3I0TA

Sulfur-sad at long wavelength: structure of bh3703 from bacillus halodurans
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
178
structure length
170
Chain Sequence
SLEKQIESYYQEIAQLIIDMIPEEWAEVRFYAQEDHDGWKIFFFHYLSASSDEWTKDIDIRDVIKVPQDEFMEKYNELSFCISDFRKDYAEAFGEPWMSFQMTFYASGKFNIDFYYDKNPFDTFLTRLAWQYEHFGTIPEDSFYKETLNEYLEEKAQGKRYPFLEPLHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Sulfur-SAD at long wavelength: Structure of BH3703 from Bacillus halodurans
rcsb
source organism Bacillus halodurans
molecule tags Unknown function
molecule keywords BH3703 protein
total genus 54
structure length 170
sequence length 178
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04634 DUF600 Protein of unknown function, DUF600
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3i0tA02
3.30.500.20 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 BH3703-like domains 3i0tA01
1XSDA 2FA5A 4DQ2A 1B1BA 1UB9A 4XLPF 1PDNC 2OQGA 3KLNA 3MEXA 4MQ9F 2ZO4A 2Q2EA 2XHKA 2QBYA 2L4AA 2H09A 5CYVA 4N0BA 4GYIA 1KQ8A 2NYXA 2M8EA 2EV5A 2CO5A 1BIBA 1O57A 2OBPA 1FYKA 4ZYDA 4Q48A 1U5TA 1WQ2A 1GXQA 2CQKA 5L3BA 2LF7A 4RAZA 2EA2A 4PGGA 1HSJA 3HSFA 4EJUA 3EQLF 4UV9A 2FBIA 4UV8A 3WE3A 2IP2A 3M7GA 4O5VA 4U7BA 3R0AA 3ROUA 1IN4A 3QP6A 1RUNA 1E17A 2VE8A 4L5JA 4M9XA 1J75A 2P5VA 3T8TA 2PG4A 1KU9A 1TTYA 1P4AA 1HW1A 5LHIA 4UUVA 2ESHA 1JHFA 4G6DA 2IW5A 3WU1B 1IRGA 2ZMEB 4BHCA 1J5YA 3ZMUA 1XB4A 4EGYA 3DQVC 3GWZA 1P4XA 3SXYA 4OIOF 1O3RA 2L54A 3V7CA 4YG2F 1EH7A 4G94A 1R23A 2A6HF 5HLHA 3I59B 1W5SA 1TQPA 2YSRA 3WTZA 3ZQ7A 1TNSA 4GYGA 4N9HA 2HFHA 1I6XA 1K7AA 3E6MA 3KP4A 4JQFA 2P5LC 2GA2A 2IRFG 5L3EA 2DTRA 1E2XA 3Q9VA 4XSXF 5HLGA 3RJPA 2WTEA 5IT9Z 1G3SA 5DD4A 4HA8A 3WU0A 1LNWA 2YR2A 2ZCWA 4RB1A 4OIPF 4G8XA 3E5QA 4UNOA 5HDNA 4BHPA 4KMUX 3W6JB 3DKWA 4D0PA 2C6YA 3U9GA 4ON0A 4G9YA 1WSUA 5J6XA 3R6SA 4A5MA 1L3LA 1P4WA 1LJ9A 1HW5A 3F22A 3REOA 4MQVA 2MLGA 3QAHA 1B6AA 2O61A 2VODA 1G4DA 1Q1HA 3ABUA 3L7WA 5DD8A 3LAJA 2M1BA 1O7LA 3N4MA 5ILVA 1A04A 3HOTA 5EEGA 4AD9A 5LBQA 5E8IA 1FYLA 1R1VA 1FX7A 3SZTA 2HDCA 5F64A 4ESFA 3QU6A 3HSEA 4WXHA 4HV5A 1ZARA 5H6QA 1YLFA 2ZBKA 3J81K 2XV4S 3IKVA 2FBKA 1XGNA 3ECOA 2R7FA 3N97A 3I4PA 1MJ9A 4FHTA 5DCMB 3FXRA 1FOKA 2QM3A 3QPHA 4BXUA 1J0RA 3JSPA 2XAQA 5E1ZB 4G6QA 3RPUA 3E3VA 2VONA 2VBYA 3V8JA 2OU2A 5K5OA 3F8BA 2O3FA 1VTNC 3LFKA 3CO7C 1X3UA 4EVIA 1K78B 4ENNA 1Z91A 3NQOA 5L3GA 1AOYA 1BI0A 1F5TA 3M8EA 4I09A 1B9MA 2XROA 2PLYA 2DI3A 3FXUA 2M45A 2YX4A 4HDVA 3BY6A 1Z7UA 4HX4A 4CDGA 4RS8A 3K1MA 4A6EA 2OQRA 2FF4A 4GO1A 2K02A 3NEUA 3RKWA 3RTRA 4L0ZB 4Y17A 4A2UA 4UVBA 3WGIA 4OIRF 4IHSA 1GXPA 4ZH4F 3J81Z 5HOOA 4ZYEA 3L9FA 3I54A 3FMQA 4KN7X 3C3WA 1P2FA 2ZMEA 1YW7A 5E20A 2JPCA 3GYHX 3FHZA 1USTA 2EFPA 3WTUC 5KVRA 2BBYA 4I98B 4RB3C 3ERED 1JE8A 1S8NA 2VBZA 3SQNA 3LSTA 2FSWA 4HQMA 1U8RA 2X4HA 2PN6A 4R79A 4HX7A 2TDXA 2PFBA 3Q9SA 4HYEA 2UWMA 2EA4A 3FZVA 3ECHA 2J5PA 1QO0D 1OYWA 4YIFA 1F1ZA 1IN6A 2Z5UA 3CO6C 1QBJA 1G3TA 3U1DA 1J9IA 5HS9A 4HZFA 2RC4A 2QQAA 3GFMA 3WTXC 2EV0A 3OOPA 4G7OF 4BQAA 4I01A 2GXGA 1FBUA 3DF8A 4LMYA 1IZ1A 2JRTA 3T0YA 5LRSA 2BV6A 4NB5A 1MDMA 2V6CA 3FF5A 4RGRA 1G3YA 2A61A 3TO6A 4CZZA 3KP6A 2FMYA 3K1PA 2BE5F 2HGCA 3GVAA 3LA2A 1YS7A 2DLLA 1UHWA 1BJAA 5HDGA 2K4BA 5BS6A 5ILSA 4HF1A 3G3ZA 5HLIA 4Z2YA 2VC1A 4IJAA 1QPMA 5HS8A 4LG0A 2HWVA 4KN4X 4PDKA 1S7OA 2RDPA 3JAMZ 3T8RA 1KQ0A 2MH9A 2DAOA 4EQQA 4Y13A 5K1YA 3Q5FA 3V8LA 1R36A 5D4RA 4WK8F 2EB7A 1B4AA 4RAYA 4HDUA 1SFEA 1WKMA 2KRFA 2YU3A 3MCZA 5EEHA 5E1WA 4WF2A 1G3WA 3ABTA 5DUIA 2P5KA 1BIAA 3HOSA 2CG4A 5D6EA 4WWCA 5CVJA 2ESNA 3TO9A 4P9UA 2F5DA 1FNNA 1OYIA 2EFOA 3GUDA 3TDZC 2DO7A 2K7LA 1K78A 5BOXA 3AAFA 3ZPLA 1FYMA 3M1EA 4YFKF 2E7WA 2V9VA 5ICEA 2GIVA 3ZMDA 3WE2A 1GVJA 3KZYA 2XRNA 4ENMA 3K69A 4FT8A 1TQIA 2DU9A 1R00A 3LQQA 2IA2A 1FWZA 3T1BA 1T6SA 2RGVA 3KEOA 3KE2A 2WWYA 4RB0A 4H0EA 4ENJA 4UXNA 3FMRA 2Y48A 2B0LA 4HBLA 1BC7C 5LGTA 1HW2A 1QQIA 1RIOH 3NRVA 2DT5A 4FX4A 4XRFA 2Q8KA 4YFNF 1TW2A 3HHHA 3GFIA 3CUQC 3F6OA 4XBFA 1UFMA 1ZG1A 3RYPA 1FBSA 3RKYA 2EWNA 1FSEA 2D1HA 2ACJA 2UZKA 1MGTA 5FFZA 3ELKA 3CUQB 3BDDA 1WRJA 4P9FA 5D4SA 5LLQA 3GW2A 3O6BB 1ON1A 3KLOA 2EFWA 1TQMA 1R7JA 5L3FA 1YO5C 5FLXK 1LEBA 4O6JA 3HUGA 4M73A 1YS6A 2F5EA 1XDUA 4L9VA 2DBBA 2E1CA 2EK5A 2JZYA 2HQNA 1WWXA 3WTWC 1O3TA 3F23A 3FMSA 3LQRA 3KETA 1BC8C 2H6CA 1OMIA 5FFXA 4BHBA 2M87A 4L18B 4HLXA 2ZJ2A 4M9ZA 2V79A 1IN5A 2DFIA 4E70A 4OMYA 1KGSA 4XLNF 5TRDA 4XSZF 4A5NA 5LHGA 1IW7F 1FBQA 1O7FA 5LHHA 3K9TA 2XAGA 1R1UA 1KYWA 3LAPA 5K5QA 2COMA 1T2KA 2L01A 3HRSA 4EM2A 2VT2A 1JGSA 3LWFA 2IJLA 3CDHA 3HIFA 5D5VB 1MDMB 4N9IA 4HOBA 3GO5A 4A0ZA 1FLIA 1O3QA 3OV8A 3IWFA 2DK8A 1XSVA 1W7PB 3CUOA 3DFGA 2H27A 3HTSB 4U0WA 1IAWA 2H6BA 3V8KA 4JBAA 5CVVA 2FNAA 5FD6A 4RGSA 2R3SA 3EYYA 4U0VA 4LG0B 3RYRA 1BN5A 2QWWA 4HV6A 3JAMK 1KU7A 1YG2A 4OINF 2CFXA 1T98A 2IA1A 2F5CA 3GEZA 5L3DA 1ZREA 4HF2A 2HS5A 1ZLKA 2FRHA 3O3KA 2G9WA 3WTSC 2DPUA 1S3JA 1ZH5A 1XSXA 3LA7A 3HHGA 2XGXA 5BPDA 1EV7A 2O03A 3PQKA 1MJAA 1U5TC 1FP2A 1KU2A 3E5UA 4WCGA 1MZBA 3L09A 3GZ5A 5HS7A 4ESJA 1TW3A 3TGNA 1LDDA 5JI6A 4R8HA 1R5GA 5F6FA 4IF4A 1IXSB 2CWEA 4MHGA 3FXQA 3U2RA 2MBFA 2LSOA 3FWEA 2NS0A 3BZ6A 1R22A 1RI7A 1R5HA 5LEJA 5E17F 2P6TA 4U0YA 3I53A 2O8XA 2CGPA 3F8CA 2XUBA 3D0SA 1QNTA 2OAZA 5BPIA 4EJTA 4CO8A 1RNLA 4QWQA 3HTUA 1ZGJA 3E5XA 1K79A 1J7KA 2ZNYA 2DW4A 3KP2A 2A3SA 2IVMA 3TQNA 3K1NA 3KP7A 2PMHA 2OZ6A 4ENKA 3BPXA 3P9CA 2O0YA 4WXCA 2MD5A 2ETHA 1I1SA 3W6KB 4LLLA 4I2OA 2OZUA 1IXRC 2FU4A 3HRTA 4Q5SF 4MTEA 2FEZA 4IRIA 1XMKA 3CUQA 1YW8A 3I0TA 2Z33A 2JSCA 3R4KA 3C18A 4L9TA 1HSTA 1R1TA 3M8FA 5AONA 4IRGA 5IT3A 4IXAA 2FBHA 3BPVA 5ED4A 2XKPA 3GZ6A 4BNCA 5LEKA 5TJJA 3IC7A 3EYIA 4P55A 3SZPA 3RI4A 4M71A 4OOIA 2VC0A 2DQLA 4AIKA 4EGZA 2GZWA 3VOEA 2LF8A 2LKPA 3BJOA 3PQJA 4DNCA 1U2WA 2A07F 1YIOA 4U88A 4IRHA 4GXOA 4KT5C 3S2WA 3ZMTA 5HDKA 1REPC 4YFXF 2MA3A 2W57A 2V1UA 1LB2A 1LQ1A 2D1VA 3I5UA 3HSRA 5FGMA 1L0OC 4EJVA 1C0WA 4UVAA 2P8TA 4EMSA 1QZZA 1FY7A 4HX8A 4MGRA 4EM0B 5E1XA 1P6RA 4L9NA 4AIJA 1EH8A 5H20A 2VT3A 2A5YB 2IA0A 2VBXA 3BROA 1SFXA 3L2CA 3BOQA 3MZYA 4CHUA 4KFCA 1W7PA 3H3ZA 3EETA 1JHHA 2K86A 3QPTA 1PP7U 3MWMA 4L9JA 4P96A 3BJ6A 2K27A 1FC3A 1ULYA 3I58A 4HW0A 2W85A 2MH2A 2VE9A 1V3FA 4ZYGA 4PZJA 1BBYA 2STWA 3E6CC 3SHFA 1W7PD 1Z9CA 4WXDA 5K5RA 1KU3A 3R60A 1SMTA 3BWGA 3H92A 1XD7A 2VOPA 4L0YB 5DYMA 3TO7A 3JSOA 2FOKA 4AIHA 2EFNA 4LJZF 4EJOA 3IRRA 1Z6RA 1FSHA 1LDKB 2GA1A 5D8KB 1U6GA 4B8XA 1U78A 1S7AA 1IF1A 5CJ9A 3PFIA 1MD0A 4B09A 2ZKZA 1DPUA 2HOEA 2QQBA 2Z99A 5DDGA 4I7HA 4IPAA 5ICFA 1Y0UA 1P92A 4LFUA 2XKOA 4M9SA 1HXDA 3QRFF 4Y15A 3R61A 5D8LB 1BI1A 3ZMZA 2QENA 2RKHA 5H6RA 2IPQX 2H94A 2X0LA 1ZHFA 3H3UA 4CICA 3GFJA 1LDJA 2D45A 1YYVA 2HR3A 1SD6A 4LLGF 2VBWA 1Z1DA 1UCRA 3ZMSA 1OPCA 4BYYA 2RVCA 2F2EA 3FM3A 1BI2A 2LDUA 3RKXA 2JT1A 4IVNA 4Q4ZF 3P9KA 4UVCA 3WTYC 2CW0F 2XIGA 1CF7B 1OKRA 1IN8A 2XVCA 5HVQC 4EM1A 3WTVC 3VFZA 2PMUA 1STZA 2FE3A 2LNBA 4LGWA 1U3EM 2E1NA 3WGHA 1H9GA 2G7UA 2XAHA 2PBIA 4IHTA 3ZMVA 4LLNA 5FLXZ 2QVOA 1XN7A 1IXCA 2PEXA 4ZYHA 2WC2A 4MNUA 3TOAA 2YPRA 2ADUA 1XGMA 4M74A 4NQWA 4I02A 3R0JA 2HQRA 3ISPA 1MKMA 2K4JA 2DPDA 4CXFA 4ESBA 5CVRA 4KIGA 4OIQF 4RGUA 1YW9A 2PQ8A 4LK0F 3MAJA 1K6OA 3E6DA 4UHTA 1Z6TA 1GHCA 2V1DA 3C1DA 1S29A 1I1GA 4K2EA 2M5WA 2BGCA 2L02A 1SD5A 3CTAA 2R7DA 3FM5A 2A69F 1ZG3A 1I5ZA 2A68F 2EJRA 3MFKA 5D5XB 2QUFA 4KIBA 2Y75A 3J7AO 2Y0MA 2RV8A 1ON2A 2OA4A 1FZPB 2O6GE 2VXZA 4HF0A 3I71A 5FD5A 3V7SA 3TOBA 4ETSA 1DUXC 3WGGA 1T0FA 1EH6A 1PP8F 4R1HA 2P7CB 4LB6B 1O3SA 4TV7A 5F1RA 4OU0A 2G7HA 4MTDA 4KICA 5CVUA 4A12A 5JFRA 3MZHA 1SFUA 1BI3A 5A2QK 3GXOA 2CSOA 5E8GA 3RIRA 2D2WA 4KIFA 1ZAOA 2PI0A 1XCBA 2ZNZA 4MEYF 2A6EF 3JTGA 4KUMA 2FMLA 5ERIA 4A0XA 3F21A 2RQPA 1DPRA 3V7RA 4KMFA 3KFWX 2BYVE 1T38A 5KK1A 1H0MA 4LD5A 3KCCA 3J80Z 1OR7A 4Q47A 3VB2A 3F3XA 2QQ9A 4ASNA 5LGNA 3IHUA 1HKTA 3DPLC 2HYFA 1TLHB 4A6DA 1J59A 4KYWA 3KEQA 2FQ3A 3DXJF 2GAUA 4G7HF 5L3CA 1IUYA 4PCQA 3RPQA 2ISYA 1SD7A 1S6LA 5DUKA 1DDNA 3BJAA 1KA8A 1RUOA 4BAYA 3ZP5A 4WX9A 2OD5A 1FP1D 4GCVA 3F8FA 5ICGA 1DP7P 2W25A 1T39A 2XAFA 2IT0A 3TKYA 4HLYA 3E6BA 2Z9OA 2ZXJA 2QZ8A 1FPQA 3JW4A 4U7DA 1Z05A 3WODF 1KYZA 1IRFA 1W5TA 3RDIA 3K0LA 2F5FA 1I27A 4GGGA 2NNNA 5J8FA 5LRRA 3EUHA 2EV6A 1LVAA 3DP7A 1CF7A 1USSA 3QOPA 3CLOA 6PAXA 3SFZA 1XGOA 1YQAA 4M6YA 4NHJA 3CJNA 4HAMA 1SMYF 3DV8A 4KNYA 1B9NA 2FNPA 4KDPA 3O2PE 1ZGAA 5AIPA 3KZZA 3ML6A 1W4MA 2EFQA 3I64A 3P9IA 4ZZLA 2GQQA 2WV0A 1ODDA 5AIQA 5D6FA 5ILUA 2KJCA 1ZLJA 2W84A 3HRUA 2NNYA 2QLZA 5D5UB 2HTJA 5D5WB 1ZN2A 3M9AA 4M6XA 4OMZA 5FO5A 1ZRCA 4QLCU 2KIFA 3EDPA 5CVIA 2KIUA 4BH9A 1LEAA 3MQ0A 2QBYB 1HBXG 5J8CA 1D3YA 1XCVA 2L4MA 1XGSA 2ISZA 1YFHA 3BP8A 4I0AA 5LGUA 1KQ9A 3L00A 4S04A 5ICCA 1ONVA 3TDUC 2W24A 1U5TB 3VODA 3B73A 3COAC 1OYYA 4F7ZA 4LK1F 2XASA 3LA3A 5JVTA 2HKXA 2DQRA 4S05A 4LB5A 3ULQB 1XDSA 2NAZA 2JPBA 3P7NA 3IRQA 2JTVA 4ZZDA 2M30A 3FX3A 3QP5A 1FT9A 3HYIA 1G6NA 4AWXB 2MC3A 3IWZA 1JXSA 2STTA 2ZFWA 2RNJA 5CLSA 3WTTC 2HZTA 2J5OA 2Q0OA 3F8NA 1ZG5A 1UHMA 2YX7A 3KP3A 2V1XA 2XAJA 4MEXF 2P4WA 1SAXA 3GX4X 2ELHA 2UXNA 1ZRFA 3I59A 4PGHA 1QZYA 2P6SA 4CGZA 4L5IA 2AXLA 2DK5A 2QYOA 4KA4A 2PJPA 3HRMA 3DPTA 1PUEE 5A2QZ 4I0BA 1H9TA 2HKOA 2KKOA 1ZYRF 3C7JA 2NRAC 1TBXA 5DCFA 2AS5F 5DEQA 3IKTA 2RN7A 5E18F 2HYGD 1XMAA 1QGPA 1B59A 2KIMA 3ZN1A 3GF2A 4JK1X 4RGXA 1IN7A 4YIIA 2Z3YA 1F4KA 3QU3A 4O3MA 2MLKA 1CGPA 3T5XA 1F9NA 1ZRDA 3G73A 1BOAA 3GLXA 3IL2A 3B02A 1D8KA 4HQEA 2GXBA 2FXAA 1BM9A 2VN2A 3VEPA 2KJBA 2UXXA 1R58A 3ZN0A 2VOOA 4P5OA 2L3DA 1HKSA 4RB2C 2E7XA 3J80K 1HQCA 1HKQA 3V4GA 3D5LA 3DEUA 3WG9A 1D8JA 3F72A 3KP5A 1YTYA 3K2ZA 2HEOA 4CYDA 4FX0A 5IT9K 4EV0A 1NHAA 5BMZA 3JTHA 5JHUA 2GWRA 3F8MA 1MJBA 3E97A 2BEOA 1D5VA 5FB2A 1J2XA 5BQTA 4M72A 4EJWA 4AVPA 5DV5A 3F6VA 1SD4A 4A0YA 1AWCA 1TNTA 1V4RA 2P7VB 3GFLA 1WI9A 5JR3A 1RZ4A 2HTSA 4G7ZF 5DCMA 2CYYA
chains in the Genus database with same CATH superfamily
1XSDA 2FA5A 4BE1A 2H26A 3GLLA 2CIKA 3FQTA 2DN0A 4CYCB 5GTIC 1Y1WJ 4PGEA 5M3MJ 4DQ2A 3ILPA 2VLKA 1R5ID 3ESWB 4PJHA 1ZHLA 3H1CA 5HYJA 1B1BA 4BUPA 3VXMA 4ZAKA 1UB9A 4XLPF 2JK3A 3QODA 1LVKA 4NBQA 1PDNC 3HE7A 1X3ZB 2FUG2 2M8GX 2TRTA 3TN0A 4UUSA 2ZOKA 1Z3YA 2OQGA 3KLNA 4NQXA 1ONQA 3ECBA 3KPRA 2UV1A 3X14A 3MEXA 5E3NA 2HYJA 4MQ9F 2ZO4A 2Q2EA 4FFEX 3L3IA 3GSOA 2XHKA 2FIKA 3VJ6A 2QBYA 1K6YA 2L4AA 3GZNB 1NAMH 2H09A 3O8GA 4LG3A 5CYVA 4N0BA 2GOMA 2VB6A 1VI0A 4GYIA 5GAGJ 1KQ8A 2V2XA 1ZT4A 4KJZA 4F92B 5MERA 2NYXA 2M8EA 2AQEA 2EV5A 4A3DJ 5FA3A 3QYFA 2CO5A 2M2EA 4BJTA 1BIBA 2Y30A 3W0WA 1O57A 3P73A 2OBPA 3SDBA 2G0EA 1FYKA 4ZYDA 4Q48A 1W0TA 1U5TA 1WQ2A 3IAM2 2XB5A 4O2EA 3BEWA 4F7EA 1GXQA 2CQKA 2LF7A 4RAZA 5L3BA 3PNYA 1T1XA 3GBGA 4M3FA 2EA2A 1FEXA 4PGGA 1HSJA 1AGFA 3AKZA 4E7LA 3HAEA 3HSFA 2M0CA 4EJUA 4XOTA 1TWHJ 2WA0A 3EQLF 4UV9A 3JVGA 3FXMA 2FBIA 4XN0A 4NNXA 3OYAA 3FXKA 1P9QC 2Z16A 3KYDB 4UV8A 3WE3A 5IOZA 5D2NA 2IP2A 2DA2A 3MRGA 4HUXA 3M7GA 4O5VA 3ZQCA 1ZR4A 1S7RA 4U7BA 3R0AA 3ROUA 1IN4A 3N05A 4IOCF 1E3HA 2KDZA 4E4HA 4C30A 5EG0A 3QP6A 2K9SA 4A3KJ 1RUNA 1E17A 1I3QJ 3D5SC 2VE8A 2AHQA 1QQDA 4L5JA 4E5XA 4JO8A 2XSJC 1T0MA 4M9XA 4ZC3A 2P5VA 3T8TA 2LY1A 2PG4A 3HPGA 1J75A 1KU9A 3BR5A 1TTYA 1P4AA 1WBZA 4ZUSA 1HW1A 4CCNA 4LHUA 1ENHA 5LHIA 4UUVA 2ESHA 4G9DA 1JHFA 4BACA 3BCBA 5C0IA 4G6DA 2IW5A 3HM5A 3WU1B 1Y6IA 4ANJA 1IRGA 2ZMEB 4OWRB 1N2RA 4BHCA 1JPFA 1J5YA 3ZMUA 1XB4A 4XONA 4EGYA 3DQVC 1ETYA 1SFKA 3DX6A 2ZSHB 3PUFA 1IC8A 3PSIA 1GT0C 3GWZA 1QO3A 1P4XA 3CMMA 3SXYA 4OIOF 1FTTA 2W48A 2YUSA 2JCCA 1O3RA 5FJ8J 4X6EA 2D5VA 2F54A 1P7JA 3PWUA 2L54A 3H5NA 3V7CA 4YG2F 3LKPA 4E7IA 1EH7A 3DLAA 4G94A 3K70D 1WZ2A 1R23A 2A6HF 4BU2A 5HLHA 4IQJA 4U1SA 3I59B 1W5SA 3A2KA 2DJIA 3VFVA 1X19A 1TQPA 3LN4A 2YSRA 1OCPA 1GVDA 3QOEA 4LIUA 3WTZA 3ZQ7A 1QA6A 1TNSA 2X4UA 4HNUA 4GYGA 5EFIA 1JF1A 1MBFA 4N9HA 2HXOA 2HFHA 1I6XA 2EZKA 4QSHA 1K7AA 3E6MA 3KP4A 4JQFA 5EGOB 2P5LC 4E7JA 2GA2A 1TWCJ 2IRFG 5B1AH 5L3EA 2JA6J 5C08A 2DTRA 1E2XA 2XAUA 3S3OA 3A03A 3Q9VA 1MH4A 4YRVA 2VI6A 1VGKA 4XSXF 5HLGA 3RJPA 3OY9A 2WTEA 5IT9Z 1MIJA 3H0DA 4QRUA 3CJRB 1G3SA 4XOPA 2F4IA 1R3HA 1X4OA 3HC7A 4II3A 5DD4A 4F55A 2BW3B 1OSZA 3QI9A 3VFWA 4HA8A 3WU0A 1S9WA 3KWWA 5HHOA 2ZXHA 1LNWA 3CCEI 2YR2A 2GITA 2ZCWA 1RR8C 4RB1A 1Q1VA 4OIPF 4G8XA 2R4GA 1MMAA 3E5QA 3A01B 4DZPA 4UNOA 1T80A 5HDNA 3PNTA 4BHPA 3V5DA 3AM8A 4KMUX 3KEYA 3W6JB 5K7HA 1P4LA 3MV8A 1F43A 3BCAA 3DKWA 3CH1A 4D0PA 5SWZA 1NTCA 4PFOA 2C6YA 3BW9A 3U9GA 3TBYA 3M1CA 1S7WA 3GTMJ 4NO3A 4ON0A 4G9YA 1NG7A 1WSUA 1OISA 3REWA 4CZCA 5E79C 2IGOA 5J6XA 3R6SA 3FISA 4G8GA 4A5MA 1L3LA 1P4WA 1LJ9A 2DFFA 1HW5A 3F22A 2DFHA 3REOA 4RLFA 2HXIA 2JRMA 4MLOA 1YPZA 4CVZA 1RESA 4MQVA 1VQ5I 3S2HJ 2MLGA 5E8NA 1OGTA 1W72A 3QAHA 3QUKA 4HNVA 2BVMA 3V42A 1B6AA 3X11A 1VF9A 4XORA 2O61A 1XG1A 1ETXA 2Y9ZA 3KPQA 5FA4A 1B3JA 1WCMJ 2VODA 1G4DA 1Q1HA 3KXFA 3ABUA 3L7WA 4MIMA 5DD8A 2YU9J 5DTDA 3LMMA 3LAJA 2M4GA 2M1BA 4BEHB 3QYBA 1S9HA 1O7LA 3L3DA 4JOMA 3F0CA 3SZGA 5ILVA 3N4MA 5L2JA 4B44A 1A04A 3HOTA 5EEGA 1YJ9I 1I1YA 4AD9A 3PUBA 5LBQA 3DEWA 5E8IA 4O2CA 3MKZA 1FYLA 3HJEA 3MRFA 4XRMA 5EU5A 2CV2A 1BR1A 1R1VA 3PABA 3GSQA 1FX7A 2XGEA 2LTPA 5F27A 3SZTA 4DJAA 2QSGX 4XKBA 2BNRA 3L3GA 3BG3A 4DZJA 2CJJA 4FETA 4BJ6C 2HDCA 5F64A 4ESFA 4NC6A 4ZFZA 2E60A 3VFNA 2FWOA 1OGAA 4PV9A 2PO6A 3QU6A 3HSEA 5IP6A 4HSRA 3ZXSA 2NOGA 4XLEA 2CW8A 2X6YA 1CQTA 3BT9A 3ARDA 2IS2A 4WXHA 3B6SA 3BGMA 3CCSI 4HV5A 1ZARA 5H6QA 1OCCH 1YLFA 2ZBKA 3VSLA 2PX9A 3J81K 2XV4S 1ZK8A 3A1YA 3IKVA 4PRAA 3RWJA 2BY0A 3CC5A 1RPWA 5HGHA 3RPUD 5IB4A 4PP8C 1PYVA 5IB3A 5MENA 2EINH 1DUZA 2M34A 2R7TA 2FBKA 2M7AA 4J19A 4PJEA 1XGNA 3ECOA 2R7FA 5J4YA 2CW7A 3N97A 3I4PA 2WY3A 1MJ9A 1UELB 4FHTA 5DCMB 3FXRA 1FOKA 2CV1A 2QSFX 3O4LA 4PRIA 5ISZA 1A9BA 2QM3A 3QPHA 4BXUA 3BG7A 4CYCA 1G6RH 1J0RA 3JSPA 3JRGA 2XAQA 1HHHA 5E1ZB 2EBIA 3ABKH 4G6QA 4BQNA 1LQVA 2DA4A 3I6GA 3RPUA 3E3VA 2VONA 4NO2A 4J00A 1MMNA 2W4SA 2VBYA 3V8JA 2OU2A 3GIVA 5K5OA 2W00A 2Q2EB 3F8BA 3TP0A 2O3FA 1VTNC 3LFKA 1T22A 3CO7C 3WHCA 2VKHA 4D9JA 1FZJA 1MH3A 3QUXA 1X3UA 4EVIA 4B3XA 2PYEA 3CCVI 1K78B 4ENNA 1Z91A 3NQOA 5L3GA 3MGTA 3CD6I 1AOYA 1BW6A 1ZSDA 4PRDA 3C9NA 4XMYA 3ARBA 3VFPA 1VQ7I 2JJ7A 1BI0A 1F5TA 4L3CA 2DA6A 1OJLA 3M8EA 4I09A 1VADA 1FMWA 2P81A 1J09A 1B9MA 1T8IA 4U1KA 1MNEA 1XH3A 5EZGA 5KAFC 4MO7A 4D7MA 2XROA 1W0WA 4BQOA 2PLYA 2DI3A 2GAZA 4AM3A 1LD9A 3FXUA 2KL4A 2M45A 4NUBA 1FJLA 2IBDA 2WV1A 2YX4A 3PJRA 3RZDJ 3DTKA 4HDVA 3BY6A 1GDTA 3FQWA 1Z7UA 2DT6A 2ID6A 3VPRA 3BR3A 4HX4A 3O3BA 4PSWA 4CDGA 4RS8A 3K1MA 3MR9A 3MKYB 4A6EA 2CKBH 5FRMA 4NHUE 3H9GA 2OQRA 2FF4A 1BZ9A 1E28A 1WJAA 1P1ZA 4GO1A 1E3PA 2D31A 2L9SA 2MHAA 2K02A 3NEUA 2OTLI 3RKWA 4MVBA 3P9MA 2EIMH 3RTQA 3RTRA 4M3DA 4L0ZB 4Y17A 4A2UA 5JHFA 4UVBA 1DUYA 2UWEA 2CUFA 5EG0B 5TISC 3WGIA 3QQAA 4OIRF 4DW6A 1IM3A 4QRPA 5IP7J 4IHSA 1GXPA 3GMRA 4A93J 3GMLA 3BR6A 4ZH4F 3MRIA 1RJYA 3J81Z 2FJ1A 5HOOA 3CCHA 4ELMA 1YX3A 4ZYEA 3BO8A 3AL0B 3L9FA 3I54A 1H89C 1HLVA 1HYRC 3FTGA 3FMQA 3RWIA 4KN7X 4A3LJ 3C3WA 5LFAA 5HGAA 5GPAA 1P2FA 1P7IA 1SAUA 2ZMEA 1IGNA 3J7AY 2X4RA 1YW7A 5E20A 2JPCA 3OS1A 3BC8A 3HKZN 3GYHX 2R7XA 3FHZA 1USTA 2EFPA 5CPRB 3I55I 1JKQC 3WTUC 2X70A 3W2VA 5EZHA 5KVRA 2BBYA 2VQCA 4I98B 4RB3C 1ZGWA 3ERED 3K4JA 4Y2DA 2BVQA 3QDMA 1JE8A 2E2HJ 1RKWA 1S8NA 2VBZA 2DT7B 3SQNA 1JI8A 3LSTA 1W36D 4GFBA 3HPHA 2FSWA 4HQMA 1U8RA 2H1LA 3HZJA 2X4HA 1AO7A 4PGDA 2PN6A 4A3EJ 3P5JA 1X58A 4R79A 4HX7A 2TDXA 1XC5A 1BR2A 4WWKC 1N75A 1WH5A 4NT6A 1Q94A 2PFBA 1L8JA 3Q0WA 3MRKA 2E1MB 2F4MB 1I39A 1Z3XA 4IHYA 3Q9SA 4PR5A 1MI5A 4HYEA 2UWMA 2EA4A 3FZVA 3BH8A 3DTEA 1M1EB 1D0ZA 3JRBA 1BR4A 2W82A 1V54H 4PJFA 4CSWA 1SC7A 3ECHA 2J5PA 2VE6A 2QEXI 1QO0D 3KYCB 1OYWA 2MD0A 4YIFA 3O3EA 1F1ZA 4A3IJ 1IN6A 3FT3A 4WUUA 2Z5UA 3CO6C 4Y33A 1H88C 1QBJA 1D1CA 1G3TA 4MXQA 4HX1A 3U1DA 1WJCA 3IUOA 3A01A 3TBWA 5EUOA 2AXTC 1TWGJ 3LSJA 3NARA 4NNJA 4BL0B 4C3IJ 1J9IA 5IYCJ 5JHDA 3UBXA 5HS9A 2BZTA 3QDJA 3RUGA 5HHPA 2I10A 2OF7A 3DPUA 1IDYA 4HZFA 1YHQI 3WS3A 2RC4A 4JFOA 2QQAA 1K4TA 4JX6A 2CLRA 1UXWA 4PREA 3GFMA 2KLOA 3WTXC 2LRDA 1KJMA 2EV0A 3OOPA 5IM7A 4G7OF 3KIOA 4DGWB 3OS0A 2ZC2A 4BQAA 1GZPA 4I01A 2JSPA 2GXGA 2OV7A 1MBGA 1RKTA 2E1OA 1FBUA 4PJDA 5J6HA 3OYCA 2VPLA 5F1IA 3DF8A 4LMYA 1IZ1A 2CQNA 3MV9A 1I3AA 3LSRA 1U9OA 2NOJB 2L9RA 2JRTA 3T0YA 1AKHA 5LRSA 2BV6A 4NB5A 3VFRA 1EKEA 2V6CA 1MDMA 3FF5A 4JP0A 2K85A 4RGRA 1BL0A 1G3YA 1MNMC 1MMSA 2A61A 2FZ3A 3TO6A 1I7RA 3QZWA 4CZZA 2L7MP 2HI3A 3KP6A 4IRJA 3ILQC 2FMYA 3K1PA 2BE5F 2JUCA 2PJRA 5EEAA 1HC8A 2VLJA 2HGCA 3GVAA 2BXZA 3LA2A 2R0QC 4BBSJ 1YE9A 2DYSH 2K5CA 1QVOA 1YS7A 4IKFA 2VAAA 1ZELA 2DLLA 1B72A 5AD0A 1UHWA 3FOMA 4BEHA 1LP9A 5F08A 5GAEJ 3KPSA 3CDIA 1BJAA 5HDGA 2K4BA 2VQLA 3S93A 5BS6A 5ILSA 1VQLI 3G3ZA 5HLIA 4HF1A 1GUUA 4Z2YA 2VC1A 4IJAA 2KISA 1QPMA 5HS8A 4LG0A 2MSYA 1N25A 3ERYA 5B66C 1R4MB 3IV5A 1WJ5A 2HWVA 4MS8A 4KN4X 4PDKA 1S7OA 1W1WE 1N59A 4PJGA 4N4NB 2B7EA 2DYRH 3QYEA 2RDPA 3JAMZ 1W36C 4LCWA 3HBLA 3T8RA 2LD5A 2ESVA 4XNFA 4PGBA 5C44J 1KQ0A 3GSUA 1U8BA 3VFSA 2MH9A 4MQ7A 2DAOA 3G71I 2NVQJ 3HDDA 4EQQA 4Y13A 2VLLA 1O4XA 5K1YA 3Q5FA 4MJ5A 4RDUA 3O8HA 2VJ5A 3V8LA 4XLAA 3K10A 3OX8A 1R36A 2M7BA 5J40A 5B38A 3IH2A 1A1MA 1TL8A 1RC9A 1EF4A 1UZCA 5D4RA 4WK8F 2XB0X 3OYLA 2EB7A 3LNQA 1HF0A 1B4AA 4ONOA 1V5FA 4RAYA 3DMMA 4HDUA 1SFEA 1WKMA 2KRFA 1WFXA 2YU3A 1EFXA 3MRHA 1K5NA 3LKSA 2EILH 2UUZA 1YJWI 4JFPA 3MCZA 5EEHA 2E7LE 5E1WA 4WF2A 1G3WA 3ABTA 3BR2A 3HB9A 2XPUA 4NC8A 5GP9A 5DUIA 3RWHA 1JGEA 3UKGA 4YEJA 2VQGA 2P5KA 3KPHA 1BIAA 3TO4A 3HOSA 3MZ8A 5LD2C 2X4QA 5F04A 2CG4A 2LVSA 3CCMI 4NO5A 3O9WA 5D6EA 1FOWA 1XMXA 5CVJA 2ESNA 4WWCA 1FOXA 4EN3C 3OYHA 2OTJI 3H9HA 3TO9A 1SFOJ 1MBHA 2R7WA 3OYJA 4P9UA 4BBRJ 2F5DA 1VQOI 1JT0A 2V26A 1FNNA 1OYIA 2BVLA 1PUFB 2YPLA 2EFOA 3DBLB 2NVYJ 1ETQA 1NK3P 3GUDA 1ED3A 2L9VA 3TDZC 5IROA 1JTXA 1PJRA 5J1UA 2DO7A 2K7LA 4IEJA 5BOXA 4M3BA 3BR1A 1K78A 2JVGA 2KDOA 3AAFA 1FYMA 3ZPLA 3M1EA 3HOVJ 4U6XA 4YFKF 2E7WA 2V9VA 5ICEA 2GM4A 3VXRA 2EPFA 1I4FA 2GIVA 4UB6C 1SVOA 2DJNA 4OAYA 3WE2A 1GVJA 3ZMDA 1T1WA 1UMQA 2ECBA 2E1MC 1DGRM 4FCYA 3VRIA 3KZYA 1AA7A 2XRNA 3P4MA 1ITYA 3OIPA 4ENMA 2BNQA 1Y0NA 2QKMB 1I50J 2E36A 3OV6A 1MBEA 3FHNA 3K69A 4FT8A 1TQIA 3GMQA 2OPTA 2DU9A 4G43A 4B48A 1R00A 4F91B 2ZOLA 3LQQA 5HGBA 2IA2A 1FWZA 5IEKA 3T1BA 4U1LA 1DDHA 1T6SA 1LDPH 2RGVA 3KEOA 1V5GA 3OSGA 1T0FC 3KE2A 2WWYA 1IV6A 2N8GA 4RB0A 2K9MA 3LKRA 5F0CA 4H0EA 4ENJA 4A3GJ 3JRFA 1FTZA 4S0UC 1DU6A 4UXNA 3FMRA 3OYBA 2DFEA 2Y48A 3IP4B 1JUFA 2B0LA 2MW8A 4HBLA 2L2OA 3PWVA 5D5MA 3BG9A 1BC7C 5LGTA 1HW2A 1QQIA 3GSWA 1RIOH 3NRVA 3CZ6A 4QPQA 3OXRA 2DOAA 2KFDA 2DT5A 3PNVA 4FX4A 4XRFA 3PSFA 4G6TB 5L2KA 3I9V2 1XTAA 2Q8KA 4YFNF 1HA8A 1TW2A 3HHHA 5F0HA 3GFIA 4PJAA 3CUQC 3W6VA 4BKXA 3HKZA 3F6OA 4HV8A 3MKWB 3SPVA 3AG1H 1FZMA 4XBFA 5C0CA 1UFMA 1ZG1A 2CUZA 1HHGA 3RYPA 1FBSA 3SJMA 1APLC 4PV8A 3GSXA 3RKYA 2EWNA 1FSEA 3FBNB 2D1HA 4B47A 5ACZA 3S6CA 3L9RA 2ACJA 2RQQA 2UZKA 5M5WJ 1D1BA 5E3LA 4GUPA 1MGTA 5FFZA 3ELKA 3FKIJ 3HG1A 3MD2A 1VQ4I 3CUQB 3BDDA 4XRSA 1WRJA 1NG6A 4P9FA 1XX5A 2WB1A 4ZDLA 4K71B 2JWTA 2Q1ZB 5D4SA 5LLQA 3GW2A 3O6BB 4NQDA 1JT6A 1ON1A 4XN3A 1OR7C 3KLOA 2EFWA 2XF5A 1TQMA 3L3JA 1R7JA 3E1SA 4XKCA 2P0WA 5L3FA 1YO5C 2QSHX 3I4MJ 5FLXK 3HOZJ 3U1KA 1LEBA 2MFZA 4O6JA 4AIDA 3HUGA 2V4JC 4M73A 1YS6A 1JTYA 2F5EA 3VFUA 4I99C 2CRGA 2I5UA 1R49A 1HDDC 1XDUA 1R6RA 2DBBA 2FQ4A 4L9VA 3GSRA 2X1CA 2E1CA 2EK5A 2JZYA 2HQNA 3FKJA 3K7AJ 1WWXA 3DBHB 1WI3A 2LY9A 3JREA 3WTWC 3DLLF 1OCOH 1Y39A 5BJTA 3BHBA 1O3TA 5C07A 5FKMA 3F23A 3FMSA 3S16J 1F36A 3LQRA 3KETA 2DOFA 2KQRA 1BC8C 4PJBA 5HHNA 2H6CA 1A6QA 1OMIA 5FFXA 4BHBA 2M87A 2ME0A 3CC2I 4HLXA 4L18B 1UG0A 1KCGC 2ZJ2A 4M9ZA 3CPLA 2V79A 2CQ7A 3QULA 1IN5A 4QPOA 2DFIA 4E70A 3AG4H 5K7ZA 4OMYA 2X4SA 1WBXA 3OOUA 3CF5F 1IUFA 3DU6A 4BQQA 4EATA 2LR8A 1KGSA 3D5RC 4XLNF 1Y1VJ 2WB1N 5TRDA 4XSZF 4A5NA 5LHGA 3VRJA 2VKEA 1IW7F 4DYRA 1FBQA 4XLFA 1O7FA 1V5EA 1QVTA 3K2AA 5LHHA 1Z67A 4HRIA 2VJIA 3FQUA 3K9TA 1HOCA 3VXNA 2XAGA 1R1UA 1KYWA 2CLZA 2F4OB 3LAPA 3GTOJ 2CV0A 5KCMA 1WBYA 3G08A 4PJJA 5K5QA 2COMA 4C3HJ 1T2KA 4AVZA 1X2NA 2L01A 3BH9A 2M4KA 2M9HA 5J4VA 2K3FA 1B0RA 1QVUA 1X4PA 3JRIA 1IDZA 3HRSA 4HWZA 4EM2A 5FKPA 2GUOA 2VT2A 5EYRA 3SFIA 1I7TA 3BTLA 1JGSA 2WAQN 2IJLA 3LWFA 3OIQA 1G2HA 3HE6A 3MV7A 3X12A 1BA5A 5DEGA 3CDHA 3HIFA 5D5VB 5IB1A 1AKHB 1LFBA 2OI9A 4AU7A 1MDMB 4N9IA 2RFXA 4HOBA 4UQ3A 3GO5A 3D1NI 4PJ5A 2P5WA 1T7YA 2QF7A 4A0ZA 1FLIA 1YI2I 1MNDA 2X85A 2KZVA 1O3QA 2BOLA 2XGCA 2PJRB 2X6OA 4GDFA 4JRXA 3OV8A 3GCMA 3IWFA 2DK8A 1B72B 1XSVA 3LN5A 1W7PB 3CUOA 2X6WA 3DFGA 3TBIA 2H27A 3HTSB 5INCA 1FOYA 4U0WA 1IAWA 5EOTA 4F7PA 2H6BA 4U87A 3TP3A 2ZXWH 3V8KA 4JBAA 3RWDA 4WW2C 1POGA 3H0GJ 5CVVA 2FNAA 2XFXA 2LKSA 1EXUA 4XIDA 1V55H 1BJZA 1OCZH 3FK6A 2XPWA 3SDGA 5FD6A 4RGSA 2R3SA 3EYYA 2Y31A 4U0VA 1AGBA 2K40A 4LG0B 3RYRA 4HPQA 1JUPA 1BN5A 1YIJI 1ZQ3P 2QWWA 4JFQA 2DODA 1NANH 4U1JA 1WPKA 2CU7A 4HV6A 3NWTA 3KPLA 2K3PA 3JAMK 1KU7A 4L8CA 4A3MJ 1PQZA 2IS1A 1YG2A 4OINF 4KT6A 5INDA 3JRDA 2CFXA 4UY8I 2Q7YA 1T98A 3X13A 2IA1A 3ZQLA 2F5CA 3GEZA 5L3DA 1TVHA 1INQA 1ZREA 4HF2A 4JFDA 4WU7A 1FIAA 5C0EA 1RK0A 2HS5A 5M3FJ 3IXAA 1JUSA 2VQHA 1ZLKA 3M17A 5MEQA 3CZFA 2FRHA 3O3KA 1N3NA 2G9WA 5GAHJ 3WTSC 2DPUA 1S3JA 1P7QA 1UAAA 1ZH5A 2OC6A 1QLFA 2DMPA 1XSXA 3LA7A 3HHGA 2XGXA 2ZXIA 4E7HA 2O5NA 2CQXA 1NH3A 2R93J 1MHEA 4RBOA 3I56I 3AU1A 5BPDA 2X4TA 1EV7A 2O03A 5B5EC 1KPUA 3PQKA 1MJAA 1QRYA 1U5TC 1FP2A 4S0HB 1KU2A 3E5UA 3VWJA 4WCGA 2EQRA 2QKLB 2VIXA 3LSMA 4QRTA 4BKWA 1MZBA 3L09A 3GZ5A 5HS7A 2Y2ZA 4ESJA 3K4MA 3RSNA 1JJ6C 2BSTA 1Z7LA 2I8DA 1TW3A 3LV3A 3RL1A 2WADA 4I76A 1E3OC 3TGNA 1JKPC 1G7QA 3GSVA 3O3DA 3ABLH 4NSKA 1LDDA 5JI6A 5F0FA 4R8HA 1R5GA 5F6FA 4IF4A 3FQRA 1PUFA 2DXIA 2J8UA 2DMUA 1S7UA 1IXSB 1T7ZA 3MRPA 2CWEA 4MHGA 3FXQA 3U2RA 2MBFA 2OCEA 3V5KA 1Z21A 2JN6A 3QEQA 2LSOA 3ZQHA 3FWEA 4UB8C 2NS0A 4HKJA 3BZ6A 3BZCA 3S17J 1R22A 1RI7A 1R5HA 5LEJA 4IZZA 5IOYA 4D5CA 1T0NA 5E17F 3MRRA 4PGCA 2P6TA 1VQKI 4U0YA 4XR6A 3I53A 2O8XA 2CGPA 3F8CA 3S15J 1AKJA 4IIQC 2XUBA 2CMPA 1TP4A 2E71A 2ZJQF 3D0SA 4G12A 3H36A 5CQGA 4A3BJ 1QNTA 5DDHA 2HVQA 3BVNA 3KLAA 2OAZA 2IXSA 5BPIA 4EJTA 4CO8A 4G9FA 3U0PA 1RNLA 4QWQA 3HTUA 4Y4HA 3ZR8X 5C09A 4XQFA 1ZGJA 1EEYA 1W5CC 3E5XA 3LSGA 1LPQA 1KJ3H 1K79A 2BY1A 1J7KA 4HNTA 2ZNYA 1Y8QB 2DW4A 4PG2A 1MW7A 1N77A 3KP2A 1G59A 2A3SA 2CLVA 2IVMA 3TQNA 3GTPJ 3H5AA 3K1NA 3KP7A 2VJJA 2PMHA 1QEWA 2OZ6A 4ENKA 1QSEA 3S2DJ 2LYCA 2FX0A 3BPXA 2EH3A 5JLWA 1AGDA 4FE7A 1BQHA 3OIOA 3P9CA 2O0YA 4PUSA 4WXCA 2MD5A 4AYBN 2ETHA 2R5ZA 1QRNA 3S32A 4E7KA 3W6KB 1I1SA 3S8PA 4LLLA 4I2OA 1WGXA 2OZUA 1IXRC 1HCRA 2HPMA 3TPUE 3OYNA 3DTIA 3KYOA 4XRSG 2FU4A 3BTIA 2AV7A 3HRTA 4Q5SF 1KJVA 2V2WA 1LKXA 4MTEA 4G59C 2FEZA 4IRIA 1S7TA 1XMKA 3CUQA 4CUGA 2ELJA 1YW8A 1ACIA 4HUVA 2OCCH 5IB5A 3I0TA 2Z33A 3H3VK 2C7UA 5FKLA 1A36A 5EJCA 2JSCA 5H94A 3R4KA 2KT0A 5IEHA 3C18A 4L9TA 3VSKA 2R5YA 5FKKA 1HSTA 1R1TA 3M8FA 4XLCA 5AONA 3RGVC 4MFDA 1T7WA 4IRGA 3CC4I 5IT3A 4IXAA 2FBHA 3HUGB 4NQWB 3BPVA 3VYSB 5DM6F 4DBRA 5F1JA 5ED4A 3PIPF 3W3CA 2XKPA 3HEFA 4B3AA 3GZ6A 1D0XA 2LY2A 4LITA 3PIOF 4V19K 2AK4A 4BNCA 4I48A 5IP9J 5LEKA 4X1EA 5C4JJ 5TJJA 5J3LA 1ETVA 3IC7A 3EYIA 4P55A 4PJ8A 2OUMA 3SZPA 3KPNA 3AL0C 3RI4A 3BTJA 4M71A 4OOIA 2VC0A 2DQLA 2WAQA 4AIKA 2E5NA 4EGZA 3L3KA 3FRUA 2GZWA 3VOEA 4CW1A 3CJQB 5E3MA 3TL4X 3TW6A 4IOAF 3ROLA 3HG9A 3DX8A 1G7PA 3FXJA 5F1NA 2LF8A 4CCLA 1B8IB 2LKPA 1VQMI 3BJOA 3PQJA 2V6EA 4DNCA 1U2WA 2LKXA 4PK4A 2A07F 3PWJA 3RL2A 1SVLA 4QOKA 1YIOA 4U88A 4Z77A 5FKOA 4IRHA 3QUYA 4YIRX 4GXOA 4Y52J 4LNRA 2Z1DA 2FOWA 3ROOA 4KT5C 3BTCA 3S2WA 3ZMTA 4X6AJ 1T21A 5HDKA 1REPC 1DP3A 4CH7A 3A4CA 4YFXF 2HVSA 3VYUB 3M07A 2NYKA 2MA3A 2R7SA 2W57A 3OL4A 1Z5LA 3HGYA 3GMMA 2V1UA 1LK2A 3FT4A 3KPOA 3P9LA 1IJWC 5J1AA 1LB2A 1LQ1A 3VH8A 2D1VA 3CCLI 4LCCC 3I5UA 5EO1A 2GTZA 4F7TA 4E0RA 1TMCA 3HSRA 2R7RA 2F74A 5FGMA 1L0OC 3MVPA 4EJVA 1SYSA 1C0WA 4UVAA 4LOCA 2P8TA 3RQ4A 4EMSA 1QZZA 3FBIB 1FY7A 4F7CA 4HX8A 4MGRA 4XM3A 4EM0B 4U1NA 5E1XA 1LEGA 1MSEC 1VQNI 1P6RA 4CCKA 2QA4I 3TJHA 4QRRA 5HODA 4L9NA 3PWLA 1ORKA 5FLMJ 3S1MJ 1RETA 1T95A 1EH8A 5H20A 2VT3A 4AIJA 3CDGA 2A5YB 3GMEA 2IA0A 2TCTA 2VBXA 3JRCA 3DBXA 2WY7Q 3BROA 4U1HA 1SFXA 3L2CA 2CS3A 3S1QJ 3BOQA 3MZYA 4CHUA 3K70C 2Y9YA 1OF2A 5F7DA 2KMUA 4KFCA 4A3CJ 1W7PA 3EUHC 3H3ZA 2NVXJ 1X7QA 3EETA 2X48A 1JHHA 4BDZA 2XGDA 2K86A 1S7VA 4B43A 4CCJA 3LKNA 1FFPA 1HDPA 3QPTA 1PP7U 4WU5A 5FRNA 2HQ5A 3DEEA 3OR2C 3LFUA 1JUMA 3H7BA 3QWLA 3MWMA 3HCVA 1TWAJ 2WBMA 1S7SA 4Y7NJ 1ZT7A 3HPJA 4L9JA 2KZGA 3MRNA 1AHDP 4P96A 3BJ6A 2K27A 3PQYA 3L1PA 2PMZN 1FC3A 4PJCA 1ULYA 1SEUA 5TGTA 4G42A 3UPRA 3I58A 3KPPA 5DEFA 1Z0XA 1ERDA 4HW0A 2W85A 2MH2A 1S5LC 5BRZA 1PVEA 2VE9A 2DYPA 3E6HA 1V3FA 3PFYA 4ZYGA 4PZJA 3TZVC 5FKNA 4PRHA 1IO2A 1OCTC 2KIQA 1BBYA 2WY8Q 2STWA 3E6CC 4HS3A 3TBSA 2KPMA 2XPGA 3SHFA 2BXYA 4BS9A 1W7PD 2HJLA 1S7XA 1Z9CA 2DTZA 4WXDA 3EUKL 5K5RA 2X4PA 3UTQA 1IRXA 3G2BA 1TC3C 1T1YA 1ZT1A 4C9YA 1KU3A 3R60A 1SMTA 3BWGA 3AG3H 2BVPA 4OAZA 2MGQA 2LK2A 3H92A 1XD7A 5HLTA 2VOPA 5KNLA 3SEZA 4L0YB 5DYMA 3TO7A 3JSOA 1EEZA 2A83A 5C0FA 2FOKA 4AIHA 3SJVA 1IV8A 2EFNA 2JVHA 4LJZF 3M3YJ 1ZAGA 4EJOA 5D2LA 5KHDA 3IRRA 4NDLA 1KPRA 1VQ8I 1Z6RA 1FSHA 3C8KA 1ZHKA 4FASD 3X2QH 2X9DA 1LDKB 3TW7A 2AV1A 2GA1A 5D8KB 1U6GA 4B8XA 1ETKA 1MMGA 3VCLA 1U78A 1S7AA 1IF1A 3CF2A 3E0JB 4BGDA 5IYDJ 3WLBA 3JTCA 2E2IJ 3ONQA 2LG4A 3SYTA 5CJ9A 3PFIA 5JVGF 1MD0A 4B09A 4RLQA 3O3AA 3KX2A 4IL6C 1MHCA 1EJ9A 1IRZA 5E8OA 4D5FA 2VL8A 1AU7A 5E00A 2ZSWA 2HU9A 4MJIA 2X6XA 4JFEA 2OL3H 2ZKZA 1DPUA 3G1MA 2HOEA 4IX7A 5C4XJ 4CCOA 3MKLA 2QQBA 2DA7A 2JUGA 3HLAA 3OS2A 2Z99A 4L9LC 3OR1C 4PJNA 2BY2A 5DDGA 3ZQIA 4I7HA 1K83J 1ZR2A 4B4CA 1LE8A 4AUXA 1GV5A 1CD1A 4IPAA 4E6KG 5ICFA 1Y0UA 3BLYA 5MEOA 1P92A 2A6TA 3JRHA 1YDPA 3LOCA 4LFUA 2XKOA 4M9SA 1LFPA 1HXDA 3QRFF 1FZKA 4DYQA 4QRSA 4Y15A 4IO9F 4N8VA 2GTWA 3OSFA 3FIWA 3R61A 1QZEA 2X1DA 5D8LB 3D2UA 1BI1A 3MRMA 3ZMZA 2QENA 3VXUA 2RKHA 5H6RA 2Z2SB 4CVXA 1FO0H 2IPQX 3ARGA 2EZLA 2H94A 2X0LA 1ZHFA 3H3UA 4CICA 3JTTA 3GFJA 1IG7A 1LDJA 1YYVA 2HR3A 2D45A 4L4TA 1OLTA 1SD6A 4LLGF 2VBWA 3DU5A 3BP4A 1Z1DA 5B3SH 1UCRA 3ZMSA 1T1ZA 2DA5A 4Z6YA 3QUZA 4ZUWA 3BR0A 2XRLA 4UQ2A 1OPCA 4BYYA 1WVRA 2F2EA 2RVCA 3FM3A 3VFMA 1BI2A 1CG9A 3WUWA 2LDUA 3RKXA 2JT1A 4IVNA 4Q4ZF 3IH3A 3P9KA 3J7ZI 4UVCA 2R5ZB 3WTYC 2X4NA 2CW0F 2XIGA 1CF7B 2NS7A 2LFBA 1OKRA 1IN8A 2XVCA 5HVQC 3NFNA 3A0HC 4F52A 4PJMA 2YPKA 5KAIC 4EM1A 3QQ3A 3WTVC 5E8PA 3VFZA 2PMUA 1STZA 2FE3A 2LNBA 1X3WB 2DDBA 4LGWA 1U3EM 2E1NA 3L2QA 3WGHA 1XR8A 3QFJA 4A3FJ 1DE4A 1H9GA 5IPAA 3ZGKA 1NK2P 2F6CA 2G7UA 4DOZA 1RK1A 2XAHA 2A05A 1K61A 2MC4A 2PBIA 4IHTA 5J6GA 1ETOA 3EUAA 1X1PA 1R4NB 3ZMVA 4LLNA 1R71A 3SEQA 5FLXZ 2QVOA 4Y4KA 1XN7A 3T8XA 1KZHA 4Y3OA 1FFOA 3ASOH 2PEXA 1IXCA 3MRBA 2R5YB 3LSIA 2FO4A 2ECCA 3UTSA 3MA7A 1VNDA 4ZYHA 3GTQJ 3HGGA 2WC2A 3ARFA 1D1AA 4Y4FA 4MNUA 3TOAA 3DXAA 2YPRA 2ADUA 3CMEI 1XGMA 3KZIC 4M74A 4NQWA 4RMNA 1X1DA 4I02A 3R0JA 3CP2A 2HQRA 1WJEA 1OFCX 4GRIA 3WU2C 1XS9A 3ISPA 4GKSA 3B6AA 1JGGA 2H1KA 1MKMA 2K4JA 2DPDA 1YITI 4BXXJ 2ZB9A 4CXFA 1TT5B 4ESBA 5CVRA 4KIGA 4OIQF 4RGUA 1YW9A 3D25A 2PQ8A 1BW5A 3GMOA 3TO2A 4LK0F 2O5RA 3MAJA 3I6LD 3S1NJ 1B8IA 1K6OA 4CCMA 3QQ4A 3TFKA 3IH4A 4XKVA 3E6DA 1TVBA 2ZMEC 3CCYA 5MEPA 2HJKA 3VXSA 2RAEA 1Y56A 4UHTA 1MMDA 1Z6TA 1GHCA 5GSVA 3UTTA 3C2GA 5M5XJ 3C2BA 2V1DA 2IS4A 3C1DA 1NEZA 5FROA 1S29A 1N78A 1I1GA 2DA3A 2B9SA 1S7EA 3PM1A 2XDVA 4K2EA 2M5WA 2BGCA 2L02A 4G8IA 1SD5A 2HOAA 3CTAA 2R7DA 3L2RA 3FM5A 2A69F 5C9JA 1ZG3A 3L2WA 1I5ZA 5J1RA 4XK4A 2A68F 2EJRA 1FMVA 2E19A 4BXFA 5D5XB 3MFKA 4BE2A 4NQEA 2QUFA 1GZQA 4W97A 2OJED 4KIBA 2KRHA 2Y75A 3J7AO 2Y0MA 2RV8A 3T1FA 4FQGA 4V2GA 2IGNA 1GLNA 2HNHA 4QRQA 1HSBA 2NW3A 1JHTA 1ON2A 2OA4A 2NX5A 1FZPB 3VYTB 3GTLJ 1A5JA 2O6GE 1S72I 2HOSA 3ZOBA 3TVMA 1T08B 2VXZA 4HF0A 3LKQA 1FFNA 3I71A 5FD5A 3MRCA 1HHIA 4PJLA 3W39A 3BZFA 5H2FC 1A31A 1WH7A 3V7SA 3V5HA 3TOBA 4ETSA 1DUXC 1AGCA 2ZSIB 3GTGJ 3FOLA 3VWKA 3VDXA 1T20A 3WGGA 5SWQA 1T0FA 4PFPA 4J01A 4Z76A 3L3HA 1EH6A 1PP8F 4R1HA 2P7CB 3G1OA 4LB6B 3MRQA 1O3SA 2HVRA 2QCOA 4TV7A 4C2MJ 5F1RA 2IAIA 5K7FA 4OU0A 3H9SA 3VXPA 3DBRB 2G7HA 2QGUA 4KICA 4MTDA 5CVUA 4A12A 4QIWN 5JFRA 3BZEA 3MZHA 1SFUA 4WO4A 4V2FA 1I6HJ 1QHHD 3K4CA 1BI3A 4BJ5C 3ZQGA 5A2QK 5HGDA 2K9LA 2VLAA 1KJ2H 1RR7A 5FDWA 5GPCA 3GXOA 3CCUI 3SDCA 4RM3A 2BVOA 2CSOA 3WS6A 5E8GA 3OXSA 3RIRA 2D2WA 4KIFA 5CQEA 4HEA2 3CQZJ 4II2A 1ZAOA 5EU4A 4KITB 1XCBA 5DS9A 3OYFA 2PI0A 2VABA 4HG2A 4I4WA 2ZNZA 4MEYF 1K8DA 1OCRH 4A3JJ 5EF6A 4M3EA 3ZQQA 2A6EF 4C2UA 3MRLA 3JTGA 4LIVA 4KUMA 2FMLA 5ERIA 4A0XA 3F21A 3WHBA 2NVTJ 2VUMJ 3TIDA 5C3EJ 2RQPA 1DPRA 3V7RA 2WAFA 4KMFA 3KFWX 2BYVE 1T38A 5KK1A 2H8RA 3O8XA 1H0MA 4MNQA 2IGKA 4LD5A 2Y0SN 3KCCA 3J80Z 1S8DA 1VQPI 3DKXA 3E7LA 3PO2J 3E6FA 1OR7A 3LKOA 3VFTA 3CMYA 4ZYAA 4Q47A 5C0BA 4EUPA 4PRPA 2GBYA 3VB2A 3F3XA 1Y8RB 4A69C 1K4SA 3BXNA 5EU3A 2QQ9A 1M6OA 4ASNA 5LGNA 2HDDA 4X6DA 3IHUA 2NXNB 4PSXA 1QPIA 1HKTA 3DPLC 2HYFA 3K4BA 1TLHB 3GMNA 4A6DA 4N0FA 1JFMA 1J59A 4KYWA 1A9EA 2JA7J 4AC0A 3KEQA 3RWCA 2FQ3A 4CA0A 3DXJF 4NQCA 2GAUA 4Y4RA 4G7HF 5L3CA 4IRSA 2KP6A 3RWFA 2L0KA 1IUYA 1JKRC 4PCQA 3RPQA 3CCRI 2ISYA 4XXCA 4F3QA 1U0JA 1SD7A 2XSDC 2GT9A 3HOWJ 2YEZA 1S6LA 5DUKA 1DDNA 5HHQA 3BJAA 2BSSA 1FG2A 4RM2A 1RJZA 1KA8A 4IQ4A 3TF7A 3I3LA 3CCQI 5E6IC 5C0JA 4E7ZA 1X1AA 1RUOA 1WJBA 4BAYA 1RRJA 3ZP5A 4WX9A 4E7SA 3G6EI 5J1YA 2OD5A 1FP1D 3D3VA 2BHZA 2PMZA 2AO9A 4FISA 4JX5A 3BG6A 3CC7I 1LE8B 4GCVA 4WDIA 5BXFA 4D1QA 3F8FA 3MRDA 4Y16A 3ERMA 3P4OA 2H6PA 4IHWA 4JQVA 3LSHA 3VWBA 4N0CA 1B0GA 3QFDA 1YJNI 5ICGA 2E5ZA 1DP7P 2W25A 1T39A 3C2HA 2XAFA 1YRNA 2IT0A 2E34A 3M8JA 1MSFC 4FE4A 2EZIA 3TKYA 4NQVA 4HLYA 3KPMA 5E9DA 3E6BA 3L2UA 2Z9OA 3GSNH 2ZFUA 2LP0A 2ZXJA 2QZ8A 5EDNA 1FPQA 2ICWG 3JW4A 3VYRB 9ANTA 5HHMA 3PWPA 2M3AA 4U7DA 1T7VA 2Y0SA 3SKOA 1Z05A 5IB2A 1X2MA 3L2VA 4EI5A 5JLXA 3WODF 1KYZA 2AXGA 3BWAA 1IRFA 3CCJI 4PRNA 1W5TA 3RDIA 3MROA 2L7ZA 3OYMA 3BZKA 3K0LA 3U21A 4RA2A 3I4NJ 2F5FA 1I27A 4GGGA 2NNNA 5J8FA 3W2AA 2JA2A 3EUHA 2EV6A 5LRRA 4V3DB 4ITVA 3UR3C 1LVAA 3DP7A 3FXOA 1HHKA 1CF7A 1USSA 3EPZA 4M6VA 3QOPA 3J7YJ 3CLOA 1U58A 1JJ8C 2HZDA 2VASA 1LUJB 5M5YJ 1BOBA 1VFCA 6PAXA 2GOXB 3RZOJ 2M0MA 2VXDA 3SFZA 2R7UA 3S1RJ 3OYGA 2L5QA 3M4OJ 1XGOA 1YQAA 2R7VA 4M6YA 4DBQA 4NHJA 3K6GA 3CJNA 1A6IA 2LMDA 1A6ZA 4XL9A 2LBFB 3DWLE 2ZJRF 4HAMA 1SMYF 1W0VA 2VLRA 3IAS2 4L29A 1FIPA 3DV8A 1G8XA 1YX5A 4KNYA 1B9NA 2BY3A 2FNPA 1ZHNA 3DTXA 4KDPA 3O2PE 1ZGAA 4PJIA 1SYVA 3E3QA 5AIPA 3KZZA 3RWEA 5EU6A 4P1WA 2K9QA 3ML6A 4PJ9A 4L8SC 1W4MA 1QU3A 1DGWY 2EFQA 3I64A 3P9IA 5D7JC 3RCOA 3FK7A 4ZZLA 3B3IA 3TMOA 5C0GA 4G59A 5B1BH 2LREA 2GQQA 3VXOA 1GV2A 1AGEA 2WV0A 3CJTB 1YN7A 4X6CA 1ODDA 5EO0A 3WL9A 4BDYA 2O7OA 3LSKA 2EIKH 5AIQA 5D6FA 5ILUA 4QTRA 3RKQA 2JA8J 2KJCA 5E3OA 1ZLJA 4U1IA 2W84A 3HRUA 2NNYA 2QLZA 5D5UB 1VQ9I 1FZOA 3FQNA 2VPRA 3OYKA 2BSRA 3MREA 4IHOA 4D0CA 2HTJA 2VJ4A 5D5WB 1ZN2A 3M9AA 4M6XA 4OMZA 3CLQA 4PRBA 2XF7A 3SKMA 5FO5A 2CH0A 3GMPA 4PDCE 1XZ0A 4UUSB 1ZRCA 4QLCU 2KIFA 2CUEA 2HPIA 3EDPA 5CVIA 2KIUA 5C0AA 4BH9A 2JQ7A 4L4VA 1LEAA 1T33A 4UUTA 3MQ0A 1ZTRA 2QBYB 5BS0A 1HBXG 3OL3A 1D3YA 5J8CA 1XCVA 2L4MA 2GJ6A 1XGSA 3K4LA 2ISZA 2ZSVA 3TA3A 2VKVA 1YFHA 1Z77A 3BP8A 1ZVSA 4HUWA 3DCFA 1N5AA 3CP8A 4I0AA 2B63J 1ZS8A 2XPVA 1QHGA 3DX7A 2LC2A 1JGDA 2R7QA 4RAGA 3HOYJ 2DMQA 2IEKA 1KQ9A 3L00A 3W2WA 4C3JJ 5LGUA 2JA5J 4V3EB 4S04A 5ICCA 3CESA 3Q0VA 1KTLA 3A0BC 1ONVA 1MWAH 1VACA 4AYBA 3TDUC 2F53A 4KISA 2W24A 2EIJH 1U5TB 3G1LA 4N0UA 3VODA 3B73A 1C16A 2AXFA 2KRCA 5CKTA 3COAC 3MYJA 2X4OA 1OYYA 3ASNH 4F7ZA 2IS6A 4LK1F 3ES6A 3JRAA 2X51A 2XASA 3LA3A 3RQIA 4ZJZA 4RAFA 2V9KA 4ZUTA 4ZUVA 3A02A 4EEFG 5JVTA 3H9QA 3SDAA 3FQXA 2RREA 2GXAA 4PJ7A 2YS9A 4JYKA 2HKXA 3FDYA 2DQRA 4ZTFA 4S05A 1I1AA 2NVUB 4JQXA 4LB5A 3ULQB 1XDSA 3MN2A 1ETWA 2NAZA 3FT2A 4F93B 2JPBA 3S3MA 4ZTJA 4APQA 4N5EA 3P7NA 5D7LA 3IRQA 1QSFA 3PO3J 4L8DA 2JTVA 5ENWA 4ZZDA 2M30A 1XR9A 3K4NA 3SDXA 3FX3A 3QP5A 1FT9A 3ZRGA 4JRYA 3HYIA 1A35A 2CIIA 4XICA 4MNGA 4O2FA 1G6NA 1VZ0A 4AWXB 4F7MA 3HUJA 4U6YA 2MC3A 1SVMA 3IWZA 3G4SI 2STTA 1JXSA 4BY1J 2ZFWA 4Z78A 1QR1A 2RNJA 5CLSA 3WTTC 3KYLA 2HZTA 2J5OA 4ZDOA 1X1BA 4NO0A 4IHXA 2HDWA 4FTVA 3I6KA 2Q0OA 4LCYA 3F8NA 1D5YA 3BG5A 1ZG5A 1UHMA 2YX7A 5F9JA 1TWFJ 1DU0A 3KP3A 4H4KC 3DKYA 2V1XA 2XAJA 4PG9A 4MEXF 2P4WA 1UXSA 3HXLA 1SAXA 3GX4X 3CMAI 2HN7A 3OMYA 3HOXJ 5D9SA 2ELHA 3QPLA 3ABMH 2UXNA 2VKDA 1JPGA 3LSPA 1ZRFA 2DOEA 3NWSA 4BY7J 3I59A 4NC7A 3E2HA 2DMNA 2L7FP 2NS8A 3AREA 4PGHA 1QZYA 2CFOA 1E27A 2RNGA 1E0EA 1ZKGA 2P6SA 3TBTA 5DM7F 1XPXA 4CGZA 1DQUA 3IT8D 1UG2A 3FFCA 3LL7A 1S7QA 2ME6A 3BQZA 2EZHA 4L5IA 1KPVA 2AXLA 5EGOA 2DK5A 1ZHBA 2QYOA 5HNHA 4KA4A 2PJPA 3GTKJ 3QDGA 3HRMA 3S14J 2MYSA 3F9KA 2A5WA 3DPTA 3ZQFA 1T7XA 1WJDA 3WG7H 2R92J 1UQSA 1PUEE 2LOOA 5A2QZ 4I0BA 3KYNA 5SWSA 2W1OA 3K4KA 1H9TA 1UJ8A 2K9NA 2HKOA 2V1NA 4B1RA 2CQQA 2KKOA 1ZYRF 2Y69H 3C7JA 2NRAC 5IYBJ 1BD2A 1M05A 4U1MA 3BP7A 2BW3A 1TBXA 5DCFA 2AS5F 1UHSA 5DEQA 3IKTA 4N4OB 1LFUP 3P4NA 4L8BA 3JCUC 2RN7A 4XLHA 1JE6A 2GIZA 1BIIA 5D7IA 3NAUA 5E18F 4YELA 5B39A 1IM9A 2V9PA 2HYGD 3FXLA 1XMAA 1QGPA 2FYYA 1B59A 2KIMA 3BQYA 3ZN1A 1TT0A 2LLKA 3GF2A 3UNGC 2HOTA 4JK1X 1HOMA 1TZLA 4RGXA 3Q3SA 2KHMA 4C2TA 1IN7A 1KONA 5FLVA 1HSAA 3FONA 4DYCA 2AKRA 1H8AC 2HLAA 4YIIA 2AQFA 3D18A 2Z3YA 3CDLA 1F4KA 2XF6A 2DMTA 3QU3A 5GTHC 3PL8A 1U9NA 4O3MA 2MLKA 1CGPA 3T5XA 1I1FA 4GKNA 1F9NA 1WHUA 3G73A 1ZRDA 4WJ5A 2HQAA 2WAEA 1BOAA 3GLXA 3IL2A 3BEVA 3CVHA 3TBVA 1YRNB 1SANA 5GADJ 4I6ZA 3B02A 5IVXA 1D8KA 3H35A 2MABA 4HQEA 3RZCA 1D0YA 2GXBA 2FXAA 5HNFA 1BM9A 2DCEA 2VN2A 4JX4A 3VEPA 3RWGA 3OYEA 4L3EA 3D39A 2KJBA 1OQYA 4K7FA 4ZUUA 4MX7A 2UXXA 2BHYA 1R58A 3ZN0A 2X1EA 4JFFA 2CUJA 2VOOA 4P5OA 3H5RA 4D0BA 1A1OA 3JTSA 2FD5A 3SCMA 2L3DA 3OWTA 4PJ0C 1HKSA 4RB2C 2O8KA 3P77A 2E7XA 2W7NA 3J80K 4ZDPA 4XKWA 4D7NA 1VQ6I 1HQCA 1HHJA 1HKQA 3V4GA 3BUYA 3D5LA 4NNYA 1X1CA 3DEUA 3WG9A 1JKOC 1A1NA 5IY5H 3AG2H 1D8JA 1I7UA 3GJFA 2R7ZJ 3F72A 3MMYB 3KP5A 3TEDA 3JR9A 3PWNA 3SDDA 2ELKA 3OYDA 4ABZA 1YTYA 3M1BA 3K2ZA 2ZJPF 2DA1A 3OYIA 3MRJA 3TIEA 3AFHA 3HL2A 2HEOA 2COBA 1T56A 4CYDA 2MG4A 3S3NA 3Q0UA 3QPSA 4FX0A 2V7FA 1S9XA 5IT9K 2F48A 4EV0A 1S9YA 1NHAA 5BMZA 1MBJA 3JTHA 2LH9A 5JHUA 2GWRA 3F8MA 4BE0A 1R9TJ 1W0UA 1CE6A 2LBFA 5BNGA 2ID3A 1MJBA 4MFEA 2XC7A 2JMWA 2L7KA 1MBKA 3E97A 5C0DA 2BEOA 1D5VA 5FB2A 4HSTA 4W1UA 3H9JA 1J2XA 2R7OA 2E2JJ 4PJXA 2L9NA 4L5EA 4M72A 4EJWA 5BQTA 1WJFA 1YN6A 4AVPA 3HOUJ 4X0GA 5DV5A 2GLOA 3F6VA 3B6CA 3MGOA 1SD4A 4A0YA 1LEKA 2F5VA 1EA3A 3GTJJ 1AWCA 1KBGH 2QQ8A 4HUUA 2P5EA 1TNTA 1V4RA 2E35A 4DIQA 4MJ6A 2H8WA 2O9LA 4D0DA 2P7VB 3GFLA 1WI9A 4X6FA 4FTHA 1YOVB 5JR3A 2BCKA 3VFOA 5GSRA 4IHVA 2IGMA 5J47A 3ZCOA 1RZ4A 2HTSA 4G7ZF 5DCMA 4M3GA 2CYYA 2DDAA
chains in the Genus database with same CATH topology
1XSDA 2FA5A 4DQ2A 1B1BA 1UB9A 4XLPF 1PDNC 2OQGA 3KLNA 3MEXA 4MQ9F 2ZO4A 2Q2EA 2XHKA 2QBYA 2L4AA 2H09A 5CYVA 4N0BA 4GYIA 1KQ8A 2NYXA 2M8EA 2EV5A 2CO5A 1BIBA 1O57A 2OBPA 1FYKA 4ZYDA 4Q48A 1U5TA 1WQ2A 1GXQA 2CQKA 5L3BA 2LF7A 4RAZA 2EA2A 4PGGA 1HSJA 3HSFA 4EJUA 3EQLF 4UV9A 2FBIA 4UV8A 3WE3A 2IP2A 3M7GA 4O5VA 4U7BA 3R0AA 3ROUA 1IN4A 3QP6A 1RUNA 1E17A 2VE8A 4L5JA 4M9XA 1J75A 2P5VA 3T8TA 2PG4A 1KU9A 1TTYA 1P4AA 1HW1A 5LHIA 4UUVA 2ESHA 1JHFA 4G6DA 2IW5A 3WU1B 1IRGA 2ZMEB 4BHCA 1J5YA 3ZMUA 1XB4A 4EGYA 3DQVC 3GWZA 1P4XA 3SXYA 4OIOF 1O3RA 2L54A 3V7CA 4YG2F 1EH7A 4G94A 1R23A 2A6HF 5HLHA 3I59B 1W5SA 1TQPA 2YSRA 3WTZA 3ZQ7A 1TNSA 4GYGA 4N9HA 2HFHA 1I6XA 1K7AA 3E6MA 3KP4A 4JQFA 2P5LC 2GA2A 2IRFG 5L3EA 2DTRA 1E2XA 3Q9VA 4XSXF 5HLGA 3RJPA 2WTEA 5IT9Z 1G3SA 5DD4A 4HA8A 3WU0A 1LNWA 2YR2A 2ZCWA 4RB1A 4OIPF 4G8XA 3E5QA 4UNOA 5HDNA 4BHPA 4KMUX 3W6JB 3DKWA 4D0PA 2C6YA 3U9GA 4ON0A 4G9YA 1WSUA 5J6XA 3R6SA 4A5MA 1L3LA 1P4WA 1LJ9A 1HW5A 3F22A 3REOA 4MQVA 2MLGA 3QAHA 1B6AA 2O61A 2VODA 1G4DA 1Q1HA 3ABUA 3L7WA 5DD8A 3LAJA 2M1BA 1O7LA 3N4MA 5ILVA 1A04A 3HOTA 5EEGA 4AD9A 5LBQA 5E8IA 1FYLA 1R1VA 1FX7A 3SZTA 2HDCA 5F64A 4ESFA 3QU6A 3HSEA 4WXHA 4HV5A 1ZARA 5H6QA 1YLFA 2ZBKA 3J81K 2XV4S 3IKVA 2FBKA 1XGNA 3ECOA 2R7FA 3N97A 3I4PA 1MJ9A 4FHTA 5DCMB 3FXRA 1FOKA 2QM3A 3QPHA 4BXUA 1J0RA 3JSPA 2XAQA 5E1ZB 4G6QA 3RPUA 3E3VA 2VONA 2VBYA 3V8JA 2OU2A 5K5OA 3F8BA 2O3FA 1VTNC 3LFKA 3CO7C 1X3UA 4EVIA 1K78B 4ENNA 1Z91A 3NQOA 5L3GA 1AOYA 1BI0A 1F5TA 3M8EA 4I09A 1B9MA 2XROA 2PLYA 2DI3A 3FXUA 2M45A 2YX4A 4HDVA 3BY6A 1Z7UA 4HX4A 4CDGA 4RS8A 3K1MA 4A6EA 2OQRA 2FF4A 4GO1A 2K02A 3NEUA 3RKWA 3RTRA 4L0ZB 4Y17A 4A2UA 4UVBA 3WGIA 4OIRF 4IHSA 1GXPA 4ZH4F 3J81Z 5HOOA 4ZYEA 3L9FA 3I54A 3FMQA 4KN7X 3C3WA 1P2FA 2ZMEA 1YW7A 5E20A 2JPCA 3GYHX 3FHZA 1USTA 2EFPA 3WTUC 5KVRA 2BBYA 4I98B 4RB3C 3ERED 1JE8A 1S8NA 2VBZA 3SQNA 3LSTA 2FSWA 4HQMA 1U8RA 2X4HA 2PN6A 4R79A 4HX7A 2TDXA 2PFBA 3Q9SA 4HYEA 2UWMA 2EA4A 3FZVA 3ECHA 2J5PA 1QO0D 1OYWA 4YIFA 1F1ZA 1IN6A 2Z5UA 3CO6C 1QBJA 1G3TA 3U1DA 1J9IA 5HS9A 4HZFA 2RC4A 2QQAA 3GFMA 3WTXC 2EV0A 3OOPA 4G7OF 4BQAA 4I01A 2GXGA 1FBUA 3DF8A 4LMYA 1IZ1A 2JRTA 3T0YA 5LRSA 2BV6A 4NB5A 1MDMA 2V6CA 3FF5A 4RGRA 1G3YA 2A61A 3TO6A 4CZZA 3KP6A 2FMYA 3K1PA 2BE5F 2HGCA 3GVAA 3LA2A 1YS7A 2DLLA 1UHWA 1BJAA 5HDGA 2K4BA 5BS6A 5ILSA 4HF1A 3G3ZA 5HLIA 4Z2YA 2VC1A 4IJAA 1QPMA 5HS8A 4LG0A 2HWVA 4KN4X 4PDKA 1S7OA 2RDPA 3JAMZ 3T8RA 1KQ0A 2MH9A 2DAOA 4EQQA 4Y13A 5K1YA 3Q5FA 3V8LA 1R36A 5D4RA 4WK8F 2EB7A 1B4AA 4RAYA 4HDUA 1SFEA 1WKMA 2KRFA 2YU3A 3MCZA 5EEHA 5E1WA 4WF2A 1G3WA 3ABTA 5DUIA 2P5KA 1BIAA 3HOSA 2CG4A 5D6EA 4WWCA 5CVJA 2ESNA 3TO9A 4P9UA 2F5DA 1FNNA 1OYIA 2EFOA 3GUDA 3TDZC 2DO7A 2K7LA 1K78A 5BOXA 3AAFA 3ZPLA 1FYMA 3M1EA 4YFKF 2E7WA 2V9VA 5ICEA 2GIVA 3ZMDA 3WE2A 1GVJA 3KZYA 2XRNA 4ENMA 3K69A 4FT8A 1TQIA 2DU9A 1R00A 3LQQA 2IA2A 1FWZA 3T1BA 1T6SA 2RGVA 3KEOA 3KE2A 2WWYA 4RB0A 4H0EA 4ENJA 4UXNA 3FMRA 2Y48A 2B0LA 4HBLA 1BC7C 5LGTA 1HW2A 1QQIA 1RIOH 3NRVA 2DT5A 4FX4A 4XRFA 2Q8KA 4YFNF 1TW2A 3HHHA 3GFIA 3CUQC 3F6OA 4XBFA 1UFMA 1ZG1A 3RYPA 1FBSA 3RKYA 2EWNA 1FSEA 2D1HA 2ACJA 2UZKA 1MGTA 5FFZA 3ELKA 3CUQB 3BDDA 1WRJA 4P9FA 5D4SA 5LLQA 3GW2A 3O6BB 1ON1A 3KLOA 2EFWA 1TQMA 1R7JA 5L3FA 1YO5C 5FLXK 1LEBA 4O6JA 3HUGA 4M73A 1YS6A 2F5EA 1XDUA 4L9VA 2DBBA 2E1CA 2EK5A 2JZYA 2HQNA 1WWXA 3WTWC 1O3TA 3F23A 3FMSA 3LQRA 3KETA 1BC8C 2H6CA 1OMIA 5FFXA 4BHBA 2M87A 4L18B 4HLXA 2ZJ2A 4M9ZA 2V79A 1IN5A 2DFIA 4E70A 4OMYA 1KGSA 4XLNF 5TRDA 4XSZF 4A5NA 5LHGA 1IW7F 1FBQA 1O7FA 5LHHA 3K9TA 2XAGA 1R1UA 1KYWA 3LAPA 5K5QA 2COMA 1T2KA 2L01A 3HRSA 4EM2A 2VT2A 1JGSA 3LWFA 2IJLA 3CDHA 3HIFA 5D5VB 1MDMB 4N9IA 4HOBA 3GO5A 4A0ZA 1FLIA 1O3QA 3OV8A 3IWFA 2DK8A 1XSVA 1W7PB 3CUOA 3DFGA 2H27A 3HTSB 4U0WA 1IAWA 2H6BA 3V8KA 4JBAA 5CVVA 2FNAA 5FD6A 4RGSA 2R3SA 3EYYA 4U0VA 4LG0B 3RYRA 1BN5A 2QWWA 4HV6A 3JAMK 1KU7A 1YG2A 4OINF 2CFXA 1T98A 2IA1A 2F5CA 3GEZA 5L3DA 1ZREA 4HF2A 2HS5A 1ZLKA 2FRHA 3O3KA 2G9WA 3WTSC 2DPUA 1S3JA 1ZH5A 1XSXA 3LA7A 3HHGA 2XGXA 5BPDA 1EV7A 2O03A 3PQKA 1MJAA 1U5TC 1FP2A 1KU2A 3E5UA 4WCGA 1MZBA 3L09A 3GZ5A 5HS7A 4ESJA 1TW3A 3TGNA 1LDDA 5JI6A 4R8HA 1R5GA 5F6FA 4IF4A 1IXSB 2CWEA 4MHGA 3FXQA 3U2RA 2MBFA 2LSOA 3FWEA 2NS0A 3BZ6A 1R22A 1RI7A 1R5HA 5LEJA 5E17F 2P6TA 4U0YA 3I53A 2O8XA 2CGPA 3F8CA 2XUBA 3D0SA 1QNTA 2OAZA 5BPIA 4EJTA 4CO8A 1RNLA 4QWQA 3HTUA 1ZGJA 3E5XA 1K79A 1J7KA 2ZNYA 2DW4A 3KP2A 2A3SA 2IVMA 3TQNA 3K1NA 3KP7A 2PMHA 2OZ6A 4ENKA 3BPXA 3P9CA 2O0YA 4WXCA 2MD5A 2ETHA 1I1SA 3W6KB 4LLLA 4I2OA 2OZUA 1IXRC 2FU4A 3HRTA 4Q5SF 4MTEA 2FEZA 4IRIA 1XMKA 3CUQA 1YW8A 3I0TA 2Z33A 2JSCA 3R4KA 3C18A 4L9TA 1HSTA 1R1TA 3M8FA 5AONA 4IRGA 5IT3A 4IXAA 2FBHA 3BPVA 5ED4A 2XKPA 3GZ6A 4BNCA 5LEKA 5TJJA 3IC7A 3EYIA 4P55A 3SZPA 3RI4A 4M71A 4OOIA 2VC0A 2DQLA 4AIKA 4EGZA 2GZWA 3VOEA 2LF8A 2LKPA 3BJOA 3PQJA 4DNCA 1U2WA 2A07F 1YIOA 4U88A 4IRHA 4GXOA 4KT5C 3S2WA 3ZMTA 5HDKA 1REPC 4YFXF 2MA3A 2W57A 2V1UA 1LB2A 1LQ1A 2D1VA 3I5UA 3HSRA 5FGMA 1L0OC 4EJVA 1C0WA 4UVAA 2P8TA 4EMSA 1QZZA 1FY7A 4HX8A 4MGRA 4EM0B 5E1XA 1P6RA 4L9NA 4AIJA 1EH8A 5H20A 2VT3A 2A5YB 2IA0A 2VBXA 3BROA 1SFXA 3L2CA 3BOQA 3MZYA 4CHUA 4KFCA 1W7PA 3H3ZA 3EETA 1JHHA 2K86A 3QPTA 1PP7U 3MWMA 4L9JA 4P96A 3BJ6A 2K27A 1FC3A 1ULYA 3I58A 4HW0A 2W85A 2MH2A 2VE9A 1V3FA 4ZYGA 4PZJA 1BBYA 2STWA 3E6CC 3SHFA 1W7PD 1Z9CA 4WXDA 5K5RA 1KU3A 3R60A 1SMTA 3BWGA 3H92A 1XD7A 2VOPA 4L0YB 5DYMA 3TO7A 3JSOA 2FOKA 4AIHA 2EFNA 4LJZF 4EJOA 3IRRA 1Z6RA 1FSHA 1LDKB 2GA1A 5D8KB 1U6GA 4B8XA 1U78A 1S7AA 1IF1A 5CJ9A 3PFIA 1MD0A 4B09A 2ZKZA 1DPUA 2HOEA 2QQBA 2Z99A 5DDGA 4I7HA 4IPAA 5ICFA 1Y0UA 1P92A 4LFUA 2XKOA 4M9SA 1HXDA 3QRFF 4Y15A 3R61A 5D8LB 1BI1A 3ZMZA 2QENA 2RKHA 5H6RA 2IPQX 2H94A 2X0LA 1ZHFA 3H3UA 4CICA 3GFJA 1LDJA 2D45A 1YYVA 2HR3A 1SD6A 4LLGF 2VBWA 1Z1DA 1UCRA 3ZMSA 1OPCA 4BYYA 2RVCA 2F2EA 3FM3A 1BI2A 2LDUA 3RKXA 2JT1A 4IVNA 4Q4ZF 3P9KA 4UVCA 3WTYC 2CW0F 2XIGA 1CF7B 1OKRA 1IN8A 2XVCA 5HVQC 4EM1A 3WTVC 3VFZA 2PMUA 1STZA 2FE3A 2LNBA 4LGWA 1U3EM 2E1NA 3WGHA 1H9GA 2G7UA 2XAHA 2PBIA 4IHTA 3ZMVA 4LLNA 5FLXZ 2QVOA 1XN7A 1IXCA 2PEXA 4ZYHA 2WC2A 4MNUA 3TOAA 2YPRA 2ADUA 1XGMA 4M74A 4NQWA 4I02A 3R0JA 2HQRA 3ISPA 1MKMA 2K4JA 2DPDA 4CXFA 4ESBA 5CVRA 4KIGA 4OIQF 4RGUA 1YW9A 2PQ8A 4LK0F 3MAJA 1K6OA 3E6DA 4UHTA 1Z6TA 1GHCA 2V1DA 3C1DA 1S29A 1I1GA 4K2EA 2M5WA 2BGCA 2L02A 1SD5A 3CTAA 2R7DA 3FM5A 2A69F 1ZG3A 1I5ZA 2A68F 2EJRA 3MFKA 5D5XB 2QUFA 4KIBA 2Y75A 3J7AO 2Y0MA 2RV8A 1ON2A 2OA4A 1FZPB 2O6GE 2VXZA 4HF0A 3I71A 5FD5A 3V7SA 3TOBA 4ETSA 1DUXC 3WGGA 1T0FA 1EH6A 1PP8F 4R1HA 2P7CB 4LB6B 1O3SA 4TV7A 5F1RA 4OU0A 2G7HA 4MTDA