2OI9A

Structure of the 2c/ld/ql9 allogeneic complex
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
175
structure length
175
Chain Sequence
GPHSMRYYETATSRRGLGEPRYTSVGYVDDKEFVRFDSDAENPRYEPQVPWMEQEGPEYWERITQVAKGQEQWFRVNLRTLLGYYNQSAGGTHTLQRMYGCDVGSDGRLLRGYEQFAYDGCDYIALNEDLRTWTAADMAAQITRRKWEQAGAAEYYRAYLEGECVEWLHRYLKNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Major Histocompatibility Complex protein
publication title How a single T cell receptor recognizes both self and foreign MHC.
pubmed doi rcsb
source organism Mus musculus
total genus 50
structure length 175
sequence length 175
ec nomenclature
pdb deposition date 2007-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 2oi9A00
4K7FA 2BVQA 4QRUA 4L3EA 4U1NA 2HN7A 1BIIA 3IXAA 5BRZA 1W0WA 3ARGA 5ENWA 3UTTA 2GITA 2AXGA 4N8VA 2BNQA 1HHHA 3E3QA 1FO0H 4Z77A 3DX6A 5F1IA 3DX7A 3TN0A 3UTQA 2HJLA 3OV6A 1ZSDA 4UQ2A 3C8KA 1N5AA 2HJKA 3LKRA 1LK2A 2BVOA 1YN7A 3FONA 2J8UA 5BXFA 5D2LA 4X6FA 3SDCA 5E8NA 1T80A 4CW1A 1EEZA 5C0EA 3I6LD 1VGKA 4EN3C 1CD1A 2GJ6A 3L3IA 3W0WA 4JQXA 1SYVA 3O3BA 2JCCA 1FG2A 3FT4A 3ARBA 1S9XA 1DDHA 4JFOA 1JPFA 3HE7A 4NO5A 5C0FA 3NFNA 4X6CA 4HS3A 3PWUA 4IIQC 3AM8A 4PJ7A 3M1BA 5E8PA 3SKOA 3VXMA 1IM3A 1B0GA 4PP8C 3P4OA 3E6FA 2VE6A 1KTLA 1FZOA 3OXRA 4HX1A 5C0AA 1S7TA 4EI5A 3BP7A 3CDGA 5IB3A 1KJMA 4G9FA 4U1HA 1DE4A 3MV9A 3VFOA 3PWJA 3BW9A 3BZFA 4LCYA 4MNQA 4PJFA 5ISZA 5IB5A 1A1NA 3D3VA 2VAAA 5HGHA 3RWDA 5DDHA 1ZHBA 2PYEA 5HYJA 4L29A 3QDJA 5BJTA 3U0PA 3HG1A 4QRPA 4PJIA 1T1XA 4MJ5A 2VLRA 2X70A 4N0UA 3MRJA 2HLAA 4MJIA 5EU6A 2MHAA 4PJ5A 4N5EA 4L8DA 5HHNA 1S7RA 4QRTA 4JFDA 5MEOA 2ESVA 4I4WA 4O2FA 3MRNA 4PJAA 5D9SA 4D0CA 1HYRC 5IB1A 1NAMH 3VXPA 3LKNA 4LNRA 3I6KA 2E7LE 4PG9A 3P9LA 1T1YA 1LP9A 1VACA 3BGMA 2XFXA 4LHUA 3O3DA 1NANH 3KLAA 1HSBA 3MR9A 4U1LA 4PJBA 1EXUA 1KPVA 3RWJA 2FO4A 2GTWA 1BD2A 1W72A 1XH3A 4PJCA 3KXFA 5INDA 1S7VA 3X13A 3H9SA 3GMOA 4UQ3A 2OL3H 2AKRA 4L4TA 3P73A 1WBZA 3TBWA 5D5MA 5FA4A 3VJ6A 4ZAKA 3BWAA 5SWZA 5IROA 3G08A 4MQ7A 4PRHA 1T7XA 1A1OA 2VABA 5EU5A 5B39A 3X11A 2ZOLA 3SJVA 3RWGA 3TIEA 1QVOA 3DTXA 3TFKA 4WO4A 3TBVA 4PRNA 3RL2A 1I1YA 1MI5A 3MRRA 4XXCA 3V5HA 4F7TA 4QRRA 3W39A 4L8CA 1G7QA 3ARFA 4WUUA 3T1FA 4MS8A 2CLRA 3VCLA 1YDPA 3VFVA 3SCMA 3QDMA 1QR1A 5E00A 3T8XA 4NO3A 4G43A 1W0VA 3RWCA 5BS0A 4U1KA 4PRPA 1ZS8A 5C09A 1KPUA 3MA7A 3ARDA 5F9JA 5C0DA 1ED3A 2A83A 3SDDA 3BEWA 4Z76A 4E5XA 3CPLA 5HHQA 1FFNA 1XR9A 2FWOA 3SPVA 2CIKA 3FQRA 1TVHA 4ZUWA 3HUJA 3QQ3A 5IB4A 1LQVA 1DUZA 2FZ3A 3O3EA 2GUOA 4PV8A 4JFFA 5EOTA 3KYOA 3LKOA 1C16A 1VADA 5D2NA 2VLKA 1T20A 3TPUE 1ZHLA 2X4QA 5SWQA 4MJ6A 1JE6A 3RL1A 2ZOKA 4ZUSA 4HKJA 3L3KA 1QEWA 3O4LA 3WUWA 1JGDA 3TBSA 1INQA 5J6HA 3LKPA 1N2RA 2VLLA 1B0RA 1ONQA 4NO0A 4U1MA 3D39A 4PR5A 2CLVA 3O9WA 1KBGH 1K8DA 1RK0A 1S7WA 3QFDA 3BO8A 3GSVA 3MRCA 4MVBA 4NT6A 3WLBA 5FA3A 1KJVA 1HOCA 3UBXA 1TMCA 3RWHA 1AO7A 3DX8A 3BVNA 2CIIA 3H9HA 3MGTA 2UWEA 3AREA 4O2EA 4MXQA 3VRJA 3MREA 4I48A 1I7RA 5D7IA 4ELMA 5J1AA 5IVXA 1KPRA 1G7PA 5EO1A 2AV7A 3FT2A 4G9DA 4L8SC 3O3AA 4PREA 5DEGA 3MRHA 4Y4HA 3FTGA 2Q7YA 1MHEA 1JGEA 3WS3A 5C0JA 1E27A 1EFXA 3D18A 1FFOA 1FZMA 1T7VA 1L8JA 3FOMA 3VFWA 4F7CA 1GZQA 3ROOA 3GMNA 3VXUA 3D25A 4MX7A 3MRQA 3MRDA 3L3DA 1A9BA 3BEVA 3BHBA 1FFPA 4GUPA 3JTSA 3MROA 5MERA 2NX5A 3TBYA 1QSEA 5E8OA 4EUPA 1UQSA 3UPRA 3L3GA 2BCKA 2GTZA 3P9MA 1ZHKA 4PGBA 4JQVA 4PV9A 3FQXA 5L2JA 3TBTA 2D31A 1A1MA 1KJ2H 3L3HA 1QO3A 1OGTA 4E0RA 3FQNA 3MRPA 3ROLA 4NNYA 1X7QA 4QRQA 1LDPH 3SKMA 1UXWA 3MV8A 1JPGA 3REWA 3RTQA 3VFTA 3QZWA 3V5KA 4CVXA 3VFNA 1I4FA 4PRIA 3VFMA 4ONOA 3X12A 3PQYA 5HHMA 3SDAA 3MRGA 3MRIA 1QSFA 3JVGA 3TIDA 3ES6A 3GMMA 4PJDA 4JRXA 3KPMA 3DBXA 3QUYA 1K5NA 1ZT4A 4PJHA 5D7LA 4ZFZA 1JFMA 3E6HA 1N59A 1S8DA 2ZSVA 4JFQA 3CVHA 2YPKA 3L9RA 3PABA 4JRYA 4Y16A 3PWNA 4L8BA 3I6GA 3KYNA 3TF7A 5HHOA 1NEZA 1P7QA 2X4OA 3HPJA 1IM9A 3WL9A 3MV7A 3WS6A 4PRDA 3VRIA 2OI9A 3KPRA 1T0MA 3L3JA 3OXSA 1JUFA 4NNXA 3RZCA 3TZVC 3HCVA 3BUYA 5H94A 1ZVSA 4WJ5A 4GKSA 1HHJA 4U6XA 5DEFA 1AKJA 4ZUUA 5IM7A 1MHCA 1DUYA 4V3EB 3KPSA 3E2HA 1UXSA 4PGDA 3AU1A 3TA3A 4U1JA 1S9YA 5EU3A 3RGVC 3BH8A 3JTCA 1RJYA 1RJZA 1ZT1A 1JF1A 4U1SA 4D0BA 1I7UA 4F7EA 3OX8A 1QLFA 2X4UA 1R3HA 3VWJA 4NSKA 1ZHNA 3FQWA 1QQDA 2X4NA 3ILPA 4APQA 3GJFA 3QFJA 4HUXA 2P5EA 2BSTA 3M17A 4L9LC 3LKQA 3MRFA 4ZUTA 3RWFA 5GSRA 4S0UC 1HHGA 4F7MA 5IEKA 4NQDA 3P4MA 2VLJA 3B6SA 3VFPA 1SYSA 2F74A 3VFSA 3GSWA 3TVMA 3VFUA 4G8GA 2V2XA 3FQUA 1M05A 4N0FA 3TO2A 5C9JA 1OSZA 4U1IA 3ILQC 4Y4KA 4HV8A 3FQTA 3VXRA 5C0CA 3P4NA 5HGDA 3VXOA 4Y4FA 2YEZA 2X4TA 4JFEA 3P77A 5ACZA 4PJXA 3JTTA 4Y2DA 1GZPA 1T22A 3QQ4A 3QUXA 4NQVA 4U6YA 2BNRA 2F53A 4PGCA 3C9NA 3HE6A 2WY3A 3MRLA 3QUKA 5C0BA 3TJHA 3GMQA 3GSOA 3RUGA 2F54A 3DXAA 3VH8A 5MEQA 3GSUA 4O2CA 2YPLA 4FTVA 4PRBA 3GMPA 1M6OA 4HUUA 4ZUVA 1N3NA 1G6RH 4LCCC 2XPGA 2P5WA 2NW3A 5F1NA 1RK1A 3VXNA 4G42A 5IB2A 1A9EA 1ZAGA 4FFEX 3VFRA 1KJ3H 5C0GA 3KPNA 4WWKC 1T21A 1TVBA 3MYJA 5F7DA 2BSSA 2AXFA 4V3DB 3TO4A 2GAZA 1LEGA 3KWWA 3CCHA 1T7ZA 1T0NA 5B38A 4WDIA 5EUOA 3PWLA 1WBYA 4K71B 1CG9A 1LEKA 4PJEA 5HHPA 1MWAH 1I1FA 4PJ9A 1AGFA 3X14A 5EO0A 4L3CA 1Z5LA 1S9WA 4L4VA 1HSAA 5FDWA 4IHOA 2C7UA 4MNGA 5FKPA 3PWPA 5EU4A 2GT9A 5C07A 3CZFA 3H7BA 4PGEA 2RFXA 1FZKA 3HAEA 5EFIA 5IEHA 2PO6A 3GIVA 1Q94A 4NHUE 4LCWA 5GSVA 1BQHA 3CC5A 5INCA 2ZSWA 3SDXA 3B3IA 2H26A 1T1WA 1U58A 3GSNH 3LN5A 4IRSA 2CLZA 4Z78A 1QRNA 5E6IC 5MEPA 3MGOA 4WW2C 1XR8A 3GMLA 2V2WA 3LKSA 2X4PA 2AV1A 3FT3A 1FZJA 1WBXA 5HGAA 1JHTA 3LV3A 5SWSA 3QDGA 3BXNA 1AGBA 5C0IA 2H6PA 4NQXA 4HWZA 3HLAA 4JFPA 3GSRA 2FIKA 3QUZA 4IRJA 1S7XA 1I7TA 3KPQA 2X4RA 3RWEA 4QOKA 1KCGC 4PRAA 4QRSA 3VWKA 4HUWA 3FOLA 4D0DA 3PWVA 3QULA 1OF2A 3FRUA 1AGDA 3GSXA 3LN4A 3MRMA 3O8XA 4WU5A 3KPOA 4NQCA 3D2UA 4WU7A 3FFCA 3ECBA 3VXSA 5MENA 3QEQA 3S6CA 1YPZA 3KPLA 2FYYA 2BSRA 1AGEA 3IT8D 2BVPA 1EEYA 1P4LA 5JHDA 1BZ9A 5HGBA 4PG2A 1T7YA 5D7JC 1T1ZA 3DMMA 5E9DA 1ZT7A 3UTSA 3KPPA 4G8IA 4HUVA 3MRKA 3GSQA 4N0CA 2AK4A 1OGAA 1T7WA 1B3JA 3V5DA 4X6EA 1P1ZA 3ERYA 1CE6A 3CH1A 1S7QA 4PJ8A 1HHKA 3GMRA 5C08A 1XZ0A 1S7SA 1S7UA 2X4SA 5L2KA 5AD0A 2CKBH 1E28A 1YN6A 4F7PA 1PQZA 3MRBA 4CVZA 5J6GA 3BH9A 3RWIA 3BP4A 4GKNA 1A6ZA 1AGCA 3QI9A 4PJGA 2DYPA 1I1AA 4PDCE 1HHIA 4G59A 3BZEA 4X6DA 1LD9A 4NO2A 4NQEA
chains in the Genus database with same CATH superfamily
4K7FA 2BVQA 4QRUA 4L3EA 4U1NA 2HN7A 1BIIA 3IXAA 5BRZA 1W0WA 3ARGA 5ENWA 3UTTA 2GITA 2AXGA 4N8VA 2BNQA 1HHHA 3E3QA 1FO0H 4Z77A 3DX6A 5F1IA 3DX7A 3TN0A 3UTQA 2HJLA 3OV6A 1ZSDA 4UQ2A 3C8KA 1N5AA 2HJKA 3LKRA 1LK2A 2BVOA 1YN7A 3FONA 2J8UA 5BXFA 5D2LA 4X6FA 3SDCA 5E8NA 1T80A 4CW1A 1EEZA 5C0EA 3I6LD 1VGKA 4EN3C 1CD1A 2GJ6A 3L3IA 3W0WA 4JQXA 1SYVA 3O3BA 2JCCA 1FG2A 3FT4A 3ARBA 1S9XA 1DDHA 4JFOA 1JPFA 3HE7A 4NO5A 5C0FA 3NFNA 4X6CA 4HS3A 3PWUA 4IIQC 3AM8A 4PJ7A 3M1BA 5E8PA 3SKOA 3VXMA 1IM3A 1B0GA 4PP8C 3P4OA 3E6FA 2VE6A 1KTLA 1FZOA 3OXRA 4HX1A 5C0AA 1S7TA 4EI5A 3BP7A 3CDGA 5IB3A 1KJMA 4G9FA 4U1HA 1DE4A 3MV9A 3VFOA 3PWJA 3BW9A 3BZFA 4LCYA 4MNQA 4PJFA 5ISZA 5IB5A 1A1NA 3D3VA 2VAAA 5HGHA 3RWDA 5DDHA 1ZHBA 2PYEA 5HYJA 4L29A 3QDJA 5BJTA 3U0PA 3HG1A 4QRPA 4PJIA 1T1XA 4MJ5A 2VLRA 2X70A 4N0UA 3MRJA 2HLAA 4MJIA 5EU6A 2MHAA 4PJ5A 4N5EA 4L8DA 5HHNA 1S7RA 4QRTA 4JFDA 5MEOA 2ESVA 4I4WA 4O2FA 3MRNA 4PJAA 5D9SA 4D0CA 1HYRC 5IB1A 1NAMH 3VXPA 3LKNA 4LNRA 3I6KA 2E7LE 4PG9A 3P9LA 1T1YA 1LP9A 1VACA 3BGMA 2XFXA 4LHUA 3O3DA 1NANH 3KLAA 1HSBA 3MR9A 4U1LA 4PJBA 1EXUA 1KPVA 3RWJA 2FO4A 2GTWA 1BD2A 1W72A 1XH3A 4PJCA 3KXFA 5INDA 1S7VA 3X13A 3H9SA 2IA1A 3GMOA 4UQ3A 2OL3H 2AKRA 4L4TA 3P73A 1WBZA 3TBWA 5D5MA 5FA4A 3VJ6A 4ZAKA 3BWAA 5SWZA 5IROA 3G08A 4MQ7A 4PRHA 1T7XA 1A1OA 2VABA 5EU5A 5B39A 3X11A 2ZOLA 3SJVA 3RWGA 3TIEA 1QVOA 3DTXA 3TFKA 4WO4A 3TBVA 4PRNA 3RL2A 1I1YA 1MI5A 3MRRA 4XXCA 3V5HA 4F7TA 4QRRA 3W39A 4L8CA 1G7QA 3ARFA 4WUUA 3T1FA 4MS8A 2CLRA 3VCLA 1YDPA 3VFVA 3SCMA 3QDMA 1QR1A 5E00A 3T8XA 4NO3A 4G43A 1W0VA 3RWCA 5BS0A 4U1KA 4PRPA 1ZS8A 5C09A 1KPUA 3MA7A 3ARDA 5F9JA 5C0DA 1ED3A 2A83A 3SDDA 3BEWA 4Z76A 4E5XA 3CPLA 5HHQA 1FFNA 1XR9A 2FWOA 3SPVA 2CIKA 3FQRA 1TVHA 4ZUWA 3HUJA 3QQ3A 5IB4A 1LQVA 1DUZA 2FZ3A 3I0TA 3O3EA 2GUOA 4PV8A 4JFFA 5EOTA 3KYOA 3LKOA 1C16A 1VADA 5D2NA 2VLKA 1T20A 3TPUE 1ZHLA 2X4QA 5SWQA 4MJ6A 1JE6A 3RL1A 2ZOKA 4ZUSA 4HKJA 3L3KA 1QEWA 3O4LA 3WUWA 1JGDA 3TBSA 1INQA 5J6HA 3LKPA 1N2RA 2VLLA 1B0RA 1ONQA 4NO0A 4U1MA 3D39A 4PR5A 2CLVA 3O9WA 1KBGH 1K8DA 1RK0A 1S7WA 3QFDA 3BO8A 3GSVA 3MRCA 4MVBA 4NT6A 3WLBA 5FA3A 1KJVA 1HOCA 3UBXA 1TMCA 3RWHA 1AO7A 3DX8A 3BVNA 2CIIA 3H9HA 3MGTA 2UWEA 3AREA 4O2EA 4MXQA 3VRJA 3MREA 4I48A 1I7RA 5D7IA 4ELMA 5J1AA 5IVXA 1KPRA 1G7PA 5EO1A 2AV7A 3FT2A 4G9DA 4L8SC 3O3AA 4PREA 5DEGA 3MRHA 4Y4HA 3FTGA 2Q7YA 1MHEA 1JGEA 3WS3A 5C0JA 1E27A 1EFXA 3D18A 1FFOA 1FZMA 1T7VA 1L8JA 3FOMA 3VFWA 4F7CA 1GZQA 3ROOA 3GMNA 3VXUA 3D25A 4MX7A 3MRQA 3MRDA 3L3DA 1A9BA 3BEVA 3BHBA 1FFPA 4GUPA 3JTSA 3MROA 5MERA 2NX5A 3TBYA 1QSEA 5E8OA 4EUPA 1UQSA 3UPRA 3L3GA 2BCKA 2GTZA 3P9MA 1ZHKA 4PGBA 4JQVA 4PV9A 3FQXA 5L2JA 3TBTA 2D31A 1A1MA 1KJ2H 3L3HA 1QO3A 1OGTA 4E0RA 3FQNA 3MRPA 3ROLA 4NNYA 1X7QA 4BKWA 4QRQA 1LDPH 3SKMA 1UXWA 4G59C 3MV8A 1JPGA 3REWA 3RTQA 3VFTA 3QZWA 3V5KA 4CVXA 3VFNA 1I4FA 4PRIA 3VFMA 4ONOA 3X12A 3PQYA 5HHMA 3SDAA 3MRGA 3MRIA 1QSFA 3JVGA 3TIDA 3ES6A 3GMMA 4PJDA 4JRXA 3KPMA 3DBXA 3QUYA 1K5NA 1ZT4A 4PJHA 5D7LA 4ZFZA 1JFMA 3E6HA 1N59A 1S8DA 2ZSVA 4JFQA 3CVHA 2YPKA 3L9RA 3PABA 4JRYA 4Y16A 3PWNA 4L8BA 3I6GA 3KYNA 3TF7A 5HHOA 1NEZA 1P7QA 2X4OA 3HPJA 1IM9A 3WL9A 3MV7A 3WS6A 4PRDA 3VRIA 2OI9A 3KPRA 2O5NA 1T0MA 3L3JA 3OXSA 1JUFA 4NNXA 3RZCA 3TZVC 3HCVA 3BUYA 5H94A 1ZVSA 4WJ5A 4GKSA 1HHJA 4U6XA 5DEFA 1AKJA 4ZUUA 5IM7A 1MHCA 1DUYA 4V3EB 3KPSA 3E2HA 1UXSA 4PGDA 3AU1A 3TA3A 4U1JA 1S9YA 5EU3A 3RGVC 3BH8A 3JTCA 1RJYA 1RJZA 1ZT1A 1JF1A 4U1SA 4D0BA 1I7UA 4F7EA 3OX8A 1QLFA 2X4UA 1R3HA 3VWJA 4NSKA 1ZHNA 3FQWA 1QQDA 2X4NA 3ILPA 4APQA 3GJFA 3QFJA 4HUXA 2P5EA 2BSTA 3M17A 4L9LC 3LKQA 3MRFA 4ZUTA 3RWFA 5GSRA 4S0UC 1HHGA 4F7MA 5IEKA 4NQDA 3P4MA 2VLJA 3B6SA 3VFPA 1SYSA 2F74A 3VFSA 3GSWA 3TVMA 3VFUA 2NYKA 4G8GA 2V2XA 3FQUA 1M05A 4N0FA 3TO2A 5C9JA 1OSZA 4U1IA 3ILQC 4Y4KA 4HV8A 3FQTA 3VXRA 5C0CA 3P4NA 5HGDA 3VXOA 4Y4FA 2YEZA 2X4TA 4JFEA 3P77A 5ACZA 4PJXA 3JTTA 4Y2DA 1GZPA 1T22A 3QQ4A 3QUXA 4NQVA 4U6YA 2BNRA 2F53A 4PGCA 3C9NA 3HE6A 2WY3A 3MRLA 3QUKA 5C0BA 3TJHA 3GMQA 3GSOA 3RUGA 2F54A 3DXAA 3VH8A 5MEQA 3GSUA 4O2CA 2YPLA 4FTVA 4PRBA 3GMPA 1M6OA 4HUUA 4ZUVA 1N3NA 1G6RH 4LCCC 2XPGA 2P5WA 2NW3A 5F1NA 1RK1A 3VXNA 4G42A 5IB2A 1A9EA 1ZAGA 4FFEX 3VFRA 1KJ3H 5C0GA 3KPNA 4WWKC 1T21A 1TVBA 3MYJA 5F7DA 2BSSA 2AXFA 4V3DB 3TO4A 2GAZA 1LEGA 3KWWA 3CCHA 1T7ZA 1T0NA 5B38A 4WDIA 5EUOA 3PWLA 1WBYA 4JO8A 4K71B 1CG9A 1LEKA 4PJEA 5HHPA 1MWAH 1I1FA 4PJ9A 1AGFA 3X14A 5EO0A 4L3CA 1Z5LA 1S9WA 4L4VA 1HSAA 5FDWA 4IHOA 2C7UA 4MNGA 5FKPA 3PWPA 5EU4A 2GT9A 5C07A 3CZFA 3H7BA 4PGEA 2RFXA 1FZKA 3HAEA 5EFIA 5IEHA 2PO6A 3GIVA 1Q94A 4NHUE 4LCWA 5GSVA 1BQHA 3CC5A 5INCA 2ZSWA 3SDXA 3B3IA 2H26A 1T1WA 1U58A 3GSNH 3LN5A 4IRSA 2CLZA 4Z78A 1QRNA 5E6IC 5MEPA 3MGOA 4WW2C 1XR8A 3GMLA 2V2WA 3LKSA 2X4PA 2AV1A 3FT3A 1FZJA 1WBXA 5HGAA 1JHTA 3LV3A 5SWSA 3QDGA 3BXNA 1AGBA 5C0IA 2H6PA 4NQXA 4HWZA 3HLAA 4JFPA 3GSRA 2FIKA 3QUZA 4IRJA 1S7XA 1I7TA 3KPQA 2X4RA 3RWEA 4QOKA 1KCGC 4PRAA 4QRSA 3VWKA 4HUWA 3FOLA 4D0DA 3PWVA 3QULA 1OF2A 3FRUA 1AGDA 3GSXA 3LN4A 3MRMA 3O8XA 4WU5A 3KPOA 4NQCA 3D2UA 4WU7A 3FFCA 3ECBA 3VXSA 5MENA 3QEQA 3S6CA 1YPZA 3KPLA 2FYYA 2BSRA 1AGEA 3IT8D 2BVPA 1EEYA 1P4LA 5JHDA 1BZ9A 5HGBA 4PG2A 1T7YA 5D7JC 1T1ZA 3DMMA 5E9DA 1ZT7A 3UTSA 3KPPA 4G8IA 4HUVA 3MRKA 3GSQA 4N0CA 2AK4A 1OGAA 1T7WA 1B3JA 3V5DA 4X6EA 1P1ZA 3ERYA 1CE6A 3CH1A 1S7QA 4PJ8A 1HHKA 3GMRA 5C08A 1XZ0A 1S7SA 1S7UA 2X4SA 5L2KA 5AD0A 2CKBH 1E28A 1YN6A 4F7PA 1PQZA 3MRBA 4CVZA 5J6GA 3BH9A 3RWIA 3BP4A 4GKNA 1A6ZA 1AGCA 3QI9A 4PJGA 2DYPA 1I1AA 4PDCE 1HHIA 4G59A 3BZEA 4X6DA 1LD9A 4NO2A 4NQEA
chains in the Genus database with same CATH topology
4K7FA 2BVQA 4QRUA 4L3EA 4U1NA 2HN7A 1BIIA 3IXAA 5BRZA 1W0WA 3ARGA 5ENWA 3UTTA 2GITA 2AXGA 4N8VA 2BNQA 1HHHA 3E3QA 1FO0H 4Z77A 3DX6A 5F1IA 3DX7A 3TN0A 3UTQA 2HJLA 3OV6A 1ZSDA 4UQ2A 3C8KA 1N5AA 2HJKA 3LKRA 1LK2A 2BVOA 1YN7A 3FONA 2J8UA 5BXFA 5D2LA 4X6FA 3SDCA 5E8NA 1T80A 4CW1A 1EEZA 5C0EA 3I6LD 1VGKA 4EN3C 1CD1A 2GJ6A 3L3IA 3W0WA 4JQXA 1SYVA 3O3BA 2JCCA 1FG2A 3FT4A 3ARBA 1S9XA 1DDHA 4JFOA 1JPFA 3HE7A 4NO5A 5C0FA 3NFNA 4X6CA 4HS3A 3PWUA 4IIQC 3AM8A 4PJ7A 3M1BA 5E8PA 3SKOA 3VXMA 1IM3A 1B0GA 4PP8C 3P4OA 3E6FA 2VE6A 1KTLA 1FZOA 3OXRA 4HX1A 5C0AA 1S7TA 4EI5A 3BP7A 3CDGA 5IB3A 1KJMA 4G9FA 4U1HA 1DE4A 3MV9A 3VFOA 3PWJA 3BW9A 3BZFA 4LCYA 4MNQA 4PJFA 5ISZA 5IB5A 1A1NA 3D3VA 2VAAA 5HGHA 3RWDA 5DDHA 1ZHBA 2PYEA 5HYJA 4L29A 3QDJA 5BJTA 3U0PA 3HG1A 4QRPA 4PJIA 1T1XA 4MJ5A 2VLRA 2X70A 4N0UA 3MRJA 2HLAA 4MJIA 5EU6A 2MHAA 4PJ5A 4N5EA 4L8DA 5HHNA 1S7RA 4QRTA 4JFDA 5MEOA 2ESVA 4I4WA 4O2FA 3MRNA 4PJAA 5D9SA 4D0CA 1HYRC 5IB1A 1NAMH 3VXPA 3LKNA 4LNRA 3I6KA 2E7LE 4PG9A 3P9LA 1T1YA 1LP9A 1VACA 3BGMA 2XFXA 4LHUA 3O3DA 1NANH 3KLAA 1HSBA 3MR9A 4U1LA 4PJBA 1EXUA 1KPVA 3RWJA 2FO4A 2GTWA 1BD2A 1W72A 1XH3A 4PJCA 3KXFA 5INDA 1S7VA 3X13A 3H9SA 3GMOA 4UQ3A 2OL3H 2AKRA 4L4TA 3P73A 1WBZA 3TBWA 5D5MA 5FA4A 3VJ6A 4ZAKA 3BWAA 5SWZA 5IROA 3G08A 4MQ7A 4PRHA 1T7XA 1A1OA 2VABA 5EU5A 5B39A 3X11A 2ZOLA 3SJVA 3RWGA 3TIEA 1QVOA 3DTXA 3TFKA 4WO4A 3TBVA 4PRNA 3RL2A 1I1YA 1MI5A 3MRRA 4XXCA 3V5HA 4F7TA 4QRRA 3W39A 4L8CA 1G7QA 3ARFA 4WUUA 3T1FA 4MS8A 2CLRA 3VCLA 1YDPA 3VFVA 3SCMA 3QDMA 1QR1A 5E00A 3T8XA 4NO3A 4G43A 1W0VA 3RWCA 5BS0A 4U1KA 4PRPA 1ZS8A 5C09A 1KPUA 3MA7A 3ARDA 5F9JA 5C0DA 1ED3A 2A83A 3SDDA 3BEWA 4Z76A 4E5XA 3CPLA 5HHQA 1FFNA 1XR9A 2FWOA 3SPVA 2CIKA 3FQRA 1TVHA 4ZUWA 3HUJA 3QQ3A 5IB4A 1LQVA 1DUZA 2FZ3A 3O3EA 2GUOA 4PV8A 4JFFA 5EOTA 3KYOA 3LKOA 1C16A 1VADA 5D2NA 2VLKA 1T20A 3TPUE 1ZHLA 2X4QA 5SWQA 4MJ6A 1JE6A 3RL1A 2ZOKA 4ZUSA 4HKJA 3L3KA 1QEWA 3O4LA 3WUWA 1JGDA 3TBSA 1INQA 5J6HA 3LKPA 1N2RA 2VLLA 1B0RA 1ONQA 4NO0A 4U1MA 3D39A 4PR5A 2CLVA 3O9WA 1KBGH 1K8DA 1RK0A 1S7WA 3QFDA 3BO8A 3GSVA 3MRCA 4MVBA 4NT6A 3WLBA 5FA3A 1KJVA 1HOCA 3UBXA 1TMCA 3RWHA 1AO7A 3DX8A 3BVNA 2CIIA 3H9HA 3MGTA 2UWEA 3AREA 4O2EA 4MXQA 3VRJA 3MREA 4I48A 1I7RA 5D7IA 4ELMA 5J1AA 5IVXA 1KPRA 1G7PA 5EO1A 2AV7A 3FT2A 4G9DA 4L8SC 3O3AA 4PREA 5DEGA 3MRHA 4Y4HA 3FTGA 2Q7YA 1MHEA 1JGEA 3WS3A 5C0JA 1E27A 1EFXA 3D18A 1FFOA 1FZMA 1T7VA 1L8JA 3FOMA 3VFWA 4F7CA 1GZQA 3ROOA 3GMNA 3VXUA 3D25A 4MX7A 3MRQA 3MRDA 3L3DA 1A9BA 3BEVA 3BHBA 1FFPA 4GUPA 3JTSA 3MROA 5MERA 2NX5A 3TBYA 1QSEA 5E8OA 4EUPA 1UQSA 3UPRA 3L3GA 2BCKA 2GTZA 3P9MA 1ZHKA 4PGBA 4JQVA 4PV9A 3FQXA 5L2JA 3TBTA 2D31A 1A1MA 1KJ2H 3L3HA 1QO3A 1OGTA 4E0RA 3FQNA 3MRPA 3ROLA 4NNYA 1X7QA 4QRQA 1LDPH 3SKMA 1UXWA 3MV8A 1JPGA 3REWA 3RTQA 3VFTA 3QZWA 3V5KA 4CVXA 3VFNA 1I4FA 4PRIA 3VFMA 4ONOA 3X12A 3PQYA 5HHMA 3SDAA 3MRGA 3MRIA 1QSFA 3JVGA 3TIDA 3ES6A 3GMMA 4PJDA 4JRXA 3KPMA 3DBXA 3QUYA 1K5NA 1ZT4A 4PJHA 5D7LA 4ZFZA 1JFMA 3E6HA 1N59A 1S8DA 2ZSVA 4JFQA 3CVHA 2YPKA 3L9RA 3PABA 4JRYA 4Y16A 3PWNA 4L8BA 3I6GA 3KYNA 3TF7A 5HHOA 1NEZA 1P7QA 2X4OA 3HPJA 1IM9A 3WL9A 3MV7A 3WS6A 4PRDA 3VRIA 2OI9A 3KPRA 1T0MA 3L3JA 3OXSA 1JUFA 4NNXA 3RZCA 3TZVC 3HCVA 3BUYA 5H94A 1ZVSA 4WJ5A 4GKSA 1HHJA 4U6XA 5DEFA 1AKJA 4ZUUA 5IM7A 1MHCA 1DUYA 4V3EB 3KPSA 3E2HA 1UXSA 4PGDA 3AU1A 3TA3A 4U1JA 1S9YA 5EU3A 3RGVC 3BH8A 3JTCA 1RJYA 1RJZA 1ZT1A 1JF1A 4U1SA 4D0BA 1I7UA 4F7EA 3OX8A 1QLFA 2X4UA 1R3HA 3VWJA 4NSKA 1ZHNA 3FQWA 1QQDA 2X4NA 3ILPA 4APQA 3GJFA 3QFJA 4HUXA 2P5EA 2BSTA 3M17A 4L9LC 3LKQA 3MRFA 4ZUTA 3RWFA 5GSRA 4S0UC 1HHGA 4F7MA 5IEKA 4NQDA 3P4MA 2VLJA 3B6SA 3VFPA 1SYSA 2F74A 3VFSA 3GSWA 3TVMA 3VFUA 4G8GA 2V2XA 3FQUA 1M05A 4N0FA 3TO2A 5C9JA 1OSZA 4U1IA 3ILQC 4Y4KA 4HV8A 3FQTA 3VXRA 5C0CA 3P4NA 5HGDA 3VXOA 4Y4FA 2YEZA 2X4TA 4JFEA 3P77A 5ACZA 4PJXA 3JTTA 4Y2DA 1GZPA 1T22A 3QQ4A 3QUXA 4NQVA 4U6YA 2BNRA 2F53A 4PGCA 3C9NA 3HE6A 2WY3A 3MRLA 3QUKA 5C0BA 3TJHA 3GMQA 3GSOA 3RUGA 2F54A 3DXAA 3VH8A 5MEQA 3GSUA 4O2CA 2YPLA 4FTVA 4PRBA 3GMPA 1M6OA 4HUUA 4ZUVA 1N3NA 1G6RH 4LCCC 2XPGA 2P5WA 2NW3A 5F1NA 1RK1A 3VXNA 4G42A 5IB2A 1A9EA 1ZAGA 4FFEX 3VFRA 1KJ3H 5C0GA 3KPNA 4WWKC 1T21A 1TVBA 3MYJA 5F7DA 2BSSA 2AXFA 4V3DB 3TO4A 2GAZA 1LEGA 3KWWA 3CCHA 1T7ZA 1T0NA 5B38A 4WDIA 5EUOA 3PWLA 1WBYA 4K71B 1CG9A 1LEKA 4PJEA 5HHPA 1MWAH 1I1FA 4PJ9A 1AGFA 3X14A 5EO0A 4L3CA 1Z5LA 1S9WA 4L4VA 1HSAA 5FDWA 4IHOA 2C7UA 4MNGA 5FKPA 3PWPA 5EU4A 2GT9A 5C07A 3CZFA 3H7BA 4PGEA 2RFXA 1FZKA 3HAEA 5EFIA 5IEHA 2PO6A 3GIVA 1Q94A 4NHUE 4LCWA 5GSVA 1BQHA 3CC5A 5INCA 2ZSWA 3SDXA 3B3IA 2H26A 1T1WA 1U58A 3GSNH 3LN5A 4IRSA 2CLZA 4Z78A 1QRNA 5E6IC 5MEPA 3MGOA 4WW2C 1XR8A 3GMLA 2V2WA 3LKSA 2X4PA 2AV1A 3FT3A 1FZJA 1WBXA 5HGAA 1JHTA 3LV3A 5SWSA 3QDGA 3BXNA 1AGBA 5C0IA 2H6PA 4NQXA 4HWZA 3HLAA 4JFPA 3GSRA 2FIKA 3QUZA 4IRJA 1S7XA 1I7TA 3KPQA 2X4RA 3RWEA 4QOKA 1KCGC 4PRAA 4QRSA 3VWKA 4HUWA 3FOLA 4D0DA 3PWVA 3QULA 1OF2A 3FRUA 1AGDA 3GSXA 3LN4A 3MRMA 3O8XA 4WU5A 3KPOA 4NQCA 3D2UA 4WU7A 3FFCA 3ECBA 3VXSA 5MENA 3QEQA 3S6CA 1YPZA 3KPLA 2FYYA 2BSRA 1AGEA 3IT8D 2BVPA 1EEYA 1P4LA 5JHDA 1BZ9A 5HGBA 4PG2A 1T7YA 5D7JC 1T1ZA 3DMMA 5E9DA 1ZT7A 3UTSA 3KPPA 4G8IA 4HUVA 3MRKA 3GSQA 4N0CA 2AK4A 1OGAA 1T7WA 1B3JA 3V5DA 4X6EA 1P1ZA 3ERYA 1CE6A 3CH1A 1S7QA 4PJ8A 1HHKA 3GMRA 5C08A 1XZ0A 1S7SA 1S7UA 2X4SA 5L2KA 5AD0A 2CKBH 1E28A 1YN6A 4F7PA 1PQZA 3MRBA 4CVZA 5J6GA 3BH9A 3RWIA 3BP4A 4GKNA 1A6ZA 1AGCA 3QI9A 4PJGA 2DYPA 1I1AA 4PDCE 1HHIA 4G59A 3BZEA 4X6DA 1LD9A 4NO2A 4NQEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K7F A;  2BVQ A;  4QRU A;  4L3E A;  4U1N A;  2HN7 A;  1BII A;  3IXA A;  5BRZ A;  1W0W A;  3ARG A;  5ENW A;  3UTT A;  2GIT A;  2AXG A;  4N8V A;  2BNQ A;  1HHH A;  3E3Q A;  1FO0 H;  4Z77 A;  3DX6 A;  5F1I A;  3DX7 A;  3TN0 A;  3UTQ A;  2HJL A;  3OV6 A;  1ZSD A;  4UQ2 A;  3C8K A;  1N5A A;  2HJK A;  3LKR A;  1LK2 A;  2BVO A;  1YN7 A;  3FON A;  2J8U A;  5BXF A;  5D2L A;  4X6F A;  3SDC A;  5E8N A;  1T80 A;  4CW1 A;  1EEZ A;  5C0E A;  3I6L D;  1VGK A;  4EN3 C;  1CD1 A;  2GJ6 A;  3L3I A;  3W0W A;  4JQX A;  1SYV A;  3O3B A;  2JCC A;  1FG2 A;  3FT4 A;  3ARB A;  1S9X A;  1DDH A;  4JFO A;  1JPF A;  3HE7 A;  4NO5 A;  5C0F A;  3NFN A;  4X6C A;  4HS3 A;  3PWU A;  4IIQ C;  3AM8 A;  4PJ7 A;  3M1B A;  5E8P A;  3SKO A;  3VXM A;  1IM3 A;  1B0G A;  4PP8 C;  3P4O A;  3E6F A;  2VE6 A;  1KTL A;  1FZO A;  3OXR A;  4HX1 A;  5C0A A;  1S7T A;  4EI5 A;  3BP7 A;  3CDG A;  5IB3 A;  1KJM A;  4G9F A;  4U1H A;  1DE4 A;  3MV9 A;  3VFO A;  3PWJ A;  3BW9 A;  3BZF A;  4LCY A;  4MNQ A;  4PJF A;  5ISZ A;  5IB5 A;  1A1N A;  3D3V A;  2VAA A;  5HGH A;  3RWD A;  5DDH A;  1ZHB A;  2PYE A;  5HYJ A;  4L29 A;  3QDJ A;  5BJT A;  3U0P A;  3HG1 A;  4QRP A;  4PJI A;  1T1X A;  4MJ5 A;  2VLR A;  2X70 A;  4N0U A;  3MRJ A;  2HLA A;  4MJI A;  5EU6 A;  2MHA A;  4PJ5 A;  4N5E A;  4L8D A;  5HHN A;  1S7R A;  4QRT A;  4JFD A;  5MEO A;  2ESV A;  4I4W A;  4O2F A;  3MRN A;  4PJA A;  5D9S A;  4D0C A;  1HYR C;  5IB1 A;  1NAM H;  3VXP A;  3LKN A;  4LNR A;  3I6K A;  2E7L E;  4PG9 A;  3P9L A;  1T1Y A;  1LP9 A;  1VAC A;  3BGM A;  2XFX A;  4LHU A;  3O3D A;  1NAN H;  3KLA A;  1HSB A;  3MR9 A;  4U1L A;  4PJB A;  1EXU A;  1KPV A;  3RWJ A;  2FO4 A;  2GTW A;  1BD2 A;  1W72 A;  1XH3 A;  4PJC A;  3KXF A;  5IND A;  1S7V A;  3X13 A;  3H9S A;  3GMO A;  4UQ3 A;  2OL3 H;  2AKR A;  4L4T A;  3P73 A;  1WBZ A;  3TBW A;  5D5M A;  5FA4 A;  3VJ6 A;  4ZAK A;  3BWA A;  5SWZ A;  5IRO A;  3G08 A;  4MQ7 A;  4PRH A;  1T7X A;  1A1O A;  2VAB A;  5EU5 A;  5B39 A;  3X11 A;  2ZOL A;  3SJV A;  3RWG A;  3TIE A;  1QVO A;  3DTX A;  3TFK A;  4WO4 A;  3TBV A;  4PRN A;  3RL2 A;  1I1Y A;  1MI5 A;  3MRR A;  4XXC A;  3V5H A;  4F7T A;  4QRR A;  3W39 A;  4L8C A;  1G7Q A;  3ARF A;  4WUU A;  3T1F A;  4MS8 A;  2CLR A;  3VCL A;  1YDP A;  3VFV A;  3SCM A;  3QDM A;  1QR1 A;  5E00 A;  3T8X A;  4NO3 A;  4G43 A;  1W0V A;  3RWC A;  5BS0 A;  4U1K A;  4PRP A;  1ZS8 A;  5C09 A;  1KPU A;  3MA7 A;  3ARD A;  5F9J A;  5C0D A;  1ED3 A;  2A83 A;  3SDD A;  3BEW A;  4Z76 A;  4E5X A;  3CPL A;  5HHQ A;  1FFN A;  1XR9 A;  2FWO A;  3SPV A;  2CIK A;  3FQR A;  1TVH A;  4ZUW A;  3HUJ A;  3QQ3 A;  5IB4 A;  1LQV A;  1DUZ A;  2FZ3 A;  3O3E A;  2GUO A;  4PV8 A;  4JFF A;  5EOT A;  3KYO A;  3LKO A;  1C16 A;  1VAD A;  5D2N A;  2VLK A;  1T20 A;  3TPU E;  1ZHL A;  2X4Q A;  5SWQ A;  4MJ6 A;  1JE6 A;  3RL1 A;  2ZOK A;  4ZUS A;  4HKJ A;  3L3K A;  1QEW A;  3O4L A;  3WUW A;  1JGD A;  3TBS A;  1INQ A;  5J6H A;  3LKP A;  1N2R A;  2VLL A;  1B0R A;  1ONQ A;  4NO0 A;  4U1M A;  3D39 A;  4PR5 A;  2CLV A;  3O9W A;  1KBG H;  1K8D A;  1RK0 A;  1S7W A;  3QFD A;  3BO8 A;  3GSV A;  3MRC A;  4MVB A;  4NT6 A;  3WLB A;  5FA3 A;  1KJV A;  1HOC A;  3UBX A;  1TMC A;  3RWH A;  1AO7 A;  3DX8 A;  3BVN A;  2CII A;  3H9H A;  3MGT A;  2UWE A;  3ARE A;  4O2E A;  4MXQ A;  3VRJ A;  3MRE A;  4I48 A;  1I7R A;  5D7I A;  4ELM A;  5J1A A;  5IVX A;  1KPR A;  1G7P A;  5EO1 A;  2AV7 A;  3FT2 A;  4G9D A;  4L8S C;  3O3A A;  4PRE A;  5DEG A;  3MRH A;  4Y4H A;  3FTG A;  2Q7Y A;  1MHE A;  1JGE A;  3WS3 A;  5C0J A;  1E27 A;  1EFX A;  3D18 A;  1FFO A;  1FZM A;  1T7V A;  1L8J A;  3FOM A;  3VFW A;  4F7C A;  1GZQ A;  3ROO A;  3GMN A;  3VXU A;  3D25 A;  4MX7 A;  3MRQ A;  3MRD A;  3L3D A;  1A9B A;  3BEV A;  3BHB A;  1FFP A;  4GUP A;  3JTS A;  3MRO A;  5MER A;  2NX5 A;  3TBY A;  1QSE A;  5E8O A;  4EUP A;  1UQS A;  3UPR A;  3L3G A;  2BCK A;  2GTZ A;  3P9M A;  1ZHK A;  4PGB A;  4JQV A;  4PV9 A;  3FQX A;  5L2J A;  3TBT A;  2D31 A;  1A1M A;  1KJ2 H;  3L3H A;  1QO3 A;  1OGT A;  4E0R A;  3FQN A;  3MRP A;  3ROL A;  4NNY A;  1X7Q A;  4QRQ A;  1LDP H;  3SKM A;  1UXW A;  3MV8 A;  1JPG A;  3REW A;  3RTQ A;  3VFT A;  3QZW A;  3V5K A;  4CVX A;  3VFN A;  1I4F A;  4PRI A;  3VFM A;  4ONO A;  3X12 A;  3PQY A;  5HHM A;  3SDA A;  3MRG A;  3MRI A;  1QSF A;  3JVG A;  3TID A;  3ES6 A;  3GMM A;  4PJD A;  4JRX A;  3KPM A;  3DBX A;  3QUY A;  1K5N A;  1ZT4 A;  4PJH A;  5D7L A;  4ZFZ A;  1JFM A;  3E6H A;  1N59 A;  1S8D A;  2ZSV A;  4JFQ A;  3CVH A;  2YPK A;  3L9R A;  3PAB A;  4JRY A;  4Y16 A;  3PWN A;  4L8B A;  3I6G A;  3KYN A;  3TF7 A;  5HHO A;  1NEZ A;  1P7Q A;  2X4O A;  3HPJ A;  1IM9 A;  3WL9 A;  3MV7 A;  3WS6 A;  4PRD A;  3VRI A;  2OI9 A;  3KPR A;  1T0M A;  3L3J A;  3OXS A;  1JUF A;  4NNX A;  3RZC A;  3TZV C;  3HCV A;  3BUY A;  5H94 A;  1ZVS A;  4WJ5 A;  4GKS A;  1HHJ A;  4U6X A;  5DEF A;  1AKJ A;  4ZUU A;  5IM7 A;  1MHC A;  1DUY A;  4V3E B;  3KPS A;  3E2H A;  1UXS A;  4PGD A;  3AU1 A;  3TA3 A;  4U1J A;  1S9Y A;  5EU3 A;  3RGV C;  3BH8 A;  3JTC A;  1RJY A;  1RJZ A;  1ZT1 A;  1JF1 A;  4U1S A;  4D0B A;  1I7U A;  4F7E A;  3OX8 A;  1QLF A;  2X4U A;  1R3H A;  3VWJ A;  4NSK A;  1ZHN A;  3FQW A;  1QQD A;  2X4N A;  3ILP A;  4APQ A;  3GJF A;  3QFJ A;  4HUX A;  2P5E A;  2BST A;  3M17 A;  4L9L C;  3LKQ A;  3MRF A;  4ZUT A;  3RWF A;  5GSR A;  4S0U C;  1HHG A;  4F7M A;  5IEK A;  4NQD A;  3P4M A;  2VLJ A;  3B6S A;  3VFP A;  1SYS A;  2F74 A;  3VFS A;  3GSW A;  3TVM A;  3VFU A;  4G8G A;  2V2X A;  3FQU A;  1M05 A;  4N0F A;  3TO2 A;  5C9J A;  1OSZ A;  4U1I A;  3ILQ C;  4Y4K A;  4HV8 A;  3FQT A;  3VXR A;  5C0C A;  3P4N A;  5HGD A;  3VXO A;  4Y4F A;  2YEZ A;  2X4T A;  4JFE A;  3P77 A;  5ACZ A;  4PJX A;  3JTT A;  4Y2D A;  1GZP A;  1T22 A;  3QQ4 A;  3QUX A;  4NQV A;  4U6Y A;  2BNR A;  2F53 A;  4PGC A;  3C9N A;  3HE6 A;  2WY3 A;  3MRL A;  3QUK A;  5C0B A;  3TJH A;  3GMQ A;  3GSO A;  3RUG A;  2F54 A;  3DXA A;  3VH8 A;  5MEQ A;  3GSU A;  4O2C A;  2YPL A;  4FTV A;  4PRB A;  3GMP A;  1M6O A;  4HUU A;  4ZUV A;  1N3N A;  1G6R H;  4LCC C;  2XPG A;  2P5W A;  2NW3 A;  5F1N A;  1RK1 A;  3VXN A;  4G42 A;  5IB2 A;  1A9E A;  1ZAG A;  4FFE X;  3VFR A;  1KJ3 H;  5C0G A;  3KPN A;  4WWK C;  1T21 A;  1TVB A;  3MYJ A;  5F7D A;  2BSS A;  2AXF A;  4V3D B;  3TO4 A;  2GAZ A;  1LEG A;  3KWW A;  3CCH A;  1T7Z A;  1T0N A;  5B38 A;  4WDI A;  5EUO A;  3PWL A;  1WBY A;  4K71 B;  1CG9 A;  1LEK A;  4PJE A;  5HHP A;  1MWA H;  1I1F A;  4PJ9 A;  1AGF A;  3X14 A;  5EO0 A;  4L3C A;  1Z5L A;  1S9W A;  4L4V A;  1HSA A;  5FDW A;  4IHO A;  2C7U A;  4MNG A;  5FKP A;  3PWP A;  5EU4 A;  2GT9 A;  5C07 A;  3CZF A;  3H7B A;  4PGE A;  2RFX A;  1FZK A;  3HAE A;  5EFI A;  5IEH A;  2PO6 A;  3GIV A;  1Q94 A;  4NHU E;  4LCW A;  5GSV A;  1BQH A;  3CC5 A;  5INC A;  2ZSW A;  3SDX A;  3B3I A;  2H26 A;  1T1W A;  1U58 A;  3GSN H;  3LN5 A;  4IRS A;  2CLZ A;  4Z78 A;  1QRN A;  5E6I C;  5MEP A;  3MGO A;  4WW2 C;  1XR8 A;  3GML A;  2V2W A;  3LKS A;  2X4P A;  2AV1 A;  3FT3 A;  1FZJ A;  1WBX A;  5HGA A;  1JHT A;  3LV3 A;  5SWS A;  3QDG A;  3BXN A;  1AGB A;  5C0I A;  2H6P A;  4NQX A;  4HWZ A;  3HLA A;  4JFP A;  3GSR A;  2FIK A;  3QUZ A;  4IRJ A;  1S7X A;  1I7T A;  3KPQ A;  2X4R A;  3RWE A;  4QOK A;  1KCG C;  4PRA A;  4QRS A;  3VWK A;  4HUW A;  3FOL A;  4D0D A;  3PWV A;  3QUL A;  1OF2 A;  3FRU A;  1AGD A;  3GSX A;  3LN4 A;  3MRM A;  3O8X A;  4WU5 A;  3KPO A;  4NQC A;  3D2U A;  4WU7 A;  3FFC A;  3ECB A;  3VXS A;  5MEN A;  3QEQ A;  3S6C A;  1YPZ A;  3KPL A;  2FYY A;  2BSR A;  1AGE A;  3IT8 D;  2BVP A;  1EEY A;  1P4L A;  5JHD A;  1BZ9 A;  5HGB A;  4PG2 A;  1T7Y A;  5D7J C;  1T1Z A;  3DMM A;  5E9D A;  1ZT7 A;  3UTS A;  3KPP A;  4G8I A;  4HUV A;  3MRK A;  3GSQ A;  4N0C A;  2AK4 A;  1OGA A;  1T7W A;  1B3J A;  3V5D A;  4X6E A;  1P1Z A;  3ERY A;  1CE6 A;  3CH1 A;  1S7Q A;  4PJ8 A;  1HHK A;  3GMR A;  5C08 A;  1XZ0 A;  1S7S A;  1S7U A;  2X4S A;  5L2K A;  5AD0 A;  2CKB H;  1E28 A;  1YN6 A;  4F7P A;  1PQZ A;  3MRB A;  4CVZ A;  5J6G A;  3BH9 A;  3RWI A;  3BP4 A;  4GKN A;  1A6Z A;  1AGC A;  3QI9 A;  4PJG A;  2DYP A;  1I1A A;  4PDC E;  1HHI A;  4G59 A;  3BZE A;  4X6D A;  1LD9 A;  4NO2 A;  4NQE A; 
#chains in the Genus database with same CATH topology
 4K7F A;  2BVQ A;  4QRU A;  4L3E A;  4U1N A;  2HN7 A;  1BII A;  3IXA A;  5BRZ A;  1W0W A;  3ARG A;  5ENW A;  3UTT A;  2GIT A;  2AXG A;  4N8V A;  2BNQ A;  1HHH A;  3E3Q A;  1FO0 H;  4Z77 A;  3DX6 A;  5F1I A;  3DX7 A;  3TN0 A;  3UTQ A;  2HJL A;  3OV6 A;  1ZSD A;  4UQ2 A;  3C8K A;  1N5A A;  2HJK A;  3LKR A;  1LK2 A;  2BVO A;  1YN7 A;  3FON A;  2J8U A;  5BXF A;  5D2L A;  4X6F A;  3SDC A;  5E8N A;  1T80 A;  4CW1 A;  1EEZ A;  5C0E A;  3I6L D;  1VGK A;  4EN3 C;  1CD1 A;  2GJ6 A;  3L3I A;  3W0W A;  4JQX A;  1SYV A;  3O3B A;  2JCC A;  1FG2 A;  3FT4 A;  3ARB A;  1S9X A;  1DDH A;  4JFO A;  1JPF A;  3HE7 A;  4NO5 A;  5C0F A;  3NFN A;  4X6C A;  4HS3 A;  3PWU A;  4IIQ C;  3AM8 A;  4PJ7 A;  3M1B A;  5E8P A;  3SKO A;  3VXM A;  1IM3 A;  1B0G A;  4PP8 C;  3P4O A;  3E6F A;  2VE6 A;  1KTL A;  1FZO A;  3OXR A;  4HX1 A;  5C0A A;  1S7T A;  4EI5 A;  3BP7 A;  3CDG A;  5IB3 A;  1KJM A;  4G9F A;  4U1H A;  1DE4 A;  3MV9 A;  3VFO A;  3PWJ A;  3BW9 A;  3BZF A;  4LCY A;  4MNQ A;  4PJF A;  5ISZ A;  5IB5 A;  1A1N A;  3D3V A;  2VAA A;  5HGH A;  3RWD A;  5DDH A;  1ZHB A;  2PYE A;  5HYJ A;  4L29 A;  3QDJ A;  5BJT A;  3U0P A;  3HG1 A;  4QRP A;  4PJI A;  1T1X A;  4MJ5 A;  2VLR A;  2X70 A;  4N0U A;  3MRJ A;  2HLA A;  4MJI A;  5EU6 A;  2MHA A;  4PJ5 A;  4N5E A;  4L8D A;  5HHN A;  1S7R A;  4QRT A;  4JFD A;  5MEO A;  2ESV A;  4I4W A;  4O2F A;  3MRN A;  4PJA A;  5D9S A;  4D0C A;  1HYR C;  5IB1 A;  1NAM H;  3VXP A;  3LKN A;  4LNR A;  3I6K A;  2E7L E;  4PG9 A;  3P9L A;  1T1Y A;  1LP9 A;  1VAC A;  3BGM A;  2XFX A;  4LHU A;  3O3D A;  1NAN H;  3KLA A;  1HSB A;  3MR9 A;  4U1L A;  4PJB A;  1EXU A;  1KPV A;  3RWJ A;  2FO4 A;  2GTW A;  1BD2 A;  1W72 A;  1XH3 A;  4PJC A;  3KXF A;  5IND A;  1S7V A;  3X13 A;  3H9S A;  2IA1 A;  3GMO A;  4UQ3 A;  2OL3 H;  2AKR A;  4L4T A;  3P73 A;  1WBZ A;  3TBW A;  5D5M A;  5FA4 A;  3VJ6 A;  4ZAK A;  3BWA A;  5SWZ A;  5IRO A;  3G08 A;  4MQ7 A;  4PRH A;  1T7X A;  1A1O A;  2VAB A;  5EU5 A;  5B39 A;  3X11 A;  2ZOL A;  3SJV A;  3RWG A;  3TIE A;  1QVO A;  3DTX A;  3TFK A;  4WO4 A;  3TBV A;  4PRN A;  3RL2 A;  1I1Y A;  1MI5 A;  3MRR A;  4XXC A;  3V5H A;  4F7T A;  4QRR A;  3W39 A;  4L8C A;  1G7Q A;  3ARF A;  4WUU A;  3T1F A;  4MS8 A;  2CLR A;  3VCL A;  1YDP A;  3VFV A;  3SCM A;  3QDM A;  1QR1 A;  5E00 A;  3T8X A;  4NO3 A;  4G43 A;  1W0V A;  3RWC A;  5BS0 A;  4U1K A;  4PRP A;  1ZS8 A;  5C09 A;  1KPU A;  3MA7 A;  3ARD A;  5F9J A;  5C0D A;  1ED3 A;  2A83 A;  3SDD A;  3BEW A;  4Z76 A;  4E5X A;  3CPL A;  5HHQ A;  1FFN A;  1XR9 A;  2FWO A;  3SPV A;  2CIK A;  3FQR A;  1TVH A;  4ZUW A;  3HUJ A;  3QQ3 A;  5IB4 A;  1LQV A;  1DUZ A;  2FZ3 A;  3I0T A;  3O3E A;  2GUO A;  4PV8 A;  4JFF A;  5EOT A;  3KYO A;  3LKO A;  1C16 A;  1VAD A;  5D2N A;  2VLK A;  1T20 A;  3TPU E;  1ZHL A;  2X4Q A;  5SWQ A;  4MJ6 A;  1JE6 A;  3RL1 A;  2ZOK A;  4ZUS A;  4HKJ A;  3L3K A;  1QEW A;  3O4L A;  3WUW A;  1JGD A;  3TBS A;  1INQ A;  5J6H A;  3LKP A;  1N2R A;  2VLL A;  1B0R A;  1ONQ A;  4NO0 A;  4U1M A;  3D39 A;  4PR5 A;  2CLV A;  3O9W A;  1KBG H;  1K8D A;  1RK0 A;  1S7W A;  3QFD A;  3BO8 A;  3GSV A;  3MRC A;  4MVB A;  4NT6 A;  3WLB A;  5FA3 A;  1KJV A;  1HOC A;  3UBX A;  1TMC A;  3RWH A;  1AO7 A;  3DX8 A;  3BVN A;  2CII A;  3H9H A;  3MGT A;  2UWE A;  3ARE A;  4O2E A;  4MXQ A;  3VRJ A;  3MRE A;  4I48 A;  1I7R A;  5D7I A;  4ELM A;  5J1A A;  5IVX A;  1KPR A;  1G7P A;  5EO1 A;  2AV7 A;  3FT2 A;  4G9D A;  4L8S C;  3O3A A;  4PRE A;  5DEG A;  3MRH A;  4Y4H A;  3FTG A;  2Q7Y A;  1MHE A;  1JGE A;  3WS3 A;  5C0J A;  1E27 A;  1EFX A;  3D18 A;  1FFO A;  1FZM A;  1T7V A;  1L8J A;  3FOM A;  3VFW A;  4F7C A;  1GZQ A;  3ROO A;  3GMN A;  3VXU A;  3D25 A;  4MX7 A;  3MRQ A;  3MRD A;  3L3D A;  1A9B A;  3BEV A;  3BHB A;  1FFP A;  4GUP A;  3JTS A;  3MRO A;  5MER A;  2NX5 A;  3TBY A;  1QSE A;  5E8O A;  4EUP A;  1UQS A;  3UPR A;  3L3G A;  2BCK A;  2GTZ A;  3P9M A;  1ZHK A;  4PGB A;  4JQV A;  4PV9 A;  3FQX A;  5L2J A;  3TBT A;  2D31 A;  1A1M A;  1KJ2 H;  3L3H A;  1QO3 A;  1OGT A;  4E0R A;  3FQN A;  3MRP A;  3ROL A;  4NNY A;  1X7Q A;  4BKW A;  4QRQ A;  1LDP H;  3SKM A;  1UXW A;  4G59 C;  3MV8 A;  1JPG A;  3REW A;  3RTQ A;  3VFT A;  3QZW A;  3V5K A;  4CVX A;  3VFN A;  1I4F A;  4PRI A;  3VFM A;  4ONO A;  3X12 A;  3PQY A;  5HHM A;  3SDA A;  3MRG A;  3MRI A;  1QSF A;  3JVG A;  3TID A;  3ES6 A;  3GMM A;  4PJD A;  4JRX A;  3KPM A;  3DBX A;  3QUY A;  1K5N A;  1ZT4 A;  4PJH A;  5D7L A;  4ZFZ A;  1JFM A;  3E6H A;  1N59 A;  1S8D A;  2ZSV A;  4JFQ A;  3CVH A;  2YPK A;  3L9R A;  3PAB A;  4JRY A;  4Y16 A;  3PWN A;  4L8B A;  3I6G A;  3KYN A;  3TF7 A;  5HHO A;  1NEZ A;  1P7Q A;  2X4O A;  3HPJ A;  1IM9 A;  3WL9 A;  3MV7 A;  3WS6 A;  4PRD A;  3VRI A;  2OI9 A;  3KPR A;  2O5N A;  1T0M A;  3L3J A;  3OXS A;  1JUF A;  4NNX A;  3RZC A;  3TZV C;  3HCV A;  3BUY A;  5H94 A;  1ZVS A;  4WJ5 A;  4GKS A;  1HHJ A;  4U6X A;  5DEF A;  1AKJ A;  4ZUU A;  5IM7 A;  1MHC A;  1DUY A;  4V3E B;  3KPS A;  3E2H A;  1UXS A;  4PGD A;  3AU1 A;  3TA3 A;  4U1J A;  1S9Y A;  5EU3 A;  3RGV C;  3BH8 A;  3JTC A;  1RJY A;  1RJZ A;  1ZT1 A;  1JF1 A;  4U1S A;  4D0B A;  1I7U A;  4F7E A;  3OX8 A;  1QLF A;  2X4U A;  1R3H A;  3VWJ A;  4NSK A;  1ZHN A;  3FQW A;  1QQD A;  2X4N A;  3ILP A;  4APQ A;  3GJF A;  3QFJ A;  4HUX A;  2P5E A;  2BST A;  3M17 A;  4L9L C;  3LKQ A;  3MRF A;  4ZUT A;  3RWF A;  5GSR A;  4S0U C;  1HHG A;  4F7M A;  5IEK A;  4NQD A;  3P4M A;  2VLJ A;  3B6S A;  3VFP A;  1SYS A;  2F74 A;  3VFS A;  3GSW A;  3TVM A;  3VFU A;  2NYK A;  4G8G A;  2V2X A;  3FQU A;  1M05 A;  4N0F A;  3TO2 A;  5C9J A;  1OSZ A;  4U1I A;  3ILQ C;  4Y4K A;  4HV8 A;  3FQT A;  3VXR A;  5C0C A;  3P4N A;  5HGD A;  3VXO A;  4Y4F A;  2YEZ A;  2X4T A;  4JFE A;  3P77 A;  5ACZ A;  4PJX A;  3JTT A;  4Y2D A;  1GZP A;  1T22 A;  3QQ4 A;  3QUX A;  4NQV A;  4U6Y A;  2BNR A;  2F53 A;  4PGC A;  3C9N A;  3HE6 A;  2WY3 A;  3MRL A;  3QUK A;  5C0B A;  3TJH A;  3GMQ A;  3GSO A;  3RUG A;  2F54 A;  3DXA A;  3VH8 A;  5MEQ A;  3GSU A;  4O2C A;  2YPL A;  4FTV A;  4PRB A;  3GMP A;  1M6O A;  4HUU A;  4ZUV A;  1N3N A;  1G6R H;  4LCC C;  2XPG A;  2P5W A;  2NW3 A;  5F1N A;  1RK1 A;  3VXN A;  4G42 A;  5IB2 A;  1A9E A;  1ZAG A;  4FFE X;  3VFR A;  1KJ3 H;  5C0G A;  3KPN A;  4WWK C;  1T21 A;  1TVB A;  3MYJ A;  5F7D A;  2BSS A;  2AXF A;  4V3D B;  3TO4 A;  2GAZ A;  1LEG A;  3KWW A;  3CCH A;  1T7Z A;  1T0N A;  5B38 A;  4WDI A;  5EUO A;  3PWL A;  1WBY A;  4JO8 A;  4K71 B;  1CG9 A;  1LEK A;  4PJE A;  5HHP A;  1MWA H;  1I1F A;  4PJ9 A;  1AGF A;  3X14 A;  5EO0 A;  4L3C A;  1Z5L A;  1S9W A;  4L4V A;  1HSA A;  5FDW A;  4IHO A;  2C7U A;  4MNG A;  5FKP A;  3PWP A;  5EU4 A;  2GT9 A;  5C07 A;  3CZF A;  3H7B A;  4PGE A;  2RFX A;  1FZK A;  3HAE A;  5EFI A;  5IEH A;  2PO6 A;  3GIV A;  1Q94 A;  4NHU E;  4LCW A;  5GSV A;  1BQH A;  3CC5 A;  5INC A;  2ZSW A;  3SDX A;  3B3I A;  2H26 A;  1T1W A;  1U58 A;  3GSN H;  3LN5 A;  4IRS A;  2CLZ A;  4Z78 A;  1QRN A;  5E6I C;  5MEP A;  3MGO A;  4WW2 C;  1XR8 A;  3GML A;  2V2W A;  3LKS A;  2X4P A;  2AV1 A;  3FT3 A;  1FZJ A;  1WBX A;  5HGA A;  1JHT A;  3LV3 A;  5SWS A;  3QDG A;  3BXN A;  1AGB A;  5C0I A;  2H6P A;  4NQX A;  4HWZ A;  3HLA A;  4JFP A;  3GSR A;  2FIK A;  3QUZ A;  4IRJ A;  1S7X A;  1I7T A;  3KPQ A;  2X4R A;  3RWE A;  4QOK A;  1KCG C;  4PRA A;  4QRS A;  3VWK A;  4HUW A;  3FOL A;  4D0D A;  3PWV A;  3QUL A;  1OF2 A;  3FRU A;  1AGD A;  3GSX A;  3LN4 A;  3MRM A;  3O8X A;  4WU5 A;  3KPO A;  4NQC A;  3D2U A;  4WU7 A;  3FFC A;  3ECB A;  3VXS A;  5MEN A;  3QEQ A;  3S6C A;  1YPZ A;  3KPL A;  2FYY A;  2BSR A;  1AGE A;  3IT8 D;  2BVP A;  1EEY A;  1P4L A;  5JHD A;  1BZ9 A;  5HGB A;  4PG2 A;  1T7Y A;  5D7J C;  1T1Z A;  3DMM A;  5E9D A;  1ZT7 A;  3UTS A;  3KPP A;  4G8I A;  4HUV A;  3MRK A;  3GSQ A;  4N0C A;  2AK4 A;  1OGA A;  1T7W A;  1B3J A;  3V5D A;  4X6E A;  1P1Z A;  3ERY A;  1CE6 A;  3CH1 A;  1S7Q A;  4PJ8 A;  1HHK A;  3GMR A;  5C08 A;  1XZ0 A;  1S7S A;  1S7U A;  2X4S A;  5L2K A;  5AD0 A;  2CKB H;  1E28 A;  1YN6 A;  4F7P A;  1PQZ A;  3MRB A;  4CVZ A;  5J6G A;  3BH9 A;  3RWI A;  3BP4 A;  4GKN A;  1A6Z A;  1AGC A;  3QI9 A;  4PJG A;  2DYP A;  1I1A A;  4PDC E;  1HHI A;  4G59 A;  3BZE A;  4X6D A;  1LD9 A;  4NO2 A;  4NQE A; 
#chains in the Genus database with same CATH homology
 4K7F A;  2BVQ A;  4QRU A;  4L3E A;  4U1N A;  2HN7 A;  1BII A;  3IXA A;  5BRZ A;  1W0W A;  3ARG A;  5ENW A;  3UTT A;  2GIT A;  2AXG A;  4N8V A;  2BNQ A;  1HHH A;  3E3Q A;  1FO0 H;  4Z77 A;  3DX6 A;  5F1I A;  3DX7 A;  3TN0 A;  3UTQ A;  2HJL A;  3OV6 A;  1ZSD A;  4UQ2 A;  3C8K A;  1N5A A;  2HJK A;  3LKR A;  1LK2 A;  2BVO A;  1YN7 A;  3FON A;  2J8U A;  5BXF A;  5D2L A;  4X6F A;  3SDC A;  5E8N A;  1T80 A;  4CW1 A;  1EEZ A;  5C0E A;  3I6L D;  1VGK A;  4EN3 C;  1CD1 A;  2GJ6 A;  3L3I A;  3W0W A;  4JQX A;  1SYV A;  3O3B A;  2JCC A;  1FG2 A;  3FT4 A;  3ARB A;  1S9X A;  1DDH A;  4JFO A;  1JPF A;  3HE7 A;  4NO5 A;  5C0F A;  3NFN A;  4X6C A;  4HS3 A;  3PWU A;  4IIQ C;  3AM8 A;  4PJ7 A;  3M1B A;  5E8P A;  3SKO A;  3VXM A;  1IM3 A;  1B0G A;  4PP8 C;  3P4O A;  3E6F A;  2VE6 A;  1KTL A;  1FZO A;  3OXR A;  4HX1 A;  5C0A A;  1S7T A;  4EI5 A;  3BP7 A;  3CDG A;  5IB3 A;  1KJM A;  4G9F A;  4U1H A;  1DE4 A;  3MV9 A;  3VFO A;  3PWJ A;  3BW9 A;  3BZF A;  4LCY A;  4MNQ A;  4PJF A;  5ISZ A;  5IB5 A;  1A1N A;  3D3V A;  2VAA A;  5HGH A;  3RWD A;  5DDH A;  1ZHB A;  2PYE A;  5HYJ A;  4L29 A;  3QDJ A;  5BJT A;  3U0P A;  3HG1 A;  4QRP A;  4PJI A;  1T1X A;  4MJ5 A;  2VLR A;  2X70 A;  4N0U A;  3MRJ A;  2HLA A;  4MJI A;  5EU6 A;  2MHA A;  4PJ5 A;  4N5E A;  4L8D A;  5HHN A;  1S7R A;  4QRT A;  4JFD A;  5MEO A;  2ESV A;  4I4W A;  4O2F A;  3MRN A;  4PJA A;  5D9S A;  4D0C A;  1HYR C;  5IB1 A;  1NAM H;  3VXP A;  3LKN A;  4LNR A;  3I6K A;  2E7L E;  4PG9 A;  3P9L A;  1T1Y A;  1LP9 A;  1VAC A;  3BGM A;  2XFX A;  4LHU A;  3O3D A;  1NAN H;  3KLA A;  1HSB A;  3MR9 A;  4U1L A;  4PJB A;  1EXU A;  1KPV A;  3RWJ A;  2FO4 A;  2GTW A;  1BD2 A;  1W72 A;  1XH3 A;  4PJC A;  3KXF A;  5IND A;  1S7V A;  3X13 A;  3H9S A;  3GMO A;  4UQ3 A;  2OL3 H;  2AKR A;  4L4T A;  3P73 A;  1WBZ A;  3TBW A;  5D5M A;  5FA4 A;  3VJ6 A;  4ZAK A;  3BWA A;  5SWZ A;  5IRO A;  3G08 A;  4MQ7 A;  4PRH A;  1T7X A;  1A1O A;  2VAB A;  5EU5 A;  5B39 A;  3X11 A;  2ZOL A;  3SJV A;  3RWG A;  3TIE A;  1QVO A;  3DTX A;  3TFK A;  4WO4 A;  3TBV A;  4PRN A;  3RL2 A;  1I1Y A;  1MI5 A;  3MRR A;  4XXC A;  3V5H A;  4F7T A;  4QRR A;  3W39 A;  4L8C A;  1G7Q A;  3ARF A;  4WUU A;  3T1F A;  4MS8 A;  2CLR A;  3VCL A;  1YDP A;  3VFV A;  3SCM A;  3QDM A;  1QR1 A;  5E00 A;  3T8X A;  4NO3 A;  4G43 A;  1W0V A;  3RWC A;  5BS0 A;  4U1K A;  4PRP A;  1ZS8 A;  5C09 A;  1KPU A;  3MA7 A;  3ARD A;  5F9J A;  5C0D A;  1ED3 A;  2A83 A;  3SDD A;  3BEW A;  4Z76 A;  4E5X A;  3CPL A;  5HHQ A;  1FFN A;  1XR9 A;  2FWO A;  3SPV A;  2CIK A;  3FQR A;  1TVH A;  4ZUW A;  3HUJ A;  3QQ3 A;  5IB4 A;  1LQV A;  1DUZ A;  2FZ3 A;  3O3E A;  2GUO A;  4PV8 A;  4JFF A;  5EOT A;  3KYO A;  3LKO A;  1C16 A;  1VAD A;  5D2N A;  2VLK A;  1T20 A;  3TPU E;  1ZHL A;  2X4Q A;  5SWQ A;  4MJ6 A;  1JE6 A;  3RL1 A;  2ZOK A;  4ZUS A;  4HKJ A;  3L3K A;  1QEW A;  3O4L A;  3WUW A;  1JGD A;  3TBS A;  1INQ A;  5J6H A;  3LKP A;  1N2R A;  2VLL A;  1B0R A;  1ONQ A;  4NO0 A;  4U1M A;  3D39 A;  4PR5 A;  2CLV A;  3O9W A;  1KBG H;  1K8D A;  1RK0 A;  1S7W A;  3QFD A;  3BO8 A;  3GSV A;  3MRC A;  4MVB A;  4NT6 A;  3WLB A;  5FA3 A;  1KJV A;  1HOC A;  3UBX A;  1TMC A;  3RWH A;  1AO7 A;  3DX8 A;  3BVN A;  2CII A;  3H9H A;  3MGT A;  2UWE A;  3ARE A;  4O2E A;  4MXQ A;  3VRJ A;  3MRE A;  4I48 A;  1I7R A;  5D7I A;  4ELM A;  5J1A A;  5IVX A;  1KPR A;  1G7P A;  5EO1 A;  2AV7 A;  3FT2 A;  4G9D A;  4L8S C;  3O3A A;  4PRE A;  5DEG A;  3MRH A;  4Y4H A;  3FTG A;  2Q7Y A;  1MHE A;  1JGE A;  3WS3 A;  5C0J A;  1E27 A;  1EFX A;  3D18 A;  1FFO A;  1FZM A;  1T7V A;  1L8J A;  3FOM A;  3VFW A;  4F7C A;  1GZQ A;  3ROO A;  3GMN A;  3VXU A;  3D25 A;  4MX7 A;  3MRQ A;  3MRD A;  3L3D A;  1A9B A;  3BEV A;  3BHB A;  1FFP A;  4GUP A;  3JTS A;  3MRO A;  5MER A;  2NX5 A;  3TBY A;  1QSE A;  5E8O A;  4EUP A;  1UQS A;  3UPR A;  3L3G A;  2BCK A;  2GTZ A;  3P9M A;  1ZHK A;  4PGB A;  4JQV A;  4PV9 A;  3FQX A;  5L2J A;  3TBT A;  2D31 A;  1A1M A;  1KJ2 H;  3L3H A;  1QO3 A;  1OGT A;  4E0R A;  3FQN A;  3MRP A;  3ROL A;  4NNY A;  1X7Q A;  4QRQ A;  1LDP H;  3SKM A;  1UXW A;  3MV8 A;  1JPG A;  3REW A;  3RTQ A;  3VFT A;  3QZW A;  3V5K A;  4CVX A;  3VFN A;  1I4F A;  4PRI A;  3VFM A;  4ONO A;  3X12 A;  3PQY A;  5HHM A;  3SDA A;  3MRG A;  3MRI A;  1QSF A;  3JVG A;  3TID A;  3ES6 A;  3GMM A;  4PJD A;  4JRX A;  3KPM A;  3DBX A;  3QUY A;  1K5N A;  1ZT4 A;  4PJH A;  5D7L A;  4ZFZ A;  1JFM A;  3E6H A;  1N59 A;  1S8D A;  2ZSV A;  4JFQ A;  3CVH A;  2YPK A;  3L9R A;  3PAB A;  4JRY A;  4Y16 A;  3PWN A;  4L8B A;  3I6G A;  3KYN A;  3TF7 A;  5HHO A;  1NEZ A;  1P7Q A;  2X4O A;  3HPJ A;  1IM9 A;  3WL9 A;  3MV7 A;  3WS6 A;  4PRD A;  3VRI A;  2OI9 A;  3KPR A;  1T0M A;  3L3J A;  3OXS A;  1JUF A;  4NNX A;  3RZC A;  3TZV C;  3HCV A;  3BUY A;  5H94 A;  1ZVS A;  4WJ5 A;  4GKS A;  1HHJ A;  4U6X A;  5DEF A;  1AKJ A;  4ZUU A;  5IM7 A;  1MHC A;  1DUY A;  4V3E B;  3KPS A;  3E2H A;  1UXS A;  4PGD A;  3AU1 A;  3TA3 A;  4U1J A;  1S9Y A;  5EU3 A;  3RGV C;  3BH8 A;  3JTC A;  1RJY A;  1RJZ A;  1ZT1 A;  1JF1 A;  4U1S A;  4D0B A;  1I7U A;  4F7E A;  3OX8 A;  1QLF A;  2X4U A;  1R3H A;  3VWJ A;  4NSK A;  1ZHN A;  3FQW A;  1QQD A;  2X4N A;  3ILP A;  4APQ A;  3GJF A;  3QFJ A;  4HUX A;  2P5E A;  2BST A;  3M17 A;  4L9L C;  3LKQ A;  3MRF A;  4ZUT A;  3RWF A;  5GSR A;  4S0U C;  1HHG A;  4F7M A;  5IEK A;  4NQD A;  3P4M A;  2VLJ A;  3B6S A;  3VFP A;  1SYS A;  2F74 A;  3VFS A;  3GSW A;  3TVM A;  3VFU A;  4G8G A;  2V2X A;  3FQU A;  1M05 A;  4N0F A;  3TO2 A;  5C9J A;  1OSZ A;  4U1I A;  3ILQ C;  4Y4K A;  4HV8 A;  3FQT A;  3VXR A;  5C0C A;  3P4N A;  5HGD A;  3VXO A;  4Y4F A;  2YEZ A;  2X4T A;  4JFE A;  3P77 A;  5ACZ A;  4PJX A;  3JTT A;  4Y2D A;  1GZP A;  1T22 A;  3QQ4 A;  3QUX A;  4NQV A;  4U6Y A;  2BNR A;  2F53 A;  4PGC A;  3C9N A;  3HE6 A;  2WY3 A;  3MRL A;  3QUK A;  5C0B A;  3TJH A;  3GMQ A;  3GSO A;  3RUG A;  2F54 A;  3DXA A;  3VH8 A;  5MEQ A;  3GSU A;  4O2C A;  2YPL A;  4FTV A;  4PRB A;  3GMP A;  1M6O A;  4HUU A;  4ZUV A;  1N3N A;  1G6R H;  4LCC C;  2XPG A;  2P5W A;  2NW3 A;  5F1N A;  1RK1 A;  3VXN A;  4G42 A;  5IB2 A;  1A9E A;  1ZAG A;  4FFE X;  3VFR A;  1KJ3 H;  5C0G A;  3KPN A;  4WWK C;  1T21 A;  1TVB A;  3MYJ A;  5F7D A;  2BSS A;  2AXF A;  4V3D B;  3TO4 A;  2GAZ A;  1LEG A;  3KWW A;  3CCH A;  1T7Z A;  1T0N A;  5B38 A;  4WDI A;  5EUO A;  3PWL A;  1WBY A;  4K71 B;  1CG9 A;  1LEK A;  4PJE A;  5HHP A;  1MWA H;  1I1F A;  4PJ9 A;  1AGF A;  3X14 A;  5EO0 A;  4L3C A;  1Z5L A;  1S9W A;  4L4V A;  1HSA A;  5FDW A;  4IHO A;  2C7U A;  4MNG A;  5FKP A;  3PWP A;  5EU4 A;  2GT9 A;  5C07 A;  3CZF A;  3H7B A;  4PGE A;  2RFX A;  1FZK A;  3HAE A;  5EFI A;  5IEH A;  2PO6 A;  3GIV A;  1Q94 A;  4NHU E;  4LCW A;  5GSV A;  1BQH A;  3CC5 A;  5INC A;  2ZSW A;  3SDX A;  3B3I A;  2H26 A;  1T1W A;  1U58 A;  3GSN H;  3LN5 A;  4IRS A;  2CLZ A;  4Z78 A;  1QRN A;  5E6I C;  5MEP A;  3MGO A;  4WW2 C;  1XR8 A;  3GML A;  2V2W A;  3LKS A;  2X4P A;  2AV1 A;  3FT3 A;  1FZJ A;  1WBX A;  5HGA A;  1JHT A;  3LV3 A;  5SWS A;  3QDG A;  3BXN A;  1AGB A;  5C0I A;  2H6P A;  4NQX A;  4HWZ A;  3HLA A;  4JFP A;  3GSR A;  2FIK A;  3QUZ A;  4IRJ A;  1S7X A;  1I7T A;  3KPQ A;  2X4R A;  3RWE A;  4QOK A;  1KCG C;  4PRA A;  4QRS A;  3VWK A;  4HUW A;  3FOL A;  4D0D A;  3PWV A;  3QUL A;  1OF2 A;  3FRU A;  1AGD A;  3GSX A;  3LN4 A;  3MRM A;  3O8X A;  4WU5 A;  3KPO A;  4NQC A;  3D2U A;  4WU7 A;  3FFC A;  3ECB A;  3VXS A;  5MEN A;  3QEQ A;  3S6C A;  1YPZ A;  3KPL A;  2FYY A;  2BSR A;  1AGE A;  3IT8 D;  2BVP A;  1EEY A;  1P4L A;  5JHD A;  1BZ9 A;  5HGB A;  4PG2 A;  1T7Y A;  5D7J C;  1T1Z A;  3DMM A;  5E9D A;  1ZT7 A;  3UTS A;  3KPP A;  4G8I A;  4HUV A;  3MRK A;  3GSQ A;  4N0C A;  2AK4 A;  1OGA A;  1T7W A;  1B3J A;  3V5D A;  4X6E A;  1P1Z A;  3ERY A;  1CE6 A;  3CH1 A;  1S7Q A;  4PJ8 A;  1HHK A;  3GMR A;  5C08 A;  1XZ0 A;  1S7S A;  1S7U A;  2X4S A;  5L2K A;  5AD0 A;  2CKB H;  1E28 A;  1YN6 A;  4F7P A;  1PQZ A;  3MRB A;  4CVZ A;  5J6G A;  3BH9 A;  3RWI A;  3BP4 A;  4GKN A;  1A6Z A;  1AGC A;  3QI9 A;  4PJG A;  2DYP A;  1I1A A;  4PDC E;  1HHI A;  4G59 A;  3BZE A;  4X6D A;  1LD9 A;  4NO2 A;  4NQE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...