2OI9A

Structure of the 2c/ld/ql9 allogeneic complex
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
175
structure length
175
Chain Sequence
GPHSMRYYETATSRRGLGEPRYTSVGYVDDKEFVRFDSDAENPRYEPQVPWMEQEGPEYWERITQVAKGQEQWFRVNLRTLLGYYNQSAGGTHTLQRMYGCDVGSDGRLLRGYEQFAYDGCDYIALNEDLRTWTAADMAAQITRRKWEQAGAAEYYRAYLEGECVEWLHRYLKNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Major Histocompatibility Complex protein
publication title How a single T cell receptor recognizes both self and foreign MHC.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 50
structure length 175
sequence length 175
ec nomenclature
pdb deposition date 2007-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 2oi9A00
1IM3A 3ARBA 3MV7A 1FFOA 4G8GA 4PJDA 3L3DA 3UTQA 1T22A 1ZAGA 3TIEA 3X14A 4Z77A 3O9WA 3QFDA 4GKSA 4NO0A 4Z78A 5JHDA 3TA3A 3KPRA 2ESVA 4IHOA 3QFJA 3HCVA 4ZUWA 5MENA 1T1WA 4U1JA 5C0AA 2OL3H 3MRJA 1BIIA 1CD1A 1A1NA 4S0UC 5E8OA 3GSWA 4L4VA 3P77A 1DUZA 3QI9A 1FG2A 3DTXA 5E8NA 1FZMA 4G9FA 5BJTA 4PV8A 3B3IA 2FIKA 1T1ZA 5HGAA 3GSXA 3T8XA 4L9LC 4N0CA 5H94A 1OGTA 4NO3A 4PV9A 3VXRA 1JHTA 3GMPA 5D2NA 2GITA 4WUUA 4PREA 3RTQA 3CPLA 2CIIA 1HSBA 1G7QA 1XZ0A 3KPPA 3SKMA 5BRZA 1A6ZA 3L9RA 4D0BA 1KBGH 1HHKA 3HLAA 3VWJA 4PJ5A 1TVBA 3MRCA 4JFFA 3O3DA 5MERA 3E6HA 3IT8D 5D7IA 3SDCA 4O2FA 2V2WA 5D7JC 3MRPA 2X4TA 4JQVA 1VACA 3O3AA 1WBXA 2X4OA 1RJYA 3MGTA 3DX7A 2AV7A 3SDXA 2NX5A 1E28A 5C0DA 3BH8A 2HN7A 2X4PA 1I1AA 1I1FA 2VLKA 5FKPA 4PJXA 1I4FA 5C08A 3UBXA 2X70A 4F7PA 4HUXA 1KTLA 3V5HA 3MRQA 3MV9A 4XXCA 3KXFA 3BGMA 1T7XA 3MRGA 5F1IA 3X12A 1JGEA 4O2EA 5F1NA 5AD0A 1SYVA 5DEGA 1XR9A 4FFEX 4D0CA 3HUJA 1B3JA 2RFXA 1P1ZA 3MGOA 4PRHA 3BW9A 2X4QA 3M17A 2ZOKA 2VAAA 1P7QA 4PJGA 2FZ3A 1WBZA 5D9SA 4U1LA 3SJVA 2DYPA 4PG9A 4WW2C 1I7TA 1S7TA 4PR5A 1T80A 3MRMA 1HSAA 4N5EA 1OGAA 1BQHA 4HV8A 3FQWA 2BNRA 3BEWA 4JQXA 3JTTA 1L8JA 4NNXA 3FQUA 3VFTA 5MEOA 4PGBA 4IIQC 1ONQA 3KYOA 4APQA 1KPRA 1QO3A 1WBYA 3SPVA 1JF1A 1KJVA 5C0IA 4PG2A 3ROLA 4PRAA 4L3CA 5C0BA 1LEKA 4NQVA 3PWNA 4PJEA 5EUOA 3KPQA 3BZFA 3T1FA 1LEGA 3P4NA 3VFOA 1EEZA 1MI5A 3QQ3A 4PJAA 4UQ2A 5HHOA 4D0DA 3GMRA 4X6CA 5EO0A 5FA3A 3TBTA 1JE6A 2CLVA 5IB4A 3TPUE 1FFNA 3LKNA 3NFNA 3RWDA 3KYNA 3TIDA 4G9DA 3QUYA 4JRXA 4U6XA 3DMMA 3WLBA 1GZQA 1VGKA 5HHNA 3SDDA 4PRBA 5F7DA 3FOLA 3O4LA 5INDA 2BVQA 3BUYA 5ENWA 1TMCA 4L8SC 4PGDA 3VFMA 4NQDA 3OX8A 5D2LA 4QRSA 2WY3A 1T7VA 3QDMA 3GSRA 3MA7A 5J1AA 4CVZA 1KPUA 5EU6A 5C9JA 3GSNH 4G59A 5D7LA 5MEQA 4NO5A 4MJ5A 3MRKA 1A9EA 4LCYA 4X6EA 3FQTA 5FDWA 3WS6A 4LNRA 1CE6A 1G7PA 1UQSA 5F9JA 3VXOA 5C0FA 2CKBH 2X4RA 3JTCA 3VH8A 2F54A 1N5AA 3LN4A 3FQNA 3MROA 4PRDA 3QULA 4PGCA 5IVXA 3BP4A 2X4NA 2Q7YA 3CC5A 3GSVA 4L4TA 3TO4A 2AXFA 4LCCC 4NQXA 2E7LE 4ELMA 1JPGA 3PWJA 5L2JA 3KPSA 4K71B 5EOTA 3S6CA 2VE6A 4LHUA 1LQVA 3QUXA 3AM8A 1B0GA 3FOMA 3LN5A 3E2HA 4QRPA 1QVOA 1QSFA 3ES6A 4N8VA 1ZHKA 4X6DA 4JFDA 5SWZA 1S7VA 4U1HA 1HYRC 1S7SA 1ZSDA 4PJIA 2ZSWA 4L8BA 3BHBA 1ZT4A 4L3EA 1A1OA 3ARDA 4WU5A 3P73A 1GZPA 1LDPH 1UXSA 1HHGA 3VFPA 3MV8A 1LK2A 3B6SA 1QEWA 1KPVA 3FTGA 1K8DA 1AGDA 2F74A 1CG9A 5EU4A 1S7UA 3MRLA 3O3BA 3PQYA 4MJ6A 4PRIA 1DE4A 5GSRA 1VADA 3ARFA 4HUWA 5L2KA 2AKRA 3GMLA 2VLJA 3QUKA 5ISZA 2FO4A 1T21A 1ZS8A 1JPFA 2C7UA 3ECBA 2P5WA 1S7WA 3L3GA 3LKRA 4PJFA 5EU3A 4WU7A 4V3EB 3TBYA 3KWWA 1T20A 2GJ6A 4G8IA 5IB5A 1AGEA 4PJBA 3RWGA 3CVHA 5FA4A 1YDPA 3KPOA 4JFOA 4HUVA 3FRUA 4Y4KA 3VFVA 3MYJA 3GMOA 4MVBA 3RL1A 5DEFA 4N0FA 1INQA 1YN6A 2BCKA 4WO4A 1HOCA 5D5MA 4PJ7A 3TVMA 1KJ2H 4QRTA 2CIKA 5E8PA 4Y4FA 1NAMH 3GJFA 3OXSA 3HE7A 2XFXA 1XR8A 5C0JA 3MRIA 3VXMA 3W39A 3C9NA 1T0MA 3O3EA 2OI9A 1ZVSA 1FZJA 1C16A 3RL2A 3D2UA 1ZHLA 1I7RA 1UXWA 2AXGA 3LV3A 2VLRA 4PRNA 1EXUA 3GSQA 3QDGA 1T1XA 4CW1A 5E6IC 1JFMA 4PRPA 4U1MA 1S9YA 1KCGC 5J6HA 1MHEA 4Y2DA 1RJZA 4Y16A 1DUYA 2AK4A 5J6GA 3RWEA 1M05A 1S8DA 1KJ3H 1T1YA 4ONOA 4ZUSA 4FTVA 3WS3A 3VXSA 1G6RH 4NNYA 1I1YA 4MS8A 5BS0A 4ZUVA 4HS3A 1QRNA 3CZFA 5HGBA 5IM7A 3I6KA 5C09A 2A83A 3TF7A 3W0WA 1AGFA 4WJ5A 5C07A 1S7XA 4PJ9A 5HHMA 3PWPA 1FO0H 1FFPA 4O2CA 3FQRA 3FFCA 4U1SA 5ACZA 1TVHA 4U6YA 1FZOA 1T7YA 4G43A 3AU1A 3QUZA 4PJCA 3BH9A 3GMQA 3VCLA 4N0UA 4EI5A 3L3JA 3JVGA 4WDIA 3O8XA 4Y4HA 2ZSVA 4JFEA 3VXNA 1ZT1A 5C0CA 3RWJA 5IB1A 3SKOA 1K5NA 5IROA 3TBVA 1RK1A 3CDGA 3BXNA 4MQ7A 2YPKA 4NT6A 4UQ3A 1AKJA 3UPRA 3I6LD 3C8KA 2GUOA 2X4SA 1KJMA 3X11A 2YPLA 3VWKA 4QRRA 1YPZA 4X6FA 1JGDA 2PO6A 1LD9A 1T7ZA 3BEVA 3KLAA 4I4WA 2HJKA 4NO2A 2NW3A 1X7QA 4L8DA 2PYEA 3TJHA 3U0PA 3HG1A 3PWVA 2VABA 1Z5LA 4QRQA 3V5DA 3SDAA 3DBXA 3HE6A 3VFSA 3TZVC 3BZEA 2H6PA 3MRDA 5C0GA 3PWLA 4I48A 5HHQA 3UTTA 2GTWA 3AREA 3DX6A 4K7FA 3ROOA 1ED3A 1Q94A 4JFPA 1HHJA 2FWOA 4PP8C 1PQZA 3G08A 1M6OA 1ZHBA 3MRFA 2ZOLA 5HHPA 5SWSA 1MHCA 3LKOA 3HAEA 3LKSA 3RUGA 5BXFA 4F7MA 1OSZA 1QQDA 3QDJA 3E6FA 3WL9A 3HPJA 1R3HA 3TO2A 1MWAH 5EO1A 1IM9A 2BNQA 1QR1A 2UWEA 4GUPA 2XPGA 2P5EA 4E5XA 1EFXA 4NSKA 3KPNA 1OF2A 3QEQA 3SCMA 3TBWA 4ZAKA 1S9WA 4F7EA 5SWQA 4CVXA 4IRSA 1U58A 3VFRA 3RGVC 3FT2A 3ERYA 3GIVA 3VFNA 3FT4A 3JTSA 4HUUA 3H7BA 1NEZA 3MRNA 3FQXA 3VRJA 2D31A 2HJLA 3QQ4A 1B0RA 4MJIA 3I6GA 1N59A 4MNGA 3D18A 4HX1A 4MXQA 1S9XA 3H9SA 3VFUA 4HWZA 4NHUE 3WUWA 4NQEA 3TFKA 1S7QA 1FZKA 3ILQC 1T0NA 5IEHA 3RZCA 3RWFA 2JCCA 3MRHA 1E27A 1DDHA 3GSOA 4GKNA 3V5KA 4Z76A 4HKJA 3TN0A 2BSSA 3VXUA 1LP9A 4WWKC 4V3DB 4ZFZA 2GAZA 1T7WA 3PWUA 2F53A 3P4MA 3UTSA 3X13A 4EN3C 5INCA 1A1MA 5IB3A 3MRRA 3ILPA 5EFIA 3BWAA 5B39A 3MR9A 3QZWA 4ZUTA 4JFQA 4ZUUA 1XH3A 3MREA 3VRIA 3M1BA 2MHAA 1I7UA 3LKQA 3VJ6A 3REWA 1HHIA 4G42A 5DDHA 3BP7A 1ZT7A 4E0RA 2AV1A 2HLAA 2CLZA 3LKPA 5E9DA 3DXAA 4PJ8A 4F7CA 1NANH 4F7TA 4L8CA 1BD2A 3IXAA 1EEYA 3CH1A 4QOKA 3D25A 4MNQA 4L29A 4LCWA 4NQCA 4EUPA 1W72A 2BVPA 4U1KA 3VFWA 4MX7A 3D3VA 1N3NA 1AGBA 3ARGA 5HYJA 3KPLA 1W0WA 3P9LA 3L3KA 1RK0A 3FONA 1W0VA 3GMNA 5B38A 4PJHA 3CCHA 4QRUA 2X4UA 5HGDA 5HGHA 1P4LA 3H9HA 1SYSA 3RWCA 3VXPA 1A9BA 3GMMA 3P9MA 3KPMA 1QSEA 3MRBA 2BVOA 2VLLA 2YEZA 3PABA 4IRJA 5E00A 5EU5A 1QLFA 2GT9A 1S7RA 4PDCE 4U1IA 3D39A 1AGCA 3RWHA 2J8UA 1ZHNA 3TBSA 2FYYA 2V2XA 3RWIA 2GTZA 1HHHA 3L3IA 1N2RA 2H26A 5MEPA 2BSTA 3E3QA 5C0EA 1AO7A 3OV6A 3FT3A 1YN7A 5IEKA 3BO8A 3GSUA 3L3HA 1BZ9A 4U1NA 5IB2A 2BSRA 3BVNA 3P4OA 5GSVA 3OXRA 2CLRA 4JRYA 4PGEA 3DX8A 1JUFA
chains in the Genus database with same CATH superfamily
1IM3A 3ARBA 3MV7A 1FFOA 4G8GA 4PJDA 3L3DA 3UTQA 1T22A 1ZAGA 3TIEA 3X14A 4Z77A 3O9WA 3QFDA 4GKSA 4NO0A 4Z78A 5JHDA 3TA3A 3KPRA 2ESVA 4IHOA 3QFJA 3HCVA 4ZUWA 5MENA 1T1WA 4U1JA 5C0AA 2OL3H 3MRJA 1BIIA 1CD1A 1A1NA 4S0UC 5E8OA 3GSWA 4L4VA 3P77A 1DUZA 3QI9A 1FG2A 3DTXA 5E8NA 1FZMA 4G9FA 5BJTA 4BKWA 4PV8A 3B3IA 2FIKA 1T1ZA 5HGAA 3GSXA 3T8XA 4L9LC 4N0CA 5H94A 1OGTA 4NO3A 4PV9A 3VXRA 1JHTA 3GMPA 5D2NA 2GITA 4WUUA 4PREA 3RTQA 3CPLA 2CIIA 1HSBA 1G7QA 1XZ0A 3KPPA 3SKMA 2NYKA 5BRZA 1A6ZA 3L9RA 4D0BA 1KBGH 1HHKA 3HLAA 3VWJA 4PJ5A 1TVBA 3MRCA 4JFFA 3O3DA 5MERA 3E6HA 3IT8D 5D7IA 3SDCA 4O2FA 2V2WA 5D7JC 3MRPA 2X4TA 4JQVA 1VACA 3O3AA 1WBXA 2X4OA 1RJYA 3MGTA 3DX7A 2AV7A 3SDXA 2NX5A 1E28A 5C0DA 3BH8A 2HN7A 2X4PA 1I1AA 1I1FA 2VLKA 5FKPA 4PJXA 1I4FA 5C08A 3UBXA 2X70A 4F7PA 4HUXA 1KTLA 3V5HA 3MRQA 3MV9A 4XXCA 3KXFA 3BGMA 1T7XA 3MRGA 5F1IA 3X12A 1JGEA 4O2EA 5F1NA 5AD0A 1SYVA 5DEGA 1XR9A 4FFEX 4D0CA 3HUJA 1B3JA 2RFXA 1P1ZA 3MGOA 4PRHA 3BW9A 2X4QA 3M17A 2ZOKA 2VAAA 1P7QA 4PJGA 2FZ3A 1WBZA 5D9SA 4U1LA 3SJVA 2DYPA 4PG9A 4WW2C 1I7TA 1S7TA 4PR5A 1T80A 3MRMA 1HSAA 4N5EA 1OGAA 1BQHA 4HV8A 3FQWA 2BNRA 3BEWA 4JQXA 3JTTA 1L8JA 4NNXA 3FQUA 3VFTA 5MEOA 4PGBA 4IIQC 1ONQA 3KYOA 4APQA 1KPRA 1QO3A 1WBYA 3SPVA 1JF1A 1KJVA 5C0IA 4PG2A 3ROLA 4PRAA 4L3CA 5C0BA 1LEKA 4NQVA 3PWNA 4PJEA 5EUOA 3KPQA 3BZFA 3T1FA 1LEGA 3P4NA 3VFOA 1EEZA 1MI5A 3QQ3A 4PJAA 4UQ2A 5HHOA 4D0DA 3GMRA 4X6CA 5EO0A 5FA3A 3TBTA 1JE6A 2CLVA 5IB4A 3TPUE 1FFNA 3LKNA 3NFNA 3RWDA 3KYNA 3TIDA 4G9DA 3QUYA 4JRXA 4U6XA 3DMMA 3WLBA 1GZQA 1VGKA 5HHNA 3SDDA 4PRBA 5F7DA 3FOLA 3O4LA 5INDA 2BVQA 3BUYA 5ENWA 1TMCA 4L8SC 4PGDA 3VFMA 4NQDA 3OX8A 5D2LA 4QRSA 2WY3A 1T7VA 3QDMA 3GSRA 3MA7A 5J1AA 4CVZA 1KPUA 5EU6A 5C9JA 3GSNH 4G59A 5D7LA 5MEQA 4NO5A 4MJ5A 3MRKA 1A9EA 4LCYA 4X6EA 3FQTA 5FDWA 3WS6A 4LNRA 1CE6A 1G7PA 1UQSA 5F9JA 3VXOA 5C0FA 2CKBH 2X4RA 3JTCA 3VH8A 2F54A 1N5AA 3LN4A 3FQNA 3MROA 4PRDA 3QULA 4PGCA 5IVXA 3BP4A 2X4NA 2Q7YA 3CC5A 3GSVA 4L4TA 3TO4A 2AXFA 4LCCC 4NQXA 2E7LE 4ELMA 1JPGA 3PWJA 5L2JA 3KPSA 4K71B 5EOTA 3S6CA 2VE6A 4LHUA 1LQVA 3QUXA 3AM8A 1B0GA 3FOMA 3LN5A 3E2HA 4QRPA 1QVOA 1QSFA 3ES6A 4N8VA 1ZHKA 4X6DA 4JFDA 5SWZA 1S7VA 4U1HA 1HYRC 1S7SA 1ZSDA 4PJIA 2ZSWA 4L8BA 3BHBA 1ZT4A 4L3EA 1A1OA 3ARDA 4WU5A 3P73A 1GZPA 1LDPH 1UXSA 1HHGA 3VFPA 3MV8A 1LK2A 3B6SA 1QEWA 3I0TA 1KPVA 3FTGA 1K8DA 1AGDA 2F74A 1CG9A 5EU4A 1S7UA 3MRLA 3O3BA 3PQYA 4MJ6A 4PRIA 1DE4A 5GSRA 1VADA 3ARFA 4HUWA 5L2KA 2AKRA 3GMLA 2VLJA 3QUKA 5ISZA 2FO4A 1T21A 1ZS8A 1JPFA 2C7UA 3ECBA 2P5WA 1S7WA 3L3GA 3LKRA 4PJFA 5EU3A 4WU7A 4V3EB 3TBYA 3KWWA 1T20A 2GJ6A 4G8IA 5IB5A 1AGEA 4PJBA 3RWGA 3CVHA 5FA4A 1YDPA 3KPOA 4JFOA 4HUVA 3FRUA 4Y4KA 3VFVA 3MYJA 3GMOA 4MVBA 3RL1A 5DEFA 4N0FA 1INQA 1YN6A 2BCKA 4WO4A 1HOCA 5D5MA 4PJ7A 3TVMA 1KJ2H 4QRTA 2CIKA 5E8PA 4Y4FA 1NAMH 3GJFA 3OXSA 3HE7A 2XFXA 1XR8A 5C0JA 3MRIA 3VXMA 3W39A 3C9NA 1T0MA 3O3EA 2OI9A 1ZVSA 1FZJA 1C16A 3RL2A 3D2UA 1ZHLA 1I7RA 1UXWA 2AXGA 3LV3A 2VLRA 4PRNA 1EXUA 3GSQA 3QDGA 1T1XA 4CW1A 5E6IC 1JFMA 4PRPA 4U1MA 1S9YA 1KCGC 5J6HA 1MHEA 4Y2DA 1RJZA 4Y16A 1DUYA 2AK4A 5J6GA 3RWEA 1M05A 1S8DA 1KJ3H 1T1YA 4ONOA 4ZUSA 4FTVA 3WS3A 3VXSA 1G6RH 4NNYA 1I1YA 4MS8A 5BS0A 4ZUVA 4HS3A 1QRNA 3CZFA 5HGBA 5IM7A 3I6KA 5C09A 2A83A 3TF7A 3W0WA 1AGFA 4WJ5A 5C07A 1S7XA 4PJ9A 5HHMA 3PWPA 2O5NA 1FO0H 1FFPA 4O2CA 3FQRA 3FFCA 4U1SA 5ACZA 1TVHA 4U6YA 1FZOA 1T7YA 4G43A 3AU1A 3QUZA 4PJCA 3BH9A 3GMQA 3VCLA 4N0UA 4EI5A 3L3JA 3JVGA 4WDIA 3O8XA 4JO8A 4Y4HA 2ZSVA 4JFEA 3VXNA 1ZT1A 5C0CA 3RWJA 5IB1A 3SKOA 1K5NA 5IROA 3TBVA 1RK1A 3CDGA 3BXNA 4MQ7A 2YPKA 4NT6A 4UQ3A 1AKJA 3UPRA 3I6LD 3C8KA 2GUOA 2X4SA 1KJMA 3X11A 2YPLA 3VWKA 4QRRA 1YPZA 4X6FA 1JGDA 2PO6A 1LD9A 1T7ZA 3BEVA 3KLAA 4I4WA 2HJKA 4NO2A 2NW3A 1X7QA 4L8DA 2PYEA 3TJHA 3U0PA 3HG1A 3PWVA 2VABA 1Z5LA 4QRQA 3V5DA 3SDAA 3DBXA 3HE6A 3VFSA 3TZVC 3BZEA 2H6PA 3MRDA 5C0GA 3PWLA 4I48A 5HHQA 3UTTA 2GTWA 3AREA 3DX6A 4K7FA 3ROOA 1ED3A 1Q94A 4JFPA 1HHJA 2FWOA 4PP8C 1PQZA 3G08A 1M6OA 1ZHBA 3MRFA 2ZOLA 5HHPA 5SWSA 1MHCA 3LKOA 3HAEA 3LKSA 3RUGA 5BXFA 4F7MA 1OSZA 1QQDA 3QDJA 3E6FA 3WL9A 3HPJA 1R3HA 3TO2A 1MWAH 5EO1A 1IM9A 2BNQA 1QR1A 2UWEA 4GUPA 2XPGA 2P5EA 4E5XA 1EFXA 4NSKA 3KPNA 1OF2A 3QEQA 3SCMA 3TBWA 4ZAKA 1S9WA 4F7EA 5SWQA 4CVXA 4IRSA 1U58A 3VFRA 3RGVC 3FT2A 3ERYA 3GIVA 3VFNA 3FT4A 3JTSA 4HUUA 3H7BA 1NEZA 3MRNA 3FQXA 3VRJA 2D31A 2HJLA 3QQ4A 1B0RA 4MJIA 4G59C 3I6GA 1N59A 4MNGA 3D18A 4HX1A 4MXQA 1S9XA 3H9SA 3VFUA 4HWZA 4NHUE 3WUWA 4NQEA 3TFKA 1S7QA 1FZKA 3ILQC 1T0NA 5IEHA 3RZCA 3RWFA 2JCCA 3MRHA 1E27A 1DDHA 3GSOA 4GKNA 3V5KA 4Z76A 4HKJA 3TN0A 2BSSA 3VXUA 1LP9A 4WWKC 4V3DB 4ZFZA 2GAZA 1T7WA 3PWUA 2F53A 3P4MA 3UTSA 3X13A 4EN3C 5INCA 1A1MA 5IB3A 3MRRA 3ILPA 5EFIA 3BWAA 5B39A 3MR9A 3QZWA 4ZUTA 4JFQA 4ZUUA 1XH3A 3MREA 3VRIA 3M1BA 2MHAA 1I7UA 3LKQA 3VJ6A 3REWA 1HHIA 4G42A 5DDHA 3BP7A 1ZT7A 4E0RA 2AV1A 2HLAA 2IA1A 2CLZA 3LKPA 5E9DA 3DXAA 4PJ8A 4F7CA 1NANH 4F7TA 4L8CA 1BD2A 3IXAA 1EEYA 3CH1A 4QOKA 3D25A 4MNQA 4L29A 4LCWA 4NQCA 4EUPA 1W72A 2BVPA 4U1KA 3VFWA 4MX7A 3D3VA 1N3NA 1AGBA 3ARGA 5HYJA 3KPLA 1W0WA 3P9LA 3L3KA 1RK0A 3FONA 1W0VA 3GMNA 5B38A 4PJHA 3CCHA 4QRUA 2X4UA 5HGDA 5HGHA 1P4LA 3H9HA 1SYSA 3RWCA 3VXPA 1A9BA 3GMMA 3P9MA 3KPMA 1QSEA 3MRBA 2BVOA 2VLLA 2YEZA 3PABA 4IRJA 5E00A 5EU5A 1QLFA 2GT9A 1S7RA 4PDCE 4U1IA 3D39A 1AGCA 3RWHA 2J8UA 1ZHNA 3TBSA 2FYYA 2V2XA 3RWIA 2GTZA 1HHHA 3L3IA 1N2RA 2H26A 5MEPA 2BSTA 3E3QA 5C0EA 1AO7A 3OV6A 3FT3A 1YN7A 5IEKA 3BO8A 3GSUA 3L3HA 1BZ9A 4U1NA 5IB2A 2BSRA 3BVNA 3P4OA 5GSVA 3OXRA 2CLRA 4JRYA 4PGEA 3DX8A 1JUFA
chains in the Genus database with same CATH topology
1IM3A 3ARBA 3MV7A 1FFOA 4G8GA 4PJDA 3L3DA 3UTQA 1T22A 1ZAGA 3TIEA 3X14A 4Z77A 3O9WA 3QFDA 4GKSA 4NO0A 4Z78A 5JHDA 3TA3A 3KPRA 2ESVA 4IHOA 3QFJA 3HCVA 4ZUWA 5MENA 1T1WA 4U1JA 5C0AA 2OL3H 3MRJA 1BIIA 1CD1A 1A1NA 4S0UC 5E8OA 3GSWA 4L4VA 3P77A 1DUZA 3QI9A 1FG2A 3DTXA 5E8NA 1FZMA 4G9FA 5BJTA 4PV8A 3B3IA 2FIKA 1T1ZA 5HGAA 3GSXA 3T8XA 4L9LC 4N0CA 5H94A 1OGTA 4NO3A 4PV9A 3VXRA 1JHTA 3GMPA 5D2NA 2GITA 4WUUA 4PREA 3RTQA 3CPLA 2CIIA 1HSBA 1G7QA 1XZ0A 3KPPA 3SKMA 5BRZA 1A6ZA 3L9RA 4D0BA 1KBGH 1HHKA 3HLAA 3VWJA 4PJ5A 1TVBA 3MRCA 4JFFA 3O3DA 5MERA 3E6HA 3IT8D 5D7IA 3SDCA 4O2FA 2V2WA 5D7JC 3MRPA 2X4TA 4JQVA 1VACA 3O3AA 1WBXA 2X4OA 1RJYA 3MGTA 3DX7A 2AV7A 3SDXA 2NX5A 1E28A 5C0DA 3BH8A 2HN7A 2X4PA 1I1AA 1I1FA 2VLKA 5FKPA 4PJXA 1I4FA 5C08A 3UBXA 2X70A 4F7PA 4HUXA 1KTLA 3V5HA 3MRQA 3MV9A 4XXCA 3KXFA 3BGMA 1T7XA 3MRGA 5F1IA 3X12A 1JGEA 4O2EA 5F1NA 5AD0A 1SYVA 5DEGA 1XR9A 4FFEX 4D0CA 3HUJA 1B3JA 2RFXA 1P1ZA 3MGOA 4PRHA 3BW9A 2X4QA 3M17A 2ZOKA 2VAAA 1P7QA 4PJGA 2FZ3A 1WBZA 5D9SA 4U1LA 3SJVA 2DYPA 4PG9A 4WW2C 1I7TA 1S7TA 4PR5A 1T80A 3MRMA 1HSAA 4N5EA 1OGAA 1BQHA 4HV8A 3FQWA 2BNRA 3BEWA 4JQXA 3JTTA 1L8JA 4NNXA 3FQUA 3VFTA 5MEOA 4PGBA 4IIQC 1ONQA 3KYOA 4APQA 1KPRA 1QO3A 1WBYA 3SPVA 1JF1A 1KJVA 5C0IA 4PG2A 3ROLA 4PRAA 4L3CA 5C0BA 1LEKA 4NQVA 3PWNA 4PJEA 5EUOA 3KPQA 3BZFA 3T1FA 1LEGA 3P4NA 3VFOA 1EEZA 1MI5A 3QQ3A 4PJAA 4UQ2A 5HHOA 4D0DA 3GMRA 4X6CA 5EO0A 5FA3A 3TBTA 1JE6A 2CLVA 5IB4A 3TPUE 1FFNA 3LKNA 3NFNA 3RWDA 3KYNA 3TIDA 4G9DA 3QUYA 4JRXA 4U6XA 3DMMA 3WLBA 1GZQA 1VGKA 5HHNA 3SDDA 4PRBA 5F7DA 3FOLA 3O4LA 5INDA 2BVQA 3BUYA 5ENWA 1TMCA 4L8SC 4PGDA 3VFMA 4NQDA 3OX8A 5D2LA 4QRSA 2WY3A 1T7VA 3QDMA 3GSRA 3MA7A 5J1AA 4CVZA 1KPUA 5EU6A 5C9JA 3GSNH 4G59A 5D7LA 5MEQA 4NO5A 4MJ5A 3MRKA 1A9EA 4LCYA 4X6EA 3FQTA 5FDWA 3WS6A 4LNRA 1CE6A 1G7PA 1UQSA 5F9JA 3VXOA 5C0FA 2CKBH 2X4RA 3JTCA 3VH8A 2F54A 1N5AA 3LN4A 3FQNA 3MROA 4PRDA 3QULA 4PGCA 5IVXA 3BP4A 2X4NA 2Q7YA 3CC5A 3GSVA 4L4TA 3TO4A 2AXFA 4LCCC 4NQXA 2E7LE 4ELMA 1JPGA 3PWJA 5L2JA 3KPSA 4K71B 5EOTA 3S6CA 2VE6A 4LHUA 1LQVA 3QUXA 3AM8A 1B0GA 3FOMA 3LN5A 3E2HA 4QRPA 1QVOA 1QSFA 3ES6A 4N8VA 1ZHKA 4X6DA 4JFDA 5SWZA 1S7VA 4U1HA 1HYRC 1S7SA 1ZSDA 4PJIA 2ZSWA 4L8BA 3BHBA 1ZT4A 4L3EA 1A1OA 3ARDA 4WU5A 3P73A 1GZPA 1LDPH 1UXSA 1HHGA 3VFPA 3MV8A 1LK2A 3B6SA 1QEWA 1KPVA 3FTGA 1K8DA 1AGDA 2F74A 1CG9A 5EU4A 1S7UA 3MRLA 3O3BA 3PQYA 4MJ6A 4PRIA 1DE4A 5GSRA 1VADA 3ARFA 4HUWA 5L2KA 2AKRA 3GMLA 2VLJA 3QUKA 5ISZA 2FO4A 1T21A 1ZS8A 1JPFA 2C7UA 3ECBA 2P5WA 1S7WA 3L3GA 3LKRA 4PJFA 5EU3A 4WU7A 4V3EB 3TBYA 3KWWA 1T20A 2GJ6A 4G8IA 5IB5A 1AGEA 4PJBA 3RWGA 3CVHA 5FA4A 1YDPA 3KPOA 4JFOA 4HUVA 3FRUA 4Y4KA 3VFVA 3MYJA 3GMOA 4MVBA 3RL1A 5DEFA 4N0FA 1INQA 1YN6A 2BCKA 4WO4A 1HOCA 5D5MA 4PJ7A 3TVMA 1KJ2H 4QRTA 2CIKA 5E8PA 4Y4FA 1NAMH 3GJFA 3OXSA 3HE7A 2XFXA 1XR8A 5C0JA 3MRIA 3VXMA 3W39A 3C9NA 1T0MA 3O3EA 2OI9A 1ZVSA 1FZJA 1C16A 3RL2A 3D2UA 1ZHLA 1I7RA 1UXWA 2AXGA 3LV3A 2VLRA 4PRNA 1EXUA 3GSQA 3QDGA 1T1XA 4CW1A 5E6IC 1JFMA 4PRPA 4U1MA 1S9YA 1KCGC 5J6HA 1MHEA 4Y2DA 1RJZA 4Y16A 1DUYA 2AK4A 5J6GA 3RWEA 1M05A 1S8DA 1KJ3H 1T1YA 4ONOA 4ZUSA 4FTVA 3WS3A 3VXSA 1G6RH 4NNYA 1I1YA 4MS8A 5BS0A 4ZUVA 4HS3A 1QRNA 3CZFA 5HGBA 5IM7A 3I6KA 5C09A 2A83A 3TF7A 3W0WA 1AGFA 4WJ5A 5C07A 1S7XA 4PJ9A 5HHMA 3PWPA 1FO0H 1FFPA 4O2CA 3FQRA 3FFCA 4U1SA 5ACZA 1TVHA 4U6YA 1FZOA 1T7YA 4G43A 3AU1A 3QUZA 4PJCA 3BH9A 3GMQA 3VCLA 4N0UA 4EI5A 3L3JA 3JVGA 4WDIA 3O8XA 4Y4HA 2ZSVA 4JFEA 3VXNA 1ZT1A 5C0CA 3RWJA 5IB1A 3SKOA 1K5NA 5IROA 3TBVA 1RK1A 3CDGA 3BXNA 4MQ7A 2YPKA 4NT6A 4UQ3A 1AKJA 3UPRA 3I6LD 3C8KA 2GUOA 2X4SA 1KJMA 3X11A 2YPLA 3VWKA 4QRRA 1YPZA 4X6FA 1JGDA 2PO6A 1LD9A 1T7ZA 3BEVA 3KLAA 4I4WA 2HJKA 4NO2A 2NW3A 1X7QA 4L8DA 2PYEA 3TJHA 3U0PA 3HG1A 3PWVA 2VABA 1Z5LA 4QRQA 3V5DA 3SDAA 3DBXA 3HE6A 3VFSA 3TZVC 3BZEA 2H6PA 3MRDA 5C0GA 3PWLA 4I48A 5HHQA 3UTTA 2GTWA 3AREA 3DX6A 4K7FA 3ROOA 1ED3A 1Q94A 4JFPA 1HHJA 2FWOA 4PP8C 1PQZA 3G08A 1M6OA 1ZHBA 3MRFA 2ZOLA 5HHPA 5SWSA 1MHCA 3LKOA 3HAEA 3LKSA 3RUGA 5BXFA 4F7MA 1OSZA 1QQDA 3QDJA 3E6FA 3WL9A 3HPJA 1R3HA 3TO2A 1MWAH 5EO1A 1IM9A 2BNQA 1QR1A 2UWEA 4GUPA 2XPGA 2P5EA 4E5XA 1EFXA 4NSKA 3KPNA 1OF2A 3QEQA 3SCMA 3TBWA 4ZAKA 1S9WA 4F7EA 5SWQA 4CVXA 4IRSA 1U58A 3VFRA 3RGVC 3FT2A 3ERYA 3GIVA 3VFNA 3FT4A 3JTSA 4HUUA 3H7BA 1NEZA 3MRNA 3FQXA 3VRJA 2D31A 2HJLA 3QQ4A 1B0RA 4MJIA 3I6GA 1N59A 4MNGA 3D18A 4HX1A 4MXQA 1S9XA 3H9SA 3VFUA 4HWZA 4NHUE 3WUWA 4NQEA 3TFKA 1S7QA 1FZKA 3ILQC 1T0NA 5IEHA 3RZCA 3RWFA 2JCCA 3MRHA 1E27A 1DDHA 3GSOA 4GKNA 3V5KA 4Z76A 4HKJA 3TN0A 2BSSA 3VXUA 1LP9A 4WWKC 4V3DB 4ZFZA 2GAZA 1T7WA 3PWUA 2F53A 3P4MA 3UTSA 3X13A 4EN3C 5INCA 1A1MA 5IB3A 3MRRA 3ILPA 5EFIA 3BWAA 5B39A 3MR9A 3QZWA 4ZUTA 4JFQA 4ZUUA 1XH3A 3MREA 3VRIA 3M1BA 2MHAA 1I7UA 3LKQA 3VJ6A 3REWA 1HHIA 4G42A 5DDHA 3BP7A 1ZT7A 4E0RA 2AV1A 2HLAA 2CLZA 3LKPA 5E9DA 3DXAA 4PJ8A 4F7CA 1NANH 4F7TA 4L8CA 1BD2A 3IXAA 1EEYA 3CH1A 4QOKA 3D25A 4MNQA 4L29A 4LCWA 4NQCA 4EUPA 1W72A 2BVPA 4U1KA 3VFWA 4MX7A 3D3VA 1N3NA 1AGBA 3ARGA 5HYJA 3KPLA 1W0WA 3P9LA 3L3KA 1RK0A 3FONA 1W0VA 3GMNA 5B38A 4PJHA 3CCHA 4QRUA 2X4UA 5HGDA 5HGHA 1P4LA 3H9HA 1SYSA 3RWCA 3VXPA 1A9BA 3GMMA 3P9MA 3KPMA 1QSEA 3MRBA 2BVOA 2VLLA 2YEZA 3PABA 4IRJA 5E00A 5EU5A 1QLFA 2GT9A 1S7RA 4PDCE 4U1IA 3D39A 1AGCA 3RWHA 2J8UA 1ZHNA 3TBSA 2FYYA 2V2XA 3RWIA 2GTZA 1HHHA 3L3IA 1N2RA 2H26A 5MEPA 2BSTA 3E3QA 5C0EA 1AO7A 3OV6A 3FT3A 1YN7A 5IEKA 3BO8A 3GSUA 3L3HA 1BZ9A 4U1NA 5IB2A 2BSRA 3BVNA 3P4OA 5GSVA 3OXRA 2CLRA 4JRYA 4PGEA 3DX8A 1JUFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IM3 A;  3ARB A;  3MV7 A;  1FFO A;  4G8G A;  4PJD A;  3L3D A;  3UTQ A;  1T22 A;  1ZAG A;  3TIE A;  3X14 A;  4Z77 A;  3O9W A;  3QFD A;  4GKS A;  4NO0 A;  4Z78 A;  5JHD A;  3TA3 A;  3KPR A;  2ESV A;  4IHO A;  3QFJ A;  3HCV A;  4ZUW A;  5MEN A;  1T1W A;  4U1J A;  5C0A A;  2OL3 H;  3MRJ A;  1BII A;  1CD1 A;  1A1N A;  4S0U C;  5E8O A;  3GSW A;  4L4V A;  3P77 A;  1DUZ A;  3QI9 A;  1FG2 A;  3DTX A;  5E8N A;  1FZM A;  4G9F A;  5BJT A;  4PV8 A;  3B3I A;  2FIK A;  1T1Z A;  5HGA A;  3GSX A;  3T8X A;  4L9L C;  4N0C A;  5H94 A;  1OGT A;  4NO3 A;  4PV9 A;  3VXR A;  1JHT A;  3GMP A;  5D2N A;  2GIT A;  4WUU A;  4PRE A;  3RTQ A;  3CPL A;  2CII A;  1HSB A;  1G7Q A;  1XZ0 A;  3KPP A;  3SKM A;  5BRZ A;  1A6Z A;  3L9R A;  4D0B A;  1KBG H;  1HHK A;  3HLA A;  3VWJ A;  4PJ5 A;  1TVB A;  3MRC A;  4JFF A;  3O3D A;  5MER A;  3E6H A;  3IT8 D;  5D7I A;  3SDC A;  4O2F A;  2V2W A;  5D7J C;  3MRP A;  2X4T A;  4JQV A;  1VAC A;  3O3A A;  1WBX A;  2X4O A;  1RJY A;  3MGT A;  3DX7 A;  2AV7 A;  3SDX A;  2NX5 A;  1E28 A;  5C0D A;  3BH8 A;  2HN7 A;  2X4P A;  1I1A A;  1I1F A;  2VLK A;  5FKP A;  4PJX A;  1I4F A;  5C08 A;  3UBX A;  2X70 A;  4F7P A;  4HUX A;  1KTL A;  3V5H A;  3MRQ A;  3MV9 A;  4XXC A;  3KXF A;  3BGM A;  1T7X A;  3MRG A;  5F1I A;  3X12 A;  1JGE A;  4O2E A;  5F1N A;  5AD0 A;  1SYV A;  5DEG A;  1XR9 A;  4FFE X;  4D0C A;  3HUJ A;  1B3J A;  2RFX A;  1P1Z A;  3MGO A;  4PRH A;  3BW9 A;  2X4Q A;  3M17 A;  2ZOK A;  2VAA A;  1P7Q A;  4PJG A;  2FZ3 A;  1WBZ A;  5D9S A;  4U1L A;  3SJV A;  2DYP A;  4PG9 A;  4WW2 C;  1I7T A;  1S7T A;  4PR5 A;  1T80 A;  3MRM A;  1HSA A;  4N5E A;  1OGA A;  1BQH A;  4HV8 A;  3FQW A;  2BNR A;  3BEW A;  4JQX A;  3JTT A;  1L8J A;  4NNX A;  3FQU A;  3VFT A;  5MEO A;  4PGB A;  4IIQ C;  1ONQ A;  3KYO A;  4APQ A;  1KPR A;  1QO3 A;  1WBY A;  3SPV A;  1JF1 A;  1KJV A;  5C0I A;  4PG2 A;  3ROL A;  4PRA A;  4L3C A;  5C0B A;  1LEK A;  4NQV A;  3PWN A;  4PJE A;  5EUO A;  3KPQ A;  3BZF A;  3T1F A;  1LEG A;  3P4N A;  3VFO A;  1EEZ A;  1MI5 A;  3QQ3 A;  4PJA A;  4UQ2 A;  5HHO A;  4D0D A;  3GMR A;  4X6C A;  5EO0 A;  5FA3 A;  3TBT A;  1JE6 A;  2CLV A;  5IB4 A;  3TPU E;  1FFN A;  3LKN A;  3NFN A;  3RWD A;  3KYN A;  3TID A;  4G9D A;  3QUY A;  4JRX A;  4U6X A;  3DMM A;  3WLB A;  1GZQ A;  1VGK A;  5HHN A;  3SDD A;  4PRB A;  5F7D A;  3FOL A;  3O4L A;  5IND A;  2BVQ A;  3BUY A;  5ENW A;  1TMC A;  4L8S C;  4PGD A;  3VFM A;  4NQD A;  3OX8 A;  5D2L A;  4QRS A;  2WY3 A;  1T7V A;  3QDM A;  3GSR A;  3MA7 A;  5J1A A;  4CVZ A;  1KPU A;  5EU6 A;  5C9J A;  3GSN H;  4G59 A;  5D7L A;  5MEQ A;  4NO5 A;  4MJ5 A;  3MRK A;  1A9E A;  4LCY A;  4X6E A;  3FQT A;  5FDW A;  3WS6 A;  4LNR A;  1CE6 A;  1G7P A;  1UQS A;  5F9J A;  3VXO A;  5C0F A;  2CKB H;  2X4R A;  3JTC A;  3VH8 A;  2F54 A;  1N5A A;  3LN4 A;  3FQN A;  3MRO A;  4PRD A;  3QUL A;  4PGC A;  5IVX A;  3BP4 A;  2X4N A;  2Q7Y A;  3CC5 A;  3GSV A;  4L4T A;  3TO4 A;  2AXF A;  4LCC C;  4NQX A;  2E7L E;  4ELM A;  1JPG A;  3PWJ A;  5L2J A;  3KPS A;  4K71 B;  5EOT A;  3S6C A;  2VE6 A;  4LHU A;  1LQV A;  3QUX A;  3AM8 A;  1B0G A;  3FOM A;  3LN5 A;  3E2H A;  4QRP A;  1QVO A;  1QSF A;  3ES6 A;  4N8V A;  1ZHK A;  4X6D A;  4JFD A;  5SWZ A;  1S7V A;  4U1H A;  1HYR C;  1S7S A;  1ZSD A;  4PJI A;  2ZSW A;  4L8B A;  3BHB A;  1ZT4 A;  4L3E A;  1A1O A;  3ARD A;  4WU5 A;  3P73 A;  1GZP A;  1LDP H;  1UXS A;  1HHG A;  3VFP A;  3MV8 A;  1LK2 A;  3B6S A;  1QEW A;  1KPV A;  3FTG A;  1K8D A;  1AGD A;  2F74 A;  1CG9 A;  5EU4 A;  1S7U A;  3MRL A;  3O3B A;  3PQY A;  4MJ6 A;  4PRI A;  1DE4 A;  5GSR A;  1VAD A;  3ARF A;  4HUW A;  5L2K A;  2AKR A;  3GML A;  2VLJ A;  3QUK A;  5ISZ A;  2FO4 A;  1T21 A;  1ZS8 A;  1JPF A;  2C7U A;  3ECB A;  2P5W A;  1S7W A;  3L3G A;  3LKR A;  4PJF A;  5EU3 A;  4WU7 A;  4V3E B;  3TBY A;  3KWW A;  1T20 A;  2GJ6 A;  4G8I A;  5IB5 A;  1AGE A;  4PJB A;  3RWG A;  3CVH A;  5FA4 A;  1YDP A;  3KPO A;  4JFO A;  4HUV A;  3FRU A;  4Y4K A;  3VFV A;  3MYJ A;  3GMO A;  4MVB A;  3RL1 A;  5DEF A;  4N0F A;  1INQ A;  1YN6 A;  2BCK A;  4WO4 A;  1HOC A;  5D5M A;  4PJ7 A;  3TVM A;  1KJ2 H;  4QRT A;  2CIK A;  5E8P A;  4Y4F A;  1NAM H;  3GJF A;  3OXS A;  3HE7 A;  2XFX A;  1XR8 A;  5C0J A;  3MRI A;  3VXM A;  3W39 A;  3C9N A;  1T0M A;  3O3E A;  2OI9 A;  1ZVS A;  1FZJ A;  1C16 A;  3RL2 A;  3D2U A;  1ZHL A;  1I7R A;  1UXW A;  2AXG A;  3LV3 A;  2VLR A;  4PRN A;  1EXU A;  3GSQ A;  3QDG A;  1T1X A;  4CW1 A;  5E6I C;  1JFM A;  4PRP A;  4U1M A;  1S9Y A;  1KCG C;  5J6H A;  1MHE A;  4Y2D A;  1RJZ A;  4Y16 A;  1DUY A;  2AK4 A;  5J6G A;  3RWE A;  1M05 A;  1S8D A;  1KJ3 H;  1T1Y A;  4ONO A;  4ZUS A;  4FTV A;  3WS3 A;  3VXS A;  1G6R H;  4NNY A;  1I1Y A;  4MS8 A;  5BS0 A;  4ZUV A;  4HS3 A;  1QRN A;  3CZF A;  5HGB A;  5IM7 A;  3I6K A;  5C09 A;  2A83 A;  3TF7 A;  3W0W A;  1AGF A;  4WJ5 A;  5C07 A;  1S7X A;  4PJ9 A;  5HHM A;  3PWP A;  1FO0 H;  1FFP A;  4O2C A;  3FQR A;  3FFC A;  4U1S A;  5ACZ A;  1TVH A;  4U6Y A;  1FZO A;  1T7Y A;  4G43 A;  3AU1 A;  3QUZ A;  4PJC A;  3BH9 A;  3GMQ A;  3VCL A;  4N0U A;  4EI5 A;  3L3J A;  3JVG A;  4WDI A;  3O8X A;  4Y4H A;  2ZSV A;  4JFE A;  3VXN A;  1ZT1 A;  5C0C A;  3RWJ A;  5IB1 A;  3SKO A;  1K5N A;  5IRO A;  3TBV A;  1RK1 A;  3CDG A;  3BXN A;  4MQ7 A;  2YPK A;  4NT6 A;  4UQ3 A;  1AKJ A;  3UPR A;  3I6L D;  3C8K A;  2GUO A;  2X4S A;  1KJM A;  3X11 A;  2YPL A;  3VWK A;  4QRR A;  1YPZ A;  4X6F A;  1JGD A;  2PO6 A;  1LD9 A;  1T7Z A;  3BEV A;  3KLA A;  4I4W A;  2HJK A;  4NO2 A;  2NW3 A;  1X7Q A;  4L8D A;  2PYE A;  3TJH A;  3U0P A;  3HG1 A;  3PWV A;  2VAB A;  1Z5L A;  4QRQ A;  3V5D A;  3SDA A;  3DBX A;  3HE6 A;  3VFS A;  3TZV C;  3BZE A;  2H6P A;  3MRD A;  5C0G A;  3PWL A;  4I48 A;  5HHQ A;  3UTT A;  2GTW A;  3ARE A;  3DX6 A;  4K7F A;  3ROO A;  1ED3 A;  1Q94 A;  4JFP A;  1HHJ A;  2FWO A;  4PP8 C;  1PQZ A;  3G08 A;  1M6O A;  1ZHB A;  3MRF A;  2ZOL A;  5HHP A;  5SWS A;  1MHC A;  3LKO A;  3HAE A;  3LKS A;  3RUG A;  5BXF A;  4F7M A;  1OSZ A;  1QQD A;  3QDJ A;  3E6F A;  3WL9 A;  3HPJ A;  1R3H A;  3TO2 A;  1MWA H;  5EO1 A;  1IM9 A;  2BNQ A;  1QR1 A;  2UWE A;  4GUP A;  2XPG A;  2P5E A;  4E5X A;  1EFX A;  4NSK A;  3KPN A;  1OF2 A;  3QEQ A;  3SCM A;  3TBW A;  4ZAK A;  1S9W A;  4F7E A;  5SWQ A;  4CVX A;  4IRS A;  1U58 A;  3VFR A;  3RGV C;  3FT2 A;  3ERY A;  3GIV A;  3VFN A;  3FT4 A;  3JTS A;  4HUU A;  3H7B A;  1NEZ A;  3MRN A;  3FQX A;  3VRJ A;  2D31 A;  2HJL A;  3QQ4 A;  1B0R A;  4MJI A;  3I6G A;  1N59 A;  4MNG A;  3D18 A;  4HX1 A;  4MXQ A;  1S9X A;  3H9S A;  3VFU A;  4HWZ A;  4NHU E;  3WUW A;  4NQE A;  3TFK A;  1S7Q A;  1FZK A;  3ILQ C;  1T0N A;  5IEH A;  3RZC A;  3RWF A;  2JCC A;  3MRH A;  1E27 A;  1DDH A;  3GSO A;  4GKN A;  3V5K A;  4Z76 A;  4HKJ A;  3TN0 A;  2BSS A;  3VXU A;  1LP9 A;  4WWK C;  4V3D B;  4ZFZ A;  2GAZ A;  1T7W A;  3PWU A;  2F53 A;  3P4M A;  3UTS A;  3X13 A;  4EN3 C;  5INC A;  1A1M A;  5IB3 A;  3MRR A;  3ILP A;  5EFI A;  3BWA A;  5B39 A;  3MR9 A;  3QZW A;  4ZUT A;  4JFQ A;  4ZUU A;  1XH3 A;  3MRE A;  3VRI A;  3M1B A;  2MHA A;  1I7U A;  3LKQ A;  3VJ6 A;  3REW A;  1HHI A;  4G42 A;  5DDH A;  3BP7 A;  1ZT7 A;  4E0R A;  2AV1 A;  2HLA A;  2CLZ A;  3LKP A;  5E9D A;  3DXA A;  4PJ8 A;  4F7C A;  1NAN H;  4F7T A;  4L8C A;  1BD2 A;  3IXA A;  1EEY A;  3CH1 A;  4QOK A;  3D25 A;  4MNQ A;  4L29 A;  4LCW A;  4NQC A;  4EUP A;  1W72 A;  2BVP A;  4U1K A;  3VFW A;  4MX7 A;  3D3V A;  1N3N A;  1AGB A;  3ARG A;  5HYJ A;  3KPL A;  1W0W A;  3P9L A;  3L3K A;  1RK0 A;  3FON A;  1W0V A;  3GMN A;  5B38 A;  4PJH A;  3CCH A;  4QRU A;  2X4U A;  5HGD A;  5HGH A;  1P4L A;  3H9H A;  1SYS A;  3RWC A;  3VXP A;  1A9B A;  3GMM A;  3P9M A;  3KPM A;  1QSE A;  3MRB A;  2BVO A;  2VLL A;  2YEZ A;  3PAB A;  4IRJ A;  5E00 A;  5EU5 A;  1QLF A;  2GT9 A;  1S7R A;  4PDC E;  4U1I A;  3D39 A;  1AGC A;  3RWH A;  2J8U A;  1ZHN A;  3TBS A;  2FYY A;  2V2X A;  3RWI A;  2GTZ A;  1HHH A;  3L3I A;  1N2R A;  2H26 A;  5MEP A;  2BST A;  3E3Q A;  5C0E A;  1AO7 A;  3OV6 A;  3FT3 A;  1YN7 A;  5IEK A;  3BO8 A;  3GSU A;  3L3H A;  1BZ9 A;  4U1N A;  5IB2 A;  2BSR A;  3BVN A;  3P4O A;  5GSV A;  3OXR A;  2CLR A;  4JRY A;  4PGE A;  3DX8 A;  1JUF A; 
#chains in the Genus database with same CATH topology
 1IM3 A;  3ARB A;  3MV7 A;  1FFO A;  4G8G A;  4PJD A;  3L3D A;  3UTQ A;  1T22 A;  1ZAG A;  3TIE A;  3X14 A;  4Z77 A;  3O9W A;  3QFD A;  4GKS A;  4NO0 A;  4Z78 A;  5JHD A;  3TA3 A;  3KPR A;  2ESV A;  4IHO A;  3QFJ A;  3HCV A;  4ZUW A;  5MEN A;  1T1W A;  4U1J A;  5C0A A;  2OL3 H;  3MRJ A;  1BII A;  1CD1 A;  1A1N A;  4S0U C;  5E8O A;  3GSW A;  4L4V A;  3P77 A;  1DUZ A;  3QI9 A;  1FG2 A;  3DTX A;  5E8N A;  1FZM A;  4G9F A;  5BJT A;  4BKW A;  4PV8 A;  3B3I A;  2FIK A;  1T1Z A;  5HGA A;  3GSX A;  3T8X A;  4L9L C;  4N0C A;  5H94 A;  1OGT A;  4NO3 A;  4PV9 A;  3VXR A;  1JHT A;  3GMP A;  5D2N A;  2GIT A;  4WUU A;  4PRE A;  3RTQ A;  3CPL A;  2CII A;  1HSB A;  1G7Q A;  1XZ0 A;  3KPP A;  3SKM A;  2NYK A;  5BRZ A;  1A6Z A;  3L9R A;  4D0B A;  1KBG H;  1HHK A;  3HLA A;  3VWJ A;  4PJ5 A;  1TVB A;  3MRC A;  4JFF A;  3O3D A;  5MER A;  3E6H A;  3IT8 D;  5D7I A;  3SDC A;  4O2F A;  2V2W A;  5D7J C;  3MRP A;  2X4T A;  4JQV A;  1VAC A;  3O3A A;  1WBX A;  2X4O A;  1RJY A;  3MGT A;  3DX7 A;  2AV7 A;  3SDX A;  2NX5 A;  1E28 A;  5C0D A;  3BH8 A;  2HN7 A;  2X4P A;  1I1A A;  1I1F A;  2VLK A;  5FKP A;  4PJX A;  1I4F A;  5C08 A;  3UBX A;  2X70 A;  4F7P A;  4HUX A;  1KTL A;  3V5H A;  3MRQ A;  3MV9 A;  4XXC A;  3KXF A;  3BGM A;  1T7X A;  3MRG A;  5F1I A;  3X12 A;  1JGE A;  4O2E A;  5F1N A;  5AD0 A;  1SYV A;  5DEG A;  1XR9 A;  4FFE X;  4D0C A;  3HUJ A;  1B3J A;  2RFX A;  1P1Z A;  3MGO A;  4PRH A;  3BW9 A;  2X4Q A;  3M17 A;  2ZOK A;  2VAA A;  1P7Q A;  4PJG A;  2FZ3 A;  1WBZ A;  5D9S A;  4U1L A;  3SJV A;  2DYP A;  4PG9 A;  4WW2 C;  1I7T A;  1S7T A;  4PR5 A;  1T80 A;  3MRM A;  1HSA A;  4N5E A;  1OGA A;  1BQH A;  4HV8 A;  3FQW A;  2BNR A;  3BEW A;  4JQX A;  3JTT A;  1L8J A;  4NNX A;  3FQU A;  3VFT A;  5MEO A;  4PGB A;  4IIQ C;  1ONQ A;  3KYO A;  4APQ A;  1KPR A;  1QO3 A;  1WBY A;  3SPV A;  1JF1 A;  1KJV A;  5C0I A;  4PG2 A;  3ROL A;  4PRA A;  4L3C A;  5C0B A;  1LEK A;  4NQV A;  3PWN A;  4PJE A;  5EUO A;  3KPQ A;  3BZF A;  3T1F A;  1LEG A;  3P4N A;  3VFO A;  1EEZ A;  1MI5 A;  3QQ3 A;  4PJA A;  4UQ2 A;  5HHO A;  4D0D A;  3GMR A;  4X6C A;  5EO0 A;  5FA3 A;  3TBT A;  1JE6 A;  2CLV A;  5IB4 A;  3TPU E;  1FFN A;  3LKN A;  3NFN A;  3RWD A;  3KYN A;  3TID A;  4G9D A;  3QUY A;  4JRX A;  4U6X A;  3DMM A;  3WLB A;  1GZQ A;  1VGK A;  5HHN A;  3SDD A;  4PRB A;  5F7D A;  3FOL A;  3O4L A;  5IND A;  2BVQ A;  3BUY A;  5ENW A;  1TMC A;  4L8S C;  4PGD A;  3VFM A;  4NQD A;  3OX8 A;  5D2L A;  4QRS A;  2WY3 A;  1T7V A;  3QDM A;  3GSR A;  3MA7 A;  5J1A A;  4CVZ A;  1KPU A;  5EU6 A;  5C9J A;  3GSN H;  4G59 A;  5D7L A;  5MEQ A;  4NO5 A;  4MJ5 A;  3MRK A;  1A9E A;  4LCY A;  4X6E A;  3FQT A;  5FDW A;  3WS6 A;  4LNR A;  1CE6 A;  1G7P A;  1UQS A;  5F9J A;  3VXO A;  5C0F A;  2CKB H;  2X4R A;  3JTC A;  3VH8 A;  2F54 A;  1N5A A;  3LN4 A;  3FQN A;  3MRO A;  4PRD A;  3QUL A;  4PGC A;  5IVX A;  3BP4 A;  2X4N A;  2Q7Y A;  3CC5 A;  3GSV A;  4L4T A;  3TO4 A;  2AXF A;  4LCC C;  4NQX A;  2E7L E;  4ELM A;  1JPG A;  3PWJ A;  5L2J A;  3KPS A;  4K71 B;  5EOT A;  3S6C A;  2VE6 A;  4LHU A;  1LQV A;  3QUX A;  3AM8 A;  1B0G A;  3FOM A;  3LN5 A;  3E2H A;  4QRP A;  1QVO A;  1QSF A;  3ES6 A;  4N8V A;  1ZHK A;  4X6D A;  4JFD A;  5SWZ A;  1S7V A;  4U1H A;  1HYR C;  1S7S A;  1ZSD A;  4PJI A;  2ZSW A;  4L8B A;  3BHB A;  1ZT4 A;  4L3E A;  1A1O A;  3ARD A;  4WU5 A;  3P73 A;  1GZP A;  1LDP H;  1UXS A;  1HHG A;  3VFP A;  3MV8 A;  1LK2 A;  3B6S A;  1QEW A;  3I0T A;  1KPV A;  3FTG A;  1K8D A;  1AGD A;  2F74 A;  1CG9 A;  5EU4 A;  1S7U A;  3MRL A;  3O3B A;  3PQY A;  4MJ6 A;  4PRI A;  1DE4 A;  5GSR A;  1VAD A;  3ARF A;  4HUW A;  5L2K A;  2AKR A;  3GML A;  2VLJ A;  3QUK A;  5ISZ A;  2FO4 A;  1T21 A;  1ZS8 A;  1JPF A;  2C7U A;  3ECB A;  2P5W A;  1S7W A;  3L3G A;  3LKR A;  4PJF A;  5EU3 A;  4WU7 A;  4V3E B;  3TBY A;  3KWW A;  1T20 A;  2GJ6 A;  4G8I A;  5IB5 A;  1AGE A;  4PJB A;  3RWG A;  3CVH A;  5FA4 A;  1YDP A;  3KPO A;  4JFO A;  4HUV A;  3FRU A;  4Y4K A;  3VFV A;  3MYJ A;  3GMO A;  4MVB A;  3RL1 A;  5DEF A;  4N0F A;  1INQ A;  1YN6 A;  2BCK A;  4WO4 A;  1HOC A;  5D5M A;  4PJ7 A;  3TVM A;  1KJ2 H;  4QRT A;  2CIK A;  5E8P A;  4Y4F A;  1NAM H;  3GJF A;  3OXS A;  3HE7 A;  2XFX A;  1XR8 A;  5C0J A;  3MRI A;  3VXM A;  3W39 A;  3C9N A;  1T0M A;  3O3E A;  2OI9 A;  1ZVS A;  1FZJ A;  1C16 A;  3RL2 A;  3D2U A;  1ZHL A;  1I7R A;  1UXW A;  2AXG A;  3LV3 A;  2VLR A;  4PRN A;  1EXU A;  3GSQ A;  3QDG A;  1T1X A;  4CW1 A;  5E6I C;  1JFM A;  4PRP A;  4U1M A;  1S9Y A;  1KCG C;  5J6H A;  1MHE A;  4Y2D A;  1RJZ A;  4Y16 A;  1DUY A;  2AK4 A;  5J6G A;  3RWE A;  1M05 A;  1S8D A;  1KJ3 H;  1T1Y A;  4ONO A;  4ZUS A;  4FTV A;  3WS3 A;  3VXS A;  1G6R H;  4NNY A;  1I1Y A;  4MS8 A;  5BS0 A;  4ZUV A;  4HS3 A;  1QRN A;  3CZF A;  5HGB A;  5IM7 A;  3I6K A;  5C09 A;  2A83 A;  3TF7 A;  3W0W A;  1AGF A;  4WJ5 A;  5C07 A;  1S7X A;  4PJ9 A;  5HHM A;  3PWP A;  2O5N A;  1FO0 H;  1FFP A;  4O2C A;  3FQR A;  3FFC A;  4U1S A;  5ACZ A;  1TVH A;  4U6Y A;  1FZO A;  1T7Y A;  4G43 A;  3AU1 A;  3QUZ A;  4PJC A;  3BH9 A;  3GMQ A;  3VCL A;  4N0U A;  4EI5 A;  3L3J A;  3JVG A;  4WDI A;  3O8X A;  4JO8 A;  4Y4H A;  2ZSV A;  4JFE A;  3VXN A;  1ZT1 A;  5C0C A;  3RWJ A;  5IB1 A;  3SKO A;  1K5N A;  5IRO A;  3TBV A;  1RK1 A;  3CDG A;  3BXN A;  4MQ7 A;  2YPK A;  4NT6 A;  4UQ3 A;  1AKJ A;  3UPR A;  3I6L D;  3C8K A;  2GUO A;  2X4S A;  1KJM A;  3X11 A;  2YPL A;  3VWK A;  4QRR A;  1YPZ A;  4X6F A;  1JGD A;  2PO6 A;  1LD9 A;  1T7Z A;  3BEV A;  3KLA A;  4I4W A;  2HJK A;  4NO2 A;  2NW3 A;  1X7Q A;  4L8D A;  2PYE A;  3TJH A;  3U0P A;  3HG1 A;  3PWV A;  2VAB A;  1Z5L A;  4QRQ A;  3V5D A;  3SDA A;  3DBX A;  3HE6 A;  3VFS A;  3TZV C;  3BZE A;  2H6P A;  3MRD A;  5C0G A;  3PWL A;  4I48 A;  5HHQ A;  3UTT A;  2GTW A;  3ARE A;  3DX6 A;  4K7F A;  3ROO A;  1ED3 A;  1Q94 A;  4JFP A;  1HHJ A;  2FWO A;  4PP8 C;  1PQZ A;  3G08 A;  1M6O A;  1ZHB A;  3MRF A;  2ZOL A;  5HHP A;  5SWS A;  1MHC A;  3LKO A;  3HAE A;  3LKS A;  3RUG A;  5BXF A;  4F7M A;  1OSZ A;  1QQD A;  3QDJ A;  3E6F A;  3WL9 A;  3HPJ A;  1R3H A;  3TO2 A;  1MWA H;  5EO1 A;  1IM9 A;  2BNQ A;  1QR1 A;  2UWE A;  4GUP A;  2XPG A;  2P5E A;  4E5X A;  1EFX A;  4NSK A;  3KPN A;  1OF2 A;  3QEQ A;  3SCM A;  3TBW A;  4ZAK A;  1S9W A;  4F7E A;  5SWQ A;  4CVX A;  4IRS A;  1U58 A;  3VFR A;  3RGV C;  3FT2 A;  3ERY A;  3GIV A;  3VFN A;  3FT4 A;  3JTS A;  4HUU A;  3H7B A;  1NEZ A;  3MRN A;  3FQX A;  3VRJ A;  2D31 A;  2HJL A;  3QQ4 A;  1B0R A;  4MJI A;  4G59 C;  3I6G A;  1N59 A;  4MNG A;  3D18 A;  4HX1 A;  4MXQ A;  1S9X A;  3H9S A;  3VFU A;  4HWZ A;  4NHU E;  3WUW A;  4NQE A;  3TFK A;  1S7Q A;  1FZK A;  3ILQ C;  1T0N A;  5IEH A;  3RZC A;  3RWF A;  2JCC A;  3MRH A;  1E27 A;  1DDH A;  3GSO A;  4GKN A;  3V5K A;  4Z76 A;  4HKJ A;  3TN0 A;  2BSS A;  3VXU A;  1LP9 A;  4WWK C;  4V3D B;  4ZFZ A;  2GAZ A;  1T7W A;  3PWU A;  2F53 A;  3P4M A;  3UTS A;  3X13 A;  4EN3 C;  5INC A;  1A1M A;  5IB3 A;  3MRR A;  3ILP A;  5EFI A;  3BWA A;  5B39 A;  3MR9 A;  3QZW A;  4ZUT A;  4JFQ A;  4ZUU A;  1XH3 A;  3MRE A;  3VRI A;  3M1B A;  2MHA A;  1I7U A;  3LKQ A;  3VJ6 A;  3REW A;  1HHI A;  4G42 A;  5DDH A;  3BP7 A;  1ZT7 A;  4E0R A;  2AV1 A;  2HLA A;  2IA1 A;  2CLZ A;  3LKP A;  5E9D A;  3DXA A;  4PJ8 A;  4F7C A;  1NAN H;  4F7T A;  4L8C A;  1BD2 A;  3IXA A;  1EEY A;  3CH1 A;  4QOK A;  3D25 A;  4MNQ A;  4L29 A;  4LCW A;  4NQC A;  4EUP A;  1W72 A;  2BVP A;  4U1K A;  3VFW A;  4MX7 A;  3D3V A;  1N3N A;  1AGB A;  3ARG A;  5HYJ A;  3KPL A;  1W0W A;  3P9L A;  3L3K A;  1RK0 A;  3FON A;  1W0V A;  3GMN A;  5B38 A;  4PJH A;  3CCH A;  4QRU A;  2X4U A;  5HGD A;  5HGH A;  1P4L A;  3H9H A;  1SYS A;  3RWC A;  3VXP A;  1A9B A;  3GMM A;  3P9M A;  3KPM A;  1QSE A;  3MRB A;  2BVO A;  2VLL A;  2YEZ A;  3PAB A;  4IRJ A;  5E00 A;  5EU5 A;  1QLF A;  2GT9 A;  1S7R A;  4PDC E;  4U1I A;  3D39 A;  1AGC A;  3RWH A;  2J8U A;  1ZHN A;  3TBS A;  2FYY A;  2V2X A;  3RWI A;  2GTZ A;  1HHH A;  3L3I A;  1N2R A;  2H26 A;  5MEP A;  2BST A;  3E3Q A;  5C0E A;  1AO7 A;  3OV6 A;  3FT3 A;  1YN7 A;  5IEK A;  3BO8 A;  3GSU A;  3L3H A;  1BZ9 A;  4U1N A;  5IB2 A;  2BSR A;  3BVN A;  3P4O A;  5GSV A;  3OXR A;  2CLR A;  4JRY A;  4PGE A;  3DX8 A;  1JUF A; 
#chains in the Genus database with same CATH homology
 1IM3 A;  3ARB A;  3MV7 A;  1FFO A;  4G8G A;  4PJD A;  3L3D A;  3UTQ A;  1T22 A;  1ZAG A;  3TIE A;  3X14 A;  4Z77 A;  3O9W A;  3QFD A;  4GKS A;  4NO0 A;  4Z78 A;  5JHD A;  3TA3 A;  3KPR A;  2ESV A;  4IHO A;  3QFJ A;  3HCV A;  4ZUW A;  5MEN A;  1T1W A;  4U1J A;  5C0A A;  2OL3 H;  3MRJ A;  1BII A;  1CD1 A;  1A1N A;  4S0U C;  5E8O A;  3GSW A;  4L4V A;  3P77 A;  1DUZ A;  3QI9 A;  1FG2 A;  3DTX A;  5E8N A;  1FZM A;  4G9F A;  5BJT A;  4PV8 A;  3B3I A;  2FIK A;  1T1Z A;  5HGA A;  3GSX A;  3T8X A;  4L9L C;  4N0C A;  5H94 A;  1OGT A;  4NO3 A;  4PV9 A;  3VXR A;  1JHT A;  3GMP A;  5D2N A;  2GIT A;  4WUU A;  4PRE A;  3RTQ A;  3CPL A;  2CII A;  1HSB A;  1G7Q A;  1XZ0 A;  3KPP A;  3SKM A;  5BRZ A;  1A6Z A;  3L9R A;  4D0B A;  1KBG H;  1HHK A;  3HLA A;  3VWJ A;  4PJ5 A;  1TVB A;  3MRC A;  4JFF A;  3O3D A;  5MER A;  3E6H A;  3IT8 D;  5D7I A;  3SDC A;  4O2F A;  2V2W A;  5D7J C;  3MRP A;  2X4T A;  4JQV A;  1VAC A;  3O3A A;  1WBX A;  2X4O A;  1RJY A;  3MGT A;  3DX7 A;  2AV7 A;  3SDX A;  2NX5 A;  1E28 A;  5C0D A;  3BH8 A;  2HN7 A;  2X4P A;  1I1A A;  1I1F A;  2VLK A;  5FKP A;  4PJX A;  1I4F A;  5C08 A;  3UBX A;  2X70 A;  4F7P A;  4HUX A;  1KTL A;  3V5H A;  3MRQ A;  3MV9 A;  4XXC A;  3KXF A;  3BGM A;  1T7X A;  3MRG A;  5F1I A;  3X12 A;  1JGE A;  4O2E A;  5F1N A;  5AD0 A;  1SYV A;  5DEG A;  1XR9 A;  4FFE X;  4D0C A;  3HUJ A;  1B3J A;  2RFX A;  1P1Z A;  3MGO A;  4PRH A;  3BW9 A;  2X4Q A;  3M17 A;  2ZOK A;  2VAA A;  1P7Q A;  4PJG A;  2FZ3 A;  1WBZ A;  5D9S A;  4U1L A;  3SJV A;  2DYP A;  4PG9 A;  4WW2 C;  1I7T A;  1S7T A;  4PR5 A;  1T80 A;  3MRM A;  1HSA A;  4N5E A;  1OGA A;  1BQH A;  4HV8 A;  3FQW A;  2BNR A;  3BEW A;  4JQX A;  3JTT A;  1L8J A;  4NNX A;  3FQU A;  3VFT A;  5MEO A;  4PGB A;  4IIQ C;  1ONQ A;  3KYO A;  4APQ A;  1KPR A;  1QO3 A;  1WBY A;  3SPV A;  1JF1 A;  1KJV A;  5C0I A;  4PG2 A;  3ROL A;  4PRA A;  4L3C A;  5C0B A;  1LEK A;  4NQV A;  3PWN A;  4PJE A;  5EUO A;  3KPQ A;  3BZF A;  3T1F A;  1LEG A;  3P4N A;  3VFO A;  1EEZ A;  1MI5 A;  3QQ3 A;  4PJA A;  4UQ2 A;  5HHO A;  4D0D A;  3GMR A;  4X6C A;  5EO0 A;  5FA3 A;  3TBT A;  1JE6 A;  2CLV A;  5IB4 A;  3TPU E;  1FFN A;  3LKN A;  3NFN A;  3RWD A;  3KYN A;  3TID A;  4G9D A;  3QUY A;  4JRX A;  4U6X A;  3DMM A;  3WLB A;  1GZQ A;  1VGK A;  5HHN A;  3SDD A;  4PRB A;  5F7D A;  3FOL A;  3O4L A;  5IND A;  2BVQ A;  3BUY A;  5ENW A;  1TMC A;  4L8S C;  4PGD A;  3VFM A;  4NQD A;  3OX8 A;  5D2L A;  4QRS A;  2WY3 A;  1T7V A;  3QDM A;  3GSR A;  3MA7 A;  5J1A A;  4CVZ A;  1KPU A;  5EU6 A;  5C9J A;  3GSN H;  4G59 A;  5D7L A;  5MEQ A;  4NO5 A;  4MJ5 A;  3MRK A;  1A9E A;  4LCY A;  4X6E A;  3FQT A;  5FDW A;  3WS6 A;  4LNR A;  1CE6 A;  1G7P A;  1UQS A;  5F9J A;  3VXO A;  5C0F A;  2CKB H;  2X4R A;  3JTC A;  3VH8 A;  2F54 A;  1N5A A;  3LN4 A;  3FQN A;  3MRO A;  4PRD A;  3QUL A;  4PGC A;  5IVX A;  3BP4 A;  2X4N A;  2Q7Y A;  3CC5 A;  3GSV A;  4L4T A;  3TO4 A;  2AXF A;  4LCC C;  4NQX A;  2E7L E;  4ELM A;  1JPG A;  3PWJ A;  5L2J A;  3KPS A;  4K71 B;  5EOT A;  3S6C A;  2VE6 A;  4LHU A;  1LQV A;  3QUX A;  3AM8 A;  1B0G A;  3FOM A;  3LN5 A;  3E2H A;  4QRP A;  1QVO A;  1QSF A;  3ES6 A;  4N8V A;  1ZHK A;  4X6D A;  4JFD A;  5SWZ A;  1S7V A;  4U1H A;  1HYR C;  1S7S A;  1ZSD A;  4PJI A;  2ZSW A;  4L8B A;  3BHB A;  1ZT4 A;  4L3E A;  1A1O A;  3ARD A;  4WU5 A;  3P73 A;  1GZP A;  1LDP H;  1UXS A;  1HHG A;  3VFP A;  3MV8 A;  1LK2 A;  3B6S A;  1QEW A;  1KPV A;  3FTG A;  1K8D A;  1AGD A;  2F74 A;  1CG9 A;  5EU4 A;  1S7U A;  3MRL A;  3O3B A;  3PQY A;  4MJ6 A;  4PRI A;  1DE4 A;  5GSR A;  1VAD A;  3ARF A;  4HUW A;  5L2K A;  2AKR A;  3GML A;  2VLJ A;  3QUK A;  5ISZ A;  2FO4 A;  1T21 A;  1ZS8 A;  1JPF A;  2C7U A;  3ECB A;  2P5W A;  1S7W A;  3L3G A;  3LKR A;  4PJF A;  5EU3 A;  4WU7 A;  4V3E B;  3TBY A;  3KWW A;  1T20 A;  2GJ6 A;  4G8I A;  5IB5 A;  1AGE A;  4PJB A;  3RWG A;  3CVH A;  5FA4 A;  1YDP A;  3KPO A;  4JFO A;  4HUV A;  3FRU A;  4Y4K A;  3VFV A;  3MYJ A;  3GMO A;  4MVB A;  3RL1 A;  5DEF A;  4N0F A;  1INQ A;  1YN6 A;  2BCK A;  4WO4 A;  1HOC A;  5D5M A;  4PJ7 A;  3TVM A;  1KJ2 H;  4QRT A;  2CIK A;  5E8P A;  4Y4F A;  1NAM H;  3GJF A;  3OXS A;  3HE7 A;  2XFX A;  1XR8 A;  5C0J A;  3MRI A;  3VXM A;  3W39 A;  3C9N A;  1T0M A;  3O3E A;  2OI9 A;  1ZVS A;  1FZJ A;  1C16 A;  3RL2 A;  3D2U A;  1ZHL A;  1I7R A;  1UXW A;  2AXG A;  3LV3 A;  2VLR A;  4PRN A;  1EXU A;  3GSQ A;  3QDG A;  1T1X A;  4CW1 A;  5E6I C;  1JFM A;  4PRP A;  4U1M A;  1S9Y A;  1KCG C;  5J6H A;  1MHE A;  4Y2D A;  1RJZ A;  4Y16 A;  1DUY A;  2AK4 A;  5J6G A;  3RWE A;  1M05 A;  1S8D A;  1KJ3 H;  1T1Y A;  4ONO A;  4ZUS A;  4FTV A;  3WS3 A;  3VXS A;  1G6R H;  4NNY A;  1I1Y A;  4MS8 A;  5BS0 A;  4ZUV A;  4HS3 A;  1QRN A;  3CZF A;  5HGB A;  5IM7 A;  3I6K A;  5C09 A;  2A83 A;  3TF7 A;  3W0W A;  1AGF A;  4WJ5 A;  5C07 A;  1S7X A;  4PJ9 A;  5HHM A;  3PWP A;  1FO0 H;  1FFP A;  4O2C A;  3FQR A;  3FFC A;  4U1S A;  5ACZ A;  1TVH A;  4U6Y A;  1FZO A;  1T7Y A;  4G43 A;  3AU1 A;  3QUZ A;  4PJC A;  3BH9 A;  3GMQ A;  3VCL A;  4N0U A;  4EI5 A;  3L3J A;  3JVG A;  4WDI A;  3O8X A;  4Y4H A;  2ZSV A;  4JFE A;  3VXN A;  1ZT1 A;  5C0C A;  3RWJ A;  5IB1 A;  3SKO A;  1K5N A;  5IRO A;  3TBV A;  1RK1 A;  3CDG A;  3BXN A;  4MQ7 A;  2YPK A;  4NT6 A;  4UQ3 A;  1AKJ A;  3UPR A;  3I6L D;  3C8K A;  2GUO A;  2X4S A;  1KJM A;  3X11 A;  2YPL A;  3VWK A;  4QRR A;  1YPZ A;  4X6F A;  1JGD A;  2PO6 A;  1LD9 A;  1T7Z A;  3BEV A;  3KLA A;  4I4W A;  2HJK A;  4NO2 A;  2NW3 A;  1X7Q A;  4L8D A;  2PYE A;  3TJH A;  3U0P A;  3HG1 A;  3PWV A;  2VAB A;  1Z5L A;  4QRQ A;  3V5D A;  3SDA A;  3DBX A;  3HE6 A;  3VFS A;  3TZV C;  3BZE A;  2H6P A;  3MRD A;  5C0G A;  3PWL A;  4I48 A;  5HHQ A;  3UTT A;  2GTW A;  3ARE A;  3DX6 A;  4K7F A;  3ROO A;  1ED3 A;  1Q94 A;  4JFP A;  1HHJ A;  2FWO A;  4PP8 C;  1PQZ A;  3G08 A;  1M6O A;  1ZHB A;  3MRF A;  2ZOL A;  5HHP A;  5SWS A;  1MHC A;  3LKO A;  3HAE A;  3LKS A;  3RUG A;  5BXF A;  4F7M A;  1OSZ A;  1QQD A;  3QDJ A;  3E6F A;  3WL9 A;  3HPJ A;  1R3H A;  3TO2 A;  1MWA H;  5EO1 A;  1IM9 A;  2BNQ A;  1QR1 A;  2UWE A;  4GUP A;  2XPG A;  2P5E A;  4E5X A;  1EFX A;  4NSK A;  3KPN A;  1OF2 A;  3QEQ A;  3SCM A;  3TBW A;  4ZAK A;  1S9W A;  4F7E A;  5SWQ A;  4CVX A;  4IRS A;  1U58 A;  3VFR A;  3RGV C;  3FT2 A;  3ERY A;  3GIV A;  3VFN A;  3FT4 A;  3JTS A;  4HUU A;  3H7B A;  1NEZ A;  3MRN A;  3FQX A;  3VRJ A;  2D31 A;  2HJL A;  3QQ4 A;  1B0R A;  4MJI A;  3I6G A;  1N59 A;  4MNG A;  3D18 A;  4HX1 A;  4MXQ A;  1S9X A;  3H9S A;  3VFU A;  4HWZ A;  4NHU E;  3WUW A;  4NQE A;  3TFK A;  1S7Q A;  1FZK A;  3ILQ C;  1T0N A;  5IEH A;  3RZC A;  3RWF A;  2JCC A;  3MRH A;  1E27 A;  1DDH A;  3GSO A;  4GKN A;  3V5K A;  4Z76 A;  4HKJ A;  3TN0 A;  2BSS A;  3VXU A;  1LP9 A;  4WWK C;  4V3D B;  4ZFZ A;  2GAZ A;  1T7W A;  3PWU A;  2F53 A;  3P4M A;  3UTS A;  3X13 A;  4EN3 C;  5INC A;  1A1M A;  5IB3 A;  3MRR A;  3ILP A;  5EFI A;  3BWA A;  5B39 A;  3MR9 A;  3QZW A;  4ZUT A;  4JFQ A;  4ZUU A;  1XH3 A;  3MRE A;  3VRI A;  3M1B A;  2MHA A;  1I7U A;  3LKQ A;  3VJ6 A;  3REW A;  1HHI A;  4G42 A;  5DDH A;  3BP7 A;  1ZT7 A;  4E0R A;  2AV1 A;  2HLA A;  2CLZ A;  3LKP A;  5E9D A;  3DXA A;  4PJ8 A;  4F7C A;  1NAN H;  4F7T A;  4L8C A;  1BD2 A;  3IXA A;  1EEY A;  3CH1 A;  4QOK A;  3D25 A;  4MNQ A;  4L29 A;  4LCW A;  4NQC A;  4EUP A;  1W72 A;  2BVP A;  4U1K A;  3VFW A;  4MX7 A;  3D3V A;  1N3N A;  1AGB A;  3ARG A;  5HYJ A;  3KPL A;  1W0W A;  3P9L A;  3L3K A;  1RK0 A;  3FON A;  1W0V A;  3GMN A;  5B38 A;  4PJH A;  3CCH A;  4QRU A;  2X4U A;  5HGD A;  5HGH A;  1P4L A;  3H9H A;  1SYS A;  3RWC A;  3VXP A;  1A9B A;  3GMM A;  3P9M A;  3KPM A;  1QSE A;  3MRB A;  2BVO A;  2VLL A;  2YEZ A;  3PAB A;  4IRJ A;  5E00 A;  5EU5 A;  1QLF A;  2GT9 A;  1S7R A;  4PDC E;  4U1I A;  3D39 A;  1AGC A;  3RWH A;  2J8U A;  1ZHN A;  3TBS A;  2FYY A;  2V2X A;  3RWI A;  2GTZ A;  1HHH A;  3L3I A;  1N2R A;  2H26 A;  5MEP A;  2BST A;  3E3Q A;  5C0E A;  1AO7 A;  3OV6 A;  3FT3 A;  1YN7 A;  5IEK A;  3BO8 A;  3GSU A;  3L3H A;  1BZ9 A;  4U1N A;  5IB2 A;  2BSR A;  3BVN A;  3P4O A;  5GSV A;  3OXR A;  2CLR A;  4JRY A;  4PGE A;  3DX8 A;  1JUF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...