2OI9A

Structure of the 2c/ld/ql9 allogeneic complex
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
175
structure length
175
Chain Sequence
GPHSMRYYETATSRRGLGEPRYTSVGYVDDKEFVRFDSDAENPRYEPQVPWMEQEGPEYWERITQVAKGQEQWFRVNLRTLLGYYNQSAGGTHTLQRMYGCDVGSDGRLLRGYEQFAYDGCDYIALNEDLRTWTAADMAAQITRRKWEQAGAAEYYRAYLEGECVEWLHRYLKNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Major Histocompatibility Complex protein
publication title How a single T cell receptor recognizes both self and foreign MHC.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 50
structure length 175
sequence length 175
ec nomenclature
pdb deposition date 2007-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 2oi9A00
1RK0A 3I6LD 1XR8A 4NO2A 5C0CA 2VLKA 3FRUA 4EN3C 3VFNA 3LN4A 3PABA 5IEKA 3KPNA 4JFFA 1A9EA 3HPJA 4FFEX 3VRJA 5HYJA 3O9WA 1W72A 1LP9A 1HHIA 2VLRA 4I48A 3BP4A 4U1IA 5EFIA 3O3EA 5B39A 5E8NA 3BGMA 5E8PA 5F1NA 3QQ3A 4L4TA 3TF7A 2NW3A 1KPRA 1W0WA 2BVQA 3P73A 1XH3A 4X6EA 3ILPA 2BVPA 3FT4A 3O4LA 4PG2A 5MEPA 1BZ9A 1A1NA 1T80A 4HX1A 1OGAA 4Y4HA 1KBGH 3GMRA 1JHTA 2HJKA 5EU3A 3E2HA 4JFDA 3FQWA 3OXSA 5L2JA 3QDMA 1S9YA 3QUKA 4X6FA 5HHPA 4F7MA 1QVOA 4CW1A 5J6GA 3FQUA 3HE7A 5C0IA 3VWKA 1K5NA 4G42A 1W0VA 1ZVSA 3QUZA 1I4FA 4CVXA 5MERA 1G7QA 1G7PA 1S7QA 2CLVA 4PJ9A 2F53A 3CZFA 2BVOA 1U58A 3C8KA 3MRQA 4MX7A 1RJZA 1FFNA 4ONOA 5D5MA 5F7DA 2P5WA 2H26A 1GZQA 4G9FA 3U0PA 3TA3A 2JCCA 5GSRA 2ZSWA 5C0FA 1A9BA 3BUYA 4PV9A 3SDAA 1LQVA 3RL2A 4HWZA 3C9NA 4E0RA 3RWDA 3MRHA 4MJ6A 4MXQA 3SDDA 4LCCC 3QFJA 3RWJA 1ZHLA 5C0AA 3RZCA 4ZUTA 3VXRA 2J8UA 3VXUA 1BD2A 3JTSA 3GSOA 5C0GA 3TPUE 4QRTA 1QR1A 1AGCA 4UQ2A 3UTQA 4N0CA 3FQXA 3MRDA 2VLLA 5IVXA 5JHDA 2ZOKA 1KJ3H 3WLBA 1JPFA 4QRQA 1LEKA 1S7RA 5E9DA 4WW2C 3LKSA 4G8GA 5C08A 1S7TA 1GZPA 5SWQA 3VJ6A 5FDWA 5SWSA 3UBXA 3ARDA 3HUJA 3RTQA 1KTLA 3FONA 4PRAA 1LK2A 3WUWA 1AGFA 4CVZA 1DDHA 1RK1A 3GMNA 5EU5A 5D7IA 4MS8A 3UTTA 1UQSA 5HHNA 1QO3A 4XXCA 5EU4A 3SPVA 2GITA 3FFCA 1I1YA 3D2UA 4Y4FA 1JFMA 2MHAA 3VXMA 3TO2A 3UTSA 4Y2DA 1B0GA 3TIDA 2X4PA 5INCA 4PJCA 4PJ7A 4NQDA 3KPSA 1TMCA 3TBVA 5E00A 3L9RA 5GSVA 3P9LA 1LDPH 4L29A 4I4WA 5ENWA 1FZJA 5DDHA 3RWHA 4NT6A 4PJDA 4PJ5A 3SKOA 4F7CA 3GMQA 3RWFA 1KPVA 5EO1A 1LD9A 3TBYA 1MWAH 1T1WA 2X4RA 3O3BA 3BHBA 1ZHNA 4Z76A 4L8CA 3BO8A 3CC5A 4N0UA 5IB5A 3MRIA 3B6SA 2CKBH 1E28A 3D18A 2FZ3A 4Z77A 4HS3A 2OI9A 3L3JA 3MRBA 2GT9A 3DXAA 3TVMA 1HSAA 1ZT7A 3QDGA 3PWUA 3RL1A 1QEWA 3OV6A 3FT2A 3KYNA 3TN0A 1EFXA 1VADA 5L2KA 4EI5A 5J6HA 5ACZA 3KPQA 2Q7YA 4K71B 2DYPA 1T1ZA 3G08A 4WDIA 1N59A 1N5AA 2YPLA 2AXFA 3I6GA 3PWNA 2VAAA 4MNGA 1MHEA 2X70A 3VXPA 1VGKA 1A1OA 3D3VA 3PWLA 5EOTA 3VCLA 3VFOA 5IB1A 2UWEA 1R3HA 4U1LA 2P5EA 4PDCE 4ZUVA 4JFPA 3SJVA 1LEGA 3VFUA 2BNRA 1IM3A 3BH8A 3MRFA 3MRPA 3MRNA 1L8JA 3BP7A 1I7TA 1HHKA 2FIKA 3HLAA 4PRDA 4QRSA 3RWGA 1FZMA 3T8XA 1CG9A 1QQDA 4D0CA 3BW9A 3GSRA 3LKPA 4G59A 4PRNA 2RFXA 1TVBA 2XFXA 4G43A 4NQCA 2XPGA 5IB4A 2VLJA 3CH1A 4F7TA 3QUXA 3I6KA 1P4LA 5J1AA 3P4NA 4ZFZA 2VE6A 5HGDA 4ZUWA 1TVHA 1T0MA 1XZ0A 3FQRA 4PRPA 4G8IA 4GKSA 3D39A 3X14A 1ZS8A 1ZT4A 3KPRA 4X6CA 4MJ5A 2A83A 4IRJA 3P77A 4L8SC 2AV7A 1X7QA 3RGVC 3DX7A 3IT8D 4D0DA 2PYEA 4V3EB 4QOKA 1ONQA 3W0WA 5IEHA 1S9XA 2X4TA 1JUFA 4HKJA 4PGDA 4QRRA 5D7JC 5DEFA 2C7UA 4G9DA 1S8DA 4U1JA 3VRIA 4O2CA 4PJ8A 3WL9A 4PV8A 3RWIA 2BNQA 3VXOA 3FOLA 3BVNA 1NANH 5BJTA 3MRCA 2V2XA 3KPPA 2PO6A 2ZSVA 4S0UC 4L8BA 2BSSA 3CVHA 5C0DA 3L3KA 5F9JA 3LKRA 4Y4KA 2AXGA 3MRLA 1INQA 1S7VA 4FTVA 4L3EA 4Y16A 1T7WA 3TBSA 3P4MA 4PJFA 5C07A 3X12A 5IB3A 3BZEA 2GAZA 3MRGA 4E5XA 1JGDA 4U1KA 4MQ7A 5C9JA 3LV3A 3O3DA 1T1YA 4L3CA 3AU1A 4PP8C 3BZFA 1AO7A 1G6RH 1YPZA 3MRKA 1YN6A 3OX8A 1E27A 4N5EA 4NQVA 1FZKA 4EUPA 1T7VA 3TBWA 4PGEA 4WU7A 4D0BA 5C0BA 5FA4A 3BXNA 4PREA 1MI5A 1S7WA 3GMMA 3O3AA 4L9LC 2GTZA 3SDCA 5INDA 1BQHA 3MROA 3S6CA 3ILQC 3QULA 1KJ2H 1KCGC 3H7BA 3KPLA 5BS0A 3KYOA 1A1MA 1C16A 3CPLA 4JRYA 4NQXA 2CIIA 3M1BA 2FO4A 1VACA 2CLRA 1T20A 4LNRA 4PRBA 1I7UA 3RUGA 4JFEA 2V2WA 5C09A 4U1NA 3CDGA 3L3HA 3MR9A 3REWA 1OF2A 1HYRC 3GMLA 3GSQA 3VXNA 3TIEA 5IM7A 3KXFA 3GIVA 3MV7A 4HUUA 2ESVA 1KPUA 1AKJA 3VH8A 4NSKA 4N8VA 3GSVA 1SYVA 3BEVA 1QLFA 5D2NA 3LKNA 1CD1A 2BSTA 2CIKA 4F7PA 3M17A 3VWJA 4QRPA 1T7ZA 4JFOA 2E7LE 4HUXA 1KJVA 4HUWA 1ZHBA 2GUOA 4MNQA 3QDJA 1HHHA 4HUVA 1HHJA 1FFPA 3MV9A 3VFMA 3MRRA 3MGTA 1I7RA 1S7SA 4O2FA 2X4SA 3MGOA 1YDPA 4WJ5A 3JTTA 1S9WA 5IROA 2ZOLA 1QSFA 5EUOA 4QRUA 5HGHA 3TFKA 2X4NA 1B0RA 1WBZA 3QQ4A 4MJIA 3ES6A 3TJHA 4NQEA 3ARFA 3H9HA 4L4VA 4PJXA 4WWKC 3SKMA 3E6FA 3L3GA 5E6IC 3V5DA 5B38A 1I1AA 2F74A 3AREA 3FQTA 4NO5A 3QZWA 3VFRA 2GJ6A 4WUUA 1XR9A 1T0NA 1EEZA 4WU5A 2HLAA 1UXWA 4NHUE 3NFNA 3W39A 3PWVA 3DX8A 2FWOA 2F54A 4IIQC 1T7YA 3VFPA 4LHUA 4GKNA 1N2RA 3GJFA 4PJAA 1ZAGA 3BWAA 3GSNH 4F7EA 3PQYA 4PG9A 3HG1A 3DMMA 3HAEA 3KWWA 3VFWA 3MRJA 3O8XA 3QI9A 5EO0A 4PRHA 4PR5A 3MYJA 3P4OA 4JQVA 1T7XA 3D25A 5H94A 4N0FA 1OSZA 3PWPA 3E3QA 5HGAA 2AKRA 1AGBA 4IRSA 1A6ZA 5ISZA 4K7FA 5AD0A 5D7LA 4L8DA 3GSUA 3JTCA 3ARBA 1KJMA 4U6YA 2X4OA 3WS6A 4GUPA 4PGCA 2VABA 3KPMA 4ZUUA 5MENA 1JPGA 3FTGA 2AK4A 4PJGA 4ZUSA 3TZVC 1T22A 3FOMA 3LKQA 3ROLA 3ROOA 2HN7A 4LCWA 1B3JA 1S7UA 5SWZA 3DX6A 3UPRA 3VFTA 5BXFA 3HCVA 3QUYA 4NO0A 4PJBA 3KLAA 3SCMA 2BSRA 1M6OA 3GMOA 3MA7A 4LCYA 2D31A 3TO4A 1FFOA 1FZOA 4JFQA 4U1SA 4MVBA 1ZHKA 3L3DA 5EU6A 5BRZA 4Z78A 2FYYA 3GMPA 3QFDA 1HHGA 3IXAA 3FQNA 3MV8A 5C0EA 3VFVA 4U1MA 3T1FA 4JQXA 3QEQA 1M05A 2BCKA 5MEQA 1FG2A 1QSEA 1DUYA 3SDXA 1WBXA 3DTXA 1SYSA 5D9SA 3ARGA 3P9MA 1BIIA 1EEYA 5FA3A 3RWEA 1P7QA 3H9SA 5F1IA 3CCHA 3GSWA 2NX5A 3VFSA 4PJHA 4NO3A 1IM9A 1P1ZA 3ERYA 3DBXA 4UQ3A 3WS3A 2AV1A 1CE6A 3BEWA 2X4QA 1QRNA 4APQA 3KPOA 1YN7A 3ECBA 3L3IA 4PGBA 5E8OA 3JVGA 1Q94A 5HGBA 1N3NA 2GTWA 3PWJA 1UXSA 1HSBA 3HE6A 1MHCA 1Z5LA 3BH9A 1AGDA 3RWCA 4WO4A 5IB2A 5HHQA 3TBTA 3V5KA 1OGTA 3X13A 4JRXA 1ZT1A 4HV8A 1S7XA 3AM8A 4X6DA 5HHMA 1DE4A 1ZSDA 3V5HA 3GSXA 3MREA 1NEZA 1T1XA 1DUZA 1HOCA 1JE6A 1WBYA 2X4UA 2YPKA 4V3DB 4PJIA 3B3IA 3OXRA 2OL3H 1AGEA 2H6PA 5C0JA 4O2EA 1EXUA 3VXSA 2WY3A 2YEZA 3LN5A 4ELMA 3LKOA 1I1FA 4U1HA 1K8DA 4IHOA 5DEGA 4ZAKA 5HHOA 2CLZA 3E6HA 5MEOA 4PRIA 3FT3A 5D2LA 3MRMA 5FKPA 3X11A 1PQZA 1NAMH 4PJEA 2HJLA 4NNXA 1T21A 1JGEA 1FO0H 1JF1A 1RJYA 4U6XA 4NNYA 1ED3A
chains in the Genus database with same CATH superfamily
1RK0A 3I6LD 1XR8A 4NO2A 5C0CA 2VLKA 3FRUA 4EN3C 3VFNA 3LN4A 3PABA 5IEKA 3KPNA 4JFFA 1A9EA 3HPJA 4FFEX 3VRJA 5HYJA 3O9WA 1W72A 1LP9A 1HHIA 2VLRA 4I48A 3BP4A 4U1IA 5EFIA 3O3EA 5B39A 5E8NA 3BGMA 5E8PA 5F1NA 3QQ3A 4L4TA 3TF7A 2NW3A 1KPRA 1W0WA 2BVQA 3P73A 1XH3A 4X6EA 3ILPA 2BVPA 3FT4A 3O4LA 4PG2A 5MEPA 1BZ9A 1A1NA 1T80A 4HX1A 1OGAA 4Y4HA 1KBGH 3GMRA 1JHTA 2HJKA 5EU3A 3E2HA 4JFDA 3FQWA 3OXSA 5L2JA 3I0TA 3QDMA 1S9YA 3QUKA 4X6FA 5HHPA 4F7MA 1QVOA 4CW1A 5J6GA 3FQUA 3HE7A 5C0IA 3VWKA 1K5NA 4G42A 1W0VA 1ZVSA 3QUZA 1I4FA 4CVXA 5MERA 1G7QA 1G7PA 1S7QA 2CLVA 4PJ9A 2F53A 3CZFA 2BVOA 1U58A 3C8KA 3MRQA 4MX7A 1RJZA 1FFNA 4ONOA 5D5MA 5F7DA 2P5WA 2H26A 1GZQA 4G9FA 3U0PA 3TA3A 2JCCA 5GSRA 2ZSWA 5C0FA 1A9BA 3BUYA 4PV9A 3SDAA 1LQVA 3RL2A 4HWZA 3C9NA 4E0RA 3RWDA 3MRHA 4MJ6A 4MXQA 3SDDA 4LCCC 3QFJA 3RWJA 1ZHLA 5C0AA 3RZCA 4ZUTA 3VXRA 2J8UA 3VXUA 1BD2A 3JTSA 3GSOA 5C0GA 3TPUE 4QRTA 1QR1A 1AGCA 4UQ2A 3UTQA 4N0CA 3FQXA 3MRDA 2VLLA 5IVXA 5JHDA 2ZOKA 1KJ3H 3WLBA 1JPFA 4QRQA 1LEKA 1S7RA 5E9DA 4WW2C 3LKSA 4G8GA 5C08A 1S7TA 1GZPA 5SWQA 3VJ6A 5FDWA 5SWSA 3UBXA 3ARDA 3HUJA 3RTQA 1KTLA 3FONA 4PRAA 1LK2A 3WUWA 1AGFA 4CVZA 1DDHA 1RK1A 3GMNA 5EU5A 5D7IA 4MS8A 3UTTA 1UQSA 5HHNA 1QO3A 4XXCA 5EU4A 3SPVA 2GITA 3FFCA 1I1YA 3D2UA 4Y4FA 1JFMA 2NYKA 2MHAA 3VXMA 3TO2A 3UTSA 4Y2DA 1B0GA 3TIDA 2X4PA 5INCA 4PJCA 4PJ7A 4NQDA 3KPSA 1TMCA 3TBVA 5E00A 3L9RA 5GSVA 3P9LA 1LDPH 4L29A 4I4WA 5ENWA 1FZJA 5DDHA 3RWHA 4NT6A 4PJDA 4PJ5A 3SKOA 4F7CA 3GMQA 3RWFA 1KPVA 5EO1A 1LD9A 3TBYA 1MWAH 1T1WA 2X4RA 3O3BA 3BHBA 1ZHNA 4Z76A 4L8CA 3BO8A 3CC5A 4N0UA 5IB5A 3MRIA 3B6SA 2CKBH 1E28A 3D18A 2FZ3A 4Z77A 4HS3A 2OI9A 3L3JA 3MRBA 2GT9A 3DXAA 3TVMA 1HSAA 1ZT7A 3QDGA 3PWUA 3RL1A 1QEWA 3OV6A 3FT2A 3KYNA 3TN0A 1EFXA 1VADA 5L2KA 4EI5A 5J6HA 5ACZA 3KPQA 2Q7YA 4K71B 2DYPA 1T1ZA 3G08A 4WDIA 1N59A 1N5AA 2YPLA 2AXFA 3I6GA 3PWNA 2VAAA 4MNGA 1MHEA 2X70A 3VXPA 1VGKA 1A1OA 3D3VA 3PWLA 5EOTA 3VCLA 3VFOA 5IB1A 2UWEA 1R3HA 4U1LA 2P5EA 4PDCE 4ZUVA 4JFPA 3SJVA 1LEGA 3VFUA 2BNRA 1IM3A 3BH8A 3MRFA 3MRPA 3MRNA 1L8JA 3BP7A 1I7TA 1HHKA 2FIKA 3HLAA 4PRDA 4QRSA 3RWGA 1FZMA 3T8XA 1CG9A 1QQDA 4D0CA 3BW9A 3GSRA 3LKPA 4G59A 4PRNA 2RFXA 1TVBA 2XFXA 4G43A 4NQCA 2XPGA 5IB4A 2VLJA 3CH1A 4F7TA 3QUXA 3I6KA 1P4LA 5J1AA 3P4NA 4ZFZA 2VE6A 5HGDA 4ZUWA 1TVHA 1T0MA 1XZ0A 3FQRA 4PRPA 4G8IA 4GKSA 3D39A 3X14A 1ZS8A 1ZT4A 3KPRA 4X6CA 2IA1A 2A83A 4MJ5A 4IRJA 3P77A 4L8SC 2AV7A 1X7QA 3RGVC 3DX7A 3IT8D 4D0DA 2PYEA 4V3EB 4QOKA 1ONQA 3W0WA 5IEHA 1S9XA 2X4TA 1JUFA 4HKJA 4PGDA 4QRRA 5D7JC 5DEFA 2C7UA 4G9DA 1S8DA 4U1JA 3VRIA 4O2CA 4PJ8A 3WL9A 4PV8A 3RWIA 2BNQA 3VXOA 3FOLA 1NANH 3BVNA 5BJTA 3MRCA 2V2XA 3KPPA 2PO6A 2ZSVA 4S0UC 4L8BA 2BSSA 3CVHA 5C0DA 3L3KA 5F9JA 3LKRA 4Y4KA 2AXGA 3MRLA 1INQA 1S7VA 4FTVA 4L3EA 4Y16A 1T7WA 3TBSA 3P4MA 4PJFA 5C07A 3X12A 5IB3A 3BZEA 2GAZA 3MRGA 4E5XA 1JGDA 4U1KA 4MQ7A 5C9JA 3LV3A 3O3DA 1T1YA 4L3CA 3AU1A 4PP8C 3BZFA 1AO7A 1G6RH 1YPZA 3MRKA 1YN6A 3OX8A 1E27A 4N5EA 2O5NA 1FZKA 4NQVA 1T7VA 4EUPA 3TBWA 4PGEA 4WU7A 4D0BA 5C0BA 5FA4A 3BXNA 4PREA 1MI5A 1S7WA 3GMMA 3O3AA 4G59C 4L9LC 2GTZA 3SDCA 5INDA 1BQHA 3MROA 3S6CA 3ILQC 3QULA 1KJ2H 1KCGC 3H7BA 3KPLA 5BS0A 3KYOA 1A1MA 1C16A 3CPLA 4JRYA 4NQXA 2CIIA 3M1BA 2FO4A 1VACA 2CLRA 1T20A 4LNRA 4PRBA 1I7UA 3RUGA 4JFEA 2V2WA 5C09A 4U1NA 3CDGA 3L3HA 3MR9A 3REWA 1OF2A 1HYRC 3GMLA 3GSQA 3VXNA 3TIEA 5IM7A 3KXFA 3GIVA 3MV7A 4HUUA 2ESVA 1KPUA 1AKJA 3VH8A 4NSKA 4N8VA 3GSVA 1SYVA 3BEVA 1QLFA 5D2NA 3LKNA 1CD1A 2BSTA 2CIKA 4F7PA 3M17A 3VWJA 4QRPA 1T7ZA 4JFOA 2E7LE 4HUXA 1KJVA 4HUWA 1ZHBA 2GUOA 4MNQA 3QDJA 1HHHA 4HUVA 1HHJA 1FFPA 3MV9A 3VFMA 3MRRA 3MGTA 1I7RA 1S7SA 4O2FA 2X4SA 3MGOA 1YDPA 4WJ5A 3JTTA 1S9WA 5IROA 2ZOLA 1QSFA 5EUOA 4QRUA 5HGHA 3TFKA 2X4NA 1B0RA 1WBZA 3QQ4A 4MJIA 3ES6A 3TJHA 4NQEA 3ARFA 3H9HA 4L4VA 4PJXA 4WWKC 3SKMA 3E6FA 3L3GA 5E6IC 3V5DA 5B38A 1I1AA 2F74A 3AREA 3FQTA 4NO5A 3QZWA 3VFRA 2GJ6A 4WUUA 1XR9A 1T0NA 1EEZA 4WU5A 2HLAA 1UXWA 4NHUE 3NFNA 3W39A 3PWVA 3DX8A 2FWOA 2F54A 4IIQC 1T7YA 3VFPA 4LHUA 4GKNA 1N2RA 3GJFA 4PJAA 1ZAGA 3BWAA 3GSNH 4F7EA 3PQYA 4PG9A 3HG1A 3DMMA 3HAEA 3KWWA 3VFWA 3MRJA 3O8XA 3QI9A 5EO0A 4PRHA 4PR5A 3MYJA 3P4OA 4JQVA 1T7XA 3D25A 5H94A 4N0FA 1OSZA 3PWPA 3E3QA 5HGAA 2AKRA 1AGBA 4IRSA 1A6ZA 5ISZA 4K7FA 5AD0A 5D7LA 4L8DA 3GSUA 3JTCA 3ARBA 1KJMA 4U6YA 2X4OA 3WS6A 4GUPA 4PGCA 2VABA 3KPMA 4ZUUA 5MENA 1JPGA 3FTGA 2AK4A 4PJGA 4ZUSA 3TZVC 1T22A 3FOMA 3LKQA 3ROLA 3ROOA 2HN7A 4LCWA 1B3JA 1S7UA 5SWZA 3DX6A 3UPRA 3VFTA 5BXFA 3HCVA 3QUYA 4NO0A 4PJBA 3KLAA 3SCMA 2BSRA 1M6OA 3GMOA 3MA7A 4LCYA 2D31A 3TO4A 1FFOA 1FZOA 4JFQA 4U1SA 4MVBA 1ZHKA 3L3DA 5EU6A 5BRZA 4Z78A 2FYYA 3GMPA 3QFDA 1HHGA 3IXAA 3FQNA 3MV8A 5C0EA 3VFVA 4U1MA 3T1FA 4JQXA 3QEQA 1M05A 2BCKA 4BKWA 5MEQA 1FG2A 1QSEA 1DUYA 3SDXA 1WBXA 3DTXA 1SYSA 5D9SA 3ARGA 3P9MA 1BIIA 1EEYA 5FA3A 3RWEA 1P7QA 3H9SA 5F1IA 3CCHA 3GSWA 2NX5A 3VFSA 4PJHA 4NO3A 1IM9A 1P1ZA 3ERYA 3DBXA 4UQ3A 3WS3A 2AV1A 1CE6A 3BEWA 2X4QA 1QRNA 4APQA 3KPOA 1YN7A 3ECBA 3L3IA 4PGBA 5E8OA 3JVGA 1Q94A 5HGBA 1N3NA 2GTWA 3PWJA 1UXSA 1HSBA 3HE6A 3BH9A 1MHCA 1Z5LA 1AGDA 3RWCA 4WO4A 5IB2A 5HHQA 4JO8A 3TBTA 3V5KA 1OGTA 3X13A 4JRXA 1ZT1A 4HV8A 1S7XA 3AM8A 4X6DA 5HHMA 1DE4A 1ZSDA 3V5HA 3GSXA 3MREA 1NEZA 1T1XA 1DUZA 1HOCA 1JE6A 1WBYA 2X4UA 2YPKA 4V3DB 4PJIA 3B3IA 3OXRA 2OL3H 1AGEA 2H6PA 5C0JA 4O2EA 1EXUA 3VXSA 2WY3A 2YEZA 3LN5A 4ELMA 3LKOA 1I1FA 4U1HA 1K8DA 4IHOA 5DEGA 4ZAKA 5HHOA 2CLZA 3E6HA 5MEOA 4PRIA 3FT3A 5D2LA 3MRMA 5FKPA 3X11A 1PQZA 1NAMH 4PJEA 2HJLA 4NNXA 1T21A 1JGEA 1FO0H 1JF1A 1RJYA 4U6XA 4NNYA 1ED3A
chains in the Genus database with same CATH topology
1RK0A 3I6LD 1XR8A 4NO2A 5C0CA 2VLKA 3FRUA 4EN3C 3VFNA 3LN4A 3PABA 5IEKA 3KPNA 4JFFA 1A9EA 3HPJA 4FFEX 3VRJA 5HYJA 3O9WA 1W72A 1LP9A 1HHIA 2VLRA 4I48A 3BP4A 4U1IA 5EFIA 3O3EA 5B39A 5E8NA 3BGMA 5E8PA 5F1NA 3QQ3A 4L4TA 3TF7A 2NW3A 1KPRA 1W0WA 2BVQA 3P73A 1XH3A 4X6EA 3ILPA 2BVPA 3FT4A 3O4LA 4PG2A 5MEPA 1BZ9A 1A1NA 1T80A 4HX1A 1OGAA 4Y4HA 1KBGH 3GMRA 1JHTA 2HJKA 5EU3A 3E2HA 4JFDA 3FQWA 3OXSA 5L2JA 3QDMA 1S9YA 3QUKA 4X6FA 5HHPA 4F7MA 1QVOA 4CW1A 5J6GA 3FQUA 3HE7A 5C0IA 3VWKA 1K5NA 4G42A 1W0VA 1ZVSA 3QUZA 1I4FA 4CVXA 5MERA 1G7QA 1G7PA 1S7QA 2CLVA 4PJ9A 2F53A 3CZFA 2BVOA 1U58A 3C8KA 3MRQA 4MX7A 1RJZA 1FFNA 4ONOA 5D5MA 5F7DA 2P5WA 2H26A 1GZQA 4G9FA 3U0PA 3TA3A 2JCCA 5GSRA 2ZSWA 5C0FA 1A9BA 3BUYA 4PV9A 3SDAA 1LQVA 3RL2A 4HWZA 3C9NA 4E0RA 3RWDA 3MRHA 4MJ6A 4MXQA 3SDDA 4LCCC 3QFJA 3RWJA 1ZHLA 5C0AA 3RZCA 4ZUTA 3VXRA 2J8UA 3VXUA 1BD2A 3JTSA 3GSOA 5C0GA 3TPUE 4QRTA 1QR1A 1AGCA 4UQ2A 3UTQA 4N0CA 3FQXA 3MRDA 2VLLA 5IVXA 5JHDA 2ZOKA 1KJ3H 3WLBA 1JPFA 4QRQA 1LEKA 1S7RA 5E9DA 4WW2C 3LKSA 4G8GA 5C08A 1S7TA 1GZPA 5SWQA 3VJ6A 5FDWA 5SWSA 3UBXA 3ARDA 3HUJA 3RTQA 1KTLA 3FONA 4PRAA 1LK2A 3WUWA 1AGFA 4CVZA 1DDHA 1RK1A 3GMNA 5EU5A 5D7IA 4MS8A 3UTTA 1UQSA 5HHNA 1QO3A 4XXCA 5EU4A 3SPVA 2GITA 3FFCA 1I1YA 3D2UA 4Y4FA 1JFMA 2MHAA 3VXMA 3TO2A 3UTSA 4Y2DA 1B0GA 3TIDA 2X4PA 5INCA 4PJCA 4PJ7A 4NQDA 3KPSA 1TMCA 3TBVA 5E00A 3L9RA 5GSVA 3P9LA 1LDPH 4L29A 4I4WA 5ENWA 1FZJA 5DDHA 3RWHA 4NT6A 4PJDA 4PJ5A 3SKOA 4F7CA 3GMQA 3RWFA 1KPVA 5EO1A 1LD9A 3TBYA 1MWAH 1T1WA 2X4RA 3O3BA 3BHBA 1ZHNA 4Z76A 4L8CA 3BO8A 3CC5A 4N0UA 5IB5A 3MRIA 3B6SA 2CKBH 1E28A 3D18A 2FZ3A 4Z77A 4HS3A 2OI9A 3L3JA 3MRBA 2GT9A 3DXAA 3TVMA 1HSAA 1ZT7A 3QDGA 3PWUA 3RL1A 1QEWA 3OV6A 3FT2A 3KYNA 3TN0A 1EFXA 1VADA 5L2KA 4EI5A 5J6HA 5ACZA 3KPQA 2Q7YA 4K71B 2DYPA 1T1ZA 3G08A 4WDIA 1N59A 1N5AA 2YPLA 2AXFA 3I6GA 3PWNA 2VAAA 4MNGA 1MHEA 2X70A 3VXPA 1VGKA 1A1OA 3D3VA 3PWLA 5EOTA 3VCLA 3VFOA 5IB1A 2UWEA 1R3HA 4U1LA 2P5EA 4PDCE 4ZUVA 4JFPA 3SJVA 1LEGA 3VFUA 2BNRA 1IM3A 3BH8A 3MRFA 3MRPA 3MRNA 1L8JA 3BP7A 1I7TA 1HHKA 2FIKA 3HLAA 4PRDA 4QRSA 3RWGA 1FZMA 3T8XA 1CG9A 1QQDA 4D0CA 3BW9A 3GSRA 3LKPA 4G59A 4PRNA 2RFXA 1TVBA 2XFXA 4G43A 4NQCA 2XPGA 5IB4A 2VLJA 3CH1A 4F7TA 3QUXA 3I6KA 1P4LA 5J1AA 3P4NA 4ZFZA 2VE6A 5HGDA 4ZUWA 1TVHA 1T0MA 1XZ0A 3FQRA 4PRPA 4G8IA 4GKSA 3D39A 3X14A 1ZS8A 1ZT4A 3KPRA 4X6CA 4MJ5A 2A83A 4IRJA 3P77A 4L8SC 2AV7A 1X7QA 3RGVC 3DX7A 3IT8D 4D0DA 2PYEA 4V3EB 4QOKA 1ONQA 3W0WA 5IEHA 1S9XA 2X4TA 1JUFA 4HKJA 4PGDA 4QRRA 5D7JC 5DEFA 2C7UA 4G9DA 1S8DA 4U1JA 3VRIA 4O2CA 4PJ8A 3WL9A 4PV8A 3RWIA 2BNQA 3VXOA 3FOLA 3BVNA 1NANH 5BJTA 3MRCA 2V2XA 3KPPA 2PO6A 2ZSVA 4S0UC 4L8BA 2BSSA 3CVHA 5C0DA 3L3KA 5F9JA 3LKRA 4Y4KA 2AXGA 3MRLA 1INQA 1S7VA 4FTVA 4L3EA 4Y16A 1T7WA 3TBSA 3P4MA 4PJFA 5C07A 3X12A 5IB3A 3BZEA 2GAZA 3MRGA 4E5XA 1JGDA 4U1KA 4MQ7A 5C9JA 3LV3A 3O3DA 1T1YA 4L3CA 3AU1A 4PP8C 3BZFA 1AO7A 1G6RH 1YPZA 3MRKA 1YN6A 3OX8A 1E27A 4N5EA 4NQVA 1FZKA 4EUPA 1T7VA 3TBWA 4PGEA 4WU7A 4D0BA 5C0BA 5FA4A 3BXNA 4PREA 1MI5A 1S7WA 3GMMA 3O3AA 4L9LC 2GTZA 3SDCA 5INDA 1BQHA 3MROA 3S6CA 3ILQC 3QULA 1KJ2H 1KCGC 3H7BA 3KPLA 5BS0A 3KYOA 1A1MA 1C16A 3CPLA 4JRYA 4NQXA 2CIIA 3M1BA 2FO4A 1VACA 2CLRA 1T20A 4LNRA 4PRBA 1I7UA 3RUGA 4JFEA 2V2WA 5C09A 4U1NA 3CDGA 3L3HA 3MR9A 3REWA 1OF2A 1HYRC 3GMLA 3GSQA 3VXNA 3TIEA 5IM7A 3KXFA 3GIVA 3MV7A 4HUUA 2ESVA 1KPUA 1AKJA 3VH8A 4NSKA 4N8VA 3GSVA 1SYVA 3BEVA 1QLFA 5D2NA 3LKNA 1CD1A 2BSTA 2CIKA 4F7PA 3M17A 3VWJA 4QRPA 1T7ZA 4JFOA 2E7LE 4HUXA 1KJVA 4HUWA 1ZHBA 2GUOA 4MNQA 3QDJA 1HHHA 4HUVA 1HHJA 1FFPA 3MV9A 3VFMA 3MRRA 3MGTA 1I7RA 1S7SA 4O2FA 2X4SA 3MGOA 1YDPA 4WJ5A 3JTTA 1S9WA 5IROA 2ZOLA 1QSFA 5EUOA 4QRUA 5HGHA 3TFKA 2X4NA 1B0RA 1WBZA 3QQ4A 4MJIA 3ES6A 3TJHA 4NQEA 3ARFA 3H9HA 4L4VA 4PJXA 4WWKC 3SKMA 3E6FA 3L3GA 5E6IC 3V5DA 5B38A 1I1AA 2F74A 3AREA 3FQTA 4NO5A 3QZWA 3VFRA 2GJ6A 4WUUA 1XR9A 1T0NA 1EEZA 4WU5A 2HLAA 1UXWA 4NHUE 3NFNA 3W39A 3PWVA 3DX8A 2FWOA 2F54A 4IIQC 1T7YA 3VFPA 4LHUA 4GKNA 1N2RA 3GJFA 4PJAA 1ZAGA 3BWAA 3GSNH 4F7EA 3PQYA 4PG9A 3HG1A 3DMMA 3HAEA 3KWWA 3VFWA 3MRJA 3O8XA 3QI9A 5EO0A 4PRHA 4PR5A 3MYJA 3P4OA 4JQVA 1T7XA 3D25A 5H94A 4N0FA 1OSZA 3PWPA 3E3QA 5HGAA 2AKRA 1AGBA 4IRSA 1A6ZA 5ISZA 4K7FA 5AD0A 5D7LA 4L8DA 3GSUA 3JTCA 3ARBA 1KJMA 4U6YA 2X4OA 3WS6A 4GUPA 4PGCA 2VABA 3KPMA 4ZUUA 5MENA 1JPGA 3FTGA 2AK4A 4PJGA 4ZUSA 3TZVC 1T22A 3FOMA 3LKQA 3ROLA 3ROOA 2HN7A 4LCWA 1B3JA 1S7UA 5SWZA 3DX6A 3UPRA 3VFTA 5BXFA 3HCVA 3QUYA 4NO0A 4PJBA 3KLAA 3SCMA 2BSRA 1M6OA 3GMOA 3MA7A 4LCYA 2D31A 3TO4A 1FFOA 1FZOA 4JFQA 4U1SA 4MVBA 1ZHKA 3L3DA 5EU6A 5BRZA 4Z78A 2FYYA 3GMPA 3QFDA 1HHGA 3IXAA 3FQNA 3MV8A 5C0EA 3VFVA 4U1MA 3T1FA 4JQXA 3QEQA 1M05A 2BCKA 5MEQA 1FG2A 1QSEA 1DUYA 3SDXA 1WBXA 3DTXA 1SYSA 5D9SA 3ARGA 3P9MA 1BIIA 1EEYA 5FA3A 3RWEA 1P7QA 3H9SA 5F1IA 3CCHA 3GSWA 2NX5A 3VFSA 4PJHA 4NO3A 1IM9A 1P1ZA 3ERYA 3DBXA 4UQ3A 3WS3A 2AV1A 1CE6A 3BEWA 2X4QA 1QRNA 4APQA 3KPOA 1YN7A 3ECBA 3L3IA 4PGBA 5E8OA 3JVGA 1Q94A 5HGBA 1N3NA 2GTWA 3PWJA 1UXSA 1HSBA 3HE6A 1MHCA 1Z5LA 3BH9A 1AGDA 3RWCA 4WO4A 5IB2A 5HHQA 3TBTA 3V5KA 1OGTA 3X13A 4JRXA 1ZT1A 4HV8A 1S7XA 3AM8A 4X6DA 5HHMA 1DE4A 1ZSDA 3V5HA 3GSXA 3MREA 1NEZA 1T1XA 1DUZA 1HOCA 1JE6A 1WBYA 2X4UA 2YPKA 4V3DB 4PJIA 3B3IA 3OXRA 2OL3H 1AGEA 2H6PA 5C0JA 4O2EA 1EXUA 3VXSA 2WY3A 2YEZA 3LN5A 4ELMA 3LKOA 1I1FA 4U1HA 1K8DA 4IHOA 5DEGA 4ZAKA 5HHOA 2CLZA 3E6HA 5MEOA 4PRIA 3FT3A 5D2LA 3MRMA 5FKPA 3X11A 1PQZA 1NAMH 4PJEA 2HJLA 4NNXA 1T21A 1JGEA 1FO0H 1JF1A 1RJYA 4U6XA 4NNYA 1ED3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RK0 A;  3I6L D;  1XR8 A;  4NO2 A;  5C0C A;  2VLK A;  3FRU A;  4EN3 C;  3VFN A;  3LN4 A;  3PAB A;  5IEK A;  3KPN A;  4JFF A;  1A9E A;  3HPJ A;  4FFE X;  3VRJ A;  5HYJ A;  3O9W A;  1W72 A;  1LP9 A;  1HHI A;  2VLR A;  4I48 A;  3BP4 A;  4U1I A;  5EFI A;  3O3E A;  5B39 A;  5E8N A;  3BGM A;  5E8P A;  5F1N A;  3QQ3 A;  4L4T A;  3TF7 A;  2NW3 A;  1KPR A;  1W0W A;  2BVQ A;  3P73 A;  1XH3 A;  4X6E A;  3ILP A;  2BVP A;  3FT4 A;  3O4L A;  4PG2 A;  5MEP A;  1BZ9 A;  1A1N A;  1T80 A;  4HX1 A;  1OGA A;  4Y4H A;  1KBG H;  3GMR A;  1JHT A;  2HJK A;  5EU3 A;  3E2H A;  4JFD A;  3FQW A;  3OXS A;  5L2J A;  3QDM A;  1S9Y A;  3QUK A;  4X6F A;  5HHP A;  4F7M A;  1QVO A;  4CW1 A;  5J6G A;  3FQU A;  3HE7 A;  5C0I A;  3VWK A;  1K5N A;  4G42 A;  1W0V A;  1ZVS A;  3QUZ A;  1I4F A;  4CVX A;  5MER A;  1G7Q A;  1G7P A;  1S7Q A;  2CLV A;  4PJ9 A;  2F53 A;  3CZF A;  2BVO A;  1U58 A;  3C8K A;  3MRQ A;  4MX7 A;  1RJZ A;  1FFN A;  4ONO A;  5D5M A;  5F7D A;  2P5W A;  2H26 A;  1GZQ A;  4G9F A;  3U0P A;  3TA3 A;  2JCC A;  5GSR A;  2ZSW A;  5C0F A;  1A9B A;  3BUY A;  4PV9 A;  3SDA A;  1LQV A;  3RL2 A;  4HWZ A;  3C9N A;  4E0R A;  3RWD A;  3MRH A;  4MJ6 A;  4MXQ A;  3SDD A;  4LCC C;  3QFJ A;  3RWJ A;  1ZHL A;  5C0A A;  3RZC A;  4ZUT A;  3VXR A;  2J8U A;  3VXU A;  1BD2 A;  3JTS A;  3GSO A;  5C0G A;  3TPU E;  4QRT A;  1QR1 A;  1AGC A;  4UQ2 A;  3UTQ A;  4N0C A;  3FQX A;  3MRD A;  2VLL A;  5IVX A;  5JHD A;  2ZOK A;  1KJ3 H;  3WLB A;  1JPF A;  4QRQ A;  1LEK A;  1S7R A;  5E9D A;  4WW2 C;  3LKS A;  4G8G A;  5C08 A;  1S7T A;  1GZP A;  5SWQ A;  3VJ6 A;  5FDW A;  5SWS A;  3UBX A;  3ARD A;  3HUJ A;  3RTQ A;  1KTL A;  3FON A;  4PRA A;  1LK2 A;  3WUW A;  1AGF A;  4CVZ A;  1DDH A;  1RK1 A;  3GMN A;  5EU5 A;  5D7I A;  4MS8 A;  3UTT A;  1UQS A;  5HHN A;  1QO3 A;  4XXC A;  5EU4 A;  3SPV A;  2GIT A;  3FFC A;  1I1Y A;  3D2U A;  4Y4F A;  1JFM A;  2MHA A;  3VXM A;  3TO2 A;  3UTS A;  4Y2D A;  1B0G A;  3TID A;  2X4P A;  5INC A;  4PJC A;  4PJ7 A;  4NQD A;  3KPS A;  1TMC A;  3TBV A;  5E00 A;  3L9R A;  5GSV A;  3P9L A;  1LDP H;  4L29 A;  4I4W A;  5ENW A;  1FZJ A;  5DDH A;  3RWH A;  4NT6 A;  4PJD A;  4PJ5 A;  3SKO A;  4F7C A;  3GMQ A;  3RWF A;  1KPV A;  5EO1 A;  1LD9 A;  3TBY A;  1MWA H;  1T1W A;  2X4R A;  3O3B A;  3BHB A;  1ZHN A;  4Z76 A;  4L8C A;  3BO8 A;  3CC5 A;  4N0U A;  5IB5 A;  3MRI A;  3B6S A;  2CKB H;  1E28 A;  3D18 A;  2FZ3 A;  4Z77 A;  4HS3 A;  2OI9 A;  3L3J A;  3MRB A;  2GT9 A;  3DXA A;  3TVM A;  1HSA A;  1ZT7 A;  3QDG A;  3PWU A;  3RL1 A;  1QEW A;  3OV6 A;  3FT2 A;  3KYN A;  3TN0 A;  1EFX A;  1VAD A;  5L2K A;  4EI5 A;  5J6H A;  5ACZ A;  3KPQ A;  2Q7Y A;  4K71 B;  2DYP A;  1T1Z A;  3G08 A;  4WDI A;  1N59 A;  1N5A A;  2YPL A;  2AXF A;  3I6G A;  3PWN A;  2VAA A;  4MNG A;  1MHE A;  2X70 A;  3VXP A;  1VGK A;  1A1O A;  3D3V A;  3PWL A;  5EOT A;  3VCL A;  3VFO A;  5IB1 A;  2UWE A;  1R3H A;  4U1L A;  2P5E A;  4PDC E;  4ZUV A;  4JFP A;  3SJV A;  1LEG A;  3VFU A;  2BNR A;  1IM3 A;  3BH8 A;  3MRF A;  3MRP A;  3MRN A;  1L8J A;  3BP7 A;  1I7T A;  1HHK A;  2FIK A;  3HLA A;  4PRD A;  4QRS A;  3RWG A;  1FZM A;  3T8X A;  1CG9 A;  1QQD A;  4D0C A;  3BW9 A;  3GSR A;  3LKP A;  4G59 A;  4PRN A;  2RFX A;  1TVB A;  2XFX A;  4G43 A;  4NQC A;  2XPG A;  5IB4 A;  2VLJ A;  3CH1 A;  4F7T A;  3QUX A;  3I6K A;  1P4L A;  5J1A A;  3P4N A;  4ZFZ A;  2VE6 A;  5HGD A;  4ZUW A;  1TVH A;  1T0M A;  1XZ0 A;  3FQR A;  4PRP A;  4G8I A;  4GKS A;  3D39 A;  3X14 A;  1ZS8 A;  1ZT4 A;  3KPR A;  4X6C A;  4MJ5 A;  2A83 A;  4IRJ A;  3P77 A;  4L8S C;  2AV7 A;  1X7Q A;  3RGV C;  3DX7 A;  3IT8 D;  4D0D A;  2PYE A;  4V3E B;  4QOK A;  1ONQ A;  3W0W A;  5IEH A;  1S9X A;  2X4T A;  1JUF A;  4HKJ A;  4PGD A;  4QRR A;  5D7J C;  5DEF A;  2C7U A;  4G9D A;  1S8D A;  4U1J A;  3VRI A;  4O2C A;  4PJ8 A;  3WL9 A;  4PV8 A;  3RWI A;  2BNQ A;  3VXO A;  3FOL A;  3BVN A;  1NAN H;  5BJT A;  3MRC A;  2V2X A;  3KPP A;  2PO6 A;  2ZSV A;  4S0U C;  4L8B A;  2BSS A;  3CVH A;  5C0D A;  3L3K A;  5F9J A;  3LKR A;  4Y4K A;  2AXG A;  3MRL A;  1INQ A;  1S7V A;  4FTV A;  4L3E A;  4Y16 A;  1T7W A;  3TBS A;  3P4M A;  4PJF A;  5C07 A;  3X12 A;  5IB3 A;  3BZE A;  2GAZ A;  3MRG A;  4E5X A;  1JGD A;  4U1K A;  4MQ7 A;  5C9J A;  3LV3 A;  3O3D A;  1T1Y A;  4L3C A;  3AU1 A;  4PP8 C;  3BZF A;  1AO7 A;  1G6R H;  1YPZ A;  3MRK A;  1YN6 A;  3OX8 A;  1E27 A;  4N5E A;  4NQV A;  1FZK A;  4EUP A;  1T7V A;  3TBW A;  4PGE A;  4WU7 A;  4D0B A;  5C0B A;  5FA4 A;  3BXN A;  4PRE A;  1MI5 A;  1S7W A;  3GMM A;  3O3A A;  4L9L C;  2GTZ A;  3SDC A;  5IND A;  1BQH A;  3MRO A;  3S6C A;  3ILQ C;  3QUL A;  1KJ2 H;  1KCG C;  3H7B A;  3KPL A;  5BS0 A;  3KYO A;  1A1M A;  1C16 A;  3CPL A;  4JRY A;  4NQX A;  2CII A;  3M1B A;  2FO4 A;  1VAC A;  2CLR A;  1T20 A;  4LNR A;  4PRB A;  1I7U A;  3RUG A;  4JFE A;  2V2W A;  5C09 A;  4U1N A;  3CDG A;  3L3H A;  3MR9 A;  3REW A;  1OF2 A;  1HYR C;  3GML A;  3GSQ A;  3VXN A;  3TIE A;  5IM7 A;  3KXF A;  3GIV A;  3MV7 A;  4HUU A;  2ESV A;  1KPU A;  1AKJ A;  3VH8 A;  4NSK A;  4N8V A;  3GSV A;  1SYV A;  3BEV A;  1QLF A;  5D2N A;  3LKN A;  1CD1 A;  2BST A;  2CIK A;  4F7P A;  3M17 A;  3VWJ A;  4QRP A;  1T7Z A;  4JFO A;  2E7L E;  4HUX A;  1KJV A;  4HUW A;  1ZHB A;  2GUO A;  4MNQ A;  3QDJ A;  1HHH A;  4HUV A;  1HHJ A;  1FFP A;  3MV9 A;  3VFM A;  3MRR A;  3MGT A;  1I7R A;  1S7S A;  4O2F A;  2X4S A;  3MGO A;  1YDP A;  4WJ5 A;  3JTT A;  1S9W A;  5IRO A;  2ZOL A;  1QSF A;  5EUO A;  4QRU A;  5HGH A;  3TFK A;  2X4N A;  1B0R A;  1WBZ A;  3QQ4 A;  4MJI A;  3ES6 A;  3TJH A;  4NQE A;  3ARF A;  3H9H A;  4L4V A;  4PJX A;  4WWK C;  3SKM A;  3E6F A;  3L3G A;  5E6I C;  3V5D A;  5B38 A;  1I1A A;  2F74 A;  3ARE A;  3FQT A;  4NO5 A;  3QZW A;  3VFR A;  2GJ6 A;  4WUU A;  1XR9 A;  1T0N A;  1EEZ A;  4WU5 A;  2HLA A;  1UXW A;  4NHU E;  3NFN A;  3W39 A;  3PWV A;  3DX8 A;  2FWO A;  2F54 A;  4IIQ C;  1T7Y A;  3VFP A;  4LHU A;  4GKN A;  1N2R A;  3GJF A;  4PJA A;  1ZAG A;  3BWA A;  3GSN H;  4F7E A;  3PQY A;  4PG9 A;  3HG1 A;  3DMM A;  3HAE A;  3KWW A;  3VFW A;  3MRJ A;  3O8X A;  3QI9 A;  5EO0 A;  4PRH A;  4PR5 A;  3MYJ A;  3P4O A;  4JQV A;  1T7X A;  3D25 A;  5H94 A;  4N0F A;  1OSZ A;  3PWP A;  3E3Q A;  5HGA A;  2AKR A;  1AGB A;  4IRS A;  1A6Z A;  5ISZ A;  4K7F A;  5AD0 A;  5D7L A;  4L8D A;  3GSU A;  3JTC A;  3ARB A;  1KJM A;  4U6Y A;  2X4O A;  3WS6 A;  4GUP A;  4PGC A;  2VAB A;  3KPM A;  4ZUU A;  5MEN A;  1JPG A;  3FTG A;  2AK4 A;  4PJG A;  4ZUS A;  3TZV C;  1T22 A;  3FOM A;  3LKQ A;  3ROL A;  3ROO A;  2HN7 A;  4LCW A;  1B3J A;  1S7U A;  5SWZ A;  3DX6 A;  3UPR A;  3VFT A;  5BXF A;  3HCV A;  3QUY A;  4NO0 A;  4PJB A;  3KLA A;  3SCM A;  2BSR A;  1M6O A;  3GMO A;  3MA7 A;  4LCY A;  2D31 A;  3TO4 A;  1FFO A;  1FZO A;  4JFQ A;  4U1S A;  4MVB A;  1ZHK A;  3L3D A;  5EU6 A;  5BRZ A;  4Z78 A;  2FYY A;  3GMP A;  3QFD A;  1HHG A;  3IXA A;  3FQN A;  3MV8 A;  5C0E A;  3VFV A;  4U1M A;  3T1F A;  4JQX A;  3QEQ A;  1M05 A;  2BCK A;  5MEQ A;  1FG2 A;  1QSE A;  1DUY A;  3SDX A;  1WBX A;  3DTX A;  1SYS A;  5D9S A;  3ARG A;  3P9M A;  1BII A;  1EEY A;  5FA3 A;  3RWE A;  1P7Q A;  3H9S A;  5F1I A;  3CCH A;  3GSW A;  2NX5 A;  3VFS A;  4PJH A;  4NO3 A;  1IM9 A;  1P1Z A;  3ERY A;  3DBX A;  4UQ3 A;  3WS3 A;  2AV1 A;  1CE6 A;  3BEW A;  2X4Q A;  1QRN A;  4APQ A;  3KPO A;  1YN7 A;  3ECB A;  3L3I A;  4PGB A;  5E8O A;  3JVG A;  1Q94 A;  5HGB A;  1N3N A;  2GTW A;  3PWJ A;  1UXS A;  1HSB A;  3HE6 A;  1MHC A;  1Z5L A;  3BH9 A;  1AGD A;  3RWC A;  4WO4 A;  5IB2 A;  5HHQ A;  3TBT A;  3V5K A;  1OGT A;  3X13 A;  4JRX A;  1ZT1 A;  4HV8 A;  1S7X A;  3AM8 A;  4X6D A;  5HHM A;  1DE4 A;  1ZSD A;  3V5H A;  3GSX A;  3MRE A;  1NEZ A;  1T1X A;  1DUZ A;  1HOC A;  1JE6 A;  1WBY A;  2X4U A;  2YPK A;  4V3D B;  4PJI A;  3B3I A;  3OXR A;  2OL3 H;  1AGE A;  2H6P A;  5C0J A;  4O2E A;  1EXU A;  3VXS A;  2WY3 A;  2YEZ A;  3LN5 A;  4ELM A;  3LKO A;  1I1F A;  4U1H A;  1K8D A;  4IHO A;  5DEG A;  4ZAK A;  5HHO A;  2CLZ A;  3E6H A;  5MEO A;  4PRI A;  3FT3 A;  5D2L A;  3MRM A;  5FKP A;  3X11 A;  1PQZ A;  1NAM H;  4PJE A;  2HJL A;  4NNX A;  1T21 A;  1JGE A;  1FO0 H;  1JF1 A;  1RJY A;  4U6X A;  4NNY A;  1ED3 A; 
#chains in the Genus database with same CATH topology
 1RK0 A;  3I6L D;  1XR8 A;  4NO2 A;  5C0C A;  2VLK A;  3FRU A;  4EN3 C;  3VFN A;  3LN4 A;  3PAB A;  5IEK A;  3KPN A;  4JFF A;  1A9E A;  3HPJ A;  4FFE X;  3VRJ A;  5HYJ A;  3O9W A;  1W72 A;  1LP9 A;  1HHI A;  2VLR A;  4I48 A;  3BP4 A;  4U1I A;  5EFI A;  3O3E A;  5B39 A;  5E8N A;  3BGM A;  5E8P A;  5F1N A;  3QQ3 A;  4L4T A;  3TF7 A;  2NW3 A;  1KPR A;  1W0W A;  2BVQ A;  3P73 A;  1XH3 A;  4X6E A;  3ILP A;  2BVP A;  3FT4 A;  3O4L A;  4PG2 A;  5MEP A;  1BZ9 A;  1A1N A;  1T80 A;  4HX1 A;  1OGA A;  4Y4H A;  1KBG H;  3GMR A;  1JHT A;  2HJK A;  5EU3 A;  3E2H A;  4JFD A;  3FQW A;  3OXS A;  5L2J A;  3I0T A;  3QDM A;  1S9Y A;  3QUK A;  4X6F A;  5HHP A;  4F7M A;  1QVO A;  4CW1 A;  5J6G A;  3FQU A;  3HE7 A;  5C0I A;  3VWK A;  1K5N A;  4G42 A;  1W0V A;  1ZVS A;  3QUZ A;  1I4F A;  4CVX A;  5MER A;  1G7Q A;  1G7P A;  1S7Q A;  2CLV A;  4PJ9 A;  2F53 A;  3CZF A;  2BVO A;  1U58 A;  3C8K A;  3MRQ A;  4MX7 A;  1RJZ A;  1FFN A;  4ONO A;  5D5M A;  5F7D A;  2P5W A;  2H26 A;  1GZQ A;  4G9F A;  3U0P A;  3TA3 A;  2JCC A;  5GSR A;  2ZSW A;  5C0F A;  1A9B A;  3BUY A;  4PV9 A;  3SDA A;  1LQV A;  3RL2 A;  4HWZ A;  3C9N A;  4E0R A;  3RWD A;  3MRH A;  4MJ6 A;  4MXQ A;  3SDD A;  4LCC C;  3QFJ A;  3RWJ A;  1ZHL A;  5C0A A;  3RZC A;  4ZUT A;  3VXR A;  2J8U A;  3VXU A;  1BD2 A;  3JTS A;  3GSO A;  5C0G A;  3TPU E;  4QRT A;  1QR1 A;  1AGC A;  4UQ2 A;  3UTQ A;  4N0C A;  3FQX A;  3MRD A;  2VLL A;  5IVX A;  5JHD A;  2ZOK A;  1KJ3 H;  3WLB A;  1JPF A;  4QRQ A;  1LEK A;  1S7R A;  5E9D A;  4WW2 C;  3LKS A;  4G8G A;  5C08 A;  1S7T A;  1GZP A;  5SWQ A;  3VJ6 A;  5FDW A;  5SWS A;  3UBX A;  3ARD A;  3HUJ A;  3RTQ A;  1KTL A;  3FON A;  4PRA A;  1LK2 A;  3WUW A;  1AGF A;  4CVZ A;  1DDH A;  1RK1 A;  3GMN A;  5EU5 A;  5D7I A;  4MS8 A;  3UTT A;  1UQS A;  5HHN A;  1QO3 A;  4XXC A;  5EU4 A;  3SPV A;  2GIT A;  3FFC A;  1I1Y A;  3D2U A;  4Y4F A;  1JFM A;  2NYK A;  2MHA A;  3VXM A;  3TO2 A;  3UTS A;  4Y2D A;  1B0G A;  3TID A;  2X4P A;  5INC A;  4PJC A;  4PJ7 A;  4NQD A;  3KPS A;  1TMC A;  3TBV A;  5E00 A;  3L9R A;  5GSV A;  3P9L A;  1LDP H;  4L29 A;  4I4W A;  5ENW A;  1FZJ A;  5DDH A;  3RWH A;  4NT6 A;  4PJD A;  4PJ5 A;  3SKO A;  4F7C A;  3GMQ A;  3RWF A;  1KPV A;  5EO1 A;  1LD9 A;  3TBY A;  1MWA H;  1T1W A;  2X4R A;  3O3B A;  3BHB A;  1ZHN A;  4Z76 A;  4L8C A;  3BO8 A;  3CC5 A;  4N0U A;  5IB5 A;  3MRI A;  3B6S A;  2CKB H;  1E28 A;  3D18 A;  2FZ3 A;  4Z77 A;  4HS3 A;  2OI9 A;  3L3J A;  3MRB A;  2GT9 A;  3DXA A;  3TVM A;  1HSA A;  1ZT7 A;  3QDG A;  3PWU A;  3RL1 A;  1QEW A;  3OV6 A;  3FT2 A;  3KYN A;  3TN0 A;  1EFX A;  1VAD A;  5L2K A;  4EI5 A;  5J6H A;  5ACZ A;  3KPQ A;  2Q7Y A;  4K71 B;  2DYP A;  1T1Z A;  3G08 A;  4WDI A;  1N59 A;  1N5A A;  2YPL A;  2AXF A;  3I6G A;  3PWN A;  2VAA A;  4MNG A;  1MHE A;  2X70 A;  3VXP A;  1VGK A;  1A1O A;  3D3V A;  3PWL A;  5EOT A;  3VCL A;  3VFO A;  5IB1 A;  2UWE A;  1R3H A;  4U1L A;  2P5E A;  4PDC E;  4ZUV A;  4JFP A;  3SJV A;  1LEG A;  3VFU A;  2BNR A;  1IM3 A;  3BH8 A;  3MRF A;  3MRP A;  3MRN A;  1L8J A;  3BP7 A;  1I7T A;  1HHK A;  2FIK A;  3HLA A;  4PRD A;  4QRS A;  3RWG A;  1FZM A;  3T8X A;  1CG9 A;  1QQD A;  4D0C A;  3BW9 A;  3GSR A;  3LKP A;  4G59 A;  4PRN A;  2RFX A;  1TVB A;  2XFX A;  4G43 A;  4NQC A;  2XPG A;  5IB4 A;  2VLJ A;  3CH1 A;  4F7T A;  3QUX A;  3I6K A;  1P4L A;  5J1A A;  3P4N A;  4ZFZ A;  2VE6 A;  5HGD A;  4ZUW A;  1TVH A;  1T0M A;  1XZ0 A;  3FQR A;  4PRP A;  4G8I A;  4GKS A;  3D39 A;  3X14 A;  1ZS8 A;  1ZT4 A;  3KPR A;  4X6C A;  2IA1 A;  2A83 A;  4MJ5 A;  4IRJ A;  3P77 A;  4L8S C;  2AV7 A;  1X7Q A;  3RGV C;  3DX7 A;  3IT8 D;  4D0D A;  2PYE A;  4V3E B;  4QOK A;  1ONQ A;  3W0W A;  5IEH A;  1S9X A;  2X4T A;  1JUF A;  4HKJ A;  4PGD A;  4QRR A;  5D7J C;  5DEF A;  2C7U A;  4G9D A;  1S8D A;  4U1J A;  3VRI A;  4O2C A;  4PJ8 A;  3WL9 A;  4PV8 A;  3RWI A;  2BNQ A;  3VXO A;  3FOL A;  1NAN H;  3BVN A;  5BJT A;  3MRC A;  2V2X A;  3KPP A;  2PO6 A;  2ZSV A;  4S0U C;  4L8B A;  2BSS A;  3CVH A;  5C0D A;  3L3K A;  5F9J A;  3LKR A;  4Y4K A;  2AXG A;  3MRL A;  1INQ A;  1S7V A;  4FTV A;  4L3E A;  4Y16 A;  1T7W A;  3TBS A;  3P4M A;  4PJF A;  5C07 A;  3X12 A;  5IB3 A;  3BZE A;  2GAZ A;  3MRG A;  4E5X A;  1JGD A;  4U1K A;  4MQ7 A;  5C9J A;  3LV3 A;  3O3D A;  1T1Y A;  4L3C A;  3AU1 A;  4PP8 C;  3BZF A;  1AO7 A;  1G6R H;  1YPZ A;  3MRK A;  1YN6 A;  3OX8 A;  1E27 A;  4N5E A;  2O5N A;  1FZK A;  4NQV A;  1T7V A;  4EUP A;  3TBW A;  4PGE A;  4WU7 A;  4D0B A;  5C0B A;  5FA4 A;  3BXN A;  4PRE A;  1MI5 A;  1S7W A;  3GMM A;  3O3A A;  4G59 C;  4L9L C;  2GTZ A;  3SDC A;  5IND A;  1BQH A;  3MRO A;  3S6C A;  3ILQ C;  3QUL A;  1KJ2 H;  1KCG C;  3H7B A;  3KPL A;  5BS0 A;  3KYO A;  1A1M A;  1C16 A;  3CPL A;  4JRY A;  4NQX A;  2CII A;  3M1B A;  2FO4 A;  1VAC A;  2CLR A;  1T20 A;  4LNR A;  4PRB A;  1I7U A;  3RUG A;  4JFE A;  2V2W A;  5C09 A;  4U1N A;  3CDG A;  3L3H A;  3MR9 A;  3REW A;  1OF2 A;  1HYR C;  3GML A;  3GSQ A;  3VXN A;  3TIE A;  5IM7 A;  3KXF A;  3GIV A;  3MV7 A;  4HUU A;  2ESV A;  1KPU A;  1AKJ A;  3VH8 A;  4NSK A;  4N8V A;  3GSV A;  1SYV A;  3BEV A;  1QLF A;  5D2N A;  3LKN A;  1CD1 A;  2BST A;  2CIK A;  4F7P A;  3M17 A;  3VWJ A;  4QRP A;  1T7Z A;  4JFO A;  2E7L E;  4HUX A;  1KJV A;  4HUW A;  1ZHB A;  2GUO A;  4MNQ A;  3QDJ A;  1HHH A;  4HUV A;  1HHJ A;  1FFP A;  3MV9 A;  3VFM A;  3MRR A;  3MGT A;  1I7R A;  1S7S A;  4O2F A;  2X4S A;  3MGO A;  1YDP A;  4WJ5 A;  3JTT A;  1S9W A;  5IRO A;  2ZOL A;  1QSF A;  5EUO A;  4QRU A;  5HGH A;  3TFK A;  2X4N A;  1B0R A;  1WBZ A;  3QQ4 A;  4MJI A;  3ES6 A;  3TJH A;  4NQE A;  3ARF A;  3H9H A;  4L4V A;  4PJX A;  4WWK C;  3SKM A;  3E6F A;  3L3G A;  5E6I C;  3V5D A;  5B38 A;  1I1A A;  2F74 A;  3ARE A;  3FQT A;  4NO5 A;  3QZW A;  3VFR A;  2GJ6 A;  4WUU A;  1XR9 A;  1T0N A;  1EEZ A;  4WU5 A;  2HLA A;  1UXW A;  4NHU E;  3NFN A;  3W39 A;  3PWV A;  3DX8 A;  2FWO A;  2F54 A;  4IIQ C;  1T7Y A;  3VFP A;  4LHU A;  4GKN A;  1N2R A;  3GJF A;  4PJA A;  1ZAG A;  3BWA A;  3GSN H;  4F7E A;  3PQY A;  4PG9 A;  3HG1 A;  3DMM A;  3HAE A;  3KWW A;  3VFW A;  3MRJ A;  3O8X A;  3QI9 A;  5EO0 A;  4PRH A;  4PR5 A;  3MYJ A;  3P4O A;  4JQV A;  1T7X A;  3D25 A;  5H94 A;  4N0F A;  1OSZ A;  3PWP A;  3E3Q A;  5HGA A;  2AKR A;  1AGB A;  4IRS A;  1A6Z A;  5ISZ A;  4K7F A;  5AD0 A;  5D7L A;  4L8D A;  3GSU A;  3JTC A;  3ARB A;  1KJM A;  4U6Y A;  2X4O A;  3WS6 A;  4GUP A;  4PGC A;  2VAB A;  3KPM A;  4ZUU A;  5MEN A;  1JPG A;  3FTG A;  2AK4 A;  4PJG A;  4ZUS A;  3TZV C;  1T22 A;  3FOM A;  3LKQ A;  3ROL A;  3ROO A;  2HN7 A;  4LCW A;  1B3J A;  1S7U A;  5SWZ A;  3DX6 A;  3UPR A;  3VFT A;  5BXF A;  3HCV A;  3QUY A;  4NO0 A;  4PJB A;  3KLA A;  3SCM A;  2BSR A;  1M6O A;  3GMO A;  3MA7 A;  4LCY A;  2D31 A;  3TO4 A;  1FFO A;  1FZO A;  4JFQ A;  4U1S A;  4MVB A;  1ZHK A;  3L3D A;  5EU6 A;  5BRZ A;  4Z78 A;  2FYY A;  3GMP A;  3QFD A;  1HHG A;  3IXA A;  3FQN A;  3MV8 A;  5C0E A;  3VFV A;  4U1M A;  3T1F A;  4JQX A;  3QEQ A;  1M05 A;  2BCK A;  4BKW A;  5MEQ A;  1FG2 A;  1QSE A;  1DUY A;  3SDX A;  1WBX A;  3DTX A;  1SYS A;  5D9S A;  3ARG A;  3P9M A;  1BII A;  1EEY A;  5FA3 A;  3RWE A;  1P7Q A;  3H9S A;  5F1I A;  3CCH A;  3GSW A;  2NX5 A;  3VFS A;  4PJH A;  4NO3 A;  1IM9 A;  1P1Z A;  3ERY A;  3DBX A;  4UQ3 A;  3WS3 A;  2AV1 A;  1CE6 A;  3BEW A;  2X4Q A;  1QRN A;  4APQ A;  3KPO A;  1YN7 A;  3ECB A;  3L3I A;  4PGB A;  5E8O A;  3JVG A;  1Q94 A;  5HGB A;  1N3N A;  2GTW A;  3PWJ A;  1UXS A;  1HSB A;  3HE6 A;  3BH9 A;  1MHC A;  1Z5L A;  1AGD A;  3RWC A;  4WO4 A;  5IB2 A;  5HHQ A;  4JO8 A;  3TBT A;  3V5K A;  1OGT A;  3X13 A;  4JRX A;  1ZT1 A;  4HV8 A;  1S7X A;  3AM8 A;  4X6D A;  5HHM A;  1DE4 A;  1ZSD A;  3V5H A;  3GSX A;  3MRE A;  1NEZ A;  1T1X A;  1DUZ A;  1HOC A;  1JE6 A;  1WBY A;  2X4U A;  2YPK A;  4V3D B;  4PJI A;  3B3I A;  3OXR A;  2OL3 H;  1AGE A;  2H6P A;  5C0J A;  4O2E A;  1EXU A;  3VXS A;  2WY3 A;  2YEZ A;  3LN5 A;  4ELM A;  3LKO A;  1I1F A;  4U1H A;  1K8D A;  4IHO A;  5DEG A;  4ZAK A;  5HHO A;  2CLZ A;  3E6H A;  5MEO A;  4PRI A;  3FT3 A;  5D2L A;  3MRM A;  5FKP A;  3X11 A;  1PQZ A;  1NAM H;  4PJE A;  2HJL A;  4NNX A;  1T21 A;  1JGE A;  1FO0 H;  1JF1 A;  1RJY A;  4U6X A;  4NNY A;  1ED3 A; 
#chains in the Genus database with same CATH homology
 1RK0 A;  3I6L D;  1XR8 A;  4NO2 A;  5C0C A;  2VLK A;  3FRU A;  4EN3 C;  3VFN A;  3LN4 A;  3PAB A;  5IEK A;  3KPN A;  4JFF A;  1A9E A;  3HPJ A;  4FFE X;  3VRJ A;  5HYJ A;  3O9W A;  1W72 A;  1LP9 A;  1HHI A;  2VLR A;  4I48 A;  3BP4 A;  4U1I A;  5EFI A;  3O3E A;  5B39 A;  5E8N A;  3BGM A;  5E8P A;  5F1N A;  3QQ3 A;  4L4T A;  3TF7 A;  2NW3 A;  1KPR A;  1W0W A;  2BVQ A;  3P73 A;  1XH3 A;  4X6E A;  3ILP A;  2BVP A;  3FT4 A;  3O4L A;  4PG2 A;  5MEP A;  1BZ9 A;  1A1N A;  1T80 A;  4HX1 A;  1OGA A;  4Y4H A;  1KBG H;  3GMR A;  1JHT A;  2HJK A;  5EU3 A;  3E2H A;  4JFD A;  3FQW A;  3OXS A;  5L2J A;  3QDM A;  1S9Y A;  3QUK A;  4X6F A;  5HHP A;  4F7M A;  1QVO A;  4CW1 A;  5J6G A;  3FQU A;  3HE7 A;  5C0I A;  3VWK A;  1K5N A;  4G42 A;  1W0V A;  1ZVS A;  3QUZ A;  1I4F A;  4CVX A;  5MER A;  1G7Q A;  1G7P A;  1S7Q A;  2CLV A;  4PJ9 A;  2F53 A;  3CZF A;  2BVO A;  1U58 A;  3C8K A;  3MRQ A;  4MX7 A;  1RJZ A;  1FFN A;  4ONO A;  5D5M A;  5F7D A;  2P5W A;  2H26 A;  1GZQ A;  4G9F A;  3U0P A;  3TA3 A;  2JCC A;  5GSR A;  2ZSW A;  5C0F A;  1A9B A;  3BUY A;  4PV9 A;  3SDA A;  1LQV A;  3RL2 A;  4HWZ A;  3C9N A;  4E0R A;  3RWD A;  3MRH A;  4MJ6 A;  4MXQ A;  3SDD A;  4LCC C;  3QFJ A;  3RWJ A;  1ZHL A;  5C0A A;  3RZC A;  4ZUT A;  3VXR A;  2J8U A;  3VXU A;  1BD2 A;  3JTS A;  3GSO A;  5C0G A;  3TPU E;  4QRT A;  1QR1 A;  1AGC A;  4UQ2 A;  3UTQ A;  4N0C A;  3FQX A;  3MRD A;  2VLL A;  5IVX A;  5JHD A;  2ZOK A;  1KJ3 H;  3WLB A;  1JPF A;  4QRQ A;  1LEK A;  1S7R A;  5E9D A;  4WW2 C;  3LKS A;  4G8G A;  5C08 A;  1S7T A;  1GZP A;  5SWQ A;  3VJ6 A;  5FDW A;  5SWS A;  3UBX A;  3ARD A;  3HUJ A;  3RTQ A;  1KTL A;  3FON A;  4PRA A;  1LK2 A;  3WUW A;  1AGF A;  4CVZ A;  1DDH A;  1RK1 A;  3GMN A;  5EU5 A;  5D7I A;  4MS8 A;  3UTT A;  1UQS A;  5HHN A;  1QO3 A;  4XXC A;  5EU4 A;  3SPV A;  2GIT A;  3FFC A;  1I1Y A;  3D2U A;  4Y4F A;  1JFM A;  2MHA A;  3VXM A;  3TO2 A;  3UTS A;  4Y2D A;  1B0G A;  3TID A;  2X4P A;  5INC A;  4PJC A;  4PJ7 A;  4NQD A;  3KPS A;  1TMC A;  3TBV A;  5E00 A;  3L9R A;  5GSV A;  3P9L A;  1LDP H;  4L29 A;  4I4W A;  5ENW A;  1FZJ A;  5DDH A;  3RWH A;  4NT6 A;  4PJD A;  4PJ5 A;  3SKO A;  4F7C A;  3GMQ A;  3RWF A;  1KPV A;  5EO1 A;  1LD9 A;  3TBY A;  1MWA H;  1T1W A;  2X4R A;  3O3B A;  3BHB A;  1ZHN A;  4Z76 A;  4L8C A;  3BO8 A;  3CC5 A;  4N0U A;  5IB5 A;  3MRI A;  3B6S A;  2CKB H;  1E28 A;  3D18 A;  2FZ3 A;  4Z77 A;  4HS3 A;  2OI9 A;  3L3J A;  3MRB A;  2GT9 A;  3DXA A;  3TVM A;  1HSA A;  1ZT7 A;  3QDG A;  3PWU A;  3RL1 A;  1QEW A;  3OV6 A;  3FT2 A;  3KYN A;  3TN0 A;  1EFX A;  1VAD A;  5L2K A;  4EI5 A;  5J6H A;  5ACZ A;  3KPQ A;  2Q7Y A;  4K71 B;  2DYP A;  1T1Z A;  3G08 A;  4WDI A;  1N59 A;  1N5A A;  2YPL A;  2AXF A;  3I6G A;  3PWN A;  2VAA A;  4MNG A;  1MHE A;  2X70 A;  3VXP A;  1VGK A;  1A1O A;  3D3V A;  3PWL A;  5EOT A;  3VCL A;  3VFO A;  5IB1 A;  2UWE A;  1R3H A;  4U1L A;  2P5E A;  4PDC E;  4ZUV A;  4JFP A;  3SJV A;  1LEG A;  3VFU A;  2BNR A;  1IM3 A;  3BH8 A;  3MRF A;  3MRP A;  3MRN A;  1L8J A;  3BP7 A;  1I7T A;  1HHK A;  2FIK A;  3HLA A;  4PRD A;  4QRS A;  3RWG A;  1FZM A;  3T8X A;  1CG9 A;  1QQD A;  4D0C A;  3BW9 A;  3GSR A;  3LKP A;  4G59 A;  4PRN A;  2RFX A;  1TVB A;  2XFX A;  4G43 A;  4NQC A;  2XPG A;  5IB4 A;  2VLJ A;  3CH1 A;  4F7T A;  3QUX A;  3I6K A;  1P4L A;  5J1A A;  3P4N A;  4ZFZ A;  2VE6 A;  5HGD A;  4ZUW A;  1TVH A;  1T0M A;  1XZ0 A;  3FQR A;  4PRP A;  4G8I A;  4GKS A;  3D39 A;  3X14 A;  1ZS8 A;  1ZT4 A;  3KPR A;  4X6C A;  4MJ5 A;  2A83 A;  4IRJ A;  3P77 A;  4L8S C;  2AV7 A;  1X7Q A;  3RGV C;  3DX7 A;  3IT8 D;  4D0D A;  2PYE A;  4V3E B;  4QOK A;  1ONQ A;  3W0W A;  5IEH A;  1S9X A;  2X4T A;  1JUF A;  4HKJ A;  4PGD A;  4QRR A;  5D7J C;  5DEF A;  2C7U A;  4G9D A;  1S8D A;  4U1J A;  3VRI A;  4O2C A;  4PJ8 A;  3WL9 A;  4PV8 A;  3RWI A;  2BNQ A;  3VXO A;  3FOL A;  3BVN A;  1NAN H;  5BJT A;  3MRC A;  2V2X A;  3KPP A;  2PO6 A;  2ZSV A;  4S0U C;  4L8B A;  2BSS A;  3CVH A;  5C0D A;  3L3K A;  5F9J A;  3LKR A;  4Y4K A;  2AXG A;  3MRL A;  1INQ A;  1S7V A;  4FTV A;  4L3E A;  4Y16 A;  1T7W A;  3TBS A;  3P4M A;  4PJF A;  5C07 A;  3X12 A;  5IB3 A;  3BZE A;  2GAZ A;  3MRG A;  4E5X A;  1JGD A;  4U1K A;  4MQ7 A;  5C9J A;  3LV3 A;  3O3D A;  1T1Y A;  4L3C A;  3AU1 A;  4PP8 C;  3BZF A;  1AO7 A;  1G6R H;  1YPZ A;  3MRK A;  1YN6 A;  3OX8 A;  1E27 A;  4N5E A;  4NQV A;  1FZK A;  4EUP A;  1T7V A;  3TBW A;  4PGE A;  4WU7 A;  4D0B A;  5C0B A;  5FA4 A;  3BXN A;  4PRE A;  1MI5 A;  1S7W A;  3GMM A;  3O3A A;  4L9L C;  2GTZ A;  3SDC A;  5IND A;  1BQH A;  3MRO A;  3S6C A;  3ILQ C;  3QUL A;  1KJ2 H;  1KCG C;  3H7B A;  3KPL A;  5BS0 A;  3KYO A;  1A1M A;  1C16 A;  3CPL A;  4JRY A;  4NQX A;  2CII A;  3M1B A;  2FO4 A;  1VAC A;  2CLR A;  1T20 A;  4LNR A;  4PRB A;  1I7U A;  3RUG A;  4JFE A;  2V2W A;  5C09 A;  4U1N A;  3CDG A;  3L3H A;  3MR9 A;  3REW A;  1OF2 A;  1HYR C;  3GML A;  3GSQ A;  3VXN A;  3TIE A;  5IM7 A;  3KXF A;  3GIV A;  3MV7 A;  4HUU A;  2ESV A;  1KPU A;  1AKJ A;  3VH8 A;  4NSK A;  4N8V A;  3GSV A;  1SYV A;  3BEV A;  1QLF A;  5D2N A;  3LKN A;  1CD1 A;  2BST A;  2CIK A;  4F7P A;  3M17 A;  3VWJ A;  4QRP A;  1T7Z A;  4JFO A;  2E7L E;  4HUX A;  1KJV A;  4HUW A;  1ZHB A;  2GUO A;  4MNQ A;  3QDJ A;  1HHH A;  4HUV A;  1HHJ A;  1FFP A;  3MV9 A;  3VFM A;  3MRR A;  3MGT A;  1I7R A;  1S7S A;  4O2F A;  2X4S A;  3MGO A;  1YDP A;  4WJ5 A;  3JTT A;  1S9W A;  5IRO A;  2ZOL A;  1QSF A;  5EUO A;  4QRU A;  5HGH A;  3TFK A;  2X4N A;  1B0R A;  1WBZ A;  3QQ4 A;  4MJI A;  3ES6 A;  3TJH A;  4NQE A;  3ARF A;  3H9H A;  4L4V A;  4PJX A;  4WWK C;  3SKM A;  3E6F A;  3L3G A;  5E6I C;  3V5D A;  5B38 A;  1I1A A;  2F74 A;  3ARE A;  3FQT A;  4NO5 A;  3QZW A;  3VFR A;  2GJ6 A;  4WUU A;  1XR9 A;  1T0N A;  1EEZ A;  4WU5 A;  2HLA A;  1UXW A;  4NHU E;  3NFN A;  3W39 A;  3PWV A;  3DX8 A;  2FWO A;  2F54 A;  4IIQ C;  1T7Y A;  3VFP A;  4LHU A;  4GKN A;  1N2R A;  3GJF A;  4PJA A;  1ZAG A;  3BWA A;  3GSN H;  4F7E A;  3PQY A;  4PG9 A;  3HG1 A;  3DMM A;  3HAE A;  3KWW A;  3VFW A;  3MRJ A;  3O8X A;  3QI9 A;  5EO0 A;  4PRH A;  4PR5 A;  3MYJ A;  3P4O A;  4JQV A;  1T7X A;  3D25 A;  5H94 A;  4N0F A;  1OSZ A;  3PWP A;  3E3Q A;  5HGA A;  2AKR A;  1AGB A;  4IRS A;  1A6Z A;  5ISZ A;  4K7F A;  5AD0 A;  5D7L A;  4L8D A;  3GSU A;  3JTC A;  3ARB A;  1KJM A;  4U6Y A;  2X4O A;  3WS6 A;  4GUP A;  4PGC A;  2VAB A;  3KPM A;  4ZUU A;  5MEN A;  1JPG A;  3FTG A;  2AK4 A;  4PJG A;  4ZUS A;  3TZV C;  1T22 A;  3FOM A;  3LKQ A;  3ROL A;  3ROO A;  2HN7 A;  4LCW A;  1B3J A;  1S7U A;  5SWZ A;  3DX6 A;  3UPR A;  3VFT A;  5BXF A;  3HCV A;  3QUY A;  4NO0 A;  4PJB A;  3KLA A;  3SCM A;  2BSR A;  1M6O A;  3GMO A;  3MA7 A;  4LCY A;  2D31 A;  3TO4 A;  1FFO A;  1FZO A;  4JFQ A;  4U1S A;  4MVB A;  1ZHK A;  3L3D A;  5EU6 A;  5BRZ A;  4Z78 A;  2FYY A;  3GMP A;  3QFD A;  1HHG A;  3IXA A;  3FQN A;  3MV8 A;  5C0E A;  3VFV A;  4U1M A;  3T1F A;  4JQX A;  3QEQ A;  1M05 A;  2BCK A;  5MEQ A;  1FG2 A;  1QSE A;  1DUY A;  3SDX A;  1WBX A;  3DTX A;  1SYS A;  5D9S A;  3ARG A;  3P9M A;  1BII A;  1EEY A;  5FA3 A;  3RWE A;  1P7Q A;  3H9S A;  5F1I A;  3CCH A;  3GSW A;  2NX5 A;  3VFS A;  4PJH A;  4NO3 A;  1IM9 A;  1P1Z A;  3ERY A;  3DBX A;  4UQ3 A;  3WS3 A;  2AV1 A;  1CE6 A;  3BEW A;  2X4Q A;  1QRN A;  4APQ A;  3KPO A;  1YN7 A;  3ECB A;  3L3I A;  4PGB A;  5E8O A;  3JVG A;  1Q94 A;  5HGB A;  1N3N A;  2GTW A;  3PWJ A;  1UXS A;  1HSB A;  3HE6 A;  1MHC A;  1Z5L A;  3BH9 A;  1AGD A;  3RWC A;  4WO4 A;  5IB2 A;  5HHQ A;  3TBT A;  3V5K A;  1OGT A;  3X13 A;  4JRX A;  1ZT1 A;  4HV8 A;  1S7X A;  3AM8 A;  4X6D A;  5HHM A;  1DE4 A;  1ZSD A;  3V5H A;  3GSX A;  3MRE A;  1NEZ A;  1T1X A;  1DUZ A;  1HOC A;  1JE6 A;  1WBY A;  2X4U A;  2YPK A;  4V3D B;  4PJI A;  3B3I A;  3OXR A;  2OL3 H;  1AGE A;  2H6P A;  5C0J A;  4O2E A;  1EXU A;  3VXS A;  2WY3 A;  2YEZ A;  3LN5 A;  4ELM A;  3LKO A;  1I1F A;  4U1H A;  1K8D A;  4IHO A;  5DEG A;  4ZAK A;  5HHO A;  2CLZ A;  3E6H A;  5MEO A;  4PRI A;  3FT3 A;  5D2L A;  3MRM A;  5FKP A;  3X11 A;  1PQZ A;  1NAM H;  4PJE A;  2HJL A;  4NNX A;  1T21 A;  1JGE A;  1FO0 H;  1JF1 A;  1RJY A;  4U6X A;  4NNY A;  1ED3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...