2OI9A

Structure of the 2c/ld/ql9 allogeneic complex
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
175
structure length
175
Chain Sequence
GPHSMRYYETATSRRGLGEPRYTSVGYVDDKEFVRFDSDAENPRYEPQVPWMEQEGPEYWERITQVAKGQEQWFRVNLRTLLGYYNQSAGGTHTLQRMYGCDVGSDGRLLRGYEQFAYDGCDYIALNEDLRTWTAADMAAQITRRKWEQAGAAEYYRAYLEGECVEWLHRYLKNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title How a single T cell receptor recognizes both self and foreign MHC.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords Major Histocompatibility Complex protein
total genus 50
structure length 175
sequence length 175
ec nomenclature
pdb deposition date 2007-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 2oi9A00
3DMMA 5F1IA 1XR8A 3PQYA 3TFKA 1CG9A 4PGCA 3PWVA 1FG2A 4U1LA 4NQCA 4GKSA 3MRQA 4CVXA 4HUVA 5EU4A 1XH3A 3MV7A 1QQDA 3MRDA 5C07A 5F7DA 3MRMA 2F74A 4LCWA 5C0IA 5IEKA 1TVHA 4U1JA 4FFEX 4HUUA 3FOLA 1K5NA 3PWJA 4WWKC 1S7TA 5L2KA 1MI5A 1T20A 3MRRA 3TPUE 1JE6A 1HHHA 2FO4A 5MERA 1AO7A 4QRTA 4GKNA 3CZFA 4UQ3A 5E6IC 4U1KA 3VFSA 2CKBH 2CLZA 1RJYA 3MRFA 3QDJA 1KTLA 2XPGA 4QRPA 5IB5A 3T1FA 1HOCA 2J8UA 3O8XA 4PGEA 2ZSVA 4HWZA 3NFNA 2GTZA 3UTSA 1RJZA 3VJ6A 3ARBA 3GSQA 3P4NA 3QI9A 4L29A 3L3KA 3CH1A 5IM7A 3BZEA 3ILQC 3KPSA 2X4RA 4MS8A 3W39A 3MV9A 1HHKA 1XR9A 1T0MA 3C8KA 3VCLA 3O9WA 4QRRA 3H7BA 1M6OA 3SDCA 3HG1A 1DDHA 4PJ8A 3TJHA 1T0NA 4HUWA 3S6CA 2CIIA 2BVQA 3HAEA 3RGVC 5J1AA 3RWFA 4MJ5A 1YPZA 4PJIA 1NANH 2BNRA 1BQHA 1FFOA 2P5WA 2YPKA 1LEKA 4D0BA 5MEPA 3CCHA 3VFMA 5DEFA 3SCMA 1AKJA 5L2JA 2JCCA 2X70A 3TZVC 3GSUA 3KPNA 2C7UA 3VFPA 3QFJA 1JGEA 3QDGA 3FT2A 5ISZA 3UTQA 3BUYA 5C0FA 3MRNA 2AV1A 1KPVA 1NAMH 4Y4FA 1S8DA 2HJLA 3QUYA 3TBTA 3LKPA 4CVZA 4X6FA 3GMQA 3GMMA 2V2WA 3UTTA 3MRIA 3WL9A 4F7TA 3O3DA 3LN5A 5J6HA 1JUFA 1T1YA 2HN7A 4ZFZA 3RL2A 5GSRA 3DXAA 3O3EA 4JFPA 4WJ5A 3ROLA 3D39A 2VLRA 4NO2A 4HUXA 1YDPA 4WW2C 2GJ6A 5EU3A 1B3JA 3TIEA 1CE6A 1T7WA 2FZ3A 3KPPA 3MRPA 3FOMA 3KPRA 1VADA 1XZ0A 3RWGA 4PRBA 3I6LD 4S0UC 3SKOA 3GSNH 3VXUA 1GZPA 4MX7A 4PG2A 1KPUA 5HGHA 1AGBA 3WUWA 1R3HA 3RWHA 5D7JC 4N0UA 1T22A 4NQVA 1T7VA 2GUOA 5BRZA 4PJXA 1W72A 4L3EA 5H94A 3MR9A 3VFTA 4L4TA 2VLKA 3FQNA 4FTVA 5J6GA 3MRKA 4O2FA 4G43A 1ED3A 4PP8C 4G9FA 2PO6A 4PV8A 2HLAA 5EO0A 4E5XA 4E0RA 1DUZA 1S7QA 1KPRA 3BP7A 1N3NA 4Y16A 3VRJA 1P7QA 3MRCA 4HKJA 1EFXA 4LCYA 3GMRA 1ZT1A 3RL1A 3W0WA 3MREA 5INCA 1PQZA 1T7YA 3BO8A 4L8DA 1BZ9A 4N5EA 3MRLA 4WU7A 1SYSA 1N2RA 3LKNA 4PDCE 1B0GA 3D2UA 3P4MA 3QZWA 3DX7A 2V2XA 4V3DB 1JGDA 3MYJA 3ARDA 5E00A 5B38A 1VGKA 2YEZA 3L3GA 2F54A 3OV6A 3ILPA 3PWNA 1INQA 1HHJA 4PRDA 3GJFA 5HHQA 5IB2A 5C09A 1S7UA 3DX8A 5HHNA 4MQ7A 1A9BA 5EO1A 2A83A 3V5HA 2E7LE 1IM9A 4NO3A 1FZOA 4ZUTA 3REWA 2ESVA 4O2CA 4IRJA 4NO0A 1QSFA 4ELMA 3GSOA 1ZSDA 4CW1A 5C0EA 3P9LA 4Y2DA 3JTCA 1JF1A 1EEZA 4I4WA 3X11A 4U6XA 1YN7A 4X6CA 1U58A 4QOKA 4L3CA 5IEHA 4QRQA 3QUZA 4G42A 4NO5A 4NT6A 3C9NA 4JRYA 1FZMA 4F7PA 5FDWA 3BP4A 3MRBA 4Y4KA 1QEWA 3VFUA 3HCVA 2BSTA 5E8NA 1Z5LA 4L8BA 1FZKA 1OGTA 3LKOA 3I6KA 4PRAA 3PWUA 2RFXA 4MJ6A 2PYEA 2X4PA 3MGTA 4JQVA 4L4VA 4Z78A 4MVBA 4NQEA 1ZHLA 3GMOA 3I6GA 4WO4A 3X13A 4APQA 4Z77A 5AD0A 1WBYA 4PRNA 2VLJA 5F1NA 2NX5A 3BXNA 3ARFA 3BGMA 2D31A 5DEGA 1LP9A 3GSVA 4NHUE 5D5MA 1VACA 1G7QA 2GT9A 3ARGA 3KPQA 4PJHA 3RZCA 4NQXA 3JTSA 1MHCA 3MRHA 3AU1A 1L8JA 2ZOLA 2FIKA 2X4TA 5IROA 3JVGA 4JRXA 2GTWA 1S9YA 4QRUA 4U1SA 1ZVSA 1S7WA 3DX6A 5F9JA 4PREA 3E2HA 1BD2A 4JQXA 2WY3A 1A1NA 1AGDA 1S7SA 1I4FA 3TVMA 2CIKA 3LN4A 4N8VA 4PJEA 1X7QA 4O2EA 5EUOA 3RTQA 2F53A 3ES6A 1WBXA 5D7IA 1S7RA 3CDGA 1ZT7A 1FFNA 4PRHA 1JPFA 4U1MA 5C0AA 5C0BA 3T8XA 3TBSA 3ECBA 3QUKA 5B39A 2Q7YA 3D25A 2MHAA 4PJFA 4XXCA 5HYJA 4JFFA 1RK1A 2BSRA 1KJ3H 1OSZA 1I1FA 3HUJA 3PWLA 3TO2A 1A9EA 2UWEA 5EU6A 4HV8A 1BIIA 4IHOA 3U0PA 3E3QA 4F7CA 3GSRA 2H26A 3P4OA 2X4OA 1IM3A 2YPLA 5C0JA 1HSAA 4NSKA 1ZT4A 3BEVA 4NQDA 3X12A 4LCCC 1ZAGA 4MNQA 5IB1A 5C9JA 1QR1A 4V3EB 3LKSA 5D2NA 3SKMA 3TN0A 5FA3A 3QFDA 1E28A 3VFOA 1M05A 2BNQA 1K8DA 3VXNA 3BWAA 1W0VA 3RWDA 1W0WA 5SWSA 2H6PA 5C0GA 3B3IA 1DUYA 4QRSA 4EI5A 1EEYA 3MA7A 5IB3A 3FFCA 3TBVA 3FQRA 3VRIA 3V5KA 1FFPA 3KWWA 5INDA 3KLAA 5MEQA 1QO3A 3BH8A 4EUPA 4U6YA 4IRSA 1HHGA 5EU5A 3KXFA 3E6HA 1YN6A 3L3IA 3VWJA 3MV8A 3FT4A 4ZUVA 3PWPA 4WU5A 5HHMA 1QLFA 3X14A 3BHBA 5IVXA 1FO0H 1FZJA 3B6SA 4PGBA 3GMNA 5SWQA 3VFNA 3MRGA 5BS0A 3KPMA 1I7UA 1LD9A 4PJDA 4ZAKA 4ONOA 2X4SA 3E6FA 1T1WA 2NW3A 4Z76A 3UPRA 1ZHKA 3IT8D 5FA4A 3OX8A 3FQWA 4HS3A 3GSXA 4NNYA 4X6EA 1T1ZA 3P73A 3KPLA 3ROOA 4U1NA 4D0DA 1KBGH 3SJVA 2VE6A 1QSEA 4G59A 1T7XA 1GZQA 1CD1A 3VFRA 1P4LA 1KJ2H 4L8CA 5BXFA 2FYYA 4PV9A 3RWJA 1TVBA 5HGDA 1ZHBA 4K7FA 4X6DA 3TO4A 4NNXA 4WDIA 3HLAA 3P77A 2FWOA 2GITA 5MENA 3AM8A 3QUXA 4G9DA 2BVPA 3VFVA 3BH9A 3L9RA 4JFDA 1C16A 1E27A 3O3BA 1S9WA 5EFIA 1LDPH 1AGEA 1S7VA 1G7PA 3FQXA 2VLLA 2CLRA 2ZSWA 2AXGA 2BCKA 3M1BA 5C0CA 5ACZA 1Q94A 4K71B 1ZHNA 1AGFA 4MXQA 5E8PA 1MWAH 5HGAA 1HSBA 3DBXA 1ONQA 5IB4A 2BVOA 5C0DA 4PJ7A 4PJCA 5C08A 2X4NA 3M17A 4N0CA 1RK0A 3OXSA 1ZS8A 4PJAA 2X4UA 1HHIA 1LQVA 5FKPA 1I7TA 3VXPA 5JHDA 3QQ3A 3TBYA 5SWZA 3KYOA 5BJTA 3SPVA 4ZUSA 3H9HA 3O3AA 1QRNA 1I1AA 3GIVA 4Y4HA 1MHEA 4G8GA 4I48A 4PJ9A 1KCGC 1UXWA 1T80A 3FQUA 4G8IA 3FRUA 4ZUWA 3DTXA 5E8OA 3MROA 2BSSA 3VXMA 4PR5A 1LEGA 3SDDA 4JFEA 1EXUA 1P1ZA 3KYNA 1UQSA 1DE4A 3GSWA 2DYPA 3FQTA 3TA3A 1HYRC 1A1MA 4PG9A 1T7ZA 2OI9A 3LV3A 2GAZA 2XFXA 4UQ2A 3HE6A 3TBWA 4L9LC 2P5EA 3UBXA 3D3VA 4PJ5A 4PRPA 3VWKA 1UXSA 1SYVA 3CPLA 3L3HA 3QDMA 3V5DA 4PJBA 3QQ4A 2VABA 5D2LA 3GMPA 3PABA 1LK2A 4LNRA 1KJVA 1QVOA 3TF7A 3VXSA 3RWEA 1T1XA 1N5AA 2CLVA 2AKRA 5HHPA 3WS6A 1JHTA 3QULA 1G6RH 5GSVA 3O4LA 2AK4A 2X4QA 1S9XA 2OL3H 4PGDA 4L8SC 3FTGA 4N0FA 4U1IA 5D9SA 3SDAA 3HPJA 3BVNA 3VH8A 3VFWA 1KJMA 2AXFA 1JFMA 3AREA 4GUPA 3OXRA 5EOTA 3RUGA 3ERYA 4WUUA 3LKQA 3CC5A 4F7MA 3VXOA 1A1OA 3L3JA 1WBZA 3RWIA 4D0CA 3FT3A 3WS3A 3H9SA 3MRJA 3FONA 5ENWA 3P9MA 3QEQA 5E9DA 4EN3C 2AV7A 4F7EA 1N59A 3LKRA 3BEWA 4MNGA 1I7RA 1TMCA 1S7XA 4HX1A 4U1HA 1OF2A 1OGAA 2ZOKA 3HE7A 4PJGA 3RWCA 3SDXA 3IXAA 4PRIA 3CVHA 3JTTA 1B0RA 3TIDA 3BW9A 4ZUUA 5MEOA 1I1YA 1T21A 4IIQC 2HJKA 4LHUA 1JPGA 1A6ZA 3D18A 3L3DA 3MGOA 5D7LA 1NEZA 4JFOA 2VAAA 5HHOA 4JFQA 3WLBA 3VXRA 3GMLA 3KPOA 1AGCA 3BZFA 5DDHA 5HGBA 3G08A 4MJIA
chains in the Genus database with same CATH superfamily
3DMMA 5F1IA 1XR8A 3PQYA 3TFKA 1CG9A 4PGCA 3PWVA 1FG2A 4U1LA 4NQCA 4GKSA 3MRQA 4CVXA 4HUVA 5EU4A 1XH3A 3MV7A 1QQDA 3MRDA 5C07A 5F7DA 3MRMA 2F74A 4LCWA 5C0IA 5IEKA 1TVHA 4U1JA 4FFEX 4HUUA 3FOLA 1K5NA 3PWJA 4WWKC 1S7TA 5L2KA 1MI5A 1T20A 3MRRA 3TPUE 1JE6A 1HHHA 2FO4A 5MERA 1AO7A 4QRTA 4GKNA 3CZFA 4UQ3A 5E6IC 4U1KA 3VFSA 2CKBH 2CLZA 1RJYA 3MRFA 3QDJA 1KTLA 2XPGA 4QRPA 5IB5A 3T1FA 1HOCA 2J8UA 3O8XA 4PGEA 2ZSVA 4HWZA 3I0TA 3NFNA 2GTZA 3UTSA 1RJZA 3VJ6A 3ARBA 3GSQA 3P4NA 3QI9A 4L29A 3L3KA 3CH1A 5IM7A 3BZEA 3ILQC 3KPSA 2X4RA 4MS8A 3W39A 3MV9A 1HHKA 1XR9A 1T0MA 3C8KA 3VCLA 3O9WA 4QRRA 3H7BA 1M6OA 3SDCA 3HG1A 1DDHA 4PJ8A 3TJHA 1T0NA 4HUWA 3S6CA 2CIIA 2BVQA 3HAEA 3RGVC 5J1AA 3RWFA 4MJ5A 1YPZA 4PJIA 1NANH 2BNRA 1BQHA 1FFOA 2P5WA 2YPKA 1LEKA 4D0BA 5MEPA 3CCHA 3VFMA 5DEFA 3SCMA 1AKJA 5L2JA 2JCCA 2X70A 3TZVC 3GSUA 3KPNA 2C7UA 3VFPA 3QFJA 1JGEA 3QDGA 3FT2A 5ISZA 3UTQA 3BUYA 5C0FA 3MRNA 2AV1A 1KPVA 1NAMH 2IA1A 4Y4FA 1S8DA 2HJLA 3QUYA 3TBTA 3LKPA 4CVZA 4X6FA 3GMQA 3GMMA 2V2WA 3UTTA 3MRIA 3WL9A 4F7TA 3O3DA 3LN5A 5J6HA 1JUFA 1T1YA 2HN7A 4ZFZA 3RL2A 5GSRA 3DXAA 3O3EA 4JFPA 4WJ5A 3ROLA 3D39A 2VLRA 4NO2A 4HUXA 1YDPA 4JO8A 4WW2C 2GJ6A 5EU3A 1B3JA 3TIEA 1CE6A 1T7WA 2FZ3A 3KPPA 3MRPA 3FOMA 3KPRA 1VADA 1XZ0A 3RWGA 4PRBA 3I6LD 4S0UC 3SKOA 3GSNH 3VXUA 1GZPA 4MX7A 4PG2A 1KPUA 5HGHA 1AGBA 3WUWA 1R3HA 3RWHA 5D7JC 4N0UA 1T22A 4NQVA 1T7VA 2GUOA 5BRZA 4PJXA 1W72A 4L3EA 5H94A 3MR9A 3VFTA 4L4TA 2VLKA 3FQNA 4FTVA 5J6GA 3MRKA 4O2FA 4G43A 1ED3A 4PP8C 4G9FA 2PO6A 4PV8A 2HLAA 5EO0A 4E5XA 4E0RA 1DUZA 1S7QA 1KPRA 3BP7A 1N3NA 4Y16A 3VRJA 1P7QA 3MRCA 4HKJA 1EFXA 4LCYA 3GMRA 1ZT1A 3RL1A 3W0WA 3MREA 5INCA 1PQZA 1T7YA 3BO8A 4L8DA 1BZ9A 4N5EA 3MRLA 4WU7A 1SYSA 1N2RA 3LKNA 4PDCE 1B0GA 3D2UA 3P4MA 3QZWA 3DX7A 2V2XA 4V3DB 1JGDA 3MYJA 3ARDA 5E00A 5B38A 1VGKA 2YEZA 3L3GA 2F54A 3OV6A 3ILPA 3PWNA 1INQA 1HHJA 4PRDA 3GJFA 5HHQA 5IB2A 5C09A 1S7UA 3DX8A 5HHNA 4MQ7A 1A9BA 5EO1A 2A83A 3V5HA 2E7LE 1IM9A 4NO3A 1FZOA 4ZUTA 3REWA 2ESVA 4O2CA 4IRJA 4NO0A 1QSFA 4ELMA 3GSOA 1ZSDA 4CW1A 5C0EA 3P9LA 4Y2DA 3JTCA 1JF1A 1EEZA 4I4WA 3X11A 4U6XA 1YN7A 4X6CA 1U58A 4QOKA 4L3CA 5IEHA 4QRQA 3QUZA 4G42A 4NO5A 4NT6A 3C9NA 4JRYA 1FZMA 4F7PA 5FDWA 3BP4A 3MRBA 4Y4KA 1QEWA 3VFUA 3HCVA 2BSTA 5E8NA 1Z5LA 4L8BA 1FZKA 1OGTA 3LKOA 3I6KA 4PRAA 3PWUA 2RFXA 4MJ6A 2PYEA 2X4PA 3MGTA 4JQVA 4L4VA 4Z78A 4MVBA 4NQEA 1ZHLA 3GMOA 3I6GA 4WO4A 3X13A 4APQA 4Z77A 5AD0A 1WBYA 4BKWA 4PRNA 2VLJA 5F1NA 2NX5A 3BXNA 3ARFA 3BGMA 2D31A 5DEGA 1LP9A 3GSVA 4NHUE 5D5MA 1VACA 1G7QA 2GT9A 3ARGA 3KPQA 4PJHA 3RZCA 4NQXA 3JTSA 1MHCA 3MRHA 3AU1A 1L8JA 2ZOLA 2FIKA 2X4TA 5IROA 3JVGA 4JRXA 2GTWA 1S9YA 4QRUA 4U1SA 1ZVSA 1S7WA 3DX6A 5F9JA 4PREA 3E2HA 1BD2A 4JQXA 2WY3A 1A1NA 1AGDA 1S7SA 1I4FA 3TVMA 2CIKA 3LN4A 4N8VA 4PJEA 1X7QA 4O2EA 5EUOA 3RTQA 2F53A 3ES6A 1WBXA 5D7IA 1S7RA 3CDGA 1ZT7A 1FFNA 4PRHA 1JPFA 4U1MA 5C0AA 5C0BA 3T8XA 3TBSA 3ECBA 3QUKA 5B39A 2Q7YA 3D25A 2MHAA 4PJFA 4XXCA 5HYJA 4JFFA 1RK1A 2BSRA 1KJ3H 1OSZA 1I1FA 3HUJA 3PWLA 3TO2A 1A9EA 2UWEA 5EU6A 4HV8A 1BIIA 4IHOA 2NYKA 3E3QA 3U0PA 4F7CA 3GSRA 2H26A 3P4OA 2X4OA 1IM3A 2YPLA 5C0JA 1HSAA 4NSKA 1ZT4A 3BEVA 4NQDA 3X12A 4LCCC 1ZAGA 4MNQA 5IB1A 5C9JA 1QR1A 4V3EB 3LKSA 5D2NA 3SKMA 3TN0A 5FA3A 3QFDA 1E28A 3VFOA 1M05A 2BNQA 1K8DA 3VXNA 3BWAA 1W0VA 3RWDA 1W0WA 5SWSA 2H6PA 5C0GA 3B3IA 1DUYA 4QRSA 4EI5A 1EEYA 3MA7A 5IB3A 3FFCA 3TBVA 3FQRA 3VRIA 3V5KA 1FFPA 3KWWA 5INDA 3KLAA 5MEQA 1QO3A 3BH8A 4EUPA 4U6YA 4IRSA 1HHGA 5EU5A 3KXFA 3E6HA 1YN6A 3L3IA 3VWJA 3MV8A 3FT4A 4ZUVA 3PWPA 4WU5A 5HHMA 1QLFA 3X14A 3BHBA 5IVXA 1FO0H 1FZJA 3B6SA 4PGBA 3GMNA 5SWQA 3VFNA 3MRGA 5BS0A 3KPMA 1I7UA 1LD9A 4PJDA 4ZAKA 4ONOA 2X4SA 3E6FA 1T1WA 2NW3A 4Z76A 3UPRA 1ZHKA 3IT8D 5FA4A 3OX8A 3FQWA 4HS3A 3GSXA 4NNYA 4X6EA 1T1ZA 3P73A 3KPLA 3ROOA 4U1NA 4D0DA 1KBGH 3SJVA 2VE6A 1QSEA 4G59A 1T7XA 1GZQA 1CD1A 3VFRA 1P4LA 1KJ2H 4L8CA 5BXFA 2FYYA 4PV9A 3RWJA 1TVBA 5HGDA 1ZHBA 4K7FA 4X6DA 3TO4A 4NNXA 4WDIA 3HLAA 3P77A 2FWOA 2GITA 5MENA 3AM8A 3QUXA 4G9DA 2BVPA 3VFVA 3BH9A 3L9RA 4JFDA 1C16A 1E27A 3O3BA 1S9WA 5EFIA 1LDPH 1AGEA 1S7VA 1G7PA 3FQXA 2VLLA 2CLRA 2ZSWA 2AXGA 2BCKA 3M1BA 5C0CA 5ACZA 1Q94A 4K71B 1ZHNA 1AGFA 4MXQA 5E8PA 1MWAH 5HGAA 1HSBA 3DBXA 1ONQA 5IB4A 2BVOA 5C0DA 4PJ7A 4PJCA 5C08A 2X4NA 3M17A 4N0CA 1RK0A 3OXSA 1ZS8A 4PJAA 2X4UA 1HHIA 1LQVA 5FKPA 1I7TA 3VXPA 5JHDA 3QQ3A 3TBYA 5SWZA 3KYOA 5BJTA 3SPVA 4ZUSA 3H9HA 3O3AA 1QRNA 1I1AA 3GIVA 4Y4HA 1MHEA 4G8GA 4I48A 4PJ9A 1KCGC 1UXWA 1T80A 3FQUA 4G8IA 3FRUA 4ZUWA 3DTXA 5E8OA 3MROA 2BSSA 3VXMA 4PR5A 1LEGA 3SDDA 4JFEA 1EXUA 1P1ZA 3KYNA 1UQSA 1DE4A 3GSWA 2DYPA 3FQTA 3TA3A 1HYRC 1A1MA 4PG9A 1T7ZA 2OI9A 3LV3A 2GAZA 2XFXA 4UQ2A 3HE6A 3TBWA 4L9LC 2P5EA 3UBXA 3D3VA 4PJ5A 4PRPA 3VWKA 1UXSA 1SYVA 3CPLA 3L3HA 3QDMA 3V5DA 2O5NA 4PJBA 3QQ4A 2VABA 5D2LA 3GMPA 3PABA 1LK2A 4LNRA 1KJVA 1QVOA 3TF7A 3VXSA 3RWEA 1T1XA 1N5AA 2CLVA 2AKRA 4G59C 5HHPA 3WS6A 1JHTA 3QULA 1G6RH 5GSVA 3O4LA 2AK4A 2X4QA 1S9XA 2OL3H 4PGDA 4L8SC 3FTGA 4N0FA 4U1IA 5D9SA 3SDAA 3HPJA 3BVNA 3VH8A 3VFWA 1KJMA 2AXFA 1JFMA 3AREA 4GUPA 3OXRA 5EOTA 3RUGA 3ERYA 4WUUA 3LKQA 3CC5A 4F7MA 3VXOA 1A1OA 3L3JA 1WBZA 3RWIA 4D0CA 3FT3A 3WS3A 3H9SA 3MRJA 3FONA 5ENWA 3P9MA 3QEQA 5E9DA 4EN3C 2AV7A 4F7EA 1N59A 3LKRA 3BEWA 4MNGA 1I7RA 1TMCA 1S7XA 4HX1A 4U1HA 1OF2A 1OGAA 2ZOKA 3HE7A 4PJGA 3RWCA 3SDXA 3IXAA 4PRIA 3CVHA 3JTTA 1B0RA 3TIDA 3BW9A 4ZUUA 5MEOA 1I1YA 1T21A 4IIQC 2HJKA 4LHUA 1JPGA 1A6ZA 3D18A 3L3DA 3MGOA 5D7LA 1NEZA 4JFOA 2VAAA 5HHOA 4JFQA 3WLBA 3VXRA 3GMLA 3KPOA 1AGCA 3BZFA 5DDHA 5HGBA 3G08A 4MJIA
chains in the Genus database with same CATH topology
3DMMA 5F1IA 1XR8A 3PQYA 3TFKA 1CG9A 4PGCA 3PWVA 1FG2A 4U1LA 4NQCA 4GKSA 3MRQA 4CVXA 4HUVA 5EU4A 1XH3A 3MV7A 1QQDA 3MRDA 5C07A 5F7DA 3MRMA 2F74A 4LCWA 5C0IA 5IEKA 1TVHA 4U1JA 4FFEX 4HUUA 3FOLA 1K5NA 3PWJA 4WWKC 1S7TA 5L2KA 1MI5A 1T20A 3MRRA 3TPUE 1JE6A 1HHHA 2FO4A 5MERA 1AO7A 4QRTA 4GKNA 3CZFA 4UQ3A 5E6IC 4U1KA 3VFSA 2CKBH 2CLZA 1RJYA 3MRFA 3QDJA 1KTLA 2XPGA 4QRPA 5IB5A 3T1FA 1HOCA 2J8UA 3O8XA 4PGEA 2ZSVA 4HWZA 3NFNA 2GTZA 3UTSA 1RJZA 3VJ6A 3ARBA 3GSQA 3P4NA 3QI9A 4L29A 3L3KA 3CH1A 5IM7A 3BZEA 3ILQC 3KPSA 2X4RA 4MS8A 3W39A 3MV9A 1HHKA 1XR9A 1T0MA 3C8KA 3VCLA 3O9WA 4QRRA 3H7BA 1M6OA 3SDCA 3HG1A 1DDHA 4PJ8A 3TJHA 1T0NA 4HUWA 3S6CA 2CIIA 2BVQA 3HAEA 3RGVC 5J1AA 3RWFA 4MJ5A 1YPZA 4PJIA 1NANH 2BNRA 1BQHA 1FFOA 2P5WA 2YPKA 1LEKA 4D0BA 5MEPA 3CCHA 3VFMA 5DEFA 3SCMA 1AKJA 5L2JA 2JCCA 2X70A 3TZVC 3GSUA 3KPNA 2C7UA 3VFPA 3QFJA 1JGEA 3QDGA 3FT2A 5ISZA 3UTQA 3BUYA 5C0FA 3MRNA 2AV1A 1KPVA 1NAMH 4Y4FA 1S8DA 2HJLA 3QUYA 3TBTA 3LKPA 4CVZA 4X6FA 3GMQA 3GMMA 2V2WA 3UTTA 3MRIA 3WL9A 4F7TA 3O3DA 3LN5A 5J6HA 1JUFA 1T1YA 2HN7A 4ZFZA 3RL2A 5GSRA 3DXAA 3O3EA 4JFPA 4WJ5A 3ROLA 3D39A 2VLRA 4NO2A 4HUXA 1YDPA 4WW2C 2GJ6A 5EU3A 1B3JA 3TIEA 1CE6A 1T7WA 2FZ3A 3KPPA 3MRPA 3FOMA 3KPRA 1VADA 1XZ0A 3RWGA 4PRBA 3I6LD 4S0UC 3SKOA 3GSNH 3VXUA 1GZPA 4MX7A 4PG2A 1KPUA 5HGHA 1AGBA 3WUWA 1R3HA 3RWHA 5D7JC 4N0UA 1T22A 4NQVA 1T7VA 2GUOA 5BRZA 4PJXA 1W72A 4L3EA 5H94A 3MR9A 3VFTA 4L4TA 2VLKA 3FQNA 4FTVA 5J6GA 3MRKA 4O2FA 4G43A 1ED3A 4PP8C 4G9FA 2PO6A 4PV8A 2HLAA 5EO0A 4E5XA 4E0RA 1DUZA 1S7QA 1KPRA 3BP7A 1N3NA 4Y16A 3VRJA 1P7QA 3MRCA 4HKJA 1EFXA 4LCYA 3GMRA 1ZT1A 3RL1A 3W0WA 3MREA 5INCA 1PQZA 1T7YA 3BO8A 4L8DA 1BZ9A 4N5EA 3MRLA 4WU7A 1SYSA 1N2RA 3LKNA 4PDCE 1B0GA 3D2UA 3P4MA 3QZWA 3DX7A 2V2XA 4V3DB 1JGDA 3MYJA 3ARDA 5E00A 5B38A 1VGKA 2YEZA 3L3GA 2F54A 3OV6A 3ILPA 3PWNA 1INQA 1HHJA 4PRDA 3GJFA 5HHQA 5IB2A 5C09A 1S7UA 3DX8A 5HHNA 4MQ7A 1A9BA 5EO1A 2A83A 3V5HA 2E7LE 1IM9A 4NO3A 1FZOA 4ZUTA 3REWA 2ESVA 4O2CA 4IRJA 4NO0A 1QSFA 4ELMA 3GSOA 1ZSDA 4CW1A 5C0EA 3P9LA 4Y2DA 3JTCA 1JF1A 1EEZA 4I4WA 3X11A 4U6XA 1YN7A 4X6CA 1U58A 4QOKA 4L3CA 5IEHA 4QRQA 3QUZA 4G42A 4NO5A 4NT6A 3C9NA 4JRYA 1FZMA 4F7PA 5FDWA 3BP4A 3MRBA 4Y4KA 1QEWA 3VFUA 3HCVA 2BSTA 5E8NA 1Z5LA 4L8BA 1FZKA 1OGTA 3LKOA 3I6KA 4PRAA 3PWUA 2RFXA 4MJ6A 2PYEA 2X4PA 3MGTA 4JQVA 4L4VA 4Z78A 4MVBA 4NQEA 1ZHLA 3GMOA 3I6GA 4WO4A 3X13A 4APQA 4Z77A 5AD0A 1WBYA 4PRNA 2VLJA 5F1NA 2NX5A 3BXNA 3ARFA 3BGMA 2D31A 5DEGA 1LP9A 3GSVA 4NHUE 5D5MA 1VACA 1G7QA 2GT9A 3ARGA 3KPQA 4PJHA 3RZCA 4NQXA 3JTSA 1MHCA 3MRHA 3AU1A 1L8JA 2ZOLA 2FIKA 2X4TA 5IROA 3JVGA 4JRXA 2GTWA 1S9YA 4QRUA 4U1SA 1ZVSA 1S7WA 3DX6A 5F9JA 4PREA 3E2HA 1BD2A 4JQXA 2WY3A 1A1NA 1AGDA 1S7SA 1I4FA 3TVMA 2CIKA 3LN4A 4N8VA 4PJEA 1X7QA 4O2EA 5EUOA 3RTQA 2F53A 3ES6A 1WBXA 5D7IA 1S7RA 3CDGA 1ZT7A 1FFNA 4PRHA 1JPFA 4U1MA 5C0AA 5C0BA 3T8XA 3TBSA 3ECBA 3QUKA 5B39A 2Q7YA 3D25A 2MHAA 4PJFA 4XXCA 5HYJA 4JFFA 1RK1A 2BSRA 1KJ3H 1OSZA 1I1FA 3HUJA 3PWLA 3TO2A 1A9EA 2UWEA 5EU6A 4HV8A 1BIIA 4IHOA 3U0PA 3E3QA 4F7CA 3GSRA 2H26A 3P4OA 2X4OA 1IM3A 2YPLA 5C0JA 1HSAA 4NSKA 1ZT4A 3BEVA 4NQDA 3X12A 4LCCC 1ZAGA 4MNQA 5IB1A 5C9JA 1QR1A 4V3EB 3LKSA 5D2NA 3SKMA 3TN0A 5FA3A 3QFDA 1E28A 3VFOA 1M05A 2BNQA 1K8DA 3VXNA 3BWAA 1W0VA 3RWDA 1W0WA 5SWSA 2H6PA 5C0GA 3B3IA 1DUYA 4QRSA 4EI5A 1EEYA 3MA7A 5IB3A 3FFCA 3TBVA 3FQRA 3VRIA 3V5KA 1FFPA 3KWWA 5INDA 3KLAA 5MEQA 1QO3A 3BH8A 4EUPA 4U6YA 4IRSA 1HHGA 5EU5A 3KXFA 3E6HA 1YN6A 3L3IA 3VWJA 3MV8A 3FT4A 4ZUVA 3PWPA 4WU5A 5HHMA 1QLFA 3X14A 3BHBA 5IVXA 1FO0H 1FZJA 3B6SA 4PGBA 3GMNA 5SWQA 3VFNA 3MRGA 5BS0A 3KPMA 1I7UA 1LD9A 4PJDA 4ZAKA 4ONOA 2X4SA 3E6FA 1T1WA 2NW3A 4Z76A 3UPRA 1ZHKA 3IT8D 5FA4A 3OX8A 3FQWA 4HS3A 3GSXA 4NNYA 4X6EA 1T1ZA 3P73A 3KPLA 3ROOA 4U1NA 4D0DA 1KBGH 3SJVA 2VE6A 1QSEA 4G59A 1T7XA 1GZQA 1CD1A 3VFRA 1P4LA 1KJ2H 4L8CA 5BXFA 2FYYA 4PV9A 3RWJA 1TVBA 5HGDA 1ZHBA 4K7FA 4X6DA 3TO4A 4NNXA 4WDIA 3HLAA 3P77A 2FWOA 2GITA 5MENA 3AM8A 3QUXA 4G9DA 2BVPA 3VFVA 3BH9A 3L9RA 4JFDA 1C16A 1E27A 3O3BA 1S9WA 5EFIA 1LDPH 1AGEA 1S7VA 1G7PA 3FQXA 2VLLA 2CLRA 2ZSWA 2AXGA 2BCKA 3M1BA 5C0CA 5ACZA 1Q94A 4K71B 1ZHNA 1AGFA 4MXQA 5E8PA 1MWAH 5HGAA 1HSBA 3DBXA 1ONQA 5IB4A 2BVOA 5C0DA 4PJ7A 4PJCA 5C08A 2X4NA 3M17A 4N0CA 1RK0A 3OXSA 1ZS8A 4PJAA 2X4UA 1HHIA 1LQVA 5FKPA 1I7TA 3VXPA 5JHDA 3QQ3A 3TBYA 5SWZA 3KYOA 5BJTA 3SPVA 4ZUSA 3H9HA 3O3AA 1QRNA 1I1AA 3GIVA 4Y4HA 1MHEA 4G8GA 4I48A 4PJ9A 1KCGC 1UXWA 1T80A 3FQUA 4G8IA 3FRUA 4ZUWA 3DTXA 5E8OA 3MROA 2BSSA 3VXMA 4PR5A 1LEGA 3SDDA 4JFEA 1EXUA 1P1ZA 3KYNA 1UQSA 1DE4A 3GSWA 2DYPA 3FQTA 3TA3A 1HYRC 1A1MA 4PG9A 1T7ZA 2OI9A 3LV3A 2GAZA 2XFXA 4UQ2A 3HE6A 3TBWA 4L9LC 2P5EA 3UBXA 3D3VA 4PJ5A 4PRPA 3VWKA 1UXSA 1SYVA 3CPLA 3L3HA 3QDMA 3V5DA 4PJBA 3QQ4A 2VABA 5D2LA 3GMPA 3PABA 1LK2A 4LNRA 1KJVA 1QVOA 3TF7A 3VXSA 3RWEA 1T1XA 1N5AA 2CLVA 2AKRA 5HHPA 3WS6A 1JHTA 3QULA 1G6RH 5GSVA 3O4LA 2AK4A 2X4QA 1S9XA 2OL3H 4PGDA 4L8SC 3FTGA 4N0FA 4U1IA 5D9SA 3SDAA 3HPJA 3BVNA 3VH8A 3VFWA 1KJMA 2AXFA 1JFMA 3AREA 4GUPA 3OXRA 5EOTA 3RUGA 3ERYA 4WUUA 3LKQA 3CC5A 4F7MA 3VXOA 1A1OA 3L3JA 1WBZA 3RWIA 4D0CA 3FT3A 3WS3A 3H9SA 3MRJA 3FONA 5ENWA 3P9MA 3QEQA 5E9DA 4EN3C 2AV7A 4F7EA 1N59A 3LKRA 3BEWA 4MNGA 1I7RA 1TMCA 1S7XA 4HX1A 4U1HA 1OF2A 1OGAA 2ZOKA 3HE7A 4PJGA 3RWCA 3SDXA 3IXAA 4PRIA 3CVHA 3JTTA 1B0RA 3TIDA 3BW9A 4ZUUA 5MEOA 1I1YA 1T21A 4IIQC 2HJKA 4LHUA 1JPGA 1A6ZA 3D18A 3L3DA 3MGOA 5D7LA 1NEZA 4JFOA 2VAAA 5HHOA 4JFQA 3WLBA 3VXRA 3GMLA 3KPOA 1AGCA 3BZFA 5DDHA 5HGBA 3G08A 4MJIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DMM A;  5F1I A;  1XR8 A;  3PQY A;  3TFK A;  1CG9 A;  4PGC A;  3PWV A;  1FG2 A;  4U1L A;  4NQC A;  4GKS A;  3MRQ A;  4CVX A;  4HUV A;  5EU4 A;  1XH3 A;  3MV7 A;  1QQD A;  3MRD A;  5C07 A;  5F7D A;  3MRM A;  2F74 A;  4LCW A;  5C0I A;  5IEK A;  1TVH A;  4U1J A;  4FFE X;  4HUU A;  3FOL A;  1K5N A;  3PWJ A;  4WWK C;  1S7T A;  5L2K A;  1MI5 A;  1T20 A;  3MRR A;  3TPU E;  1JE6 A;  1HHH A;  2FO4 A;  5MER A;  1AO7 A;  4QRT A;  4GKN A;  3CZF A;  4UQ3 A;  5E6I C;  4U1K A;  3VFS A;  2CKB H;  2CLZ A;  1RJY A;  3MRF A;  3QDJ A;  1KTL A;  2XPG A;  4QRP A;  5IB5 A;  3T1F A;  1HOC A;  2J8U A;  3O8X A;  4PGE A;  2ZSV A;  4HWZ A;  3NFN A;  2GTZ A;  3UTS A;  1RJZ A;  3VJ6 A;  3ARB A;  3GSQ A;  3P4N A;  3QI9 A;  4L29 A;  3L3K A;  3CH1 A;  5IM7 A;  3BZE A;  3ILQ C;  3KPS A;  2X4R A;  4MS8 A;  3W39 A;  3MV9 A;  1HHK A;  1XR9 A;  1T0M A;  3C8K A;  3VCL A;  3O9W A;  4QRR A;  3H7B A;  1M6O A;  3SDC A;  3HG1 A;  1DDH A;  4PJ8 A;  3TJH A;  1T0N A;  4HUW A;  3S6C A;  2CII A;  2BVQ A;  3HAE A;  3RGV C;  5J1A A;  3RWF A;  4MJ5 A;  1YPZ A;  4PJI A;  1NAN H;  2BNR A;  1BQH A;  1FFO A;  2P5W A;  2YPK A;  1LEK A;  4D0B A;  5MEP A;  3CCH A;  3VFM A;  5DEF A;  3SCM A;  1AKJ A;  5L2J A;  2JCC A;  2X70 A;  3TZV C;  3GSU A;  3KPN A;  2C7U A;  3VFP A;  3QFJ A;  1JGE A;  3QDG A;  3FT2 A;  5ISZ A;  3UTQ A;  3BUY A;  5C0F A;  3MRN A;  2AV1 A;  1KPV A;  1NAM H;  4Y4F A;  1S8D A;  2HJL A;  3QUY A;  3TBT A;  3LKP A;  4CVZ A;  4X6F A;  3GMQ A;  3GMM A;  2V2W A;  3UTT A;  3MRI A;  3WL9 A;  4F7T A;  3O3D A;  3LN5 A;  5J6H A;  1JUF A;  1T1Y A;  2HN7 A;  4ZFZ A;  3RL2 A;  5GSR A;  3DXA A;  3O3E A;  4JFP A;  4WJ5 A;  3ROL A;  3D39 A;  2VLR A;  4NO2 A;  4HUX A;  1YDP A;  4WW2 C;  2GJ6 A;  5EU3 A;  1B3J A;  3TIE A;  1CE6 A;  1T7W A;  2FZ3 A;  3KPP A;  3MRP A;  3FOM A;  3KPR A;  1VAD A;  1XZ0 A;  3RWG A;  4PRB A;  3I6L D;  4S0U C;  3SKO A;  3GSN H;  3VXU A;  1GZP A;  4MX7 A;  4PG2 A;  1KPU A;  5HGH A;  1AGB A;  3WUW A;  1R3H A;  3RWH A;  5D7J C;  4N0U A;  1T22 A;  4NQV A;  1T7V A;  2GUO A;  5BRZ A;  4PJX A;  1W72 A;  4L3E A;  5H94 A;  3MR9 A;  3VFT A;  4L4T A;  2VLK A;  3FQN A;  4FTV A;  5J6G A;  3MRK A;  4O2F A;  4G43 A;  1ED3 A;  4PP8 C;  4G9F A;  2PO6 A;  4PV8 A;  2HLA A;  5EO0 A;  4E5X A;  4E0R A;  1DUZ A;  1S7Q A;  1KPR A;  3BP7 A;  1N3N A;  4Y16 A;  3VRJ A;  1P7Q A;  3MRC A;  4HKJ A;  1EFX A;  4LCY A;  3GMR A;  1ZT1 A;  3RL1 A;  3W0W A;  3MRE A;  5INC A;  1PQZ A;  1T7Y A;  3BO8 A;  4L8D A;  1BZ9 A;  4N5E A;  3MRL A;  4WU7 A;  1SYS A;  1N2R A;  3LKN A;  4PDC E;  1B0G A;  3D2U A;  3P4M A;  3QZW A;  3DX7 A;  2V2X A;  4V3D B;  1JGD A;  3MYJ A;  3ARD A;  5E00 A;  5B38 A;  1VGK A;  2YEZ A;  3L3G A;  2F54 A;  3OV6 A;  3ILP A;  3PWN A;  1INQ A;  1HHJ A;  4PRD A;  3GJF A;  5HHQ A;  5IB2 A;  5C09 A;  1S7U A;  3DX8 A;  5HHN A;  4MQ7 A;  1A9B A;  5EO1 A;  2A83 A;  3V5H A;  2E7L E;  1IM9 A;  4NO3 A;  1FZO A;  4ZUT A;  3REW A;  2ESV A;  4O2C A;  4IRJ A;  4NO0 A;  1QSF A;  4ELM A;  3GSO A;  1ZSD A;  4CW1 A;  5C0E A;  3P9L A;  4Y2D A;  3JTC A;  1JF1 A;  1EEZ A;  4I4W A;  3X11 A;  4U6X A;  1YN7 A;  4X6C A;  1U58 A;  4QOK A;  4L3C A;  5IEH A;  4QRQ A;  3QUZ A;  4G42 A;  4NO5 A;  4NT6 A;  3C9N A;  4JRY A;  1FZM A;  4F7P A;  5FDW A;  3BP4 A;  3MRB A;  4Y4K A;  1QEW A;  3VFU A;  3HCV A;  2BST A;  5E8N A;  1Z5L A;  4L8B A;  1FZK A;  1OGT A;  3LKO A;  3I6K A;  4PRA A;  3PWU A;  2RFX A;  4MJ6 A;  2PYE A;  2X4P A;  3MGT A;  4JQV A;  4L4V A;  4Z78 A;  4MVB A;  4NQE A;  1ZHL A;  3GMO A;  3I6G A;  4WO4 A;  3X13 A;  4APQ A;  4Z77 A;  5AD0 A;  1WBY A;  4PRN A;  2VLJ A;  5F1N A;  2NX5 A;  3BXN A;  3ARF A;  3BGM A;  2D31 A;  5DEG A;  1LP9 A;  3GSV A;  4NHU E;  5D5M A;  1VAC A;  1G7Q A;  2GT9 A;  3ARG A;  3KPQ A;  4PJH A;  3RZC A;  4NQX A;  3JTS A;  1MHC A;  3MRH A;  3AU1 A;  1L8J A;  2ZOL A;  2FIK A;  2X4T A;  5IRO A;  3JVG A;  4JRX A;  2GTW A;  1S9Y A;  4QRU A;  4U1S A;  1ZVS A;  1S7W A;  3DX6 A;  5F9J A;  4PRE A;  3E2H A;  1BD2 A;  4JQX A;  2WY3 A;  1A1N A;  1AGD A;  1S7S A;  1I4F A;  3TVM A;  2CIK A;  3LN4 A;  4N8V A;  4PJE A;  1X7Q A;  4O2E A;  5EUO A;  3RTQ A;  2F53 A;  3ES6 A;  1WBX A;  5D7I A;  1S7R A;  3CDG A;  1ZT7 A;  1FFN A;  4PRH A;  1JPF A;  4U1M A;  5C0A A;  5C0B A;  3T8X A;  3TBS A;  3ECB A;  3QUK A;  5B39 A;  2Q7Y A;  3D25 A;  2MHA A;  4PJF A;  4XXC A;  5HYJ A;  4JFF A;  1RK1 A;  2BSR A;  1KJ3 H;  1OSZ A;  1I1F A;  3HUJ A;  3PWL A;  3TO2 A;  1A9E A;  2UWE A;  5EU6 A;  4HV8 A;  1BII A;  4IHO A;  3U0P A;  3E3Q A;  4F7C A;  3GSR A;  2H26 A;  3P4O A;  2X4O A;  1IM3 A;  2YPL A;  5C0J A;  1HSA A;  4NSK A;  1ZT4 A;  3BEV A;  4NQD A;  3X12 A;  4LCC C;  1ZAG A;  4MNQ A;  5IB1 A;  5C9J A;  1QR1 A;  4V3E B;  3LKS A;  5D2N A;  3SKM A;  3TN0 A;  5FA3 A;  3QFD A;  1E28 A;  3VFO A;  1M05 A;  2BNQ A;  1K8D A;  3VXN A;  3BWA A;  1W0V A;  3RWD A;  1W0W A;  5SWS A;  2H6P A;  5C0G A;  3B3I A;  1DUY A;  4QRS A;  4EI5 A;  1EEY A;  3MA7 A;  5IB3 A;  3FFC A;  3TBV A;  3FQR A;  3VRI A;  3V5K A;  1FFP A;  3KWW A;  5IND A;  3KLA A;  5MEQ A;  1QO3 A;  3BH8 A;  4EUP A;  4U6Y A;  4IRS A;  1HHG A;  5EU5 A;  3KXF A;  3E6H A;  1YN6 A;  3L3I A;  3VWJ A;  3MV8 A;  3FT4 A;  4ZUV A;  3PWP A;  4WU5 A;  5HHM A;  1QLF A;  3X14 A;  3BHB A;  5IVX A;  1FO0 H;  1FZJ A;  3B6S A;  4PGB A;  3GMN A;  5SWQ A;  3VFN A;  3MRG A;  5BS0 A;  3KPM A;  1I7U A;  1LD9 A;  4PJD A;  4ZAK A;  4ONO A;  2X4S A;  3E6F A;  1T1W A;  2NW3 A;  4Z76 A;  3UPR A;  1ZHK A;  3IT8 D;  5FA4 A;  3OX8 A;  3FQW A;  4HS3 A;  3GSX A;  4NNY A;  4X6E A;  1T1Z A;  3P73 A;  3KPL A;  3ROO A;  4U1N A;  4D0D A;  1KBG H;  3SJV A;  2VE6 A;  1QSE A;  4G59 A;  1T7X A;  1GZQ A;  1CD1 A;  3VFR A;  1P4L A;  1KJ2 H;  4L8C A;  5BXF A;  2FYY A;  4PV9 A;  3RWJ A;  1TVB A;  5HGD A;  1ZHB A;  4K7F A;  4X6D A;  3TO4 A;  4NNX A;  4WDI A;  3HLA A;  3P77 A;  2FWO A;  2GIT A;  5MEN A;  3AM8 A;  3QUX A;  4G9D A;  2BVP A;  3VFV A;  3BH9 A;  3L9R A;  4JFD A;  1C16 A;  1E27 A;  3O3B A;  1S9W A;  5EFI A;  1LDP H;  1AGE A;  1S7V A;  1G7P A;  3FQX A;  2VLL A;  2CLR A;  2ZSW A;  2AXG A;  2BCK A;  3M1B A;  5C0C A;  5ACZ A;  1Q94 A;  4K71 B;  1ZHN A;  1AGF A;  4MXQ A;  5E8P A;  1MWA H;  5HGA A;  1HSB A;  3DBX A;  1ONQ A;  5IB4 A;  2BVO A;  5C0D A;  4PJ7 A;  4PJC A;  5C08 A;  2X4N A;  3M17 A;  4N0C A;  1RK0 A;  3OXS A;  1ZS8 A;  4PJA A;  2X4U A;  1HHI A;  1LQV A;  5FKP A;  1I7T A;  3VXP A;  5JHD A;  3QQ3 A;  3TBY A;  5SWZ A;  3KYO A;  5BJT A;  3SPV A;  4ZUS A;  3H9H A;  3O3A A;  1QRN A;  1I1A A;  3GIV A;  4Y4H A;  1MHE A;  4G8G A;  4I48 A;  4PJ9 A;  1KCG C;  1UXW A;  1T80 A;  3FQU A;  4G8I A;  3FRU A;  4ZUW A;  3DTX A;  5E8O A;  3MRO A;  2BSS A;  3VXM A;  4PR5 A;  1LEG A;  3SDD A;  4JFE A;  1EXU A;  1P1Z A;  3KYN A;  1UQS A;  1DE4 A;  3GSW A;  2DYP A;  3FQT A;  3TA3 A;  1HYR C;  1A1M A;  4PG9 A;  1T7Z A;  2OI9 A;  3LV3 A;  2GAZ A;  2XFX A;  4UQ2 A;  3HE6 A;  3TBW A;  4L9L C;  2P5E A;  3UBX A;  3D3V A;  4PJ5 A;  4PRP A;  3VWK A;  1UXS A;  1SYV A;  3CPL A;  3L3H A;  3QDM A;  3V5D A;  4PJB A;  3QQ4 A;  2VAB A;  5D2L A;  3GMP A;  3PAB A;  1LK2 A;  4LNR A;  1KJV A;  1QVO A;  3TF7 A;  3VXS A;  3RWE A;  1T1X A;  1N5A A;  2CLV A;  2AKR A;  5HHP A;  3WS6 A;  1JHT A;  3QUL A;  1G6R H;  5GSV A;  3O4L A;  2AK4 A;  2X4Q A;  1S9X A;  2OL3 H;  4PGD A;  4L8S C;  3FTG A;  4N0F A;  4U1I A;  5D9S A;  3SDA A;  3HPJ A;  3BVN A;  3VH8 A;  3VFW A;  1KJM A;  2AXF A;  1JFM A;  3ARE A;  4GUP A;  3OXR A;  5EOT A;  3RUG A;  3ERY A;  4WUU A;  3LKQ A;  3CC5 A;  4F7M A;  3VXO A;  1A1O A;  3L3J A;  1WBZ A;  3RWI A;  4D0C A;  3FT3 A;  3WS3 A;  3H9S A;  3MRJ A;  3FON A;  5ENW A;  3P9M A;  3QEQ A;  5E9D A;  4EN3 C;  2AV7 A;  4F7E A;  1N59 A;  3LKR A;  3BEW A;  4MNG A;  1I7R A;  1TMC A;  1S7X A;  4HX1 A;  4U1H A;  1OF2 A;  1OGA A;  2ZOK A;  3HE7 A;  4PJG A;  3RWC A;  3SDX A;  3IXA A;  4PRI A;  3CVH A;  3JTT A;  1B0R A;  3TID A;  3BW9 A;  4ZUU A;  5MEO A;  1I1Y A;  1T21 A;  4IIQ C;  2HJK A;  4LHU A;  1JPG A;  1A6Z A;  3D18 A;  3L3D A;  3MGO A;  5D7L A;  1NEZ A;  4JFO A;  2VAA A;  5HHO A;  4JFQ A;  3WLB A;  3VXR A;  3GML A;  3KPO A;  1AGC A;  3BZF A;  5DDH A;  5HGB A;  3G08 A;  4MJI A; 
#chains in the Genus database with same CATH topology
 3DMM A;  5F1I A;  1XR8 A;  3PQY A;  3TFK A;  1CG9 A;  4PGC A;  3PWV A;  1FG2 A;  4U1L A;  4NQC A;  4GKS A;  3MRQ A;  4CVX A;  4HUV A;  5EU4 A;  1XH3 A;  3MV7 A;  1QQD A;  3MRD A;  5C07 A;  5F7D A;  3MRM A;  2F74 A;  4LCW A;  5C0I A;  5IEK A;  1TVH A;  4U1J A;  4FFE X;  4HUU A;  3FOL A;  1K5N A;  3PWJ A;  4WWK C;  1S7T A;  5L2K A;  1MI5 A;  1T20 A;  3MRR A;  3TPU E;  1JE6 A;  1HHH A;  2FO4 A;  5MER A;  1AO7 A;  4QRT A;  4GKN A;  3CZF A;  4UQ3 A;  5E6I C;  4U1K A;  3VFS A;  2CKB H;  2CLZ A;  1RJY A;  3MRF A;  3QDJ A;  1KTL A;  2XPG A;  4QRP A;  5IB5 A;  3T1F A;  1HOC A;  2J8U A;  3O8X A;  4PGE A;  2ZSV A;  4HWZ A;  3I0T A;  3NFN A;  2GTZ A;  3UTS A;  1RJZ A;  3VJ6 A;  3ARB A;  3GSQ A;  3P4N A;  3QI9 A;  4L29 A;  3L3K A;  3CH1 A;  5IM7 A;  3BZE A;  3ILQ C;  3KPS A;  2X4R A;  4MS8 A;  3W39 A;  3MV9 A;  1HHK A;  1XR9 A;  1T0M A;  3C8K A;  3VCL A;  3O9W A;  4QRR A;  3H7B A;  1M6O A;  3SDC A;  3HG1 A;  1DDH A;  4PJ8 A;  3TJH A;  1T0N A;  4HUW A;  3S6C A;  2CII A;  2BVQ A;  3HAE A;  3RGV C;  5J1A A;  3RWF A;  4MJ5 A;  1YPZ A;  4PJI A;  1NAN H;  2BNR A;  1BQH A;  1FFO A;  2P5W A;  2YPK A;  1LEK A;  4D0B A;  5MEP A;  3CCH A;  3VFM A;  5DEF A;  3SCM A;  1AKJ A;  5L2J A;  2JCC A;  2X70 A;  3TZV C;  3GSU A;  3KPN A;  2C7U A;  3VFP A;  3QFJ A;  1JGE A;  3QDG A;  3FT2 A;  5ISZ A;  3UTQ A;  3BUY A;  5C0F A;  3MRN A;  2AV1 A;  1KPV A;  1NAM H;  2IA1 A;  4Y4F A;  1S8D A;  2HJL A;  3QUY A;  3TBT A;  3LKP A;  4CVZ A;  4X6F A;  3GMQ A;  3GMM A;  2V2W A;  3UTT A;  3MRI A;  3WL9 A;  4F7T A;  3O3D A;  3LN5 A;  5J6H A;  1JUF A;  1T1Y A;  2HN7 A;  4ZFZ A;  3RL2 A;  5GSR A;  3DXA A;  3O3E A;  4JFP A;  4WJ5 A;  3ROL A;  3D39 A;  2VLR A;  4NO2 A;  4HUX A;  1YDP A;  4JO8 A;  4WW2 C;  2GJ6 A;  5EU3 A;  1B3J A;  3TIE A;  1CE6 A;  1T7W A;  2FZ3 A;  3KPP A;  3MRP A;  3FOM A;  3KPR A;  1VAD A;  1XZ0 A;  3RWG A;  4PRB A;  3I6L D;  4S0U C;  3SKO A;  3GSN H;  3VXU A;  1GZP A;  4MX7 A;  4PG2 A;  1KPU A;  5HGH A;  1AGB A;  3WUW A;  1R3H A;  3RWH A;  5D7J C;  4N0U A;  1T22 A;  4NQV A;  1T7V A;  2GUO A;  5BRZ A;  4PJX A;  1W72 A;  4L3E A;  5H94 A;  3MR9 A;  3VFT A;  4L4T A;  2VLK A;  3FQN A;  4FTV A;  5J6G A;  3MRK A;  4O2F A;  4G43 A;  1ED3 A;  4PP8 C;  4G9F A;  2PO6 A;  4PV8 A;  2HLA A;  5EO0 A;  4E5X A;  4E0R A;  1DUZ A;  1S7Q A;  1KPR A;  3BP7 A;  1N3N A;  4Y16 A;  3VRJ A;  1P7Q A;  3MRC A;  4HKJ A;  1EFX A;  4LCY A;  3GMR A;  1ZT1 A;  3RL1 A;  3W0W A;  3MRE A;  5INC A;  1PQZ A;  1T7Y A;  3BO8 A;  4L8D A;  1BZ9 A;  4N5E A;  3MRL A;  4WU7 A;  1SYS A;  1N2R A;  3LKN A;  4PDC E;  1B0G A;  3D2U A;  3P4M A;  3QZW A;  3DX7 A;  2V2X A;  4V3D B;  1JGD A;  3MYJ A;  3ARD A;  5E00 A;  5B38 A;  1VGK A;  2YEZ A;  3L3G A;  2F54 A;  3OV6 A;  3ILP A;  3PWN A;  1INQ A;  1HHJ A;  4PRD A;  3GJF A;  5HHQ A;  5IB2 A;  5C09 A;  1S7U A;  3DX8 A;  5HHN A;  4MQ7 A;  1A9B A;  5EO1 A;  2A83 A;  3V5H A;  2E7L E;  1IM9 A;  4NO3 A;  1FZO A;  4ZUT A;  3REW A;  2ESV A;  4O2C A;  4IRJ A;  4NO0 A;  1QSF A;  4ELM A;  3GSO A;  1ZSD A;  4CW1 A;  5C0E A;  3P9L A;  4Y2D A;  3JTC A;  1JF1 A;  1EEZ A;  4I4W A;  3X11 A;  4U6X A;  1YN7 A;  4X6C A;  1U58 A;  4QOK A;  4L3C A;  5IEH A;  4QRQ A;  3QUZ A;  4G42 A;  4NO5 A;  4NT6 A;  3C9N A;  4JRY A;  1FZM A;  4F7P A;  5FDW A;  3BP4 A;  3MRB A;  4Y4K A;  1QEW A;  3VFU A;  3HCV A;  2BST A;  5E8N A;  1Z5L A;  4L8B A;  1FZK A;  1OGT A;  3LKO A;  3I6K A;  4PRA A;  3PWU A;  2RFX A;  4MJ6 A;  2PYE A;  2X4P A;  3MGT A;  4JQV A;  4L4V A;  4Z78 A;  4MVB A;  4NQE A;  1ZHL A;  3GMO A;  3I6G A;  4WO4 A;  3X13 A;  4APQ A;  4Z77 A;  5AD0 A;  1WBY A;  4BKW A;  4PRN A;  2VLJ A;  5F1N A;  2NX5 A;  3BXN A;  3ARF A;  3BGM A;  2D31 A;  5DEG A;  1LP9 A;  3GSV A;  4NHU E;  5D5M A;  1VAC A;  1G7Q A;  2GT9 A;  3ARG A;  3KPQ A;  4PJH A;  3RZC A;  4NQX A;  3JTS A;  1MHC A;  3MRH A;  3AU1 A;  1L8J A;  2ZOL A;  2FIK A;  2X4T A;  5IRO A;  3JVG A;  4JRX A;  2GTW A;  1S9Y A;  4QRU A;  4U1S A;  1ZVS A;  1S7W A;  3DX6 A;  5F9J A;  4PRE A;  3E2H A;  1BD2 A;  4JQX A;  2WY3 A;  1A1N A;  1AGD A;  1S7S A;  1I4F A;  3TVM A;  2CIK A;  3LN4 A;  4N8V A;  4PJE A;  1X7Q A;  4O2E A;  5EUO A;  3RTQ A;  2F53 A;  3ES6 A;  1WBX A;  5D7I A;  1S7R A;  3CDG A;  1ZT7 A;  1FFN A;  4PRH A;  1JPF A;  4U1M A;  5C0A A;  5C0B A;  3T8X A;  3TBS A;  3ECB A;  3QUK A;  5B39 A;  2Q7Y A;  3D25 A;  2MHA A;  4PJF A;  4XXC A;  5HYJ A;  4JFF A;  1RK1 A;  2BSR A;  1KJ3 H;  1OSZ A;  1I1F A;  3HUJ A;  3PWL A;  3TO2 A;  1A9E A;  2UWE A;  5EU6 A;  4HV8 A;  1BII A;  4IHO A;  2NYK A;  3E3Q A;  3U0P A;  4F7C A;  3GSR A;  2H26 A;  3P4O A;  2X4O A;  1IM3 A;  2YPL A;  5C0J A;  1HSA A;  4NSK A;  1ZT4 A;  3BEV A;  4NQD A;  3X12 A;  4LCC C;  1ZAG A;  4MNQ A;  5IB1 A;  5C9J A;  1QR1 A;  4V3E B;  3LKS A;  5D2N A;  3SKM A;  3TN0 A;  5FA3 A;  3QFD A;  1E28 A;  3VFO A;  1M05 A;  2BNQ A;  1K8D A;  3VXN A;  3BWA A;  1W0V A;  3RWD A;  1W0W A;  5SWS A;  2H6P A;  5C0G A;  3B3I A;  1DUY A;  4QRS A;  4EI5 A;  1EEY A;  3MA7 A;  5IB3 A;  3FFC A;  3TBV A;  3FQR A;  3VRI A;  3V5K A;  1FFP A;  3KWW A;  5IND A;  3KLA A;  5MEQ A;  1QO3 A;  3BH8 A;  4EUP A;  4U6Y A;  4IRS A;  1HHG A;  5EU5 A;  3KXF A;  3E6H A;  1YN6 A;  3L3I A;  3VWJ A;  3MV8 A;  3FT4 A;  4ZUV A;  3PWP A;  4WU5 A;  5HHM A;  1QLF A;  3X14 A;  3BHB A;  5IVX A;  1FO0 H;  1FZJ A;  3B6S A;  4PGB A;  3GMN A;  5SWQ A;  3VFN A;  3MRG A;  5BS0 A;  3KPM A;  1I7U A;  1LD9 A;  4PJD A;  4ZAK A;  4ONO A;  2X4S A;  3E6F A;  1T1W A;  2NW3 A;  4Z76 A;  3UPR A;  1ZHK A;  3IT8 D;  5FA4 A;  3OX8 A;  3FQW A;  4HS3 A;  3GSX A;  4NNY A;  4X6E A;  1T1Z A;  3P73 A;  3KPL A;  3ROO A;  4U1N A;  4D0D A;  1KBG H;  3SJV A;  2VE6 A;  1QSE A;  4G59 A;  1T7X A;  1GZQ A;  1CD1 A;  3VFR A;  1P4L A;  1KJ2 H;  4L8C A;  5BXF A;  2FYY A;  4PV9 A;  3RWJ A;  1TVB A;  5HGD A;  1ZHB A;  4K7F A;  4X6D A;  3TO4 A;  4NNX A;  4WDI A;  3HLA A;  3P77 A;  2FWO A;  2GIT A;  5MEN A;  3AM8 A;  3QUX A;  4G9D A;  2BVP A;  3VFV A;  3BH9 A;  3L9R A;  4JFD A;  1C16 A;  1E27 A;  3O3B A;  1S9W A;  5EFI A;  1LDP H;  1AGE A;  1S7V A;  1G7P A;  3FQX A;  2VLL A;  2CLR A;  2ZSW A;  2AXG A;  2BCK A;  3M1B A;  5C0C A;  5ACZ A;  1Q94 A;  4K71 B;  1ZHN A;  1AGF A;  4MXQ A;  5E8P A;  1MWA H;  5HGA A;  1HSB A;  3DBX A;  1ONQ A;  5IB4 A;  2BVO A;  5C0D A;  4PJ7 A;  4PJC A;  5C08 A;  2X4N A;  3M17 A;  4N0C A;  1RK0 A;  3OXS A;  1ZS8 A;  4PJA A;  2X4U A;  1HHI A;  1LQV A;  5FKP A;  1I7T A;  3VXP A;  5JHD A;  3QQ3 A;  3TBY A;  5SWZ A;  3KYO A;  5BJT A;  3SPV A;  4ZUS A;  3H9H A;  3O3A A;  1QRN A;  1I1A A;  3GIV A;  4Y4H A;  1MHE A;  4G8G A;  4I48 A;  4PJ9 A;  1KCG C;  1UXW A;  1T80 A;  3FQU A;  4G8I A;  3FRU A;  4ZUW A;  3DTX A;  5E8O A;  3MRO A;  2BSS A;  3VXM A;  4PR5 A;  1LEG A;  3SDD A;  4JFE A;  1EXU A;  1P1Z A;  3KYN A;  1UQS A;  1DE4 A;  3GSW A;  2DYP A;  3FQT A;  3TA3 A;  1HYR C;  1A1M A;  4PG9 A;  1T7Z A;  2OI9 A;  3LV3 A;  2GAZ A;  2XFX A;  4UQ2 A;  3HE6 A;  3TBW A;  4L9L C;  2P5E A;  3UBX A;  3D3V A;  4PJ5 A;  4PRP A;  3VWK A;  1UXS A;  1SYV A;  3CPL A;  3L3H A;  3QDM A;  3V5D A;  2O5N A;  4PJB A;  3QQ4 A;  2VAB A;  5D2L A;  3GMP A;  3PAB A;  1LK2 A;  4LNR A;  1KJV A;  1QVO A;  3TF7 A;  3VXS A;  3RWE A;  1T1X A;  1N5A A;  2CLV A;  2AKR A;  4G59 C;  5HHP A;  3WS6 A;  1JHT A;  3QUL A;  1G6R H;  5GSV A;  3O4L A;  2AK4 A;  2X4Q A;  1S9X A;  2OL3 H;  4PGD A;  4L8S C;  3FTG A;  4N0F A;  4U1I A;  5D9S A;  3SDA A;  3HPJ A;  3BVN A;  3VH8 A;  3VFW A;  1KJM A;  2AXF A;  1JFM A;  3ARE A;  4GUP A;  3OXR A;  5EOT A;  3RUG A;  3ERY A;  4WUU A;  3LKQ A;  3CC5 A;  4F7M A;  3VXO A;  1A1O A;  3L3J A;  1WBZ A;  3RWI A;  4D0C A;  3FT3 A;  3WS3 A;  3H9S A;  3MRJ A;  3FON A;  5ENW A;  3P9M A;  3QEQ A;  5E9D A;  4EN3 C;  2AV7 A;  4F7E A;  1N59 A;  3LKR A;  3BEW A;  4MNG A;  1I7R A;  1TMC A;  1S7X A;  4HX1 A;  4U1H A;  1OF2 A;  1OGA A;  2ZOK A;  3HE7 A;  4PJG A;  3RWC A;  3SDX A;  3IXA A;  4PRI A;  3CVH A;  3JTT A;  1B0R A;  3TID A;  3BW9 A;  4ZUU A;  5MEO A;  1I1Y A;  1T21 A;  4IIQ C;  2HJK A;  4LHU A;  1JPG A;  1A6Z A;  3D18 A;  3L3D A;  3MGO A;  5D7L A;  1NEZ A;  4JFO A;  2VAA A;  5HHO A;  4JFQ A;  3WLB A;  3VXR A;  3GML A;  3KPO A;  1AGC A;  3BZF A;  5DDH A;  5HGB A;  3G08 A;  4MJI A; 
#chains in the Genus database with same CATH homology
 3DMM A;  5F1I A;  1XR8 A;  3PQY A;  3TFK A;  1CG9 A;  4PGC A;  3PWV A;  1FG2 A;  4U1L A;  4NQC A;  4GKS A;  3MRQ A;  4CVX A;  4HUV A;  5EU4 A;  1XH3 A;  3MV7 A;  1QQD A;  3MRD A;  5C07 A;  5F7D A;  3MRM A;  2F74 A;  4LCW A;  5C0I A;  5IEK A;  1TVH A;  4U1J A;  4FFE X;  4HUU A;  3FOL A;  1K5N A;  3PWJ A;  4WWK C;  1S7T A;  5L2K A;  1MI5 A;  1T20 A;  3MRR A;  3TPU E;  1JE6 A;  1HHH A;  2FO4 A;  5MER A;  1AO7 A;  4QRT A;  4GKN A;  3CZF A;  4UQ3 A;  5E6I C;  4U1K A;  3VFS A;  2CKB H;  2CLZ A;  1RJY A;  3MRF A;  3QDJ A;  1KTL A;  2XPG A;  4QRP A;  5IB5 A;  3T1F A;  1HOC A;  2J8U A;  3O8X A;  4PGE A;  2ZSV A;  4HWZ A;  3NFN A;  2GTZ A;  3UTS A;  1RJZ A;  3VJ6 A;  3ARB A;  3GSQ A;  3P4N A;  3QI9 A;  4L29 A;  3L3K A;  3CH1 A;  5IM7 A;  3BZE A;  3ILQ C;  3KPS A;  2X4R A;  4MS8 A;  3W39 A;  3MV9 A;  1HHK A;  1XR9 A;  1T0M A;  3C8K A;  3VCL A;  3O9W A;  4QRR A;  3H7B A;  1M6O A;  3SDC A;  3HG1 A;  1DDH A;  4PJ8 A;  3TJH A;  1T0N A;  4HUW A;  3S6C A;  2CII A;  2BVQ A;  3HAE A;  3RGV C;  5J1A A;  3RWF A;  4MJ5 A;  1YPZ A;  4PJI A;  1NAN H;  2BNR A;  1BQH A;  1FFO A;  2P5W A;  2YPK A;  1LEK A;  4D0B A;  5MEP A;  3CCH A;  3VFM A;  5DEF A;  3SCM A;  1AKJ A;  5L2J A;  2JCC A;  2X70 A;  3TZV C;  3GSU A;  3KPN A;  2C7U A;  3VFP A;  3QFJ A;  1JGE A;  3QDG A;  3FT2 A;  5ISZ A;  3UTQ A;  3BUY A;  5C0F A;  3MRN A;  2AV1 A;  1KPV A;  1NAM H;  4Y4F A;  1S8D A;  2HJL A;  3QUY A;  3TBT A;  3LKP A;  4CVZ A;  4X6F A;  3GMQ A;  3GMM A;  2V2W A;  3UTT A;  3MRI A;  3WL9 A;  4F7T A;  3O3D A;  3LN5 A;  5J6H A;  1JUF A;  1T1Y A;  2HN7 A;  4ZFZ A;  3RL2 A;  5GSR A;  3DXA A;  3O3E A;  4JFP A;  4WJ5 A;  3ROL A;  3D39 A;  2VLR A;  4NO2 A;  4HUX A;  1YDP A;  4WW2 C;  2GJ6 A;  5EU3 A;  1B3J A;  3TIE A;  1CE6 A;  1T7W A;  2FZ3 A;  3KPP A;  3MRP A;  3FOM A;  3KPR A;  1VAD A;  1XZ0 A;  3RWG A;  4PRB A;  3I6L D;  4S0U C;  3SKO A;  3GSN H;  3VXU A;  1GZP A;  4MX7 A;  4PG2 A;  1KPU A;  5HGH A;  1AGB A;  3WUW A;  1R3H A;  3RWH A;  5D7J C;  4N0U A;  1T22 A;  4NQV A;  1T7V A;  2GUO A;  5BRZ A;  4PJX A;  1W72 A;  4L3E A;  5H94 A;  3MR9 A;  3VFT A;  4L4T A;  2VLK A;  3FQN A;  4FTV A;  5J6G A;  3MRK A;  4O2F A;  4G43 A;  1ED3 A;  4PP8 C;  4G9F A;  2PO6 A;  4PV8 A;  2HLA A;  5EO0 A;  4E5X A;  4E0R A;  1DUZ A;  1S7Q A;  1KPR A;  3BP7 A;  1N3N A;  4Y16 A;  3VRJ A;  1P7Q A;  3MRC A;  4HKJ A;  1EFX A;  4LCY A;  3GMR A;  1ZT1 A;  3RL1 A;  3W0W A;  3MRE A;  5INC A;  1PQZ A;  1T7Y A;  3BO8 A;  4L8D A;  1BZ9 A;  4N5E A;  3MRL A;  4WU7 A;  1SYS A;  1N2R A;  3LKN A;  4PDC E;  1B0G A;  3D2U A;  3P4M A;  3QZW A;  3DX7 A;  2V2X A;  4V3D B;  1JGD A;  3MYJ A;  3ARD A;  5E00 A;  5B38 A;  1VGK A;  2YEZ A;  3L3G A;  2F54 A;  3OV6 A;  3ILP A;  3PWN A;  1INQ A;  1HHJ A;  4PRD A;  3GJF A;  5HHQ A;  5IB2 A;  5C09 A;  1S7U A;  3DX8 A;  5HHN A;  4MQ7 A;  1A9B A;  5EO1 A;  2A83 A;  3V5H A;  2E7L E;  1IM9 A;  4NO3 A;  1FZO A;  4ZUT A;  3REW A;  2ESV A;  4O2C A;  4IRJ A;  4NO0 A;  1QSF A;  4ELM A;  3GSO A;  1ZSD A;  4CW1 A;  5C0E A;  3P9L A;  4Y2D A;  3JTC A;  1JF1 A;  1EEZ A;  4I4W A;  3X11 A;  4U6X A;  1YN7 A;  4X6C A;  1U58 A;  4QOK A;  4L3C A;  5IEH A;  4QRQ A;  3QUZ A;  4G42 A;  4NO5 A;  4NT6 A;  3C9N A;  4JRY A;  1FZM A;  4F7P A;  5FDW A;  3BP4 A;  3MRB A;  4Y4K A;  1QEW A;  3VFU A;  3HCV A;  2BST A;  5E8N A;  1Z5L A;  4L8B A;  1FZK A;  1OGT A;  3LKO A;  3I6K A;  4PRA A;  3PWU A;  2RFX A;  4MJ6 A;  2PYE A;  2X4P A;  3MGT A;  4JQV A;  4L4V A;  4Z78 A;  4MVB A;  4NQE A;  1ZHL A;  3GMO A;  3I6G A;  4WO4 A;  3X13 A;  4APQ A;  4Z77 A;  5AD0 A;  1WBY A;  4PRN A;  2VLJ A;  5F1N A;  2NX5 A;  3BXN A;  3ARF A;  3BGM A;  2D31 A;  5DEG A;  1LP9 A;  3GSV A;  4NHU E;  5D5M A;  1VAC A;  1G7Q A;  2GT9 A;  3ARG A;  3KPQ A;  4PJH A;  3RZC A;  4NQX A;  3JTS A;  1MHC A;  3MRH A;  3AU1 A;  1L8J A;  2ZOL A;  2FIK A;  2X4T A;  5IRO A;  3JVG A;  4JRX A;  2GTW A;  1S9Y A;  4QRU A;  4U1S A;  1ZVS A;  1S7W A;  3DX6 A;  5F9J A;  4PRE A;  3E2H A;  1BD2 A;  4JQX A;  2WY3 A;  1A1N A;  1AGD A;  1S7S A;  1I4F A;  3TVM A;  2CIK A;  3LN4 A;  4N8V A;  4PJE A;  1X7Q A;  4O2E A;  5EUO A;  3RTQ A;  2F53 A;  3ES6 A;  1WBX A;  5D7I A;  1S7R A;  3CDG A;  1ZT7 A;  1FFN A;  4PRH A;  1JPF A;  4U1M A;  5C0A A;  5C0B A;  3T8X A;  3TBS A;  3ECB A;  3QUK A;  5B39 A;  2Q7Y A;  3D25 A;  2MHA A;  4PJF A;  4XXC A;  5HYJ A;  4JFF A;  1RK1 A;  2BSR A;  1KJ3 H;  1OSZ A;  1I1F A;  3HUJ A;  3PWL A;  3TO2 A;  1A9E A;  2UWE A;  5EU6 A;  4HV8 A;  1BII A;  4IHO A;  3U0P A;  3E3Q A;  4F7C A;  3GSR A;  2H26 A;  3P4O A;  2X4O A;  1IM3 A;  2YPL A;  5C0J A;  1HSA A;  4NSK A;  1ZT4 A;  3BEV A;  4NQD A;  3X12 A;  4LCC C;  1ZAG A;  4MNQ A;  5IB1 A;  5C9J A;  1QR1 A;  4V3E B;  3LKS A;  5D2N A;  3SKM A;  3TN0 A;  5FA3 A;  3QFD A;  1E28 A;  3VFO A;  1M05 A;  2BNQ A;  1K8D A;  3VXN A;  3BWA A;  1W0V A;  3RWD A;  1W0W A;  5SWS A;  2H6P A;  5C0G A;  3B3I A;  1DUY A;  4QRS A;  4EI5 A;  1EEY A;  3MA7 A;  5IB3 A;  3FFC A;  3TBV A;  3FQR A;  3VRI A;  3V5K A;  1FFP A;  3KWW A;  5IND A;  3KLA A;  5MEQ A;  1QO3 A;  3BH8 A;  4EUP A;  4U6Y A;  4IRS A;  1HHG A;  5EU5 A;  3KXF A;  3E6H A;  1YN6 A;  3L3I A;  3VWJ A;  3MV8 A;  3FT4 A;  4ZUV A;  3PWP A;  4WU5 A;  5HHM A;  1QLF A;  3X14 A;  3BHB A;  5IVX A;  1FO0 H;  1FZJ A;  3B6S A;  4PGB A;  3GMN A;  5SWQ A;  3VFN A;  3MRG A;  5BS0 A;  3KPM A;  1I7U A;  1LD9 A;  4PJD A;  4ZAK A;  4ONO A;  2X4S A;  3E6F A;  1T1W A;  2NW3 A;  4Z76 A;  3UPR A;  1ZHK A;  3IT8 D;  5FA4 A;  3OX8 A;  3FQW A;  4HS3 A;  3GSX A;  4NNY A;  4X6E A;  1T1Z A;  3P73 A;  3KPL A;  3ROO A;  4U1N A;  4D0D A;  1KBG H;  3SJV A;  2VE6 A;  1QSE A;  4G59 A;  1T7X A;  1GZQ A;  1CD1 A;  3VFR A;  1P4L A;  1KJ2 H;  4L8C A;  5BXF A;  2FYY A;  4PV9 A;  3RWJ A;  1TVB A;  5HGD A;  1ZHB A;  4K7F A;  4X6D A;  3TO4 A;  4NNX A;  4WDI A;  3HLA A;  3P77 A;  2FWO A;  2GIT A;  5MEN A;  3AM8 A;  3QUX A;  4G9D A;  2BVP A;  3VFV A;  3BH9 A;  3L9R A;  4JFD A;  1C16 A;  1E27 A;  3O3B A;  1S9W A;  5EFI A;  1LDP H;  1AGE A;  1S7V A;  1G7P A;  3FQX A;  2VLL A;  2CLR A;  2ZSW A;  2AXG A;  2BCK A;  3M1B A;  5C0C A;  5ACZ A;  1Q94 A;  4K71 B;  1ZHN A;  1AGF A;  4MXQ A;  5E8P A;  1MWA H;  5HGA A;  1HSB A;  3DBX A;  1ONQ A;  5IB4 A;  2BVO A;  5C0D A;  4PJ7 A;  4PJC A;  5C08 A;  2X4N A;  3M17 A;  4N0C A;  1RK0 A;  3OXS A;  1ZS8 A;  4PJA A;  2X4U A;  1HHI A;  1LQV A;  5FKP A;  1I7T A;  3VXP A;  5JHD A;  3QQ3 A;  3TBY A;  5SWZ A;  3KYO A;  5BJT A;  3SPV A;  4ZUS A;  3H9H A;  3O3A A;  1QRN A;  1I1A A;  3GIV A;  4Y4H A;  1MHE A;  4G8G A;  4I48 A;  4PJ9 A;  1KCG C;  1UXW A;  1T80 A;  3FQU A;  4G8I A;  3FRU A;  4ZUW A;  3DTX A;  5E8O A;  3MRO A;  2BSS A;  3VXM A;  4PR5 A;  1LEG A;  3SDD A;  4JFE A;  1EXU A;  1P1Z A;  3KYN A;  1UQS A;  1DE4 A;  3GSW A;  2DYP A;  3FQT A;  3TA3 A;  1HYR C;  1A1M A;  4PG9 A;  1T7Z A;  2OI9 A;  3LV3 A;  2GAZ A;  2XFX A;  4UQ2 A;  3HE6 A;  3TBW A;  4L9L C;  2P5E A;  3UBX A;  3D3V A;  4PJ5 A;  4PRP A;  3VWK A;  1UXS A;  1SYV A;  3CPL A;  3L3H A;  3QDM A;  3V5D A;  4PJB A;  3QQ4 A;  2VAB A;  5D2L A;  3GMP A;  3PAB A;  1LK2 A;  4LNR A;  1KJV A;  1QVO A;  3TF7 A;  3VXS A;  3RWE A;  1T1X A;  1N5A A;  2CLV A;  2AKR A;  5HHP A;  3WS6 A;  1JHT A;  3QUL A;  1G6R H;  5GSV A;  3O4L A;  2AK4 A;  2X4Q A;  1S9X A;  2OL3 H;  4PGD A;  4L8S C;  3FTG A;  4N0F A;  4U1I A;  5D9S A;  3SDA A;  3HPJ A;  3BVN A;  3VH8 A;  3VFW A;  1KJM A;  2AXF A;  1JFM A;  3ARE A;  4GUP A;  3OXR A;  5EOT A;  3RUG A;  3ERY A;  4WUU A;  3LKQ A;  3CC5 A;  4F7M A;  3VXO A;  1A1O A;  3L3J A;  1WBZ A;  3RWI A;  4D0C A;  3FT3 A;  3WS3 A;  3H9S A;  3MRJ A;  3FON A;  5ENW A;  3P9M A;  3QEQ A;  5E9D A;  4EN3 C;  2AV7 A;  4F7E A;  1N59 A;  3LKR A;  3BEW A;  4MNG A;  1I7R A;  1TMC A;  1S7X A;  4HX1 A;  4U1H A;  1OF2 A;  1OGA A;  2ZOK A;  3HE7 A;  4PJG A;  3RWC A;  3SDX A;  3IXA A;  4PRI A;  3CVH A;  3JTT A;  1B0R A;  3TID A;  3BW9 A;  4ZUU A;  5MEO A;  1I1Y A;  1T21 A;  4IIQ C;  2HJK A;  4LHU A;  1JPG A;  1A6Z A;  3D18 A;  3L3D A;  3MGO A;  5D7L A;  1NEZ A;  4JFO A;  2VAA A;  5HHO A;  4JFQ A;  3WLB A;  3VXR A;  3GML A;  3KPO A;  1AGC A;  3BZF A;  5DDH A;  5HGB A;  3G08 A;  4MJI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...