4WDIA

Weak tcr binding to an unstable insulin epitope drives type 1 diabetes
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
277
structure length
277
Chain Sequence
MGPHSLRYFVTAVSRPGLGEPRFIAVGYVDDTQFVRFDSDADNPRFEPRAPWMEQEGPEYWEEQTQRAKSDEQWFRVSLRTAQRYYNQSKGGSHTFQRMFGCDVGSDWRLLRGYHQFAYDGRDYIALNEDLKTWTAADTAALITRRKWEQAGDAEYYRAYLEGECVEWLRRYLELGNETLLRTDSPKAHVTYHPRSQVDVTLRCWALGFYPADITLTWQLNGEDLTQDMELVETRPAGDGTFQKWAAVVVPLGKEQNYTCHVHHKGLPEPLTLRWKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, K-D alpha chain
publication title Distortion of the Major Histocompatibility Complex Class I Binding Groove to Accommodate an Insulin-derived 10-Mer Peptide.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 67
structure length 277
sequence length 277
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4wdiA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4wdiA01
2ERJB 3W5NA 1XF3A 2IANB 5C3LD 3O6FB 1EHLH 5IB4B 3BH9A 1I1AA 3HNSL 1HQRA 4KWUA 3Q3GB 3RL1A 4M1CC 1JYVA 5FFLA 4ZOAA 3OMZA 5IVXF 4KRLB 4LCWA 2JKXA 2QQQA 4LPXA 4MVBC 1OARH 4H88L 4J3XA 3NACL 3OKMA 3IU4L 5E9DD 1KCUH 4EZMA 1YEEH 4DCQB 3MRRA 4LLWA 3V4PL 5T3ZE 2VLJD 3TNMA 1DLFH 4PTUA 3S8WA 2E8ZA 5GHWL 4Y16B 1ZTXH 3OJDA 4K9EC 4OLVL 3SGJA 4I3SH 3HB3C 4NQED 4UT6H 1UCTA 4X9BA 4HEPG 1BX2B 1JCKA 2F5AL 4J7RA 4MSWA 3S97C 4F58H 1MCKA 3BN9C 5DVLA 1GC1H 5HGBB 2K1MA 2ZKHH 4UT9H 1GXEA 3SDXF 4G6AD 3BKCH 4NKIH 2E8YA 2HFFB 2OL3L 1QOKA 4UAOC 1JUFA 4NM8L 1TCRA 2PUQT 3PWVA 4BKLA 5D93C 1HH9B 3CDCA 1D6EB 4D0DA 3VH8A 4Z95H 2XRAL 4Y19B 5BVPL 3AXLB 3MZTA 4CN1A 4LLYA 1JZ8A 1RVFH 1UA6H 1QR4A 4XHJD 4E42A 1U95B 1MRFL 1R3HA 3C5SB 5CZVH 3ZKQD 1BOGA 1WTLA 2X4QB 2V2WA 4PJHB 4DZ8B 3WBDA 4K7PL 5E6ID 1FVDA 1GVIA 2VO5A 4QNPE 3MRMB 5JXEC 3MRLB 4RZCB 1EJOH 2F9BT 2BSED 4JRXB 2W60A 4OF7A 4QCIB 1U3HA 2J88H 4WV1A 1HEZB 4GRLC 1IGML 5F9AC 1V5JA 1BREA 2CK2A 3FL7A 3MJ9L 4KV5E 5K9JL 4WW2B 3WIHA 4RAVA 2LVCA 3WFDH 3L3HA 2VLMD 3JUZA 5D4QA 4XPAH 3W9DB 5L88L 4QRQB 5EOTA 2VWEC 3GB7B 4GO6B 4G6JL 1UB6B 5I18H 1WCQA 2NR6C 4R7NA 1FFNA 1LK3L 1UVQA 4G8GE 4JN1L 4KPHL 4IRSD 1YYML 1KB5A 3NZ8A 4ODUB 4K3EL 2RFXB 2GJ6B 4ZO9A 1JTTA 4YHKL 5CZXD 1OGAD 4TUKH 3FQRB 3VXUD 3OG4B 4X7TB 1OAYL 3MRHA 4RMRA 2XWBA 5IIEB 4FQJH 5JUEL 1ZT4A 2F54E 4MD4A 3FCTB 3VXRD 4J3SA 3P11L 4LK4A 3BSZL 2Q76B 4NRYB 4AZ8A 1U8PA 3P3YA 2ICCA 1S9WB 5JXAH 2W1NA 5EIQA 3C5JA 1ACYL 2O5ZH 3ARBB 3MLZL 4P48A 2AJZB 4UZGA 3X12A 2E7LC 3CPLB 4R2GD 3IDYB 3ARGB 4L5FH 4YDVA 4TPRH 2W0KA 1NFIA 2B7DT 3FN9A 4RMQA 4CNIA 2ZUQC 4HX1A 3BP6B 4D0BA 2VTFA 5FGSA 1NKRA 5EU6D 1HINL 1E0OB 3QUYD 3VCLB 1NDGA 4G59A 4OZHA 4ZXBC 4JPKH 4ZO6A 2DMBA 4OM1H 1CDHA 4XCYA 5E8EB 3BWAB 4Q6YA 2VLRE 5F71A 5IB1A 1YEHL 2ZOLB 1T3FB 1CGSL 5DJ8A 1FORL 4OV6F 1NJ9A 3WD5H 4FFYL 4LCUA 3HFMH 4FQIL 3AAZB 1C5DA 2QKIA 3QPXH 2R4RL 4MNQA 4M02A 3MGTB 3PQYD 1UCBH 3W9EA 3VRJB 1H5BB 1QLRB 4XP5H 1KG0B 5E9DB 3ZHLA 4X5XB 1QFWL 5EWIH 4JM2C 1CFQA 5KVFH 4YXKH 2Q7YA 2VLJB 3BEVA 4RBPH 4X0KA 3DMMA 3SBWC 3RY6C 4JQXC 1MVUB 4MYWB 3V5KA 1JPSH 3RGHA 5IK3A 1MOEA 4NQEB 4PJXA 4LLQB 1JPTH 4ZFGH 2AP2A 3ES6A 2XG4A 3ROOA 4BYHA 1J0KA 3H7BB 1A21A 3QJHA 2LTQC 2X5PA 1ZKAA 2FBJL 4QNPF 3QZWA 2P8PB 5IWLC 5DHYA 1NGXB 4YPGA 4B41A 5DJXB 3C87A 4KV5F 3BO8A 4MD5A 3TYGL 4P2QD 3VWKC 1O7VA 1BVKA 1P53A 4YWGL 1WCBB 3ROLA 2Y5TA 3MRNA 1JYNA 4PRBB 3G5ZB 3QDHA 2BNUA 1BQUA 5KSAC 3WXVH 3MV7E 1V05A 2K7PA 1J1PL 3JWDH 5MEOA 2PYFA 4ORGB 2R8SL 2H1PH 4OZGE 1FSKB 1CIDA 2A6KB 5DTFA 3IETB 2QSQA 1KT2A 5TQ0H 3UO1H 2EDBA 4LU5H 5JMRA 4BSWB 5DD0H 3WLWD 1M7IB 2FECI 4JAMB 4NKMB 2V2XA 1LD9B 4F80A 1N4XL 4UT7H 5F6HI 2AXFA 3OKLB 2XV6B 2PETA 2Q8BH 3EKCA 2GUOB 4PRNB 4Y8AA 3GBNL 5AZEL 4PJIB 1AR1D 1INDL 1FNEB 1KBGL 4IRSB 4UB0L 3RU8H 3UTTD 3TBVB 2P8LA 1D5MB 4BM7A 3GSVB 4P2RE 4XP4H 4R4NC 1OGAB 4LMQE 5FECB 3VXUB 1FZOB 2GKIA 4HWBA 5C0IB 3EOYG 2VDMH 4G7VH 3VXRB 3QDMD 2BVPB 3MOAL 4NHUE 4HS3B 2C1PA 5JQHC 5IHUH 3D85A 5KG9A 2V7NB 1H3VA 4HIHA 5AG9A 2FEDD 1FYTA 2M8XA 4ZUWA 3OAUH 2LU3A 1S8DA 4LNRA 3GFUA 1KEMH 4XAWL 3FO2A 5F3BB 5GXBB 4R2GB 1ZGLB 5ILTH 4Y5XA 1NC2D 1R6VA 3T77B 4PGJA 3Q6GH 3BZDA 5LXGL 1UJTA 5EDXA 5HVGB 1CDGA 1T20B 3QUYB 5CGYD 3BD5A 5FM5O 4WJ5B 4OD1L 1MJ8H 1QPXA 3HRZB 4FQ1L 1PZUB 3GSNA 4NWUL 4WO4D 3IYLW 3Q5YA 3QEHB 4WHTB 3A67L 5DRXB 1ONQA 1PLGL 1NCWL 1X5YA 1A6WL 5JNYB 1BFVL 3NPSC 4HH9A 1UWEL 3LZFH 3W2DH 4BQ8A 4PRDA 4GKSA 1NLBL 2OZ4L 4KKLD 1NMAH 3PQYB 1CF8H 2P42B 1WZ1L 5E2WL 3EJZD 3UJTL 4RWYH 1D5ZA 2CO6B 3P9LB 4LGPB 3B9VA 3BD4A 2JE8A 3STZA 3VFGL 5H37G 3BT2L 4HPYH 3SQBA 1JWMA 4M7LH 2AABH 4QHUB 5EUOE 4I13B 4X98B 4CVZB 3FJTA 5D72L 3SE9H 3MNVA 4KKAC 4HKXA 2A9NL 5DYOA 2OP4H 1I1YA 3AROA 4K7PX 3P73B 4X4MA 4OZGF 4UBDC 4X4YB 5J89A 3GJFA 4XP1H 4I1NB 5DGQA 4BQ9A 2XN9E 3OHXB 4M8QA 1HOCA 1IGCH 4UNUA 4GS7C 2IANE 2PF6A 4P2QB 4O5LL 1SY6H 2W07A 3U9PL 5L2JB 1FP5A 1I7ZB 3GMOB 2B0SH 3ARSA 3MRKB 5EG6C 5D7LA 4HK3N 3VXSD 3BZ4B 5CEYB 4FHBD 3K7UA 4U49A 4OI8A 5MEPA 3X3FL 1NMCB 3VFNB 3T3PE 1ADQL 3DVNA 2G2RB 1XF4A 4YEEA 5GZOD 4CKVX 2GSGB 1MJ7H 4OAWB 5DFVD 4PJFA 1L7TL 2Z91B 3NFNB 2NMSA 1G1CA 4Q9QL 4U1GC 1RZJH 3MCKA 5DC9B 4YUEH 4RMSA 2XKNB 4JQVA 1OW0A 1QLFA 5T33L 4PJCA 3VI4E 1KFAH 3GSWA 1MHHA 1K6QH 4J23A 1MLBA 2OXHA 2V9TA 2DAVA 4KU1A 1GAFH 3UTTB 1NBVH 3BEWA 3BW9B 5SX4I 3D69A 4PJAA 2APFA 5JZ7D 4DK6A 4WY7L 5KS9B 3L5IA 1M05A 2NNAA 4RX4D 2NZ9D 5DJZB 4WI7A 5DO2C 5HVHC 2NX5A 3UBXA 5C0JB 4Y4HA 1TCMA 5HHPB 3QDMB 4Y19E 1WT5A 2XY2A 4XCEB 2WV3A 3AGVA 1RHHB 3CK0H 3ZDYE 4J12A 1N6QL 4HAFA 1UKSA 3R0MA 1QD0A 2X2YA 3UDWC 4M6NL 4PJHE 3IRZA 1RIUH 3OKKA 4E0RA 1RI8A 3DOSA 4PJDB 2A2QT 2AGJH 3CU7A 1VFAB 3JWOH 3OL2A 4NNXB 1NC2B 1W0WB 4XRCB 3U6RB 1E4XI 3BMVA 3IB4A 3QQ4A 3TYFA 2E6PA 4OTXL 3S4SA 2Y25A 3QULB 2GY5A 2ZG3A 2RCSH 5MERA 4TUOB 5D5MB 4LEOA 3HLAA 2IEPA 4XNQA 1MCLA 3DXAD 2BVUA 3E8UH 4WO4B 5C0CA 2GK0A 4JG0L 2CK0H 3ARPA 1HYRC 3M17B 1BQHB 2P24A 4UV4H 3ZYJA 3X3GL 2VLKD 3F58L 5TE4H 1LP9A 3QUKA 2R69L 2V2TB 5JPNA 5EUOF 1FGNH 5C0EA 3QJFA 5GZNC 5TJWK 3IDUA 2IH3B 4N5EC 4U1KA 1HQ4A 4R97B 4GQ9L 2PCPB 3MXWH 3DX8A 5H2BA 1NH6A 1NDMB 3SDYH 3T0ED 5LGJA 4HWNA 4Y5YB 1AGBA 3LKRB 3H42L 2DQHH 1MVFA 2FO4A 2FH6A 3L3IB 6FABH 4HG4J 1PYWA 1MLCB 4WRLA 1YQVH 1S5HA 3B9KC 4K8RD 3DX9B 1UJ3A 5C92A 4XBPB 3B6SB 3ARYA 2FJFB 4P2YA 5EC2B 4UOW0 4KDVA 1AGEA 5FYJL 3QUXD 4OUOA 5K93A 3T3PF 2IG2L 1N7MH 4PJ9A 3B83A 2OQJA 3LEYL 5D6CB 4JB9H 1VFOA 2ADGA 5GS0C 5F7EH 1BWMA 3DUUA 3FQXB 5EO1B 4N0FA 1D5XB 3BAEL 5FYKL 3VXSB 4G6MH 3ZO0A 5MP6L 1QBML 1FL3B 3VI4F 2OK0H 3DBXA 1NLDH 3MXVH 1T6WA 2YPLA 4XB8A 4F15B 5E9DE 2VXQH 3G5VB 3LEXB 1UC6A 2IQ9L 2Z8VC 2NY3D 2VLJE 1HSBA 4PJEF 5DJAA 4PP2B 3DARA 3G5YB 1ETZB 1G7PA 3RNKB 5GGVL 1EBAA 1EO7A 1U0QA 3BKYL 4NNPH 5E00A 2DI8A 2NTFA 4LKCA 5GS1A 5FKAB 3VG0L 3ORJA 2W9LA 1ZSDB 3IF1A 4MZ2A 3BP5B 4EI5C 4PJHF 4AENA 1WFOA 1CQYA 3HAEA 4TSBH 1EK3A 5F7YC 1CFNB 4FZ8H 2C4XA 1RJCA 3HA0A 1JK8A 2BRRL 3TFKA 4IOFD 3PJSB 3HC3L 4WTXA 3QO0A 2ILLA 1TJIL 5KOMC 3L95A 1ZEAH 1D5BB 2DQFB 3CUPB 5IVXA 2H26A 5KVGH 4P9HH 4HXBL 2VXUH 1J7VR 2AQ3A 2JELH 2C3GA 2FGWH 3REWA 4TNVK 3CSGA 2D7QA 2R0ZH 1KTRL 4NBZB 3ULVL 1DBAL 4PGEA 3NCEB 1JRHL 4K3JL 1JNLH 3H0TA 3CFEA 1D5IL 3KJ6L 4FQ2L 4K3HA 2O5XH 5J6HB 4ETYA 3P9WB 3PDDA 4KK8C 4U6VL 5A2FA 5EZIH 1NAKL 3O4LE 2J6EL 2VLME 4YXLH 4P23C 4ZFOA 2BOCB 4XMKL 5T1MB 3GIVA 4NCC1 4LFHD 3QCUL 2QR0B 3QNZA 1S9XB 5JHDE 4D9LL 3DXAB 4NN5B 1TVHB 5JORB 2IBZY 4M62H 5CJXA 3SDXA 4PJIE 4GG6B 1FCCA 5F7NC 4FQCH 1EZVY 3QEUA 2VLKB 2YK1H 5AUMA 1RZ8A 2AJYH 5F6IB 1IGFL 5BO1H 1OGAE 2JIXA 1V7NL 3ULSB 1C1EL 1FIEA 3R1GL 3RVVD 3B5HA 5C9JA 2YZ8A 3U7AA 3VXRE 3O6LH 4IS6B 3BD3A 4DKFL 2FO1A 1DBKL 5IM7B 5C71A 1KN2L 1NUFA 1B6UA 1AP2B 1FNFA 2VNCA 3O2WL 1IC7H 1YNLH 2WINB 3KAAA 5E2UL 4PYGA 2QHRL 4CBPA 3IFNL 1NL0H 5IMOB 1HHIA 1RZFL 2O5YL 2DQTL 2BY0A 2IFFL 5HI4C 2IBZX 4W6XB 1S7TA 1OSPH 4HIIB 5E6IC 4XCFL 1JZ2A 5DWUH 3WFHB 5J11B 2D31A 1FLRH 5EBWA 2A9ML 3OJMB 3CSBA 1AIFA 4F2MB 4ZUVB 1MHPL 2X9YA 2JJTA 2NY6C 3HNSH 3IXTB 1Q94A 3ARFC 1V3JA 1L6XA 4AEFA 2XFXB 3FFCA 1ORQB 3DX7A 4H88H 1EHAA 1HXYA 3NACH 1S7VB 4HBQA 3O81A 2P5EA 3IU4H 2I07A 3KPRD 3P9MB 5CBAA 2WBJA 4WENB 4P3CL 4LCCA 5CIPA 3RX7A 1TETH 2FHBA 1RUML 3ULUL 1EV2E 3RY5A 4HLZH 3IJHA 3N06B 5GHWH 5J0BA 4QHNB 3RGVB 4OLVH 5TE7L 1TQBC 4WU7A 2FIRT 3EYFB 5FO7A 2F5AH 3LKPB 1FV1A 1BF2A 3Q5TA 5BZDA 1ORSB 4NM8H 3N1MC 4EBQL 4M6OL 3WLBA 1RUQL 1ZV5A 3EAKA 4KQ4H 1IAII 1R3LB 5DMGD 2XRAH 1J0JA 5BVPH 4MCYB 2GSIB 2ADIA 1FJ1B 1Q38A 4P2QE 4LAJH 1MRFH 1JNJA 3HE7D 4JQVC 3L3KA 4K7PH 2GIYA 1XH3A 5FA4A 1RK1A 1K8DB 4HK0B 3HCVB 4PJIF 3LS4L 2QEJA 1ND0B 3QDGD 1CGUA 3MJ9H 3IDIB 5K9JH 3FT4A 2ZCLL 4Y4HC 4G42A 2EE9A 2UYLA 5MI0C 1WT5C 1HIML 4XNXL 5L88H 1I85A 5DUML 4KVCL 3DVIA 1FHGA 4LAQL 3RDTA 5C08A 4G6JH 1A4KB 2WIIB 1X9QA 3UTQA 1HHJB 4X7SL 3GJEA 4IIQA 4QF1A 1LK3H 1KENL 2CDGA 3ABZA 4JN1H 4KPHH 1MCBA 3V52L 2P7TB 4JZOB 4Z18A 4K3EH 4JFZL 3SGEH 5JW5A 1A1OB 3GSQA 1YEFL 4YHKH 4DVBB 3MREA 3T4AA 4FQHA 4MX7A 3EYUH 4BH8A 1OAYH 5KS9E 2DYPA 1IM9D 1HZHL 5JUEH 4GMSL 1F4YL 1RULL 3P11H 5D9SB 3D2UA 3F7VA 3QDME 1DBML 3BSZH 5FYJD 5IKCB 1P5UA 1U58A 2PTUA 5LAXA 5I71B 3REVB 5GGVY 4V1DE 3ILPA 1ACYH 4J2XA 3LPWA 2J8OA 3MLZH 1KIPB 3I50L 4G8GA 1FAKT 4PLKD 2XZAL 1NCDL 2OMNA 3ZHDA 4PJDE 3EBAA 2Q3AA 2JB6B 1JNHA 4L9LC 5ACLA 1OTTC 5FYKD 3TBSA 2Q20A 1L9MA 2AXGB 5ERWB 1EEZB 1BFOA 1LEGB 2F54A 1IC5L 2CRYA 1KPVB 4ZS6C 1N0XL 4P46C 4YR6B 4JFHD 4HCRA 2CRMA 5D5ME 4YDLB 3OAYK 5C0GB 2HT3D 2P46B 4PR5B 3WFBL 5D1ZD 3U0PA 1G9NC 3MTRA 4Z6AT 1YEHH 3S3PA 1T1XA 3HE6A 4X6CB 3S98A 1YN6A 1FORH 5JLZA 4FFYH 3U7YL 1JBJA 4FQIH 2P8MA 2APWA 4KY1L 4TUJA 3GGWB 4Y4FA 2DKMA 3U30C 5HY9B 3BPOC 3PNWA 5EBMA 2AKRB 3KPRB 4HGWB 1QFWH 2OBGA 3OJVC 5EBLA 1PG7L 2COQA 3HZMA 4PJ9C 1IAIM 4B7LA 1U6AL 2WBWB 5IHBA 1YMHB 1MWAL 2MQ0A 2VLRA 4NUJA 2X9WA 1XGYL 1G9MC 1FNGA 3V79C 15C8L 1UKTA 2DQIL 1KIRB 9CGTA 4QWWC 5JW4R 1H15A 2FBJH 4HS8L 5D7IB 3CLEL 3WO4B 1LDPL 2NY4D 4F3FB 3BPNB 3BP7A 4WHCA 3RVUD 3SDAA 4IDJL 4X9GA 3AREB 3TYGH 2EDWA 5E1AB 3MJGX 3QNYB 1A6TB 1TJHL 3HE7B 4GW4B 4K8RH 4N0CC 1CE6A 4KI5E 3UTPD 3DIFA 3VXSE 1UXSA 1J8HD 1UM4L 2YSSB 3BDXA 3TIEA 1J1PH 5C6TL 4Z76A 2R8SH 4LKXB 1IC4L 2ZZUT 2I27N 1YQ2A 4QTHA 4JKMA 3GSUA 4IRJC 3ME0A 4JANB 3QDGB 1Z9OA 1CZ8L 3WIFB 1SJXA 5KS9F 3O6ML 3O9WD 1MY7A 4ODVL 3CNKA 2NY1C 2R2BA 1NANI 4KVNL 1N4XH 5JHLL 4LVEA 2CGRL 3EYOB 4HK3J 3GBNH 5AZEH 4HT1L 1JHLL 2C7UA 1NGZA 1INDH 1MCHA 3F8UB 1KBGH 1X5JA 3MV7A 3NZHL 4UB0H 4BSVB 5JR1L 4CADA 4YC2B 4PJDF 1S7RA 1P4LB 1UB5A 3QUZD 1EAPB 5HGDA 5D1QC 4LSTL 1IM9B 1NUNB 4YAQA 4MNHB 2IBGA 3MOAH 1YMMD 2BY2A 2BRQA 3FKUS 2OI9B 5E94A 1AD0A 3UX9B 1YN7A 1FN4A 4JFPB 4JO2L 1XIWD 1GOGA 2NXYD 5D5MF 4M6ML 4YO0B 3G6AA 3MGOA 2M26A 5CJXC 4XAWH 2ESVD 5F3HA 4LOUC 1YEDB 2EYRA 1TVBA 1IEBA 5A3IC 1GGUA 4QY8A 3V7MA 3OAZK 1AFVL 4P2RA 1RUAL 4POYA 5JOFB 3V0WH 1JGVL 5A16B 1S7UA 1XR9A 2FD6L 4S2SB 1JPST 5LXGH 5IHZB 4LHUB 2B5IB 5A2JH 3IFPA 1W2KT 4NHUA 3OQ3B 4CU6A 4U1IB 4PGBA 1UWXH 1FFOB 4OD1H 4R3SA 4CJ0A 2IAMD 4FQ1H 2ZUXA 4X6BB 1JPFB 5CBEA 4XC1H 3ULUD 4NWUH 5JIHA 1F11B 2R1XA 3DXAE 3A67H 5D1ZB 4AQ1B 2V6HA 1JP5A 4S1DC 3T0AA 4D3CL 1PLGH 4PP1D 4MQXD 1P9MA 4GG6E 1NCWH 1NEZA 2VLKE 3EHBD 3PP4L 1A6WH 4ELKA 1BFVH 1MEXL 1P69B 1UWEH 1YZZA 2DM2A 3VXOA 3VRIA 4U1JB 1UWGL 4AM0B 1NLBH 2OZ4H 5HJ3A 43CAA 4X6FB 1C5CH 5BZWA 1WZ1H 5E2WH 2BSTB 1XZ0B 4PB0L 1HHKA 5DHVB 3UJTH 1EFXD 3M1BA 1U8HB 4OB5L 4BUGA 5I30H 3ZSSA 3GRWL 4R0LA 3U0WL 4YFLF 5D6DA 3VFGH 4G80B 3BT2H 2NZ9C 1VHPA 3PV6B 3O3DA 5F89A 3VFUB 3KPPA 4HC1L 5ICZB 1FAIL 4F9PA 1IZJA 5CJQL 5J57B 1HI6A 4DGYL 1T22B 5D72H 1A6ZB 4KI5F 5ETUA 3LSOB 3GKWL 1IKFL 2A9NH 2YUZA 1WZMA 1P7QD 4YK4C 3SO5A 2WBJC 4JY4B 4OKVB 4UUJB 1JN6A 2NY4B 3JBG7 1Q9LA 4KJWC 2P4AB 3KPNA 5D2NB 1OWWA 1BF8A 5EO0B 4RGOL 4O5LH 4XNYL 4PG2A 4A6YB 3U9PH 3ERYA 4P2OC 1VERA 2CIKB 2DDQL 5TH2B 5KSBB 1OP5K 5EUOA 1OGTB 4QHKI 1MHEB 3BE1L 2A1WL 3CC5B 3UZQA 3GBLA 2NW2A 3UPCA 1NGWB 1J8HB 3HZYB 1ZWIB 1ES0A 3GI9L 1ZA3A 4NO2A 3X3FH 1HNGA 1ADQH 4L8CA 2NLJB 5E6ZA 1DUZA 5FOJA 1LK2A 3A6OA 1Z0MA 3DO7B 2XN9A 2VQ1B 1G84A 3O41A 4F9LA 3DRQB 1L0YA 1L7TH 5EB9A 3O6FA 1YJDC 1YNTB 2HJLB 3O9WB 5IB4A 4Q9QH 2GCYB 1LO5B 3HC4L 3Q3GA 1T21B 5B38B 5T33H 2XKSA 3T0EC 3HI5L 3MBXL 1EEYB 3FQTB 1PY4A 4J3UA 5E70A 5EZLB 4WY7H 5IF0B 4DCQA 3QUZB 1HE7A 3CFCL 3BYTA 3PWLA 4ODXB 3L7FA 4LQFL 1CICD 1YMMB 5J11C 1S9VB 4H0IA 1N6QH 1ACZA 2BY1A 3RDTC 3QUXC 1XIWB 4RGND 4GT7A 4M6NH 5C0RL 5FDWB 1PZ5B 5HGBA 2ESVB 5HXMA 1J0IA 5TDOB 1MCWW 5GGSA 2P45B 1VGEL 2HFFA 3TNNB 1UACL 3OR6B 3D25B 4PJEA 1NBQA 2BCKA 1D6EA 2YRZA 1A02N 4M7LT 4OTXH 2RAMA 1HK6A 2ATKA 3VXPA 4UQ2B 4Y19A 3B2UD 1OTUD 1VCAA 1SHMA 4D94A 1I9JL 1UKQA 3C5SA 3SDCB 4RMTA 3F7PC 2DLGA 5L6YL 2IAMB 4BZ2L 2X4QA 4PJHA 1W0VA 4JG0H 1WV7T 5E4IA 5IW1B 2NY3C 1B4JL 4GBXD 5IB2B 3MRMA 3X3GH 1CK0L 5D7JC 3MRLA 3F58H 4RZCA 4MWFB 4KJQC 2YD2A 4NZRL 2R69H 4QT5A 4QCIA 3OB0K 4WFHE 1ZAGA 4NQSB 2YZ1A 1HEZA 3CXDL 1JZ3A 1OPGL 3FZUC 1FZJB 3HUJB 2Z9TA 2FYYA 1N5AB 2DJ4A 4R4BB 4GQ9H 3W9DA 3KPTA 3OKOB 5IROA 1JTOA 1SBBA 3TT3L 4QRQA 5DD5L 2WANA 3GB7A 4QO1A 5T1LA 1U3YA 3EOTL 3QWQB 1UB6A 5EUKB 5FB8A 3C60D 4FFZL 2ICWJ 3H42H 4LDLB 5GJTH 3HE6C 3HNVL 1FVCA 1DFBL 2OXGA 3BRGC 3RZCD 2VXSL 3ALXA 2RFXA 3QIBD 4BK4A 4M4PA 5IIEA 4NUGL 2D9CA 4LSUL 1P7QB 3FCTA 3OWEA 2WNGA 5FYJH 4C4KT 3ZKMD 2VLLB 4JFFD 2IG2H 2Q76A 1FZMB 4NRYA 3C8KB 3X14B 3LEYH 4NQCB 1S9WA 4MNGB 5I1IL 3W81A 4QGTA 4K94L 4M3JA 3ARBA 3N9GL 2AJZA 4Y2DC 3CPLA 1SY6A 1IL1A 3ARGA 4JKKA 2UVFA 1S78D 4X6CE 1HYSD 3BAEH 5FYKH 1MRDL 3WUWG 5MP6H 1QBMH 4G6FD 4JFXB 2X4SB 1AHWA 5ESAB 1F4WL 2XZZA 3A6CL 5BXFB 5DQ9B 4TSAL 1EH9A 3KPRE 3VCLA 2IQ9H 4Q58C 2HFEB 4N8VB 3DETD 4TN9A 4WUUD 5GGVH 5E8EA 3E0GA 1JF1B 3N85L 3BKYH 4JG1L 3G08B 3KVQA 4KAQL 1AI1L 1CFTB 2ZOLA 5DJ2A 3VG0H 4BFEA 1WWWX 43C9A 2EO1A 3L5XL 4F57L 3AAZA 5I1EL 1JI2A 1FL6A 4IMKA 5DHVH 1H3UA 5HYIA 5D7IE 1H5BA 3CX2A 1QLRA 1CLCA 1KG0A 5E9DA 3QSKB 2BRRH 4HUXB 1XAUA 3HC3H 2AK4D 2VLJA 4MA3B 1TJIH 4FQLL 4S10A 3ARDB 4N9GB 3QIWD 1MVUA 1CICB 2H6PB 4XPBH 5EU4A 2GAZB 1DDHB 5B8CB 4HXBH 3WFCL 3BRFA 4RGNB 4LLQA 1J18A 5H94B 4XMLL 3H7BA 4OF6A 1DBAH 3ILQD 2VDQL 3UTZB 3CFKB 2P8PA 4K3JH 4P3DB 3P77A 1MCPL 5ALCL 4W4NA 1D5IH 1NGXA 4FQ2H 4YE4L 1N2RA 3WS6C 4CJ1A 4U1MA 1A1MB 3BQUC 4U6VH 5DJXA 1KIUA 1NAKH 1IBGL 5SV3A 2J6EH 4GRMB 1OM3L 3B2VL 3LN4B 4U6XB 4XMKH 1WCBA 3WIIL 25C8L 3PHOB 1AGDA 3QCUH 1A5FL 4PRBA 1T4KB 3G5ZA 2F8XC 3HRPA 5JIIA 3JZ7A 2QTEA 1MRCH 1EFQA 3I3EA 4GBXB 3AVEA 3EFDL 1F3RB 1MWAB 3RWGA 3AY4A 1PVHA 1MCFA 5HPMB 3FOLB 2A6KA 1IGFH 1T0PB 3IETA 1ZHNB 1IGJA 1V7NH 1C1EH 3TA3C 3HN3A 3R1GH 3TJHC 3UPRB 1FFQA 4BSWA 2EDEA 3O4LA 2BHZA 1M7IA 4JAMA 3ARTA 2X1OA 2VYRE 4NKMA 2Q86A 4DKFH 1DBKH 1G7JB 4ERSL 5FYJE 1R24B 1KN2H 4OFKA 1W0YT 5LQBH 3OKLA 4MA7L 5JHDA 2A0LD 3NVQA 3O2WH 5E2UH 2GUOA 1NCBL 2R4SL 4YFEA 3C60B 2QHRH 4PJIA 5DMGC 4C83A 1ZXQA 1FNEA 2BNRA 3B5GA 3IFNH 4KMTL 2P49B 3Q2CA 2O5YH 2DQTH 3MRGA 2R9HD 3OZ9L 3L5HA 2IFFH 3RZCB 5C0FB 4X6CF 3GSVA 5FUZL 2I5YL 1OGAA 5FECA 3C9NB 5FYKE 4C4KO 1PD6A 4XCFH 3T0BA 2HTKD 4FXKB 5GGUB 5C0IA 3VXRA 5L9DL 4HS3A 1LO2L 2AW2A 4GXUM 2OR8A 4JFHE 2V7NA 4OCMC 2A9MH 4JFFB 2Z93A 1S7XA 4PGCA 2CXGA 1MHPH 4P4KA 1GCFA 5DDHB 1DBBH 2KKQA 3UMTA 3L5JA 2GW5A 1R5WA 4MQ7B 1CDCA 1ZGLA 3QIUD 4QRUB 5B39G 1R5IB 3HG1D 4XVSL 2VDLL 3WV0A 4G6FB 3T77A 3VGDA 3QB7C 4NKOB 4M1DH 4Y1AD 4HKJB 1HCVA 1BZ9B 1UADC 4P3CH 5D7IF 3QUYA 3W11C 2H8PA 1XGUB 1RUMH 3ULUH 4L8BB 1PEWA 5HHVL 3HRZA 1K2DB 4WUUB 2YMXL 2QJDA 4WHTA 3BI9X 5TE7H 3X13B 4EJ1C 3WCYA 4DKAA 2VC2H 3G9AB 4CU8A 2AQ2A 1FC2D 5JNYA 1OP3H 3KR3L 2DLEA 3GMQA 1B9ZA 3UYOD 2VZTA 4U2YA 4E5XB 4RISL 3X17A 1RMFL 3K8KA 1CFSB 3ULVE 4EBQH 2BVOA 4M6OH 4I4WB 1BIHA 4PP8C 1S7SA 3FO9B 5DD6B 5JW4N 3PGCB 3IAPA 3KPSD 2AK4B 4IHOB 5D2NE 1U36A 3QIWB 3RWFB 3H9SE 1T03H 1NGYB 4M7KL 4P4RB 1M4KA 4QHUA 4NRZB 5INDB 3NH7L 5KSBE 1DJSA 4CVZA 4X98A 3UTPE 4J1UB 4FFEX 2NY2C 5B21A 2E7BA 3FN3A 1J8HE 1A22B 1C7TA 3LS4H 5L2KD 4WWKD 3P73A 4X4YA 3UZEA 1PFCA 1PAMA 2R2EB 3FOMB 4G7YL 3B5TA 2ZCLH 3OHXA 4JFQB 4QXGH 1HIMH 3L3OB 2LAAA 4P2QA 4XNXH 4KVCH 4AH2A 1S7QB 4LAQH 1I7ZA 3MRKA 2Q3ZA 3ARXA 4X7SH 3G04A 3BZ4A 4M7ZC 1KENH 3B3IB 3V52H 5CEYA 5D7SL 3NCFB 4OZFA 3MRFB 4JFZH 1KJ3L 3C5ZB 1YEFH 3VFNA 2R56L 3MYZA 4Z8FL 2G2RA 1ZE3C 3AFLA 1U8KB 2GSGA 1HZHH 3S5LB 3VWJD 4OAWA 4GMSH 1F4YH 1RULH 3OXSB 2Z91A 3NFNA 1DBMH 4JFDD 1YMME 5SX5K 3BHBB 5CJBA 5I73B 5ADPL 2XKNA 5DJ0B 5KAQG 1G6RL 3EZJB 3I50H 5TPWL 3C09C 2EDFA 2XZAH 3GM0A 5IFAL 1NCDH 4AEHL 3UEZA 5FM8A 3CLFH 4RFNC 3BW9A 2JTDA 4IJ3C 1OQXA 3FQNB 4M43H 3ZE2E 5KS9A 1F13A 5I76A 1IARB 3KXFD 4LLMB 1N0XH 5HHPA 4Z0BL 1GOHA 1RHHA 3RKDD 4XVUD 4KROD 1MF2L 1CU4H 5B4MD 5IROC 5BS0A 4GKNB 4V1DA 3WFBH 3ULUE 4OF8A 2DM7A 2ITDA 1OAXL 4C59B 1FRGL 1HHGA 4PJDA 4JO3H 5I74C 3VXMD 1I8MB 4WU5B 2AS5M 3U7YH 3DPBA 4NNXA 1NC2A 1W0WA 3GJFK 3HG1B 4KY1H 4XRCA 3U6RA 2LV4A 5IR1A 3V0VA 3HUJE 4RGMC 4Y1AB 3QULA 4JPIA 2Z35B 3ULVF 4I8DA 4LLDB 4TUOA 1PG7H 1EHNA 5D5MA 3RAJL 3PWJB 3I6LE 1A4JB 1MWAH 2VN4A 4ZNCD 3BGFC 4L4VA 15C8H 2E9WA 2NY0D 4JPWL 2DQIH 2NXYC 5KSBF 3TT1L 5E5UB 3Q1SL 1AHWC 4HS8H 1OF2A 4XWGL 3DV4B 4ZO8A 3LKOB 4KHTL 4EOWL 2IH3A 3CLEH 1OOAA 1LDPH 1WBZA 5L7XL 2OL3A 1CDJA 4GOSA 1DEEB 3O2VL 5J9PA 4XCCL 5DRNB 4KKNA 1QBBA 1Q1JL 1NDMA 3KPSB 4IDJH 4NQCE 3I6KA 4JDTH 4MNGE 3I6GA 5D96C 4Y5YA 1MH5B 3LKRA 3MACL 3L3IA 1TJHH 2EDNA 2Y06L 1C8PA 3K0WA 2UWEB 3O4OC 1MLCA 1EEQA 2Z92B 3DX9A 1M6OB 5J13C 1UM4H 4DFIA 4XBPA 3WDIA 4DN4L 5F72S 4TULL 3B6SA 4ZNEE 2FJFA 3RVXC 1IC4H 4MQXC 3MRDB 5L2KB 3LPFA 4JDVB 4WWKB 5GGRY 4AIZB 5IJVB 1CZ8H 1JF6A 4H1LB 5D6CA 3O6MH 3MJ9A 2FLRT 4ODVH 1CXIA 4H26B 5JHLH 3FQXA 5EO1A 2W0PA 1IT9L 1A9EB 1D5XA 3VXSA 4HT1H 1JHLH 1A3LL 1FL3A 3NZHH 5JR1H 3A6BL 5BOZG 5DQJB 3V6BR 4LIQH 4HQQL 1YDPB 1NEZG 3T1WA 3MV8D 2PR4L 2Y72A 4NO5B 1P6FA 3LEXA 2ZP0T 2N4IA 2CIIB 2DLTA 4LSTH 3ZE2F 3VWJB 3PUCA 4PP2A 1ETZA 3RNKA 2LQRA 4K9EL 5AAMA 4JFDB 1QVOB 2EDLA 4PB9L 4JO2H 5I75C 3TO2B 4OCXL 5ICYB 4M6MH 4RGNE 3CVIL 3EO0A 1H9VA 5KN5B 1ZSDA 2O93L 1D7FA 3OXRB 3BP5A 3PGFH 1L9NA 2CUIA 2YA1A 3U36A 5HHOB 3ULUF 1QFHA 1GGIL 2HT2D 1O0VA 1B6DA 5F1OB 1AFVH 1EHXA 2MKWA 1RUAH 4ZODA 5L8KB 4Q6IB 1JGVH 2CDEB 3DJ9A 3DUSA 3DVGA 2FD6H 2IWGA 4RX4A 3T1FA 5I8EB 3KXFB 2E27L 4WEUD 1RK0B 1I8LA 4MB5A 3HUJF 5F9JA 2CKBL 1A64A 1D5BA 1FO0L 4KROB 5DRZA 2DQFA 1W8NA 3CUPA 1BVLB 3PP3K 2DLHA 1JWUB 3K4AA 6CGTA 5I1KL 3MBED 3NN8A 5ITFB 2ICWI 1MFBL 3PP4H 5DJYB 3VXMB 4PYHA 2E7CA 3U4BL 1MEXH 1Z9MA 3P4LA 4BZ1L 4MXQC 1UWGH 4V2CB 1OAKL 4V3DB 5I17B 4HPOL 4ZAKD 4UIMA 3KYKL 3RIFF 1SYVB 4PB0H 5JO5B 3U0TA 1MY5A 4OB5H 3QQ3A 4NQTA 4HJ0D 2BOCA 5HYEA 3K8LA 3GRWH 3U0WH 3DI3B 2XQYG 1CD9B 4P4KC 2QR0A 1S9XA 3DXAA 5TFSL 5JORA 1TVHA 2DQJL 2E3VA 4HC1H 3W5MA 2ZUVA 1FAIH 1JIBA 5GSVA 5D1XD 2VLKA 5CJQH 3QH3B 4NQDD 2NY0B 3IJYB 4DGYH 4WCYL 1KJVA 4B53A 2FLBT 4OCWL 2A74B 3GKWH 3F65A 3U1SL 1IKFH 4XBGB 3ULSA 2ZNXA 2P1YA 2HT4D 3H3KA 2M2DA 4P5TC 2PYED 2WP3T 3KYAA 1X4ZA 4IS6A 1DANT 1XGQA 1ZLWH 5JDSB 2X70B 4U05A 5FF6B 4JFFE 5IM7A 3MRCA 4DKEL 2FIKB 5J8OA 4RGOH 4XNYH 4ODSL 3C6SA 5DRWA 1B4RA 1KSRA 4PS4L 3D0LB 1I8KB 2DDQH 2X4PA 5C2BL 5TF0A 5IMOA 1Q0YL 3BE1H 2A1WH 1BFSA 4NC1C 1P84K 3EZ8A 3I9GL 3OX8A 3D6GA 4L8SB 4HIIA 2HRPL 3GI9H 5IW6B 3QI9D 4EXKA 3W39B 1N64L 5HYSB 3L5WA 4LIQE 2HTLD 4EUPG 4ZUVA 1D9KB 1A0QL 4WUUE 3F7RA 3HC4H 1NFDE 3CD4A 2XFXA 1I9RL 4P9HC 3VFWB 3LQAC 1BBJB 1ORQA 3HI5H 3MBXH 3MLWL 4YHLL 5ISZE 4OIAA 1S7VA 1I7TB 5E8PB 4HIEB 1ZVSA 3P9MA 3MV8B 3GSOA 2HLFC 4M61A 1IC1A 5DJDB 1Y6NR 3CFCH 3QIBC 5TQ2L 3SE4C 5GGRB 5EIIA 5F9OL 4LQFH 3WNOA 1Q0XL 4QXUL 3TN0C 4QHNA 4IEFB 3IAGC 1FH5L 3RGVA 2G9HB 2OMBA 5KVMC 1I9IL 1WITA 2CDFB 4H0GA 3MV01 3EYFA 4UNTA 3ZKMC 1BAFL 4Q9RL 1WFUA 3V6ZA 2A6JB 3IS1X 4WNQB 5C0RH 1JHKL 4XNZB 3F5WB 3N1PC 1IVLA 4NQVB 3OV6A 3JTCA 1VGEH 2WMPA 4QRPD 5I16B 3O0RH 3RL2A 5E4EB 1HN1A 1UACH 4HKBA 2IPKB 5T1KA 2EDOA 1KOAA 1NCUA 1R3LA 4MCYA 1FJ1A 1FBIL 1I9JH 2EEAA 4TTGA 4HEME 4N90D 5L6YH 3S36L 2DLFL 2YRPA 5IG7B 1RJYB 1Q9WA 3S35X 3W82A 3MBEB 3O3EB 3HPLB 3KS0H 1CK0H 4M03A 1K8DA 2MSPA 5GJSL 4NZRH 3HCVA 5L0QC 2P5WD 3EDJA 4OI9A 1ND0A 4G5ZL 4H1LH 5AYUL 3CXDH 1L0QA 3HZKB 2C26A 4ZAKB 3HPJB 2OZ4A 2GYSA 4UDTB 3ZSTA 1P2CB 3F62A 3MMEB 4NZUL 2AVGA 5CJOL 3MC0A 1F97A 3TT3H 3PHSA 5DD5H 3OKYA 1A4KA 1H3GA 2WIIA 3EOTH 1HHJA 1B0WA 4FFZH 4KKCD 4NP4L 5DURB 3LH2L 3HNVH 4JZOA 2AJ3B 2JK5A 1DFBH 5D1XB 4APQD 4I0PC 1T66C 3GMRB 2VXSH 1DQJA 1A1OA 3IKKA 1EA9C 4NQDB 5D71H 4E9LA 4CU7A 4DVBA 2J8HA 5FDYA 2IBBA 1RJZB 3KPOB 4NUGH 2WP3O 1QFOA 3R8QA 4LSUH 4CDGC 5AG8A 4RA3A 2Z31D 5CJ5A 3G9VA 5D9SA 1SVCP 3LB6C 1JFMA 2PYEB 3KPMB 3C8HA 2XXMB 5IKCA 2XA3A 4DQOL 4OV5B 5I1IH 3REVA 3MOQA 3AM8A 4F7TB 2H41A 3KPQA 1IE5A 3NFSL 5KVEL 2ZSWB 4NN7C 4OFYD 1KIPA 3MFFB 1GGYA 2C4FU 2QBWA 4N8CL 4HDIB 4M1CD 2JB6A 4XPAL 1NFDF 1MRDH 3KJ4B 3SGKA 3HG1E 4MVBD 1F4WH 2AXGA 4MLSA 2HFTA 3LMJL 3QXWA 5ERWA 1EEZA 3A6CH 5BV7C 2XQBL 3QI9B 2PW1B 5E5MB 3RNQA 4TSAH 2X7LA 4UDUB 4YR6A 4Y1AE 1F4HA 4F7PB 4YFLI 1ADQA 5FHAL 5C0GA 2AEQL 3VW3L 5IW3A 2YR3A 1RAMA 1TFHA 3N85H 4JG1H 4KAQH 4NQUA 3RPIA 3U79A 1AI1H 5E03A 3HB3D 4X6CA 3GBMH 3NCYP 3RKPA 1XGTB 2P43B 1IKNC 2X1PA 3L5XH 4F57H 3BN9D 1G6RB 5I1EH 3WNLA 3DHMA 1IAKB 1KJMB 5HY9A 4QRTB 2EIZB 3MUY1 3OPZL 2AKRA 3KPRA 4HGWA 2R1YA 2I26N 5DA4A 4FQLH 2HMIC 3KPSE 4ZTOL 1YMHA 5ENWB 4JFYA 3WFCH 4X9HA 2UWEE 2EIBA 2CRZA 1YC7A 4XMLH 1KIRA 1EVUA 3IDJB 4YHNB 3LPGA 4PJBB 2DF3A 2VDQH 1F42A 5D7IA 4QRPB 5L2KE 2F53D 3QIUC 4YE4H 2Z8WC 3MPCA 4GRLD 1U3JA 4OLYL 4HUUA 4R8WL 2IADB 3HFML 3NPZB 3MRIA 4JKLA 5FGCE 3AREA 1IBGH 4RIRB 1OM3H 3B2VH 5I0ZA 3WIIH 25C8H 5IP4A 3FB8B 5DC4B 3STLA 2I9LB 3SPVB 4GW4A 1A5FH 4FP8L 2MCPL 4LASL 2BVEA 5KVFL 2NR6D 1EUTA 3PWNA 5C6WH 3EFDH 2NY5C 2YSSA 5TDPB 4LKXA 2W65B 2AV7B 4G6KH 1K9TA 4BFGA 4QXTA 2P5WB 1FG9C 5DZNA 1I7RB 3DSFL 3MO1B 2PKDA 4JANA 3MGAA 2F19L 3WIFA 2HVKB 1IQWL 3VG9C 4EIGB 5IOPB 1MIML 5DGRA 4JFDE 3U7WL 4ERSH 1Z3GL 1A9BB 4MA7H 1QFWI 3EYOA 3INUL 1NCBH 2R4SH 2Q7NA 1AO7B 5HHOE 4BSVA 4KMTH 4DUWA 1CXLA 1FNSL 2BVQA 2EEBA 4APQB 4JEGB 3OZ9H 3JV0A 3I02B 4B0MM 5FUZH 5ALBL 2I5YH 4KKBD 3EGSB 4U2ZA 1P4LA 5HHQA 1EAPA 5HHNB 3CH1B 3K2MC 4ODTL 3QO1B 1IM9A 4CN6A 2XWTA 3KXFE 4MNHA 2Z31B 1LO2H 4UI2A 2OI9A 5EZJB 4OZ4A 2H1PL 3N50A 4BK5A 4JFPA 2AV1B 4PJ8A 4YO0A 4U7SA 3MODL 3WDHA 3QWRD 2RHEA 4OLXH 3SKMB 3IFOB 4FQPA 1YEDA 3V8OA 1SJEA 3VXME 1PEZA 2VDLH 4HZLB 5A16A 2Q8BL 4HH8A 4S2SA 2YUXA 1H3PL 5IHZA 3GSRA 4LHUA 5KVDH 2UV3A 4JM4L 3V5HA 3TPUB 4U1IA 3RU8L 4C54A 1Y6KR 4KFZC 1KTDB 3DUHA 4YNYB 1FFOA 4JM2D 3Q48A 5DVNA 5HHVH 3CJJA 32C2B 1JPFA 3GSXA 3V4UL 1J1XL 2XPGB 4ZFZB 2BERA 3BP4A 1BD2B 5IHUL 2CLZB 1VADB 1OB1A 3KR3H 1E4XL 1U8LB 1EMTL 5HGGS 2UWEF 2P44B 3TEUA 3V4VL 1JMZA 4JFEE 4U1JA 2SEBA 4AM0A 1UZ8B 4Y0GA 4RISH 1RMFH 1RZKC 3H3PL 4OZFG 2BSTA 1XZ0A 4UAOB 1Y18B 3D3VD 5DHVA 3QXUA 1U8HA 5D93B 5FUCC 1GOFA 3LDBC 1JPGB 4QRRD 1IGTB 1A6PA 1XGRB 3VGEA 2MJWA 5DZLA 1ZHKA 3VWKD 4S1RL 2IJ0C 4M7KH 4CAGA 3CVHA 4FA8A 3VFUA 1EXUA 5C07D 5CFHA 2W0LA 3E3QE 2CKBB 4I9WD 3U46B 1FO0B 3NH7H 1P1ZB 4IRZL 1T22A 1A6ZA 5KSAD 2J7LA 5D8JL 4Z7VE 1F2XK 3S36X 3WSQH 2F15A 4H5SA 2F53B 3FT3B 3JVGC 2G75B 4YLQT 3QDJE 1EPFA 3C6LA 1BZQK 4G7YH 5E2VL 4GRLB 1NSNL 3W2DL 2WQRA 5D2NA 3GM8A 5GS0L 1S5IL 5EO0A 1QEWB 2HG5B 2H9GB 3H9SA 3SKOA 4CVXB 3FB7B 3QRGH 2J6EA 1NBZB 2FBOJ 2CIKA 1QFWM 5KSBA 3IVKB 1OGTA 4MD0B 2BSRB 1MHEA 3CC5A 4Y4KC 5D7SH 2XTJE 1NGWA 3VMNA 3HZYA 3WNKA 1F00I 1KJ3H 3IXAB 4YGVA 4J3VA 4OGZA 2R56H 5CD3B 5E8DL 4Z8FH 5J06A 2VL4A 4PG9A 4FFVC 5M94B 3MJ8B 3P0YL 1I3VA 4N5UA 4PJGB 1MCIA 1T2QL 3DURB 3DRQA 1L0XA 1GGCL 1YNTA 2HJLA 2O61A 2GCYA 5C0AD 3E2HC 5ADPH 4K07A 1R3IL 4ZUUB 2EYTA 1G6RH 5DEZA 2W9DH 1A7BA 5DF0A 5TPWH 4YHPB 3H3BC 1EEYA 5IFAH 4NCDA 3U9UB 1G0YR 2XOTA 2K3TA 1YYLL 1CGXA 4AEHH 3FQTA 5EZLA 1F6FB 3T08A 2XG5A 1KUMA 3DYMA 3FRUB 5IF0A 2CH8A 3QUZA 4ODXA 2ZUQB 4OKDA 1BECA 1C08A 4RBPK 3I84A 1J0YA 4Z0BH 2CLRA 1AE6L 1YMMA 1HSAB 1S9VA 3QCVL 3S9DB 3OSKA 1MF2H 4I5BB 4YDIL 1XIWA 4Z77B 5I66B 2V9QA 3RHWK 5EZOL 4LP5A 1PZ5A 1OAXH 3K8MA 1FRGH 3VE0B 5TDOA 3V6OE 4XZUB 1TLKA 5HD8C 5EU3B 3OR6A 4OSUL 3D25A 3PABB 4PRID 5I8OL 1CE1H 4HWBL 1KB9K 5IEHA 4UQ2A 1PSKL 3QXDB 2W0FB 1GAFL 1H3TA 1MCEA 3RAJH 4JM2B 3SDCA 2CO7B 1DUYB 2IAMA 4HUMB 3AM8C 5KOVC 3I3DA 2YD4A 1DLHB 5IW1A 5E2JA 4D9QE 5IB2A 4MWFA 1GHFL 4LBEA 3BDYL 3DV6A 4JPWH 4TVPL 5F6HJ 1LEIA 4OJFL 3TT1H 3Q1SH 4MDJB 4NQDE 4OZIB 4NQSA 3TPKA 4KKAD 1ZHLB 2EE2A 1NCAL 2LTQB 3HUJA 4KHTH 4Z7VF 1SYSB 1GYAA 2FWOB 5HI5C 4FNLL 1R3JB 1CVSC 1JJUA 2Q8AL 5L7XH 1N5AA 4UBDD 3O2VH 1CXHA 3D3VB 4FZEL 1X5LA 2PYEE 2Z4QB 3I75B 3OKOA 4XCCH 5FGRA 1C12B 1Q1JH 1E6OL 4QRRB 5EUKA 1IGIL 3VWKB 1F4AA 2Y06H 5C07B 2E6QA 1ULVA 4JGUA 3SCMC 2JLLA 3VFMB 2YN3A 2N7BA 1FVEB 4MDIA 3F6LA 4GUPB 5E99L 3G6JB 3W0WD 5KSAB 4EN3C 4DN4H 4TULH 8FABB 4DW2L 3BJ91 3EOBA 1P7QA 4MAYC 4EKXA 2BJML 4HS6B 1J11A 4J8RB 3MZGB 5CD5C 4YQXL 3EJYD 1FZMA 1V3KA 3C8KA 1LILA 3X14A 1IZKA 4G8FB 1I7UB 4NQCA 2X1QA 2HJFB 4MNGA 5CKAA 4AEEA 4H0HB 4X5WB 3CH8A 1M7DB 3OAYH 5J7CC 3MXWL 1I1CA 1A3LH 1FCGA 2X4SA 4JFXA 2DMCA 4OD2B 5ESAA 3WN5A 3A6BH 1KLGB 5DFWH 3S3SA 4ZNEA 1N5YL 5BJTA 5BXFA 4HQQH 5DQ9A 1A2YB 2PR4H 5EU5B 3CFDB 3RIAF 3TO4A 4HHAB 4N8VA 1MJJB 3VXQA 5DO2D 3IGAB 3VD4A 4K9EH 3WNPA 1GZQB 1UH3A 2QSCL 2HT4C 4YHZL 1JF1A 4PB9H 5C0AB 3QEGL 5DQDH 1CFTA 3CVIH 4TRPL 4WUKL 4LEXL 1GGIH 2FR4B 2C9AA 1LE9A 4JB9L 2YUWA 4OGYL 3JV4B 4PJBE 3MV9D 5DZOA 3ZYZA 1X4XA 1X5IA 4QRPE 2YUVA 1BJ1J 5H37H 4HUXA 2YD9A 3LY6A 4MA3A 2VE6B 2E27H 5FYLD 3ARDA 3RWJB 4N9GA 5F7KC 1CICA 2H6PA 1ZLSL 3MA7B 4O58H 2CKBH 1DDHA 3ZKNC 1FO0H 4YBQC 3TBYB 4G8IB 5B8CA 3AB0C 2D4FA 4N90E 3DRTB 1G7LB 2HTLC 2APTA 5I1KH 1MFBH 1DEDA 4LPTA 4JY6B 3ARZA 2ZOKB 3WEXB 1MCCA 1MIEL 1V3LA 3UTZA 3CFKA 3U4BH 4P3DA 3EYVB 5AYQA 3PXHA 2P5WE 3NPSB 4O2FB 3WKMH 1IAIL 1OAKH 4PRIB 2YWZA 4HPOH 1A1MA 1T0MA 3KYKH 1P7HL 5GZND 4PPTA 4N5ED 1HILB 4NJ9L 4DN3L 2XIDA 3LN4A 4U6XA 2GITB 1T04B 4LGSB 3OGCB 2Q6WB 4PJ8C 3FAWA 5TFSH 1T4KA 1XF3B 4RMWA 2DQJH 1FNAA 4L4JA 4M48L 4WHDA 4GBXA 1AO7E 3RL1B 1MWAA 2APBA 4DGVL 4BA8A 5ACZB 1ZEAL 1F3JB 5HPMA 4WCYH 4OCWH 2CR6A 3CGTA 3KYNA 4KI1A 4WTZA 3SKNB 1ZHNA 4RNRB 3U1SH 5HYFA 1U8IA 2JJVA 3F7QA 3OKMB 3UPRA 5IJKC 2D2OA 2GTZB 3RTQC 1FE8L 1G7JA 3EO9L 5C0DB 4F7CA 1R24A 4DKEH 1JNLL 3DMMD 1TZHA 1CQKA 4LDEB 1DQLL 2X4RA 4ODSH 1Y0LA 4GS7B 4KH2A 3JSSA 3C60A 5KANG 5GS0D 4PS4H 3BPLC 3IRPX 1Q0YH 3VGFA 5GGTL 2DL9A 2CD0A 5FV1L 3RZCA 5C0FA 2HKHL 3SY0B 3O8XC 4HF5L 3I9GH 3U2SA 3C9NA 1XCTB 4LSRL 3W0WB 1E28B 2HRPH 2EDHA 2A73B 2GFBA 4FXKA 5GGUA 2NTSP 2YA0A 2D7OA 3WJLC 3OAZH 4S1SL 1N64H 2YK1L 3LQZB 3TPUE 1TCRB 2FJGA 1JRHI 4JFFA 4L29A 1A0QH 3WNMA 1G9NL 2J8UE 2R0WH 5DDHA 3TH4T 4PUBL 3K3QA 4U1GB 5ICXB 4MQ7A 5CWSB 4E42B 5FOBB 4OCSH 1BD2E 4FQXA 1N59B 3O6LL 4M5ZL 4QRUA 1R5IA 1I9RH 1MQ8A 1RFDL 3MLWH 3MROB 3P0VL 1P5VA 4YHLH 1Z6JT 3D0VA 1MCDA 4J4PC 3VDAA 1YNLL 5T1DL 4F7EB 4MAUL 3ULVC 3QAZC 1YUHB 4NKOA 3P4NB 4HKJA 3C6LC 3HC0B 4U1LA 3BH8A 2B4CC 4L8BA 5TQ2H 5F9OH 5HVHB 1BJ8A 1Q0XH 1K2DA 3L3HB 4WUUA 3D9AL 1FH5H 1KLUB 1OLZA 2GEEA 1E27A 2CXKA 1I9IH 1LVEA 1G9ML 1NFDA 4RMUA 4U31A 1PY9A 1BAFH 2VDKL 5I2IB 3BGAA 4Z7UB 4RRPA 1JHKH 3V7AG 2BC4B 1MUJA 2ARJB 4O51B 5ISZA 3LKNB 4E5XA 3MV9B 3NZ8B 4PV8B 4KK5C 1CFSA 3BIKB 5IB5B 2E7MA 4H8WC 4I4WA 3L6FB 1MAMH 2F53E 5DD6A 1HDMB 4L1HA 2XWBB 3H9HB 3PGCA 4KK8D 4NRXB 4ZS7L 4MD4B 3PGDA 4IHOA 4U4BA 2VDPL 4QOKD 1FBIH 1M71B 3QIWA 3RWFA 4S1QL 1NGYA 2XZCL 3VFVB 1G7MB 4P23D 4P4RA 1FYTD 4W4OA 3S36H 2DLFH 2VWEE 1TETL 4P0DA 4J1UA 1WLHA 4M7JL 2L7UA 5GJSH 1TQCC 3JXAA 4WEBL 4MMZC 1DR9A 5I19L 1DP0A 2XZQL 4TVPD 4G5ZH 1FZKB 5AYUH 5FAAA 3FOMA 1IFHH 2IC2A 3TVMC 4X6DB 4K71C 4PJGE 1CD1B 1JGEA 4HX1B 2AAVA 3QBTB 3L3OA 3ZKXC 4NZUH 5CJOH 3BKJL 1S7QA 1E4KA 4PV9A 4DOHB 3MLRL 2QADC 3GRWA 1IAMA 4NP4H 4KQ4L 4UV7L 3LH2H 1AXIB 2DIBA 2E7LE 7FABH 2A83B 3MRFA 4HC1A 4YJZL 3C5ZA 1XGPA 1QUNA 1NJ9B 3B9KB 5HI4D 1ZT1B 2YS4A 4FN0A 5AAWA 3AMLA 1U8KA 5HDBE 3S5LA 3OXSA 2GTWB 4FABL 3BHBA 4DQOH 5LCVL 4MS8C 5B22A 4UILL 3BEVB 1CN4A 4IMLB 5ITBL 5ESQB 3NFSH 5EPMB 4OCRL 5KVEH 1VFBA 2NY6D 3CCHB 4N8CH 3PL6C 4NO3B 3RWHB 2J8UF 3ARFD 5IK3B 2EXWC 3SGDH 3GEWB 3ZL4L 3ROOB 4I0KA 3LMJH 3HR5A 5J6GB 2XQBH 2BDNL 5F44A 1V7ML 2YA2A 1CXKA 5DHYB 5F7WC 4FTVD 4YPGB 3CDGB 5FHAH 4GKNA 2AEQH 3DI2B 3VW3H 3EYUL 3VXNB 1F90H 2J1KA 3MLYL 1HWHB 4J6RL 2R23B 4PRHD 3ROLB 3K4ZA 1I8MA 4WU5A 3K1DA 3PIQB 2R29L 3UYPA 1X44A 3HG1A 1QZ1A 3LRGA 3WJJC 4F7MB 4EI5B 1KCKA 3P0GB 4OZIE 5H8DA 5I1AB 2OTWA 2PYFB 5FGBC 3ZZ1A 5KZCD 3OPZH 5SWSD 5HHMD 5JPMB 3OB0H 2Z35A 1OAQL 5DTFB 4LLDA 3D3VE 2ZUSA 2ICES 4KKBC 3PWJA 3T04D 4URTB 3GZKA 1A4JA 4QRRE 5B3JE 4ZTOH 1GL4B 5EU7C 3O11B 4D0CA 3TZVA 3BVNB 1T89C 1SEBA 4JLRB 5C07E 2A6IB 5SV4A 2AXFB 4I9WE 4O2CB 2QSVA 2FB4L 1B90A 3G6JE 3TIDB 3WN5C 3BGMA 1DVFC 3RY4A 2FSEB 3LKOA 5IMLB 2CQVA 4C56A 4ONHB 2NXZC 2VAJA 1DEEA 1A8JH 4OLYH 3TO4C 4AEIL 1FL5A 4R8WH 5DRNA 2NX5D 1NC4A 3KPSA 1LHZA 1OY3B 4Y4HD 3RWIA 4PJGF 1MH5A 1PQZB 1A6AB 2C1PB 4QOKB 1BJ1H 4P23B 3RWEA 1TVDA 1AKJD 3O3AB 3QHTC 3I85A 4O2EB 2UWEA 4GXUN 4LRIC 4AQOA 5I1GL 4FP8H 2EH7L 2MCPH 3DWTA 2GY7B 4LASH 2WUCL 2ARJQ 3QPQC 2FDBP 2PXYC 4KUCD 3LN5B 2H3NB 2HVJA 3JTSB 5E8OB 4O02L 4YX2L 3ZT5A 3MRDA 5L2KA 4JDVA 4WWKA 3DSFH 1WWBX 2VJXA 4AIZA 3T0DA 4R90L 2F19H 3FB6B 4NM4L 4H1LA 2DWEB 1YJDL 2DWDB 5HDBF 1IQWH 4C58B 5FKPB 3CX5K 1MIMH 4H26A 1MFAL 4MGXA 3DYPA 3U7WH 2VDRL 1Z3GH 3B8SA 5C0AE 2DI9A 1VACB 3INUH 1A9EA 3GSNB 1IMHC 1F6AA 3MNWA 1FNSH 3LD8C 3CZJA 3KPLB 5DQJA 2RGSA 3GMLA 1KC5L 2B8OT 5ALBH 5I8CB 1OTTD 4WW1B 4NO5A 4K8RL 4KZEH 2BZDA 1INQA 4HD9A 4ODTH 5GS3A 5E6IB 3VWJA 5I6XC 4ZS6D 3P40A 4P46D 1X5GA 5CINL 1D5ZB 5BQ7B 1K4DA 5GRUL 3MODH 2VZOA 4JM2F 5KN5A 1AGCB 3STZB 3T2OA 5F7DB 3OXRA 5HHOA 2NY6B 2NZIA 1S9YA 4Z0XA 1RIHL 5SX4H 3ARFB 4U3CA 5FXCH 2AJUH 4Q6IA 2P48B 3MNVB 4PRIE 1H3PH 4OZIF 5SWZE 5DYOB 4JM4H 1I1YB 1RK0A 2F74B 3L3DA 3TWCL 4FTVB 4PJ9D 4MCZA 4TTDC 1BVLA 2A77L 4KK9D 1JWUA 4LVHB 3V4UH 1J1XH 2I9TA 4ELME 1OSZB 5B3JF 5IFJB 1TQBB 3C2SA 4PRHB 1QBLL 3K81A 4W81A 5DJYA 1DSFL 1E4XH 2NYYC 1EMTH 1FYHB 3V4VH 5IQ9A 3HI6L 4OIBA 2D4DA 1YY9C 4N9OB 1SVZA 1NQBA 4QWWD 3G6JF 2VKWA 4DUXA 3H3PH 5MEPB 1SYVA 5KZCB 5JO5A 5SWSB 5HHMB 5CEZL 1XF4B 1AY1L 4V2BA 2QLVB 4M00A 3V0WL 1J12A 1JV5B 4NBYB 1F8TL 3FB5B 1WJ3A 4S1RH 2ED7A 3MRJA 4NWTL 5E24E 1FIGL 4LNVA 1QSFD 1X5ZA 4BFIB 4FQXC 4JZJC 5EU6B 3RUGE 4N0CD 3QH3A 4M9PA 4IRZH 3IJYA 2KL6A 4JFEA 4ZD3L 5D8JH 2MWCA 4XC1L 2JF1A 3W0WE 4Q74A 1MLBB 4X4XB 4RWHA 4NNYB 2DQEL 1J87A 5C86A 4NO0D 5ID1A 4AK1A 5E2VH 1N0LA 4IRJD 2X70A 4K7PY 3KYMB 2YD8A 2ZSVA 1NSNH 2FIKA 2NX5B 4XCNB 5GS0H 1S5IH 4Y4HB 2PO6A 5GRXG 5MI0B 1C5CL 1M1SA 2NY1D 3BIBX 3D0LA 3OG6B 1KGCD 1F45A 1AKJB 1P7KB 3ELAT 1IQDB 3CSYB 3V95A 5I30L 5F70A 2DIJA 4Z7VA 3CU1A 4L8SA 1I1AC 2IALB 2ADJB 2YWYA 5E8DH 1DTUA 3EIFA 3W39A 3UAJC 2C3HA 5HYSA 3QDJA 2VAAB 3P0YH 4JE4B 1T2QH 5D1QD 1D9KA 1GGCH 3DGCR 4EVNB 2ZUUA 4PBWD 4NT6B 1R3IH 2VZSA 2J5LB 4XNQB 3SO3C 4Z7UE 4BZYA 4LPWA 5DVOA 1AQKL 4OFVA 1YYLH 4LOUD 1LP9B 5IQ7H 5A3ID 1I7TA 3SGJC 3TCLA 3MV9E 4HIEA 5TE6H 4L9LB 1ZLVH 3MLSL 5HGHA 5JPNB 1IRAY 2JIXD 5DJDA 4LLVB 4NC2B 2L0DA 1ED3B 5GGRA 5CSGA 1UG9A 1AE6H 4U1KB 4EDWL 4P46B 3QCVH 4NPYB 2G9HA 3PXJA 4YDIH 1E4KC 2CDFA 1X4YA 2BSSB 1DN0A 3HMXL 2A6JA 4CVUA 3VD5A 3EJYC 1P84J 4WNQA 1FG2B 5EZOH 2YBRB 3VFSB 4S1DD 4OGXL 3F5WA 4ELMF 4NQVA 2APXA 4NZTL 5AD0B 1CXFA 2FZ3B 3RVTC 4OSUH 2Y23A 5I8OH 2IPKA 4HWBH 4POZC 5FO8B 1JNNL 4LVNC 4X6DE 4GAYB 3DX6B 3U30B 2WZPD 2ZG2A 3BPOB 1PSKH 4LQ1A 4Z7QE 1AGEB 3E6HA 3CAFA 4PBVC 5J12C 2VKXA 1U3HC 4PJ9B 4WV1C 4DOHE 2MHAB 5FM4A 4OF0A 1RY7B 5K59E 4I3GA 5GRJL 1RJYA 5IB3B 3LRSB 4PLJC 1A1NA 3MBEA 3O3EA 1J5OL 3BZEB 1GHFH 3V6OA 4I18A 1KPRA 3BDYH 4MA1C 4TVPH 5IFHL 3RUGF 4GRWB 4OJFH 3IKCB 4OD3L 1NCAH 3HZKA 1FNLA 1DANU 3HPJA 2P5ED 2VUOA 4FNLH 2Q8AH 2WBJD 3TBWB 1H8NA 4FZEH 1P2CA 1HKLL 4JRXE 3MLTB 4KJPC 5DT1L 3CMOL 1E6OH 3VD9A 2E9JA 1A7PL 4KJWD 3JV6B 1G7PB 1LMKA 1IGIH 5L8JB 3RX8A 4OFDA 4P2OD 2AJ3A 3MCLL 1QSFB 4OQ1A 2NTFB 5D1XA 2BHUA 3GMRA 4LKCB 1U91A 5E99H 4NQDA 5EOQL 3IF1B 1PX4A 4LARL 1RJZA 3KPOA 5GRVK 1NBYB 4DW2H 2AXJA 35C8L 1ZOXA 2X89D 4NO0B 1B2WL 2BJMH 3FT2A 4WFED 3NOIA 1NUGA 3QRFM 2PYEA 3KPMA 4YQXH 1JK8B 4IRJB 2GJ6E 3MUGB 4OV5A 3MRPB 5I1CH 2DOCA 3H9ZA 4F7TA 1U42A 1CXEA 2ZSWA 2VXTL 1A6VH 3TZVC 2NY1B 4XWOC 4HDIA 5IVXB 4N0RA 3WUWB 4I3RL 4A2LA 5T5NG 3REWB 3QEQA 4LVOC 2VSCA 1PDKA 4Z7UF 1UYWL 3CDFA 4JHWL 1N5YH 5C7XL 2PW1A 5E5MA 5GJTL 4Y5VA 4UDUA 2HWZL 1OTSC 1ZLUH 3CFEB 3L1OL 1QSVA 1UWXK 4YIQB 5DMKB 5D1QB 2PW2B 1MREH 4HSQA 4ZYKB 1T83A 4KGJA 3D48R 2QSCH 1SEQL 1VA9A 1WSST 2YXFA 4YHZH 4XI5C 3QEGH 4RSVA 5DEFB 3VGGA 3DGGA 3RDTD 5C08D 3SE8L 4CMHC 2ITCB 1XGTA 4TRPH 3QNZB 4WUKH 4LEXH 3KDMA 3PDOB 3DMMC 4LSVL 1G6RA 1QRKA 4OGYH 1IAKA 1KJMA 2PTTB 3QEUB 4I0CC 4QRTA 2EIZA 3T65A 1S7WB 1IEAB 1QNZL 4DWHA 2JIXB 2DQGL 2DYPD 1QLEL 3UJIL 4X6DF 5I1LB 4UIKL 1ZLSH 4I48A 4QOKE 1KXVC 4M1GL 4Z7QF 5ENWA 4YHOL 1F02I 3VU2A 4PRPD 5KSVA 2IMNA 3U4AA 1CLOL 3KLHC 3T0VA 5K59F 4YHNA 3LOWA 5D7JD 3RWCB 1MIEH 4KJQD 3OR7B 4MB3A 4QRPA 3MNZB 3ZDYF 1IAIH 4QHKJ 4ETQA 4NQEE 2FL5A 3CFBA 4TVPE 1WBYB 1R3KB 3FZUD 4LP4A 5IVZB 2IADA 3G6DH 5HYQB 3LV3A 2D31B 5GPRA 4NJ9H 4RIRA 4DN3H 5EBWB 3RVWC 5BMFL 3PDGA 5CEZD 3SPVA 4FMKA 5AWNL 5MEQB 4M48H 3KLSA 2HJKB 4HV8B 4K94C 4KUZL 2VN7A 3HE6D 3GMPB 2X4UA 4WW2F 2IQAB 4XAKD 2D3VA 4DGVH 4XPBL 5HDLA 2W65A 2AV7A 3S3JA 3ALPA 4K7FA 4WI6A 3MO1A 1GIGL 3MA9L 1F6LL 1HXYB 3QWOB 2KPNA 4BUHA 2P5EB 4YK4B 2I07B 2WBJB 4KDTA 2V5RA 1FE8H 3EO9H 5JQ6L 1A9BA 4F37F 4DK3A 1DQLH 3GHBL 1AO7A 3SE3A 4Y2DD 4A6YL 5JW3L 3VFRA 4P2OB 5GGTH 4U1NA 5FO7B 5F1SA 1KCSL 1FV1B 2HKHH 3I02A 4HF5H 3EGSA 4LSRH 3WHE1 5FO9B 5DMJB 5HHNA 1QACA 4NGHL 3I2CL 3CH1A 5DUPH 5FCUH 3T09A 1CIUA 1MRCL 3QO1A 5T5FL 4S1SH 3QFDA 4ZQKA 4X4ME 5EZJA 4Y5XC 3FQWB 4RFOL 4FTVE 2AV1A 2DTML 1WIOA 1DL7L 4LCIL 1G9NH 4M5YL 3VXUE 2C1OB 4MJ5B 4OFYA 4PUBH 4R26L 2G60L 5FM5M 3IFOA 3PP3H 3MR9B 4PRHE 5B39B 1AXTH 4M5ZH 1OT2A 1P4BL 1RFDH 4HW6A 1RHFA 4HZLA 3P0VH 5LQBL 1EIBA 3T0EB 5FA4B 4XPGL 5EC1B 4MB4A 3QXTA 4MAUH 5T1DH 2LABA 4WGWB 1KTKE 3VI3E 3TPUA 4Y89A 5SWSE 4LSPL 5HHME 1KTDA 4YNYA 2EXYC 2VR9A 4NDMB 5EA0H 1T5XA 1MFNA 2PO6C 3D9AH 2J8UA 4G42B 4EIZC 4FG6C 2XPGA 4ZFZA 1G9MH 5I1HL 1BD2A 4OFPA 2VDKH 4GRWH 5TGBB 5C08B 3RDTB 4CMMA 5EU6E 3QUXB 4DVRL 1VADA 5IT2L 5I9QC 1U8LA 3QQ9C 3GJEB 4MHHI 2CDGB 3MV7D 1HCFX 3VH8G 1UZ8A 2Y07L 3TBTA 1DBBL 3GSQB 1Y18A 2FEEL 2Y6SC 3FONB 3MREB 3T4AB 3OBAA 2C4FT 4FQHB 1KIQB 4OCLC 4UTAL 3BQUD 5A2KH 2DYPB 4OBRA 4ZS7H 1IGTA 1QFUL 1XGRA 3FAXA 2VDPH 1IGYB 4P5KB 3F7VB 4S1QH 2XZCH 3PQYE 4M1DL 3VDBA 1II4E 5LAXB 2CKBA 5FYJU 5CAYB 1FO0A 4XH2B 4M93B 4PRPB 1P1ZA 3ILPB 4LVHC 4M7JH 2XTJC 2NY3B 4ODBD 5GSRB 4H20L 3UJJL 5EIVA 3TESA 5D7JB 4WEBH 5JXEA 5I19H 2AEIT 4NC0B 1JNHB 1BIIB 4HBCL 4JREC 2XZQH 2DB8A 2VC2L 2B39A 1CTOA 2F53A 4XXDA 3FT3A 2G75A 2KQNA 1IAOB 5DS8B 4GRLA 5FYKU 3TA3D 3TJHD 2OJEB 1ITBB 1TPXC 4U3HA 3BKJH 2RB8A 1TZGL 3FB7A 1NBZA 3MLRH 4O4YH 1U2HA 3IVKA 3MFGB 5DK0A 3VMPA 4UV7H 5DFTA 5GQBA 3BYYA 3UBXI 1LE5A 3HE6B 3KWWB 5IBTL 1LP9E 1KYOK 2X4OB 1T03L 5E1HB 3EUUA 4HKZB 5CD3A 1A3QA 1OW0C 3MJ8A 4JCLA 3UROR 4I77L 4PJGA 3KLAB 4OCYH 4Z7WB 2VH5L 3K2UL 2OR9L 3DURA 1H0DB 1NANH 4FABH 4JR9L 2BOBA 1XT5A 4K23H 2RR3A 4JHBA 5LCVH 2AJVL 4UILH 1X6LA 3QT2A 5ITBH 4OCRH 1UXWB 2ADFL 2CLVA 4GQPH 4YHPA 4C55A 2E7LA 4QXGL 4Y2DB 1C5BL 3U9UA 1XMWA 5DVMA 3V6OC 4I18C 4HWUA 1MAJA 1Z9LA 1T7YA 3ZL4H 1FLTX 3P4OB 3QA3A 2W59A 2Y5EA 4GG8B 3FRUA 4PRAB 1RZ7L 2BXYA 1H15B 3O45A 4U6HB 4Y8DC 2BDNH 1V7MH 1NGPL 4JRYD 4RAUB 2R1WA 1HSAA 3VI3F 4G9FD 3KYOA 3UTTE 3W11D 4GAGL 1TJGL 3OKEB 5I66A 4ZXBA 1SJHB 4JCMA 3QWRA 3MLYH 4XTRC 4J6RH 3VE0A 4IOIB 4MJ2A 3TC9A 3WHXB 2R29H 1F4XL 2V5SA 2J5LC 4GRWE 5EU3A 3PABA 4Z76B 1EAJA 2N7AA 5IV2B 2W0FA 1OAQH 2XNAA 2WWMC 3GSUB 3V6FA 3NIGE 3CLFL 4JM2A 2XN9D 1DUYA 4M43L 3IT8D 3SBWA 3RY6A 1DLHA 3D18B 5GGQL 5CEXB 3V8CA 1MFEL 4U6TA 1RIVL 3QZWG 4WI2A 1AGFB 1QSFE 1OWRM 1CU4L 2FB4H 5KTEH 4OZIA 2NY2D 1ZHLA 4TNWK 3ARUA 4Y5VC 1A3RL 4KUCF 3NIDE 4LSQL 5DI8B 1ZT7B 1Q8MA 3CFJA 4JO3L 5IWLA 2Z4QA 3ZDXE 1UB5B 4P99A 3I75A 5HI3C 4AEIH 5LGKA 1UJ3C 4XNUL 1VEPA 1XCQB 1C12A 3BQUB 4N0UB 1VFUA 4QRRA 4OGAC 5I1DB 5DJ6B 2G5BB 5K33A 2YXMA 5E94B 1AD0B 3VFOA 1YN7B 1T0NA 2YPKA 5C07A 5I1GH 1KGCE 4LPYA 2EH7H 3VFMA 2WUCH 4GUPA 3G6JA 4KK9C 5F3HB 1KB9J 4ZDHB 4U0RC 8FABA 1CDUA 4O02H 4YX2H 2VIRA 3QFJD 4HS6A 1LP9F 1MCNA 5FHBL 4U6YB 4R90H 2ENSA 4NM4H 1S7UB 1XR9B 3H9YA 4G8FA 3TA3B 5J1TC 1YJDH 5A40E 1IM3B 2HJFA 5E8NA 4LCYB 4EI6B 1MFAH 4X5WA 1AQDA 2VDRH 5CP3H 4R3SB 1M7DA 5CBEB 2ZUWA 2R1XB 2R0KL 4DEPC 4OD2A 4JDTL 1NEZB 8CGTA 1KC5H 4ELKB 1A2YA 5GS1C 1GZPA 5EU5A 3CFDA 5HJ3B 4HHAA 2B20A 3IGAA 2ID5A 1G7QB 3R06B 1GZQA 5CINH 4X80L 2FATL 4YHML 5C0AA 5GRUH 4HFWB 3TFKC 1A7NL 1DQML 5T1LD 4Y88A 2BY3A 1YPZB 1MSPA 2FR4A 3O3DB 5F89B 5HDOA 3KPPB 1RIHH 2AJSL 3JV4A 7CGTA 3IDMB 2IPUK 1BMGA 1L6ZA 4GRWF 2I60H 5F9WC 1RU9L 4JRYB 3RWJA 3V5DA 4OZGA 1IJ9A 3TWCH 4JFOB 5GIRB 1AH1A 4G9FB 4LIQL 4G8IA 1Q9LB 2A77H 1QRND 2UY6A 3DRTA 1G7LA 3NIGF 1WEJL 3NFPB 3VFPA 2XTLA 1CI5A 5SWQA 5C0NC 4JQIH 1QBLH 2LAGB 3WEXA 1DSFH 4O00A 1VEMA 4B50A 4ONGL 3WDJA 3G5XB 3HI6H 4W70A 3WFZA 2HAZA 1PX3A 4QRSB 5SWZA 1BBDL 1ES0B 3PGFL 4NO2B 1JMXA 1HILA 3IDNB 3GKZA 5CEZH 1CGVA 3NIDF 4L3CB 4QTIL 2OX5A 2GITA 1AY1H 1T04A 2Q6WA 1QSED 3UCRA 3MLUL 4CL7A 1PKQB 3O41B 1QYGH 1F8TH 1HHHB 3ARQA 4ELMA 2JJSA 4NWTH 5ELIA 1FIGH 1U9KA 3U48A 5ACZA 1F3JA 2VITA 3MRBA 4ZD3H 1FPTL 2VZ3A 3NA9L 4XPHL 3SKNA 4RNRA 2NY2B 1CTNA 4X6EA 1RZIB 4MHHG 2DQEH 1CR9L 3RVXD 3BRDA 4WFEE 2GTZA 3TP4A 5C0DA 5IUSA 4MXWH 5KSUA 3PWLB 4OFIA 1ZS8B 5D2LB 3L7FB 5F1NA 4HJJL 4OUUB 1I1FB 4YBLC 3RUGA 2FX9L 4UTBL 2A6DB 3OF6A 1JWSB 3SY0A 4M7ZB 4YDKL 1QA9B 1XCTA 3W0WA 4K3DL 1E28A 3ZT7A 3T0EE 5BV7L 2JJTC 1V3MA 2A73A 5GGSB 4U0QB 1X7QA 4FQQA 3QFJB 2NQCA 3LQZA 1J9CT 4EUPB 4PJEB 2BCKB 4Q2ZA 3B43A 3SN6N 2ATKB 3VXPB 5GRZA 2B1HL 5ICXA 5JTWA 5CWSA 5FOBA 4ZPTA 1N59A 4LCCC 5C08E 4NJAL 3MYJA 4GLRI 1W0VB 5K9OB 3GHEL 1AQKH 2KBGA 3MROA 3C09B 3UBXG 4HFUL 4F7EA 1YUHA 3NA4A 3P4NA 3T4YA 3MLSH 3IFLL 4QT5B 3RFZC 4RFNB 4IJ3B 1CWVA 2EZ0C 3HC0A 4DKDC 4ESKA 1I3GH 3EYQC 3LRHA 3O4LD 4EDWH 2FYYB 1I75A 5F96L 1KLUA 2Y7QB 4ODHL 3WS3B 1T5WB 3HMXH 3SDDA 3SJVD 5JHDD 5I2IA 5C3TA 2HH0L 4PRPE 4Z7UA 5T1LB 3UDWA 3KG5A 5FB8B 2BC4A 2ARJA 1OLLA 3MV11 4OGXH 2ATPB 2IANA 2BNRD 4O51A 1FVCB 4NZTH 4ZTPL 4U1SB 3LKNA 3S4SG 3MV9A 5I74B 4PV8A 3BIKA 5IB5A 5JW4M 2AK1L 2CSPA 5F8RC 4MXQD 2IPTL 3L6FA 1NCTA 1O5DT 1JNNH 1ZHBB 1HDMA 4HWZB 3H9HA 3FRPA 4NRXA 1WZLA 4JKWA 4RGMB 3HMWL 1M71A 3VFVA 1G7MA 3RA7L 3NBNA 5CEZE 1QRNB 5LWYL 4UU9B 4P4KD 5GRJH 4M4RA 2NY5L 5EULV 1J5OH 4Y16A 4XVTL 1IL1B 4WFFD 1I85C 4XAKE 5IBUG 5IFHH 3BGFB 1XF2B 4OD3H 2NXYB 1FZKA 1AHWB 1BX2A 4WHYG 4XBEL 3D39D 4IM8A 4X6DA 1DBJL 3KGRA 4IIQC 1CD1A 4Z7WE 5IEKB 4N5EA 4P5TD 3NAAL 1B3JA 1OAZL 4GG6F 5C2UB 4PGDB 1HKLH 5DT1H 4M9OA 3CMOH 3O0RL 1JYXA 1QSEB 1K85A 1A7PH 1HH9A 2YPVL 4JDZB 5JOEA 5D96B 2ZUTA 5DUBB 3MCLH 3AXLA 2A83A 4GW1B 3O4OB 5DJ2B 1X5FA 1U95A 5EOQH 1HXMB 3B9KA 2BNQD 1ZT1A 1KNOB 4M93C 2CUMA 4LARH 43C9B 1K3ZA 4DZ8A 1CBVL 2EKSB 3QG7L 5J13B 4NSKB 1BP3B 35C8H 1FL6B 1UFUA 3LEVH 1B2WH 1WIPA 1OD9A 2GTWA 4JRXA 4DAGH 2MCG1 3ZYOA 3MLXL 4IMLA 5ESQA 4PJ7B 5IESL 5EPMA 3DNKA 2VXTH 4WW2A 3CCHA 5EU4B 3RWHA 4NO3A 3BESR 2VDOL 5CS7A 1KULA 3PWUB 1EFXB 4I3RH 3NGBC 3C08L 2J4WH 2DBJA 4YHYC 3QG6B 1UYWH 4KRMB 4JHWH 5C7XH 5J6GA 2HKFH 2HWZH 3P77B 2KUTA 3L1OH 4ODWB 2HLFD 4ODUA 1N2RB 2GJ6A 3CDGA 4U1MB 5D71L 3VFTB 3FQRA 4X7TA 3TN0D 4Y4FC 3VXNA 3ZTJG 1SEQH 3HAEG 5HSFA 2R23A 2CJUL 3SE8H 1DQQB 5I75B 1AGDB 3PIQA 5DLML 3NABL 4LSVH 2KZ1B 4F7MA 3VD7A 4EI5A 4YXHL 4ZFFB 1Z9SA 5I1AA 3RWGB 1RZKL 2JCCB 1P4IH 3IJSB 3F7YB 5JPMA 1QNZH 4NN6C 2VISB 3KNBB 4ISVB 1IGJB 2DQGH 5F7UA 4XXCA 4PD4K 1QLEH 2GK2A 3UJIH 2BMKB 4N0UE 4UIKH 1GC1C 3O4LB 1JE6A 3BP6A 3O11A 4M1GH 2Q86B 1INEL 4YHOH 3BVNA 4UQ3B 4JLRA 2A6IA 3SJVB 5JHDB 1YEJL 1CLOH 5I15L 4O2CA 5BRZD 3SDAC 3TIDA 4C83B 2RJMA 4G43B 2BNRB 4CN4A 2FSEA 3BWAA 3MRGB 4QXWA 5IMLA 5C1MB 4LLAA 1UM5L 2QQLH 4ONHA 2YC1B 1T3FA 3GBML 4JVWA 1EO8L 2OJZL 3SGDI 1ZLWK 2YN5A 1PBYA 5GRVL 4MJID 3H6JA 1JZ4A 2X05A 2FH8A 4ZUSB 1PQZA 4Z7WF 1C16B 1A6AA 2UUDK 3MGTA 4QOKA 4JVUA 4U1HB 3VRJA 1BJMA 5BMFH 1WAAE 5BS0D 4HUVB 2KQMA 4P23A 3QXAB 2Z93B 5AWNH 1S7XB 3O3AA 4O2EA 4PGCB 4P3WA 4X5XA 4V1DD 1J8KA 4P4KB 5E6YA 5KAQF 4PFEA 2ICWB 4KUZH 4QHLB 4NFDA 1R5WB 3LN5A 4HXAL 2H3NA 3JTSA 5E8OA 3RRQA 2EDDA 4I0PD 1T66D 4EUPH 5CHNB 3V2AR 1H8SA 4NQEA 1GIGH 2V17L 4AL8L 3MA9H 2QQNL 3D39B 3FB6A 1HH6B 1QFPA 4AMKL 1B0GB 3OTTA 2DWEA 5TDNB 2DWDA 5FKPA 3S37L 3LB6D 2DQCL 4P5TB 5JQ6H 3DO3A 2WM0A 2H8PB 1MHCB 1VACA 4LMQI 4PJ5D 3GHBH 3QDGE 4MZ3A 1YPZE 4A6YH 5JW3H 2E6JA 2XWJB 5J4MA 1I3RB 3KPLA 1KCSH 1CDIA 1KF9B 4L4VD 12E8L 5I8CA 4WW1A 2BNQB 3GMQB 2DJUA 2YEZB 2H32B 4NGHH 2L7JA 3I2CH 3J7HA 1WBXB 4JVPA 5T5FH 5E6IA 5HDQL 4JRYE 2BVOB 4ORGA 4RFOH 3VXTB 4G6KL 1S7SB 3M07A 4G9FE 5BQ7A 3CXHK 2DTMH 3S88L 1DL7H 4LCIH 1AGCA 4M5YH 5F7DA 1CLYL 4R26H 2JJSC 1XFPA 2G60H 1Z5LB 3WFEL 2N56A 3U83A 3ARFA 1LD9A 1P4BH 2AXHA 4XPGH 2VSDA 2WSKA 2AJXL 4PRNA 1IILE 5J3HC 3AC0A 1P9MC 5CKGA 2ZPKH 3CX5J 4IRSA 2F74A 1WWAX 4LSPH 4OLEA 3TBVA 1BQLL 1D5MA 4FTVA 4FXGB 4OCNC 4FRWA 3QIBB 4WDIB 2HMID 1PKQE 4KRPC 3VXUA 2W92A 1FZOA 1F5WA 3TN0B 4X9IA 4KK6C 1OSZA 5ADOL 4RAHA 5IFJA 5I1HH 3MUHL 2BVPA 4PRHA 4AH2B 1G0XA 1LO3L 4DVRH 5CUSL 5IT2H 4KI5D 4R0LC 3G04B 2IMMA 5D6DC 2VZVA 4LPUA 1Z2KA 1CL7L 1V8HA 2Y07H 2VXVL 4OZFB 4ZO7A 3BUTA <