3I0TA

Sulfur-sad at long wavelength: structure of bh3703 from bacillus halodurans
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
178
structure length
170
Chain Sequence
SLEKQIESYYQEIAQLIIDMIPEEWAEVRFYAQEDHDGWKIFFFHYLSASSDEWTKDIDIRDVIKVPQDEFMEKYNELSFCISDFRKDYAEAFGEPWMSFQMTFYASGKFNIDFYYDKNPFDTFLTRLAWQYEHFGTIPEDSFYKETLNEYLEEKAQGKRYPFLEPLHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BH3703 protein
publication title Sulfur-SAD at long wavelength: Structure of BH3703 from Bacillus halodurans
rcsb
source organism Bacillus halodurans
molecule tags Unknown function
total genus 54
structure length 170
sequence length 178
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04634 DUF600 Protein of unknown function, DUF600
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3i0tA02
3.30.500.20 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 BH3703-like domains 3i0tA01
3TO7A 3KP2A 3AAFA 1HKTA 4YFXF 1YIOA 4EVIA 4FX4A 5E20A 2F5CA 5CVUA 1DDNA 4HLXA 3WTYC 3F6OA 3GVAA 5CVJA 1HW1A 4M9SA 2QBYB 4CGZA 3E3VA 3V4GA 2KIMA 1KQ8A 1JHHA 3GXOA 4PDKA 1QZYA 2DW4A 3FM3A 4YFNF 2V1XA 1TTYA 2G7UA 3M7GA 1EV7A 4IXAA 3O6BB 1WWXA 1YW9A 5E8IA 2P8TA 1KA8A 2JPCA 1P2FA 1E2XA 5TRDA 4XSXF 3V8LA 3DP7A 5CVIA 5DCFA 5KVRA 1ZGAA 2VT3A 5K5OA 1FY7A 2GXBA 4ENKA 4LFUA 4BAYA 5ILSA 4WX9A 1G4DA 1S8NA 3KP4A 4AD9A 2ZJ2A 2X4HA 5D5WB 1B9NA 1ODDA 2CG4A 1P4WA 3WE3A 4IJAA 4WXCA 5ICFA 3JTGA 1HQCA 2E7WA 3NRVA 1TLHB 3L7WA 4L18B 2IW5A 1OKRA 5F64A 1XB4A 3H3UA 2GZWA 4R8HA 2E1CA 4WXHA 1R1UA 4KDPA 3SHFA 4WCGA 2NAZA 3SQNA 3IHUA 3P9KA 2QWWA 1R7JA 2JSCA 4I7HA 2OU2A 4U88A 5DDGA 3WTSC 2QVOA 4OINF 3P9IA 1YO5C 1J9IA 1NHAA 4G7HF 4FT8A 4HW0A 2NYXA 1J75A 3DPLC 3OV8A 3J81K 1T2KA 1K79A 3R61A 2LF8A 1D5VA 4HAMA 2W85A 3F3XA 1U5TC 2QUFA 5LLQA 1YQAA 2F5FA 2QENA 1FP2A 4RAZA 2NNNA 3S2WA 4ZZLA 3J80Z 2B0LA 2BBYA 4IF4A 3ZMTA 2DQRA 3GX4X 3F8FA 1GHCA 2MD5A 3B73A 2VE8A 2MBFA 2R3SA 4HLYA 4UVBA 2XKOA 3C1DA 3I54A 3GO5A 1PP8F 1P4XA 1FT9A 5DCMA 2ESHA 2XAQA 3MZYA 1SFEA 4A0YA 4N0BA 1G3YA 4JK1X 4RS8A 2W24A 5L3GA 3MEXA 1T0FA 1J2XA 4EJOA 5D6EA 3E5UA 3RKYA 5H20A 3ERED 3TQNA 4I02A 3JW4A 2XHKA 1BC7C 2HTJA 2M8EA 4PCQA 3GW2A 1I5ZA 4LMYA 1ON2A 3ZN1A 4RB1A 1QBJA 1FNNA 4IHSA 4I2OA 2L4MA 4UNOA 1JXSA 2H6CA 2GA2A 2FNPA 1A04A 3KEOA 3WU0A 4UV9A 3RDIA 1BIBA 1W4MA 4ETSA 4GGGA 1U2WA 5ICCA 3REOA 1BI3A 4G94A 2LDUA 2HZTA 5FFXA 2W25A 1F1ZA 1H9GA 4KIGA 3IC7A 5L3EA 2OZUA 1O3RA 2A6EF 1T6SA 4CICA 2R7DA 2AXLA 1O7FA 4BHCA 3D5LA 1F9NA 1YG2A 2JZYA 4CYDA 3KP6A 5H6RA 2CYYA 5AONA 5L3FA 4IHTA 4IRHA 2J5OA 2PQ8A 3J7AO 2HKXA 2L54A 4BHPA 3E6DA 1IN7A 2HGCA 1UHWA 3ELKA 5E8GA 3IRRA 3R4KA 4HV5A 2V79A 1R23A 3KZYA 2XAGA 1Q1HA 4HX8A 1XMAA 2Z5UA 3HSRA 2UZKA 3RKXA 4CHUA 4EM2A 1FYMA 2CW0F 4HX7A 3VEPA 5BPDA 4MGRA 1T38A 2PFBA 2G9WA 2EA4A 2XVCA 4L9NA 2QLZA 1J0RA 4UVAA 4RB2C 3GZ5A 3KLNA 1AWCA 1XCVA 1Z1DA 2O03A 1LQ1A 2CO5A 2YPRA 2VBXA 5IT9Z 3ZPLA 5LGTA 4CO8A 2MA3A 1SFUA 3DEUA 1QZZA 2LKPA 3K1NA 4IPAA 5DCMB 2LNBA 3K2ZA 4BH9A 1YFHA 3LA2A 2J5PA 3K1MA 2IA2A 1FSHA 1KGSA 4AIKA 3HSFA 4A5NA 4PZJA 3RPQA 3B02A 3BJAA 3HHGA 3KEQA 2QM3A 1VTNC 2GA1A 5ICGA 1IXRC 3E6BA 5LRSA 2YX4A 3WTVC 2WWYA 5H6QA 1GXPA 1CGPA 1CF7A 3PQKA 1HXDA 2EJRA 4RGSA 4GYIA 4XLNF 1XGNA 1TQMA 5D8KB 3P7NA 2IRFG 2HWVA 4RGUA 1EH7A 4OMYA 2P6TA 1U6GA 3F23A 2O61A 5DD4A 1B4AA 1W7PA 5EEHA 2P5VA 5FLXZ 1BC8C 2VN2A 1MD0A 5BQTA 1HKQA 4ASNA 2EWNA 2DFIA 5E1ZB 3MFKA 1HBXG 3SZPA 4LK0F 1D8JA 3KLOA 3MZHA 4RB3C 2C6YA 1XSVA 3RTRA 3WODF 3BZ6A 2FBHA 1E17A 1J7KA 3ZMSA 1U78A 2Q0OA 3WGHA 1KQ0A 1SFXA 3CDHA 5J8CA 5FO5A 1BI2A 2GWRA 3U2RA 4MTDA 3HYIA 4UXNA 2Z3YA 1RUOA 2OZ6A 4O5VA 2XUBA 2YSRA 4U0WA 1MKMA 2L02A 1MDMA 3DPTA 1ZREA 2EFNA 1R5HA 4UVCA 1LJ9A 4OOIA 3MCZA 3VODA 5EEGA 4RAYA 4EMSA 2Y48A 2V1DA 3LQRA 5LHIA 2GQQA 5BOXA 1BJAA 2QQAA 4RGRA 3TOBA 5JFRA 2RGVA 3O3KA 2Y75A 4HBLA 1WQ2A 3T1BA 1KU7A 4GXOA 2BV6A 2VONA 4KMFA 2HYGD 3V7RA 3HRMA 2ESNA 4M74A 2P7VB 2DAOA 2V6CA 3P9CA 1L0OC 1IZ1A 3EUHA 4R79A 1O57A 3DV8A 1U5TA 4HQMA 3V7CA 3RYRA 3W6JB 3KFWX 5D4RA 2A61A 3WE2A 4KNYA 3IWFA 3BDDA 4I09A 2A07F 4NB5A 5FGMA 5ERIA 4L9TA 5D8LB 2OD5A 2KJBA 1P6RA 1F5TA 2KIFA 2VC1A 2Z99A 1OYYA 1PDNC 3Q9VA 1IN6A 3ZMDA 4N9HA 1CF7B 4M9ZA 3VOEA 2RDPA 2FSWA 2XKPA 2Y0MA 2P4WA 1KYZA 3WG9A 2PEXA 2A6HF 3K1PA 3WTXC 2K27A 2PG4A 4HX4A 1STZA 1H0MA 3CJNA 2LSOA 2RQPA 5FLXK 5HS9A 2ETHA 3R6SA 3LWFA 2DBBA 3F8BA 4YFKF 1W7PB 5HDGA 4H0EA 1B6AA 3VB2A 2YR2A 3HUGA 4HDVA 4CXFA 2M30A 4EJUA 2JPBA 2UXXA 2DLLA 1FZPB 2VBYA 3HTSB 3W6KB 5LGUA 2HQRA 4S04A 4HYEA 2ISZA 1XSXA 2KIUA 3R60A 2ELHA 1KQ9A 1TBXA 1YS6A 1I1SA 3ECHA 2DPUA 3ZN0A 2FBIA 4PGHA 3F8NA 2ZXJA 1ZN2A 3LSTA 2M45A 1MJAA 2Q2EA 1S3JA 1W5SA 4LG0A 3KCCA 2XGXA 1YTYA 2EB7A 3C7JA 3F8MA 1FPQA 4EM0B 2OAZA 1OYWA 2HKOA 2PMHA 1JHFA 1MDMB 2XROA 5JHUA 3WTWC 3SFZA 2H94A 4A6DA 1Z05A 4ZZDA 1TNTA 2DPDA 4F7ZA 3I71A 3JSPA 1OPCA 2PBIA 2CWEA 4DQ2A 5BMZA 4GYGA 3KE2A 2XAFA 2ADUA 5D5VB 3N4MA 3F72A 2RC4A 5FD6A 4IRGA 1YYVA 4B09A 2RKHA 4A0XA 3GEZA 1XGMA 2CSOA 1B9MA 3FMRA 4HF0A 1J5YA 2EV6A 3RI4A 3IRQA 3I59A 4UUVA 4EJVA 3JAMZ 1UCRA 1UFMA 3C3WA 1U5TB 3FXRA 4L9JA 2DK8A 4L0YB 4CZZA 1R5GA 1XDSA 1XMKA 4KN4X 2PMUA 2VC0A 1OMIA 4HF2A 1G6NA 4HV6A 1KU2A 2MH2A 1F4KA 3WTUC 3OOPA 3VFZA 1LB2A 2UXNA 2XIGA 3M9AA 2DU9A 4OMZA 1W5TA 4AIJA 5D4SA 1IN8A 1RNLA 2L01A 5DEQA 1FYLA 1BI1A 4JQFA 1DPUA 5CJ9A 2A69F 4MHGA 4EJWA 4ENNA 2EA2A 1P4AA 4ESJA 2BYVE 1B59A 2FRHA 1UHMA 3K69A 3GFJA 5LBQA 1KU9A 5KK1A 3K9TA 3HSEA 3ZP5A 4B8XA 5CVVA 3DFGA 5L3CA 1W7PD 4ZYEA 5AIPA 1TW2A 1OYIA 5D6FA 5DYMA 3MAJA 3ZQ7A 2EV0A 1QQIA 4UV8A 4O3MA 1MJ9A 4ZYGA 2CGPA 1IXSB 1J59A 1C0WA 3RJPA 5LHGA 2VODA 3CUQC 1IN4A 3BJOA 1FBSA 2IT0A 3WTZA 4A5MA 4OIPF 4I98B 1ZAOA 3TDUC 2K02A 2D2WA 2ZMEA 1LDJA 4LG0B 4ESFA 3IKVA 1T39A 4KIFA 2XRNA 1YW7A 1BM9A 1EH8A 4L5JA 2A68F 2FQ3A 1FP1D 4EJTA 4KN7X 3J80K 2F5DA 5F1RA 3U9GA 4KA4A 1ZG5A 1IRFA 1U8RA 4UHTA 2PI0A 1IW7F 3MWMA 2STWA 2EFOA 4Y17A 4FX0A 1YW8A 1OR7A 2K7LA 2IVMA 5HOOA 1S29A 5LGNA 5E18F 5DUKA 2QQ9A 4BYYA 1KU3A 4KYWA 4ON0A 3DXJF 4KFCA 5L3BA 1O7LA 2ZNYA 2UWMA 1JGSA 3I58A 1R1TA 4U0VA 3I59B 2EFPA 3RPUA 2OBPA 2FMLA 2Z33A 2PLYA 1SD6A 4Q48A 1KYWA 3FF5A 5ILVA 3IWZA 1AOYA 3SXYA 2P7CB 2TDXA 2D1VA 3GUDA 2Z9OA 3FX3A 5TJJA 2HDCA 1BBYA 4OIQF 3HTUA 2V1UA 2DI3A 1TNSA 3M1EA 2D1HA 3EQLF 4LLGF 4EQQA 2K4JA 2O3FA 4OIOF 3E5XA 1WKMA 3BJ6A 2X0LA 1D8KA 3G73A 2R7FA 3PFIA 2NRAC 6PAXA 1LEAA 3WU1B 2VT2A 1FBUA 2M87A 3QAHA 2COMA 2W84A 5DUIA 4EV0A 2STTA 2H09A 1RZ4A 5K5RA 3R0AA 2RV8A 3F8CA 2XAHA 5LEKA 1ON1A 1Z9CA 3M8FA 5ICEA 2VE9A 1BIAA 3F6VA 2KRFA 3HHHA 1G3WA 3V7SA 3EYYA 1LNWA 3HOTA 5DV5A 3V8JA 3ULQB 2ZO4A 4AWXB 1V4RA 2ZMEB 1ZARA 1GVJA 1DUXC 4MTEA 4NHJA 4Y13A 2A5YB 1TQPA 2KKOA 4EGZA 1FC3A 5FB2A 1LVAA 5JR3A 3IL2A 2GAUA 5IT9K 4YIIA 2FU4A 3GZ6A 4O6JA 2RN7A 2CFXA 3DF8A 5D5XB 3BY6A 4AVPA 1RIOH 1K6OA 4AIHA 2IJLA 5E1XA 3BROA 5AIQA 3D0SA 3QP6A 3E6MA 1L3LA 1Z6RA 3EETA 3E5QA 1PP7U 2FE3A 3J81Z 1IXCA 4MQVA 1DP7P 2HEOA 5JVTA 3KETA 3NEUA 3CTAA 4I0BA 1FYKA 3E97A 4A2UA 1YLFA 2DTRA 2JRTA 5IT3A 1EH6A 1R58A 3BOQA 5E1WA 4KICA 3BPXA 5LRRA 2Q8KA 1DPRA 2BE5F 1R1VA 4MEXF 3MQ0A 5L3DA 1XSDA 2ZNZA 1HKSA 4L5IA 3Q5FA 4YG2F 3JTHA 4QLCU 4LLNA 5K5QA 2IPQX 2KJCA 2HYFA 2ZCWA 1S6LA 4LB5A 4G6DA 4JBAA 3KP3A 3GFMA 3T8RA 3PQJA 1T98A 1QO0D 1FOKA 2VXZA 3LA3A 4KT5C 1Z91A 5CVRA 2MLGA 3FMSA 4LLLA 2EFQA 4M6XA 3O2PE 1P92A 5E17F 4XRFA 1WRJA 1LDKB 1XN7A 3F21A 2BGCA 4ENMA 2GXGA 5BPIA 4G7OF 3I4PA 4U7BA 3CUOA 3HRUA 1O3TA 3HOSA 2BEOA 3COAC 5JI6A 3DQVC 3RKWA 3EDPA 5HDKA 2FMYA 2IA0A 2DK5A 2FA5A 2W57A 1B1BA 3LA7A 2ZKZA 2A3SA 3I53A 5A2QZ 2HOEA 2ZFWA 4LD5A 1R36A 1XCBA 1ZG3A 2ACJA 1SMTA 2O0YA 3WTTC 5ED4A 2L4AA 2JT1A 2FNAA 4EM1A 3ROUA 3QPHA 4GCVA 3FZVA 3KP7A 2E1NA 5LEJA 2HFHA 1I27A 4PGGA 4ZYHA 4S05A 1BOAA 3H3ZA 4MQ9F 2XV4S 5HLHA 2RNJA 1IAWA 1IUYA 2HQNA 1Y0UA 1G3SA 1ZLJA 4HDUA 4N9IA 3CUQA 1ZLKA 1JE8A 2FOKA 1HSJA 4WXDA 3L2CA 2DQLA 2MC3A 1X3UA 4LJZF 4KUMA 1IN5A 3ECOA 1O3QA 5CLSA 1HSTA 1R00A 4U7DA 4HOBA 1YS7A 3BP8A 3ABTA 2P5LC 3E6CC 3EYIA 3LAJA 3LQQA 3LFKA 5FD5A 4GO1A 2P5KA 2VOPA 4QWQA 4FHTA 4M73A 1K78A 1QGPA 1XD7A 1LEBA 3TOAA 1I1GA 2VBZA 4L0ZB 1G3TA 3RIRA 4RGXA 1FBQA 1ZRCA 2LF7A 1UB9A 1RUNA 5HVQC 5HLIA 2PN6A 5HS8A 2QYOA 3QU3A 1XGOA 4U0YA 3GLXA 3BWGA 5FFZA 1V3FA 4MEYF 4HA8A 1FSEA 1WI9A 2O6GE 5D5UB 4OIRF 4P9FA 3SZTA 1TQIA 2DO7A 3WGIA 5BS6A 2H6BA 1SMYF 2QZ8A 2V9VA 1HW5A 3WGGA 3H92A 3QU6A 4BNCA 2AS5F 4M9XA 3HRTA 4Y15A 5HDNA 4I01A 1ZYRF 4M71A 3LAPA 2IP2A 1ULYA 4P5OA 4Q47A 4R1HA 3FWEA 4D0PA 1HW2A 5J8FA 5CYVA 3TO9A 4P55A 4A6EA 1GXQA 4BXUA 3Q9SA 4E70A 1ZGJA 3FHZA 4LK1F 5HLGA 2OA4A 1USTA 5A2QK 1WSUA 1H9TA 3TGNA 4WK8F 2F2EA 1IRGA 1SD4A 2RVCA 3C18A 4P9UA 3GFIA 2FXAA 4LB6B 2JTVA 4HQEA 2ZBKA 3QPTA 1FX7A 4TV7A 4EGYA 4LGWA 2EV5A 4IVNA 3FM5A 2HTSA 4ENJA 3TKYA 1PUEE 4HZFA 5J6XA 1S7AA 2OQRA 3G3ZA 3CUQB 3FXUA 3GFLA 3FMQA 1TW3A 3HRSA 4HF1A 2E7XA 1ZG1A 2OQGA 1QPMA 2P6SA 4ZH4F 2WC2A 1FWZA 3IKTA 2NNYA 1S7OA 3JAMK 1SAXA 2WV0A 3I0TA 2XASA 2K86A 1ZH5A 3GWZA 1LDDA 1SD5A 3TO6A 3L09A 3R0JA 4G9YA 3F22A 1IF1A 2D45A 3HIFA 2DT5A 2ISYA 3GF2A 1K78B 2HR3A 4YIFA 1ZHFA 4BQAA 4A0ZA 2VBWA 2QQBA 3JSOA 2M5WA 3FXQA 3KZZA 3BPVA 4M6YA 3ZMZA 3CLOA 5ILUA 1ZRDA 2FBKA 4MNUA 2QBYA 3ML6A 4XSZF 2H27A 3M8EA 3U1DA 4DNCA 4Q5SF 4ESBA 4IRIA 1Z6TA 3ABUA 1I6XA 1BN5A 1Z7UA 4P96A 5HS7A 2IA1A 4NQWA 3KP5A 2WTEA 1BI0A 2PJPA 2GIVA 2F5EA 1SD7A 3GYHX 4M72A 4XBFA 4K2EA 2VOOA 5K1YA 3QRFF 1QNTA 4RB0A 2YX7A 1D3YA 2NS0A 3L00A 3CO7C 4XLPF 4G6QA 3QOPA 4CDGA 1R22A 3N97A 2G7HA 1O3SA 2FEZA 3TDZC 3I64A 4ZYDA 2M1BA 4Q4ZF 4KIBA 3T8TA 4BHBA 5LHHA 4I0AA 1USSA 2MLKA 2K4BA 3I5UA 3ISPA 3L9FA 5DD8A 4WWCA 3ZMVA 1ZRFA 1XGSA 1RI7A 3NQOA 1MZBA 1FLIA 2EK5A 3DKWA 2HS5A 3V8KA 4Z2YA 3K0LA 4WF2A 3CO6C 2XAJA 3T0YA 3QP5A 4G8XA 4OU0A 3T5XA 4G7ZF 4A12A 2O8XA 1XDUA 3RYPA 4KMUX 2L3DA 1MJBA 2YU3A 1MGTA 5F6FA 1U3EM 1K7AA 1REPC 1ONVA 2CQKA 3ZMUA 4L9VA 2MH9A 2FF4A 2EFWA
chains in the Genus database with same CATH superfamily
1ORKA 3TO7A 4PJ9A 3KP2A 2RAEA 3GMOA 3AAFA 1HKTA 4YFXF 4PRPA 2HPIA 1YIOA 4IHVA 3S16J 3T8XA 4EVIA 3VH8A 2VJ5A 3O3AA 4U1NA 1AHDP 2JVHA 2JWTA 3GMRA 4NQVA 4FX4A 4XRSG 4IRJA 5E20A 2F5CA 3DMMA 3TZVC 5CVUA 1DDNA 1NEZA 2DN0A 4HLXA 4EATA 1KZHA 3WTYC 5IVXA 2IGKA 2KRCA 5KCMA 2GTWA 1QZEA 1QU3A 2C7UA 3S6CA 3F6OA 2L9RA 3AG4H 3GVAA 3TO4A 1YX3A 5CVJA 3BHBA 1HW1A 4M9SA 2QBYB 3E3QA 4XIDA 2FJ1A 4CGZA 3E3VA 4MVBA 3V4GA 3HZJA 4JOMA 2KIMA 2XGCA 1KQ8A 5IB5A 4BGDA 1JHHA 3GXOA 3HPGA 4F93B 2DA4A 2LYCA 2OC6A 4PDKA 1K83J 1ZELA 5CQGA 3BH8A 1QZYA 2DW4A 2KQRA 2HQ5A 3FM3A 4XN0A 2CQXA 4YFNF 3L3KA 3FXLA 2XPWA 2ICWG 5CPRB 3OYFA 2V1XA 1VQMI 1N25A 1TTYA 2G7UA 3M7GA 1EV7A 1XTAA 4IXAA 4UUSA 2BVPA 4LOCA 1VQ6I 4IOAF 3M1BA 3O6BB 4JFFA 3QUZA 3LNQA 1WWXA 4PJHA 1YW9A 5E8IA 3QDMA 2P8TA 2ID3A 1N3NA 1KA8A 2JPCA 4NQWB 1BD2A 4G42A 2BZTA 1P2FA 3HUJA 3CVHA 4QPOA 3DXAA 4JX5A 2O5RA 1SEUA 1E2XA 5TRDA 4XSXF 3V8LA 1W72A 2XSDC 2CUFA 3DP7A 3O8GA 5CVIA 3FKIJ 5DCFA 5KVRA 1YPZA 3MRMA 1ZGAA 1BJZA 2VT3A 3QDJA 5K5OA 2ZSIB 3GCMA 3NWSA 2ZJQF 2EZKA 1FY7A 2TCTA 1MBKA 2GXBA 3OYKA 3BR0A 4ENKA 4LFUA 2FQ4A 2VQLA 1JUPA 4BAYA 1HDPA 5ILSA 4XM3A 4WX9A 1G4DA 1S8NA 3G2BA 2XB0X 3KP4A 1O4XA 3SJVA 5C9JA 4AD9A 1Z5LA 2ZJ2A 1EEYA 2X4HA 5D5WB 1B9NA 1ODDA 1ETVA 1P4WA 2CG4A 3L3GA 1OJLA 3WE3A 4IJAA 3KPRA 4LHUA 2ZOLA 3L2VA 4WXCA 5FKLA 5ICFA 3MREA 3JTGA 4Y4KA 1HQCA 2E7WA 2K9QA 3S14J 5JLXA 3NRVA 5HLTA 1DU6A 2X1DA 5EDNA 1TLHB 4IHWA 3L7WA 4L18B 1UG2A 4CW1A 5L2KA 2DJIA 2IW5A 1VQPI 1CE6A 1OKRA 3BC8A 2M0CA 5B1AH 4QTRA 1T1XA 1AU7A 2PJRA 2GM4A 5F64A 2L5QA 2FD5A 3CZ6A 5K7FA 1XB4A 1ITYA 1E27A 4HUWA 3HGGA 3FBNB 3H3UA 2GZWA 1LD9A 4R8HA 4HS3A 1APLC 1IRXA 1JHTA 4PV9A 2E1CA 4WXHA 1R1UA 4KDPA 3TW6A 3SHFA 2FOWA 3JRAA 4WCGA 1X4OA 2NAZA 3SQNA 3IHUA 1XX5A 2YPLA 1WCMJ 5GAGJ 2XRLA 3P9KA 1E0EA 3L3IA 2EH3A 2QWWA 1R7JA 1I1FA 2JSCA 2LRDA 4I7HA 5F0FA 2OU2A 2VKVA 2IS6A 4U88A 1RK1A 4XL9A 2X9DA 1S72I 5DDGA 4L5EA 2R7SA 3WTSC 2QVOA 4OINF 2X6YA 5EU4A 3P9IA 1TWGJ 4JX4A 1YO5C 1J9IA 4PJMA 3HDDA 3PSIA 1OCPA 3K10A 1NHAA 4G7HF 4FT8A 4HW0A 1E28A 1T56A 2XC7A 3GMQA 2NYXA 1SYSA 5FKOA 3ABKH 1J75A 4LITA 3DPLC 1WHUA 3H35A 4A69C 1FOXA 3OV8A 3J81K 2D5VA 4A3GJ 2M4KA 1T2KA 3FOMA 1K79A 5IB3A 3R61A 1GV5A 2LF8A 1D5VA 1QLFA 4HAMA 2L7KA 4QIWN 4QRQA 3A2KA 2ELJA 2W85A 3F3XA 1HOCA 2M8GX 2JA5J 5BRZA 4Y3OA 1U5TC 2WAEA 2EBIA 1IUFA 2ZJPF 2Y9YA 2O7OA 2QUFA 4XKCA 5LLQA 1YQAA 2F5FA 2QENA 1FP2A 4RAZA 2NNNA 3S2WA 4ZZLA 3J80Z 4Z76A 3K70D 2B0LA 2BBYA 4IF4A 3BEWA 4LCYA 1YJWI 3ZMTA 2DQRA 2OF7A 2K9SA 3GX4X 3H0DA 3JRFA 1ZHBA 3F8FA 1GHCA 2E2IJ 2MD5A 2AXFA 3B73A 2VE8A 4NO0A 2MBFA 3G1LA 2R3SA 1TVBA 4HLYA 1AA7A 2AXTC 4UVBA 3SKMA 3T1FA 2XKOA 3KYDB 2CQ7A 4PJXA 5C0DA 1NANH 4YIRX 4F7PA 2VL8A 3C1DA 3I54A 3VFNA 3VXOA 3GO5A 4BXXJ 1PP8F 3DEEA 1P4XA 1FT9A 1CQTA 5DCMA 4APQA 2ESHA 5C44J 1Z77A 1D5YA 2XAQA 3MZYA 1SFEA 5D9SA 4A0YA 3RWIA 1NK3P 5IB2A 1QR1A 4N0BA 1MNMC 2HVSA 2EQRA 3OWTA 3QYBA 5J1YA 5DM7F 3RWGA 1G3YA 4WO4A 4JK1X 3RZOJ 1DE4A 4PFOA 4RS8A 2W24A 4RLQA 4C3HJ 3ARDA 5L3GA 1IM9A 3MEXA 1T0FA 4G9FA 3TP0A 2CIIA 1PJRA 3ZOBA 2NOGA 1J2XA 2LP0A 4EJOA 3DX6A 1WVRA 5D6EA 3ZQCA 3E5UA 2E2JJ 4WU7A 1CG9A 1UG0A 2DYSH 3RKYA 4Y16A 4U1LA 5H20A 3ERED 2Z1DA 3TQNA 2DA1A 4I02A 2QQ8A 3JW4A 5IM7A 2V2WA 2XHKA 1BC7C 2HTJA 3CJTB 2M8EA 4PCQA 1SVOA 1SVMA 3GW2A 1I5ZA 4LMYA 5J3LA 1ON2A 1I1YA 3SKOA 3ZN1A 1NTCA 3CLQA 4RB1A 1FNNA 1QBJA 4IHSA 2L4MA 4I2OA 4UNOA 1JXSA 4XLCA 1X3WB 2V7FA 3KPOA 1QRYA 1R4MB 2H6CA 2GA2A 3WL9A 2FNPA 1A04A 4XK4A 3KEOA 4UUSB 3OYGA 2ZSVA 1SVLA 2BVOA 2LVSA 2E5NA 3WU0A 3PIPF 4UV9A 3SDDA 3RDIA 2M7BA 3CMEI 2DOEA 4XKBA 4B48A 2FWOA 5SWZA 1BIBA 1MBHA 5MENA 3TP3A 1W4MA 2GXAA 3GMNA 4ETSA 1ZT4A 2AQEA 3MRBA 3TVMA 3VSLA 4GGGA 1U2WA 1PUFB 3TBSA 1B0GA 2Y69H 4FETA 5ICCA 1GZPA 4NNYA 3REOA 1PQZA 1BI3A 4G94A 2HVRA 3RL2A 2XF7A 1EJ9A 3S17J 2LDUA 2HZTA 1RESA 3OSGA 4PRDA 4PRIA 5FFXA 1IV6A 4BKWA 2W25A 3L2QA 1UZCA 1YI2I 1F1ZA 1H9GA 4XOPA 4KIGA 2Y31A 2BNQA 5FKMA 3IC7A 5L3EA 2AXGA 4O2FA 3MN2A 1XZ0A 2OZUA 1O3RA 2A6EF 1T6SA 4CICA 1YE9A 2AXLA 1O7FA 2R7DA 5K7HA 4BHCA 3D5LA 3O8HA 2DDAA 1F9NA 1S9XA 1IDYA 1YG2A 2JZYA 4CYDA 3VYRB 3KP6A 5E3OA 5H6RA 2CYYA 1FG2A 5AONA 2L7ZA 2F74A 5L3FA 5C07A 4A3BJ 1YRNA 5DM6F 4Z6YA 4IRHA 4IHTA 4PJ7A 2J5OA 4PR5A 3UPRA 2PQ8A 2CLRA 1JTYA 5E79C 2PJRB 3J7AO 4PRBA 4GKNA 2M34A 3QPLA 2HKXA 1JJ8C 2L54A 3BCAA 4JP0A 4BHPA 3C2HA 3FFCA 3E6DA 1IN7A 3EUKL 3IH2A 1Y6IA 2DTZA 1UHWA 2HGCA 2Z16A 3ELKA 5GAHJ 3REWA 1U58A 4II3A 2QSHX 1JPFA 5E8GA 3HEFA 3R4KA 4HV5A 3IRRA 2YPKA 3LKPA 5HYJA 2X4NA 2V79A 1LUJB 3CCVI 1R23A 2HDWA 3KZYA 1DGRM 4A3MJ 2XAGA 1Q1HA 4FQGA 1X1BA 3O4LA 4HX8A 1XMAA 2Z5UA 3HSRA 2UZKA 3RKXA 2ELKA 3MGTA 4CHUA 4EM2A 4P1WA 1FYMA 2CW0F 4HX7A 2E34A 3VEPA 4D9JA 2K9MA 5BPDA 3KPLA 2M3AA 3BCBA 1K5NA 1D1AA 3CCHA 4N0UA 1A6QA 4MFDA 5KNLA 3DX8A 4MGRA 2WY8Q 4X6FA 1T38A 2CS3A 3S2HJ 2IAIA 2PFBA 2G9WA 2EA4A 4NBQA 5FRNA 2XVCA 4L9NA 2QLZA 1J0RA 4UVAA 4RB2C 4IHXA 3GZ5A 3SDGA 3KLNA 1AWCA 1XCVA 1Z1DA 4WDIA 3D25A 5AD0A 3VXNA 2O03A 1LQ1A 2VKEA 2P81A 3MV9A 2CO5A 2YPRA 4QRPA 2W82A 1H88C 1Z3XA 1ZK8A 3ROOA 2VBXA 5IT9Z 4O2CA 2QKLB 4FE4A 5EEAA 3ZPLA 2VABA 2E71A 4MNQA 2MSYA 4D7MA 5LGTA 3FT4A 1I50J 2KFDA 3PL8A 4CO8A 2MA3A 1SFUA 3DEUA 3C8KA 1VQ9I 1NG7A 2VE6A 1G59A 3ZQQA 2KRHA 1D0XA 1QZZA 3ILPA 2LKPA 3OYJA 3K1NA 2YU9J 2VB6A 3ZR8X 4IPAA 1OQYA 1TMCA 5DCMB 2XF5A 2O8KA 3QFJA 4PK4A 2IGOA 2FX0A 1VQLI 2BY0A 4S0UC 2LNBA 3K2ZA 4BH9A 3BLYA 2V9PA 2HVQA 1YFHA 3LOCA 5C4JJ 3C2GA 4AC0A 1ZT1A 3LA2A 2J5PA 3K1MA 4YRVA 1W36C 1W1WE 2IA2A 3H1CA 1YOVB 3WU2C 1FSHA 2X4RA 3GTQJ 4HUXA 1KGSA 4AIKA 3G71I 3DLAA 3HSFA 1TC3C 4PZJA 4A5NA 3RPQA 4XKVA 3B02A 3BJAA 3HHGA 3KEQA 4AYBA 4GKSA 3VJ6A 2H1KA 1JT6A 4B3XA 2DMPA 3MV8A 1B3JA 5B5EC 2OUMA 1S7UA 1TT0A 2QM3A 1VTNC 2GA1A 2X85A 2M0MA 3GTLJ 2KMUA 2LOOA 2MGQA 5ICGA 1IXRC 3E6BA 5GPCA 4E7HA 3JTCA 4PGBA 3VFVA 1LE8A 2R92J 3ASNH 1Y8RB 2WB1A 3HE7A 5LRSA 2YX4A 3D5RC 3WTVC 3H9SA 2WWYA 5H6QA 1GXPA 1CGPA 1CF7A 4V3DB 1HXDA 3PQKA 1YJ9I 1A35A 1DUZA 2MYSA 3A0HC 3W6VA 2EJRA 1SANA 4RGSA 4GYIA 3ECBA 4XLNF 1XGNA 1TQMA 5D8KB 4F91B 1KTLA 3X11A 1LKXA 3P7NA 2HOAA 2X4TA 3HAEA 2IRFG 1J09A 1UJ8A 2HWVA 5E9DA 3PWLA 4RDUA 5J4YA 3NFNA 4IEJA 1ZR4A 4RGUA 1EH7A 4OMYA 3GMEA 1RKTA 2QKMB 2JA6J 2P6TA 1GT0C 3PO3J 2KZGA 4Y4HA 1U6GA 3PO2J 3V42A 4N0FA 4PG9A 3F23A 2O61A 5DD4A 1YIJI 4M6VA 3KYOA 1B4AA 3UTSA 1QVOA 1W7PA 5GTIC 5IP7J 2GTZA 1MIJA 5EEHA 1QQDA 1MSEC 4BXFA 3RWDA 4NDLA 2P5VA 3LKNA 3LSGA 2ZMEC 5FLXZ 1WPKA 3NARA 1TWAJ 1BC8C 2HOTA 2VN2A 1ZT7A 1MD0A 2K3PA 1HKQA 5BQTA 2HDDA 2W48A 4ASNA 3B6SA 2KIQA 2EWNA 3M4OJ 2DFIA 4DYCA 5J47A 5JVGF 4M3DA 5E1ZB 1VI0A 2AK4A 5F7DA 2VUMJ 3A1YA 3BG5A 1UAAA 2CMPA 3MFKA 1YRNB 1HBXG 3SZPA 2IS4A 5E00A 4LK0F 1D8JA 3BWAA 3HE6A 3KLOA 3A02A 1VQ5I 2K9LA 3MZHA 4RB3C 1AGCA 3FHNA 2C6YA 1XSVA 3RTRA 1FTZA 3WODF 2QF7A 3BZ6A 1YITI 2FBHA 3CMAI 1E17A 5HGDA 1J7KA 3W2VA 3ZMSA 4ABZA 2R7RA 1U78A 1RC9A 1A31A 1KJVA 2Q0OA 2NVTJ 3DBXA 4A3CJ 1S8DA 3WGHA 3VXUA 1KQ0A 1SFXA 3CDHA 2DFFA 3ES6A 3D5SC 4ANJA 3L2RA 1T1YA 1T22A 1ZQ3P 2OCEA 4D0DA 1Y1WJ 3G08A 5J8CA 1W0WA 4C3IJ 3BP7A 4GUPA 1OR7C 1I39A 5HNFA 1RRJA 5FO5A 4B44A 1T7XA 1R6RA 3OMYA 3LSMA 1BI2A 2X4PA 4CCKA 2GWRA 1G7QA 1HHIA 3U2RA 3CC5A 1ONQA 4MTDA 3HYIA 1VQOI 2JUGA 2Z3YA 4UXNA 5HHNA 3BG9A 2BW3B 1RUOA 4AYBN 4PSXA 3HCVA 2JRMA 2EIKH 2OZ6A 4O5VA 4ZYAA 1JUFA 2XUBA 5HHPA 4J01A 2R7VA 2YSRA 4U0WA 3KLAA 4RM3A 2WBMA 2XFXA 5C09A 1T08B 1MKMA 2VLRA 2L02A 1HLVA 1MDMA 3TA3A 3DPTA 1I4FA 2GT9A 3GBGA 1ZREA 2EFNA 1RR7A 2UWEA 1R5HA 3MD2A 4UVCA 1LJ9A 4OOIA 4A3KJ 4L8SC 3KXFA 5HHQA 2FIKA 4CH7A 1VQ7I 3ARGA 3MRDA 3MCZA 3VODA 4NQDA 1P7IA 3EPZA 3Q0VA 4QRRA 5DDHA 3QDGA 2V1NA 4MS8A 5F9JA 1QVTA 3MZ8A 3PWJA 1LFPA 1I3AA 3V5KA 1Z67A 4UB8C 4B1RA 2R7OA 5EEGA 1BIIA 3TN0A 4RAYA 3E6FA 4EMSA 2Y48A 1EA3A 1MNEA 2E1MB 2V1DA 2JJ7A 3LQRA 3JRCA 3LN5A 3TBIA 1L8JA 4WUUA 3UKGA 4IX7A 5LHIA 2NW3A 3DTKA 2GQQA 5BOXA 1BJAA 2X1CA 2P5WA 2QQAA 2VQGA 4RGRA 3TOBA 2RGVA 5JFRA 1XPXA 3O3KA 2Y75A 3J7AY 4Y52J 2H6PA 4HBLA 1N77A 1EF4A 1WQ2A 3T1BA 1MWAH 4V3EB 4WJ5A 1KU7A 4GXOA 2BV6A 2VONA 4PJJA 4Y33A 3MRFA 4KMFA 4QSHA 2HYGD 2EINH 3V7RA 2O9LA 3HRMA 2ESNA 1SC7A 4M74A 2P7VB 1ZAGA 2DAOA 1FJLA 2V6CA 1Z7LA 3P9CA 2HN7A 1L0OC 2R5YA 2CU7A 1IZ1A 4E4HA 2V9KA 3EUHA 3BP4A 3OXSA 1JUSA 4R79A 4MJ6A 5ISZA 1O57A 3DV8A 3P4NA 2XPVA 4BDYA 2DT6A 3E0JB 3P77A 3ZQHA 3AU1A 1U5TA 4HQMA 4ELMA 3V7CA 3PM1A 3RYRA 3JVGA 4OWRB 3W6JB 3QUKA 3KFWX 5D4RA 2A61A 3AKZA 3BVNA 3RWEA 3WE2A 4KNYA 3IWFA 3WS3A 2HQAA 3BDDA 4I09A 4NB5A 5EZGA 4GRIA 4RAFA 2A07F 2CIKA 1FIPA 5F27A 5FGMA 5ERIA 4L9TA 5D8LB 2OD5A 2KJBA 1P6RA 4C2MJ 2DXIA 2NVQJ 1F5TA 1T7WA 1LE8B 1V54H 3TBWA 2KIFA 2VC1A 2Z99A 2NVUB 4HNVA 1OYYA 1PDNC 3TIEA 3Q9VA 3ZRGA 1IN6A 3ZMDA 4N9HA 3OYHA 2VLAA 2QSFX 2ESVA 3H3VK 1A1NA 4HWZA 2CQNA 2UV1A 1CF7B 3OIQA 5FRMA 3GTMJ 5F1NA 3BXNA 4M9ZA 3VOEA 3AFHA 2RDPA 4PRHA 1VQ4I 2FSWA 2XKPA 2Y0MA 2P4WA 5F0CA 1KYZA 3WG9A 1ZHKA 4PG2A 4EUPA 2F4MB 2L7FP 4F52A 4CCJA 2PEXA 1N78A 3GJFA 2A6HF 4X6CA 3JRHA 5M3FJ 4L4TA 3K1PA 5D2LA 1MNDA 5KHDA 3WTXC 2K27A 4JFEA 3HKZN 2PG4A 4HX4A 1OCOH 1STZA 5FKNA 4HUVA 1H0MA 1TP4A 3CJNA 2LSOA 3OR2C 2RQPA 1R4NB 3LKSA 1AGBA 5FLXK 5HS9A 1X7QA 2R7UA 1GV2A 3ROLA 1A9BA 2ETHA 3R6SA 3HG1A 3HPJA 5B1BH 3LWFA 3JREA 2DBBA 3NAUA 3MRGA 1SAUA 3F8BA 4YFKF 1M6OA 1ETKA 3GTPJ 3FTGA 1I3QJ 1W7PB 2WV1A 2XPUA 2WADA 5HDGA 4H0EA 2V6EA 4BUPA 3E6HA 3FQNA 2ZJRF 4U1KA 5MEPA 1B6AA 3VB2A 1HHHA 1S7TA 1AGDA 2ZSWA 1T7YA 2YR2A 2M9HA 3HUGA 4HDVA 4CXFA 1G6RH 2M30A 4EJUA 1XH3A 2JPBA 3CJQB 4K7FA 4WU5A 4A3DJ 5J6GA 2DA6A 2UXXA 2DLLA 1Y8QB 4FTVA 1FZPB 2VBYA 2M7AA 3HTSB 2CRGA 1MMDA 3W6KB 5LGUA 1FZKA 2HQRA 4Z78A 4S04A 4HYEA 4HSTA 2LBFB 2E2HJ 2ISZA 2HXIA 4C9YA 3DEWA 4DOZA 4HNTA 1TZLA 2M2EA 2P0WA 3L1PA 1OGAA 5D5MA 2W4SA 4OAYA 1XSXA 2CUJA 3HBLA 1MBGA 2JK3A 1DGWY 2KIUA 2ELHA 3R60A 3CDIA 4XLFA 1KQ9A 1TBXA 1YS6A 5HHOA 1I1SA 3ECHA 3P73A 4V19K 2DPUA 5IB4A 3VCLA 1A1OA 4A93J 2J8UA 3L3JA 2RNGA 1JKPC 3MRCA 1JGDA 2M4GA 2GOMA 3ZN0A 3S2DJ 5FKKA 4ZUWA 2FBIA 3JTTA 2BXYA 1AGFA 1P7JA 4X1EA 1JUMA 1H89C 5BXFA 3GZNB 2DOFA 4PGHA 3F8NA 2ZXJA 3PWNA 1ZN2A 4G59A 3LSTA 3HJEA 2M45A 2NYKA 3GMPA 1MJAA 4I4WA 2Q2EA 1S3JA 1W5SA 3SDBA 3HOWJ 5EO1A 2EIJH 4CYCA 5INCA 4LG0A 3KCCA 2GLOA 3H36A 2PO6A 3PWVA 2XGXA 1MBFA 1YTYA 2EB7A 1G2HA 5JHDA 3HOVJ 2EZHA 3C7JA 4BQOA 1T21A 5E3MA 3F8MA 1FPQA 5D7IA 4EM0B 2OAZA 2AHQA 3H5AA 1OYWA 3JRDA 4NC6A 4AUXA 2HKOA 4PJNA 5MEOA 4BL0B 2PMHA 1JHFA 5B3SH 1S7RA 1MDMB 2ZSHB 2XROA 1HC8A 2X4OA 5JHUA 4U1MA 3V5DA 3WTWC 2AV1A 3SFZA 5H94A 2H94A 3EUHC 4BJTA 3AG1H 1RKWA 2LMDA 4A6DA 3H0GJ 4YEJA 4DIQA 1R49A 1Z05A 4ZZDA 1TNTA 1E3OC 2DPDA 4F7ZA 3I71A 3JSPA 2E36A 1OPCA 3RKQA 4NC8A 2P5EA 2ZB9A 2PBIA 1R71A 2CWEA 2MW8A 1KPVA 4ITVA 2L0KA 4DQ2A 5C3EJ 5BMZA 3DU6A 2ZXIA 3LV3A 4GYGA 4X6EA 3KE2A 3ASOH 2RREA 2XAFA 1QHGA 2ADUA 5D5VB 3N4MA 2R7ZJ 4BU2A 2VPRA 2RC4A 3F72A 1P9QC 1KCGC 5EG0B 1RETA 3PSFA 3HG9A 1BW6A 1MW7A 2XPGA 5FD6A 4IRGA 3FXOA 1YYVA 4L8BA 4U1JA 2K40A 2E60A 4B09A 2RKHA 4A0XA 3VXPA 1OF2A 3BG3A 1XGMA 3GEZA 3TBVA 2F4IA 4F7CA 3OYIA 1X19A 2CH0A 2CSOA 1B9MA 3FMRA 4HF0A 1J5YA 2DFHA 1A36A 3CJRB 1RPWA 2EV6A 1WI3A 3WHBA 3RI4A 3IRQA 2MG4A 5D7LA 2V4JC 2O5NA 3FK7A 1S7WA 5C0BA 2K9NA 2AV7A 3I59A 1LP9A 2R5YB 3VWKA 1FEXA 4UUVA 4EJVA 3JAMZ 1OFCX 2W1OA 1UCRA 1HHGA 2Y0SA 1VADA 4PJIA 3GSRA 3MRHA 1UFMA 3C3WA 1U5TB 4C2TA 1RR8C 3V5HA 1T1WA 1LEKA 2XDVA 3FXRA 3GSVA 3H9QA 3K4MA 4L9JA 2DK8A 3NWTA 1EFXA 5IPAA 4FTHA 4L0YB 4CZZA 1R5GA 3I6KA 3GSWA 1T7VA 5B38A 3RPUD 1ENHA 1X2NA 1XDSA 1XMKA 3PFYA 4KN4X 2PMUA 2VC0A 3GTOJ 1OMIA 4HF2A 4FCYA 4OAZA 1G6NA 4XLHA 2DA2A 1WZ2A 4HV6A 2X70A 3RWJA 3OS1A 1KU2A 4JQXA 1QVUA 3OYNA 2MH2A 2LKSA 1DDHA 1F4KA 2R7WA 3WTUC 5J1UA 1Y39A 3OOPA 3MMYB 1POGA 5E8OA 5FROA 3VFZA 1LQVA 1LB2A 2UXNA 3RWCA 3DBRB 4XNFA 3VFTA 4HSRA 4PJ0C 3IAS2 3W0WA 2WY7Q 5EU5A 2XIGA 3M9AA 1RJZA 4O2EA 5ACZA 2BY1A 4E7KA 2DU9A 3BZKA 4OMZA 1W5TA 1WFXA 4AIJA 5D4SA 3SEQA 3QFDA 1IN8A 1D0YA 1T20A 3UTQA 4ZUUA 4K71B 3BTJA 1HYRC 9ANTA 1RNLA 1V55H 2E35A 3GTGJ 2L01A 5DEQA 1FYLA 2YEZA 2KDOA 2I10A 2ME0A 1BI1A 1D1CA 4JQFA 1DPUA 5CJ9A 2A69F 2HI3A 4MHGA 3CCRI 1XS9A 5C4XJ 4EJWA 2R5ZA 1K4SA 1HSAA 1VACA 4ENNA 2EA2A 1P4AA 5M5WJ 1HCRA 3BR6A 4UY8I 1ERDA 2LLKA 4XOTA 4D5FA 2UUZA 2BYVE 4ESJA 3PWUA 1B59A 1T8IA 4CUGA 2NS8A 2FRHA 4F7EA 3FQUA 4G59C 3JTSA 1UHMA 5IOZA 3K69A 3GFJA 5LBQA 3MV7A 2VAAA 1KU9A 5KK1A 2MC4A 3HUGB 3K9TA 4B43A 1G8XA 3VYSB 3HSEA 2GITA 3ZP5A 2EPFA 4B8XA 4ONOA 4F7MA 5C0EA 1T33A 2LK2A 5CVVA 3WHCA 3QUXA 3DFGA 5L3CA 3KYLA 1W7PD 2LY1A 4ZYEA 5K7ZA 1VFCA 5AIPA 1TW2A 1OYIA 5D6FA 5DYMA 3CF5F 1HHJA 3FQTA 1ZR2A 1U0JA 3LKRA 4PJDA 1XG1A 3MAJA 3H9JA 4E7LA 4F3QA 4PJFA 3ZQ7A 5KAIC 2EV0A 3KPQA 1QQIA 4UV8A 4O3MA 1MJ9A 4ZYGA 1FMVA 2X48A 2CGPA 4DGWB 3L3HA 3EUAA 2RQQA 1M05A 1IXSB 1J59A 3G6EI 1C0WA 4FISA 3RJPA 3LSRA 5LHGA 2VODA 3CUQC 4MQ7A 5EU3A 1IN4A 1FFOA 3MGOA 1GVDA 3BJOA 1FBSA 2MD0A 5DEGA 2IT0A 3WTZA 2CUEA 3HOYJ 4A5MA 3OYMA 3PIOF 4I98B 4OIPF 1ZAOA 3TDUC 2BSTA 2VLKA 2K02A 3JRGA 2D2WA 1S7SA 5C0JA 3U21A 3LSKA 1TWFJ 5TGTA 5LFAA 2Q2EB 2ZMEA 1LDJA 3C9NA 4G43A 3RL1A 4NO2A 3LN4A 1U8BA 4LG0B 3CMYA 3QQ4A 4ESFA 3VFMA 4BE0A 2LY2A 3IKVA 1T39A 4CA0A 3S15J 4KIFA 2XRNA 2Y0SN 4QRSA 1YW7A 1BM9A 2JVGA 2XF6A 5BJTA 1EH8A 1K8DA 2V2XA 4N8VA 2IEKA 2AO9A 3KX2A 5JHFA 1W5CC 2DA5A 4L5JA 2BVQA 2A68F 2FQ3A 1AKJA 1FP1D 2H1LA 4EJTA 1V5GA 1I7UA 3CP2A 3S3NA 1KJ2H 1T7ZA 4XQFA 3UBXA 4WWKC 1XR9A 4KN7X 3J80K 3BG7A 2F5DA 5F1RA 3U9GA 4KA4A 3P4MA 1ZG5A 1QSEA 3VFPA 1IRFA 3RSNA 5MERA 3IP4B 1U8RA 4UHTA 3VPRA 2W7NA 2PI0A 1IW7F 4II2A 3MWMA 2JCCA 2STWA 2EFOA 1A1MA 4Y17A 4FX0A 4L29A 3VFSA 1YW8A 3PUFA 1BL0A 3BTLA 1OR7A 2K7LA 3I4NJ 4JFPA 2IVMA 5HOOA 1S29A 4L8CA 5LGNA 5E18F 3VXRA 5DUKA 2W00A 2QQ9A 1QRNA 3FBIB 4Y4RA 4BYYA 1KU3A 3X13A 2L9SA 1X2MA 4KYWA 4ON0A 3DXJF 4KFCA 5L3BA 1O7LA 2ZNYA 2UWMA 1JGSA 2B7EA 4JX6A 1BR2A 3O3BA 3I58A 1R1TA 3QUYA 2QSGX 3AG2H 4U0VA 4BDZA 3I59B 2EFPA 1BW5A 1MHCA 3KPNA 3QI9A 3D3VA 4Y4FA 3RWFA 3Q0WA 4N0CA 3Q0UA 3RPUA 2OBPA 5C0AA 3BZEA 1F43A 3QPSA 2FMLA 3DKYA 3I9V2 2X1EA 1FZJA 3TFKA 4DZJA 3SFIA 1VQNI 2VLJA 2Z33A 3CC7I 2PLYA 3ARFA 4CCMA 2ECCA 4NNXA 2LY9A 4AVZA 3OSFA 4QOKA 1SD6A 4Q48A 1FFNA 1FTTA 1S9YA 1KYWA 4G8IA 3FF5A 1P4LA 5ILVA 3IWZA 1AOYA 3SXYA 3CZFA 3P9LA 2BSRA 3RGVC 2P7CB 2TDXA 4IL6C 5C0CA 3MKZA 3ZQLA 3I4MJ 1A6IA 2D1VA 3GUDA 2LG4A 4XLAA 3A01A 2Z9OA 3FX3A 5FDWA 3BGMA 4I76A 5TJJA 4U1HA 2AQFA 1WH7A 2DDBA 1VQKI 1BBYA 5HODA 2HDCA 2QA4I 3HTUA 4OIQF 2V1UA 2L7MP 2DI3A 2X6XA 3QZWA 2OJED 2KL4A 3B6AA 4N4OB 1TNSA 3RQIA 2HYJA 3M1EA 2D1HA 1IGNA 1VNDA 3K2AA 4FASD 3EQLF 1TL8A 3RUGA 3PWPA 2QEXI 1JGEA 3AG3H 4LLGF 2Z2SB 4EQQA 2K4JA 2DJNA 1X4PA 2O3FA 4MJ5A 2Y2ZA 4OIOF 1W0VA 3E5XA 1WJFA 1WKMA 2H26A 3BJ6A 1JKOC 2X0LA 4NC7A 3ZQIA 5F1IA 1D8KA 1UQSA 3G73A 3S3OA 3O3EA 3DKXA 4RA2A 3M8JA 1N2RA 2XGEA 2R7FA 3PFIA 3FRUA 1FO0H 2YS9A 5IROA 4L8DA 2R5ZB 3GSXA 4MLOA 2NRAC 1C16A 2F53A 4MX7A 6PAXA 1LEAA 5C0FA 4PJGA 3WU1B 2BXZA 2IBDA 2VT2A 1FBUA 4A3LJ 1DQUA 3SCMA 5IP9J 3BZFA 2M87A 4F55A 3QAHA 2COMA 2OTLI 3I56I 2W84A 2JA8J 3KIOA 3CMMA 5DUIA 4EV0A 3CCSI 5KAFC 2STTA 2H09A 1YHQI 3WLBA 1OCRH 4KITB 2R7TA 4PJ5A 3CPLA 3CESA 1I1AA 1RZ4A 5K5RA 5CKTA 3R0AA 5J1RA 1V5EA 1ZGWA 3QODA 4QRTA 2RV8A 3F8CA 4CVXA 4KJZA 2KT0A 1S7XA 2XAHA 3S32A 5LEKA 1ON1A 1Z9CA 3M8FA 3SDCA 2DA3A 4UB6C 5ICEA 2VE9A 1S7QA 3O9WA 4V2FA 1TWCJ 3B6CA 1BIAA 3C2BA 3F6VA 3OS2A 3F9KA 2KRFA 3HHHA 2MHAA 1DP3A 3L3DA 3OYLA 5EO0A 2ME6A 3FXMA 1G3WA 2ZXWH 5BS0A 2A5WA 3PUBA 4XRSA 2CQQA 2GOXB 3V7SA 3S1RJ 2MFZA 1X1DA 2JN6A 4D5CA 1EKEA 3EYYA 3TO2A 1G7PA 2DYPA 1WJDA 1LNWA 3BR5A 3HOTA 5DV5A 3M3YJ 1NAMH 2WY3A 4G8GA 4RM2A 3V8JA 3ULQB 2ZO4A 4EI5A 1ZTRA 1V4RA 3BTCA 4AWXB 4W1UA 2ZMEB 3HKZA 1ZARA 1GVJA 1DUXC 2XGDA 1ETQA 1OLTA 2L9NA 4KT6A 4MTEA 5FLMJ 3AL0C 3CH1A 1KBGH 1ZVSA 4NHJA 3GTKJ 4Y13A 3WS6A 3QOEA 3CC4I 1IJWC 2A5YB 3S93A 1E3PA 1TQPA 2KKOA 1MI5A 4EGZA 1FC3A 5FB2A 1AO7A 1LVAA 5JR3A 1DU0A 3IL2A 3MKLA 5B66C 4NSKA 2GAUA 4A3JJ 5FLVA 1I6HJ 5IT9K 2Q1ZB 3I6GA 4YIIA 2FU4A 5ENWA 2VASA 3GZ6A 3CCLI 5DTDA 4O6JA 3MRPA 1B72A 1X1AA 2RN7A 1TWHJ 3LSHA 1JT0A 4LCCC 4E7ZA 3OL4A 3OYBA 4XMYA 2CFXA 3ABMH 1WJ5A 3DF8A 2HPMA 3VXSA 5D5XB 1HDDC 5EOTA 4XONA 2I5UA 4HG2A 3OYEA 3BY6A 4AVPA 4BS9A 3GIVA 2X4SA 2KISA 4PP8C 1Z0XA 3CCQI 3QYEA 3BH9A 1RIOH 1K4TA 1K6OA 4AIHA 2FO4A 3TF7A 4XRMA 1GZQA 4IQJA 4M3FA 2IJLA 5H2FC 3OL3A 1V5FA 3IV5A 4HNUA 5E1XA 3TL4X 2LKXA 2V26A 4JYKA 3TEDA 3BROA 5AIQA 3D0SA 3QP6A 3E6MA 1JJ6C 1SFOJ 2ECBA 4MFEA 3MRNA 1L3LA 1Z6RA 2VXDA 3EETA 3I6LD 3MROA 4J00A 2LH9A 3E5QA 1PP7U 2KZVA 4E7IA 1MMAA 2FE3A 4BEHA 3J81Z 2VQHA 2FYYA 4IOCF 1IXCA 2VIXA 4MQVA 5EYRA 4X6AJ 3FKJA 4HUUA 3IH4A 1DP7P 2HEOA 5JVTA 4IHYA 2CV1A 3KETA 3NEUA 1B0RA 2JUCA 3CTAA 2MABA 4AU7A 2DYRH 1Z21A 4I0BA 4IRSA 4N5EA 1FYKA 3E97A 4A2UA 3VFOA 1IV8A 3W2AA 1YLFA 2PYEA 2DTRA 1R5ID 2JRTA 4PGCA 5IT3A 2JA2A 1EH6A 4BJ5C 2D31A 1R58A 1GUUA 2CW8A 3BOQA 3LL7A 3QWLA 5E8PA 2HZDA 1I7TA 1VQ8I 2GUOA 5E1WA 4KICA 3BPXA 3JRBA 1QEWA 4RBOA 2WAQA 2B63J 5LRRA 3K4NA 5GAEJ 2Q8KA 3J7YJ 1DPRA 1TVHA 3BT9A 2BE5F 3A01B 1R1VA 2JSPA 3LSPA 3HB9A 4MEXF 1X3ZB 3FXJA 3E2HA 3TPUE 4CSWA 3MQ0A 3SDAA 3KPSA 3IAM2 2F6CA 5L3DA 4ZJZA 1IM3A 1XSDA 1H8AC 3H9HA 4L3CA 1XR8A 1JE6A 3LSIA 2ZNZA 2K3FA 5E8NA 1HKSA 4L5IA 3CCJI 3Q5FA 3CQZJ 3MVPA 4YG2F 3JTHA 4QLCU 4LLNA 5K5QA 3P5JA 5HNHA 2IPQX 2KJCA 2QGUA 2PX9A 2HYFA 2ZCWA 1MMSA 3OR1C 1S6LA 4LB5A 2Y30A 4MNGA 4G6DA 4JBAA 4QPQA 3JRIA 3KP3A 3GFMA 3T8RA 3MKYB 3PQJA 2DMTA 1T98A 1QO0D 1FOKA 2VXZA 1W36D 4D1QA 3DU5A 3DCFA 3LA3A 4MXQA 1S7VA 4KT5C 1Z91A 5GADJ 1SFKA 5CVRA 1S9WA 2MLGA 4BY7J 4RLFA 2E19A 5L2JA 1WJEA 3FMSA 3D2UA 4LLLA 3BR3A 2EFQA 5J40A 4M6XA 3O2PE 3ZCOA 1PUFA 1Z3YA 4L4VA 1P92A 3BR2A 1Y1VJ 5TISC 1HOMA 5E17F 2IGMA 2ZXHA 2CV2A 1MH3A 4XRFA 4N4NB 1ZSDA 3OXRA 1WRJA 3ERYA 1S9HA 2NOJB 2XAUA 4BBRJ 5IP6A 2RFXA 3GSNH 1LDKB 3CC2I 4S0HB 1XN7A 2R7XA 4U6YA 1IG7A 2NVXJ 3F21A 2BGCA 4PJ8A 4ENMA 4CVZA 2KHMA 2GXGA 5BPIA 4G7OF 3QEQA 3GSQA 2DMNA 3I4PA 5EZHA 3CUOA 4U7BA 3ESWB 3HRUA 3CCEI 3FOLA 1O3TA 1XC5A 2E1OA 3ONQA 3IT8D 4ZDPA 3QULA 3VDXA 1FOYA 3HOSA 1X1PA 4AM3A 2BEOA 4FE7A 5IYBJ 2JA7J 2DMQA 2X6OA 3COAC 5C0GA 5JI6A 1WBXA 2XB5A 3DQVC 2BVLA 2NX5A 4IIQC 1UELB 2KPMA 1D1BA 3RKWA 3EDPA 1RJYA 5HDKA 2FMYA 4CCOA 4PRAA 3KZIC 2IA0A 4NQEA 4BKXA 2DK5A 2FA5A 2W57A 1B1BA 2CJJA 3LA7A 1IRZA 3QQ3A 2ZKZA 2A3SA 3I53A 5A2QZ 5E3NA 2BCKA 3CF2A 2HOEA 2JMWA 4DYRA 3VWBA 2ZFWA 4LD5A 3MR9A 1R36A 1XCBA 3DPUA 1ZG3A 2ACJA 5J4VA 3LMMA 4XLEA 1SMTA 2O0YA 2NS7A 3WTTC 2DFEA 5ED4A 5EJCA 2L4AA 4D7NA 2JT1A 1JF1A 5C0IA 2FNAA 2HLAA 4EM1A 4A3EJ 3GSUA 3ROUA 3QPHA 4GCVA 3FZVA 3KP7A 1XMXA 2E1NA 5LEJA 4ZTFA 2WA0A 2HFHA 5GTHC 4JFQA 1I27A 4PGGA 4JFDA 1PYVA 5EFIA 4ZYHA 1BOAA 4E7SA 4S05A 3H3ZA 2WAQN 1R9TJ 3KPHA 2XV4S 4MQ9F 5HLHA 1B72B 1WJAA 2RNJA 1PVEA 3HGYA 3HXLA 3UR3C 1IAWA 4W97A 2KLOA 1IUYA 2HQNA 1UXSA 4D0CA 1Y0UA 1G3SA 1ZLJA 3K4JA 4HDUA 3X12A 3KPPA 4N9IA 5HGHA 1JKRC 2VJJA 1LPQA 1HA8A 5M3MJ 4PGEA 1WJBA 1LFUP 3CUQA 3SZGA 1ZLKA 4PJAA 3OIOA 1JE8A 2CFOA 2BHZA 2KP6A 4DZPA 1VZ0A 2FOKA 1HSJA 4WXDA 3MRQA 3L2CA 4NQCA 4F92B 4IZZA 4PSWA 2DQLA 2MC3A 4LCWA 1WBYA 4JFOA 4I6ZA 3BEVA 1X3UA 4LJZF 4KUMA 3MRRA 4E5XA 1IN5A 3ECOA 4HPQA 1O3QA 3A03A 4A3IJ 1JTXA 5CLSA 4WW2C 1HSTA 1INQA 1R00A 3LSJA 3N05A 3LKQA 2GJ6A 1U9OA 3L2UA 1VF9A 4BEHB 4U7DA 2L2OA 3FK6A 4HOBA 1YS7A 3BP8A 3RQ4A 2DOAA 3ABTA 2P5LC 3I55I 3E6CC 3HM5A 3FQRA 3EYIA 4V2GA 3LAJA 1BQHA 3QQAA 3MRJA 5D2NA 4F7TA 4NO3A 3CCYA 3W2WA 3TMOA 3LQQA 3F0CA 3LFKA 1QSFA 1WH5A 2VLLA 3H9GA 5FD5A 3MRLA 4PJEA 4GO1A 3G1OA 2P5KA 2VOPA 4HEA2 4QWQA 4FHTA 4M73A 1WBZA 2F54A 3UNGC 1K78A 1BR1A 1QGPA 4LG3A 1A6ZA 1XD7A 1LEBA 3TOAA 5JLWA 1UMQA 1KPUA 2CUZA 1UXWA 4ZDLA 1I1GA 1NG6A 2VBZA 4L0ZB 1EEZA 3DWLE 1G3TA 3L9RA 4BE1A 2GBYA 3D18A 3RIRA 1K6YA 4PJCA 4RGXA 5J6HA 1FBQA 4UUTA 3CCUI 1ZRCA 4MJIA 5SWSA 3FISA 2LF7A 4U1IA 4LIUA 1W0UA 3AM8A 4PDCE 2JQ7A 1UB9A 4BE2A 2AKRA 5FKPA 4MO7A 1RUNA 5HVQC 3DX7A 5HLIA 2PN6A 5HS8A 4B4CA 2QYOA 5GSVA 3QU3A 1XGOA 4U0YA 1GDTA 2IS2A 2K5CA 3GLXA 2VI6A 5EF6A 4E7JA 3GMMA 2Y9ZA 2BNRA 1B8IA 4BBSJ 3BWGA 5FFZA 3OX8A 5M5XJ 1V3FA 1QO3A 4MEYF 3M17A 4HA8A 5IYCJ 1FSEA 2R0QC 1WI9A 3BG6A 2PMZA 4C2UA 2O6GE 2R93J 5D5UB 3U0PA 3CDLA 4PJLA 4OIRF 4P9FA 3SZTA 3VYUB 1TQIA 2KDZA 3TW7A 2CLZA 4XN3A 1P1ZA 3DTEA 2DO7A 5EU6A 4DW6A 4BJ6C 1AKHA 1ETOA 3M1CA 3WGIA 3G4SI 3L2WA 3HOZJ 5BS6A 2OL3H 3DTXA 2H6BA 4ZUVA 4BY1J 1SMYF 2QZ8A 1JKQC 1QHHD 2BY2A 2V9VA 1HW5A 3FONA 3WGGA 4PJBA 2X4QA 3H92A 2GIZA 3QU6A 4BNCA 2OTJI 4EN3C 2AS5F 4M9XA 3BQZA 3HRTA 4Y15A 1NH3A 5HDNA 4I01A 4HV8A 1ZYRF 4M71A 3CD6I 3LAPA 4B47A 1KONA 2IP2A 1ULYA 2EILH 4P5OA 4Q47A 4R1HA 4B3AA 3FT3A 2LREA 3FWEA 4D0PA 1HW2A 3MYJA 5J8FA 5DS9A 5CYVA 1X58A 3TO9A 4P55A 1N5AA 3GSOA 4G6TB 2LTPA 4A6EA 3DTIA 1GXQA 4BXUA 1N75A 3Q9SA 4E70A 3VYTB 3ZXSA 1Y56A 1ZGJA 3I3LA 5F04A 3FHZA 4LK1F 2I8DA 4RAGA 4CCNA 1K61A 5HLGA 5IY5H 2XSJC 3ZQFA 1KJMA 2OA4A 3X14A 1USTA 2A6TA 3VXMA 5LD2C 5A2QK 1HHKA 4BACA 3VSKA 1Y0NA 4M3EA 1WSUA 3G1MA 3KWWA 5EGOA 2VJ4A 1H9TA 3TGNA 1ACIA 3DBLB 2VPLA 2ID6A 2DA7A 3GLLA 4WK8F 1X1CA 4ZDOA 2F2EA 1D0ZA 2FUG2 5FA3A 5CQEA 1IRGA 1T0MA 1JGGA 2CKBH 1ED3A 3LFUA 1SD4A 1A9EA 2RVCA 1VGKA 3FDYA 3C18A 4CYCB 4P9UA 2BY3A 3AREA 3GFIA 2TRTA 2FXAA 1OSZA 4LB6B 4JRXA 4NO5A 5HGBA 2LFBA 1P7QA 1YN6A 1OISA 4I48A 3X2QH 4D0BA 4C30A 2JTVA 4HQEA 2ZBKA 3TIDA 1BA5A 3HLAA 3QPTA 1FX7A 3CDGA 4PV8A 4TV7A 2NXNB 2ZC2A 3OYAA 3JCUC 3DLLF 4EGYA 4LGWA 4CCLA 2COBA 2EV5A 3K4KA 4IVNA 4HKJA 1T1ZA 3W3CA 5FJ8J 2H8RA 3FM5A 3ARBA 2HTSA 2NVYJ 4ENJA 4IQ4A 3S1MJ 3WUWA 4U1SA 3TKYA 1MBJA 4HZFA 1PUEE 5M5YJ 5J6XA 3QYFA 4M3BA 3VWJA 1S7AA 2OQRA 3CCMI 3RZDJ 2BW3A 5IEKA 3OOUA 1YDPA 3G3ZA 3CUQB 3FXUA 4DBQA 1OCCH 3GFLA 1JI8A 2L9VA 3UTTA 3FMQA 4EEFG 1TW3A 4L3EA 1OGTA 3HRSA 4MIMA 4HF1A 3A4CA 2E7XA 4IKFA 2ZOKA 1ZG1A 2OQGA 1QPMA 3MA7A 2P6SA 5IB1A 2BHYA 5HHMA 4PRNA 1HF0A 4L9LC 4ZH4F 4NT6A 2WC2A 1FWZA 3IKTA 1HSBA 2PMZN 4C3JJ 2NNYA 4PREA 1T0FC 1S7OA 3JAMK 4CZCA 1SAXA 1MBEA 3BO8A 2WV0A 3I0TA 2XASA 2K86A 3B3IA 1ZH5A 3GWZA 3VFRA 1LDDA 1SD5A 1LVKA 2EZLA 3IUOA 4LNRA 3TO6A 4X0GA 2F48A 1S5LC 4Y7NJ 1FFPA 3L09A 3R0JA 3K7AJ 3PQYA 4G9YA 1RK0A 3F22A 1IF1A 2D45A 2F4OB 3HIFA 1MMNA 2DT5A 3HL2A 1T80A 2ISYA 3SJMA 4DJAA 3GF2A 1IDZA 1K78B 4FFEX 3U1KA 2HR3A 1R3HA 4U6XA 1WJCA 2N8GA 1F36A 1MMGA 4YIFA 5IYDJ 3P4OA 1T0NA 3S8PA 4A3FJ 3TBTA 3D1NI 3HOUJ 1ZHFA 2LC2A 4XORA 4BQAA 5IEHA 2R7QA 1N59A 3ZGKA 4A0ZA 3JR9A 2VBWA 1KPRA 1Q94A 3BW9A 3A0BC 3PABA 1U9NA 2QQBA 1A5JA 3VRIA 1ZKGA 2OV7A 3JSOA 2VQCA 5F08A 2M5WA 1QPIA 3FXQA 3FIWA 3WG7H 2CV0A 3KZZA 3E1SA 1EXUA 3H5NA 3BPVA 4M6YA 1MSFC 1GLNA 3ZMZA 5BNGA 3CLOA 2GAZA 3M07A 5GPAA 2OCCH 2FBKA 5ILUA 4MNUA 4RMNA 2OPTA 1ZRDA 2BSSA 4XXCA 3FT2A 3SPVA 4JQVA 1B8IB 4NUBA 3ML6A 2QBYA 4HRIA 1FZOA 4XSZF 1FIAA 2IS1A 1SYVA 2H27A 2E7LE 2VJIA 2BOLA 3VFWA 3M8EA 3U1DA 4NNJA 5F1JA 2HJKA 2R4GA 4DNCA 2EIMH 1IO2A 4Q5SF 4PGDA 4ESBA 1YJNI 1ZS8A 4IRIA 4NQXA 1FMWA 1Z6TA 2IGNA 4NHUE 1ETXA 3ABUA 3IXAA 1AKHB 1I6XA 2LD5A 3J7ZI 4IO9F 1BN5A 1NK2P 1Z7UA 4P96A 2H8WA 3OS0A 1YN7A 5HS7A 2Q7YA 3K6GA 3CP8A 3ILQC 3OV6A 1BR4A 4IHOA 4Y2DA 1ETYA 4JO8A 2IA1A 4NQWA 3RWHA 3HOXJ 3KP5A 4ZFZA 3BTIA 5GP9A 2WTEA 3BUYA 1BI0A 2PJPA 1ETWA 1WGXA 1YX5A 4M3GA 1CD1A 1IC8A 2BVMA 4XKWA 3ERMA 5J1AA 2GIVA 2ZFUA 3OY9A 4LIVA 3LKOA 4ZUTA 2F5EA 4GFBA 1LK2A 1M1EB 3KYNA 1SD7A 4I99C 2E5ZA 4PUSA 3GYHX 1DUYA 2X4UA 5E6IC 3O8XA 4M72A 4XBFA 1JPGA 4UQ3A 2DT7B 4U87A 1W0TA 1JFMA 4K2EA 4BQNA 4XICA 5K1YA 2VOOA 5DEFA 2OI9A 3QRFF 1QNTA 4RB0A 2YX7A 3MRIA 1D3YA 3FXKA 3MRKA 2NS0A 1UHSA 3E7LA 1ZHLA 3L00A 2X51A 4XLPF 4G6QA 3CO7C 1BZ9A 4G12A 3QOPA 4E6KG 3ZQGA 5D7JC 4CDGA 2CW7A 3FQXA 3PNYA 1R22A 3N97A 1KJ3H 3RZCA 2G7HA 1O3SA 2FEZA 1FZMA 3H5RA 3HC7A 5EGOB 3GMLA 2B9SA 3KPMA 4Z77A 2G0EA 3TDZC 2HU9A 2K85A 3FQWA 3TJHA 4PFPA 4ZC3A 1Q1VA 3I64A 3SYTA 4ZYDA 2LBFA 1T95A 4G9DA 2M1BA 4BQQA 3OYDA 4Q4ZF 3K70C 4AIDA 5F0HA 3S3MA 3SEZA 3HPHA 4KIBA 2EZIA 3IH3A 3T8TA 3BQYA 1S7EA 4BHBA 2DCEA 3H7BA 2HNHA 5SWQA 5LHHA 4I0AA 4UQ2A 4ZTJA 1TT5B 1USSA 3K4BA 3S1NJ 4JRYA 2MLKA 4H4KC 4E0RA 1AGEA 5C08A 2X6WA 2K4BA 3I5UA 3ISPA 3L9FA 5DD8A 3PJRA 4XR6A 4WWCA 2FZ3A 2A05A 2E1MC 1BOBA 3ZMVA 3MKWB 1ZRFA 5MEQA 1XGSA 3BR1A 1RI7A 1FOWA 4QRUA 4YELA 3K4CA 5IOYA 3ABLH 3NQOA 4KISA 2HJLA 2QCOA 1MZBA 3OIPA 4J19A 3D39A 3PNVA 1FLIA 4HX1A 3PNTA 2F5VA 1LFBA 2EK5A 2YUSA 3DKWA 2HOSA 3O3DA 2HS5A 3V8KA 1LDPH 4Z2YA 5HGAA 5INDA 3Q3SA 4GDFA 3KEYA 3KYCB 2HXOA 3K0LA 4DBRA 2WAFA 3GTJJ 2LR8A 1I7RA 1LEGA 4WF2A 3OYCA 3CO6C 2XAJA 3AL0B 5GSRA 2DMUA 2DODA 2WB1N 3T0YA 3QP5A 4G8XA 3P9MA 1QA6A 4OU0A 3T5XA 4G7ZF 4A12A 3SDXA 1E3HA 2O8XA 1XDUA 3DBHB 3RYPA 4KMUX 2L3DA 2IXSA 2VKDA 1MJBA 2YU3A 1ZHNA 1MGTA 5F6FA 5FA4A 5B39A 3K4LA 1U3EM 1K7AA 1MH4A 4ZAKA 3VFUA 1REPC 3VRJA 3RTQA 2VKHA 1MHEA 5E3LA 3S1QJ 2A83A 1ONVA 2CQKA 4DYQA 2CLVA 3RCOA 3TBYA 3ZMUA 1OCTC 4X6DA 5EG0A 4L9VA 2MH9A 4ZUSA 2FF4A 1OCZH 2EFWA 3BZCA 5EUOA 3W39A
chains in the Genus database with same CATH topology
3TO7A 3KP2A 3AAFA 1HKTA 4YFXF 1YIOA 4EVIA 4FX4A 5E20A 2F5CA 5CVUA 1DDNA 4HLXA 3WTYC 3F6OA 3GVAA 5CVJA 1HW1A 4M9SA 2QBYB 4CGZA 3E3VA 3V4GA 2KIMA 1KQ8A 1JHHA 3GXOA 4PDKA 1QZYA 2DW4A 3FM3A 4YFNF 2V1XA 1TTYA 2G7UA 3M7GA 1EV7A 4IXAA 3O6BB 1WWXA 1YW9A 5E8IA 2P8TA 1KA8A 2JPCA 1P2FA 1E2XA 5TRDA 4XSXF 3V8LA 3DP7A 5CVIA 5DCFA 5KVRA 1ZGAA 2VT3A 5K5OA 1FY7A 2GXBA 4ENKA 4LFUA 4BAYA 5ILSA 4WX9A 1G4DA 1S8NA 3KP4A 4AD9A 2ZJ2A 2X4HA 5D5WB 1B9NA 1ODDA 2CG4A 1P4WA 3WE3A 4IJAA 4WXCA 5ICFA 3JTGA 1HQCA 2E7WA 3NRVA 1TLHB 3L7WA 4L18B 2IW5A 1OKRA 5F64A 1XB4A 3H3UA 2GZWA 4R8HA 2E1CA 4WXHA 1R1UA 4KDPA 3SHFA 4WCGA 2NAZA 3SQNA 3IHUA 3P9KA 2QWWA 1R7JA 2JSCA 4I7HA 2OU2A 4U88A 5DDGA 3WTSC 2QVOA 4OINF 3P9IA 1YO5C 1J9IA 1NHAA 4G7HF 4FT8A 4HW0A 2NYXA 1J75A 3DPLC 3OV8A 3J81K 1T2KA 1K79A 3R61A 2LF8A 1D5VA 4HAMA 2W85A 3F3XA 1U5TC 2QUFA 5LLQA 1YQAA 2F5FA 2QENA 1FP2A 4RAZA 2NNNA 3S2WA 4ZZLA 3J80Z 2B0LA 2BBYA 4IF4A 3ZMTA 2DQRA 3GX4X 3F8FA 1GHCA 2MD5A 3B73A 2VE8A 2MBFA 2R3SA 4HLYA 4UVBA 2XKOA 3C1DA 3I54A 3GO5A 1PP8F 1P4XA 1FT9A 5DCMA 2ESHA 2XAQA 3MZYA 1SFEA 4A0YA 4N0BA 1G3YA 4JK1X 4RS8A 2W24A 5L3GA 3MEXA 1T0FA 1J2XA 4EJOA 5D6EA 3E5UA 3RKYA 5H20A 3ERED 3TQNA 4I02A 3JW4A 2XHKA 1BC7C 2HTJA 2M8EA 4PCQA 3GW2A 1I5ZA 4LMYA 1ON2A 3ZN1A 4RB1A 1QBJA 1FNNA 4IHSA 4I2OA 2L4MA 4UNOA 1JXSA 2H6CA 2GA2A 2FNPA 1A04A 3KEOA 3WU0A 4UV9A 3RDIA 1BIBA 1W4MA 4ETSA 4GGGA 1U2WA 5ICCA 3REOA 1BI3A 4G94A 2LDUA 2HZTA 5FFXA 2W25A 1F1ZA 1H9GA 4KIGA 3IC7A 5L3EA 2OZUA 1O3RA 2A6EF 1T6SA 4CICA 2R7DA 2AXLA 1O7FA 4BHCA 3D5LA 1F9NA 1YG2A 2JZYA 4CYDA 3KP6A 5H6RA 2CYYA 5AONA 5L3FA 4IHTA 4IRHA 2J5OA 2PQ8A 3J7AO 2HKXA 2L54A 4BHPA 3E6DA 1IN7A 2HGCA 1UHWA 3ELKA 5E8GA 3IRRA 3R4KA 4HV5A 2V79A 1R23A 3KZYA 2XAGA 1Q1HA 4HX8A 1XMAA 2Z5UA 3HSRA 2UZKA 3RKXA 4CHUA 4EM2A 1FYMA 2CW0F 4HX7A 3VEPA 5BPDA 4MGRA 1T38A 2PFBA 2G9WA 2EA4A 2XVCA 4L9NA 2QLZA 1J0RA 4UVAA 4RB2C 3GZ5A 3KLNA 1AWCA 1XCVA 1Z1DA 2O03A 1LQ1A 2CO5A 2YPRA 2VBXA 5IT9Z 3ZPLA 5LGTA 4CO8A 2MA3A 1SFUA 3DEUA 1QZZA 2LKPA 3K1NA 4IPAA 5DCMB 2LNBA 3K2ZA 4BH9A 1YFHA 3LA2A 2J5PA 3K1MA 2IA2A 1FSHA 1KGSA 4AIKA 3HSFA 4A5NA 4PZJA 3RPQA 3B02A 3BJAA 3HHGA 3KEQA 2QM3A 1VTNC 2GA1A 5ICGA 1IXRC 3E6BA 5LRSA 2YX4A 3WTVC 2WWYA 5H6QA 1GXPA 1CGPA 1CF7A 3PQKA 1HXDA 2EJRA 4RGSA 4GYIA 4XLNF 1XGNA 1TQMA 5D8KB 3P7NA 2IRFG 2HWVA 4RGUA 1EH7A 4OMYA 2P6TA 1U6GA 3F23A 2O61A 5DD4A 1B4AA 1W7PA 5EEHA 2P5VA 5FLXZ 1BC8C 2VN2A 1MD0A 5BQTA 1HKQA 4ASNA 2EWNA 2DFIA 5E1ZB 3MFKA 1HBXG 3SZPA 4LK0F 1D8JA 3KLOA 3MZHA 4RB3C 2C6YA 1XSVA 3RTRA 3WODF 3BZ6A 2FBHA 1E17A 1J7KA 3ZMSA 1U78A 2Q0OA 3WGHA 1KQ0A 1SFXA 3CDHA 5J8CA 5FO5A 1BI2A 2GWRA 3U2RA 4MTDA 3HYIA 4UXNA 2Z3YA 1RUOA 2OZ6A 4O5VA 2XUBA 2YSRA 4U0WA 1MKMA 2L02A 1MDMA 3DPTA 1ZREA 2EFNA 1R5HA 4UVCA 1LJ9A 4OOIA 3MCZA 3VODA 5EEGA 4RAYA 4EMSA 2Y48A 2V1DA 3LQRA 5LHIA 2GQQA 5BOXA 1BJAA 2QQAA 4RGRA 3TOBA 5JFRA 2RGVA 3O3KA 2Y75A 4HBLA 1WQ2A 3T1BA 1KU7A 4GXOA 2BV6A 2VONA 4KMFA 2HYGD 3V7RA 3HRMA 2ESNA 4M74A 2P7VB 2DAOA 2V6CA 3P9CA 1L0OC 1IZ1A 3EUHA 4R79A 1O57A 3DV8A 1U5TA 4HQMA 3V7CA 3RYRA 3W6JB 3KFWX 5D4RA 2A61A 3WE2A 4KNYA 3IWFA 3BDDA 4I09A 2A07F 4NB5A 5FGMA 5ERIA 4L9TA 5D8LB 2OD5A 2KJBA 1P6RA 1F5TA 2KIFA 2VC1A 2Z99A 1OYYA 1PDNC 3Q9VA 1IN6A 3ZMDA 4N9HA 1CF7B 4M9ZA 3VOEA 2RDPA 2FSWA 2XKPA 2Y0MA 2P4WA 1KYZA 3WG9A 2PEXA 2A6HF 3K1PA 3WTXC 2K27A 2PG4A 4HX4A 1STZA 1H0MA 3CJNA 2LSOA 2RQPA 5FLXK 5HS9A 2ETHA 3R6SA 3LWFA 2DBBA 3F8BA 4YFKF 1W7PB 5HDGA 4H0EA 1B6AA 3VB2A 2YR2A 3HUGA 4HDVA 4CXFA 2M30A 4EJUA 2JPBA 2UXXA 2DLLA 1FZPB 2VBYA 3HTSB 3W6KB 5LGUA 2HQRA 4S04A 4HYEA 2ISZA 1XSXA 2KIUA 3R60A 2ELHA 1KQ9A 1TBXA 1YS6A 1I1SA 3ECHA 2DPUA 3ZN0A 2FBIA 4PGHA 3F8NA 2ZXJA 1ZN2A 3LSTA 2M45A 1MJAA 2Q2EA 1S3JA 1W5SA 4LG0A 3KCCA 2XGXA 1YTYA 2EB7A 3C7JA 3F8MA 1FPQA 4EM0B 2OAZA 1OYWA 2HKOA 2PMHA 1JHFA 1MDMB 2XROA 5JHUA 3WTWC 3SFZA 2H94A 4A6DA 1Z05A 4ZZDA 1TNTA 2DPDA 4F7ZA 3I71A 3JSPA 1OPCA 2PBIA 2CWEA 4DQ2A 5BMZA 4GYGA 3KE2A 2XAFA 2ADUA 5D5VB 3N4MA 3F72A 2RC4A 5FD6A 4IRGA 1YYVA 4B09A 2RKHA 4A0XA 3GEZA 1XGMA 2CSOA 1B9MA 3FMRA 4HF0A 1J5YA 2EV6A 3RI4A 3IRQA 3I59A 4UUVA 4EJVA 3JAMZ 1UCRA 1UFMA 3C3WA 1U5TB 3FXRA 4L9JA 2DK8A 4L0YB 4CZZA 1R5GA 1XDSA 1XMKA 4KN4X 2PMUA 2VC0A 1OMIA 4HF2A 1G6NA 4HV6A 1KU2A 2MH2A 1F4KA 3WTUC 3OOPA 3VFZA 1LB2A 2UXNA 2XIGA 3M9AA 2DU9A 4OMZA 1W5TA 4AIJA 5D4SA 1IN8A 1RNLA 2L01A 5DEQA 1FYLA 1BI1A 4JQFA 1DPUA 5CJ9A 2A69F 4MHGA 4EJWA 4ENNA 2EA2A 1P4AA 4ESJA 2BYVE 1B59A 2FRHA 1UHMA 3K69A 3GFJA 5LBQA 1KU9A 5KK1A 3K9TA 3HSEA 3ZP5A 4B8XA 5CVVA 3DFGA 5L3CA 1W7PD 4ZYEA 5AIPA 1TW2A 1OYIA 5D6FA 5DYMA 3MAJA 3ZQ7A 2EV0A 1QQIA 4UV8A 4O3MA 1MJ9A 4ZYGA 2CGPA 1IXSB 1J59A 1C0WA 3RJPA 5LHGA 2VODA 3CUQC 1IN4A 3BJOA 1FBSA 2IT0A 3WTZA 4A5MA 4OIPF 4I98B 1ZAOA 3TDUC 2K02A 2D2WA 2ZMEA 1LDJA 4LG0B 4ESFA 3IKVA 1T39A 4KIFA 2XRNA 1YW7A 1BM9A 1EH8A 4L5JA 2A68F 2FQ3A 1FP1D 4EJTA 4KN7X 3J80K 2F5DA 5F1RA 3U9GA 4KA4A 1ZG5A 1IRFA 1U8RA 4UHTA 2PI0A 1IW7F 3MWMA 2STWA 2EFOA 4Y17A 4FX0A 1YW8A 1OR7A 2K7LA 2IVMA 5HOOA 1S29A 5LGNA 5E18F 5DUKA 2QQ9A 4BYYA 1KU3A 4KYWA 4ON0A 3DXJF 4KFCA 5L3BA 1O7LA 2ZNYA 2UWMA 1JGSA 3I58A 1R1TA 4U0VA 3I59B 2EFPA 3RPUA 2OBPA 2FMLA 2Z33A 2PLYA 1SD6A 4Q48A 1KYWA 3FF5A 5ILVA 3IWZA 1AOYA 3SXYA 2P7CB 2TDXA 2D1VA 3GUDA 2Z9OA 3FX3A 5TJJA 2HDCA 1BBYA 4OIQF 3HTUA 2V1UA 2DI3A 1TNSA 3M1EA 2D1HA 3EQLF 4LLGF 4EQQA 2K4JA 2O3FA 4OIOF 3E5XA 1WKMA 3BJ6A 2X0LA 1D8KA 3G73A 2R7FA 3PFIA 2NRAC 6PAXA 1LEAA 3WU1B 2VT2A 1FBUA 2M87A 3QAHA 2COMA 2W84A 5DUIA 4EV0A 2STTA 2H09A 1RZ4A 5K5RA 3R0AA 2RV8A 3F8CA 2XAHA 5LEKA 1ON1A 1Z9CA 3M8FA 5ICEA 2VE9A 1BIAA 3F6VA 2KRFA 3HHHA 1G3WA 3V7SA 3EYYA 1LNWA 3HOTA 5DV5A 3V8JA 3ULQB 2ZO4A 4AWXB 1V4RA 2ZMEB 1ZARA 1GVJA 1DUXC 4MTEA 4NHJA 4Y13A 2A5YB 1TQPA 2KKOA 4EGZA 1FC3A 5FB2A 1LVAA 5JR3A 3IL2A 2GAUA 5IT9K 4YIIA 2FU4A 3GZ6A 4O6JA 2RN7A 2CFXA 3DF8A 5D5XB 3BY6A 4AVPA 1RIOH 1K6OA 4AIHA 2IJLA 5E1XA 3BROA 5AIQA 3D0SA 3QP6A 3E6MA 1L3LA 1Z6RA 3EETA 3E5QA 1PP7U 2FE3A 3J81Z 1IXCA 4MQVA 1DP7P 2HEOA 5JVTA 3KETA 3NEUA 3CTAA 4I0BA 1FYKA 3E97A 4A2UA 1YLFA 2DTRA 2JRTA 5IT3A 1EH6A 1R58A 3BOQA 5E1WA 4KICA 3BPXA 5LRRA 2Q8KA 1DPRA 2BE5F 1R1VA 4MEXF 3MQ0A 5L3DA 1XSDA 2ZNZA 1HKSA 4L5IA 3Q5FA 4YG2F 3JTHA 4QLCU 4LLNA 5K5QA 2IPQX 2KJCA 2HYFA 2ZCWA 1S6LA 4LB5A 4G6DA 4JBAA 3KP3A 3GFMA 3T8RA 3PQJA 1T98A 1QO0D 1FOKA 2VXZA 3LA3A 4KT5C 1Z91A 5CVRA 2MLGA 3FMSA 4LLLA 2EFQA 4M6XA 3O2PE 1P92A 5E17F 4XRFA 1WRJA 1LDKB 1XN7A 3F21A 2BGCA 4ENMA 2GXGA 5BPIA 4G7OF 3I4PA 4U7BA 3CUOA 3HRUA 1O3TA 3HOSA 2BEOA 3COAC 5JI6A 3DQVC 3RKWA 3EDPA 5HDKA 2FMYA 2IA0A 2DK5A 2FA5A 2W57A 1B1BA 3LA7A 2ZKZA 2A3SA 3I53A 5A2QZ 2HOEA 2ZFWA <