4WDIA

Weak tcr binding to an unstable insulin epitope drives type 1 diabetes
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
277
structure length
277
Chain Sequence
b'MGPHSLRYFVTAVSRPGLGEPRFIAVGYVDDTQFVRFDSDADNPRFEPRAPWMEQEGPEYWEEQTQRAKSDEQWFRVSLRTAQRYYNQSKGGSHTFQRMFGCDVGSDWRLLRGYHQFAYDGRDYIALNEDLKTWTAADTAALITRRKWEQAGDAEYYRAYLEGECVEWLRRYLELGNETLLRTDSPKAHVTYHPRSQVDVTLRCWALGFYPADITLTWQLNGEDLTQDMELVETRPAGDGTFQKWAAVVVPLGKEQNYTCHVHHKGLPEPLTLRWKP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, K-D alpha chain
publication title Distortion of the Major Histocompatibility Complex Class I Binding Groove to Accommodate an Insulin-derived 10-Mer Peptide.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 67
structure length 277
sequence length 277
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4wdiA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4wdiA01
4WO4D 1I4FA 2H26A 3AREB 4TVPD 4KJYA 3DHMA 1LDSA 2NY4D 5B22A 1X5ZA 4BKLB 4LBEA 4RGMB 2HTLD 3EFFA 3N1FC 2W65B 5J1TC 1YEGH 2VZ3A 4XCEA 3I02A 3HA0A 4MXQC 4H20L 1OQXA 3W0WA 4YO0A 1HSAA 4H1LA 2Q1EA 2H32B 1WK0A 4KHTL 3VGFA 5C1MB 1J1OH 1J05A 1EO8H 1JV5A 2F8XC 3WV0A 5DVLA 4EUPG 3HB3C 4L5FH 1A5FL 4CADA 4DOHE 1IM9B 1J10A 3JWOL 3BP4B 3UJIH 1N6QL 1XIWA 2VDRH 3CAFA 4PLJC 4QRSB 3K1DA 4JFDE 1FO0L 1FAIL 3C5ZC 5JOPD 1FLTX 4ODWB 3P0VL 4OD2A 5F21B 2DQFA 3EO0B 4OF7A 4M7ZC 4NSKB 2A6IA 1XR8B 4N0FB 4H1LH 2E9BA 3PWJB 2I9LB 3MRNA 2FGWL 2RR3A 1TJIL 5GRWA 1K3IA 1GGCL 1RZ8B 4C4KO 4KKCD 4DUXA 2OI9C 3FT4A 1HHGA 1Q9WB 5DK2B 3GO1L 4CNIA 3JTSB 3CXDH 1FNEA 4U1GB 2EDYA 1J1XH 2D7MA 1S7QB 1EVUA 1NCDH 3QWOB 4HH8A 4JJHA 4X6DE 5ANMB 3FKUS 4Z76B 2LFGA 1MWAL 5A40E 1MCWW 2ICWA 1MJ7H 5HVGB 4ZFFA 4NQVB 2O5YL 1I3GL 4Q9RH 1C5DA 5D7JA 1U0QA 3TBWB 4XPGL 1JYWA 2OSLB 4Q6IA 3IDMB 3C6SB 4I3SL 4JFOB 5EZOH 1QUNA 1KGCE 2YWZA 5K9KB 3WEXB 1UQSB 1Y6KR 4JO4L 4POZC 2YBRA 2AK1L 2R0KH 2A0LD 4P59L 3R1GL 2NY7H 3NZHL 5C92A 2R4SL 3WL9B 5IUSA 1LD9A 4OJFL 5KG9B 4NUGH 5IB2A 5B8CC 4PJDF 3JBG7 2QKIB 3U46B 1JGVH 4XXDA 4IJ3C 3TV3H 4AJ0A 4X6CA 4X98B 4AEFA 1D7FA 1I9IL 3BT2L 3HMWH 5J12B 3RUGB 1BIIB 2C7UB 4M8VA 4DN4L 1HQ4A 3EDKA 3GJEA 3HRZB 5I17B 15C8L 3C8DA 4D3CH 1RHHA 1YMMD 1DBML 1OM3L 3KPPA 4HIXH 3MLTB 4UT7H 1DDHA 1OAUL 4GW4B 2WBJD 3TNNB 2UV3A 5MENE 5D2NA 5GSRB 5I74B 2H6PB 1KLGA 3QBTB 1QRNE 5JIKA 5IMLB 4M7LL 4DCQB 3MREB 2VZOA 5C6WH 1FC2D 1KJ3L 3QHZL 3TWCH 5I8EB 3TNMB 4EN3B 3BGMA 4MJ5B 2K9UA 1FIGL 2FIKB 3O6ML 3DURB 4PGBB 1CLYH 4OI7A 1X4XA 1U3HC 4Y16A 5GS1A 3FB5B 2EC8A 2UZXB 2DM3A 4PTUB 3QB7C 3NOIA 4NT6B 4EI5B 1NAKL 2V5MA 4HS6B 4ZODA 2XKSA 2E7MA 4U1JA 3KYOA 4LAQH 3UAJD 2IFFH 4HULB 1E4KA 5ERWA 5IVXE 3WFCL 4P5TA 2PXYA 2XNAB 3OKDB 3CDGA 5CBAA 4Y89A 1UZ8A 1B4JL 1NCUA 2DICA 1CT8A 2AW2A 1UH2A 4P9HL 1RZKC 4P3WA 1G1CA 5FOBB 1OVZA 3L6FA 2ARJQ 3P40A 3WIFA 2YXFA 1XZ0B 3HZKB 1NEUA 4K3GA 3MV9A 3ARPA 3IAGC 5I0ZA 1H3PH 5E99L 3RY6A 3KLDA 2AJZB 2E7LC 4NM4H 3FZUD 5EOCL 1MFDH 3VMOA 2C3WA 3I84A 4JZNB 4Y2DB 4DZBA 1KIQB 5DQDL 5JPNB 1V7MH 4M61A 4H5SB 1HHIB 3FTGB 3QPXH 2EIDA 2XT1B 4JQXA 3MXVH 5BRZD 3QWQB 3NBNA 1R3JA 2JKXA 4I3RL 4PJHF 4HPYL 1LVEA 3X11B 2Z93A 1KPRB 1R6VA 1G9MH 4WW1B 4PGCB 5E8NA 4NJAL 1LP9A 2WUCL 3B9EA 2ZCHH 2FJGA 3R06A 4Y19D 1F90L 4KJYB 3DSFL 4O9HH 1JPGA 1SHMA 4XGZA 4Z7VE 5D7LB 1KTDB 5C0FB 2ESVE 1R5VA 4KI5C 2Z92B 4YR6B 4DKAA 3W0WB 5SWSE 2BOBB 4P2OD 3PF2A 4FZ8L 4H1LB 3N1QC 4JGUA 3PHOA 3WE6B 5CIPB 1J05B 3G6JE 2BP3A 3RGVA 4MXVE 3AVEA 1CLZH 4R0LA 3RIAF 3GIVB 4W70A 2HRPH 1VEPA 1G7HB 4TVPE 4F15B 3T08A 4LARL 5BS0A 3QXAB 4PJXB 1U42A 4C59B 1C16B 3U4BL 1NGZB 1MHPL 1KEGL 5D1XA 1NC2A 1QPPA 3OX8A 4PR5A 5CMAA 3MRCA 4OV6F 1D6VH 1A4JA 1J8HD 2B2XH 2VIRA 4NQED 5F9JA 3G5ZB 4QTIH 4G6ML 3DX8B 1AJ7L 4NRYA 4LLMB 2ATKB 5HI4D 4P4KB 3MRNB 3DX9A 4YHML 3WFHA 1LO5A 4BA8A 3RNQA 2YPVH 3QDMD 4LQFH 2R1YB 3O2VH 4U3XA 3LKRB 1I7RB 5I15L 5D1ZB 3C60D 1ACYL 5E8PB 4S1SH 1U8LA 5KSAD 3MUGB 1LWRA 2FDBP 3HLAB 5HGBA 5JOPE 3GSNL 4APQD 3EYVB 3VXTA 3VFWA 2QHLA 3MCKB 1C1EH 1R24A 1CG9B 2HJLB 3F6IA 4H25A 1MI5A 4JCLA 5JXED 3B9KB 4ZFFB 3LOWA 3ZSTA 1EHLH 1I8LC 1YDPB 4LLQB 5I18L 3PP4L 3CPLA 4HKXB 3M8OL 1NGQL 2F54D 5DJ6B 1GVIA 5I1CL 1FV1B 1ZGLA 5D1QC 3O2WL 1S5IL 3D39A 3W11C 1VFOA 3MV7A 1HH6A 1NEZG 4JFQB 1EAPA 4FP8L 4FHBD 5GRXG 2XRAH 4NC1E 1UKTA 1RVFH 4N0YL 1UWXH 5DJZB 1KN4H 2ZUYA 4LRIA 4LLAA 4OLZL 4Z7NE 5DJ0A 5B39B 2AEQH 1SVCP 4PJ8A 1S7SA 3MZTA 4BSVB 5IB2B 4NZUL 5GGVH 3PWUB 5IBLD 4PB9L 1I7UA 3L95A 3BD3A 3UZQA 4Y5XB 4OF3A 4ESKA 2PTTB 3HUJE 1GHFL 2AQ3A 4LSVH 4X9FA 4QRPA 2HFGL 3ARGD 3W39A 5ESVA 2A73A 3EDJA 2HMIC 4HS3A 3GIZH 2HT3D 1J8KA 1QEWA 3CXHK 3DUUB 5F8QC 4BSWA 3D69A 4JM2D 1WCQA 1FYTB 5F1SA 4GMTH 5LCVH 4DOHB 3DPBA 3B2VL 5D2NB 2IANA 3ABZA 3IVKB 2EE9A 1DN0B 1HH9A 4KVCL 3UBXG 4P2RD 1ADQA 1VFBA 3O11A 4PJ7F 1F45A 2XWJA 1EGJH 4S1DC 5IJVB 3BHBA 4S0UC 3GSWB 4IM8A 2VZSA 1YMME 4L4TA 4ZO9A 2GHWB 5IT2H 1U41A 4LCWA 1AKJB 2D31B 4YWGL 4WFFD 4NRXB 1NFDF 3SKOA 4FN0A 1YJDH 3MO1A 3FAWA 3DVGA 2AJUH 1R5IB 4NUJB 3NZ8B 2C3XA 1HI6A 3BVNB 2Q20A 3ZDXF 2ZJSL 2IH1A 2DTML 2NY2D 4G5ZH 3VRLF 4U1JB 4IIQA 4PLKC 4LLDA 3E6HA 3QH3A 2Z8SA 3LEYH 1AO7A 4KKAD 1F4WL 2MCG1 3QUYC 3TN0D 2B4CL 3ZKMD 2BNQB 4NGHH 5ICYA 1CT8B 3QCUL 3OKKB 2NY0D 1T7ZA 3RWHB 5GGSY 1UJ3A 4L8CA 2HVJB 5CJ5A 1Z3GL 4F9LC 5K33A 4WUUA 2LQRA 5F44A 5CSZA 5IVOA 4AEIL 5TF0A 3VFVB 3QRGL 3U0WL 3VXOB 1J11A 4KY1L 1BM3H 2L7UA 1FCGA 1EO5A 1SVZA 5LGJB 4PJFE 4IRSB 5DMIL 5I8CA 3ARWA 2CJUL 4O02L 4D2NA 1T22B 5CWSA 1UXSB 12E8H 1U58B 2VR5A 1QQDA 3T0ED 3V95A 3P0YH 1DVFA 5TFSH 3TT3H 3VWKD 4GAJH 1EEYA 3BH9A 2I9TB 4AMKH 1KIRB 2CMRH 4E0RB 5HHQA 4ODBD 2DKSA 4JZOB 1P4LB 1X5LA 1KJ2A 4HJJL 1RZGA 1G1YA 4LLUA 3L7FB 1T0NA 2VLKD 1U8IA 3VRIA 2HAZA 3PL6C 5BRZE 3NA9H 5I66A 1BWWA 1ND0A 5EA0H 3L1OL 4JFPA 3A0OA 1JCKA 2D7TH 4AIOA 3S37L 2BVOA 4TSCL 3E1F1 1JNLH 2YKLL 4MD5A 4RAHA 4C83A 2AJ3B 2BHYA 1J0YA 4H88L 3TH2T 1OWWA 4Y19E 1T6WA 4MQSB 5JW4Q 3SDAA 1XGRA 5JQ6L 2YD6A 3O8XB 5BS0B 3WIIH 5C7XH 1KJ2H 5J9PB 4U7SA 5BZWA 3VFUB 3LKQA 4R3SB 1NMCB 2FJFA 1UACL 1BGXL 4FFWC 3WJLA 4JG1H 1NC2B 4QRRB 3UDWC 2VIRB 1N3NA 4ZOEA 4DWHA 5I1LA 4MAYD 1HCFX 3UPAA 2D7OA 4WI9A 2OR7A 5I0DA 1CE1H 4LSRH 4Z95H 4IMLA 4ZNEE 2DYPD 5HY9B 5IGXH 2H1PL 1KCVL 5AZEL 2PO6C 3BOVA 3EHBC 3MRRB 1A6ZB 1OY3B 5DJ2A 2M8XA 1F4AA 1JRHI 1OTSC 5IQ7L 2FX9L 4P9MH 5H2BA 1UEMA 4RA3A 2GY5A 4IOFD 1J8HE 4GKNB 3CSPA 1L4IA 4L1DA 4NKOB 4NQEE 2BVPA 4A2LA 3VFWB 1YN6B 2GTWB 4XCYA 2D7QA 5I19H 4H25B 4TN9A 4GRLB 5DC9B 3JSSA 3QA3B 3S34L 4HAFA 5KSVB 3QO1B 2FX7H 2WINB 3T3MF 3QDME 1I7ZB 5EORH 1KUMA 1TJHH 3PDGA 3LSOB 1MSPA 4IDJL 3OAYK 2CDGB 1MAML 3ARZA 2X05A 1EAPB 3GMNA 2GSIA 1EDQA 4MVBA 2UVEA 3RDTA 1XEDA 4JDVB 3DMMD 4Z5RA 1P1ZA 3JV6A 5I2IA 5ICZA 1JZ3A 1JE6A 1WEJH 2F54E 1QFWL 4PTTB 2HT2D 1Y18A 4HIHB 4P4RA 4M1DL 1OTTC 4NYLA 4KTEH 3GI9H 2ESVB 4ORGB 2GKIA 2WK2A 4FQCL 4K3DL 2G60H 3QCVH 4BH7B 3WO4C 5ESVB 3K8LA 3OR7B 4F7CA 3G6JB 1E6JL 2VDLH 4RNRA 4PRBB 1V3LA 2IAMC 3U9PL 5D70H 1YYML 2BY2A 3WNMA 2F8OA 1MIEL 2GJZB 5IB5B 1HH9B 3D9AH 4O4YL 4A6YA 4J8RA 3NN8A 4X8JA 3IDUA 2XWJB 3IFNH 4MDJA 5KSBF 1RIHL 4HS8H 2XZCH 1MRFH 5MI0B 4P5KA 4I2XE 4YPGB 3QHFH 3OG4B 2NY6C 2HYMA 4J3XA 4LCWB 3CGTA 5D5ME 3RNKA 1CVSC 5CGTA 3V6ZB 1NCCL 2EE3A 1PG7H 4D0CA 3JV4B 1PKQE 4NBZB 3WIHA 1JVKA 2D0FA 2PETA 4IBLT 4P2RE 2IF7A 3BRGC 3U0TA 1HNFA 5GS2H 1RZIB 2IH1B 2X1QA 3IS0X 2IQ9L 4KKLC 2R69L 1OAZL 3RTQD 1A0QH 2ZG2A 3ARDD 4O2FA 4GSDL 3MOBL 1HN1A 1W0VB 5KOVC 4WFFE 1ONQA 1N2RA 5ICYB 3LEXA 1XFPA 3WDIA 1A6VL 5C0NC 2P5ED 2Q8AL 1QVOB 4OZ4A 5FYKH 4UDTA 2FWOB 1UJ3B 2J2ZA 3BSZL 4UNTA 1G7MA 3ZYZA 4BQ8A 3ULVH 1EEZB 2VDNH 1I1AA 1LGVA 1SJEB 43C9A 2CDFB 2DWEB 3O0RH 2NNAB 5CSZB 5GRVK 1TMCA 5HHXH 5IOPB 4Y4HA 5L2KB 4I77H 3CVHA 5T1KA 3CFBA 1FFOB 1WTLA 5EUKA 3TJHC 5ESAB 5C0DA 4YXKL 1A6AA 4FQLH 2UZYB 1MVUB 4Q2ZA 2PTVA 2ZPKL 3QZWA 5KVDH 5EZIL 5E8OA 5JNYA 5LWYL 3H42L 3BD4A 3QEUA 1CL7I 5TE6H 3HPLA 4HWEL 3GMOB 3ARBB 2BY3A 4IRJC 3HUJB 2NXZD 3GHEL 5D7KD 5JMRA 1S5HA 3P30L 2E8YA 3EYSH 5CKAA 2CQVA 1KJ2B 2DMBA 3CX5K 4LLUB 4ZG1A 3OKEA 4NN5B 4UQ3A 4QHMA 2DLIA 2AKRB 4XMKH 2YRZA 3CVHH 1WFUA 3T0EE 3U1SH 1LNUB 5IWLC 4PLOB 4KJPD 3DUSB 5I66B 4X7TA 5E6ZA 4JO2H 3ARXA 3MLYL 3P77B 4PS4H 5D7JD 1JZ5A 1LK2A 1GC1H 1FG2A 2VYRE 4G8IA 3STLA 1GPOL 1U6AH 1CDUA 1TVHA 4H1LG 3BP5A 4XB7A 2XA3A 4WW2C 5C0BD 3BYYA 1EO7A 3HE6C 3OJDB 1DQDL 2X4SB 1TPXC 1LO4H 1HYSD 5FHBL 1ZMYA 3AREC 2VLKE 3JUYA 2G75A 5JW5A 1XGYH 5IM7B 4W81A 5M7QA 3MRJB 1T3FA 2LV4A 3C6LD 4H0HB 4L3CA 4RGMC 2O26U 1ZTXL 5AEAA 4HLZH 2YK1L 3PGDA 3QG7L 3ME0A 3KPOA 1ZAGA 1CLOL 1KIPB 4RX4D 5IB4B 4JM4H 1OGTA 3ARYA 2YS4A 1U91B 4XTRD 5H8DA 1K2DA 1DBBH 2GUOB 3V4VL 4ELMF 4EI6A 3CLEH 4MJ6B 1YA5A 3LS5H 5I73B 5MEQA 4Q58C 3LQAC 3MRPB 5E2VH 5DQ9B 1KLUA 3VCLB 4KJWD 4XP5L 2YRLA 5DR5H 1MRCH 3U7YL 2BK8A 5EZJA 2PYFA 1II4E 3NFNA 1FVDB 2KZWA 1IILE 5I1AA 3THML 4ZUVB 4NOBA 5T1DH 3VFPA 3CJJA 4JZJB 4NKIL 4QRTB 4QF1B 4J3UA 4Y5VA 3TZVD 5JW4N 4RAVB 3B43A 3BKJL 4JR9L 3RU8H 1IE5A 5L2JB 1PKOA 1S7TA 5E9DD 2XG5A 4F80A 2EC9T 4PJ5B 3GSRB 4XC1L 2Q6WB 5F3BA 5LVEA 3NCYP 4R4BA 2V7NA 3FRUA 4PJFB 4Y16D 1FRGL 2CR3A 3FT3B 1T2JA 2CLZA 5EBWA 3RY4A 3ULUD 3IDXL 1ZA3A 4JFEB 3BN9C 3WFDL 1EAJA 4WFED 3KNBB 2EDLA 3GMNB 2GSIB 5CEZH 1DQQA 2XYCA 2P45B 2XZAH 1TTGA 4KK8C 4U1GC 2BNUB 3WFEL 2R2HA 5EO1B 2X6MA 4C56B 1P1ZB 1CYGA 2E8ZA 3U0PA 4G8GB 3MOAH 2JJTA 4AH2A 1T21A 4P5TD 3FFDB 2ILLA 3EYOA 4YNYB 5IR1A 2FR4B 4LSTL 5B39G 5TQ0H 3KXFA 5HPOA 4XBEL 4NHCL 4OFIA 1FNHA 1AGEA 5BRZB 2ADIB 5KTEH 2W9LA 3EO9H 1YEHH 4ONHB 4X99A 4Z7OF 2Q8BL 3OHXA 3QIWB 1BFTA 3VFMB 5IV2A 1MREL 2R0WH 4XPAL 5EZLA 3VXRA 1U3ZA 3CSGA 1UCBH 4YHZL 2GTZB 1BQLL 1KNOA 4KU1A 4XPFH 3LDBB 4Y19B 4ODVH 4NZJA 1OP3K 1JTPA 4M62L 3OXRB 4GAYB 1F4HA 3MUHL 1H3TA 3ZE1F 3UTOA 3TFKC 4WI2A 5HYQA 2IH3B 4TVSa 4PV8B 3E3QE 1FO0A 3OKYA 4LVNB 2EXWD 1RU9L 5J12C 4EDWL 1DANU 4KAQH 5D7IA 2JE8A 5FUZH 1H0DB 3L5WA 2GYSA 4ODSL 2NX5A 4I18A 1KTKE 4ODTH 1QLRA 2ZSVB 4FTVB 5FO7A 1X4ZA 4JHWL 4UT9L 4NM8L 5I74C 2ZUWA 5JO5A 1A5FH 1I1YB 3U0TB 3JWOH 4MB3A 1B9ZA 5GISH 3OMZA 4G80B 5IHZB 1J8HB 5DD1H 3DTXB 4NQEB 5HI3C 5EBMA 4PPTA 3T0BA 3P4MA 1HXYA 4HGWA 4LHUA 4EN3C 5KVMC 4TPRL 3BH8B 1XGTB 2HVKA 5T33L 4QHUA 1MWAA 3HNTH 5DUPL 3QDMB 1IGIH 3HC4L 1WC7B 3MMEA 4PJGF 5D1XD 2FGWH 2DRUA 1TJIH 4EI5C 1D9KB 1UZ6F 1YYLL 1I1AB 3U83A 1IC5H 1GGCH 2ICEA 4ODHH 1TMCB 5C0EA 5EU6D 4APQB 1FL6A 5A16A 2E7BA 5GXBB 2YUWA 4JFFD 4CKVX 3GO1H 4H8WC 1NCWH 5IMMA 1Q9LB 4M43L 5F7WC 2BNRA 4Q2ZB 3QZWB 4RGND 2CXKA 5TE4H 1KENL 2P5EE 3BXNA 3HAEA 3VFOB 2V7HB 1HZHL 1F97A 4P3DB 2OJZH 2HFEB 4AM0A 2O5YH 2ZNXA 3F62A 4OZHE 4NQSB 4PGEA 2J88H 5C6TL 3P4OB 1BEYL 3W9DB 1MCBA 3BZFB 4P3CL 5J1AB 1MI5D 4Y2DC 1PY9A 1RZKL 4JPKL 3VXSA 3BKML 1EHAA 1KJVA 5FAAA 5FKAA 4JO4H 4JKKA 3SE3C 2Y7QB 2AK1H 2J5LB 5E08H 2ICWI 4P59H 1G0XA 4FQPA 1OGAA 3NZHH 3P73B 1R3LA 1D5ZA 3HAEH 4OJFH 5D72H 4OF5A 5D7KE 4KUZL 3BP5B 4ONOA 3QUXA 2FECL 1RUKH 4LGPB 1T89C 1I9IH 5F6HJ 2CRZA 3L3KA 3T0AA 3PNWB 4DN4H 5ADPL 5JW5B 4PJ8D 5FM8A 15C8H 4L3CB 2ED7A 4PJBB 4U1MA 1DBMH 1OM3H 5E4IA 2Y72A 4UBDD 4HQQH 3TO2A 1OAUH 1KCSH 4QRPD 1K2DB 4HIEB 1IEBA 5C0BE 1OQOA 4N5EC 1A9EB 3V6FA 1FL3B 4P23A 1CQYA 4M7LH 1MFBH 1S3KL 3T09A 5D6CB 4Y4KA 3GSUA 1KJ3H 1FDLL 3CMOL 4F15C 5BXFA 4JVPA 1YY9C 1XIWC 1SMAA 2WLZA 7FABL 3QUZD 3IKCA 3QP3A 2XTJD 2APVA 4LIQL 1N5AB 3BO8A 4KGLA 5I1KH 4PJDA 4G7VL 3QQ4B 5GGTH 2EXYD 4Z9KB 1OP9A 2QHRH 5JR1L 1NAKH 2GITA 1H3XA 4OFPA 4U1KA 1BD2B 3PP3H 4P4KC 3TIEB 1FVEA 4UMGA 1Z9SA 1VEMA 2EECA 3RJQB 3D87B 3HI1B 1QBBA 3FHQA 3KYMA 4S11A 3VFSB 4XHJC 4JO3L 5D1ZC 1ZA3B 4WY7L 2IG2L 5CJ8A 4D9RD 3HCVB 1I8MA 1B4JH 4XNUL 1QYGL 5C08A 2MQ3A 1NCNA 1M1SA 3HC0A 4XX1G 1RK0A 5E9DE 1UENA 1R0AH 5FGSA 3O41A 1YEIL 4RFEA 2W1NA 4OFYA 1IQDB 4KQ4L 2CK2A 3H7BA 3ALXA 1FFQA 5E99H 3B9KC 3G5VA 1C5CL 5GRVL 3FN9A 2VLLA 3T0EB 1XF5B 2Y9RT 3ULUE 2Z31A 3VWKB 4NNPL 4WFEE 1WT5A 3PHSA 4O00A 4FQJL 4QLRA 2AQ2A 5IHUH 1RUAL 4NQDD 5KANG 4HPYH 1KNOB 5DO2C 3RX7A 2YEZB 4KDTC 3RVUC 2MQCA 4MSWA 2IQAA 1RULL 2ZG1A 1DVFD 4RZCA 3VMPA 3MODH 1F90H 4GRMA 3DSFH 5D71L 1AE6H 1E27A 3Q6FB 1K5NA 5HYIA 1NGWB 4F2MA 3RVTC 4QKXB 3HI6L 1CF8L 3MGAA 4TUJB 3MXWL 5DEFB 5FUCE 2RAMA 3VDCA 1KSRA 4FZ8H 3FT2A 2ZUVA 4YGVA 5J6GB 5T3ZD 1WBZA 4FQIL 4JDZA 3L5WB 1QBLL 2NX5B 2JF1A 4O2CB 4QOKB 3TBYB 4OLVH 5IB1B 4HFWA 1MCHA 5D2NC 4CVXA 2BDNH 5GGRA 3DECA 2C4FT 1WBYA 3DROA 1XGPA 5TPWL 5DSCB 3U4BH 3DHJA 4MJIA 5KZCB 1T5WA 3GSNA 4PP2A 5JLZA 1TZHA 1HIML 1LP9E 1KEGH 5CGYD 4I9WD 2PYEA 5CZVL 4NO2B 2EEAA 3SDAD 3HKFA 4F58L 4UQ2A 1MFAL 1AJ7H 1HHKA 2ADGA 4HCRL 4N8VB 5GS1C 3TF7A 3BKYL 4LSDA 3VFTB 4X7SL 3PWLA 2H8PA 4GG6F 5ABDE 4FFVC 4LSPH 1VGKB 2ICEB 3TO4A 5I15H 5D9SB 1L7IL 1ACYH 3O3EB 4Z77B 4PJAF 3BE1L 2IALB 3NCEB 5EB9A 3RWEB 3GSNH 1RIUL 1KBGH 2BMKB 4G8FA 2A74B 5JXAH 1OPGL 5IG7A 2C1OB 3EOTL 5CGMA 3Q3GA 3EYQC 2X4QB 3L3HA 5DGRA 3F58L 1S7VB 1G9MC 1CR9L 5C2BL 5F6IB 5I18H 3PP4H 2RB8A 1OLZA 3M8OH 1AD0B 1U92B 4ZUWA 5I1CH 5EU6E 2J8UF 4YHNB 3MC0A 3O2WH 4JFFE 4PP1D 1UH3A 4OM0L 1RJZB 3GK8L 3RGHA 4LHQB 4MQXD 2EIEA 2JELL 1WCBA 1T1YB 2HKFH 4L4JA 4Y1AA 4Z18A 4N0YH 2OTWB 4RGNE 4RMWA 5EUOF 4L8SA 1UM5L 4YBLB 2EDJA 4KXZH 4JQXC 5K9QG 2V5TA 3O2DL 2XQBL 1GYAA 2RGSA 1D5ZB 3PGCB 4OCWH 2MOVA 1U3JA 1L0XA 2NXYC 3HS0A 4LF3A 2XZQL 4R8WL 3T3PF 3KPLA 4TTDD 2Z35A 3I6KB 4LVOC 5IFHL 5C3TA 3F12A 5ICXA 3VRJA 1MI5E 4LLYA 2HFGH 1B4RA 2D03L 4BK4A 1HILA 3T2NL 3H3PH 4YLQT 5F3HB 3W9EA 2DMKA 3OSKA 1IEAA 2LVEA 1CFVL 2P7TB 4QY8B 4KRLB 1PG7W 1P5UA 3LQZB 3B2VH 1JN6B 1BQHB 1BVLB 5CLTA 3IFPB 4R96A 5IJKC 5INCA 3RGVC 1IM3B 1OF2B 4HWUA 1JZ2A 3IXTA 3U48A 1WAAA 4ISVB 1HHHA 3IB4A 4W6YB 5KS9A 4OCYL 2C9AA 3O8XC 2J7LA 4XVTL 4KZEH 1C08A 5DUML 1W72L 3OPZL 2DQJH 4PJDB 5GZOC 3PQYA 3BWAB 3CZFA 4QRPE 3G9VA 3GUTA 1RAMA 5J6HA 1OSZB 4J7RA 3RTQB 1CD1A 1PAMA 5ACMA 1IEHA 3ARDB 5IKCA 2HN7A 3P4LA 5D96B 3O45B 3ZTNH 4OKVA 1NCTA 3Q5YA 3KYMB 1A1MA 2P5EB 2XTJE 4MCYB 1F4WH 4ZFZB 3K80A 2PNDA 2X4NA 4JJ5A 2ZUXA 2VZ1A 1I8MB 3QI9A 2B1AL 3QCUH 1EA9C 1RK0B 5FKPA 3O41B 3EKCA 3PDOB 4GT7A 3DETC 3OBAA 4OGYH 1DJSA 3ZL4H 3LZFL 4PJ7A 3M1BA 5GIRB 4GRLC 4I0PD 3BRDA 4AEIH 1IKNC 5GS0H 2NYYD 3SGKC 4AENA 5F7DB 5HHVL 4O02H 1LO3L 1JPFA 2BXYA 3D25A 1VPOH 4LGRB 3GI8L 4D9RE 5L88H 3O6KL 1OARH 2D9QB 1Q38A 4G6AD 1E4JA 1I85C 1V3JA 2F5AL 4PUBL 5DS8B 2NXZB 4F7PB 5HD8D 3BP6A 5FYLD 1L7TL 5K59F 1U3YA 4OD3H 4XP1H 1INEH 3FQWB 3S96B 5JORA 1NH6A 3ILPB 3MTRA 3HR5B 1NFIB 4NZDA 3IFLH 5HYFA 5DRNA 4JKLA 4GRWE 3L1OH 2YUVA 1CK0L 1PDKA 1A6TA 4UNUA 4NQDE 3GGWA 5C0BB 1F11B 3TCXA 5DJDB 1YJDC 3S37H 2XFXA 1NPUA 1A3LH 1WBZB 4JDZB 3OZ9L 2AERT 2F53D 4R4ND 1DQLL 2YKLH 3TEUA 5IVNA 2YD2A 4RA0C 1MCQA 5IESL 2KZ1B 4X9IA 2V17L 5JQ6H 4WEBL 2MNUA 4EZMA 2V5SA 1WBYB 1BX2A 5K9QI 4TULL 2XWTA 3V7AE 2FSEA 3MFFA 3TT1L 3GSNB 4PP2B 1BGXH 4OF6A 5T1MA 1PYWA 4PJHB 2E27L 2NY1D 4PRHB 5MI0C 2DKUA 3LRSA 4NCC2 3Q5TA 3T4AA 5T3ZE 3LN9A 2VQ1A 5AYUH 1HHKB 4BFEA 5IMOA 1S9KC 5LKNA 2H1PH 3FN3A 1EBPA 1MHCB 3HE7A 5IROA 1KCVH 5AZEH 2GIYA 3WNNA 1AFVL 3QIUA 5E8EB 1KELL 4HSQA 3TO4B 1PEWA 3TZVB 2XWBB 1OSPH 3SOBH 5EC1B 3VD9A 4XNQB 2EDHA 1CE6B 5FGBA 3MJ9L 3SE9L 4I9WE 4ZTOL 2P5WA 3CX5J 2I26N 2A9NL 5EC2A 4Z78A 1U8JA 4AL8L 5TQ2L 1ROWA 2WW8A 4BUGA 1IC1A 5IG7B 2FGZA 3QZWG 4QHLA 4P48A 4CU8A 5LJYH 4KKCC 4ENED 1UJ3C 4N0UE 3VGHA 4M7LT 3JVGA 4U1HA 4S0SD 4IDJH 1M05B 2WV3A 4G6JL 1ZT4B 1MAMH 5FGCE 2WWMD 4UNVA 1WCBB 4GBXA 4Y1AB 5H35A 4EJ1C 4HLZG 5CEXB 1YMHA 3J8F7 4QTHB 5F7EH 4M5YH 2DQUL 1QSEB 5IBUB 1DUZB 2IMNA 4J3SA 3DV4A 1UXWB 2AAVA 5KSUA 3CH1B 4CJ0A 2BOCB 3BZ4A 3VXMD 3ARBC 5FO9A 3SHSA 5TH2A 1FZJA 2Z35B 5FF6B 1MCCA 1YN7A 3NFPA 4QT5B 4D9LL 3OGOE 5L0QB 4LCUB 4KUCF 4UUJA 1N59B 1FC1A 1U8KA 4K3DH 4DZ8B 4NN5C 3FQUB 2EH7H 4LLWA 2IBGA 5KW9L 1OD7A 2R1XB 5TDOA 2V2TB 3FO2A 4HH9A 5CD3A 5IMKA 3O9WA 4X9BA 4M1CC 1I1FA 1CXKA 3U9PH 3WS6C 2P1YA 1EFXA 3TBVA 1T0MA 1YYMH 3MNWB 5HPMB 5SX4H 4X0KB 4L29A 4ETYA 1MY7A 1QSFA 3ZT7A 2LTQB 2YSSA 3MLUH 5ID0A 1CICA 3LMJL 1S7WB 1S9WA 1CFTB 1T5XA 1T7VA 1I1CA 4HIIB 3WUWA 4NFBA 3ROLA 1NCCH 1ZSDA 1KCUL 2GT9A 1MJ8H 1ZWIB 2P47B 2IEPA 3ARFB 1FPTL 4P2QB 2E6PA 3UC0L 2CIIB 3ZLQC 1V3KA 2JK5A 3SKJL 1I7TA 3VH8B 1YNLH 1FBIH 1R3IL 2IQ9H 5ECJE 2R69H 1G7PA 4RMRA 1OAZH 1YY8B 4J4PA 3DO7A 3QJHB 1NBYA 3T1FB 1GGIL 3MOBH 1LDPL 3UTSB 5A2IH 3KLAB 4JJ5B 3CC5B 2CO6B 4NO0D 2DQTH 4KMTL 4JRWA 3LQAL 2VLJB 4JZJC 5GPRA 1A6VH 3GBMH 4H26A 4OZFB 4NRZA 1DLHA 1MLBA 5EU6B 3RL1A 3BSZH 4O51A 2R2EA 4JFFB 3UAJC 1ZHKB 3AROA 4LHUD 5KSBA 1X6NA 4JCMA 4HX1B 1T03L 5FK9A 3UTQB 4NKMA 4AENB 3FRPA 4UT6H 1IZJA 1CU4L 4OCLC 3G08A 1NFDB 1A7PL 5A3ID 3U82B 2ZPKH 4Q0XL 1MJJA 3RWCB 2RHEA 1D5IL 1I8IA 2VL5B 2A77L 3AS3A 4XH2B 3BP6B 4HWEH 3PWNB 3NH7L 1YC7A 5LAXA 5J1SC 4XBPB 1ZHNB 3GHEH 4X5WB 3P30H 3UTTD 2HKHH 4L9LB 4YAQA 4OB5L 5FFLA 3DXAA 3H8NA 5DD5L 5F7YC 3X12A 3T4YB 5HXMA 3MRBB 5JW3L 1PZ5B 4YQXL 3EOAA 1MH5A 5DRNB 1CGTA 3N9GH 3PWPD 3QIWC 2W60A 1MHEA 3MLYH 4YDJB 3UZEA 2XTLA 5FYLE 2DJUA 4WI7A 1GPOH 1A4KA 4G9DA 3MR9A 3K4ZA 3VXSD 3FQRA 4XNZB 1T0PB 4MXQA 5IEHB 1RUQL 3LS4L 4MDIA 5LQBL 1DQDH 2DD8H 1IMHC 1G7JA 4R6UA 4JB9H 3GZKA 4FZEL 1OGAD 3VE0A 3FJTA 3VXPA 2MPAH 2VN4A 2R1WB 1MF2L 2W9EH 4LVNC 1ZTXH 5EIIB 2YK1H 3QUXD 1CLOH 4WU5B 3NIGE 2P8LA 4L9DA 1TXKA 3NMEA 3UTZA 3MRQB 1KYOK 1YEJL 4ZFOB 2F53E 1NJ9A 4PJEF 3V4VH 5I16A 1AD9A 4M00A 3V5KA 3BIKB 3BEVA 3C5ZA 2BCKB 2OJEA 1EX0A 4N8VG 3S98A 4XP5H 4CMMB 5ENWB 4FQ2H 5KVGH 3DYPA 3QUZB 5CHNB 2XTJB 2BSRA 1AQKL 3TYFA 4KKBD 5DJ8B 1UB6B 3MRDB 1FP5A 5DJAB 4NO3A 2BVUA 4QCIB 3THMH 2DKMA 4RFOH 3D0LB 1V7NH 2YD7A 4P23D 2BVQA 4FQXB 4F37K 5JOEA 3FB6B 4NDMA 3SDCB 4J3OC 3BKJH 4JR9H 5EC2B 4ZUTA 5DLML 4X6BA 3MV8A 1ZXQA 4LCIH 4LEXL 4Y4KD 3LPGA 1TFHA 3S5LA 4XC1H 4HUWA 1AR1D 4YHOL 3MRLA 3QXDB 3M17A 3HAEG 2CLRA 4U6TA 2WAHA 1JPSL 5EBGA 3AUVA 2AXGA 1D9KC 5C9JA 1I1AC 1K6QL 1SBSH 3QDJA 3GRWA 2DQCL 3QFJD 5BVPL 4F7EA 4APQC 4Y4HC 3K0WA 3IDXH 1S9YB 3QUMH 3WFDH 1QKZL 4GBXB 3EZ8A 4G6KL 1B0WA 2PF6A 4ELMA 3DVIA 2QV2A 2ENSA 3IJSA 3IXAA 2J6EL 1DE4B 4NP4L 3WBDA 4H8WL 4HDIA 5I8KL 3CFIC 3H6JA 4ZPTA 4PJXF 5TH2B 5C08D 1H5BB 4LCCA 3QUKA 4Z7WF 1FZJB 2W07A 1CD0A 1MCOH 1EMTL 2MHAA 4DJMA 4NQDB 5DT1L 2Q8BH 5B8CA 4OLXL 2JIXA 4ODXA 4XPAH 4DEPB 4CDHA 1Y6NR 2DB8A 1FJ1B 1FE8L 4OIAA 1U95B 3O9WB 4YHZH 3TPKA 5F1IA 3RL2B 4U6YA 2J5LC 2Z31D 3RX8A 3L7EB 1EFXB 4HJGA 3QCTH 5E2WL 4MNGA 3VXME 4F3FA 4JY6A 3I6LD 5K9OA 5HI5C 1LEKB 7CGTA 1YEGL 1BQHG 1YPZF 4WIQA 3OXSA 3EGSB 1HQRA 3MNVB 4U6HA 2DQGL 5HGHA 4WENB 4EVNB 2HT3C 4ELKA 5DMKA 4EDWH 1IAIL 3EJYD 4YC2B 1Z5LB 2ITDB 3AAZB 1J0HA 3QPQD 3SGDH 3DIFB 4CVUA 1I9EA 5SV3A 1CFSA 4L5FL 1QLEL 5CEYA 3CCHA 4ODSH 3UJIL 1CFNB 5BVJA 2XXCB 4ACPA 1ZHLA 4JHWH 3X14A 4NM8H 5EG6C 1CFQA 1KFAL 1U3HA 1EXUA 4D94A 3T2PA 2QQLH 2O5ZL 3KPSA 2UVFA 4WWKA 2H2SD 5EU3A 5T5NF 4MNQA 4ZSOE 1LO2L 4N68A 3SDDB 5I6XB 5FCSH 2G5BB 1JTOA 1KJMA 4D0BA 5T33H 43CAA 4NC2B 3I50L 1V8HA 4Y5VC 4N0UB 2YUZA 5CD5D 4PY8J 4EDXB 1QOKA 4JVUA 1X9QA 3HC4H 4MJID 1LEIA 4NRZB 1DLHB 1MLBB 1JZ8A 4O51B 3HG1D 3VGAB 5BOPA 4Q7DA 4L4VB 4BUHA 3CXDL 5KSBB 3ZHDA 4E5XA 1J1XL 4GKSA 4KKAC 4GKZA 5SWZA 5AWNH 4QHNA 3DVNA 4BH8A 3MACL 3NAAL 4U3HA 3ZYIA 3FFCA 3PV6B 4NBXB 4M43H 5CP7A 2E7LA 3EBAA 4G9FA 4MZ3A 3MCLL 5HYJA 1YEFL 3FHAA 4X6FB 1KENH 4M9PA 1YNTA 1ORQB 1KOAA 2R15A 2WBKA 4UIMA 3FQXB 4KROD 1SYVA 1I9RL 3O4LA 2JJTC 4G8EA 5C0RL 3VFNA 5DQJB 4ERSH 5ADOL 1BEYH 4I5BB 4P46A 5TDPB 3OAYH 4AT6A 3T0EC 1URLA 4BELD 4JPKH 3AM8A 5IBTH 3OAUH 3C5SB 3IJHA 3PABA 5DJXA 4X80L 4B5EA 2O61A 5HHOA 5C09D 1M4KA 1JGVL 1WWAX 4P5MA 1LQSR 5HDOA 1A4KB 2HLAA 3D18A 3HMWL 3GSVB 3FQRB 3RIFK 2VLRA 2YN3A 5IFJB 3UTTE 3WLWD 3SPVB 3JWOC 4D3CL 1X5IA 4NIKB 4X6DF 4HIXL 5E7FA 4GW1A 2X1WL 4UT7L 5ADPH 4KH2A 2MKLC 1IAKB 1GCFA 1UGNA 2FBJL 3PWPE 1K4CA 1JYNA 5DD0L 3DBXB 3GMQA 5F7MC 2NW3B 4Y8DC 3ROOA 3KR3H 4UU9B 3JTTA 3VXSE 1XCTA 5JHDA 1XGUB 1FN4B 4CVZB 3TWCL 3V5KB 3BEVB 1OGAE 1WICA 4HV8A 4IS6A 2SEBA 3WLBA 1FDLH 4EUPA 1W0WB 3QUMB 4GMSL 2YOCA 1EJ6A 4D8PA 3P4NB 1IRAY 2EYTB 1MELA 4U0QB 5CILH 1MHHA 3FB7B 3BDXA 5B3NA 4NQXB 5BQ7B 4XPBL 4JPIB 2XQYK 5JR1H 4LAQL 1GZPB 5HVWA 3MRLB 1RD6A 3F7RA 2Y06H 1F58L 4M4PA 4L8BB 1GAFH 5E6ID 2I5YH 5IEKA 2HH0H 1KTLA 4PB0H 4IOFC 4J23A 4ZTPH 1JHTB 2GSGA 4WY7H 1I8LA 3QIBD 2IG2H 1QFWM 2P42B 2VQTA 1QYGH 3LKNA 5DD6A 5D1QA 3QEQD 2R9HC 4I0PB 5ISZD 1IAMA 4CW1B 1O7VA 1MFDL 1T83A 2X70A 3EO1B 5DA4A 1MVFA 2VISB 3R0NA 4KQ4H 1V7ML 4JAMB 4J1UA 4PJIE 1Z9OA 3H0TA 3L3GB 1FYHB 4ZPTB 5F6IC 3QI9D 1AGDB 3DX6A 3QFJE 4LCCB 2B8OT 3MXVL 4H0IA 1D5MA 4M6AA 2BY1A 35C8L 3TH4T 3WSQL 2VSCA 3LH2L 4ODXB 2DQIL 2CRIA 4FQJH 1RUAH 1INDL 5AUMA 4YX2H 3R8QA 2YPKA 4F37F 1AQDA 2ZCHL 5E94A 1JF1B 4YBLC 4DQOH 2HFFA 3VXQA 5IVXF 4O9HL 3TPUB 2X4PA 2DS4A 3H9YA 1TCRB 5C08E 4C4KT 1T20A 1XF3A 2FH6A 5GJSH 3MROA 1P7QD 3KPRB 5DHVH 3RWIA 5IB3B 3L3DB 5GHWH 4WGWB 4U6HB 2BX5A 4ELKB 4YBQC 2YA0A 4LDEB 4M48H 4X8XA 1NC4D 5IIEA 3EJZC 3HI6H 2F53B 3HPJA 3WXWL 5JA9A 4Y5YB 4YPJA 1A9BA 2C1PB 2OTUB 4HCRA 4XPHL 1AH1A 1ZHBB 3N85H 1QBLH 1EZVY 1JFQL 4OGAD 5CSGA 2W0FA 3I6LE 2JLLA 2XY2A 4TUOB 1ZHLB 1M6OB 4LEOA 4HF5L 3BP7A 5C9KA 4GO6B 1D6VL 5HHMB 5TPWH 2NW2A 1DEEB 2EKSA 3REVA 4QTIL 3VH8G 1Z2KA 2OP4L 1HIMH 2C26A 1AHWB 4V3DB 1OB1A 1CDYA 4ZS7L 1FZKA 1CQKA 2VITA 5FXCH 1HCVA 5EDXA 4F58H 1J0IA 1MFAH 1IGYA 1JK8A 3O2VL 3DV6B 4LKXB 4X7SH 3T2QA 4N9GB 4NCC1 4R90L 4Z7VF 4G43A 3QUYA 1CN4A 1OLLA 1IJ9A 4UZGA 5FYJD 1HOCA 5AD0A 3RTQC 3V79C 3MCG1 5SWZB 5C0GA 3BPOB 1C1EL 5D96C 1L7IH 3BE1H 4MMXC 2Q86A 1S7XA 3G6JF 1GH7A 3HE7D 4MXVF 4PJ9B 1HXMA 1CWVA 2GJ6B 3PWVB 3H9SA 3EUUA 3O2DA 1OPGH 1PGRB 3GSQB 3EOTH 3BUYA 3GMMB 4MJIE 3HG1E 3F58H 1CR9H 5GGSB 5C2BH 2P5WD 2DL9A 1FFPA 1K8IB 2VABB 4Q74A 2XRAL 2FZ3A 1RVFL 4U1LA 1MJUH 5DI8B 4JLRB 4LPXA 3ZZ1A 3GK8H 1KN4L 4AT6B 4KXZI 2AK4A 3HNSH 3S35X 3SDYH 4M8QB 3G6AA 5GGVL 4KWUA 4PJGB 4N0CD 4GG6A 3BFOA 2N4IA 1ZT7B 2FB4H 4M6MH 4P5MB 3O2DH 2XQBH 5EU5A 3CSYB 5L6YH 1RURH 3PL6A 4NKQB 4DTGL 4UTAL 3QG6B 3NGBB 2VH5H 4XT1C 2XZQH 1SMOA 4PJAA 5IFHH 2R23B 2X7LA 2EH8H 1W72A 3T2NH 3MJ7A 2IJ0C 4J3TA 3WDHA 5C09E 1G0DA 3MUZ1 1CFVH 1B0RA 1I3UA 4LFHG 4GH7B 4F8QA 4KPHH 1CXEA 4I1NB 5B4MC 1OP3H 1EGJL 1G6RB 1YQ2A 2XY1A 3JXAA 1WVZA 4EOWH 4RDQF 5IT2L 4GQ9H 4HUXB 4IS6B 5LBSL 4R7NB 2L7JA 3CFDB 3RPIA 3WLBB 2HWZL 5KN5B 1CIUA 5EUOA 4M03A 4Z7NF 4XVTH 4AQOA 3VXNA 1YJDL 4IEFB 4YHLL 4RQQA 4U1SB 4HPOH 3SKUD 1UVQA 4XCCH 2F74B 4XTRC 2PO6A 3OPZH 1NDMA 4WI3A 1KPVA 1IGTB 4HZLA 3RA7H 3LEYL 2A6KB 4Y7MA 3RIFF 4M93B 2W0PA 2M1KA 4NO0B 2C3VA 5JPMA 1A1OB 3OF6D 2DTSA 4NGHL 4LP5A 3TYGL 3SJVA 3FCTA 3TO4C 3FOMA 2AABH 3TZVC 5C07A 1WQVT 3BW9B 5ID1A 5E24E 4XZUB 1TZIA 2B1AH 2CRMA 1WAAE 1U8HA 5AYQA 5DWUL 5KS9E 1LHZA 4U6XB 3VJ6B 4J4PD 4NHUA 4PG9A 2X70B 1ORSB 5DTFB 3EAKA 4X7EC 1S9VA 4PP8C 3K81A 3WFBH 5SWQB 3D85A 3FO1B 1A7RH 3H0TB 3MV01 5DHVB 4Z7QE 3DRQB 1JUFB 4HKBA 1JBJA 4LMQI 4OZGE 3SY0A 5TFSL 1XAUA 3I6GB 2QSVA 4N1CA 3MRIB 5EPMA 3LKSA 2A6DA 4BSJA 4MA1B 2VDKH 4AMKL 4QXTB 3PG2A 1BOGA 4PUBH 3QAZB 3S8WA 4TNWK 1JYXA 3QEQE 5ISZE 4OCRH 3UTTB 3V7MA 1AXSA 3VXQB 4X6EA 5IW1B 2X4PB 5CJQH 1UM6L 1BWMA 3IJYB 5JIHA 1EH9A 3B3IA 4W4OC 1FCCA 3NA9L 4Z7UA 1NBZA 5JMOC 5EA0L 3D3VD 3PWPB 5L0QC 2ZSWB 4ZQKA 2V2XB 4PRAA 4LK4A 5C0JB 1FZOA 1CK0H 1JNLL 3DXAD 2H3NB 5M94B 3C9NB 2QADD 1BMGA 1MLCA 3OB0K 4R2GB 1QA9A 3WNOA 5C7XL 3OZ9H 1FL5B 3V0WL 1DQLH 4R7DA 5DUBB 1JHKH 3L3JB 4MX7B 4PJFF 3UX9B 3U4EA 4MCZB 4LEOB 2E5EA 2CKBH 5DHXB 5DHYB 5C0AB 5I1EH 1XGQB 2VDML 4WEBH 2NQCA 3V6OE 3MJ9A 3C2AH 3AS2A 3MRMB 3HHRB 2LTQC 3P11H 2EKSB 3TT1H 1MFEL 3UBXA 1A3RH 4MXQD 4LSRL 4Z95L 4BZ2H 1OB1B 5IGXL 3VG9B 2H2PC 4JY4A 2JCCA 5E4EB 4S1RH 3GB7A 1J12A 1NDGB 2MQ0A 4JFXB 1IGYB 1JK8B 3HFML 4YHIA 2CDEA 3HB3D 5EU4B 3ARFC 1KXVC 3NACH 3QQ3B 5GS0C 4LNRB 5HGDA 3FONB 1IL1B 3RHWK 1U8MB 2ZKHL 4PLJD 4DAGH 1T7XA 3MJ9H 3MGTB 4I4WB 4O58H 1XCQB 2DF3A 4MLSA 4WRLA 2PW2B 2WM0A 2A9NH 3FRPG 4AL8H 1JI2A 4Y88A 1TVBB 1QZ1A 2X9XA 3OJ2C 5C70A 1NUGA 3QJFB 4PJIB 1G6VK 4QHKJ 3TJHA 1QPXA 1TJHL 2X4UB 3QFJB 4PY7A 5IQ9A 5FYJU 5FYJE 4DN3H 1G7IA 3MA7A 5GGQH 2FZ3B 3MV8D 1UG9A 4J3WA 5CBEA 4G6JH 3VWJD 1L9NA 1F4XL 3T8XA 1XR9A 2MTPA 4E41D 2BSTB 2LE9A 4FXGB 1IFHL 1QFWI 1TNNA 4FQQB 2H9GB 4KTEL 4PRNA 5AZ2H 4KV5E 1SYSA 2P5WE 2ITCA 3PJSB 4UOJA 1CXFA 3TESA 4HBCL 4DK6A 4BYHA 2VJXA 1J0JA 1KYOJ 2ZOLA 4PJAB 4D9LH 1O0VA 2I60L 1AGBA 4DGVH 2VDLL 2C3HA 4JFYA 4OV5A 4LCYB 3QNYB 2KDGA 1XF2B 2ARJA 3ZYJA 2IPUG 3I3DA 4WW2A 3EW3B 2NLJB 4POZD 5D70L 4WTZG 2MSPA 3C5JA 3HE6A 3O3AB 5BZDA 3BDYL 3BN3B 4ONFH 1U2CA 3NVQA 5JTWA 5SX4I 3AREA 3D9AL 1A6PA 4O5LL 1AXTL 3HN3A 2J8UB 1ZV5A 5KVFL 2JIXD 2W65A 1F8TH 2Q76B 4XNZC 4FNLH 2DIAA 3QHFL 4ZUSB 2HJKB 4HWNA 5HBBA 2H32A 2XKNB 4X7FC 1VHPA 2E9IA 8FABB 1JWUB 1TIUA 3RWGB 1YNKL 4GS7B 1UVQB 1E4XL 3KDMB 2FYYB 3SN6N 3CUPB 1QO3B 4K8RH 1NDMB 3TA3B 3ALPA 5ESQB 3PP3K 2DN7A 3OG6B 1IM9A 3BP4A 4B7IA 1KCUH 1Q9KB 4W6WB 2AV7B 1OAKL 3UC0H 4QRSA 5T1LB 1A0QL 1QP1A 4V1DB 3S5LG 4ZFGL 1DBKL 3V4PL 2YPLD 3TCLB 1R3IH 3GSOB 4KJQD 1ZLWH 4ODWA 3EO0A 2C3VB 1HE7A 4PREB 1HWHB 2XTJC 4NSKA 1XR8A 4N0FA 5HHPB 1QBMH 1LDPH 3PWJA 1JWSB 3GM8A 3VXUA 2I9LA 1T04B 3FB8B 5F6HI 2VAAB 5FGBC 3HG1B 2EXYC 3EFDL 4KMTH 2VDNL 4FQXC 2XACC 3KPSD 1GZQB 3AU1B 3SDCC 1RZ8A 3MLXH 4JQVC 1D5BB 4MNQD 4PJCE 3U2SB 1Q9WA 5DK2A 3JTSA 4FQLL 3MQIA 1S7QA 3REWA 2FHCA 1RZ7L 4HGMA 4JM2F 5GRJH 2QR0B 4QNPE 4KMLB 5D5MF 3QWOA 5CLWA 5ANMA 3JWDH 1MEXL 1CU4H 3E8UH 4MQ7B 1BFOB 1RSFA 2DQEL 1B2WL 4MAUL 3FQTB 4G3YL 3QDGB 1D5IH 2NY3C 4GBXC 2A77H 4YEFA 1PG7X 4LHJB 4MS8C 2WIIB 3TBWA 1AXSB 4WWID 3FFCD 3IDMA 3B6SB 4MD0B 3C6SA 4X6EB 4JFOA 3SE8L 1VGEL 2CKBB 5AAWA 4JDTH 1FVCB 4WVRA 5HYJD 5DMGC 5K9KA 3WEXA 3U1SL 1UQSA 5DD5H 2YN5A 4JO2L 5C09B 1H5BC 2DQDL 2VRAA 3FL7A 4YQXH 3WL9A 3V0VB 4D9QD 5KG9A 4YDKH 1U6AL 3O4LD 2QKIA 3U46A 5D6DC 3TFKA 4DEPC 1CS6A 1G9NH 1J5OL 1IGJB 4X98A 3S4SB 4OLEA 2B1HL 3O9WC 3KPTA 5D2LE 3RUGA 3WDJA 1BIIA 4I48B 4UTBH 1RUQH 3HRZA 5I17A 5HHOD 4OGXH 5ITBL 1YEKH 3D3VE 3G5YB 3A67H 4HWZA 3V5DB 3KG5A 5AG9A 4ZO6A 3MLTA 4LSUL 4GW4A 4JM4L 2JB5L 1E28B 3TNNA 1MF2H 2VLRD 2RBLA 5GSRA 1BAFL 2H6PA 1DBBL 2ZCLH 3DOSA 3DXAE 4KI5D 3WJJC 3O6FB 5IMLA 3LS5L 4YC2C 5HYSB 2ZUTA 4DCQA 1YEJH 5DR5L 1VSCA 4XCNB 4HXBH 4Y4FB 3MYJB 5J13C 5I8EA 4F33B 1RJYB 1QFUL 4K9EH 3TNMA 4EN3A 2FIKA 4OBRA 5T1DL 3DURA 3MRGB 1SQ2N 4JN2B 4PGBA 1G9EA 4V3EB 4Z7WE 3QQNA 4LPUA 1F42A 3FB5A 4TQEH 5CGYC 3RU8L 5IVZB 2EDOA 4GLRI 4PTUA 3RBSA 4B53A 4NT6A 4NBYB 4EI5A 2D3VA 4K3JL 4NO5B 4HS6A 4L8DB 3SDDC 5I6XC 1FIEA 1WIPA 1QRKA 4LEXH 3RWDB 1JGDB 3B5HA 3STZA 5ALCH 2J6EA 5E6IB 1KXQE 2Z8VC 3CSBA 1YEDB 4KRPD 4OZGB 3V8OA 3BD5A 5IQ9B 3S36X 2XNAA 2WUBH 1JPSH 3QIBB 3OKDA 3VGAC 5CEZL 1K6QH 2PUQT 2DQCH 2XZAL 5BVPH 3E6FB 3QEQB 5ISZB 5F71A 1O7SA 5FOBA 1OAXH 5JUEH 1QKZH 1XZ0A 4QWWD 3HZKA 3JV5A 4FXLA 4K7PL 4K71B 3T8XB 4HWBH 4OI8A 2EO9A 5JDSB 1EK3A 4G6KH 4PJEA 2AJZA 3HC3H 3CVIH 5TQ0L 5BMFH 4OUOA 4JZNA 4Y2DA 1KB5B 1R3HA 1KIQA 5JPNA 4H5SA 2F58H 1HHIA 3EO9L 2J6EH 4NP4H 2CUMA 1Y0LB 3FTGA 5MEOB 5ETUB 2WP3O 1XT5A 3BMVA 3MV8E 5D1QD 3V5HA 4MQXC 3SE4C 3W11D 1BZQK 2OCFD 3U7WH 1NUFA 1EHNA 5CINH 4OLXH 3X11A 4LDOB 1KPRA 3UPRB 3RHWF 4E41E 1ZA6B 4WW1A 4PGCA 4AEHL 1FE8H 3R4DA 1SJHB 1T89A 4XNMA 3IF1B 5DRXB 2QQNH 1QLFB 4CL7A 1ULVA 1HDMA 1P7QB 4LPCA 4BZ1H 4JREC 5E2WH 5E5RB 5IK3B 5D7LA 1CXHA 1KTDA 5C0FA 1R3KB 1NC4B 4OUUA 1WBXB 4KAQL 2Z92A 3F6LA 4YR6A 4V2BA 5A2JH 4XRCB 2BOBA 4K3EH 2DQGH 3SGDI 5FUZL 3WE6A 5CIPA 1IAIH 2HMID 4N5EA 1DQJB 4ODTL 4OLWL 5CCKL 3GIVA 1G7HA 1QLEH 3RWFB 2LU4A 5GISL 3QXAA 2PW1B 4PJXA 5GQBA 3E0GA 1C16A 5DD1L 1NGZA 4S0TD 1RMFH 1IQWH 5IW6B 4LNVA 1KFAH 3MSPA 4XNXH 2O5ZH 4K2UH 3BEWB 2A1WL 3L5HA 3G5ZA 3BIAX 3HNTL 2YD9A 4C58B 3DX8A 1LO2H 4HUUB 1CTNA 4LLMA 1IGIL 2D4DA 2ATKA 3RZCB 4XMLH 2BC4B 4P4KA 5CIPH 3VXUB 1B3JA 2X42A 3SDXE 4OM1L 1IC5L 3I50H 2R1YA 4ODHL 3LKRA 1I7RA 1ZK9A 5D1ZA 4PRPB 5E8PA 4M02A 4X5LA 1S9XB 4EEEA 3G04B 3MUGA 1NCWL 3HLAA 2YPLE 4PLKD 1EJOL 1ES0B 1CGXA 1PSKL 3REWB 3EYVA 3F7YA 3MCKA 3MACH 5TE4L 3NAAH 4PRIB 1C12A 1CG9A 2HJLA 3U9UB 4D0DB 1VFAB 3QUYD 4FS0A 2A38A 3B9KA 3GBNH 3MCLH 2FCBA 1YEFH 4W6XB 1YDPA 4LLQA 4WTWA 2OJZL 4HKXA 5DJ6A 3KPSE 1FV1A 1S7UB 1FLRL 4HIJB 2J88L 4MNQE 4I0PC 4ODUB 2NYYC 1N5YH 4JFQA 2CGRH 1I9RH 5C0RH 4JEGB 5ADOH 2GJJA 5DJZA 4WHDA 4HK3J 5E08L 4LCCC 4KDTA 1UADC 3BQUA 5B39A 5J11C 1Q0YH 1AXIB 3MLWL 2X9WA 1Q1JL 2UZIH 2HP4A 2KQMA 3BDBA 5J56B 4BSVA 5D72L 4X80H 5J4MA 1F5WA 3PWUA 3TBTB 1QR1B 4RFNB 1ED3B 4XAKD 2FECI 4Y5XA 1RUKL 3FFCE 2PTTA 5H94B 3P9LB 4XHQA 5HYJE 2W92A 1CIDA 4NQCB 3DUUA 3LIZH 4U49A 4HWZB 1FYTA 3VG0H 3AC0A 4HQQL 4D9QE 1KCSL 5EN2B 2HJFB 3CFCH 3O4LE 2FBJH 3STBA 5DD0H 2FEEL 3IVKA 4YXLL 1DN0A 2FO4A 4OZHF 3QQ9D 4LQ1A 2QLVB 4JFDA 1MFBL 4Y5YC 5FCUL 4YDIL 4UIKL 5HDBE 4LP4A 1BP3B 4L3AA 5IJVA 5HHOE 3GSWA 4X7DC 4P2YA 4OIBA 4TYUA 2AJYL 1AKJA 4BJLA 2D31A 5I1KL 4NRXA 4UINH 4DGIL 1VACB 4GMSH 2VERN 2VLRE 5GGTL 1Y6MR 4ZAKB 2R2CA 1R5IA 5FGRA 4NUJA 4WWKC 3NZ8A 4KI5E 2QHRL 2I27N 3NABL 3BVNA 3MJGX 3WHE0 1AHWC 4PJCB 1E4WH 1XMWA 4XPBH 3STZB 4LIQE 2K3TA 1UT9A 1Q0XH 1ZANL 3KPMB 1F58H 2PO6D 3EHBD 4ZO7A 2F19H 4AIZB 2BNQA 3K4DA 1T2QL 3OKKA 1OTSD 2ZG3A 1YQVL 1R0AL 3RWHA 3BPOC 1KT2B 5I8OH 2P8PA 2HVJA 4NCDA 3QSKB 4PJEB 3WHE1 4PJ9C 4WJ5B 3VFVA 4JRXD 3VXOA 3SJVD 4POUB 3QXVA 4R97B 5LGJA 4QEGA 1R3HB 5C07D 4IRSA 5F9OH 1T22A 1UXSA 5C8JB 1U58A 3W5NA 1KCRL 3V5HB 3SCMD 4OFVA 5IHUL 3TBSA 35C8H 2H45A 3S97C 3WSQH 2I9TA 4P46C 3LH2H 2LU7A 4U0RB 2IFGA 1KIRA 2DQIH 2CUIA 3HR6A 4E0RA 3D85D 5D2LB 4JZOA 1INDH 1P4LA 3AM8C 4QRUB 5I9QB 4XNMB 1O5DT 3BKCL 3MODL 1A47A 1HDMB 3L7FA 3D3VB 1B0GA 1PQZB 1AE6L 5EWIH 4LVEA 3TC9A 1V5JA 1F6AB 5F9WB 2V2WB 4OUUB 1H3VA 1A22B 4HXAL 3ARTA 3UEZA 3MRHB 1M71B 1QRNA 3WMSA 4XWOD 4ZPVB 1I8KB 5IJKA 3TVMB 3BGAA 5TGBB 3WXWH 3U4AA 4OLVL 5A2KH 1WFNA 2AJ3A 3IDJB 1IGFH 4M5ZH 4YIQB 2IAMD 5EBLB 2A83B 4XPHH 1AP2B 2BDNL 3O8XA 1JFQH 1SEQH 5J9PA 3ULUF 4Z7WB 1PX3A 3VFUA 1LO0H 4ZXBB 4R3SA 4HF5H 1U9KA 1N7MH 3VGBA 3W2DL 3KLHC 5TF1L 4QRRA 3WKNA 4ORZC 3ES6B 1X5AA 2OP4H 1PBYA 3FN0H 4BM7A 2NY6D 5F7LB 5HY9A 4ZS7H 1FGVL 2I07B 2XXMB 3U6RB 3OKNA 1WWWX 4LSPL 3MRRA 4EKXA 1A6ZA 1U8NB 2F8VA 1YPZB 4R90H 3LRHA 4YJZL 2V6HA 3LRGA 4GKNA 4KKLD 1M7DB 4NKOA 3F7YB 1GRWA 1KBGL 1YN6A 4M93C 4Z6AT 2GTWA 3PXJA 5JXAL 2XN9B 1C12B 5EOTB 4GRLA 1UWGL 4JO1H 1IKNA 3QA3A 5KSVA 3QO1A 2WINA 4OLUL 3SGKA 4S1QL 3VDBA 1I7ZA 3CNKA 5C0ND 4IHOB 1U36A 2UYLB 3LSOA 4CRPA 3MNZB 3GJFH 4GFTB 4MZ2A 2CDGA 1T83C 3VWJB 2KPNA 1LE9B 1I85A 1LP9F 1A3QA 2HKFL 2IADB 4XI5C 4E41B 1K9TA 1X5GA 2DIBA 3LHPH 4JDVA 3TJHD 3T77B 3NA4A 2Z4QB 3BQUB 3KPNB 1OAYL 4S2SB 4HHAB 3I9GH 4OCWL 4MA1C 4PTTA 4ETQA 4HIHA 1FNLA 3QAZC 3ULUL 2ESVA 1EGJA 4ORGA 4YZFE 3HZVB 4IRJD 4DTGH 4UTAH 3WN5B 1DBJH 2BSSB 3PV7A 3S4SG 4BH7A 1JPST 3OR7A 3G6JA 3H3PL 1JIBA 4PRBA 1S7RB 1BBDL 3OWEA 2AJSL 3PIQB 3CDCA 3D1MC 2GFBB 3IAQA 4G42B 1UFUA 5DRWB 2GJZA 5IB5A 2FO4B 2BERA 4XAKE 1JGEB 4JFDB 2NR6C 3K4AA 3L5XL 4R2GC 4X7CC 1EUTA 2IPUK 2FRGP 5HYSG 3IKKA 1ERNA 2EIBA 3HE6D 4KZEL 5HHNB 4YPGA 3LKPB 2YA2A 5LBSH 4RAUB 3ARED 4URTB 2HWZH 3K2UH 2DQJL 4PBVC 4B41A 3V6ZA 3IFOB 3SDXB 4YHLH 5L9DH 1K8DB 1NGPL 1OHQA 3JV4A 1WITA 4QRQB 4DKFL 4TVPH 3D2UB 4ZUUA 5H37H 1F4YL 1CDBA 3ARRA 4FXKB 1RZIA 5FUOL 3VG9C 3VI4F 4M3JA 3PGFL 1VERA 2YPLB 3N06B 3ZTNL 4NWUL 4WDIB 5E4EC 1FZMB 1IGML 2ZOKB 2EIZB 3BJLA 1FNGB 4X6DB 2QSQA 1ZEAL 5F89B 1W0VA 4ZDHB 2APBA 3TYGH 5I1DB 2Y36H 3DRTB 1P6AB 1QVOA 4RWYL 3ILQC 2FWOA 2P8PB 1N8ZB 4OGYL 3ZL4L 1EEZA 1SJEA 2CDFA 2DWEA 4X4YB 2NNAA 1FSKB 3C08L 5DWUH 5GS0L 5L2KA 5IOPA 2OR9H 1FFOA 5DK0B 5ESAA 4WI4A 4HKZB 4G59A 1MVUA 1FQ9C 2Y5TB 4JRYD 1VPOL 3DYMA 5L88L 1OARL 5J3HC 3P9MB 4O2EB 3TBSB 5GSVB 3UYRH 3MA9H 3B2UD 5T3XD 2BFVH 1FFNA 3BN9D 1ZT1B 3GMOA 3ARBA 1LMKA 4KK8D 2VXUH 3HUJA 2EYRB 4JRXE 1X7QB 1KG0B 4M1GH 4OD3L 4XP1L 3SJVE 1INEL 1HSBB 4OT1H 5C07E 3GBLA 5F7HA 2AKRA 3KWWB 1B0GB 5HSFA 1UM6H 4QGTA 3ZTJH 3IFLL 1LNUA 3WNKA 2OL3B 3DUSA 1M7IB 2XA8L 5MENB 3P77A 4NHUE 3WS6A 3GSXB 4FFZL 5BV7B 2G9HB 1QRNB 1ZLUK 3HZYA 4EXPX 4L3ED 2WQ8A 1A3LL 3IETB 3DO3A 2E6JA 3OJDA 2NY5C 3MBXL 1G0YR 1OTUC 2X4SA 5IF0B 4HBQA 3K46A 3V0WH 1D5XB 5IM7A 5D8JL 3MBEB 3MRJA 3W5MA 3TFKD 1DTUA 2F5BL 2VDMH 3MJ8B 4LL9A 2AXFB 1KIPA 4OFDA 1MPAL 3EJYC 2Z9TA 5IB4A 1U91A 1MFEH 2ZCKL 1J7VR 3ZKSD 5AYUL 5FB8B 2FHBA 2GUOA 3GDBA 6CGTA 3LN4A 4M7KH 4MJ6A 4Q97A 4Z7UE 4LKCA 4GS7C 1IKFH 3MRPA 5IVXB 4U05A 5DQ9A 3VCLA 1NGXB 3OKNB 4XC3L 5C0CD 3GJFB 3TA3C 1FVDA 3HFMH 2XI9A 3WD5H 1H8SA 1OSPL 3SOBL 1N4XL 4ZUVA 2DM2A 1QHOA 4K7FB 4GRWF 4JZJA 4QRTA 4QF1A 1JPTH 3MV11 4RAVA 3UBXI 5HI3D 2ZKHH 5L2JA 3KGRA 2P46B 5ILTL 3LB6D 3VA2C 4PJ5A 3GSRA 3T2OA 2Q6WA 5DJYB 5DZOA 4EN3D 4UI2A 1JZ6A 4ZFOL 4KRPB 3L3IB 1OAQL 4LRNL 4PJFA 1A7OL 1F02I 2AV1B 4WHTB 4JGJA 3C09C 2BJMH 2X4TB 3B9VA 3FT3A 1VADB 4BQ9A 4HG4K 5FDYA 4EI5D 4JFEA 4FQHB 2Q87A 2NCMA 3KNBA 2JCCE 4BQCA 3P9WB 3I3BA 2BNUA 3DWTA 4X4ZA 1JHLH 4F7MB 1FORL 5EO1A 4C56A 2VDOL 4KZDL 4GW5B 5F7EL 4G8GA 4M5YL 1F4XH 3KYKL 3FFDA 4OCXH 5I75B 4YNYA 2IPKB 5F7NC 3FQNA 2FR4A 1BZ7B 1IFHH 5INDB 4ETQB 4Z7VB 2HTKC 5BRZA 2ADIA 4WCYL 4CN6A 4ONHA 4HBCH 5SWSB 4TOYL 4KVNH 3QIWA 3DUHA 2EH7L 3VFMA 4LLVB 4PY8I 3ZO0A 5E5MB 2FL5B 2I60H 1UEYA 4Y2DD 2HLFD 2GTZA 4WO4B 4OQ1A 4Y19A 4YXHL 3ZHKA 5DDHB 4EIZC 2NY4B 4XP4H 3OXRA 4GAYA 3BDYH 1QFPA 2J4WL 3OQ3B 5DD3L 2VO5A 3NCJH 5JOFB 2IH3A 1WZLA 4O5LH 1AXTH 4PV8A 2VZTA 3MLUL 1GGTA 5KVFH 2AEPL 1QTYT 2KBGA 1LE5B 4ZNEA 2C4XA 1Q94B 3EDDA 3V8CA 5LGHH 2D0HA 2EICA 1H0DA 3Q1SL 3OKMB 1YNKH 3T0XA 1MJ8L 2ZSVA 3QXWA 1E4XH 1SJXA 4FTVA 4KMQA 4ZUUB 2OM5A 1I1YA 3O6FC 3W0WD 4G80A 5IHZA 1YNLL 1FBIL 1J8HA 3M07A 3DTXA 4NQEA 1OAKH 3L5IA 4N5ED 4WV1A 1A1NB 4Y4FC 3SKMB 4ZFGH 5K93A 5DGQA 1AI1L 4JPVL 1DBKH 2IPTL 3V4PH 3K74B 4V2CB 3BH8A 1XGTA 2DQTL 4PGDB 4YDVB 1YY9D 1Q72L 1KN2L 4YHYB 3GBML 3QDMA 1XIWD 4FOMA 2R4RH 2BHUA 3GMRB 1TJGH 1WC7A 1CGVA 1WF5A 1MRDL 3EFDH 1YC8A 4OZIE 3CDYA 3KYNA 1D9KA 3O3UN 4APQA 1A6UL 1V3MA 4G7YH 4UT6L 5E6IC 3RZWA 2EEDA 4HMEA 1Q9LA 1HHJB 1RZ7H 2FLBT 4JFHD 3QIBC 3RAJH 1MEXH 1H3WM 3L3OB 2F54A 3VFOA 5GRUL 1JRHH 2V7HA 1FFNB 5D1ZD 5MP6H 2DQEH 3IDGB 1B2WH 1F2QA 4MAUH 4P3DA 4G3YH 2HFEA 3FO0H 3LKOB 4K71C 5F70A 4NQSA 2HKHL 1RK1B 3P4OA 3W9DA 1CGSL 3BZFA 5J1AA 3QHTC 3SE8H 1VGEH 4K55A 3B9KD 2MMXA 4JRYE 4IMKC 1U8OB 2Y7QA 3N9GL 1D6EB 3UJTL 1UM4L 5T3XE 4NPYB 2DQDH 3P73A 3HZYB 4N9OB 1I9JH 4OSUH 4K8RC 5ANME 1J5OH 2XPGB 2DD8L 2B1HH 4I2XA 4JB9L 1YMMB 1JNNL 5FDWB 1K3ZA 1EEQA 3LV3B 3PNWA 1GGUA 5D5MA 5SX5K 5BW7C 2MPAL 1A7NH 3F8UB 4ZOCA 2WBJB 3V6OC 4NQUA 2W9EL 5ITBH 4TNVK 4PJBA 4QXGL 1I1RA 1NGYB 1PKQA 4LSUH 1P7HL 2JB5H 1TETH 3RKDC 4L3EE 2WZPD 5E00B 2X10A 1JGLH 4HIEA 1BAFH 1U8PB 3LN4B 2BXZA 4WU7B 5M95B 1A9EA 1FL3A 1W8NA 4LKCB 2Y23A 3CFJB 4OGAC 5FA3A 1MIMH 4FQ2L 3F65A 5GGRY 5KVGL 1FYTD 5D6CA 4PYGA 1Z9LA 5EIQA 5ACLA 2HG5B 3T0WA 1QFUH 1SBBA 2NTFB 4RFOL 3RVWC 1V7NL 4WUKH 1MNUL 1U8QB 1MCKA 1N5AA 1KB9K 4PV9B 1FFRA 1A2YB 3RUGE 2X44D 3IT8D 1QSZA 3QQ4A 3JWDC 4HK0B 4X5XB 3ZT6A 3H3BC 1KACB 4LCIL 3QFDB 1JGUH 3HZMB 4K3JH 1CXLA 5F1NB 4WFGD 2EKJA 3TIDA 1BD2A 3RZCC 1AIFB 1DL7H 5C0CE 1SY6H 1AKJD 3TIEA 3TN0A 5JIPA 1SBSL 3HI1A 3VFSA 4FFVD 4OTXL 3C8KB 4KRNA 1YUHB 3QUML 3HCVA 3EIFA 3NIGF 2K7PA 2W59A 2DJ4A 5T5NG 1WFTA 4JRXB 1ZGLM 4XNYH 3K1KC 3N1GC 4K7PH 3V9FA 2PXYD 1IQDA 5DVMA 2OMBA 3FQNB 4XPTL 5DEZA 4Q6YA 2BNQD 4XCFL 1GJIA 1G9NC 3T0EA 1XF5A 3EYQD 3SCMB 3QULB 4MD4B 1QBAA 1MCOL 3VWKA 5J06A 1RFDH 5C71A 3MV9D 4JKMA 2FEDC 3VFRB 3PE9A 2BVTA 4UOW0 2AI0H 5E2JA 3SO5A 1AGCB 3CMGA 3UTPD 1MAKA 1DUYB 2YEZA 3MUY1 4ZYKB 4N0CC 2UWEE 3ZE2E 5E03A 3QCTL 4AEHH 4MNHB 2YZ8A 4NZTH 3VU2A 4RFNC 4NWTL 3DGGB 2Z8RA 3Q6FA 2NXYD 4P2OB 3WO4B 4OCNC 1NGWA 4K9EC 5T3XH 1IAII 1BLNB 5MERB 2CD0A 5FYLL 1L0QA 4TUJA 3ZYOA 5DEFA 4KK5C 2IAMB 5EO9A 1WV7T 5J6GA 4WFHD 1NMBH 3L9RB 3QYCA 4O2CA 4QOKA 3TBYA 3GMPA 4OLWH 5CCKH 2XKUA 1L8JA 5IB1A 3CIQA 5E7BA 3UPCA 3OB0H 3R8BB 2QQLL 4OBSA 5DSCA 3LPWA 3L5JA 3RGVD 2CK0H 5ACZB 4WV1B 4JVWA 2CXGA 2GAZB 4NO2A 3NIDE 2A1WH 5TDNB 3RBGA 2N56A 3O8XD 5BS0D 1X5YA 5F93C 4N8VA 3VFTA 4JG0L 1KC5L 5EU7E 4ZAKC 4BFGA 3O3BB 3C60B 3M45A 1FGNL 1NC2D 1NKOA 1RZFL 3KYNB 4OM1H 3W0WE 4QRRD 5KSAB 1VGKA 1B6UA 2N1KA 5LXGH 5AWNL 1WWCA 4HEME 1PLGH 3RWJB 5D9SA 3O3EA 2GCYB 2B0SL 5HTSA 4Z77A 1JNHB 1UB5B 2IALA 1EJOH 3RWEA 1PSKH 4XVUD 4NC0B 3QNZB 4WHCA 2BMKA 3MLZH 2G2RA 2A74A 5DJCB 2QQKH 1DFBL 3EOBB 1DQMH 2C1OA 2F54B 1INQB 3QEHB 1XH3B 5DC4B 2X4QA 1DZBA 4JY5L 1S7VA 2ENYA 3MGOB 3MPCA 3V0AC 4ONGL 4U2ZA 1CLCA 2EYSB 2E9WA 3B8SA 1AD0A 1U92A 1FLRH 5SV4A 4DW2L 1MFCH 3MJ6A 2XIDA 3IU4L 4YHNA 3UROR 4ERSL 3DETD 4U2YA 2EDTA 1RJZA 3SQBA 4RMQA 2FX8L 3FO9B 5ELIA 5JW4R 2VXTL 1T1YA 5IBTL 3OAUL 4JFHE 1H15B 3D0VB 2OTWA 3NCMA 2HRLA 4RISH 1I3RB 3D39D 5MEPB 3MLWH 1Q1JH 3MV7D 3PGCA 2XZZA 1Z6JT 4IRJB 4K07A 1N64L 4U0RC 2YD5A 5I1HL 3ARGB 3I6KA 5I9QC 3KPQB 4MB5A 4I2XB 2B39A 3E2HB 2EO1A 4JM2B 5D5MB 5GGUA 3WNPA 5F3HA 5F9WC 3VI3E 4CAGA 1KPUB 1CFBA 5GGTA 1PKQB 1OT1A 4PRDB 2P7TA 4I0KA 2R0ZH 3KR3L 4P2RB 3ZMRA 4QY8A 3VD5A 3LQZA 1JN6A 1BQHA 1BVLA 4YXLH 3IFPA 4DVBB 3TVMC 2YRPA 2OQJB 2D7PA 1IM3A 2AGJL 1OF2A 5CS7A 3TJEL 1W0YT 1TPXB 5FA3B 5FCUH 4YDIH 4UIKH 4ISVA 3WHXB 3N1MC 4HJ0C 4ALAH 2WSKA 5JA8B 1JTTA 5E5UB 2IAND 4P0DA 3BYTA 5FOJA 4ZXBC 5FECB 3J7HA 2AJYH 4X6CE 3IYLW 4KTDH 4DGIH 1T1WB 5CILL 4OZIB 1QSVA 2ADJB 3BWAA 2NY2B 3UYPA 3Q48A 1IAOB 3NABH 1OSZA 2X89A 1OP5H 3RTQA 3TIDB 1LQVA 4L4TD 1NBVH 2Y06L 3ARDA 4LCWD 4TTGA 1FYTE 4OQTL 1G6RL 3O45A 2DI8A 1GAFL 3TN0B 2I5YL 3I2CL 2WIMA 5CUSL 2HH0L 5I71B 4PB0L 5D2NE 4KHXH 4ZTPL 3AXLB 1ZANH 1DP0A 2NY0B 5E2UL 2P5EA 4MCYA 4ZFZA 3LEVH 1V05A 5CP3A 2CIKB 1T2QH 2X4RA 1MCIA 4TNVF 1QD0A 4OZHA 1YQVH 4MJ2A 2AQ1A 3PDOA 4WFGE 1AO7D 3BPCB 1AY1H 1N0XH 5GIRA 2FLRT 3SKNB 4MYWB 3F5WB 4JRYB 5F7DA 3SO3B 3MRKB 2DWDB 2V5YA 3NIFE 5CZXC 1KCRH 3INUH 3VWJC 3EOYG 5DS8A 4WUUD 5FEBA 1T66D 3EYFB 3IGAB 5L2KD 3VGDA 5CP3H 4YX2L 4F7PA 3GHBL 5IHLB 1NANH 4DQOL 1BVKB 1TTUA 3BQUC 2VLKB 1ZOXA 2BNQE 5JIIA 4U4BA 4WNQB 2M2DA 3BKCH 5KBNC 5H37G 3IRZA 3FQWA 3S96A 4Z0XB 5GJSL 4U6VH 4XVSH 3GMLB 3ILPA 4GXUM 1G84A 5GHWL 3HR5A 4Y5XC 5DRZB 1NFIA 2VMFA 3ARBD 3WS3B 3MV9E 1CDIA 1UCTA 1ZS8B 4M48L 4QHKI 4L3EB 3QXTA 3WN5C 4EBQL 4HXAH 1X5HA 1ETZA 3UTPE 5C0BA 1F11A 1MOEA 3LY6A 5DJDA 1Z9MA 4MA8H 5EO9B 1J0ZA 3N85L 1LK3L 5C0IA 3GMPB 4HUVB 3OKOB 4PJIF 3SQOH 4M1CD 3U7AA 3D5OF 3C6LA 5I76B 2VC2H 5DF0A 1ZLWK 1H3UA 2MKWA 4MA3B 5C86A 4RX4A 4U1NA 1NCAH 1QNZH 4UV4L 3WFZA 4MAYB 1AGFB 2DAVA 3PHQB 4PJHA 3W2DH 4KK9C 1KV3A 5TF1H 4PRHA 2DYPB 2D9CA 32C2A 2ATPB 1OCWH 4QYOA 4NJ9L 4WFHE 1KXTB 5C0CB 3AY4C 3WNLA 3ZKND 4NNYB 5F9DC 2PKDA 1MHCA 1FGVH 3MLRH 3ECBB 2A6JB 5E8EA 1C5BH 4WGVB 1J86A 3TZVA 2XWBA 5EC1A 5EFIB 4XNQA 3I75B 1CE6A 4KJQC 5HGAB 4EQ3A 5E9DA 4YK4B 4RDQG 3ZTJG 5A43C 3MLVH 3CU7A 2Q3ZA 4FABL 5BS0E 3UCRA 5FHAL 2G2RB 3OR6B 5ITFB 5HJ3A 2OZ4L 1UWGH 2P24B 1W2KT 3HMXL 4LU5H 5D93B 4OLUH 4QRRE 4S1QH 5KVEL 4WEUD 1JL8A 5CJOL 4HUNB 3MRFB 1RHFA 4OAWB 4JANB 1MUJA 1ZVHA 1FSKC 1M05A 1MJUL 1R5WB 2P48B 4PJ5D 1ZT4A 1UC6A 5EO0B 3DMMB 3HNVH 1LEGB 6FABH 1BBJB 3HNSL 4IRSC 4BFIB 3SDYL 1K4DB 3WUZA 2UWEB 2JB6A 2VXQH 5CEXA 4QTHA 1QSEA 1OAYH 1RZJH 2FB4L 4M6ML 4WI6A 5GZNC 1DUZA 2EDQA 4JFED 4W4OA 5L6YL 1UXWA 1RURL 1T1ZA 3CH1A 2BOCA 4MVBD 3RVVD 2VH5L 1JWMB 4F9PA 4RBPH 3ULUH 2VOTA 5FF6A 4QT5A 2YMXL 3RDTD 4LCUA 4C56D 4YHKH 1N59A 2Q7YB 4G8GD 3U36B 4DZ8A 3FQUA 2EH8L 2Z91B 5GGUB 5E8DL 2R1XA 1J88A 2V2TA 5DEGB 2P43B 5CFHA 2FNBA 4MWFB 4QGYA 1BBDH 1PD6A 3IRPX 1P4BL 2AJSH 3D39E 2Y07H 4OIIH 3MV7E 3GEWB 1UYWH 4JHBA 4YHPB 5BV7C 4KPHL 4XX1E 3QIWD 2VSDA 3MNWA 2CR6A 5HPMA 5J0BA 3T1WA 4X0KA 1PW3A 2EC9U 3RJDA 3F7VA 3L5XH 4EOWL 3DI2B 1I4FB 4GQ9L 2H26B 5KANI 2XQYG 4I8DA 5DFVD 1PJ9A 4LBEB 3QR2A 5GS2D 1RQ5A 3EFFB 2RCSL 3CX2A 3MBEC 1NMCC 4HPOL 4AEEA 1S7WA 4AG4L 4XCCL 1CFTA 2VKXA 5ALBH 4XCEB 4HG4J 3I02B 2NY5L 4HIIA 2VLMD 1L6XA 4YO0B 1NGPH 1HSAB 3VDAA 1ZWIA 3ARFA 4DKFH 3RA7L 4P2QA 5J7CC 2CIIA 1F4YH 4M4RA 5EOQL 1JV5B 5GS3A 5FUOH 3VH8A 3PGFH 8CGTA 4NWUH 5FYKD 1IGMH 4CADB 3ALWA 1YY8A 5I1JL 2BVEA 2IANE 3ULVD 3MZGB 1XIWB 3QJHA 2AABL 4FTVD 3T1FA 1ZEAH 3UTSA 1A14L 3KLAA 1D3CA 4HC1L 3CC5A 4OFKA 2X4RB 3H3KA 2VLJA 2KKQA 3S35H 4OZFA 4RWYH 4OZHB 4OD2B 2DQFB 4B0MM 5EU6A 2A6IB 4XP6H 4JKPL 4L4TE 4R4FL 4JFFA 3WFBL 1ZHKA 4LCWE 2NZ9C 5I1IH 3C08H 4HX1A 3GNML 4KRPC 4Z8FH 1A7RL 1NQBA 3UTQA 4CGTA 4UAOB 3ZKXB 1NFDA 3FT4B 1JI1A 1ZLVK 3JTCA 1HHGB 3SGJC 1D9KD 2VDKL 1I1AD 4CNIB 2EE6A 4LPYA 1GIGL 1TQCB 3RWCA 1FNEB 4XXCC 4QWWC 2VL5A 4OCRL 4Y4HD 4XH2A 5T1KD 4M6OH 3WCYA 4IRZH 3PWNA 1AO7E 4XBPA 4OZFH 1ZHNA 3Q0HA 1NCBH 4OLYL 5JHLH 2ICWB 4X5WA 5CJQL 5I75C 4L9LA 4ZOBA 3WKML 2EDBA 3T4YA 3MRBA 4NN6B 1C5DB 5D7JB 1PZ5A 1B90A 4J6RH 4Q6IB 4WUUE 1WGOA 4TRPL 2B20A 2XA8H 5L2KE 4YDJA 1WAAF 1ETZB 5K9JL 4FFZH 4X4MA 5GRYA 2YBRB 5KS9F 1KCGC 4WO4C 1IC7L 1JHKL 5C0IB 1H9VA 5IEHA 2WWKO 1LD9B 2NY4C 3MBXH 2VXVL 2CKBL 3C6LB 4Z7QF 5I1EL 1AC6A 1JYVA 5HYEA 1U93A 2HTLC 4OZGF 5KJRL 1RUML 4XXDB 3RQ3A 3C2AL 3VGEA 4U1NB 1IC4H 4X6CB 5D8JH 3P11L 1BOYA 4NFDA 3ZE0F 5HI5D 2APTA 2R1WA 5EIIA 1HQ4B 1QFOA 1A3RL 2F5BH 2Y4SA 1WUNT 3GJEB 4WU5A 4BZ2L 1MPAH 32C2B 5F8RC 1RHHB 3MRQA 4QYOB 5L7XL 4S1RL 2ZCKH 3KPPB 4ZFOA 2IBZY 3UZVB 1DDHB 3BIKA 2VN7A 2BCKA 4CMMA 3NACL 5ENWA 1KLGB 4XC3H 3QUZA 4HFUL 5CHNA 5DJ8A 5HDQL 1UB6A 4KQ3H 3MRDA 1ZLSL 1GOHA 5DJAA 4QCIA 1N4XH 4J3VA 1IGCL 4DAGL 3D0LA 4EQ2A 5E9DB 4HLJA 2EZ0D 4O58L 3UO1H 4FQXA 5KOMC 3FB6A 3SDCA 3BGMB 2D0GA 4LPVA 4JQVA 5ILTH 4Y16B 5GS1B 5HJ3B 2PCPA 5CEZD 2Z0BA 4HAGA 4YHYC 3QXDA 1OAQH 4LRNH 2YA1A 3BX7C 3O3DA 5F96H 1A7OH 4NKDA 4DN3L 5DA0B 5GGQL 1MUJB 4HUMB 3KYOB