4EJTA 2QYOA 1O3RA 5K5RA 2OQGA 3C7JA 1LEBA 3GO5A 1HW2A 3V8KA 1ZRCA 4Y15A 1Z05A 4EGYA 4IRHA 5CVUA 2CYYA 4A5NA 1JGSA 3R4KA 2ZJ2A 1U8RA 2EV0A 4O5VA 2A6HF 3E97A 3KP4A 1Z6TA 2CG4A 1R22A 4KT5C 1KQ8A 1ODDA 1R5GA 4KN4X 2KIFA 4HA8A 3ZN0A 3FMSA 3G73A 1P2FA 3IKVA 4M6YA 3TOAA 2BYVE 1FC3A 1I6XA 1LDDA 5JHUA 4OIRF 3PQKA 3JW4A 1D5VA 3C1DA 4O6JA 4UHTA 3QP5A 1E17A 2HQNA 2LSOA 4H0EA 4ZYHA 4LJZF 5LHIA 1TQMA 3L00A 2NNYA 3MFKA 2F5EA 2G7UA 1ZG1A 4PCQA 1MJ9A 4L9VA 3HHGA 3WE2A 3E6BA 1YS7A 4E70A 3E6CC 1JXSA 1Z91A 3FMQA 1ZN2A 2LDUA 4NB5A 1EH8A 2FQ3A 4L9JA 2NYXA 1P4XA 1H9TA 2YX7A 4ASNA 1SAXA 3I59A 2M8EA 1BJAA 1FBSA 4PDKA 3GFLA 2OAZA 2HKOA 5E8IA 2DQLA 2PLYA 5JFRA 2HTSA 3WG9A 4LK1F 3VODA 5A2QZ 1REPC 2XKPA 1O7LA 2NAZA 4HQEA 4HLYA 4PGHA 1ZLKA 5JR3A 3U1DA 2P7VB 1YO5C 1AWCA 3KP7A 3Q9SA 3F6OA 2RQPA 1GXPA 2DO7A 3RPUA 3ZMUA 3ECHA 1QZZA 4HF1A 1QO0D 1P4AA 3TOBA 1GVJA 2UWMA 5F6FA 5H6QA 2DT5A 1IXCA 4ZZLA 3IRRA 1ZH5A 1ON1A 2PEXA 3V8JA 5D5XB 2XVCA 3F21A 1PUEE 4OINF 1K79A 1BBYA 3GZ5A 4M73A 4EJVA 1G3YA 4FT8A 4RAYA 3L2CA 1SD5A 2V9VA 2LKPA 3ZQ7A 2XAHA 2HDCA 4G6DA 1FBUA 1ZREA 1RIOH 3ERED 3PQJA 3Q9VA 3HRMA 2BV6A 4S04A 3KLNA 3KEQA 2HZTA 3LFKA 1IZ1A 1H9GA 2QM3A 3V8LA 3R6SA 2HQRA 1GHCA 4KUMA 1RZ4A 4HX4A 4KIBA 5FB2A 5FO5A 2VXZA 3IRQA 4U7DA 4I98B 4I2OA 3DP7A 5L3FA 2L54A 2QENA 1XGMA 2ETHA 3LA7A 1FY7A 2CQKA 4BQAA 4M6XA 1HW1A 1I1SA 3JAMZ 1SD6A 3SZPA 5CVVA 1T6SA 4UUVA 4YFKF 2R7FA 5ERIA 4HF2A 4M72A 5E18F 3P7NA 4U0VA 1F4KA 2DAOA 2G7HA 3BJ6A 1ON2A 4B09A 2ZFWA 4WXDA 4RB3C 4IHTA 4GO1A 1XMAA 1DPRA 4OIQF 2XAJA 3GF2A 2X4HA 3KCCA 3LSTA 2FBHA 5E20A 3L7WA 4HDVA 1W5TA 2NNNA 3LWFA 2XASA 4KIFA 2PG4A 2HTJA 3F8FA 3P9KA 4MNUA 1QZYA 1UFMA 3SQNA 2QZ8A 4MQVA 5E8GA 1YS6A 3MEXA 3K69A 2CFXA 1R5HA 2BGCA 4EJWA 2HS5A 3QU3A 2MLGA 1OMIA 3GWZA 3HSFA 3VFZA 1Z9CA 2EWNA 3RKXA 2IP2A 1SFEA 3GXOA 1CF7B 2Y0MA 2EFPA 3O2PE 1ZARA 1ULYA 4HZFA 1LDKB 2JPCA 1BIAA 1FP2A 2GXBA 1BIBA 2QWWA 4ZZDA 4HBLA 4UV9A 4LLNA 3ZMTA 1Z1DA 5HLHA 3EDPA 3V7SA 1FSEA 5D6FA 1YYVA 2IW5A 4OIPF 3LQQA 4EGZA 4BHBA 1T0FA 4AIKA 1OYWA 5D8KB 3B73A 1WRJA 1V4RA 2ADUA 3GFJA 2OQRA 5LEJA 3WTXC 3T8RA 3ZN1A 1BM9A 1XSXA 2Z9OA 5IT9K 1R1TA 4NQWA 3B02A 5DDGA 5D5UB 1U5TC 3S2WA 2YR2A 5AIQA 1IUYA 2WWYA 2GA1A 1FBQA 3IHUA 4KIGA 3TO7A 5J6XA 5BQTA 1ZAOA 2KJCA 1TQIA 5HS9A 1TNSA 3F8MA 1QPMA 3K1MA 4GGGA 4GYIA 2JZYA 2CSOA 1R58A 4HQMA 3HRSA 4A0YA 1XSVA 2B0LA 3K1PA 2ZKZA 1EH7A 2BEOA 4HF0A 3WGGA 4WXHA 2IA1A 1RUNA 4RAZA 3FX3A 1KU9A 3CUQA 3HUGA 5D5WB 3M7GA 4HLXA 4RGUA 3O6BB 1BI0A 2XHKA 4A6DA 2XROA 3BZ6A 5LHHA 3GW2A 2L01A 2DK8A 2OD5A 1FT9A 4DNCA 2H94A 5D4RA 2J5PA 4CYDA 3VEPA 3MZHA 2P6SA 4LMYA 3K9TA 1D8JA 5L3GA 2DQRA 2STTA 3RKWA 4L0YB 2RC4A 2JSCA 2F5FA 1F5TA 4G6QA 4M71A 4K2EA 5BPIA 2M5WA 1EV7A 2MC3A 3E6MA 2P6TA 1IN4A 4HV5A 4RS8A 1ZLJA 5K5OA 3M8EA 3FZVA 1S7OA 2XV4S 4I0AA 2RVCA 3GX4X 4CICA 4EJOA 5HVQC 3GFIA 2HR3A 4EQQA 5LGNA 4WCGA 3ULQB 2DW4A 5ICEA 1STZA 4FX4A 2R7DA 1D8KA 3IC7A 2O03A 2J5OA 1I5ZA 2K02A 3E3VA 2VE9A 3TDUC 4YFNF 5L3DA 4UVCA 1J2XA 4Q47A 1QGPA 2VBXA 1J75A 4A12A 2FNPA 3E5XA 3EYIA 3CUQB 2P5KA 2NRAC 3FM5A 1JHHA 5ICFA 3WTUC 1USTA 3EYYA 4KMFA 2W84A 3VB2A 6PAXA 4R8HA 2ISZA 2IRFG 1ZG3A 2CO5A 3FXUA 3QU6A 3F23A 2GAUA 2YU3A 3DF8A 5FFXA 2PBIA 1U2WA 2D1HA 3V7CA 2GWRA 2CW0F 4WX9A 2F2EA 4XLNF 3MZYA 4DQ2A 2M30A 2FE3A 4UV8A 5LHGA 1IRGA 4IXAA 1UHWA 1U78A 5D4SA 4IRGA 3KP3A 3DEUA 2EA4A 2KJBA 5J8FA 4BHPA 2LF8A 3IWFA 4XBFA 4BHCA 1G4DA 4HYEA 1OYIA 2A68F 2MH9A 4R1HA 1KU7A 3CUOA 3I64A 1R7JA 3TKYA 3J80K 1ZGJA 1P6RA 4QLCU 3G3ZA 3I71A 2JT1A 3F8BA 2OZUA 4XSZF 3JSOA 4NHJA 3J81K 1BN5A 1V3FA 1BI3A 1ONVA 3RTRA 3CJNA 1VTNC 5A2QK 3C3WA 2UZKA 1UHMA 2Z5UA 3M9AA 4I0BA 3BY6A 4TV7A 1FP1D 4EMSA 5E1ZB 3WTSC 3MCZA 4KICA 3BROA 1R36A 1XGNA 5HS7A 4IJAA 2HKXA 4A0XA 1HKQA 2FRHA 2G9WA 1PP8F 3JTHA 2GIVA 3K0LA 1S29A 5CYVA 1MGTA 1SD7A 1WI9A 2VC1A 2QQ9A 4KNYA 1Z7UA 1IF1A 1JE8A 2O6GE 1A04A 1HKSA 2IVMA 4G94A 1XCVA 1MDMB 4OOIA 2PQ8A 4JK1X 4I01A 2HGCA 2KIMA 1QQIA 1ZRDA 3VOEA 2YX4A 2QQAA 3ZMVA 3DPTA 1B9MA 5ILUA 5ILSA 5HLIA 1DDNA 4YIFA 1UCRA 3F8CA 2O0YA 5FLXK 3T0YA 2P4WA 4EM0B 2GXGA 3FMRA 4Q48A 1P4WA 4LB5A 3DQVC 4P96A 2CWEA 3F8NA 1HSJA 4IF4A 2K4JA 2OU2A 1ZRFA 4MGRA 1ZYRF 1YTYA 3P9CA 1H0MA