3I0TA

Sulfur-sad at long wavelength: structure of bh3703 from bacillus halodurans
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
178
structure length
170
Chain Sequence
SLEKQIESYYQEIAQLIIDMIPEEWAEVRFYAQEDHDGWKIFFFHYLSASSDEWTKDIDIRDVIKVPQDEFMEKYNELSFCISDFRKDYAEAFGEPWMSFQMTFYASGKFNIDFYYDKNPFDTFLTRLAWQYEHFGTIPEDSFYKETLNEYLEEKAQGKRYPFLEPLHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords BH3703 protein
publication title Sulfur-SAD at long wavelength: Structure of BH3703 from Bacillus halodurans
rcsb
source organism Bacillus halodurans
total genus 54
structure length 170
sequence length 178
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04634 DUF600 Protein of unknown function, DUF600
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3i0tA02
3.30.500.20 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 BH3703-like domains 3i0tA01
1V4RA 3FMSA 1USTA 4LLGF 4G94A 4A2UA 4O6JA 3GWZA 3ULQB 3WGIA 5TJJA 3J7AO 4KT5C 1G3YA 4L9NA 2V79A 5HDNA 1P4AA 1MGTA 3BROA 3WTTC 1MZBA 1TLHB 1IUYA 5EEHA 1D5VA 3FXUA 4MNUA 2P6TA 4RB1A 3WU0A 4LB5A 1XDUA 1F9NA 1FYLA 3K1MA 1QQIA 5AIQA 1A04A 4OIQF 3GUDA 2YU3A 2CWEA 2MH2A 3EYIA 1SD7A 1F5TA 4IVNA 5E8GA 1BI3A 3GX4X 2ZXJA 2PI0A 4ENJA 1RNLA 1OYYA 3J81K 2D1VA 1W5TA 5DCFA 3TKYA 1SAXA 1QBJA 4RGXA 2DPDA 1R1VA 2ETHA 2DFIA 1P2FA 1FBSA 4EJWA 2VBZA 1XSXA 3KEOA 3F23A 2LF8A 5JVTA 1B59A 3JW4A 3H3UA 1SMTA 1PDNC 4N9HA 1USSA 3Q9VA 3V8KA 4HLXA 4XLPF 3ERED 1U3EM 3HTUA 1S7AA 2IA2A 5D8LB 1YW9A 2K7LA 3V8JA 2BYVE 3EETA 1HSJA 1L3LA 4JK1X 5L3GA 2PMHA 1B4AA 2BGCA 2KJBA 2W57A 1DPUA 2L02A 1W7PD 2ESHA 2IW5A 2HZTA 4M74A 2BE5F 4BQAA 3HSRA 4CO8A 2VT2A 1REPC 1ZGAA 1DUXC 3C7JA 3F21A 4HQMA 2DAOA 3QAHA 2VC1A 5ILVA 2J5OA 4EJUA 2EFWA 4JBAA 5F64A 1ZHFA 4WK8F 1P92A 1DP7P 2HGCA 3TO6A 5BPIA 3M1EA 1XDSA 1HW1A 3L2CA 2PG4A 2LSOA 4B09A 2L4MA 2PN6A 2E7XA 2A6EF 1ZGJA 1ON1A 2RV8A 4HX4A 3CO6C 4WWCA 5FLXK 3JAMK 3RKYA 4RAYA 3HRMA 1HQCA 3K1PA 2VODA 3PQJA 1TQMA 1U5TB 1JXSA 3CDHA 2VE9A 2QQBA 3I58A 2D2WA 3O3KA 4BHBA 1JHHA 2F5EA 2XASA 1W5SA 4KMUX 2O61A 5FFZA 1D3YA 2FU4A 1PP7U 1I6XA 3V4GA 3M9AA 3GFIA 4HW0A 1L0OC 3HUGA 1LVAA 2FE3A 1K7AA 3K9TA 3NQOA 1TBXA 4MTEA 4Q5SF 3LFKA 3R4KA 3GO5A 4ESBA 2ESNA 2YSRA 1GXPA 2JT1A 4A0ZA 2XAJA 1FC3A 3FWEA 5E18F 3KP2A 4N0BA 4IRIA 5JI6A 1FYMA 2D1HA 2PFBA 1NHAA 5BMZA 4L5IA 4IHSA 4Y13A 2DBBA 3IRRA 5D4SA 2H6BA 4OIRF 2XHKA 4AIHA 2HKXA 4PGHA 3F3XA 1W7PB 3SFZA 1LEBA 1YW7A 4ESFA 1XMAA 3GW2A 1ZARA 3DFGA 3T8RA 5CJ9A 3QPHA 1UB9A 1DPRA 4CGZA 3KCCA 4P96A 2R3SA 3I54A 2GXBA 1R00A 5L3BA 3K1NA 1O3RA 3P7NA 3LWFA 4KDPA 4HDUA 3RJPA 5IT9K 3WTSC 3ZMDA 2D45A 1HXDA 2PQ8A 1FP1D 5ILUA 3I5UA 3O6BB 5E1XA 1OMIA 4G7OF 1XMKA 2MBFA 4LK0F 1HKSA 1SFXA 2XV4S 2FSWA 2HS5A 2HEOA 3SZTA 4MQVA 3IWZA 5LEKA 1HBXG 2VOPA 1TNTA 3RI4A 3BDDA 4FX0A 5D6EA 3ZMSA 3TQNA 2EV0A 4EGYA 5K1YA 4Z2YA 3EQLF 5LHGA 4P55A 1BOAA 4A6DA 2HTJA 2CG4A 3GVAA 3KETA 4HA8A 3J80K 3E5UA 1H0MA 3Q5FA 4HDVA 4HBLA 5HS7A 5DCMA 2WTEA 2FOKA 1AOYA 4LMYA 2ZMEA 1WKMA 4KN7X 1G4DA 1U2WA 5DD8A 2YX4A 3WTZA 2XKOA 2A6HF 5LGNA 3WTUC 2O03A 2JPBA 5ICCA 3M8EA 1P6RA 2IJLA 2VN2A 1O3SA 3TOBA 3DPLC 1IRFA 4EM0B 2H09A 1T98A 2W84A 3E3VA 1O7LA 1R1UA 2STWA 4UVAA 2FNAA 1CGPA 4A6EA 2R7FA 4NQWA 3RYRA 1JGSA 3L09A 1FYKA 3R60A 4HAMA 1OYWA 3DPTA 1T39A 2YR2A 1ON2A 3I0TA 2GA2A 3VOEA 1FSEA 1MDMA 1XGSA 3R61A 1SMYF 2P8TA 1K78A 3ROUA 1FY7A 4YIIA 2IRFG 4KMFA 2UXXA 4L18B 1R23A 3COAC 2ISYA 3Q9SA 2NRAC 2A68F 4Y17A 1BI0A 4XBFA 1MJ9A 2CYYA 2F5FA 2Y75A 1BJAA 2A3SA 1RUOA 4EV0A 1YTYA 3P9IA 5H20A 5JFRA 1YS7A 2DU9A 3DKWA 1WSUA 2W25A 1JE8A 5KVRA 3IKVA 5D5UB 2ZFWA 3MFKA 5DV5A 5J8FA 2NNNA 1XGMA 5HLHA 4M73A 5H6QA 3CLOA 3L9FA 4UHTA 4ENNA 3WGHA 1J7KA 3KP6A 2UWMA 2X0LA 1U6GA 2MH9A 4U0WA 1Z6RA 2IVMA 3N97A 2A5YB 1BBYA 3SQNA 5LGTA 2OZ6A 3GF2A 4GGGA 5L3CA 2E7WA 4M9ZA 4EGZA 1Z1DA 3FM3A 3EYYA 1IN7A 3CUOA 1CF7A 5CLSA 2EK5A 4EJTA 2K02A 3ABUA 1ONVA 4WXHA 3TDZC 1GVJA 1SFEA 2OAZA 1KU2A 1K6OA 4LB6B 4CHUA 3I64A 3RKWA 4MHGA 2P6SA 1FP2A 3MCZA 1BI2A 3DQVC 4R1HA 2HWVA 1TW3A 3LA7A 1T6SA 2K86A 3KZZA 2EFOA 1FPQA 2AS5F 5A2QK 3BWGA 4G9YA 1HW2A 3F72A 2XUBA 1YO5C 3H92A 2HDCA 4HOBA 2PBIA 3E6CC 1LNWA 3VODA 4LG0B 2FBHA 3TGNA 3JAMZ 2LDUA 1S6LA 3GEZA 5FD6A 4I01A 3M7GA 4XSXF 4B8XA 1OR7A 3WTXC 1J0RA 2CGPA 4U7DA 5AONA 1I27A 3BP8A 4LLLA 2M30A 3ZMUA 4HF2A 4PCQA 4EM2A 4P9FA 2ISZA 3LQRA 5BQTA 1WI9A 1IZ1A 1YLFA 2Q0OA 1ODDA 1P4WA 2EFQA 5E1ZB 5FGMA 4KNYA 1SFUA 3RPQA 1Z9CA 5D4RA 4OIOF 2RKHA 1FZPB 3PQKA 1EH8A 4RB3C 2L01A 2JTVA 3P9CA 4HX7A 3L7WA 1ULYA 2W85A 4L5JA 2DK8A 2FF4A 1IW7F 3S2WA 3GFLA 1XB4A 2ZKZA 2QBYA 5HS9A 3K69A 2EFPA 3KP5A 1LDJA 5CVIA 3W6JB 1OPCA 2EJRA 1YG2A 4HZFA 1IN5A 4MGRA 3BZ6A 3GZ5A 3CTAA 1RZ4A 4CYDA 3FHZA 2HFHA 3SHFA 3GFJA 2VOOA 4LD5A 4ZZDA 3ISPA 4YFXF 4HV5A 3LA3A 4KFCA 1O57A 2OA4A 5ICGA 3HHGA 3JSOA 2EB7A 3IWFA 3QU3A 3B73A 1QGPA 1XGNA 4YFNF 5DD4A 3IL2A 4K2EA 1MD0A 2X4HA 4P5OA 1G3SA 1HKTA 1UFMA 2JRTA 4I98B 3MQ0A 4PDKA 3HRTA 2QLZA 2Z9OA 2KRFA 4EJOA 5LRRA 2XIGA 2JZYA 3WODF 1U5TC 1AWCA 2STTA 1U8RA 4I0AA 4IXAA 5AIPA 2TDXA 4WXDA 1KGSA 1ZG1A 5L3DA 2M5WA 4KN4X 4CICA 2PLYA 2HKOA 4A0YA 4RGRA 4ZYGA 4U7BA 2EA2A 4HX8A 4AD9A 3MZHA 2R7DA 4I09A 4RGUA 2XROA 4OIPF 4KIGA 1STZA 2KIMA 2IPQX 2YX7A 5HLIA 2MC3A 3QP5A 3WG9A 3IKTA 3GXOA 4ZYDA 2F5CA 2L54A 3KLOA 1F4KA 4UVBA 1FX7A 2GXGA 3I4PA 5KK1A 3HYIA 5EEGA 2IA0A 4Q48A 1BIBA 2WC2A 3F8FA 1E2XA 2QYOA 2Y0MA 1FWZA 1ZYRF 3DV8A 2OQGA 3C18A 4RS8A 2LNBA 3U1DA 2K4JA 4LK1F 1KU7A 2M87A 3I53A 4KICA 1KYZA 4GXOA 2VONA 3KLNA 1BC8C 1LJ9A 4D0PA 2Q2EA 3N4MA 3KFWX 1SD5A 2BBYA 3OV8A 1WQ2A 1QNTA 3ECOA 1XD7A 1YYVA 1ZLJA 4M6XA 1KQ8A 3D5LA 1J9IA 3PFIA 2NYXA 2GZWA 4ASNA 2VBWA 5BOXA 3QU6A 1G3TA 3GYHX 1W4MA 2K4BA 5LHHA 1FT9A 5E1WA 4EMSA 1UCRA 1YQAA 4AVPA 1BIAA 2OD5A 3HRSA 2DK5A 1TNSA 2BV6A 4BAYA 3I59B 2UXNA 3KZYA 4M71A 3G3ZA 2RNJA 2MLGA 1SD6A 1K79A 4A5MA 1OKRA 4O5VA 1IRGA 2P5LC 2KIUA 5HDGA 4PZJA 3I71A 1J2XA 3LA2A 5DCMB 5HVQC 2ZMEB 3O2PE 3C3WA 2P5KA 3E5XA 3ZN0A 1LQ1A 1C0WA 1R1TA 5HDKA 2NAZA 1RIOH 1EV7A 3U9GA 5K5QA 2O3FA 2EFNA 2DTRA 4XRFA 3HSFA 1UHWA 5J8CA 2RQPA 4DQ2A 4PGGA 5HOOA 3K2ZA 3LQQA 1YW8A 5DUIA 2RN7A 5LEJA 1V3FA 1BN5A 1VTNC 1I1GA 3CUQC 4AWXB 4ZZLA 3ZPLA 2E1CA 2EA4A 2CFXA 1IXSB 1KA8A 1Q1HA 1O7FA 4CZZA 3CUQB 4F7ZA 2P7CB 5LHIA 3G73A 4KUMA 4XSZF 3TO7A 3IC7A 2M8EA 2ACJA 5E20A 2Y48A 4OMYA 4RB2C 1IN4A 4BH9A 3FXQA 4CDGA 2KIFA 3RPUA 5BPDA 4U0VA 3RIRA 1HSTA 2RVCA 1I5ZA 5D5WB 4IRHA 2NNYA 2HYGD 1D8KA 4A5NA 2XAQA 2WWYA 1QO0D 1Z91A 1IXRC 3VEPA 3H3ZA 3BOQA 4ON0A 4ZYHA 5L3EA 2Z99A 4L0YB 3WU1B 2QWWA 2LF7A 3HRUA 3E6DA 3KEQA 4HQEA 3J81Z 4RGSA 1IN6A 4KA4A 4UUVA 2KJCA 1F1ZA 4LJZF 2QZ8A 3QOPA 2GWRA 1YIOA 5ILSA 4S05A 1FBUA 2O6GE 2DLLA 2V9VA 1HW5A 2IA1A 1GHCA 3ML6A 2XGXA 4OINF 3RTRA 1LDDA 3RDIA 3SZPA 1CF7B 5IT3A 3VFZA 3WTWC 2HOEA 5ICFA 4Q47A 4ETSA 1X3UA 2EWNA 4KIBA 1LB2A 4G8XA 2HTSA 1Y0UA 3BJOA 3WE3A 2YPRA 4R8HA 2DI3A 3R0JA 4HV6A 4G6QA 4G7ZF 1MKMA 2XAGA 4NHJA 3RYPA 2Z33A 5ED4A 2VT3A 3BJAA 5CVRA 3EDPA 4UV8A 3ZMZA 3WGGA 1QPMA 4Q4ZF 2OQRA 4HYEA 2J5PA 4BXUA 2FQ3A 2ZCWA 1R5HA 4KIFA 6PAXA 2V6CA 4MQ9F 1ZRFA 3C1DA 3HSEA 4L9VA 4EVIA 3D0SA 3NEUA 3BJ6A 4EJVA 3TDUC 5FLXZ 2VBYA 3FZVA 2G7HA 5ICEA 3E6MA 4GCVA 2CSOA 5FO5A 1B9NA 2ZO4A 1J75A 3LAJA 1SD4A 2NS0A 5JHUA 4FX4A 3E5QA 4FT8A 4WX9A 4MTDA 2QENA 2A07F 2V1DA 2H6CA 2ZNYA 2H94A 2VE8A 2W24A 2RDPA 1MJAA 2XAFA 2ZNZA 2QUFA 5LBQA 2WV0A 2OBPA 4LG0A 3ZMTA 2QBYB 5K5RA 2L3DA 2XRNA 2O8XA 2VBXA 3E97A 1I1SA 2ADUA 1U78A 5J6XA 4S04A 1GXQA 3SXYA 3HIFA 1JHFA 2COMA 3V8LA 4E70A 4A12A 4I02A 4WCGA 2DQRA 2O0YA 4IRGA 2KKOA 3F6OA 1XN7A 2M1BA 4BHPA 4QLCU 2G7UA 1J59A 5K5OA 3LAPA 3JTGA 1BC7C 3ZN1A 2OU2A 1O3TA 4IHTA 2RC4A 3KE2A 3FXRA 1PP8F 2MA3A 1Z6TA 3FMQA 3WTVC 2GAUA 5ERIA 2RGVA 1FSHA 5HLGA 3DP7A 1G6NA 4A0XA 4CXFA 1PUEE 1UHMA 5IT9Z 5DEQA 3F6VA 1Z05A 3V7CA 3VB2A 5BS6A 1ZAOA 5DUKA 3ELKA 1T2KA 2BEOA 4YG2F 4IF4A 4QWQA 1S29A 5HS8A 1R36A 4HF0A 1RI7A 1ZRDA 3AAFA 3KP3A 1G3WA 3MZYA 4M72A 3F8NA 4RAZA 4R79A 2FRHA 4U0YA 2EV5A 4G6DA 2ELHA 3V7SA 2VXZA 1ZRCA 3KP4A 2Q8KA 1B1BA 2XKPA 4TV7A 2PEXA 3GFMA 1YFHA 3ZQ7A 3FM5A 4L9JA 1Z7UA 3J80Z 3REOA 2A61A 2IP2A 3ZMVA 4BYYA 4N9IA 2HR3A 3F8CA 1O3QA 4ENMA 1TQPA 2C6YA 1U5TA 2DPUA 2HQRA 4HLYA 1BM9A 2Z3YA 1EH6A 2CW0F 4ZH4F 5CYVA 2FEZA 3E6BA 1J5YA 2ZJ2A 4DNCA 5H6RA 4L9TA 1R7JA 4LLNA 2P7VB 4KYWA 3FF5A 1IXCA 2DO7A 1XGOA 3P9KA 1OYIA 3T0YA 1IAWA 2VC0A 3T8TA 1RUNA 1IN8A 2GQQA 3ABTA 2F5DA 3EUHA 3WE2A 3K0LA 4AIJA 4WF2A 1B9MA 1B6AA 3IHUA 4H0EA 3MEXA 1XSVA 2P4WA 4U88A 2A69F 4RB0A 1D8JA 4MEYF 1FNNA 3HOSA 1ZG3A 1BI1A 1IF1A 2FMYA 3MWMA 5CVJA 3ZP5A 5D8KB 4MEXF 3HTSB 2LKPA 1H9TA 4Y15A 4P9UA 1WRJA 5L3FA 4LGWA 1W7PA 5TRDA 1P4XA 2EV6A 2QQ9A 4M9SA 2FA5A 1ZH5A 4IPAA 3T5XA 4AIKA 4YIFA 2FXAA 1S3JA 4UXNA 2B0LA 2QQAA 3W6KB 4FHTA 1TQIA 2ZBKA 2PJPA 2FBIA 1TW2A 3T1BA 4GO1A 2G9WA 3R6SA 5F6FA 1EH7A 1KQ0A 2FNPA 3BPVA 3NRVA 1ZLKA 3I59A 3M8FA 1R5GA 3B02A 4ESJA 1T38A 2XVCA 3LSTA 3KP7A 1H9GA 1ZREA 3R0AA 5D6FA 4OOIA 1R58A 2CO5A 4IJAA 4OU0A 4GYGA 5LRSA 2DQLA 2K27A 1FOKA 4I0BA 4I7HA 2XAHA 3TOAA 1ZN2A 5DDGA 1MJBA 4XLNF 2F2EA 2JPCA 3JTHA 1MDMB 5FD5A 1KU3A 4JQFA 4L0ZB 2OZUA 3HOTA 4NB5A 1K78B 3F8BA 4O3MA 4ZYEA 2QM3A 5LGUA 1XSDA 4LFUA 5A2QZ 2JSCA 2AXLA 4G7HF 3GLXA 3OOPA 4M9XA 2V1UA 2IT0A 1DDNA 3FMRA 4I2OA 4UV9A 3IRQA 3CJNA 1T0FA 2DW4A 2E1NA 3CUQA 4M6YA 1E17A 4BHCA 2V1XA 4EQQA 2Z5UA 4ENKA 3F8MA 5CVUA 2M45A 2GIVA 2MD5A 5D5XB 1YS6A 1QZYA 4UNOA 5F1RA 3QRFF 3QPTA 1KQ9A 4HF1A 5FB2A 1FBQA 2L4AA 2FBKA 4GYIA 3DXJF 3HHHA 5E17F 2PMUA 5FFXA 3JSPA 3GZ6A 4EM1A 3TO9A 2H27A 2GA1A 4WXCA 1TTYA 4UVCA 3BPXA 2DT5A 5CVVA 5JR3A 2HQNA 3V7RA 1LEAA 3RKXA 2HYFA 1XCBA 5D5VB 4OMZA 3DEUA 3QP6A 3WTYC 1S8NA 2QVOA 1LDKB 3CO7C 5E8IA 1KYWA 2CQKA 1KU9A 2MLKA 1R22A 3L00A 3MAJA 2FMLA 3U2RA 2UZKA 1XCVA 1ZG5A 5LLQA 2P5VA 3DF8A 1WWXA 3FX3A 1S7OA 1QZZA 3F22A 1FLIA 3BY6A 4BNCA 1HKQA 4YFKF 3ECHA 5DYMA
chains in the Genus database with same CATH superfamily
1FIPA 4PRAA 1V4RA 3FMSA 1R5ID 1USTA 4F7MA 4LLGF 3ARDA 4KT6A 4G94A 4A2UA 4UUSA 4O6JA 2X85A 4MJ5A 4NC7A 1OGTA 3GWZA 3ULQB 5IVXA 3WGIA 3VXSA 5TJJA 2XGDA 3BGMA 3J7AO 4HSTA 1W36C 3PNTA 4CW1A 2R5ZA 4KT5C 1FZJA 3BVNA 3N05A 1G3YA 3GMLA 1YN7A 3LSGA 3OYCA 4L9NA 3V5KA 2V79A 5HDNA 1RR7A 3QPSA 4RM2A 1IV8A 2QCOA 4FETA 5EFIA 1P4AA 5KAFC 1MGTA 1OR7C 5EG0B 2RQQA 1FFNA 3LOCA 1MWAH 4BKWA 1T1YA 5FDWA 1AU7A 1E0EA 3BROA 1I7TA 5IOYA 2L9SA 3WTTC 3HBLA 3H9JA 3AG3H 1LFPA 3WHCA 1MZBA 1QVUA 1TLHB 3KYOA 4MFEA 1YRNA 1IUYA 4G9DA 1WI3A 5EEHA 1D5VA 2HPIA 3FXUA 4MNUA 1QSEA 3FXLA 2P6TA 4CCNA 4RB1A 3QUYA 2GM4A 3WU0A 4LB5A 3MYJA 4NQEA 1S72I 4II2A 2FYYA 5FROA 1YE9A 1XDUA 4NDLA 3FIWA 5F1NA 3P73A 1F9NA 1P7JA 4RBOA 2LC2A 1LK2A 2VE6A 5ACZA 1Z3XA 1FYLA 2OTLI 3K1MA 1S7QA 4JFQA 1QQIA 5AIQA 1A04A 4OIQF 3GUDA 3PWPA 3E3QA 2YU3A 2CWEA 2MH2A 3EYIA 2HYJA 3HZJA 3BR2A 1A9EA 1SD7A 2CRGA 3HG9A 1F5TA 5L2JA 3QUZA 3HJEA 2XGEA 4IVNA 4L4TA 1YX3A 1TWHJ 1BI3A 5E8GA 3V5HA 3GX4X 2KFDA 2ZXJA 1TWFJ 3ZQCA 1EXUA 3L3IA 2PI0A 2YU9J 4ENJA 1HLVA 1T08B 1RNLA 1ACIA 1OYYA 2XDVA 3GSVA 1UXWA 3J81K 3OYGA 2D1VA 1W5TA 3HEFA 5GAGJ 3G4SI 5DCFA 1TVHA 4LCYA 3TKYA 1G7QA 1SAXA 1QBJA 3MRCA 4RGXA 2DPDA 1MNDA 2ME0A 3CESA 1R1VA 4IHVA 1HDPA 2DFIA 2ETHA 1INQA 1P2FA 2R4GA 3KPPA 4E7SA 2KPMA 3C2GA 1FBSA 3X2QH 4EJWA 3TPUE 1S7UA 2VBZA 1XSXA 3KEOA 5EDNA 3F23A 4GFBA 3MRNA 2LF8A 2ZB9A 1B59A 4DYRA 3JW4A 5JVTA 2WAQN 3LSMA 2V7FA 3H3UA 5C0AA 1SMTA 4XLHA 1PDNC 4HNVA 4N9HA 2R7XA 3S17J 1T0NA 3D2UA 1USSA 2M7BA 1HHJA 1ZHKA 3O8GA 3JRBA 3CCSI 2GT9A 1JF1A 3Q9VA 3V8KA 4HLXA 4XLPF 3ERED 2QA4I 3CZFA 4BQQA 1ITYA 1U3EM 5FA3A 1JPGA 4ZYAA 3CCLI 2YPKA 4CZCA 3HTUA 3GTMJ 4CSWA 1S7AA 4BY1J 2IA2A 5D8LB 3BZKA 1YW9A 2K7LA 1A6ZA 3V8JA 2BYVE 4BKXA 3QI9A 3EETA 1HSJA 1LFBA 1L3LA 4JK1X 3MRHA 5L3GA 2PMHA 3MRQA 2DA5A 3H1CA 1FTZA 1B4AA 2BGCA 2KJBA 3FXKA 3ZQQA 2W57A 1DPUA 2L02A 1W7PD 4PUSA 3W2WA 4XLFA 4ZDLA 2ESHA 3ARFA 4LITA 2IW5A 2HZTA 2NW3A 1MBKA 4M74A 5EYRA 2OUMA 2BE5F 5IY5H 4BQAA 2V2XA 3HSRA 4DZPA 2GTWA 4CO8A 1NAMH 4C3HJ 3FONA 5GTHC 2OC6A 3BR1A 1JJ8C 1KONA 3CCRI 2CV0A 2VT2A 4XQFA 2EILH 3RL1A 1T22A 1REPC 4PJ0C 1X1CA 1RRJA 3IH2A 4HNTA 1ZGAA 3B6AA 2R5YA 3C7JA 1DUXC 1HA8A 3F21A 3CDIA 1FMWA 3LFUA 1R3HA 4D0DA 4HQMA 2A6TA 3OYNA 2DAOA 3QAHA 4JX5A 4M3EA 2VC1A 2Y31A 2E35A 4QOKA 4EN3C 5ILVA 3A01B 4PJDA 2J5OA 1ONQA 3TBTA 2JSPA 2QF7A 4EJUA 4BDYA 4DJAA 1WGXA 2IS1A 5IP6A 2EFWA 4EATA 4JBAA 5F64A 3TJHA 1ZHFA 4WK8F 1P92A 2V2WA 1DP7P 1EJ9A 4OAYA 2HGCA 4XRMA 1FOXA 1Y1VJ 3TO6A 5BPIA 3M1EA 1XDSA 3ZGKA 1HW1A 3L2CA 2A83A 3TW7A 2JWTA 3VXMA 4HV8A 2WB1N 2PG4A 2V26A 2LSOA 4B09A 3OYFA 2L4MA 4IZZA 2PN6A 2E7XA 2R0QC 3OIQA 4YRVA 1D1AA 1T7YA 2X6WA 2A6EF 2VLAA 1X58A 1CE6A 2DOAA 1ZGJA 1ON1A 4XOTA 2RV8A 3A1YA 2XF7A 4HX4A 1E3OC 3GTQJ 2GOMA 5B66C 3CO6C 4WWCA 5FLXK 3JAMK 4NO2A 2ELKA 3RKYA 2FIKA 1WJEA 3D18A 2ZXHA 2LYCA 3K4LA 2V1NA 3BTCA 4M3FA 3HRMA 4RAYA 1YJWI 3G6EI 1HQCA 4RAGA 3K1PA 3ZXSA 2Y9ZA 2VODA 3P9MA 1BA5A 2A05A 1S5LC 3OL4A 3BH8A 2K85A 1TQMA 3PQJA 3QYEA 1XS9A 5IB3A 3GTOJ 3DWLE 1U5TB 1JXSA 3LN4A 3HDDA 3CDHA 2VE9A 3ZQHA 2QQBA 3I58A 5F04A 1T7XA 2XPWA 3HPJA 3I55I 5D5MA 3X12A 2D2WA 2R7QA 3FOLA 3O3KA 4BHBA 1N25A 4BUPA 1JHHA 1QHHD 4D5CA 2F5EA 4U1KA 2VQCA 4X1EA 4KITB 4ITVA 2IGNA 1LEGA 4LCCC 2XASA 1W5SA 4KMUX 3DEWA 1X1BA 2F6CA 4B4CA 3CJQB 4LIVA 2O61A 2XPVA 4Y33A 5FFZA 3WUWA 1D3YA 2FJ1A 3IH4A 4NQCA 3CC4I 2FU4A 2BY0A 1PP7U 2DMUA 1I6XA 4E7LA 3V4GA 2LY9A 1U8BA 3M9AA 3GFIA 4HW0A 1L0OC 3HUGA 2V9KA 3U21A 2HNHA 4Y4HA 1QR1A 1LVAA 1ZSDA 3H9SA 4PSXA 1B3JA 3GMRA 2FE3A 3M07A 3K2AA 3CCHA 1K7AA 4A3GJ 3K9TA 3NQOA 1TBXA 4RLQA 3RSNA 3SJVA 4MTEA 2KQRA 3F9KA 3LFKA 3R4KA 4Q5SF 4BQNA 2BVQA 3GO5A 2ZOKA 3S3OA 4WDIA 4ESBA 2JVHA 1S7WA 2ESNA 2KRHA 3KYLA 3MKWB 2YSRA 3CCQI 3RWJA 1P9QC 1IV6A 3OYAA 5DTDA 2JT1A 4A0ZA 1GXPA 2X70A 1B0RA 3VWKA 4PJMA 5BNGA 3K70C 1TWCJ 3SDDA 4J19A 2XAJA 4RDUA 1Z3YA 3KIOA 1FC3A 3FWEA 5FKKA 5E18F 3KP2A 4N0BA 4IRIA 5JI6A 1FYMA 2WV1A 2DA1A 5EF6A 4E7IA 2D1HA 5D9SA 3QUKA 2HZDA 2PFBA 3L2UA 1NHAA 4JX4A 2OCCH 2AQEA 5BMZA 4L5IA 4IHSA 1LP9A 2M34A 4Y13A 4HG2A 1P7IA 2DBBA 3IRRA 2JUCA 1Y1WJ 5D4SA 2BNRA 2H6BA 4OIRF 3RGVC 3SJMA 2XHKA 5DS9A 4AIHA 2HKXA 4PGHA 1GLNA 2VKVA 3SEZA 2VJIA 1W7PB 3F3XA 3BEWA 3CQZJ 5D2NA 4A3BJ 2NYKA 3SFZA 2HDWA 1LEBA 1YW7A 4ESFA 5E3MA 3CJRB 1VQ5I 4I4WA 1XMAA 3CCVI 3GW2A 3HCVA 1ZARA 5J4YA 3OSGA 3DFGA 3DBHB 1T20A 3T8RA 1ZGWA 2KL4A 2LVSA 5KCMA 5CJ9A 3OIOA 3Q0UA 4NHUE 3G2BA 3KPRA 1FMVA 2DMQA 3PSFA 3QPHA 3LSPA 3PWNA 1UB9A 4FE7A 1DPRA 1Y56A 4CGZA 3KCCA 1G8XA 4HSRA 4P96A 2CV2A 3ILQC 4QRRA 1V5EA 2R3SA 3HLAA 2WY8Q 2EH3A 3QDGA 1R4NB 3I54A 2GXBA 2PJRA 1QPIA 1R00A 5L3BA 2JA6J 3K1NA 1QLFA 3LKNA 3KYDB 3QDMA 4PDCE 1O3RA 3P7NA 4N0FA 3LWFA 3GMQA 3BR6A 4KDPA 4GKNA 4HDUA 3RJPA 5IT9K 1UG0A 3WTSC 3OXRA 4HS3A 3ZMDA 4PJ9A 2D45A 3QQ3A 2D31A 1HXDA 5EU6A 2FZ3A 2DODA 1W1WE 2I8DA 2KIQA 1T7VA 2PQ8A 1FP1D 5ILUA 3I5UA 3O6BB 5E1XA 2JA2A 1IG7A 1S7SA 2H8WA 3PWJA 1OMIA 4G7OF 5SWQA 2F4IA 1XMKA 2MBFA 2PYEA 4LK0F 1HKSA 1SFXA 1F43A 2XV4S 2FSWA 2XRLA 2HS5A 5E79C 2HEOA 3SZTA 5FKPA 5EJCA 2ZSWA 2OF7A 5CPRB 5EGOB 4MQVA 3T8XA 3IWZA 2WB1A 5LEKA 3S16J 3NAUA 2XSJC 4WU7A 3A2KA 1ZHLA 4G42A 2FD5A 1HBXG 2W4SA 1NG6A 2VOPA 3RZOJ 1TNTA 1X2MA 2GLOA 2CKBH 3RI4A 1OISA 3BDDA 1T95A 4FX0A 5D6EA 3ZMSA 2BVLA 3TQNA 3GSUA 3E6FA 4NO0A 5F9JA 2EV0A 2BHYA 2AQFA 1OCCH 4EGYA 5K1YA 4HUUA 3VFWA 2DOEA 4AM3A 4Z2YA 2IS4A 2XAUA 1ZHBA 3EQLF 2MSYA 3LL7A 5LHGA 4P55A 4ZUWA 3VFPA 3VFMA 1BOAA 2HTJA 4A6DA 2F48A 2CG4A 3OIPA 1JPFA 5HGDA 3VDXA 2XF5A 3TO2A 1E28A 1JKQC 3GVAA 3KETA 2ZJQF 1QSFA 4HA8A 3J80K 3E5UA 1H0MA 3Q5FA 2IS6A 1I1YA 2H26A 5C0CA 4PJIA 1I7RA 1IGNA 4HDVA 4MQ7A 3DX7A 4HBLA 5HS7A 4JFEA 1R9TJ 3L2RA 2BW3B 4F3QA 3LKOA 3BHBA 3WS6A 2CH0A 3BEVA 1IRXA 4OAZA 5DCMA 2WTEA 4HX1A 1ETOA 2I5UA 3BR5A 2FOKA 2H1KA 4LMYA 2ZMEA 4LOCA 1AOYA 1WKMA 2ZXIA 1R6RA 2X1EA 4KN7X 1G4DA 1X1PA 1U2WA 4NT6A 4PRIA 2KT0A 2E60A 3HC7A 2ZC2A 4D5FA 3O4LA 5DD8A 2YX4A 3WTZA 5GADJ 4ZUVA 1UXSA 3BW9A 2XKOA 1MI5A 2A6HF 4BJTA 5LGNA 3WTUC 2O03A 2JPBA 3FQRA 5ICCA 2LFBA 2WAFA 3G71I 3M8EA 1P6RA 1PYVA 2IJLA 5F7DA 2VN2A 2QGUA 1PUFA 2ME6A 1O3SA 4JO8A 3MRRA 3MRGA 3TOBA 3X11A 1LPQA 3DPLC 1IRFA 1TWAJ 5M3FJ 2BNQA 4EM0B 4NUBA 2H09A 2MC4A 1T98A 2MW8A 2W84A 1O7LA 1R1UA 2CQXA 3E3VA 3QQAA 4UVAA 2STWA 1G7PA 3TBSA 1X4OA 3LSIA 2FNAA 1CGPA 4C2UA 4A6EA 2AXFA 2J8UA 2R7FA 3MMYB 3UR3C 1AO7A 1BW6A 2NVXJ 1WPKA 4IKFA 4NQWA 3RYRA 4S0HB 4EI5A 1K5NA 1NH3A 1JGSA 3L09A 3GSOA 3RL2A 1FYKA 3R60A 3WU2C 4HAMA 1MSFC 1OYWA 3DPTA 5J1RA 3TMOA 1T39A 2DDAA 1I1FA 1OCOH 3GLLA 2YR2A 3CC5A 3CZ6A 2JA7J 1ON2A 1DDHA 2VKDA 5JHFA 4PJEA 1S7TA 3I0TA 4CCMA 2L7FP 3P4NA 4QSHA 5AD0A 5INDA 2ELJA 2GA2A 3H36A 4XR6A 3LSJA 2AV1A 3VOEA 3QDJA 4FTVA 3PABA 5EU3A 1FSEA 2HU9A 1T33A 1MDMA 1XGSA 3L3GA 3GMMA 1WZ2A 4FE4A 3BG5A 4LG3A 4IRJA 3HOYJ 1HOMA 3R61A 1SMYF 2AXGA 3FOMA 5C0BA 2P8TA 3JRFA 1MBEA 1K78A 2CU7A 3MRLA 4LIUA 3ROUA 5EZHA 1FY7A 4YIIA 3CCMI 2VLJA 3UBXA 3OSFA 2IRFG 2DA3A 1YN6A 4KMFA 5EOTA 1OCRH 1A36A 2UXXA 4L18B 1R23A 3COAC 5J1AA 2ISYA 1LE8B 3L3JA 2VLKA 3Q9SA 5SWZA 2NRAC 3WL9A 1UQSA 2A68F 5HGAA 4Y17A 2XC7A 1BI0A 3DBRB 1V5FA 1MJ9A 3SDGA 2CYYA 2F5FA 2Y75A 3MVPA 4XBFA 1HHHA 1BJAA 1XR9A 4G43A 2A3SA 3RWEA 2DTZA 3FRUA 1RUOA 4EV0A 1JUMA 2O8KA 2LKSA 2TRTA 1YTYA 3P9IA 5H20A 5JFRA 1YS7A 4QPQA 1MMAA 1JFMA 2VXDA 1TVBA 5LFAA 3CC2I 2DU9A 3DKWA 3AKZA 2PX9A 1WSUA 4WJ5A 2W25A 1JE8A 5C07A 2OCEA 2DOFA 3H5RA 3S1MJ 2NOJB 4NQVA 4NSKA 5KVRA 3IKVA 5D5UB 3TBWA 2QEXI 2ZFWA 3ERMA 3HXLA 3MFKA 5DV5A 5J8FA 2NNNA 1XGMA 3CMAI 1T21A 1WJDA 4PJ7A 2CQQA 1MNEA 1K4SA 5HLHA 1LEKA 4M73A 5GTIC 3ES6A 1SVMA 5H6QA 3CLOA 3L9FA 1YPZA 4UHTA 1VQ6I 3PUFA 4ENNA 3A4CA 3WGHA 1B72B 3SDCA 1J7KA 4L3CA 3KP6A 2LLKA 4U6YA 2UWMA 2X0LA 1U6GA 2X51A 1N3NA 2MH9A 4U0WA 4A3DJ 1Z6RA 1UAAA 1RK0A 2IVMA 3KPQA 3J7AY 3JTTA 4HUXA 4FISA 1DQUA 3N97A 2A5YB 1BBYA 3FDYA 3SQNA 4LHUA 2X1DA 4UUSB 3FK6A 5LGTA 3L3KA 5HNHA 3M17A 2OZ6A 1UZCA 5IB5A 5M5XJ 4NO3A 3GF2A 4GGGA 5L3CA 5F0HA 4NO5A 2E7WA 3DTKA 2DMPA 5F1JA 4M9ZA 4EGZA 3W3CA 4HRIA 4IRSA 5HNFA 4A3LJ 2YEZA 3X13A 1I3AA 1B0GA 4O2CA 3MZ8A 3Q0VA 4M3GA 1MH3A 1Z1DA 2CJJA 1JJ6C 3FM3A 3JRHA 2R7SA 3AFHA 3CMEI 3CC7I 4IEJA 3EYYA 1WFXA 1IN7A 4ANJA 1CD1A 3CUOA 1P7QA 2WY3A 3AU1A 1CF7A 5CLSA 2M2EA 5CQEA 2VKHA 4PJGA 2EK5A 4EJTA 2IGMA 3JTCA 2HJKA 5ISZA 4YIRX 1JT0A 5GAEJ 1KPRA 4L8BA 4IL6C 1XMXA 1T80A 2K02A 3ABUA 5DM6F 3JRDA 2NXNB 1ONVA 4WXHA 3TDZC 4IO9F 3JRCA 1YRNB 1S8DA 1GVJA 1SFEA 2LBFB 5E8PA 2OAZA 1KU2A 4C9YA 1K6OA 4LB6B 3BCAA 3K4KA 4CHUA 1QEWA 3I64A 3RKWA 4MHGA 3MGTA 1BQHA 2P6SA 1FP2A 3MCZA 1BI2A 2AHQA 2GJ6A 3DQVC 4R1HA 2HWVA 4M6VA 4XK4A 1X1DA 1TW3A 3LA7A 1L8JA 1T6SA 3OS1A 2K86A 1VI0A 3KZZA 3HL2A 1AHDP 2HDDA 1ED3A 2XB0X 3ABMH 2EFOA 4B3AA 1W0WA 3LV3A 4D0BA 4A3CJ 3QOEA 3FQNA 4ZFZA 3VFOA 1FPQA 4CCOA 5KHDA 1PJRA 2NVYJ 2AS5F 3KLAA 3VFSA 5A2QK 3BWGA 4G9YA 3DBXA 2O7OA 1HW2A 2R92J 3F72A 2XUBA 3IAS2 5LD2C 1YO5C 1Y39A 1A1OA 3H92A 2HDCA 4HOBA 2VPRA 4P1WA 2HLAA 1I7UA 3O3EA 2EZKA 2PBIA 2W82A 5J6GA 4ONOA 3E6CC 4XKVA 1LNWA 1MW7A 2AXTC 2L7MP 3VODA 4LG0B 2VLRA 2FBHA 3TGNA 3B6SA 1K4TA 4ZDPA 2LDUA 1S6LA 2VIXA 3JAMZ 1XH3A 2Q7YA 3O8XA 5B38A 3O8HA 3SKMA 1VQ9I 1U58A 3GEZA 5FD6A 2HOTA 2RAEA 2VQHA 4HNUA 1VQOI 4I01A 1LD9A 3LKQA 3M7GA 4XSXF 4B8XA 1SEUA 1T56A 2EIKH 1OR7A 3H9GA 3KZIC 3WG7H 3WTXC 1N78A 3KWWA 1J0RA 2KZGA 3CCEI 2CGPA 1N2RA 1D0YA 4U7DA 5AONA 1I27A 3BP8A 4LLLA 2M30A 3ZMUA 4HF2A 4NQXA 1RC9A 2P81A 3MKZA 1RJYA 3IH3A 4PCQA 4EM2A 4XIDA 4P9FA 3OYIA 2CUEA 5C44J 2ISZA 3LQRA 5BQTA 2LKXA 1I4FA 3NARA 1FEXA 3K6GA 2JA5J 4DZJA 1WI9A 1IZ1A 1W72A 1YLFA 1XC5A 2Q0OA 3E1SA 1ODDA 1P4WA 2EFQA 5E1ZB 4J01A 5FGMA 3DU5A 2EIMH 2CV1A 1K6YA 3Q3SA 1BD2A 1ETYA 1W0UA 4KNYA 1KZHA 1WJCA 1SFUA 3DMMA 4QRUA 3PNVA 3VXOA 3RPQA 2LTPA 3D5SC 3TIEA 3VCLA 1Z9CA 5D4RA 4IX7A 4OIOF 1XZ0A 2RKHA 1FZPB 1FIAA 3PQKA 5IEHA 1MHEA 1EH8A 2DT7B 4RB3C 1X2NA 2L01A 2Y9YA 2JTVA 3P9CA 4HX7A 3L7WA 3IUOA 4B47A 1ULYA 2QKLB 2DYSH 2ID6A 2W85A 5DEFA 2E5ZA 4L5JA 1V5GA 1XR8A 4X6CA 4W97A 5KAIC 4RAFA 1X19A 4BEHB 3S1QJ 2DK8A 2FF4A 1IW7F 3S2WA 3GFLA 1XB4A 3ECBA 1ETXA 2ZKZA 2QBYA 3FKIJ 2CS3A 4XONA 2OI9A 3LKRA 4K71B 3QPLA 5HS9A 4MXQA 3K10A 2LRDA 3K69A 2IXSA 3L2WA 2EFPA 3KP5A 4PJJA 5F0FA 3K7AJ 1LDJA 2R5YB 1AKHA 3U0PA 5CVIA 4PJHA 3W6JB 4BACA 1OPCA 5FRMA 1TP4A 2EJRA 2EINH 5MEQA 3VJ6A 1YG2A 1WH5A 4HZFA 1YI2I 1IN5A 1Z67A 4MGRA 1KPVA 3BG7A 3BZ6A 3GZ5A 3CTAA 4A69C 1RZ4A 1WJFA 3DU6A 4CYDA 3D25A 1KPUA 3FHZA 2HFHA 3SHFA 1Z21A 3GFJA 2HXIA 2VOOA 4LD5A 3ABKH 3ZRGA 3RZCA 2GTZA 4ZZDA 3BG3A 1UMQA 3GTLJ 3ISPA 2BVPA 2JMWA 4YFXF 5JVGF 4HV5A 3LA3A 4KFCA 2DYPA 1O57A 4D1QA 2OA4A 5ICGA 2M8GX 3HHGA 3A03A 5DM7F 4XL9A 3JSOA 2EB7A 3SYTA 3IWFA 1V54H 2NOGA 4YELA 1FJLA 3CCUI 3QU3A 1NANH 3B73A 3PFYA 1QGPA 1XGNA 4YFNF 5DD4A 4Z78A 3IL2A 4K2EA 1JGEA 1MD0A 2X4HA 1IO2A 4JQVA 4P5OA 5CQGA 3TEDA 1KJ3H 3JR9A 2KHMA 1G3SA 4F52A 2EPFA 3BC8A 1HKTA 2LD5A 2ZSVA 2AKRA 3W2AA 1UFMA 4UUTA 3NWSA 3J7ZI 2JRTA 4I98B 3MQ0A 4PDKA 3PJRA 4PJNA 4U1HA 3HRTA 2AO9A 2QLZA 4NNYA 4NBQA 3HB9A 1LKXA 2KRFA 2M9HA 2WY7Q 2ZJRF 2Z9OA 4MNGA 4S0UC 1ZQ3P 3PM1A 3E7LA 4EJOA 5LRRA 4PJ5A 2XIGA 3OYMA 5L2KA 3HE6A 1Y8RB 5D7JC 3AG2H 1KJMA 3QULA 2O5NA 2JZYA 3ESWB 2X4RA 1JTYA 4G6TB 3WODF 4BS9A 1U5TC 1AWCA 2STTA 2MHAA 1VQNI 1B8IB 3PNYA 1U8RA 4I0AA 2R7TA 4IXAA 5AIPA 5HHPA 3VXRA 2BY1A 2L9RA 2TDXA 4APQA 4WXDA 1A1NA 3GSWA 5INCA 3JREA 1KGSA 5KNLA 3RWCA 2FOWA 2K3PA 4XKWA 1ZG1A 1Y0NA 4G59C 1HSBA 4L8SC 5L3DA 2M5WA 4KN4X 1SC7A 4IQ4A 5E3LA 1EA3A 1SFKA 1H8AC 4V2FA 4PREA 3HUGB 4CICA 1AGCA 2PLYA 2HKOA 4A0YA 4PRPA 3BZCA 1FZOA 4RGRA 2H8RA 4D7MA 1VQ8I 1QVOA 4ZYGA 5FJ8J 4U7BA 2K40A 2EA2A 4HX8A 4AD9A 3TA3A 3OYJA 2R93J 4XLAA 2Y30A 3OYEA 1WJAA 4PGDA 2IGOA 2NS8A 3MZHA 2Y69H 3IP4B 3VSLA 3FT3A 2R7DA 2JCCA 2XPUA 4I09A 4D9JA 1TWGJ 4RGUA 1T7WA 3BP7A 2XROA 4OIPF 4KIGA 1STZA 4W1UA 2KIMA 3A02A 2IPQX 2YX7A 4G8IA 4HUVA 3P77A 3ZOBA 3BWAA 2Y0SN 5HLIA 1QZEA 1IUFA 4PSWA 5IYDJ 2MC3A 4M3BA 3MREA 2DA4A 3FXOA 3GSNH 3QP5A 1S7VA 2COBA 3DCFA 3TF7A 3WG9A 1ZT1A 4MFDA 2DXIA 4GDFA 3IKTA 3EPZA 3O9WA 4FTHA 3GXOA 4ZYDA 2F5CA 4A3EJ 2L54A 3EUKL 1MMDA 3KLOA 1F4KA 1WVRA 1JTXA 1IC8A 3PL8A 4E7KA 1VQMI 4EUPA 2P0WA 4UVBA 1FX7A 2GXGA 2E1MB 3I4PA 3L2QA 5KK1A 1QA6A 3MKLA 3HYIA 5EEGA 3HOWJ 2IA0A 4MLOA 4DYCA 1BIBA 3K4JA 4Q48A 1IDZA 4PJCA 2WC2A 2D5VA 3F8FA 1E2XA 2QYOA 2Y0MA 2VPLA 2KLOA 2RFXA 1D0XA 1FWZA 3I6KA 1ZYRF 4PGBA 3DV8A 2OQGA 3D1NI 3C18A 4RS8A 2LNBA 3KYNA 5TISC 1YX5A 4GUPA 3KPMA 3U1DA 2K4JA 3MROA 4FASD 4PRNA 1SYVA 4LK1F 1KU7A 1D0ZA 4HUWA 2M87A 3I53A 4KICA 5IPAA 4V3EB 1KYZA 3IT8D 4GXOA 2M0CA 3KLNA 4XN3A 2VONA 1VF9A 4QRSA 1MBFA 4BL0B 4IIQC 2M4GA 2PJRB 1S7RA 1BC8C 2VQLA 1LJ9A 4BXFA 3PIOF 1DGRM 4D0PA 3W0WA 2Q2EA 3HOXJ 1X3ZB 4X0GA 3N4MA 3KFWX 1GV5A 1JGDA 1SD5A 2E36A 2H6PA 2BBYA 2KDZA 3OV8A 1WQ2A 1Y8QB 1BR4A 3CD6I 1ZK8A 1QNTA 3ECOA 2ESVA 1XD7A 1YYVA 1ZLJA 4M6XA 1KQ8A 3D5LA 1BOBA 3ZQLA 1Q94A 3BQYA 1H88C 1VZ0A 3TW6A 3H0GJ 3GMPA 1J9IA 9ANTA 3DX6A 1DU6A 3PFIA 2HQAA 2NYXA 3GTKJ 2Z2SB 2GZWA 1QU3A 3S1NJ 4ASNA 1MMSA 2CIIA 5GPAA 1SVOA 2VBWA 4BBRJ 1S9YA 1T1XA 5BOXA 3QU6A 3TP0A 1FZKA 1QO3A 3E6HA 1G3TA 4PJBA 3GYHX 2QKMB 3SEQA 2HJLA 4MS8A 5IROA 3I4MJ 4U1IA 1W4MA 3S8PA 4G12A 5E00A 2K4BA 5LHHA 2M0MA 4U1JA 1FT9A 1R4MB 5E1WA 4EMSA 1ZR2A 1UCRA 1YQAA 2E34A 1X3WB 3CMMA 4AVPA 2CFOA 1BIAA 1N5AA 1G59A 2OD5A 3HRSA 3Q0WA 3SDBA 1QQDA 3I6LD 3VFTA 2DK5A 1TNSA 1WJBA 2ZJPF 2BV6A 2EZHA 4BAYA 3JRIA 2X4UA 3I59B 2UXNA 2DJIA 3KZYA 2V6EA 2ECCA 5M5YJ 4M71A 3G3ZA 2DA7A 2RNJA 4F7TA 2MLGA 2YUSA 3AM8A 5IEKA 1SD6A 4HEA2 1K79A 3LMMA 4A5MA 1FOWA 5IOZA 5EO1A 1OKRA 4I48A 5HGHA 3TZVC 1M6OA 4U1LA 3KXFA 4O5VA 3V5DA 5TGTA 4ZUUA 5C4XJ 2DFFA 1NTCA 2W00A 4RM3A 2EZIA 2HVRA 3FQWA 2M3AA 1X4PA 3VYSB 2P5LC 1IRGA 1MMNA 4N0CA 2KIUA 2HPMA 3H35A 5HDGA 2DA6A 4PZJA 3I71A 1MIJA 1Z5LA 1J2XA 1GT0C 3LA2A 2B63J 4M3DA 4L8DA 5DDHA 5DCMB 2CLZA 4X6FA 2XF6A 5HVQC 4E7JA 2ZMEB 3O2PE 3C3WA 2P5KA 3V42A 1S9XA 1I50J 3D3VA 3RTQA 3E5XA 5FLVA 3ZN0A 1ETWA 1RKTA 4IQJA 3FXJA 1LQ1A 1C0WA 1R1TA 5HDKA 2HVQA 3BZFA 2NAZA 1RIOH 3JVGA 1EV7A 3CJTB 3VYRB 2M4KA 3MV7A 3U9GA 1PUFB 5K5QA 2O3FA 4PRBA 5EGOA 2EFNA 4IHXA 2DTRA 1VGKA 4WUUA 2FWOA 4XRFA 3HSFA 1UHWA 1V55H 2RQPA 3BLYA 5J8CA 4DQ2A 2TCTA 2FQ4A 4PGGA 5HOOA 1GDTA 3GZNB 3K2ZA 3LQQA 1X7QA 1YW8A 3ARGA 1OJLA 5DUIA 1IRZA 2RN7A 5LEJA 1V3FA 3CDGA 2XGCA 1GZQA 1BN5A 1T0FC 4F55A 1JE6A 2E2HJ 4Z6YA 1VTNC 3VXPA 1I1GA 3CUQC 4AWXB 4ZZLA 2YPLA 3GCMA 3ZPLA 3MD2A 1X1AA 4JRYA 2E1CA 2EA4A 2CFXA 2DCEA 2Y0SA 4XRSA 1W36D 2K5CA 1IXSB 4QRQA 1KA8A 4ZUTA 1Q1HA 3AG1H 3L1PA 1BZ9A 5BJTA 1O7FA 4CZZA 1I39A 5C0DA 1DUYA 3BQZA 3WLBA 3CUQB 1MH4A 4AVZA 3MV8A 4F7ZA 1XTAA 2UV1A 2LMDA 4PFPA 1HF0A 2P7CB 2AV7A 5LHIA 3VWBA 3G73A 4KUMA 4N0UA 3GTGJ 4XSZF 3TO7A 4X6DA 1IJWC 3UKGA 3DXAA 3IC7A 5C0JA 2W7NA 3OX8A 2M8EA 2ACJA 4UY8I 5E20A 2Y48A 4OMYA 3RUGA 4RB2C 1FZMA 4HPQA 5GSVA 1IN4A 3G1OA 4E5XA 1YJNI 4CVZA 3LSHA 4BH9A 2VASA 4KJZA 3FXQA 4CDGA 2A5WA 2KIFA 5HODA 3OWTA 3G08A 3RPUA 1JT6A 2R7RA 5BPDA 4E0RA 4U0VA 3RIRA 4UB8C 1HSTA 2RVCA 1I5ZA 3AL0C 1OFCX 4L5EA 3FKJA 1QRNA 3D39A 3MRFA 2ZXWH 2F5VA 2F74A 4F7EA 5D5WB 4IRHA 2NNYA 2HYGD 1D8KA 2DJNA 2XAQA 4A5NA 4PJFA 1IM9A 5M5WJ 2ZSIB 2WWYA 4B3XA 5GP9A 3AL0B 1Z77A 2X48A 4ZJZA 1QO0D 1Z91A 3ARBA 1IXRC 1WJ5A 3VEPA 3PO3J 4BXXJ 3QEQA 3H3ZA 3BOQA 1D5YA 4PV9A 4ON0A 4ZYHA 2XB5A 3KPLA 3QZWA 4DBQA 5L3EA 1JHTA 2MGQA 2Z99A 3MRPA 2H1LA 1H89C 3FQUA 4U1SA 1OQYA 1DGWY 2VJ5A 4L0YB 3BTJA 3WU1B 3DLLF 4BDZA 2QWWA 2B9SA 2LF7A 4JX6A 3HRUA 4V19K 3E6DA 3P9LA 3KEQA 4HQEA 1A5JA 3J81Z 4PP8C 4RGSA 1IN6A 3VXUA 4KA4A 2PMZA 3S2HJ 2KMUA 1P1ZA 3BUYA 1EEYA 4PGEA 1SANA 1A6QA 5JHDA 4CYCA 3GTJJ 2KJCA 4UUVA 1F1ZA 4CCJA 4LJZF 2QZ8A 3QOPA 1T8IA 2ZFUA 1NG7A 2GWRA 4PJXA 2E2JJ 1YIOA 5ILSA 3FFCA 3MGOA 5H94A 4S05A 1FG2A 3AG4H 1FBUA 1DE4A 5HHNA 5FLMJ 2O6GE 2DLLA 2V9VA 4PG2A 1HW5A 2IA1A 1HSAA 3CLQA 4MJ6A 3VYTB 1LE8A 5IB1A 1GHCA 4Y7NJ 2CMPA 2E71A 3VFNA 2DN0A 3ML6A 3ZCOA 4V3DB 5FKLA 3RZDJ 2XGXA 1ZHNA 3QFJA 4E7HA 3OR1C 1ZAGA 4OINF 3RTRA 2L5QA 3ZR8X 5EU4A 3HKZA 1LDDA 3RDIA 3SZPA 4NQDA 1CF7B 3S15J 2GITA 5IT3A 3VFZA 3WTWC 1HHGA 1JUSA 2HOEA 3G1MA 2QSFX 2E19A 5ICFA 3CCYA 1VQ4I 2CLRA 2R5ZB 4PGCA 3I6GA 3ILPA 2CIKA 4Q47A 1YDPA 4U1MA 2JN6A 4ETSA 4PR5A 1X3UA 2EWNA 3FHNA 1OLTA 3S3MA 2GOXB 4KIBA 2VKEA 4JRXA 1LB2A 1I3QJ 2FUG2 4CUGA 2BZTA 1VFCA 5GAHJ 3K4CA 2VJJA 2RREA 4G8XA 2K9SA 1S9HA 1VACA 2HTSA 4C3IJ 3GSRA 4BQOA 3VRIA 1Y0UA 3BJOA 3WE3A 2YPRA 4R8HA 2DI3A 4GKSA 3R0JA 4HV6A 4YEJA 4G6QA 1AKJA 4G7ZF 3MRKA 1MKMA 2K9NA 1M05A 2XAGA 4NHJA 1HCRA 2JUGA 3D5RC 3RYPA 3S93A 3LNQA 4F91B 2Z33A 3TVMA 5ED4A 1LUJB 2VT3A 4HKJA 4AUXA 4J00A 2P5WA 4EEFG 3BJAA 1TL8A 4ZDOA 4A3JJ 3ROOA 1R49A 4XMYA 2LK2A 5CVRA 4U1NA 2X4QA 5HHMA 3FQTA 3EDPA 4UV8A 1RETA 4JOMA 3ZMZA 4ABZA 3BR0A 3PO2J 2KISA 3E0JB 5C4JJ 3WGGA 1QPMA 3FBIB 1AA7A 1RJZA 4JFOA 4Q4ZF 5IB2A 2OQRA 4HYEA 2J5PA 4XKBA 1F36A 4BXUA 2JQ7A 1T1ZA 3VFUA 2X1CA 3SFIA 1P4LA 3U1KA 3FQXA 2FQ3A 2ZCWA 1FFPA 1R5HA 4KIFA 6PAXA 2V6CA 3C2BA 3S6CA 4MQ9F 4QPOA 1ZRFA 3C1DA 3VPRA 2BXYA 1VQ7I 1OF2A 2X4SA 1MBHA 4AU7A 2G0EA 1OCPA 2DA2A 3BTLA 3HSEA 3LN5A 5H2FC 4L9VA 5C0FA 4EVIA 3D0SA 1Z7LA 3M3YJ 3NEUA 3O3AA 5J47A 3BJ6A 3CF5F 2X4OA 2LBFA 3RCOA 2R7UA 4EJVA 4PJAA 4HWZA 1BL0A 3TDUC 1DUZA 1FO0H 4F92B 3HOZJ 4ZUSA 5FLXZ 5IM7A 2VBYA 3FZVA 5EG0A 2G7HA 4AIDA 4FCYA 5ICEA 3S14J 2VLLA 4XXCA 1OCZH 3E6MA 1UJ8A 4GCVA 1AGFA 3OXSA 4QTRA 2CSOA 3HOVJ 3W39A 5FO5A 2VQGA 4WO4A 1B9NA 2ZO4A 3MRMA 4MNQA 3BO8A 3MR9A 5HLTA 5FA4A 1J75A 3CVHA 2CUJA 3LAJA 4NC6A 1SD4A 2E5NA 2NS0A 5F0CA 3QUXA 3MRBA 2FX0A 2K9MA 5JHUA 1RK1A 4FX4A 1EF4A 3E5QA 4FT8A 4WX9A 4MTDA 2KP6A 2QENA 2E1OA 4PJLA 2O9LA 4K7FA 4PG9A 2A07F 2V1DA 5J3LA 2H6CA 2ZNYA 1W0TA 2H94A 2VE8A 2W24A 4RLFA 1ZT4A 3BCBA 2LY2A 2N8GA 2RDPA 2HVSA 1MJAA 2XAFA 3RWIA 2ZNZA 2QUFA 5HGBA 2GXAA 4Z77A 2ZSHB 5LBQA 2WV0A 5E6IC 3GIVA 2OBPA 4LG0A 1HYRC 3ZMTA 2QBYB 1W0VA 1ZS8A 4B48A 3KPSA 5K5RA 2L3DA 2NVTJ 1MSEC 1ETQA 2XRNA 3IXAA 2CUFA 1U9NA 4MJIA 5BS0A 4ELMA 1HHIA 1SVLA 2O8XA 1OGAA 3OL3A 4ZC3A 2VBXA 3E97A 1I1SA 1AKHB 2ADUA 1D1BA 1U78A 3I4NJ 3ABLH 5C0IA 5J6XA 2F4MB 1CQTA 4S04A 5HHOA 3JRAA 2MG4A 4WU5A 1GXQA 2ECBA 3KPNA 4DYQA 3H3VK 2JRMA 2JJ7A 2ZOLA 2X6XA 2I10A 3SXYA 5EU5A 3GSQA 3HIFA 2CUZA 2O5RA 4D7NA 3IV5A 3CCJI 1KTLA 4N4NB 2E7LE 5EEAA 2BCKA 2K3FA 3S3NA 1JHFA 2COMA 3V8LA 3GMOA 3K70D 4Y52J 5J4VA 4E70A 3C9NA 4A12A 2HOSA 3CDLA 4I02A 4WCGA 2DQRA 4GRIA 2O0YA 3OOUA 4IRGA 2LOOA 3PWLA 2KKOA 1IDYA 3F6OA 1XN7A 3BG6A 3OYHA 3FTGA 3NFNA 3GJFA 2M1BA 4BHPA 4QLCU 2BSTA 3KPOA 1WBZA 2G7UA 4CCKA 2LR8A 1J59A 1JUPA 3GMEA 1A6IA 3QFDA 4X6EA 5EO0A 1WHUA 2DYRH 5K5OA 1WBXA 2QQ8A 2XFXA 3B3IA 5E8NA 4PK4A 2Q1ZB 1JKPC 5C0EA 3CF2A 1HOCA 2FO4A 4JFDA 4BEHA 3LAPA 3FXMA 3JTGA 3RWDA 1BC7C 3ZN1A 1VQPI 1JUFA 3SCMA 1ZKGA 5FRNA 2EBIA 5J1YA 2OU2A 1O3TA 1YJ9I 4IHTA 1Z0XA 2RC4A 3KE2A 3FXRA 4XNFA 1YOVB 4LCWA 1T7ZA 1GV2A 2WAEA 3PWUA 1PP8F 2MA3A 5F27A 4NNJA 4A3MJ 3HGGA 5IP9J 1Z6TA 3UTQA 3FMQA 3WTVC 2GAUA 2W1OA 5ERIA 3OR2C 1O4XA 3S2DJ 4A93J 1BIIA 3L9RA 4D0CA 2RGVA 4C2MJ 1FSHA 5E8OA 4Z76A 5HLGA 3DP7A 5JLXA 3B6CA 1BW5A 3AREA 4JQXA 4O2FA 1G6NA 4A0XA 2BXZA 3WS3A 3ASOH 1ZR4A 4CXFA 1EKEA 3L3HA 1PUEE 1PQZA 3TO4A 1UHMA 5IT9Z 2EQRA 5DEQA 3F6VA 3UTSA 3OS0A 2BVOA 1Z05A 3V7CA 3VB2A 3CH1A 3H0DA 5BS6A 1ZAOA 5C3EJ 2MFZA 4AYBN 3VXNA 5DUKA 3ELKA 1T2KA 4Y4FA 5F1IA 2BEOA 4YG2F 2R7ZJ 3OYLA 2VABA 4IF4A 1QRYA 2R7VA 2MABA 4QWQA 2JK3A 1N59A 3SDAA 3A01A 1S29A 4XN0A 4CA0A 3DTEA 5HS8A 1R36A 4HF0A 3BTIA 1RI7A 5C09A 3M1CA 3MKYB 1ZRDA 4KISA 4N5EA 3LKPA 3AAFA 3KP3A 4F93B 1G3WA 2VJ4A 3MZYA 4M72A 2HN7A 3F8NA 4RAZA 4XORA 4R79A 4MX7A 2FRHA 4U0YA 3CMYA 2CW7A 4CH7A 2EV5A 3JCUC 4G6DA 3REWA 4L29A 2ELHA 3RWGA 1UG2A 3V7SA 1S7XA 3BH9A 2VXZA 2PO6A 3QODA 3ZQGA 2QSGX 1ZRCA 2OL3H 2L0KA 4XICA 3H9HA 3KP4A 4BBSJ 2Q8KA 1B1BA 5C08A 2XKPA 4TV7A 2PEXA 4XOPA 3W2VA 3GFMA 1YFHA 1BR2A 3ZQ7A 3FM5A 4LNRA 3TBIA 4Y2DA 3EUHC 3OV6A 1MHCA 4L9JA 3P4OA 1MBJA 3CP8A 3MV9A 1Z7UA 5HHQA 1RKWA 2X9DA 5B39A 3J80Z 2MYSA 3REOA 2A61A 1TZLA 2IP2A 3A0HC 1POGA 1B8IA 1FOYA 3ZMVA 4BYYA 4N9IA 2NS7A 5K7FA 2HR3A 3F8CA 4BY7J 3RWHA 4B44A 1O3QA 4ENMA 1K83J 1TQPA 3CP2A 5SWSA 3KEYA 2C6YA 2JA8J 1U5TA 2DPUA 1HDDC 1ETKA 2HQRA 1BM9A 2E1MC 2Z3YA 4HLYA 4WW2C 5C9JA 3BZEA 2VAAA 3TFKA 1EH6A 2CW0F 4ZH4F 4Y16A 4PFOA 5CYVA 1TMCA 2FEZA 1BJZA 3E6BA 5F08A 3RPUD 1E27A 1J5YA 2X6YA 3MRIA 4IHOA 4G59A 5CKTA 2LY1A 2ZJ2A 3UNGC 3ASNH 5IYCJ 2C7UA 3KPHA 4UQ2A 4DNCA 1KJVA 5H6RA 2CQNA 3C2HA 4ZTFA 4JFPA 3C8KA 2XPGA 1I1AA 4L9TA 1R7JA 5C0GA 3PWVA 4C30A 4LLNA 1UHSA 1W5CC 2Q2EB 4MIMA 2P7VB 3A0BC 4KYWA 3TBYA 2DMTA 1IXCA 2WAQA 3FF5A 2DO7A 2X6OA 1XGOA 1CG9A 1OCTC 3EUAA 1OYIA 3P9KA 3T0YA 1IAWA 2VC0A 3T8TA 1RUNA 1IN8A 2GQQA 3PUBA 3ABTA 2F5DA 3EUHA 2GUOA 2NVQJ 4IHWA 3SPVA 3WHBA 3PSIA 1A31A 3VFVA 3WE2A 3K0LA 4AIJA 2BY3A 4F7PA 1YHQI 4WF2A 4QIWN 2OPTA 1B9MA 1B6AA 3OYDA 1RESA 4QRPA 4DGWB 2BSSA 5MEPA 1U9OA 3IHUA 2WADA 4H0EA 2Z16A 3MEXA 2OTJI 2UWEA 4IOAF 1XSVA 1ETVA 2P4WA 3GBGA 4U88A 3TL4X 2A69F 4X6AJ 4XRSG 4RB0A 2E2IJ 2Y2ZA 4OWRB 1D8JA 5IP7J 4B43A 2QSHX 4MEYF 4BE1A 1G2HA 1FNNA 3HOSA 5B5EC 1OSZA 3VWJA 1KCGC 3K4BA 1ZG3A 2L9NA 1BI1A 2PMZN 1IF1A 1VQLI 2L7ZA 5HYJA 4BU2A 1ENHA 4MO7A 3M4OJ 2FMYA 3MWMA 4C3JJ 4JYKA 5CVJA 3ZP5A 5D8KB 4DW6A 4MEXF 3LKSA 3HTSB 2LKPA 4L9LC 3X14A 4I99C 3TIDA 1H9TA 4Y15A 4P9UA 1C16A 1ERDA 1RR8C 1WRJA 4A3KJ 3OY9A 3QYBA 1XPXA 1D1CA 5L3FA 3QWLA 4E6KG 3RQIA 4LGWA 1W7PA 5TRDA 2NX5A 1P4XA 2EV6A 2QQ9A 4M9SA 1KJ2H 2L7KA 3DKXA 3BG9A 3HUJA 1HHKA 4BGDA 2FA5A 3SDXA 1WBYA 4E4HA 3PIPF 1SFOJ 3H9QA 1ZH5A 4IPAA 1K61A 3W6VA 3DTIA 4O2EA 3T5XA 3LSRA 4BE2A 4CCLA 2R7OA 3HKZN 5EZGA 1S9WA 4AIKA 1A35A 3JRGA 1MBGA 4YIFA 5E9DA 2AK4A 1WCMJ 2FXAA 3KX2A 3PQYA 1S3JA 4UXNA 5FKMA 2VI6A 3BXNA 2ZMEC 3FT4A 1EFXA 4E7ZA 2IGKA 2NVUB 1XG1A 1DU0A 5MEOA 2B0LA 2QQAA 3FBNB 3W6KB 4AYBA 3UTTA 4BJ6C 4FHTA 2X4TA 3JTSA 1TQIA 5GPCA 1AGDA 3T1FA 3RQ4A 4CVXA 2ZBKA 4DOZA 2PJPA 4ZAKA 2FBIA 5IYBJ 1Q1VA 2MD0A 1TW2A 4II3A 3DLAA 3J7YJ 3T1BA 4GO1A 1N77A 2G9WA 3R6SA 1JKOC 2GAZA 3ROLA 3RWFA 3VH8A 5F6FA 4PRDA 1EH7A 3HGYA 1KQ0A 3HPGA 2FNPA 3NWTA 3L2VA 3RKQA 5D7IA 2V4JC 3BPVA 4NC8A 3NRVA 1ZLKA 3I59A 2KDOA 5J6HA 3M8FA 1R5GA 3B02A 1M1EB 4ESJA 1NEZA 3S1RJ 1T38A 2XVCA 3DX8A 4BE0A 2KRCA 1WH7A 2L2OA 3S32A 4Y3OA 1TT5B 3LSTA 3BP4A 2L9VA 3KP7A 3I9V2 4Y4KA 3TN0A 1LFUP 1H9GA 2DFEA 1ZREA 3R0AA 5D6FA 3VYUB 4G9FA 4OOIA 1VQKI 3DTXA 4U6XA 1R58A 2CO5A 2LP0A 5BXFA 2DFHA 1IM3A 4IJAA 4OU0A 3FT2A 1A9BA 1JGGA 4GYGA 1A1MA 4NQWB 3HPHA 3I56I 4XKCA 1FTTA 1K8DA 5LRSA 2DQLA 2K27A 1FOKA 2DDBA 3M1BA 4QRTA 3TBVA 3MN2A 2RNGA 4I0BA 4I7HA 3VSKA 1PVEA 2YS9A 4A3IJ 2XAHA 4ZTJA 1E3HA 2X4PA 3ONQA 3TP3A 3O3DA 3HG1A 3TOAA 4AC0A 1ZN2A 3LSKA 3K4NA 5DDGA 4RA2A 2LG4A 1MJBA 4XLNF 2F2EA 2IBDA 2P5EA 2JPCA 3DPUA 3JTHA 1MDMB 2OV7A 5FD5A 1KU3A 2EIJH 4JQFA 4Y4RA 2OZUA 5J1UA 4L0ZB 5B1BH 3MA7A 5DEGA 2GIZA 2LH9A 3G1LA 2DMNA 3H5AA 3KYCB 3OYKA 2BVMA 3HOTA 2BW3A 3HE7A 3I3LA 1QVTA 4NB5A 5B1AH 1K78B 1SYSA 4B1RA 1DP3A 1I6HJ 3F0CA 3F8BA 5E3NA 2F53A 4O3MA 4ZYEA 5K7ZA 1SAUA 2QM3A 4L8CA 5LGUA 5FKNA 1XSDA 4LFUA 2R7WA 5J40A 3SZGA 4RMNA 3BR3A 4U87A 2JSCA 5A2QZ 4UQ3A 2AXLA 1XX5A 1ORKA 4FQGA 4G7HF 2HOAA 2KZVA 3MRJA 5D7LA 4PRHA 4H4KC 1APLC 3GLXA 1R71A 1GUUA 4DIQA 1GZPA 3O3BA 1NK3P 3UPRA 2DT6A 5FKOA 3OOPA 3GSXA 4M9XA 4PJ8A 2V1UA 2BHZA 2IT0A 4NNXA 2ICWG 1UELB 1DDNA 3FMRA 1KBGH 4I2OA 4UV9A 3CPLA 3IRQA 3CJNA 1T0FA 3FK7A 1J09A 2DW4A 4F7CA 2EZLA 2E1NA 1U0JA 3CUQA 1E3PA 1EEZA 4M6YA 3GTPJ 4G8GA 1N75A 1YITI 1E17A 5JLWA 2V9PA 2Z1DA 4CYCB 4BHCA 2CW8A 2V1XA 1TT0A 4EQQA 3HM5A 1S7EA 2Z5UA 5D2LA 4ENKA 3F8MA 5M3MJ 5CVUA 2LREA 2CLVA 2M45A 2GIVA 5IB4A 3VFRA 2MD5A 5D5XB 3ERYA 3QYFA 1YS6A 2BY2A 4L3EA 1QZYA 3IAM2 5F1RA 4UNOA 3H5NA 4UB6C 4PV8A 3QRFF 2VL8A 3QPTA 1KQ9A 4HF1A 5FB2A 1FBQA 4JP0A 4MVBA 1LQVA 3FISA 3QQ4A 3HAEA 5BRZA 4V2GA 2BSRA 2L4AA 3E2HA 3L3DA 2IEKA 2F54A 1HC8A 2FBKA 4GYIA 3DXJF 3HHHA 1ZTRA 2WBMA 4C2TA 4IHYA 2HXOA 2PMUA 5FFXA 5E17F 1G6RH 2UUZA 3JSPA 3GZ6A 2M7AA 3P4MA 1LVKA 2F4OB 1Y6IA 3TO9A 4EM1A 2K9LA 2H27A 1RPWA 2GA1A 2HQ5A 3P5JA 4N4OB 4WXCA 2XSDC 3GMNA 1TTYA 4UVCA 3OS2A 1ZT7A 3M8JA 3BPXA 1AGBA 3K4MA 2DT5A 3DBLB 4I76A 2CQ7A 5CVVA 5MENA 4N8VA 1ZVSA 5JR3A 2HQNA 3V7RA 4A3FJ 1LEAA 3RKXA 2HYFA 1XCBA 3DKYA 3BT9A 5K7HA 5D5VB 5EUOA 4OMZA 3ZQFA 3DEEA 2WA0A 3DEUA 3QP6A 5B3SH 3WTYC 1T0MA 3ZQIA 1S8NA 2QVOA 1LDKB 3CO7C 1GVDA 1VNDA 5E8IA 2IS2A 1KYWA 3MRDA 2CQKA 1KU9A 1FFOA 2HI3A 2MLKA 4XLCA 5ENWA 3SKOA 1R22A 2VUMJ 3L00A 3MAJA 2FMLA 4BJ5C 4I6ZA 1LDPH 4JFFA 3U2RA 2UZKA 1JKRC 1XCVA 1ZG5A 1VADA 1QHGA 3H7BA 4WWKC 2W48A 3OYBA 5LLQA 2P5VA 3DF8A 4XLEA 2BOLA 1T1WA 2K9QA 1NK2P 4DBRA 3OMYA 4XM3A 4IOCF 1AGEA 2VB6A 1WWXA 1MMGA 3FX3A 1TC3C 2OJED 4FFEX 2X4NA 1S7OA 5E3OA 1BR1A 1JI8A 2GBYA 1QZZA 3F22A 2ID3A 1MNMC 2IAIA 5GSRA 1FLIA 2JVGA 3BY6A 3HOUJ 1ZELA 4L4VA 1B72A 2B7EA 4BNCA 1HKQA 4YFKF 3ECHA 3VRJA 5MERA 5DYMA 1YIJI
chains in the Genus database with same CATH topology
1V4RA 3FMSA 1USTA 4LLGF 4G94A 4A2UA 4O6JA 3GWZA 3ULQB 3WGIA 5TJJA 3J7AO 4KT5C 1G3YA 4L9NA 2V79A 5HDNA 1P4AA 1MGTA 3BROA 3WTTC 1MZBA 1TLHB 1IUYA 5EEHA 1D5VA 3FXUA 4MNUA 2P6TA 4RB1A 3WU0A 4LB5A 1XDUA 1F9NA 1FYLA 3K1MA 1QQIA 5AIQA 1A04A 4OIQF 3GUDA 2YU3A 2CWEA 2MH2A 3EYIA 1SD7A 1F5TA 4IVNA 5E8GA 1BI3A 3GX4X 2ZXJA 2PI0A 4ENJA 1RNLA 1OYYA 3J81K 2D1VA 1W5TA 5DCFA 3TKYA 1SAXA 1QBJA 4RGXA 2DPDA 1R1VA 2ETHA 2DFIA 1P2FA 1FBSA 4EJWA 2VBZA 1XSXA 3KEOA 3F23A 2LF8A 5JVTA 1B59A 3JW4A 3H3UA 1SMTA 1PDNC 4N9HA 1USSA 3Q9VA 3V8KA 4HLXA 4XLPF 3ERED 1U3EM 3HTUA 1S7AA 2IA2A 5D8LB 1YW9A 2K7LA 3V8JA 2BYVE 3EETA 1HSJA 1L3LA 4JK1X 5L3GA 2PMHA 1B4AA 2BGCA 2KJBA 2W57A 1DPUA 2L02A 1W7PD 2ESHA 2IW5A 2HZTA 4M74A 2BE5F 4BQAA 3HSRA 4CO8A 2VT2A 1REPC 1ZGAA 1DUXC 3C7JA 3F21A 4HQMA 2DAOA 3QAHA 2VC1A 5ILVA 2J5OA 4EJUA 2EFWA 4JBAA 5F64A 1ZHFA 4WK8F 1P92A 1DP7P 2HGCA 3TO6A 5BPIA 3M1EA 1XDSA 1HW1A 3L2CA 2PG4A 2LSOA 4B09A 2L4MA 2PN6A 2E7XA 2A6EF 1ZGJA 1ON1A 2RV8A 4HX4A 3CO6C 4WWCA 5FLXK 3JAMK 3RKYA 4RAYA 3HRMA 1HQCA 3K1PA 2VODA 3PQJA 1TQMA 1U5TB 1JXSA 3CDHA 2VE9A 2QQBA 3I58A 2D2WA 3O3KA 4BHBA 1JHHA 2F5EA 2XASA 1W5SA 4KMUX 2O61A 5FFZA 1D3YA 2FU4A 1PP7U 1I6XA 3V4GA 3M9AA 3GFIA 4HW0A 1L0OC 3HUGA 1LVAA 2FE3A 1K7AA 3K9TA 3NQOA 1TBXA 4MTEA 4Q5SF 3LFKA 3R4KA 3GO5A 4ESBA 2ESNA 2YSRA 1GXPA 2JT1A 4A0ZA 2XAJA 1FC3A 3FWEA 5E18F 3KP2A 4N0BA 4IRIA 5JI6A 1FYMA 2D1HA 2PFBA 1NHAA 5BMZA 4L5IA 4IHSA 4Y13A 2DBBA 3IRRA 5D4SA 2H6BA 4OIRF 2XHKA 4AIHA 2HKXA 4PGHA 3F3XA 1W7PB 3SFZA 1LEBA 1YW7A 4ESFA 1XMAA 3GW2A 1ZARA 3DFGA 3T8RA 5CJ9A 3QPHA 1UB9A 1DPRA 4CGZA 3KCCA 4P96A 2R3SA 3I54A 2GXBA 1R00A 5L3BA 3K1NA 1O3RA 3P7NA 3LWFA 4KDPA 4HDUA 3RJPA 5IT9K 3WTSC 3ZMDA 2D45A 1HXDA 2PQ8A 1FP1D 5ILUA 3I5UA 3O6BB 5E1XA 1OMIA 4G7OF 1XMKA 2MBFA 4LK0F 1HKSA 1SFXA 2XV4S 2FSWA 2HS5A 2HEOA 3SZTA 4MQVA 3IWZA 5LEKA 1HBXG 2VOPA 1TNTA 3RI4A 3BDDA 4FX0A 5D6EA 3ZMSA 3TQNA 2EV0A 4EGYA 5K1YA 4Z2YA 3EQLF 5LHGA 4P55A 1BOAA 4A6DA 2HTJA 2CG4A 3GVAA 3KETA 4HA8A 3J80K 3E5UA 1H0MA 3Q5FA 4HDVA 4HBLA 5HS7A 5DCMA 2WTEA 2FOKA 1AOYA 4LMYA 2ZMEA 1WKMA 4KN7X 1G4DA 1U2WA 5DD8A 2YX4A 3WTZA 2XKOA 2A6HF 5LGNA 3WTUC 2O03A 2JPBA 5ICCA 3M8EA 1P6RA 2IJLA 2VN2A 1O3SA 3TOBA 3DPLC 1IRFA 4EM0B 2H09A 1T98A 2W84A 3E3VA 1O7LA 1R1UA 2STWA 4UVAA 2FNAA 1CGPA 4A6EA 2R7FA 4NQWA 3RYRA 1JGSA 3L09A 1FYKA 3R60A 4HAMA 1OYWA 3DPTA 1T39A 2YR2A 1ON2A 3I0TA 2GA2A 3VOEA 1FSEA 1MDMA 1XGSA 3R61A 1SMYF 2P8TA 1K78A 3ROUA 1FY7A 4YIIA 2IRFG 4KMFA 2UXXA 4L18B 1R23A 3COAC 2ISYA 3Q9SA 2NRAC 2A68F 4Y17A 1BI0A 4XBFA 1MJ9A 2CYYA 2F5FA 2Y75A 1BJAA 2A3SA 1RUOA 4EV0A 1YTYA 3P9IA 5H20A 5JFRA 1YS7A 2DU9A 3DKWA 1WSUA 2W25A 1JE8A 5KVRA 3IKVA 5D5UB 2ZFWA 3MFKA 5DV5A 5J8FA 2NNNA 1XGMA 5HLHA 4M73A 5H6QA 3CLOA 3L9FA 4UHTA 4ENNA 3WGHA 1J7KA 3KP6A 2UWMA 2X0LA 1U6GA 2MH9A 4U0WA 1Z6RA 2IVMA 3N97A 2A5YB 1BBYA 3SQNA 5LGTA 2OZ6A 3GF2A 4GGGA 5L3CA 2E7WA 4M9ZA 4EGZA 1Z1DA 3FM3A 3EYYA 1IN7A 3CUOA 1CF7A 5CLSA 2EK5A 4EJTA 2K02A 3ABUA 1ONVA 4WXHA 3TDZC 1GVJA 1SFEA 2OAZA 1KU2A 1K6OA 4LB6B 4CHUA 3I64A 3RKWA 4MHGA 2P6SA 1FP2A 3MCZA 1BI2A 3DQVC 4R1HA 2HWVA 1TW3A 3LA7A 1T6SA 2K86A 3KZZA 2EFOA 1FPQA 2AS5F 5A2QK 3BWGA 4G9YA 1HW2A 3F72A 2XUBA 1YO5C 3H92A 2HDCA 4HOBA 2PBIA 3E6CC 1LNWA 3VODA 4LG0B 2FBHA 3TGNA 3JAMZ 2LDUA 1S6LA 3GEZA 5FD6A 4I01A 3M7GA 4XSXF 4B8XA 1OR7A 3WTXC 1J0RA 2CGPA 4U7DA 5AONA 1I27A 3BP8A 4LLLA 2M30A 3ZMUA 4HF2A 4PCQA 4EM2A 4P9FA 2ISZA 3LQRA 5BQTA 1WI9A 1IZ1A 1YLFA 2Q0OA 1ODDA 1P4WA 2EFQA 5E1ZB 5FGMA 4KNYA 1SFUA 3RPQA 1Z9CA 5D4RA 4OIOF 2RKHA 1FZPB 3PQKA 1EH8A 4RB3C 2L01A 2JTVA 3P9CA 4HX7A 3L7WA 1ULYA 2W85A 4L5JA 2DK8A 2FF4A 1IW7F 3S2WA 3GFLA 1XB4A 2ZKZA 2QBYA 5HS9A 3K69A 2EFPA 3KP5A 1LDJA 5CVIA 3W6JB 1OPCA 2EJRA 1YG2A 4HZFA 1IN5A 4MGRA 3BZ6A 3GZ5A 3CTAA 1RZ4A 4CYDA 3FHZA 2HFHA 3SHFA 3GFJA 2VOOA 4LD5A 4ZZDA 3ISPA 4YFXF 4HV5A 3LA3A 4KFCA 1O57A 2OA4A 5ICGA 3HHGA 3JSOA 2EB7A 3IWFA 3QU3A 3B73A 1QGPA 1XGNA 4YFNF 5DD4A 3IL2A 4K2EA 1MD0A 2X4HA 4P5OA 1G3SA 1HKTA 1UFMA 2JRTA 4I98B 3MQ0A 4PDKA 3HRTA 2QLZA 2Z9OA 2KRFA 4EJOA 5LRRA 2XIGA 2JZYA 3WODF 1U5TC 1AWCA 2STTA 1U8RA 4I0AA 4IXAA 5AIPA 2TDXA 4WXDA 1KGSA 1ZG1A 5L3DA 2M5WA 4KN4X 4CICA 2PLYA 2HKOA 4A0YA 4RGRA 4ZYGA 4U7BA 2EA2A 4HX8A 4AD9A 3MZHA 2R7DA 4I09A 4RGUA 2XROA 4OIPF 4KIGA 1STZA 2KIMA 2IPQX 2YX7A 5HLIA 2MC3A 3QP5A 3WG9A 3IKTA 3GXOA 4ZYDA 2F5CA 2L54A 3KLOA 1F4KA 4UVBA 1FX7A 2GXGA 3I4PA 5KK1A 3HYIA 5EEGA 2IA0A 4Q48A 1BIBA 2WC2A 3F8FA 1E2XA 2QYOA 2Y0MA 1FWZA 1ZYRF 3DV8A 2OQGA 3C18A 4RS8A 2LNBA 3U1DA 2K4JA 4LK1F 1KU7A 2M87A 3I53A 4KICA 1KYZA 4GXOA 2VONA 3KLNA 1BC8C 1LJ9A 4D0PA 2Q2EA 3N4MA 3KFWX 1SD5A 2BBYA 3OV8A 1WQ2A 1QNTA 3ECOA 1XD7A 1YYVA 1ZLJA 4M6XA 1KQ8A 3D5LA 1J9IA 3PFIA 2NYXA 2GZWA 4ASNA 2VBWA 5BOXA 3QU6A 1G3TA 3GYHX 1W4MA 2K4BA 5LHHA 1FT9A 5E1WA 4EMSA 1UCRA 1YQAA 4AVPA 1BIAA 2OD5A 3HRSA 2DK5A 1TNSA 2BV6A 4BAYA 3I59B 2UXNA 3KZYA 4M71A 3G3ZA 2RNJA 2MLGA 1SD6A 1K79A 4A5MA 1OKRA 4O5VA 1IRGA 2P5LC 2KIUA 5HDGA 4PZJA 3I71A 1J2XA 3LA2A 5DCMB 5HVQC 2ZMEB 3O2PE 3C3WA 2P5KA 3E5XA 3ZN0A 1LQ1A 1C0WA 1R1TA 5HDKA 2NAZA 1RIOH 1EV7A 3U9GA 5K5QA 2O3FA 2EFNA 2DTRA 4XRFA 3HSFA 1UHWA 5J8CA 2RQPA 4DQ2A 4PGGA 5HOOA 3K2ZA 3LQQA 1YW8A 5DUIA 2RN7A 5LEJA 1V3FA 1BN5A 1VTNC 1I1GA 3CUQC 4AWXB 4ZZLA 3ZPLA 2E1CA 2EA4A 2CFXA 1IXSB 1KA8A 1Q1HA 1O7FA 4CZZA 3CUQB 4F7ZA 2P7CB 5LHIA 3G73A 4KUMA 4XSZF 3TO7A 3IC7A 2M8EA 2ACJA 5E20A 2Y48A 4OMYA 4RB2C 1IN4A 4BH9A 3FXQA 4CDGA 2KIFA 3RPUA 5BPDA 4U0VA 3RIRA 1HSTA 2RVCA 1I5ZA 5D5WB 4IRHA 2NNYA 2HYGD 1D8KA 4A5NA 2XAQA 2WWYA 1QO0D 1Z91A 1IXRC 3VEPA 3H3ZA 3BOQA 4ON0A 4ZYHA 5L3EA 2Z99A 4L0YB 3WU1B 2QWWA 2LF7A 3HRUA 3E6DA 3KEQA 4HQEA 3J81Z 4RGSA 1IN6A 4KA4A 4UUVA 2KJCA 1F1ZA 4LJZF 2QZ8A 3QOPA 2GWRA 1YIOA 5ILSA 4S05A 1FBUA 2O6GE 2DLLA 2V9VA 1HW5A 2IA1A 1GHCA 3ML6A 2XGXA 4OINF 3RTRA 1LDDA 3RDIA 3SZPA 1CF7B 5IT3A 3VFZA 3WTWC 2HOEA 5ICFA 4Q47A 4ETSA 1X3UA 2EWNA 4KIBA 1LB2A 4G8XA 2HTSA 1Y0UA 3BJOA 3WE3A 2YPRA 4R8HA 2DI3A 3R0JA 4HV6A 4G6QA 4G7ZF 1MKMA 2XAGA 4NHJA 3RYPA 2Z33A 5ED4A 2VT3A 3BJAA 5CVRA 3EDPA 4UV8A 3ZMZA 3WGGA 1QPMA 4Q4ZF 2OQRA 4HYEA 2J5PA 4BXUA 2FQ3A 2ZCWA 1R5HA 4KIFA 6PAXA 2V6CA 4MQ9F 1ZRFA 3C1DA 3HSEA 4L9VA 4EVIA 3D0SA 3NEUA 3BJ6A 4EJVA 3TDUC 5FLXZ 2VBYA 3FZVA 2G7HA 5ICEA 3E6MA 4GCVA 2CSOA 5FO5A 1B9NA 2ZO4A 1J75A 3LAJA 1SD4A 2NS0A 5JHUA 4FX4A 3E5QA 4FT8A 4WX9A 4MTDA 2QENA 2A07F 2V1DA 2H6CA 2ZNYA 2H94A 2VE8A 2W24A 2RDPA 1MJAA 2XAFA 2ZNZA 2QUFA 5LBQA 2WV0A 2OBPA 4LG0A 3ZMTA 2QBYB 5K5RA 2L3DA 2XRNA 2O8XA 2VBXA 3E97A 1I1SA 2ADUA 1U78A 5J6XA 4S04A 1GXQA 3SXYA 3HIFA 1JHFA 2COMA 3V8LA 4E70A 4A12A 4I02A 4WCGA 2DQRA 2O0YA 4IRGA 2KKOA