2OI9A

Structure of the 2c/ld/ql9 allogeneic complex
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
175
structure length
175
Chain Sequence
b'GPHSMRYYETATSRRGLGEPRYTSVGYVDDKEFVRFDSDAENPRYEPQVPWMEQEGPEYWERITQVAKGQEQWFRVNLRTLLGYYNQSAGGTHTLQRMYGCDVGSDGRLLRGYEQFAYDGCDYIALNEDLRTWTAADMAAQITRRKWEQAGAAEYYRAYLEGECVEWLHRYLKNG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Major Histocompatibility Complex protein
publication title How a single T cell receptor recognizes both self and foreign MHC.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 50
structure length 175
sequence length 175
ec nomenclature
pdb deposition date 2007-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 2oi9A00
1E27A 3P4NA 4PJCA 5JHDA 2NW3A 1LDPH 3QQ3A 4I48A 3TJHA 1T7ZA 1VACA 5IEKA 4X6EA 5D7JC 4PV9A 3M1BA 2VLKA 1K5NA 4N0CA 5C09A 3OV6A 5C08A 1XR8A 4PG2A 1RK1A 1T7VA 4LCCC 3BEWA 3GSRA 1W0WA 4IRJA 4PREA 2YPLA 1I1AA 3AU1A 3MGTA 2XFXA 4NNXA 3VXMA 3U0PA 3HE7A 1LP9A 3OXRA 4G8GA 3IXAA 1LQVA 2F74A 1UQSA 2BCKA 3CZFA 2X70A 3L3JA 3KPSA 1AGDA 5IB1A 3WUWA 4HUVA 4NT6A 5C9JA 4D0BA 3ARDA 4QRSA 3MRIA 1ZT4A 1X7QA 3L9RA 4NQCA 3VFNA 2P5WA 2AV1A 1CE6A 3TBTA 3V5DA 5HHPA 1A1MA 3ERYA 5C07A 4V3DB 1MI5A 3ROLA 5C0CA 1ZT7A 3L3IA 3SDAA 3LKRA 4PRNA 3QUXA 3GSQA 1S7RA 3TBSA 3C8KA 3MRMA 1I1FA 1WBYA 2CLVA 4PGCA 3P9MA 1I4FA 3I6GA 5HGDA 5ACZA 1T7WA 3FQRA 5MERA 3PABA 1KJMA 3D18A 3BGMA 3KLAA 1QVOA 5B38A 3PWNA 4WDIA 5INDA 4WW2C 1FZKA 3HG1A 1DDHA 4ZFZA 2BNRA 1JPFA 3O3DA 4PG9A 2AV7A 3RL1A 4G43A 3X13A 1E28A 3BW9A 4QRUA 5E8OA 5C0DA 3X14A 4U1KA 3TBYA 5HYJA 1JHTA 4L9LC 3VFWA 3SPVA 3VFPA 3VWKA 1HOCA 4U1SA 4WJ5A 3HUJA 5IB5A 1IM3A 2J8UA 3L3KA 1ZT1A 4FFEX 1P1ZA 5IVXA 5D7LA 1QSFA 2YPKA 4JFFA 4PDCE 5IB3A 1AGEA 3MREA 2YEZA 2VLRA 3QZWA 5E8PA 3KPNA 3WLBA 3NFNA 3MROA 1BIIA 3JTTA 1IM9A 5HHQA 1FZJA 4LNRA 3KPRA 3V5KA 3CH1A 2CLZA 1S7QA 4HKJA 5F9JA 4X6DA 1SYSA 3DX7A 5F1NA 3LN4A 3VFTA 3VFVA 3MYJA 1B0RA 3ILPA 3LKNA 4NSKA 3VFUA 4PJGA 3TPUE 4ZUUA 1S9WA 3GSWA 1I7TA 3OXSA 4I4WA 3BP4A 4JFDA 2FZ3A 3CVHA 3MRJA 5SWZA 4ZAKA 1DUZA 4L4VA 5IB2A 3BEVA 3MV8A 2BVQA 3LKOA 1HSAA 4N0FA 3FOLA 4D0DA 1S7TA 3T1FA 4NO2A 3MRQA 3RZCA 1S9XA 4JFPA 3FT2A 1GZQA 1LK2A 2PYEA 4L3EA 3KPQA 5F1IA 3MRHA 2GITA 2BNQA 1I7UA 4G59A 5J6HA 4U6YA 2VAAA 4HS3A 1Z5LA 3QDMA 5DDHA 1A9BA 5FA4A 4K7FA 3VXNA 3E3QA 3E6FA 4PJAA 3W0WA 1AO7A 4MXQA 4N5EA 3SCMA 1LEGA 3BHBA 3GSUA 5D2LA 1T22A 1T21A 1DE4A 4HUXA 4N0UA 1K8DA 3RWFA 1UXSA 3KXFA 3TVMA 4E5XA 3MRRA 3VRJA 1CG9A 3TFKA 5C0JA 5FDWA 5IEHA 1A1NA 3PWPA 1ZS8A 1RJZA 4X6CA 3DX8A 3KWWA 5IB4A 4E0RA 1BD2A 1ZHBA 4S0UC 3RWIA 4XXCA 5MENA 3VCLA 4JFEA 3QUZA 1ZHNA 4Y4FA 1LD9A 1WBXA 3TA3A 1W72A 3LKSA 1S7WA 2OL3H 2VLLA 3DXAA 1G6RH 3JVGA 3P9LA 2XPGA 3HE6A 3P77A 1L8JA 3ARFA 3MV9A 2BSRA 1KJ2H 4JRYA 1S9YA 4NHUE 4Z76A 1EFXA 1W0VA 3CCHA 5D2NA 3ARBA 1ZSDA 1N5AA 2MHAA 3BUYA 3L3GA 1B3JA 1QO3A 3X12A 4PJDA 4PGDA 3TN0A 1FFNA 1R3HA 2ZOKA 4HWZA 4HUUA 3VFMA 3QULA 5E9DA 1U58A 3O4LA 5DEGA 1I1YA 4PJ8A 4PRIA 3PWVA 1ZHLA 1HHHA 2ZOLA 4CW1A 3MV7A 1T20A 1N3NA 1JE6A 3O3EA 3UBXA 2FIKA 3BP7A 4NO3A 1EXUA 1A6ZA 1A1OA 3P4MA 3P73A 2ZSVA 2V2WA 2X4TA 3GJFA 5EU3A 5C0FA 1MHEA 3HAEA 2PO6A 3SKOA 4MVBA 3LKQA 3MRGA 5FKPA 2GJ6A 3MR9A 3AM8A 3D3VA 3REWA 1KBGH 1OF2A 3VWJA 4JQXA 1HYRC 4G42A 1DUYA 4MNGA 3RWEA 4F7EA 4WUUA 1B0GA 5L2JA 3X11A 4G9FA 4PR5A 3QDGA 1T7YA 4F7CA 3IT8D 3QEQA 1HHKA 1GZPA 1KJVA 2E7LE 5MEQA 2AKRA 3GMRA 3TZVC 1HHIA 3VFOA 3ROOA 5HHMA 3O3AA 4ELMA 1FO0H 3GSOA 3ILQC 4ZUVA 3MRKA 4MQ7A 1FZOA 4U1LA 1YDPA 3RTQA 3FQXA 4PJ7A 4LCWA 3VXPA 3GMNA 3MRCA 5GSVA 2GAZA 1HSBA 1KPUA 5HHNA 4F7PA 4PJBA 3BZFA 1AGBA 5IM7A 4PRHA 4L8BA 1ZHKA 2JCCA 3GSNH 4NQEA 4O2FA 3QQ4A 4ZUTA 3KYNA 1T0MA 3VXSA 1T1YA 2BVOA 3TIDA 5ISZA 4V3EB 1WBZA 5E6IC 3HLAA 3MRBA 1LEKA 3MRPA 4CVXA 3B3IA 5D9SA 2X4SA 1NANH 3KPOA 2BSTA 3V5HA 3DX6A 3TO2A 3AREA 4MJIA 2HLAA 2HN7A 1QR1A 1KTLA 2CKBH 4CVZA 5F7DA 3P4OA 4QRQA 3RWJA 4LHUA 5H94A 1OGTA 4HX1A 4K71B 3CDGA 3UTSA 4N8VA 4NQVA 3D39A 1BZ9A 1TVHA 4F7TA 2ESVA 4L8DA 3RWHA 1RJYA 3I6LD 4IIQC 1N59A 1S7SA 3KYOA 4PJFA 5HGBA 4PRPA 1XH3A 3GSXA 1S7XA 1I7RA 3B6SA 1NEZA 1JGDA 2GTZA 1HHJA 1KPVA 1QEWA 1TVBA 4L8SC 3WL9A 2FO4A 3QDJA 3SKMA 2NX5A 5GSRA 4NQDA 2BSSA 3RUGA 1T80A 1NAMH 3VH8A 4FTVA 2X4PA 1P4LA 2AK4A 3BH9A 3E6HA 3O8XA 5EU4A 2GT9A 3PQYA 1ONQA 2CIIA 2AXGA 2GUOA 3PWUA 4G8IA 3H7BA 3VXUA 3FTGA 3KPMA 4U1NA 4D0CA 4PGEA 4IHOA 3JTSA 5EO0A 5L2KA 4NQXA 1YN6A 1QQDA 4WU5A 3L3DA 5HGAA 3TBWA 5SWQA 4MJ6A 4QOKA 2OI9A 3G08A 4PJEA 5HGHA 4JFQA 4ZUSA 1M6OA 2X4RA 3L3HA 4HV8A 1VADA 5C0EA 5E00A 3RWDA 1A9EA 2WY3A 3TO4A 1TMCA 2X4OA 5C0AA 4GKSA 1INQA 1YPZA 1AGCA 4QRTA 2HJKA 3WS6A 1RK0A 3FT3A 1PQZA 2VLJA 4U1MA 1T1ZA 5C0BA 2BVPA 3QI9A 4F7MA 3BVNA 3BWAA 5EOTA 3TBVA 4JRXA 3UPRA 2CIKA 3RGVC 3ARGA 1ED3A 3GSVA 4Y4KA 2GTWA 3D25A 2FWOA 3HPJA 1KPRA 3SJVA 3MRNA 1JGEA 2CLRA 3MA7A 1N2RA 2DYPA 3RWGA 3HCVA 1EEYA 2H6PA 1ZAGA 4EUPA 1MWAH 3ECBA 2C7UA 3GMLA 4PRBA 4Z77A 3BO8A 2RFXA 2F54A 3DMMA 3H9SA 5EU5A 1AGFA 1G7QA 3D2UA 2X4QA 3GMPA 3MRDA 4APQA 5EO1A 1FZMA 3M17A 4NNYA 2ZSWA 4U6XA 1HHGA 1FG2A 4PJ9A 4Z78A 5DEFA 1XR9A 1KJ3H 1YN7A 2D31A 3KPLA 3RL2A 3BXNA 3PWLA 3H9HA 4NO5A 5IROA 4PJ5A 4U1JA 3GIVA 5SWSA 3I6KA 4MJ5A 5D5MA 4HUWA 4QRRA 3SDDA 4L4TA 1M05A 3QUYA 3LV3A 1SYVA 1EEZA 2X4NA 3JTCA 5BRZA 3FRUA 3DTXA 5C0GA 2A83A 3GMQA 4WO4A 1JFMA 1G7PA 1KCGC 1FFOA 1ZVSA 3DBXA 3FT4A 4PRAA 1Q94A 3FONA 1S8DA 4U1HA 4WWKC 3FQUA 4PJIA 4QRPA 1UXWA 1QSEA 3GMMA 3BH8A 4LCYA 5MEOA 4L8CA 4EI5A 1OSZA 3TIEA 1BQHA 1VGKA 1C16A 5FA3A 3E2HA 1T1WA 4X6FA 1QRNA 3UTTA 1XZ0A 3LKPA 4MNQA 2F53A 4U1IA 1MHCA 2V2XA 4JFOA 3KPPA 5EUOA 1OGAA 4O2EA 4PRDA 4UQ3A 3RWCA 5BS0A 4ZUWA 3UTQA 3VJ6A 3FFCA 1QLFA 4ONOA 3T8XA 3FQNA 2VABA 4L29A 2AXFA 4NO0A 4L3CA 3FOMA 3VRIA 2Q7YA 4MX7A 3S6CA 1P7QA 1T1XA 4Y2DA 4Y4HA 3WS3A 4WU7A 4PGBA 5BJTA 5B39A 3W39A 3VFSA 4G9DA 3LN5A 5AD0A 3VXOA 1JPGA 5J6GA 4GKNA 5J1AA 3BZEA 3O9WA 4PJHA 1CD1A 5C0IA 5MEPA 1T0NA 1AKJA 3OX8A 2HJLA 4MS8A 3FQTA 1S7UA 5D7IA 5ENWA 2UWEA 4EN3C 3TF7A 5E8NA 3CC5A 3SDCA 4PV8A 2VE6A 3VXRA 3C9NA 3GMOA 2P5EA 5EFIA 1JUFA 4Y16A 3MRFA 1FFPA 3CPLA 3FQWA 4PP8C 3PWJA 3MRLA 5BXFA 3MGOA 3SDXA 3ES6A 3O3BA 1S7VA 2FYYA 4UQ2A 2H26A 3QUKA 1JF1A 3VFRA 4O2CA 4JQVA 3QFJA 5HHOA 4GUPA 4IRSA 1T7XA 4PJXA 5INCA 3QFDA 5EU6A 2X4UA
chains in the Genus database with same CATH superfamily
1E27A 3P4NA 4PJCA 5JHDA 2NW3A 1LDPH 3QQ3A 4I48A 3TJHA 1T7ZA 1VACA 5IEKA 4X6EA 5D7JC 4PV9A 3M1BA 2VLKA 1K5NA 4N0CA 5C09A 3OV6A 5C08A 1XR8A 4PG2A 1RK1A 1T7VA 4LCCC 3BEWA 3GSRA 1W0WA 4IRJA 4PREA 2YPLA 1I1AA 3AU1A 3MGTA 2XFXA 4NNXA 3VXMA 3U0PA 3HE7A 1LP9A 3OXRA 4G8GA 3IXAA 1LQVA 2F74A 1UQSA 2BCKA 3CZFA 2X70A 3L3JA 3KPSA 1AGDA 5IB1A 3WUWA 4HUVA 4NT6A 5C9JA 4D0BA 3ARDA 4QRSA 3MRIA 1ZT4A 1X7QA 3L9RA 4NQCA 3VFNA 2P5WA 2AV1A 1CE6A 3TBTA 3V5DA 5HHPA 1A1MA 3ERYA 5C07A 4V3DB 1MI5A 3ROLA 5C0CA 1ZT7A 3L3IA 3SDAA 3LKRA 4PRNA 3QUXA 3GSQA 1S7RA 3TBSA 3C8KA 3MRMA 1I1FA 1WBYA 2CLVA 4PGCA 3P9MA 1I4FA 2O5NA 3I6GA 5HGDA 5ACZA 1T7WA 3FQRA 5MERA 3PABA 1KJMA 3D18A 3BGMA 3KLAA 1QVOA 5B38A 3PWNA 4WDIA 5INDA 4WW2C 1FZKA 3HG1A 1DDHA 4ZFZA 2BNRA 1JPFA 3O3DA 4PG9A 2AV7A 3RL1A 4G43A 3X13A 1E28A 3BW9A 4QRUA 5E8OA 5C0DA 3X14A 4U1KA 3TBYA 5HYJA 1JHTA 4L9LC 3VFWA 3SPVA 3VFPA 3VWKA 1HOCA 4U1SA 4WJ5A 3HUJA 5IB5A 1IM3A 2J8UA 3L3KA 1ZT1A 4FFEX 1P1ZA 5IVXA 5D7LA 1QSFA 2YPKA 4JFFA 4PDCE 5IB3A 1AGEA 3MREA 2YEZA 2VLRA 3QZWA 5E8PA 3KPNA 3WLBA 3NFNA 3MROA 1BIIA 3JTTA 1IM9A 5HHQA 1FZJA 4LNRA 3KPRA 3V5KA 3CH1A 2CLZA 1S7QA 4HKJA 5F9JA 4X6DA 1SYSA 3DX7A 5F1NA 3LN4A 3VFTA 3VFVA 3MYJA 1B0RA 3ILPA 3LKNA 4NSKA 3VFUA 4PJGA 3TPUE 4ZUUA 1S9WA 3GSWA 1I7TA 3OXSA 4I4WA 3BP4A 4JFDA 2FZ3A 3CVHA 3MRJA 5SWZA 4ZAKA 1DUZA 4L4VA 5IB2A 3BEVA 3MV8A 2BVQA 3LKOA 1HSAA 4N0FA 3FOLA 4D0DA 1S7TA 3T1FA 4NO2A 3MRQA 3RZCA 1S9XA 4JFPA 3FT2A 1GZQA 1LK2A 2PYEA 4L3EA 3KPQA 5F1IA 3MRHA 2GITA 2BNQA 1I7UA 4G59A 5J6HA 4G59C 2VAAA 4U6YA 4HS3A 1Z5LA 3QDMA 5DDHA 1A9BA 5FA4A 4K7FA 3VXNA 3E3QA 3E6FA 4PJAA 3W0WA 1AO7A 4MXQA 4N5EA 3SCMA 1LEGA 3BHBA 3GSUA 5D2LA 1T22A 1T21A 1DE4A 4HUXA 4N0UA 1K8DA 3RWFA 1UXSA 3KXFA 3TVMA 4E5XA 3MRRA 3VRJA 1CG9A 3TFKA 5C0JA 5FDWA 2IA1A 5IEHA 1A1NA 3PWPA 1ZS8A 1RJZA 4X6CA 3DX8A 3KWWA 5IB4A 4E0RA 1BD2A 1ZHBA 4S0UC 3RWIA 4XXCA 5MENA 3VCLA 4JFEA 3QUZA 1ZHNA 4Y4FA 1LD9A 1WBXA 3TA3A 1W72A 3LKSA 1S7WA 2OL3H 2VLLA 3DXAA 1G6RH 3JVGA 3P9LA 2XPGA 3HE6A 3P77A 1L8JA 3ARFA 3MV9A 2BSRA 1KJ2H 4JRYA 1S9YA 4NHUE 4Z76A 1EFXA 1W0VA 3CCHA 5D2NA 3ARBA 1ZSDA 1N5AA 2MHAA 3BUYA 3L3GA 1B3JA 1QO3A 3X12A 4PJDA 4PGDA 3TN0A 1FFNA 1R3HA 2ZOKA 4HWZA 4HUUA 3VFMA 3QULA 5E9DA 1U58A 3O4LA 5DEGA 1I1YA 4PJ8A 4PRIA 3PWVA 1ZHLA 1HHHA 2ZOLA 4CW1A 3MV7A 1T20A 1N3NA 1JE6A 3O3EA 3UBXA 2FIKA 3BP7A 4NO3A 1EXUA 1A6ZA 1A1OA 3P4MA 3P73A 2ZSVA 2V2WA 2X4TA 3GJFA 5EU3A 5C0FA 1MHEA 3HAEA 2PO6A 3SKOA 4MVBA 3LKQA 3MRGA 5FKPA 2GJ6A 3MR9A 3AM8A 3D3VA 3REWA 1KBGH 1OF2A 3VWJA 4JQXA 1HYRC 4G42A 1DUYA 4MNGA 3RWEA 4F7EA 4WUUA 1B0GA 5L2JA 3X11A 4G9FA 4PR5A 3QDGA 1T7YA 4F7CA 3IT8D 3QEQA 1HHKA 1GZPA 1KJVA 2E7LE 5MEQA 2AKRA 3GMRA 3TZVC 1HHIA 3VFOA 3ROOA 5HHMA 3O3AA 4ELMA 1FO0H 3GSOA 3ILQC 2NYKA 4ZUVA 3MRKA 4MQ7A 1FZOA 4U1LA 1YDPA 3RTQA 3FQXA 4PJ7A 4LCWA 3VXPA 3GMNA 3MRCA 5GSVA 2GAZA 1HSBA 1KPUA 5HHNA 4F7PA 4PJBA 3BZFA 1AGBA 5IM7A 4PRHA 4L8BA 1ZHKA 2JCCA 3GSNH 4NQEA 4O2FA 3QQ4A 4ZUTA 3KYNA 1T0MA 3VXSA 1T1YA 2BVOA 3TIDA 5ISZA 4V3EB 1WBZA 5E6IC 3HLAA 3MRBA 1LEKA 3MRPA 4CVXA 3B3IA 5D9SA 2X4SA 1NANH 3KPOA 2BSTA 3V5HA 3DX6A 3TO2A 3AREA 4MJIA 2HLAA 2HN7A 1QR1A 1KTLA 2CKBH 4CVZA 5F7DA 3P4OA 4QRQA 3RWJA 4LHUA 5H94A 1OGTA 4HX1A 4K71B 3CDGA 3UTSA 4N8VA 4NQVA 3D39A 1BZ9A 4JO8A 1TVHA 4F7TA 2ESVA 4L8DA 3RWHA 1RJYA 3I6LD 4IIQC 1N59A 1S7SA 3KYOA 4PJFA 5HGBA 4PRPA 1XH3A 3GSXA 1S7XA 1I7RA 3B6SA 1NEZA 1JGDA 2GTZA 1HHJA 1KPVA 1QEWA 1TVBA 4L8SC 3WL9A 2FO4A 3QDJA 3SKMA 2NX5A 5GSRA 4NQDA 2BSSA 3RUGA 1T80A 1NAMH 3VH8A 4FTVA 2X4PA 1P4LA 2AK4A 3BH9A 3E6HA 3O8XA 5EU4A 2GT9A 3PQYA 1ONQA 2CIIA 2AXGA 2GUOA 3PWUA 4G8IA 3H7BA 3VXUA 3FTGA 3KPMA 4U1NA 4D0CA 4PGEA 4IHOA 3JTSA 5EO0A 5L2KA 4NQXA 1YN6A 1QQDA 4WU5A 3L3DA 5HGAA 3TBWA 5SWQA 4MJ6A 4QOKA 2OI9A 3G08A 4PJEA 5HGHA 4JFQA 4ZUSA 1M6OA 2X4RA 3L3HA 4HV8A 1VADA 5C0EA 5E00A 3RWDA 1A9EA 2WY3A 3TO4A 1TMCA 2X4OA 5C0AA 4GKSA 1INQA 1YPZA 1AGCA 4QRTA 2HJKA 3WS6A 1RK0A 3FT3A 1PQZA 2VLJA 4U1MA 1T1ZA 5C0BA 2BVPA 3QI9A 4F7MA 3BVNA 3BWAA 5EOTA 3TBVA 4JRXA 3UPRA 2CIKA 3RGVC 3ARGA 1ED3A 3GSVA 4Y4KA 2GTWA 3D25A 2FWOA 3HPJA 1KPRA 3SJVA 3MRNA 1JGEA 2CLRA 3MA7A 1N2RA 2DYPA 3RWGA 3HCVA 1EEYA 2H6PA 1ZAGA 4EUPA 1MWAH 3ECBA 2C7UA 3GMLA 4PRBA 4Z77A 3BO8A 2RFXA 2F54A 3DMMA 3H9SA 5EU5A 1AGFA 1G7QA 3D2UA 2X4QA 3GMPA 3MRDA 4APQA 5EO1A 1FZMA 3M17A 4NNYA 2ZSWA 4U6XA 1HHGA 1FG2A 4PJ9A 3I0TA 4Z78A 5DEFA 1XR9A 1KJ3H 1YN7A 2D31A 3KPLA 3RL2A 3BXNA 3PWLA 3H9HA 4NO5A 5IROA 4PJ5A 4U1JA 3GIVA 5SWSA 3I6KA 4MJ5A 5D5MA 4HUWA 4QRRA 3SDDA 4L4TA 1M05A 3QUYA 3LV3A 1SYVA 1EEZA 2X4NA 3JTCA 5BRZA 3FRUA 3DTXA 5C0GA 2A83A 3GMQA 4WO4A 1JFMA 1G7PA 1KCGC 1FFOA 1ZVSA 3DBXA 3FT4A 4PRAA 1Q94A 3FONA 1S8DA 4U1HA 4WWKC 3FQUA 4PJIA 4QRPA 1UXWA 1QSEA 3GMMA 3BH8A 4LCYA 5MEOA 4L8CA 4EI5A 1OSZA 3TIEA 1BQHA 4BKWA 1VGKA 1C16A 5FA3A 3E2HA 1T1WA 4X6FA 1QRNA 3UTTA 1XZ0A 3LKPA 4MNQA 2F53A 4U1IA 1MHCA 2V2XA 4JFOA 3KPPA 5EUOA 1OGAA 4O2EA 4PRDA 4UQ3A 3RWCA 5BS0A 4ZUWA 3UTQA 3VJ6A 3FFCA 1QLFA 4ONOA 3T8XA 3FQNA 2VABA 4L29A 2AXFA 4NO0A 4L3CA 3FOMA 3VRIA 2Q7YA 4MX7A 3S6CA 1P7QA 1T1XA 4Y2DA 4Y4HA 3WS3A 4WU7A 4PGBA 5BJTA 5B39A 3W39A 3VFSA 4G9DA 3LN5A 5AD0A 3VXOA 1JPGA 5J6GA 4GKNA 5J1AA 3BZEA 3O9WA 4PJHA 1CD1A 5C0IA 5MEPA 1T0NA 1AKJA 3OX8A 2HJLA 4MS8A 3FQTA 1S7UA 5D7IA 5ENWA 2UWEA 4EN3C 3TF7A 5E8NA 3CC5A 3SDCA 4PV8A 2VE6A 3VXRA 3C9NA 3GMOA 2P5EA 5EFIA 1JUFA 4Y16A 3MRFA 1FFPA 3CPLA 3FQWA 4PP8C 3PWJA 3MRLA 5BXFA 3MGOA 3SDXA 3ES6A 3O3BA 1S7VA 2FYYA 4UQ2A 2H26A 3QUKA 1JF1A 3VFRA 4O2CA 4JQVA 3QFJA 5HHOA 4GUPA 4IRSA 1T7XA 4PJXA 5INCA 3QFDA 5EU6A 2X4UA
chains in the Genus database with same CATH topology
1E27A 3P4NA 4PJCA 5JHDA 2NW3A 1LDPH 3QQ3A 4I48A 3TJHA 1T7ZA 1VACA 5IEKA 4X6EA 5D7JC 4PV9A 3M1BA 2VLKA 1K5NA 4N0CA 5C09A 3OV6A 5C08A 1XR8A 4PG2A 1RK1A 1T7VA 4LCCC 3BEWA 3GSRA 1W0WA 4IRJA 4PREA 2YPLA 1I1AA 3AU1A 3MGTA 2XFXA 4NNXA 3VXMA 3U0PA 3HE7A 1LP9A 3OXRA 4G8GA 3IXAA 1LQVA 2F74A 1UQSA 2BCKA 3CZFA 2X70A 3L3JA 3KPSA 1AGDA 5IB1A 3WUWA 4HUVA 4NT6A 5C9JA 4D0BA 3ARDA 4QRSA 3MRIA 1ZT4A 1X7QA 3L9RA 4NQCA 3VFNA 2P5WA 2AV1A 1CE6A 3TBTA 3V5DA 5HHPA 1A1MA 3ERYA 5C07A 4V3DB 1MI5A 3ROLA 5C0CA 1ZT7A 3L3IA 3SDAA 3LKRA 4PRNA 3QUXA 3GSQA 1S7RA 3TBSA 3C8KA 3MRMA 1I1FA 1WBYA 2CLVA 4PGCA 3P9MA 1I4FA 3I6GA 5HGDA 5ACZA 1T7WA 3FQRA 5MERA 3PABA 1KJMA 3D18A 3BGMA 3KLAA 1QVOA 5B38A 3PWNA 4WDIA 5INDA 4WW2C 1FZKA 3HG1A 1DDHA 4ZFZA 2BNRA 1JPFA 3O3DA 4PG9A 2AV7A 3RL1A 4G43A 3X13A 1E28A 3BW9A 4QRUA 5E8OA 5C0DA 3X14A 4U1KA 3TBYA 5HYJA 1JHTA 4L9LC 3VFWA 3SPVA 3VFPA 3VWKA 1HOCA 4U1SA 4WJ5A 3HUJA 5IB5A 1IM3A 2J8UA 3L3KA 1ZT1A 4FFEX 1P1ZA 5IVXA 5D7LA 1QSFA 2YPKA 4JFFA 4PDCE 5IB3A 1AGEA 3MREA 2YEZA 2VLRA 3QZWA 5E8PA 3KPNA 3WLBA 3NFNA 3MROA 1BIIA 3JTTA 1IM9A 5HHQA 1FZJA 4LNRA 3KPRA 3V5KA 3CH1A 2CLZA 1S7QA 4HKJA 5F9JA 4X6DA 1SYSA 3DX7A 5F1NA 3LN4A 3VFTA 3VFVA 3MYJA 1B0RA 3ILPA 3LKNA 4NSKA 3VFUA 4PJGA 3TPUE 4ZUUA 1S9WA 3GSWA 1I7TA 3OXSA 4I4WA 3BP4A 4JFDA 2FZ3A 3CVHA 3MRJA 5SWZA 4ZAKA 1DUZA 4L4VA 5IB2A 3BEVA 3MV8A 2BVQA 3LKOA 1HSAA 4N0FA 3FOLA 4D0DA 1S7TA 3T1FA 4NO2A 3MRQA 3RZCA 1S9XA 4JFPA 3FT2A 1GZQA 1LK2A 2PYEA 4L3EA 3KPQA 5F1IA 3MRHA 2GITA 2BNQA 1I7UA 4G59A 5J6HA 4U6YA 2VAAA 4HS3A 1Z5LA 3QDMA 5DDHA 1A9BA 5FA4A 4K7FA 3VXNA 3E3QA 3E6FA 4PJAA 3W0WA 1AO7A 4MXQA 4N5EA 3SCMA 1LEGA 3BHBA 3GSUA 5D2LA 1T22A 1T21A 1DE4A 4HUXA 4N0UA 1K8DA 3RWFA 1UXSA 3KXFA 3TVMA 4E5XA 3MRRA 3VRJA 1CG9A 3TFKA 5C0JA 5FDWA 5IEHA 1A1NA 3PWPA 1ZS8A 1RJZA 4X6CA 3DX8A 3KWWA 5IB4A 4E0RA 1BD2A 1ZHBA 4S0UC 3RWIA 4XXCA 5MENA 3VCLA 4JFEA 3QUZA 1ZHNA 4Y4FA 1LD9A 1WBXA 3TA3A 1W72A 3LKSA 1S7WA 2OL3H 2VLLA 3DXAA 1G6RH 3JVGA 3P9LA 2XPGA 3HE6A 3P77A 1L8JA 3ARFA 3MV9A 2BSRA 1KJ2H 4JRYA 1S9YA 4NHUE 4Z76A 1EFXA 1W0VA 3CCHA 5D2NA 3ARBA 1ZSDA 1N5AA 2MHAA 3BUYA 3L3GA 1B3JA 1QO3A 3X12A 4PJDA 4PGDA 3TN0A 1FFNA 1R3HA 2ZOKA 4HWZA 4HUUA 3VFMA 3QULA 5E9DA 1U58A 3O4LA 5DEGA 1I1YA 4PJ8A 4PRIA 3PWVA 1ZHLA 1HHHA 2ZOLA 4CW1A 3MV7A 1T20A 1N3NA 1JE6A 3O3EA 3UBXA 2FIKA 3BP7A 4NO3A 1EXUA 1A6ZA 1A1OA 3P4MA 3P73A 2ZSVA 2V2WA 2X4TA 3GJFA 5EU3A 5C0FA 1MHEA 3HAEA 2PO6A 3SKOA 4MVBA 3LKQA 3MRGA 5FKPA 2GJ6A 3MR9A 3AM8A 3D3VA 3REWA 1KBGH 1OF2A 3VWJA 4JQXA 1HYRC 4G42A 1DUYA 4MNGA 3RWEA 4F7EA 4WUUA 1B0GA 5L2JA 3X11A 4G9FA 4PR5A 3QDGA 1T7YA 4F7CA 3IT8D 3QEQA 1HHKA 1GZPA 1KJVA 2E7LE 5MEQA 2AKRA 3GMRA 3TZVC 1HHIA 3VFOA 3ROOA 5HHMA 3O3AA 4ELMA 1FO0H 3GSOA 3ILQC 4ZUVA 3MRKA 4MQ7A 1FZOA 4U1LA 1YDPA 3RTQA 3FQXA 4PJ7A 4LCWA 3VXPA 3GMNA 3MRCA 5GSVA 2GAZA 1HSBA 1KPUA 5HHNA 4F7PA 4PJBA 3BZFA 1AGBA 5IM7A 4PRHA 4L8BA 1ZHKA 2JCCA 3GSNH 4NQEA 4O2FA 3QQ4A 4ZUTA 3KYNA 1T0MA 3VXSA 1T1YA 2BVOA 3TIDA 5ISZA 4V3EB 1WBZA 5E6IC 3HLAA 3MRBA 1LEKA 3MRPA 4CVXA 3B3IA 5D9SA 2X4SA 1NANH 3KPOA 2BSTA 3V5HA 3DX6A 3TO2A 3AREA 4MJIA 2HLAA 2HN7A 1QR1A 1KTLA 2CKBH 4CVZA 5F7DA 3P4OA 4QRQA 3RWJA 4LHUA 5H94A 1OGTA 4HX1A 4K71B 3CDGA 3UTSA 4N8VA 4NQVA 3D39A 1BZ9A 1TVHA 4F7TA 2ESVA 4L8DA 3RWHA 1RJYA 3I6LD 4IIQC 1N59A 1S7SA 3KYOA 4PJFA 5HGBA 4PRPA 1XH3A 3GSXA 1S7XA 1I7RA 3B6SA 1NEZA 1JGDA 2GTZA 1HHJA 1KPVA 1QEWA 1TVBA 4L8SC 3WL9A 2FO4A 3QDJA 3SKMA 2NX5A 5GSRA 4NQDA 2BSSA 3RUGA 1T80A 1NAMH 3VH8A 4FTVA 2X4PA 1P4LA 2AK4A 3BH9A 3E6HA 3O8XA 5EU4A 2GT9A 3PQYA 1ONQA 2CIIA 2AXGA 2GUOA 3PWUA 4G8IA 3H7BA 3VXUA 3FTGA 3KPMA 4U1NA 4D0CA 4PGEA 4IHOA 3JTSA 5EO0A 5L2KA 4NQXA 1YN6A 1QQDA 4WU5A 3L3DA 5HGAA 3TBWA 5SWQA 4MJ6A 4QOKA 2OI9A 3G08A 4PJEA 5HGHA 4JFQA 4ZUSA 1M6OA 2X4RA 3L3HA 4HV8A 1VADA 5C0EA 5E00A 3RWDA 1A9EA 2WY3A 3TO4A 1TMCA 2X4OA 5C0AA 4GKSA 1INQA 1YPZA 1AGCA 4QRTA 2HJKA 3WS6A 1RK0A 3FT3A 1PQZA 2VLJA 4U1MA 1T1ZA 5C0BA 2BVPA 3QI9A 4F7MA 3BVNA 3BWAA 5EOTA 3TBVA 4JRXA 3UPRA 2CIKA 3RGVC 3ARGA 1ED3A 3GSVA 4Y4KA 2GTWA 3D25A 2FWOA 3HPJA 1KPRA 3SJVA 3MRNA 1JGEA 2CLRA 3MA7A 1N2RA 2DYPA 3RWGA 3HCVA 1EEYA 2H6PA 1ZAGA 4EUPA 1MWAH 3ECBA 2C7UA 3GMLA 4PRBA 4Z77A 3BO8A 2RFXA 2F54A 3DMMA 3H9SA 5EU5A 1AGFA 1G7QA 3D2UA 2X4QA 3GMPA 3MRDA 4APQA 5EO1A 1FZMA 3M17A 4NNYA 2ZSWA 4U6XA 1HHGA 1FG2A 4PJ9A 4Z78A 5DEFA 1XR9A 1KJ3H 1YN7A 2D31A 3KPLA 3RL2A 3BXNA 3PWLA 3H9HA 4NO5A 5IROA 4PJ5A 4U1JA 3GIVA 5SWSA 3I6KA 4MJ5A 5D5MA 4HUWA 4QRRA 3SDDA 4L4TA 1M05A 3QUYA 3LV3A 1SYVA 1EEZA 2X4NA 3JTCA 5BRZA 3FRUA 3DTXA 5C0GA 2A83A 3GMQA 4WO4A 1JFMA 1G7PA 1KCGC 1FFOA 1ZVSA 3DBXA 3FT4A 4PRAA 1Q94A 3FONA 1S8DA 4U1HA 4WWKC 3FQUA 4PJIA 4QRPA 1UXWA 1QSEA 3GMMA 3BH8A 4LCYA 5MEOA 4L8CA 4EI5A 1OSZA 3TIEA 1BQHA 1VGKA 1C16A 5FA3A 3E2HA 1T1WA 4X6FA 1QRNA 3UTTA 1XZ0A 3LKPA 4MNQA 2F53A 4U1IA 1MHCA 2V2XA 4JFOA 3KPPA 5EUOA 1OGAA 4O2EA 4PRDA 4UQ3A 3RWCA 5BS0A 4ZUWA 3UTQA 3VJ6A 3FFCA 1QLFA 4ONOA 3T8XA 3FQNA 2VABA 4L29A 2AXFA 4NO0A 4L3CA 3FOMA 3VRIA 2Q7YA 4MX7A 3S6CA 1P7QA 1T1XA 4Y2DA 4Y4HA 3WS3A 4WU7A 4PGBA 5BJTA 5B39A 3W39A 3VFSA 4G9DA 3LN5A 5AD0A 3VXOA 1JPGA 5J6GA 4GKNA 5J1AA 3BZEA 3O9WA 4PJHA 1CD1A 5C0IA 5MEPA 1T0NA 1AKJA 3OX8A 2HJLA 4MS8A 3FQTA 1S7UA 5D7IA 5ENWA 2UWEA 4EN3C 3TF7A 5E8NA 3CC5A 3SDCA 4PV8A 2VE6A 3VXRA 3C9NA 3GMOA 2P5EA 5EFIA 1JUFA 4Y16A 3MRFA 1FFPA 3CPLA 3FQWA 4PP8C 3PWJA 3MRLA 5BXFA 3MGOA 3SDXA 3ES6A 3O3BA 1S7VA 2FYYA 4UQ2A 2H26A 3QUKA 1JF1A 3VFRA 4O2CA 4JQVA 3QFJA 5HHOA 4GUPA 4IRSA 1T7XA 4PJXA 5INCA 3QFDA 5EU6A 2X4UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E27 A;  3P4N A;  4PJC A;  5JHD A;  2NW3 A;  1LDP H;  3QQ3 A;  4I48 A;  3TJH A;  1T7Z A;  1VAC A;  5IEK A;  4X6E A;  5D7J C;  4PV9 A;  3M1B A;  2VLK A;  1K5N A;  4N0C A;  5C09 A;  3OV6 A;  5C08 A;  1XR8 A;  4PG2 A;  1RK1 A;  1T7V A;  4LCC C;  3BEW A;  3GSR A;  1W0W A;  4IRJ A;  4PRE A;  2YPL A;  1I1A A;  3AU1 A;  3MGT A;  2XFX A;  4NNX A;  3VXM A;  3U0P A;  3HE7 A;  1LP9 A;  3OXR A;  4G8G A;  3IXA A;  1LQV A;  2F74 A;  1UQS A;  2BCK A;  3CZF A;  2X70 A;  3L3J A;  3KPS A;  1AGD A;  5IB1 A;  3WUW A;  4HUV A;  4NT6 A;  5C9J A;  4D0B A;  3ARD A;  4QRS A;  3MRI A;  1ZT4 A;  1X7Q A;  3L9R A;  4NQC A;  3VFN A;  2P5W A;  2AV1 A;  1CE6 A;  3TBT A;  3V5D A;  5HHP A;  1A1M A;  3ERY A;  5C07 A;  4V3D B;  1MI5 A;  3ROL A;  5C0C A;  1ZT7 A;  3L3I A;  3SDA A;  3LKR A;  4PRN A;  3QUX A;  3GSQ A;  1S7R A;  3TBS A;  3C8K A;  3MRM A;  1I1F A;  1WBY A;  2CLV A;  4PGC A;  3P9M A;  1I4F A;  3I6G A;  5HGD A;  5ACZ A;  1T7W A;  3FQR A;  5MER A;  3PAB A;  1KJM A;  3D18 A;  3BGM A;  3KLA A;  1QVO A;  5B38 A;  3PWN A;  4WDI A;  5IND A;  4WW2 C;  1FZK A;  3HG1 A;  1DDH A;  4ZFZ A;  2BNR A;  1JPF A;  3O3D A;  4PG9 A;  2AV7 A;  3RL1 A;  4G43 A;  3X13 A;  1E28 A;  3BW9 A;  4QRU A;  5E8O A;  5C0D A;  3X14 A;  4U1K A;  3TBY A;  5HYJ A;  1JHT A;  4L9L C;  3VFW A;  3SPV A;  3VFP A;  3VWK A;  1HOC A;  4U1S A;  4WJ5 A;  3HUJ A;  5IB5 A;  1IM3 A;  2J8U A;  3L3K A;  1ZT1 A;  4FFE X;  1P1Z A;  5IVX A;  5D7L A;  1QSF A;  2YPK A;  4JFF A;  4PDC E;  5IB3 A;  1AGE A;  3MRE A;  2YEZ A;  2VLR A;  3QZW A;  5E8P A;  3KPN A;  3WLB A;  3NFN A;  3MRO A;  1BII A;  3JTT A;  1IM9 A;  5HHQ A;  1FZJ A;  4LNR A;  3KPR A;  3V5K A;  3CH1 A;  2CLZ A;  1S7Q A;  4HKJ A;  5F9J A;  4X6D A;  1SYS A;  3DX7 A;  5F1N A;  3LN4 A;  3VFT A;  3VFV A;  3MYJ A;  1B0R A;  3ILP A;  3LKN A;  4NSK A;  3VFU A;  4PJG A;  3TPU E;  4ZUU A;  1S9W A;  3GSW A;  1I7T A;  3OXS A;  4I4W A;  3BP4 A;  4JFD A;  2FZ3 A;  3CVH A;  3MRJ A;  5SWZ A;  4ZAK A;  1DUZ A;  4L4V A;  5IB2 A;  3BEV A;  3MV8 A;  2BVQ A;  3LKO A;  1HSA A;  4N0F A;  3FOL A;  4D0D A;  1S7T A;  3T1F A;  4NO2 A;  3MRQ A;  3RZC A;  1S9X A;  4JFP A;  3FT2 A;  1GZQ A;  1LK2 A;  2PYE A;  4L3E A;  3KPQ A;  5F1I A;  3MRH A;  2GIT A;  2BNQ A;  1I7U A;  4G59 A;  5J6H A;  4U6Y A;  2VAA A;  4HS3 A;  1Z5L A;  3QDM A;  5DDH A;  1A9B A;  5FA4 A;  4K7F A;  3VXN A;  3E3Q A;  3E6F A;  4PJA A;  3W0W A;  1AO7 A;  4MXQ A;  4N5E A;  3SCM A;  1LEG A;  3BHB A;  3GSU A;  5D2L A;  1T22 A;  1T21 A;  1DE4 A;  4HUX A;  4N0U A;  1K8D A;  3RWF A;  1UXS A;  3KXF A;  3TVM A;  4E5X A;  3MRR A;  3VRJ A;  1CG9 A;  3TFK A;  5C0J A;  5FDW A;  5IEH A;  1A1N A;  3PWP A;  1ZS8 A;  1RJZ A;  4X6C A;  3DX8 A;  3KWW A;  5IB4 A;  4E0R A;  1BD2 A;  1ZHB A;  4S0U C;  3RWI A;  4XXC A;  5MEN A;  3VCL A;  4JFE A;  3QUZ A;  1ZHN A;  4Y4F A;  1LD9 A;  1WBX A;  3TA3 A;  1W72 A;  3LKS A;  1S7W A;  2OL3 H;  2VLL A;  3DXA A;  1G6R H;  3JVG A;  3P9L A;  2XPG A;  3HE6 A;  3P77 A;  1L8J A;  3ARF A;  3MV9 A;  2BSR A;  1KJ2 H;  4JRY A;  1S9Y A;  4NHU E;  4Z76 A;  1EFX A;  1W0V A;  3CCH A;  5D2N A;  3ARB A;  1ZSD A;  1N5A A;  2MHA A;  3BUY A;  3L3G A;  1B3J A;  1QO3 A;  3X12 A;  4PJD A;  4PGD A;  3TN0 A;  1FFN A;  1R3H A;  2ZOK A;  4HWZ A;  4HUU A;  3VFM A;  3QUL A;  5E9D A;  1U58 A;  3O4L A;  5DEG A;  1I1Y A;  4PJ8 A;  4PRI A;  3PWV A;  1ZHL A;  1HHH A;  2ZOL A;  4CW1 A;  3MV7 A;  1T20 A;  1N3N A;  1JE6 A;  3O3E A;  3UBX A;  2FIK A;  3BP7 A;  4NO3 A;  1EXU A;  1A6Z A;  1A1O A;  3P4M A;  3P73 A;  2ZSV A;  2V2W A;  2X4T A;  3GJF A;  5EU3 A;  5C0F A;  1MHE A;  3HAE A;  2PO6 A;  3SKO A;  4MVB A;  3LKQ A;  3MRG A;  5FKP A;  2GJ6 A;  3MR9 A;  3AM8 A;  3D3V A;  3REW A;  1KBG H;  1OF2 A;  3VWJ A;  4JQX A;  1HYR C;  4G42 A;  1DUY A;  4MNG A;  3RWE A;  4F7E A;  4WUU A;  1B0G A;  5L2J A;  3X11 A;  4G9F A;  4PR5 A;  3QDG A;  1T7Y A;  4F7C A;  3IT8 D;  3QEQ A;  1HHK A;  1GZP A;  1KJV A;  2E7L E;  5MEQ A;  2AKR A;  3GMR A;  3TZV C;  1HHI A;  3VFO A;  3ROO A;  5HHM A;  3O3A A;  4ELM A;  1FO0 H;  3GSO A;  3ILQ C;  4ZUV A;  3MRK A;  4MQ7 A;  1FZO A;  4U1L A;  1YDP A;  3RTQ A;  3FQX A;  4PJ7 A;  4LCW A;  3VXP A;  3GMN A;  3MRC A;  5GSV A;  2GAZ A;  1HSB A;  1KPU A;  5HHN A;  4F7P A;  4PJB A;  3BZF A;  1AGB A;  5IM7 A;  4PRH A;  4L8B A;  1ZHK A;  2JCC A;  3GSN H;  4NQE A;  4O2F A;  3QQ4 A;  4ZUT A;  3KYN A;  1T0M A;  3VXS A;  1T1Y A;  2BVO A;  3TID A;  5ISZ A;  4V3E B;  1WBZ A;  5E6I C;  3HLA A;  3MRB A;  1LEK A;  3MRP A;  4CVX A;  3B3I A;  5D9S A;  2X4S A;  1NAN H;  3KPO A;  2BST A;  3V5H A;  3DX6 A;  3TO2 A;  3ARE A;  4MJI A;  2HLA A;  2HN7 A;  1QR1 A;  1KTL A;  2CKB H;  4CVZ A;  5F7D A;  3P4O A;  4QRQ A;  3RWJ A;  4LHU A;  5H94 A;  1OGT A;  4HX1 A;  4K71 B;  3CDG A;  3UTS A;  4N8V A;  4NQV A;  3D39 A;  1BZ9 A;  1TVH A;  4F7T A;  2ESV A;  4L8D A;  3RWH A;  1RJY A;  3I6L D;  4IIQ C;  1N59 A;  1S7S A;  3KYO A;  4PJF A;  5HGB A;  4PRP A;  1XH3 A;  3GSX A;  1S7X A;  1I7R A;  3B6S A;  1NEZ A;  1JGD A;  2GTZ A;  1HHJ A;  1KPV A;  1QEW A;  1TVB A;  4L8S C;  3WL9 A;  2FO4 A;  3QDJ A;  3SKM A;  2NX5 A;  5GSR A;  4NQD A;  2BSS A;  3RUG A;  1T80 A;  1NAM H;  3VH8 A;  4FTV A;  2X4P A;  1P4L A;  2AK4 A;  3BH9 A;  3E6H A;  3O8X A;  5EU4 A;  2GT9 A;  3PQY A;  1ONQ A;  2CII A;  2AXG A;  2GUO A;  3PWU A;  4G8I A;  3H7B A;  3VXU A;  3FTG A;  3KPM A;  4U1N A;  4D0C A;  4PGE A;  4IHO A;  3JTS A;  5EO0 A;  5L2K A;  4NQX A;  1YN6 A;  1QQD A;  4WU5 A;  3L3D A;  5HGA A;  3TBW A;  5SWQ A;  4MJ6 A;  4QOK A;  2OI9 A;  3G08 A;  4PJE A;  5HGH A;  4JFQ A;  4ZUS A;  1M6O A;  2X4R A;  3L3H A;  4HV8 A;  1VAD A;  5C0E A;  5E00 A;  3RWD A;  1A9E A;  2WY3 A;  3TO4 A;  1TMC A;  2X4O A;  5C0A A;  4GKS A;  1INQ A;  1YPZ A;  1AGC A;  4QRT A;  2HJK A;  3WS6 A;  1RK0 A;  3FT3 A;  1PQZ A;  2VLJ A;  4U1M A;  1T1Z A;  5C0B A;  2BVP A;  3QI9 A;  4F7M A;  3BVN A;  3BWA A;  5EOT A;  3TBV A;  4JRX A;  3UPR A;  2CIK A;  3RGV C;  3ARG A;  1ED3 A;  3GSV A;  4Y4K A;  2GTW A;  3D25 A;  2FWO A;  3HPJ A;  1KPR A;  3SJV A;  3MRN A;  1JGE A;  2CLR A;  3MA7 A;  1N2R A;  2DYP A;  3RWG A;  3HCV A;  1EEY A;  2H6P A;  1ZAG A;  4EUP A;  1MWA H;  3ECB A;  2C7U A;  3GML A;  4PRB A;  4Z77 A;  3BO8 A;  2RFX A;  2F54 A;  3DMM A;  3H9S A;  5EU5 A;  1AGF A;  1G7Q A;  3D2U A;  2X4Q A;  3GMP A;  3MRD A;  4APQ A;  5EO1 A;  1FZM A;  3M17 A;  4NNY A;  2ZSW A;  4U6X A;  1HHG A;  1FG2 A;  4PJ9 A;  4Z78 A;  5DEF A;  1XR9 A;  1KJ3 H;  1YN7 A;  2D31 A;  3KPL A;  3RL2 A;  3BXN A;  3PWL A;  3H9H A;  4NO5 A;  5IRO A;  4PJ5 A;  4U1J A;  3GIV A;  5SWS A;  3I6K A;  4MJ5 A;  5D5M A;  4HUW A;  4QRR A;  3SDD A;  4L4T A;  1M05 A;  3QUY A;  3LV3 A;  1SYV A;  1EEZ A;  2X4N A;  3JTC A;  5BRZ A;  3FRU A;  3DTX A;  5C0G A;  2A83 A;  3GMQ A;  4WO4 A;  1JFM A;  1G7P A;  1KCG C;  1FFO A;  1ZVS A;  3DBX A;  3FT4 A;  4PRA A;  1Q94 A;  3FON A;  1S8D A;  4U1H A;  4WWK C;  3FQU A;  4PJI A;  4QRP A;  1UXW A;  1QSE A;  3GMM A;  3BH8 A;  4LCY A;  5MEO A;  4L8C A;  4EI5 A;  1OSZ A;  3TIE A;  1BQH A;  1VGK A;  1C16 A;  5FA3 A;  3E2H A;  1T1W A;  4X6F A;  1QRN A;  3UTT A;  1XZ0 A;  3LKP A;  4MNQ A;  2F53 A;  4U1I A;  1MHC A;  2V2X A;  4JFO A;  3KPP A;  5EUO A;  1OGA A;  4O2E A;  4PRD A;  4UQ3 A;  3RWC A;  5BS0 A;  4ZUW A;  3UTQ A;  3VJ6 A;  3FFC A;  1QLF A;  4ONO A;  3T8X A;  3FQN A;  2VAB A;  4L29 A;  2AXF A;  4NO0 A;  4L3C A;  3FOM A;  3VRI A;  2Q7Y A;  4MX7 A;  3S6C A;  1P7Q A;  1T1X A;  4Y2D A;  4Y4H A;  3WS3 A;  4WU7 A;  4PGB A;  5BJT A;  5B39 A;  3W39 A;  3VFS A;  4G9D A;  3LN5 A;  5AD0 A;  3VXO A;  1JPG A;  5J6G A;  4GKN A;  5J1A A;  3BZE A;  3O9W A;  4PJH A;  1CD1 A;  5C0I A;  5MEP A;  1T0N A;  1AKJ A;  3OX8 A;  2HJL A;  4MS8 A;  3FQT A;  1S7U A;  5D7I A;  5ENW A;  2UWE A;  4EN3 C;  3TF7 A;  5E8N A;  3CC5 A;  3SDC A;  4PV8 A;  2VE6 A;  3VXR A;  3C9N A;  3GMO A;  2P5E A;  5EFI A;  1JUF A;  4Y16 A;  3MRF A;  1FFP A;  3CPL A;  3FQW A;  4PP8 C;  3PWJ A;  3MRL A;  5BXF A;  3MGO A;  3SDX A;  3ES6 A;  3O3B A;  1S7V A;  2FYY A;  4UQ2 A;  2H26 A;  3QUK A;  1JF1 A;  3VFR A;  4O2C A;  4JQV A;  3QFJ A;  5HHO A;  4GUP A;  4IRS A;  1T7X A;  4PJX A;  5INC A;  3QFD A;  5EU6 A;  2X4U A; 
#chains in the Genus database with same CATH topology
 1E27 A;  3P4N A;  4PJC A;  5JHD A;  2NW3 A;  1LDP H;  3QQ3 A;  4I48 A;  3TJH A;  1T7Z A;  1VAC A;  5IEK A;  4X6E A;  5D7J C;  4PV9 A;  3M1B A;  2VLK A;  1K5N A;  4N0C A;  5C09 A;  3OV6 A;  5C08 A;  1XR8 A;  4PG2 A;  1RK1 A;  1T7V A;  4LCC C;  3BEW A;  3GSR A;  1W0W A;  4IRJ A;  4PRE A;  2YPL A;  1I1A A;  3AU1 A;  3MGT A;  2XFX A;  4NNX A;  3VXM A;  3U0P A;  3HE7 A;  1LP9 A;  3OXR A;  4G8G A;  3IXA A;  1LQV A;  2F74 A;  1UQS A;  2BCK A;  3CZF A;  2X70 A;  3L3J A;  3KPS A;  1AGD A;  5IB1 A;  3WUW A;  4HUV A;  4NT6 A;  5C9J A;  4D0B A;  3ARD A;  4QRS A;  3MRI A;  1ZT4 A;  1X7Q A;  3L9R A;  4NQC A;  3VFN A;  2P5W A;  2AV1 A;  1CE6 A;  3TBT A;  3V5D A;  5HHP A;  1A1M A;  3ERY A;  5C07 A;  4V3D B;  1MI5 A;  3ROL A;  5C0C A;  1ZT7 A;  3L3I A;  3SDA A;  3LKR A;  4PRN A;  3QUX A;  3GSQ A;  1S7R A;  3TBS A;  3C8K A;  3MRM A;  1I1F A;  1WBY A;  2CLV A;  4PGC A;  3P9M A;  1I4F A;  2O5N A;  3I6G A;  5HGD A;  5ACZ A;  1T7W A;  3FQR A;  5MER A;  3PAB A;  1KJM A;  3D18 A;  3BGM A;  3KLA A;  1QVO A;  5B38 A;  3PWN A;  4WDI A;  5IND A;  4WW2 C;  1FZK A;  3HG1 A;  1DDH A;  4ZFZ A;  2BNR A;  1JPF A;  3O3D A;  4PG9 A;  2AV7 A;  3RL1 A;  4G43 A;  3X13 A;  1E28 A;  3BW9 A;  4QRU A;  5E8O A;  5C0D A;  3X14 A;  4U1K A;  3TBY A;  5HYJ A;  1JHT A;  4L9L C;  3VFW A;  3SPV A;  3VFP A;  3VWK A;  1HOC A;  4U1S A;  4WJ5 A;  3HUJ A;  5IB5 A;  1IM3 A;  2J8U A;  3L3K A;  1ZT1 A;  4FFE X;  1P1Z A;  5IVX A;  5D7L A;  1QSF A;  2YPK A;  4JFF A;  4PDC E;  5IB3 A;  1AGE A;  3MRE A;  2YEZ A;  2VLR A;  3QZW A;  5E8P A;  3KPN A;  3WLB A;  3NFN A;  3MRO A;  1BII A;  3JTT A;  1IM9 A;  5HHQ A;  1FZJ A;  4LNR A;  3KPR A;  3V5K A;  3CH1 A;  2CLZ A;  1S7Q A;  4HKJ A;  5F9J A;  4X6D A;  1SYS A;  3DX7 A;  5F1N A;  3LN4 A;  3VFT A;  3VFV A;  3MYJ A;  1B0R A;  3ILP A;  3LKN A;  4NSK A;  3VFU A;  4PJG A;  3TPU E;  4ZUU A;  1S9W A;  3GSW A;  1I7T A;  3OXS A;  4I4W A;  3BP4 A;  4JFD A;  2FZ3 A;  3CVH A;  3MRJ A;  5SWZ A;  4ZAK A;  1DUZ A;  4L4V A;  5IB2 A;  3BEV A;  3MV8 A;  2BVQ A;  3LKO A;  1HSA A;  4N0F A;  3FOL A;  4D0D A;  1S7T A;  3T1F A;  4NO2 A;  3MRQ A;  3RZC A;  1S9X A;  4JFP A;  3FT2 A;  1GZQ A;  1LK2 A;  2PYE A;  4L3E A;  3KPQ A;  5F1I A;  3MRH A;  2GIT A;  2BNQ A;  1I7U A;  4G59 A;  5J6H A;  4G59 C;  2VAA A;  4U6Y A;  4HS3 A;  1Z5L A;  3QDM A;  5DDH A;  1A9B A;  5FA4 A;  4K7F A;  3VXN A;  3E3Q A;  3E6F A;  4PJA A;  3W0W A;  1AO7 A;  4MXQ A;  4N5E A;  3SCM A;  1LEG A;  3BHB A;  3GSU A;  5D2L A;  1T22 A;  1T21 A;  1DE4 A;  4HUX A;  4N0U A;  1K8D A;  3RWF A;  1UXS A;  3KXF A;  3TVM A;  4E5X A;  3MRR A;  3VRJ A;  1CG9 A;  3TFK A;  5C0J A;  5FDW A;  2IA1 A;  5IEH A;  1A1N A;  3PWP A;  1ZS8 A;  1RJZ A;  4X6C A;  3DX8 A;  3KWW A;  5IB4 A;  4E0R A;  1BD2 A;  1ZHB A;  4S0U C;  3RWI A;  4XXC A;  5MEN A;  3VCL A;  4JFE A;  3QUZ A;  1ZHN A;  4Y4F A;  1LD9 A;  1WBX A;  3TA3 A;  1W72 A;  3LKS A;  1S7W A;  2OL3 H;  2VLL A;  3DXA A;  1G6R H;  3JVG A;  3P9L A;  2XPG A;  3HE6 A;  3P77 A;  1L8J A;  3ARF A;  3MV9 A;  2BSR A;  1KJ2 H;  4JRY A;  1S9Y A;  4NHU E;  4Z76 A;  1EFX A;  1W0V A;  3CCH A;  5D2N A;  3ARB A;  1ZSD A;  1N5A A;  2MHA A;  3BUY A;  3L3G A;  1B3J A;  1QO3 A;  3X12 A;  4PJD A;  4PGD A;  3TN0 A;  1FFN A;  1R3H A;  2ZOK A;  4HWZ A;  4HUU A;  3VFM A;  3QUL A;  5E9D A;  1U58 A;  3O4L A;  5DEG A;  1I1Y A;  4PJ8 A;  4PRI A;  3PWV A;  1ZHL A;  1HHH A;  2ZOL A;  4CW1 A;  3MV7 A;  1T20 A;  1N3N A;  1JE6 A;  3O3E A;  3UBX A;  2FIK A;  3BP7 A;  4NO3 A;  1EXU A;  1A6Z A;  1A1O A;  3P4M A;  3P73 A;  2ZSV A;  2V2W A;  2X4T A;  3GJF A;  5EU3 A;  5C0F A;  1MHE A;  3HAE A;  2PO6 A;  3SKO A;  4MVB A;  3LKQ A;  3MRG A;  5FKP A;  2GJ6 A;  3MR9 A;  3AM8 A;  3D3V A;  3REW A;  1KBG H;  1OF2 A;  3VWJ A;  4JQX A;  1HYR C;  4G42 A;  1DUY A;  4MNG A;  3RWE A;  4F7E A;  4WUU A;  1B0G A;  5L2J A;  3X11 A;  4G9F A;  4PR5 A;  3QDG A;  1T7Y A;  4F7C A;  3IT8 D;  3QEQ A;  1HHK A;  1GZP A;  1KJV A;  2E7L E;  5MEQ A;  2AKR A;  3GMR A;  3TZV C;  1HHI A;  3VFO A;  3ROO A;  5HHM A;  3O3A A;  4ELM A;  1FO0 H;  3GSO A;  3ILQ C;  2NYK A;  4ZUV A;  3MRK A;  4MQ7 A;  1FZO A;  4U1L A;  1YDP A;  3RTQ A;  3FQX A;  4PJ7 A;  4LCW A;  3VXP A;  3GMN A;  3MRC A;  5GSV A;  2GAZ A;  1HSB A;  1KPU A;  5HHN A;  4F7P A;  4PJB A;  3BZF A;  1AGB A;  5IM7 A;  4PRH A;  4L8B A;  1ZHK A;  2JCC A;  3GSN H;  4NQE A;  4O2F A;  3QQ4 A;  4ZUT A;  3KYN A;  1T0M A;  3VXS A;  1T1Y A;  2BVO A;  3TID A;  5ISZ A;  4V3E B;  1WBZ A;  5E6I C;  3HLA A;  3MRB A;  1LEK A;  3MRP A;  4CVX A;  3B3I A;  5D9S A;  2X4S A;  1NAN H;  3KPO A;  2BST A;  3V5H A;  3DX6 A;  3TO2 A;  3ARE A;  4MJI A;  2HLA A;  2HN7 A;  1QR1 A;  1KTL A;  2CKB H;  4CVZ A;  5F7D A;  3P4O A;  4QRQ A;  3RWJ A;  4LHU A;  5H94 A;  1OGT A;  4HX1 A;  4K71 B;  3CDG A;  3UTS A;  4N8V A;  4NQV A;  3D39 A;  1BZ9 A;  4JO8 A;  1TVH A;  4F7T A;  2ESV A;  4L8D A;  3RWH A;  1RJY A;  3I6L D;  4IIQ C;  1N59 A;  1S7S A;  3KYO A;  4PJF A;  5HGB A;  4PRP A;  1XH3 A;  3GSX A;  1S7X A;  1I7R A;  3B6S A;  1NEZ A;  1JGD A;  2GTZ A;  1HHJ A;  1KPV A;  1QEW A;  1TVB A;  4L8S C;  3WL9 A;  2FO4 A;  3QDJ A;  3SKM A;  2NX5 A;  5GSR A;  4NQD A;  2BSS A;  3RUG A;  1T80 A;  1NAM H;  3VH8 A;  4FTV A;  2X4P A;  1P4L A;  2AK4 A;  3BH9 A;  3E6H A;  3O8X A;  5EU4 A;  2GT9 A;  3PQY A;  1ONQ A;  2CII A;  2AXG A;  2GUO A;  3PWU A;  4G8I A;  3H7B A;  3VXU A;  3FTG A;  3KPM A;  4U1N A;  4D0C A;  4PGE A;  4IHO A;  3JTS A;  5EO0 A;  5L2K A;  4NQX A;  1YN6 A;  1QQD A;  4WU5 A;  3L3D A;  5HGA A;  3TBW A;  5SWQ A;  4MJ6 A;  4QOK A;  2OI9 A;  3G08 A;  4PJE A;  5HGH A;  4JFQ A;  4ZUS A;  1M6O A;  2X4R A;  3L3H A;  4HV8 A;  1VAD A;  5C0E A;  5E00 A;  3RWD A;  1A9E A;  2WY3 A;  3TO4 A;  1TMC A;  2X4O A;  5C0A A;  4GKS A;  1INQ A;  1YPZ A;  1AGC A;  4QRT A;  2HJK A;  3WS6 A;  1RK0 A;  3FT3 A;  1PQZ A;  2VLJ A;  4U1M A;  1T1Z A;  5C0B A;  2BVP A;  3QI9 A;  4F7M A;  3BVN A;  3BWA A;  5EOT A;  3TBV A;  4JRX A;  3UPR A;  2CIK A;  3RGV C;  3ARG A;  1ED3 A;  3GSV A;  4Y4K A;  2GTW A;  3D25 A;  2FWO A;  3HPJ A;  1KPR A;  3SJV A;  3MRN A;  1JGE A;  2CLR A;  3MA7 A;  1N2R A;  2DYP A;  3RWG A;  3HCV A;  1EEY A;  2H6P A;  1ZAG A;  4EUP A;  1MWA H;  3ECB A;  2C7U A;  3GML A;  4PRB A;  4Z77 A;  3BO8 A;  2RFX A;  2F54 A;  3DMM A;  3H9S A;  5EU5 A;  1AGF A;  1G7Q A;  3D2U A;  2X4Q A;  3GMP A;  3MRD A;  4APQ A;  5EO1 A;  1FZM A;  3M17 A;  4NNY A;  2ZSW A;  4U6X A;  1HHG A;  1FG2 A;  4PJ9 A;  3I0T A;  4Z78 A;  5DEF A;  1XR9 A;  1KJ3 H;  1YN7 A;  2D31 A;  3KPL A;  3RL2 A;  3BXN A;  3PWL A;  3H9H A;  4NO5 A;  5IRO A;  4PJ5 A;  4U1J A;  3GIV A;  5SWS A;  3I6K A;  4MJ5 A;  5D5M A;  4HUW A;  4QRR A;  3SDD A;  4L4T A;  1M05 A;  3QUY A;  3LV3 A;  1SYV A;  1EEZ A;  2X4N A;  3JTC A;  5BRZ A;  3FRU A;  3DTX A;  5C0G A;  2A83 A;  3GMQ A;  4WO4 A;  1JFM A;  1G7P A;  1KCG C;  1FFO A;  1ZVS A;  3DBX A;  3FT4 A;  4PRA A;  1Q94 A;  3FON A;  1S8D A;  4U1H A;  4WWK C;  3FQU A;  4PJI A;  4QRP A;  1UXW A;  1QSE A;  3GMM A;  3BH8 A;  4LCY A;  5MEO A;  4L8C A;  4EI5 A;  1OSZ A;  3TIE A;  1BQH A;  4BKW A;  1VGK A;  1C16 A;  5FA3 A;  3E2H A;  1T1W A;  4X6F A;  1QRN A;  3UTT A;  1XZ0 A;  3LKP A;  4MNQ A;  2F53 A;  4U1I A;  1MHC A;  2V2X A;  4JFO A;  3KPP A;  5EUO A;  1OGA A;  4O2E A;  4PRD A;  4UQ3 A;  3RWC A;  5BS0 A;  4ZUW A;  3UTQ A;  3VJ6 A;  3FFC A;  1QLF A;  4ONO A;  3T8X A;  3FQN A;  2VAB A;  4L29 A;  2AXF A;  4NO0 A;  4L3C A;  3FOM A;  3VRI A;  2Q7Y A;  4MX7 A;  3S6C A;  1P7Q A;  1T1X A;  4Y2D A;  4Y4H A;  3WS3 A;  4WU7 A;  4PGB A;  5BJT A;  5B39 A;  3W39 A;  3VFS A;  4G9D A;  3LN5 A;  5AD0 A;  3VXO A;  1JPG A;  5J6G A;  4GKN A;  5J1A A;  3BZE A;  3O9W A;  4PJH A;  1CD1 A;  5C0I A;  5MEP A;  1T0N A;  1AKJ A;  3OX8 A;  2HJL A;  4MS8 A;  3FQT A;  1S7U A;  5D7I A;  5ENW A;  2UWE A;  4EN3 C;  3TF7 A;  5E8N A;  3CC5 A;  3SDC A;  4PV8 A;  2VE6 A;  3VXR A;  3C9N A;  3GMO A;  2P5E A;  5EFI A;  1JUF A;  4Y16 A;  3MRF A;  1FFP A;  3CPL A;  3FQW A;  4PP8 C;  3PWJ A;  3MRL A;  5BXF A;  3MGO A;  3SDX A;  3ES6 A;  3O3B A;  1S7V A;  2FYY A;  4UQ2 A;  2H26 A;  3QUK A;  1JF1 A;  3VFR A;  4O2C A;  4JQV A;  3QFJ A;  5HHO A;  4GUP A;  4IRS A;  1T7X A;  4PJX A;  5INC A;  3QFD A;  5EU6 A;  2X4U A; 
#chains in the Genus database with same CATH homology
 1E27 A;  3P4N A;  4PJC A;  5JHD A;  2NW3 A;  1LDP H;  3QQ3 A;  4I48 A;  3TJH A;  1T7Z A;  1VAC A;  5IEK A;  4X6E A;  5D7J C;  4PV9 A;  3M1B A;  2VLK A;  1K5N A;  4N0C A;  5C09 A;  3OV6 A;  5C08 A;  1XR8 A;  4PG2 A;  1RK1 A;  1T7V A;  4LCC C;  3BEW A;  3GSR A;  1W0W A;  4IRJ A;  4PRE A;  2YPL A;  1I1A A;  3AU1 A;  3MGT A;  2XFX A;  4NNX A;  3VXM A;  3U0P A;  3HE7 A;  1LP9 A;  3OXR A;  4G8G A;  3IXA A;  1LQV A;  2F74 A;  1UQS A;  2BCK A;  3CZF A;  2X70 A;  3L3J A;  3KPS A;  1AGD A;  5IB1 A;  3WUW A;  4HUV A;  4NT6 A;  5C9J A;  4D0B A;  3ARD A;  4QRS A;  3MRI A;  1ZT4 A;  1X7Q A;  3L9R A;  4NQC A;  3VFN A;  2P5W A;  2AV1 A;  1CE6 A;  3TBT A;  3V5D A;  5HHP A;  1A1M A;  3ERY A;  5C07 A;  4V3D B;  1MI5 A;  3ROL A;  5C0C A;  1ZT7 A;  3L3I A;  3SDA A;  3LKR A;  4PRN A;  3QUX A;  3GSQ A;  1S7R A;  3TBS A;  3C8K A;  3MRM A;  1I1F A;  1WBY A;  2CLV A;  4PGC A;  3P9M A;  1I4F A;  3I6G A;  5HGD A;  5ACZ A;  1T7W A;  3FQR A;  5MER A;  3PAB A;  1KJM A;  3D18 A;  3BGM A;  3KLA A;  1QVO A;  5B38 A;  3PWN A;  4WDI A;  5IND A;  4WW2 C;  1FZK A;  3HG1 A;  1DDH A;  4ZFZ A;  2BNR A;  1JPF A;  3O3D A;  4PG9 A;  2AV7 A;  3RL1 A;  4G43 A;  3X13 A;  1E28 A;  3BW9 A;  4QRU A;  5E8O A;  5C0D A;  3X14 A;  4U1K A;  3TBY A;  5HYJ A;  1JHT A;  4L9L C;  3VFW A;  3SPV A;  3VFP A;  3VWK A;  1HOC A;  4U1S A;  4WJ5 A;  3HUJ A;  5IB5 A;  1IM3 A;  2J8U A;  3L3K A;  1ZT1 A;  4FFE X;  1P1Z A;  5IVX A;  5D7L A;  1QSF A;  2YPK A;  4JFF A;  4PDC E;  5IB3 A;  1AGE A;  3MRE A;  2YEZ A;  2VLR A;  3QZW A;  5E8P A;  3KPN A;  3WLB A;  3NFN A;  3MRO A;  1BII A;  3JTT A;  1IM9 A;  5HHQ A;  1FZJ A;  4LNR A;  3KPR A;  3V5K A;  3CH1 A;  2CLZ A;  1S7Q A;  4HKJ A;  5F9J A;  4X6D A;  1SYS A;  3DX7 A;  5F1N A;  3LN4 A;  3VFT A;  3VFV A;  3MYJ A;  1B0R A;  3ILP A;  3LKN A;  4NSK A;  3VFU A;  4PJG A;  3TPU E;  4ZUU A;  1S9W A;  3GSW A;  1I7T A;  3OXS A;  4I4W A;  3BP4 A;  4JFD A;  2FZ3 A;  3CVH A;  3MRJ A;  5SWZ A;  4ZAK A;  1DUZ A;  4L4V A;  5IB2 A;  3BEV A;  3MV8 A;  2BVQ A;  3LKO A;  1HSA A;  4N0F A;  3FOL A;  4D0D A;  1S7T A;  3T1F A;  4NO2 A;  3MRQ A;  3RZC A;  1S9X A;  4JFP A;  3FT2 A;  1GZQ A;  1LK2 A;  2PYE A;  4L3E A;  3KPQ A;  5F1I A;  3MRH A;  2GIT A;  2BNQ A;  1I7U A;  4G59 A;  5J6H A;  4U6Y A;  2VAA A;  4HS3 A;  1Z5L A;  3QDM A;  5DDH A;  1A9B A;  5FA4 A;  4K7F A;  3VXN A;  3E3Q A;  3E6F A;  4PJA A;  3W0W A;  1AO7 A;  4MXQ A;  4N5E A;  3SCM A;  1LEG A;  3BHB A;  3GSU A;  5D2L A;  1T22 A;  1T21 A;  1DE4 A;  4HUX A;  4N0U A;  1K8D A;  3RWF A;  1UXS A;  3KXF A;  3TVM A;  4E5X A;  3MRR A;  3VRJ A;  1CG9 A;  3TFK A;  5C0J A;  5FDW A;  5IEH A;  1A1N A;  3PWP A;  1ZS8 A;  1RJZ A;  4X6C A;  3DX8 A;  3KWW A;  5IB4 A;  4E0R A;  1BD2 A;  1ZHB A;  4S0U C;  3RWI A;  4XXC A;  5MEN A;  3VCL A;  4JFE A;  3QUZ A;  1ZHN A;  4Y4F A;  1LD9 A;  1WBX A;  3TA3 A;  1W72 A;  3LKS A;  1S7W A;  2OL3 H;  2VLL A;  3DXA A;  1G6R H;  3JVG A;  3P9L A;  2XPG A;  3HE6 A;  3P77 A;  1L8J A;  3ARF A;  3MV9 A;  2BSR A;  1KJ2 H;  4JRY A;  1S9Y A;  4NHU E;  4Z76 A;  1EFX A;  1W0V A;  3CCH A;  5D2N A;  3ARB A;  1ZSD A;  1N5A A;  2MHA A;  3BUY A;  3L3G A;  1B3J A;  1QO3 A;  3X12 A;  4PJD A;  4PGD A;  3TN0 A;  1FFN A;  1R3H A;  2ZOK A;  4HWZ A;  4HUU A;  3VFM A;  3QUL A;  5E9D A;  1U58 A;  3O4L A;  5DEG A;  1I1Y A;  4PJ8 A;  4PRI A;  3PWV A;  1ZHL A;  1HHH A;  2ZOL A;  4CW1 A;  3MV7 A;  1T20 A;  1N3N A;  1JE6 A;  3O3E A;  3UBX A;  2FIK A;  3BP7 A;  4NO3 A;  1EXU A;  1A6Z A;  1A1O A;  3P4M A;  3P73 A;  2ZSV A;  2V2W A;  2X4T A;  3GJF A;  5EU3 A;  5C0F A;  1MHE A;  3HAE A;  2PO6 A;  3SKO A;  4MVB A;  3LKQ A;  3MRG A;  5FKP A;  2GJ6 A;  3MR9 A;  3AM8 A;  3D3V A;  3REW A;  1KBG H;  1OF2 A;  3VWJ A;  4JQX A;  1HYR C;  4G42 A;  1DUY A;  4MNG A;  3RWE A;  4F7E A;  4WUU A;  1B0G A;  5L2J A;  3X11 A;  4G9F A;  4PR5 A;  3QDG A;  1T7Y A;  4F7C A;  3IT8 D;  3QEQ A;  1HHK A;  1GZP A;  1KJV A;  2E7L E;  5MEQ A;  2AKR A;  3GMR A;  3TZV C;  1HHI A;  3VFO A;  3ROO A;  5HHM A;  3O3A A;  4ELM A;  1FO0 H;  3GSO A;  3ILQ C;  4ZUV A;  3MRK A;  4MQ7 A;  1FZO A;  4U1L A;  1YDP A;  3RTQ A;  3FQX A;  4PJ7 A;  4LCW A;  3VXP A;  3GMN A;  3MRC A;  5GSV A;  2GAZ A;  1HSB A;  1KPU A;  5HHN A;  4F7P A;  4PJB A;  3BZF A;  1AGB A;  5IM7 A;  4PRH A;  4L8B A;  1ZHK A;  2JCC A;  3GSN H;  4NQE A;  4O2F A;  3QQ4 A;  4ZUT A;  3KYN A;  1T0M A;  3VXS A;  1T1Y A;  2BVO A;  3TID A;  5ISZ A;  4V3E B;  1WBZ A;  5E6I C;  3HLA A;  3MRB A;  1LEK A;  3MRP A;  4CVX A;  3B3I A;  5D9S A;  2X4S A;  1NAN H;  3KPO A;  2BST A;  3V5H A;  3DX6 A;  3TO2 A;  3ARE A;  4MJI A;  2HLA A;  2HN7 A;  1QR1 A;  1KTL A;  2CKB H;  4CVZ A;  5F7D A;  3P4O A;  4QRQ A;  3RWJ A;  4LHU A;  5H94 A;  1OGT A;  4HX1 A;  4K71 B;  3CDG A;  3UTS A;  4N8V A;  4NQV A;  3D39 A;  1BZ9 A;  1TVH A;  4F7T A;  2ESV A;  4L8D A;  3RWH A;  1RJY A;  3I6L D;  4IIQ C;  1N59 A;  1S7S A;  3KYO A;  4PJF A;  5HGB A;  4PRP A;  1XH3 A;  3GSX A;  1S7X A;  1I7R A;  3B6S A;  1NEZ A;  1JGD A;  2GTZ A;  1HHJ A;  1KPV A;  1QEW A;  1TVB A;  4L8S C;  3WL9 A;  2FO4 A;  3QDJ A;  3SKM A;  2NX5 A;  5GSR A;  4NQD A;  2BSS A;  3RUG A;  1T80 A;  1NAM H;  3VH8 A;  4FTV A;  2X4P A;  1P4L A;  2AK4 A;  3BH9 A;  3E6H A;  3O8X A;  5EU4 A;  2GT9 A;  3PQY A;  1ONQ A;  2CII A;  2AXG A;  2GUO A;  3PWU A;  4G8I A;  3H7B A;  3VXU A;  3FTG A;  3KPM A;  4U1N A;  4D0C A;  4PGE A;  4IHO A;  3JTS A;  5EO0 A;  5L2K A;  4NQX A;  1YN6 A;  1QQD A;  4WU5 A;  3L3D A;  5HGA A;  3TBW A;  5SWQ A;  4MJ6 A;  4QOK A;  2OI9 A;  3G08 A;  4PJE A;  5HGH A;  4JFQ A;  4ZUS A;  1M6O A;  2X4R A;  3L3H A;  4HV8 A;  1VAD A;  5C0E A;  5E00 A;  3RWD A;  1A9E A;  2WY3 A;  3TO4 A;  1TMC A;  2X4O A;  5C0A A;  4GKS A;  1INQ A;  1YPZ A;  1AGC A;  4QRT A;  2HJK A;  3WS6 A;  1RK0 A;  3FT3 A;  1PQZ A;  2VLJ A;  4U1M A;  1T1Z A;  5C0B A;  2BVP A;  3QI9 A;  4F7M A;  3BVN A;  3BWA A;  5EOT A;  3TBV A;  4JRX A;  3UPR A;  2CIK A;  3RGV C;  3ARG A;  1ED3 A;  3GSV A;  4Y4K A;  2GTW A;  3D25 A;  2FWO A;  3HPJ A;  1KPR A;  3SJV A;  3MRN A;  1JGE A;  2CLR A;  3MA7 A;  1N2R A;  2DYP A;  3RWG A;  3HCV A;  1EEY A;  2H6P A;  1ZAG A;  4EUP A;  1MWA H;  3ECB A;  2C7U A;  3GML A;  4PRB A;  4Z77 A;  3BO8 A;  2RFX A;  2F54 A;  3DMM A;  3H9S A;  5EU5 A;  1AGF A;  1G7Q A;  3D2U A;  2X4Q A;  3GMP A;  3MRD A;  4APQ A;  5EO1 A;  1FZM A;  3M17 A;  4NNY A;  2ZSW A;  4U6X A;  1HHG A;  1FG2 A;  4PJ9 A;  4Z78 A;  5DEF A;  1XR9 A;  1KJ3 H;  1YN7 A;  2D31 A;  3KPL A;  3RL2 A;  3BXN A;  3PWL A;  3H9H A;  4NO5 A;  5IRO A;  4PJ5 A;  4U1J A;  3GIV A;  5SWS A;  3I6K A;  4MJ5 A;  5D5M A;  4HUW A;  4QRR A;  3SDD A;  4L4T A;  1M05 A;  3QUY A;  3LV3 A;  1SYV A;  1EEZ A;  2X4N A;  3JTC A;  5BRZ A;  3FRU A;  3DTX A;  5C0G A;  2A83 A;  3GMQ A;  4WO4 A;  1JFM A;  1G7P A;  1KCG C;  1FFO A;  1ZVS A;  3DBX A;  3FT4 A;  4PRA A;  1Q94 A;  3FON A;  1S8D A;  4U1H A;  4WWK C;  3FQU A;  4PJI A;  4QRP A;  1UXW A;  1QSE A;  3GMM A;  3BH8 A;  4LCY A;  5MEO A;  4L8C A;  4EI5 A;  1OSZ A;  3TIE A;  1BQH A;  1VGK A;  1C16 A;  5FA3 A;  3E2H A;  1T1W A;  4X6F A;  1QRN A;  3UTT A;  1XZ0 A;  3LKP A;  4MNQ A;  2F53 A;  4U1I A;  1MHC A;  2V2X A;  4JFO A;  3KPP A;  5EUO A;  1OGA A;  4O2E A;  4PRD A;  4UQ3 A;  3RWC A;  5BS0 A;  4ZUW A;  3UTQ A;  3VJ6 A;  3FFC A;  1QLF A;  4ONO A;  3T8X A;  3FQN A;  2VAB A;  4L29 A;  2AXF A;  4NO0 A;  4L3C A;  3FOM A;  3VRI A;  2Q7Y A;  4MX7 A;  3S6C A;  1P7Q A;  1T1X A;  4Y2D A;  4Y4H A;  3WS3 A;  4WU7 A;  4PGB A;  5BJT A;  5B39 A;  3W39 A;  3VFS A;  4G9D A;  3LN5 A;  5AD0 A;  3VXO A;  1JPG A;  5J6G A;  4GKN A;  5J1A A;  3BZE A;  3O9W A;  4PJH A;  1CD1 A;  5C0I A;  5MEP A;  1T0N A;  1AKJ A;  3OX8 A;  2HJL A;  4MS8 A;  3FQT A;  1S7U A;  5D7I A;  5ENW A;  2UWE A;  4EN3 C;  3TF7 A;  5E8N A;  3CC5 A;  3SDC A;  4PV8 A;  2VE6 A;  3VXR A;  3C9N A;  3GMO A;  2P5E A;  5EFI A;  1JUF A;  4Y16 A;  3MRF A;  1FFP A;  3CPL A;  3FQW A;  4PP8 C;  3PWJ A;  3MRL A;  5BXF A;  3MGO A;  3SDX A;  3ES6 A;  3O3B A;  1S7V A;  2FYY A;  4UQ2 A;  2H26 A;  3QUK A;  1JF1 A;  3VFR A;  4O2C A;  4JQV A;  3QFJ A;  5HHO A;  4GUP A;  4IRS A;  1T7X A;  4PJX A;  5INC A;  3QFD A;  5EU6 A;  2X4U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...