4WDIA

Weak tcr binding to an unstable insulin epitope drives type 1 diabetes
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
277
structure length
277
Chain Sequence
MGPHSLRYFVTAVSRPGLGEPRFIAVGYVDDTQFVRFDSDADNPRFEPRAPWMEQEGPEYWEEQTQRAKSDEQWFRVSLRTAQRYYNQSKGGSHTFQRMFGCDVGSDWRLLRGYHQFAYDGRDYIALNEDLKTWTAADTAALITRRKWEQAGDAEYYRAYLEGECVEWLRRYLELGNETLLRTDSPKAHVTYHPRSQVDVTLRCWALGFYPADITLTWQLNGEDLTQDMELVETRPAGDGTFQKWAAVVVPLGKEQNYTCHVHHKGLPEPLTLRWKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords H-2 class I histocompatibility antigen, K-D alpha chain
publication title Distortion of the Major Histocompatibility Complex Class I Binding Groove to Accommodate an Insulin-derived 10-Mer Peptide.
pubmed doi rcsb
source organism Mus musculus
total genus 67
structure length 277
sequence length 277
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4wdiA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4wdiA01
2JK5A 5TE6H 3VRIB 3MA7A 3CVHH 3ROLB 1P2CA 4MJ5A 4MB3A 3MLVH 1FO0H 2PKDA 2X9WA 5MP6L 5FGRA 1MELA 1NMCB 4Y8AA 3U9UA 5F72S 5EORH 4U1GB 2WWKT 4H88H 4Y4HC 4YZFF 4KMQA 3PWJA 5L2KE 3DTXA 2F5BH 4E41D 4PRAA 2XWJA 1JPGB 1PYWA 4F58H 5J3HD 1EEQA 1W0VB 3C60A 1AGFB 2BHZA 2XZZA 4HWBH 4JPVL 1YY8B 2VLLB 3BP6A 3IS0X 3MLPA 2VDPL 3CLEL 4MHHG 1QRNE 1TTGA 2AXFB 2Y7QA 1I7ZA 1FYHB 4M93B 5GZNC 4EUPH 1DANT 2NY2C 3PHOB 5KJRL 1A7RL 1I9RL 4I0KA 4R4FH 1QOKA 1OAYH 4LSRL 3NACH 1I9EA 3FN3A 3STZB 5CEZD 3HMXL 2DI8A 4J7RA 1QZ1A 3D3VA 1UWXK 3W11D 2Y36H 1Q0XH 2OMBA 3OHXA 1RZJC 1BWMA 1FORL 2W60B 1AHWA 3U7WL 1T66D 1LDPL 2AV7A 3QYCA 1BPVA 2P7TA 3F65A 1NFDF 3OKOA 5D9SB 4KUCD 3BISA 5K9OB 1LEKB 2FX7H 3AU1B 5LAXA 1FAKT 1IQDA 35C8L 1UJTA 1HYRC 2F5AH 5IMKA 4R96B 1B6DA 5IMOA 3NCCB 4EN3D 3ZKXC 2CDEA 3MODH 1S7RA 4M6OL 4J8RB 3H2WA 4JFPB 2EIZB 1C16A 1REIA 4OAWA 4R26L 3RU8L 3H3PH 4JPKL 1BD2A 5CP3H 5TDPB 4ENED 4LOUC 4G80A 2HWZH 2R4SL 4OCXL 3IS1X 2VXTL 3O8XB 1JMZA 1ZA6B 1J8HB 4K9EH 1TQCB 4PRIB 2ITCB 3GSRB 3HB3D 2DM2A 4FMFA 5EU6A 5D2NB 2IANE 1FH5L 2FJHA 3V5DB 2DIBA 3X13A 1CLZH 4MVBD 3QIBA 2RFXA 1K8IA 4NC0B 3EOTL 3RUGE 4ZYKA 3SPVB 1GIGH 3RKPA 1HOCA 3I6LE 4N0YH 5FGCB 5GGSY 5C0CD 2RCSH 3MYJB 3FT4A 4N9GB 4R7NB 1B0GA 1F6AA 4WTWA 1FFRA 1MFCH 4PRNA 3EFDL 4TSCH 2VLRA 4ELME 2JB5H 1EFQA 5LJYH 4JO1L 3TH3T 3ARGB 5FM5M 4KK6C 3WHXB 3IDXH 5JIIA 3MLWH 3OGOE 3GBLA 1WK0A 2LTQB 3MR9B 3QQNA 3SKNA 5KSVA 1C7SA 5HHNA 4P5TD 4U6HA 2Z4QB 2OK0L 1NGYA 3NCFB 1OGAE 4GKSB 3TCLA 1I3GL 4PGBB 3AGVA 4G8EA 4OF8A 1JF1A 3ZDZF 4Z77B 3U36B 1BVKB 3GI8L 3BPNB 3DRQA 4DN3L 4QRPA 5D6CA 2VN7A 3EZJB 1A1NA 3HUJF 3WFZA 2ICWB 5F89B 4N0CC 1ZANL 3D2UB 3HCVA 2C3XA 1RD6A 4FFYH 1CF8L 3PWPE 4B7LA 1OPGH 4N5EA 4KRPB 3O9WA 2X6MA 4GAFB 2OQJB 5CGMA 1MJJB 1KGCD 3H3KA 3ULVL 1DQQB 1KB5A 2R0KL 2ZP0T 2QSCL 1MVUB 1FAIL 1MFBL 2HFFB 3BSZL 1MRDH 2YRZA 5EPMA 2IF7A 4HUNB 4OFVA 1U0QA 4KK9D 3U4BH 2AGJH 1BLNB 5E24E 5EU7E 4G8IB 3ARQA 2QQNH 2HRPH 5E8OB 1UWEH 4HKJB 5C0DA 4I0PB 3TIDA 2OTWA 5ACLA 3JUZA 4G9FE 4MXWH 4NRZA 1T1WA 1IMHC 4WU5A 5TE6L 2DI7A 3U79A 3RFZC 1KC5H 3CVHL 4AIXA 4RGMC 2BRQA 5C09D 3WIFB 2YWYA 3MLVL 2A0LC 4NRXB 1FO0L 3CCHB 5DFVD 2M2DA 1EERB 3BP5B 5T1LD 5DXWA 1AQKH 1BF2A 2V9TA 5JLZA 1Y6MR 3MLYH 1EGJA 4RA0C 2BY3A 5EORL 4QYOB 4H88L 2FBJH 2Y6SC 3QCVH 4G6JH 5IMLA 4M9PA 1ES0B 2F5BL 4F58L 5F7WC 1WBXB 3QFDB 3VXRD 4JY5H 3RBSA 3RX7A 3PDDA 1NBVH 2PO6D 3OKNB 5JOFB 2C5DC 3QUZC 5JORA 4P2RA 2OZ4A 3BZ4A 4HX1A 3QIUC 1EXUA 1E6JH 1MLCA 4HWBL 5KVEH 1TVHA 4PTTA 4WUUB 1OGAB 1VACB 1FG2B 3BP4A 5E4EB 4JKLA 3M45A 1PGRB 5L0QC 1ZLWH 4H25B 2DL2A 2W65A 3C9NB 1CXFA 4Y5VA 1S7VB 4E42A 4KJPD 1B9ZA 4I3RH 4MJIA 3OKEA 4R4FL 4UNVA 3DETD 3HZYB 1DR9A 1OAYL 2YXFA 3OWEA 1CFNA 1T20B 3S9DB 2D3VA 4RMRA 3SGEI 3NACL 3QQ3B 3VFMA 2N7BA 2IH1A 3DVGA 1BFOB 4JFHE 4JDZA 1UADC 1H0DA 3EDKA 4FQXB 3LD8B 1B0WA 2D9CA 2Y36L 1CDCA 5BZWA 1BZ9B 1HSBB 4X4XA 2FSEA 2MOVA 3MUGB 3B2VH 2VZTA 2WBJB 3S35H 2VJXA 1OB1A 1OLZA 4NDMB 4MD0A 3FFDA 1DE4B 5JHLH 3ULVD 1MCBA 2FX7L 4U1HB 1YEIH 1QQDA 3SKOB 5IF0A 1FV1A 2EDKA 2CDFA 2F5AL 4ZFFB 3GB7B 5TE7H 5HYJB 1UJ3B 2HT4C 4MSWA 4QOKE 3MODL 4X0KB 5GGQH 4KVNH 1A14H 4EI5B 4LVOB 5I6XC 4NCC2 3H3PL 3QUMB 3VXSE 4Y4FA 5IV2A 2HWZL 5AG8A 3U0PA 4QRRE 2EKSA 2BVEA 5IVZB 3BZEB 1X5GA 5IEHB 1KB9J 2HJLB 4KFZC 4J3UA 4XRCB 4KMTL 1JWUB 4K9EL 4MCZB 4N8CH 2L4OA 3FJTA 1FYTB 3NN8A 5C0FB 2BC4A 1A2YA 1OM3H 2L0DA 1E27B 3D9AH 3IF1B 1CLZL 3V2AR 2XQYK 1UCTA 1I1AB 1CYGA 4G7YH 3H9ZA 4X4MA 3HG1A 1JF6A 1MHHB 3RRQA 4FFVD 1DVFD 2P5WD 1GIGL 3BD5A 4N0YL 3CXHK 3F7YB 2RCSL 4KRLB 1E4KA 2FEEI 1A8JH 4EIGB 5MENB 2Z9TA 5GRVL 1MFCL 2JB5L 2BSTB 1AO7B 5I1LA 1G84A 2BOCA 3LB6D 3IDXL 3MLWL 1T7WA 4RRPG 3X3GH 4NO2A 3U46A 1FNLA 2EZ0C 5AYUH 4C56B 4M7ZC 3KVQA 1MJUH 1S7SB 2Y23A 4UBDC 4Z8FH 1II4E 4W6XB 3D5OF 2DL9A 2YEZB 4POZD 4W6YB 1P1ZA 2OSLA 1NGPH 4PLNC 3EJJX 3T0EB 4WJ5B 1U8PA 2Z92B 4Q9QH 1OY3B 3VE0B 3VD7A 5F1NB 3TO2B 1U9KA 1Q72H 4NSKB 1A9BA 3SCMC 5B8CA 4PJ8D 1FDLH 2X4TA 3VFNB 4NKIH 3FOLA 4OT1H 3O6KH 4FFYL 3I6KA 1YN6B 3DUUB 5IB3B 4JN2B 2Z8VC 1YUHB 2ID5A 2NXYD 1NUGA 1DEEA 1HH9A 3KPTA 2CK0H 1Z2KA 4X7SH 4X7TB 1FGNH 3LDBC 1YC8A 1MRDL 4NO0B 3GMLA 2VMFA 5J4MA 3U4BL 4K71C 4X98B 3ILQD 2AGJL 1F00I 4XNUH 3X11A 2QQNL 2HRPL 2KBGA 5IOPA 4PRDA 1UWEL 2HP4A 1INEH 3HUJA 4NYLB 2VITA 4CMHC 2XTJE 4MXWL 4PLKC 1KV3A 2V2TB 4DKEH 1GGTA 1KC5L 3MRRA 3OXRA 1U58B 5IW1A 5I66A 4PJDE 2WINA 4P4KA 4HFUH 1XF2A 2G5RA 5FOBB 2BNUB 1L0YA 3SJVA 1QFPA 1AQKL 5EB9A 2AKRB 4ODUA 3TPUA 1I85C 4G43B 4LLDB 3MLYL 3T4AA 4HPOH 2VDMH 5AWNH 5DD1H 1SMAA 2VO5A 3DARA 2M8XA 2FBJL 4PJ7B 3QCVL 3RWEA 4G6JL 3T0DA 1HHKB 4NQVB 4XNZC 2W92A 4O00A 5E9DE 4JY5L 2X1OA 2HFGH 3DJ9A 1NBVL 3N1MC 3SDXB 1AGDB 3CZFA 1E6JL 5KVEL 4U2ZA 2NY6C 5IB4B 1GZPB 3EFFB 4PJ9B 1A6VH 3FQTA 4BFEA 3C6LD 3MV7A 5H94A 4Y16D 1FQ9C 3C5JB 5JDSB 4I3RL 3HAEA 2NX5E 3PWLB 8FABB 3TVMB 1BHGA 4KKNA 2OM5A 2EE3A 4L9LB 1H3PH 2AEWA 3GHEH 12E8L 3CX5J 4HUXB 3MJ7B 4JHWH 2ICEA 4G6AC 4RWYH 4ZAKD 1T83A 2BVQA 1AIFB 4JFXA 2HVKA 4W70A 3VFVB 5EIQA 1S7XB 4UINH 3T3PF 1A5FH 2EICA 2VXQH 3PL6B 5JMRA 1CE6B 3ES6A 5ISZD 2EC9U 4NP4H 1CDYA 2C3VB 2ZKHH 2GJZA 2AXHA 3B2VL 5ICXB 1YNTA 5LGJA 3RPIA 5M7QA 3RAJH 1LEGB 2NR6D 3BEWB 1CICD 1S9KC 5KSBF 5IWLC 2H3NB 2XXMB 5JHLL 5IJKC 4MDJB 1YEIL 4MAUH 3RL2A 5A2KH 2V9RA 4HFWA 4BK4A 5ICYB 5I0ZA 4HS3A 3CH1A 2V7NB 1VADA 5I73B 1EMTH 1K4CA 3IFNH 4FTVE 1OSZB 5GGQL 1EDQA 1XF5B 3GMNB 4KVNL 2OYPA 1A14L 3QUYD 4ZDHB 2XY2A 1J05A 2AQ1A 1D9KC 4TULH 3OJMB 3OR7B 5SWSE 2MQ0A 5IR1A 1FZJB 3FB8B 5L2KD 1X5XA 3P4MB 3BH9B 3R0NA 5BRZB 4NUGH 1C5BH 2QV2A 3KXFE 3N0PB 5SV3A 3MNZB 2J8UF 5INDB 4AYFA 4N8CL 5J9PB 3ULSB 4OIBA 1NAMA 1DSFH 3PV6B 43C9A 3D9AL 4X99A 4D8PB 4WWKA 4LHQB 1UCBH 1QSVA 4JDVA 3MRIA 3AC0A 4HJ0D 4G7YL 3SE8H 3ZYIA 5T1KD 1QRND 1A02N 4KHTH 2WNGA 1KG0A 1X5ZA 5JIHA 3DI3B 2VL5A 4UTBH 3W39A 3SDAA 2ICWJ 4YXLH 5DQJB 5TH2B 4C59B 4XMPH 1SJEB 2Z8RA 4Z7VE 3RTQA 1Q9WA 2X70A 5I76A 4ORGA 1X44A 4D2NA 3HLAA 3ECBA 3B2UC 3X3GL 2H2SC 4C83B 5B3JE 4DKDC 4TVSa 1UB6B 3LS5H 5AYUL 3WD5H 1HDMA 3RY5A 3ZDYE 5J06A 5HPMB 2HKFH 5CEXB 4Z8FL 2E9JA 1Q94A 2XT1B 2FEDC 1YDPA 4B50A 4CW1A 1NGPL 1RIVH 2ERJC 3QO1B 3HE7A 1NGZA 2QTEA 3D2UD 4Q9QL 2P47B 5A16B 4MNHA 5AYQA 4XCNB 3ZMRA 3I84A 4P2YA 1Q72L 3C09C 3BMVA 1M6OA 1FDLL 1I7TB 4PJAF 2K7QA 3QUXA 2WWMD 1GRWA 4J23A 2F8VA 4NKIL 4TQEH 4OT1L 3O6LH 5DJYB 1U8HA 4U2YA 4MNQE 4JGJA 4ZOCA 2GYSA 1OQXA 5FA4A 1AGCA 2CK0L 2APTA 5DJXA 4X7SL 3MJ9H 1F58H 1FGNL 2YBRA 2AK4E 3LQMA 4YBLC 5DD0H 2XA3A 3BPOB 4LPCA 4D9QE 3LEVH 1R3IH 2PTVA 3QEQB 4O5LH 4Q0XH 5FKAA 1FL5B 3BH8A 3QG6A 5GPRA 4EQ2A 5D4QA 5SX4I 5IVXB 1NAKH 4CADA 2YN5A 1AD0A 1INEL 2IAND 4FZ8H 3VDCA 3KXFB 3OQ3B 4Y19A 2V9QA 4DKEL 1JWSB 4TUOA 5KN5A 1UM6H 3UROR 1EPFA 2CRYA 3I6LD 3UTPE 1BQHA 4HFUL 1E4XH 4WI6A 3QRGH 4MD4A 3UBXB 1D5ZA 4G42B 4Q74A 2R2BB 3H9YA 5MEQA 4HPOL 4WI2A 2VDML 5AWNL 4HS6A 5DD1L 3GZKA 4JGUA 5D70H 2PXYC 4MYWB 5TDNB 4YQXH 4PG9A 1YQVH 1CGSH 4P46B 1MWAA 1MCOL 2XZCH 3GSXB 1DFBH 3L7FA 4WUUD 1OGAD 1O5DT 2HFGL 4LLAA 1ROWA 2IAMB 1X4YA 5MEOA 2R23B 4H1LG 1X7QA 4R0LA 3CDFA 3HZMB 4NJ9H 1JPTH 3BPLB 2C9AA 2EIDA 2BCKB 3HA0A 4HIJB 4JPWH 1KTLB 4MXVE 1A6VL 4P2OB 4HH9B 5B39A 3TNMB 4K8RD 1RK1A 2XN9A 5D93C 1CD0A 1TCMA 3GKZA 2DOCA 3NH7H 3SOBH 1IKFH 3VXUB 2BZDA 2OI9A 3MBEA 4BH7A 1KT2A 1H3PL 2OP4H 3GHEL 3TN0A 5IW6B 4JHWL 2FIKA 4RWYL 5KS9A 1HCVA 4YJZL 4NBYB 3PF2A 3WV0A 2A6KA 4XAKE 1S5IH 2YUXA 3OL2A 4OF3A 4OQ1A 4RIRA 3FONA 4UINL 1A5FL 2P24A 2VXQL 3Q48A 5ALCL 3RNKA 3C5SB 4NP4L 2AK4B 1BVLA 1FFPA 2ZKHL 4JO3H 3GJEA 1CI5A 4ONOA 4LKCA 1JI2A 3RAJL 5J56B 1P69B 3IXTB 3DGCR 4UNUA 5I9QB 2DWEA 2VIRB 4QTHB 4MAUL 1BJMA 3F7VB 3MGTA 3QQ9D 5EO0B 2J12B 3P30H 3T3ME 5EZOH 2OTPA 4F8TA 4NNYA 4WHYG 1IFHH 1EMTL 4RFNC 1NJ9A 3ULUH 2P8MA 5HHOA 3IFNL 4OM0H 2PCPB 1CN4A 3D18A 5F6HJ 1ZHLB 5IP4A 1T0NB 3HPJB 2J6EA 4ZUTB 1KPRA 4TULL 3RZCA 1BX2B 1NCWH 3WXVH 1NBYA 2RQ8A 5J6GA 5JW4R 2ZG1A 3C5ZB 4NUGL 5JIKA 1A6UH 1C5BL 4KJYB 2M26A 4XNYH 4NQEA 1WVZA 1CVRA 1QSFB 4N0UE 1L0QA 4OCNC 1KJ3H 3BESR 3MROB 5DS8B 1S8DA 1DSFL 1FSKC 4QCIA 3QT2A 1UCBL 3LN5B 3SE8L 3V4VH 3WXWH 2FHBA 1NCNA 5MEND 4KHTL 3VGGA 2NCMA 4UUJB 4IMKC 5TE4H 3T8XA 3G5YB 1AO7D 4OBSA 3KLAA 4YXLL 5C0BB 2UYLB 3QNYB 5DEGA 4LSPH 4XMPL 2G9HA 5CD3B 3FOMB 1TNNA 1YMME 2ADGB 4PJXE 1BF8A 2OTUB 3T4YA 2VZ3A 2VQ1A 1KIRA 3LS5L 4GRMB 3WD5L 1KTDA 3EYVA 2HKFL 4JFHD 2J8UA 1LK2A 4LCCC 4UQ2A 4JFZH 1RIVL 3GMMB 5HYFA 4Y5YB 3K2UH 5D7JD 1NGWB 3KGRA 5JW4M 2HLFC 4LIQE 4XC1H 3MJ6A 3WN5B 5I71B 4P5MA 5D7LB 3T1WA 5K9KA 4L8CA 1WWCA 4CDHA 1IM9D 5T3ZH 1C7TA 4TQEL 4YPJA 3WS6A 3O6LL 3C2AH 1UXWB 1HEZB 5AEAA 3BKYH 3H0TB 1HHJA 3D25B 4NO0D 1E4WH 4XP5H 3SE3A 1IBGH 5IQ7H 2EDXA 2HLAB 2AJZB 5FGBC 4MLIA 3OR6A 3MJ9L 2H26B 2AJXH 4CN4A 3QH3B 5HPOA 1FLRL 3LEVL 3QDME 1TETH 4QRRD 4XNQB 1R3IL 4O5LL 4Q0XL 2UWEF 1T5XB 4FQQB 2GTWA 1MHEB 1BFVH 4X8XA 1NAKL 2VDRH 3VW3H 3LZFH 4PP1C 5EBGA 3JV4A 5GIRA 3E3QC 4G8GE 5GS1C 3VI3E 4FZ8L 4PGJA 1VFAA 5J11C 3W9EB 4D0DA 2BNQE 1KCUH 1U91B 4PJAA 1CD8A 3WJJA 4ONGH 1UM6L 5INCB 2LFGA 3ARBB 2ENYA 3VWKA 4L8DA 1E4XL 1P4LB 3QRGL 3W0WA 3IDYB 4EEEA 3OX8B 3LN4B 5ANME 1LP9B 4J6RH 1XR9A 3OBAA 5D70L 1IAOA 3FRUA 5A2FA 4YQXL 4O58H 1YQVL 1CGSL 2XZCL 1IGTA 1DFBL 2Z8WC 1WFNA 4KI5D 3VFUB 3DX8A 3ALWA 1WIUA 4JY4A 5KAQF 1KIUA 1U3HB 4YIQA 3V8CA 4E41A 2VAAB 5C08A 4DCQB 4CDGC 2K3TA 3OAYH 4NJ9L 5D96B 5C0AB 1JPTL 4PRBB 4OGAD 2CUHA 4GS7C 5FKPB 2LAGB 3DVFA 3L3JB 2IALA 5FYLE 3N1QC 2I25N 3MNWA 5HDBE 3DX7A 4G6KH 5CEYB 1P7QA 5FIEA 3OXSB 3P9LA 1D7FA 4GBXB 4O2FB 1ADQA 2XFXB 4P57A 4YHYB 4YX2H 4ZUWA 5DZLA 3SOBL 1IKFL 1XH3A 5HSFA 3QHTC 4FQ1H 3EYSH 3CU7A 4PJBB 5I8CA 4YGVB 3SN6N 3PL6D 2OP4L 4YFDB 3P4LA 1U92A 1NGXA 3X12B 2ADJB 1NLDH 2Z8SA 3LEXB 3P4NA 3VH8G 4DKFH 1F8TH 5JQ6L 1J0ZA 3VI4F 5SWZB 3WKMH 1S5IL 1JWMB 2VLJB 4HUMB 4PJEE 3IDNA 2P8LA 3KYNB 3EHBD 2EDJA 2KZWA 4HWEH 4JO3L 5E6YA 4PGDA 3ARDB 4LRNH 2R0LH 5DDHA 2XTJD 4X6DB 5DJ2A 1HI6B 1H5BC 4N0FA 2FZ3B 4F9LA 3SDCB 3KDMB 2DQJH 1QEWA 3RWHB 3P30L 4G8GB 4UTAL 4OLYH 5EZOL 3MREB 1IFHL 2D4DA 3ULUL 3E6FB 1DUZA 4OM0L 4YO0B 4HGWA 1JNNH 1MLBA 1P6FA 2WUBH 2ZUTA 5FF6A 4TNWK 1ZKAA 5D5MF 4EN3A 4DEPB 1NCWL 3WXVL 3P3YA 4JFEA 4K3HA 4NQXA 1A6UL 1S7QB 4XNYL 3QI9B 1F13A 1P9MA 4LSTL 3HS0A 5E9DD 2X9XA 5I2IA 4HUUA 3C87A 2LU3A 2J2ZA 3IAGC 3ISWA 3BWAB 1KJ3L 3ZL4H 2F54B 2SEBB 3QDJB 5SV4A 1K5NA 1S7TA 2H6PB 2ZNWA 1VEMA 2BFVH 2W1NA 3WXWL 3U82B 1PSKH 2HYMA 5CBAA 5TE4L 1TZHA 2BY2A 3SGJC 4ZXBB 2H9GB 5BMFL 2DM3A 2IQAA 4MVBA 4HKXB 4PREB 4HEPG 4LSPL 4Y1AE 5AZEL 4JZOB 5ACZB 4XMKH 4HWZB 4KC3B 2FYYA 3VWJB 4LIQH 1KNOB 1PEWA 3E2HC 3V4PH 5C0CA 4PJGE 2NX5D 5LKNA 2DQFA 5EBLA 2KL6A 2DQGH 2UZYB 3QIWC 3CFDB 2R69H 5FYJU 1GL4B 3O2WH 3P0GB 1HYSD 1EBAA 5D2LB 3LKNA 1U8OB 1V3LA 3C8HA 3MV8B 4WHTA 5JMOC 3G9AB 4P5TA 2A73B 3VD3A 4XPHH 1UVQA 5IB5B 3K2UL 4IMLB 1YA5A 4OZGB 5DYOA 4XC1L 1A3LH 2VNCA 1D5IH 1RIHH 1CLOH 3DMMB 3RL1B 3CSPA 3CSYB 4JG0H 1ZHNB 4IJ3C 5T3ZL 3QDGE 1IEAB 3IRPX 3DGGA 2XZAH 1S5HB 2MHAA 3BKYL 1SJHA 4OD2A 1EEUA 4XXCC 4XP5L 1E4WL 2AEQL 3CK0H 5I1HH 1IBGL 5IQ7L 2I07A 3QDAA 5C3TA 2FHFA 3HMXA 4O02H 4OV5B 1LNUB 1A6TA 5CZXC 2AJXL 5SWSD 2QSTA 1RZ8A 3D0VB 4KY1L 5FUCC 1ZLUK 1TETL 2Q86A 3MQIA 4FG6C 1ONQA 3KXFD 3HNVH 4PP2A 3B9KC 1XCQB 4OCRH 3RGVC 5E8PB 1BFVL 1PY9A 5I17B 1WFTA 2VDRL 2DJUA 1U93B 2CH8A 4XP1H 2X2YA 4ZFGH 4LP4A 1U8MA 4ODWB 3Q5TA 4GW5A 3IETB 1KCUL 2PYEB 2CSPA 5FFLA 4P23B 4Q97A 4OZIF 4ONGL 3O4OB 3H9HA 3LQZA 1ERNA 1G1YA 3UX9B 4NZUH 3C8DA 3FT3B 3Q1SH 1IGCH 1NLBH 2F53E 5F3HB 1EX0A 3MNVB 4TSBH 4P46D 3GJFB 4QT5A 5C09A 1UYWL 4E0RB 1NC2B 2V7HA 1C12A 1BQSA 5E8EA 4TPRH 3MCLH 2V2XA 1KCVH 3E1F1 3GFUA 4RMVA 5T1LA 3LKSB 4P3WA 2IAMD 3U6RB 1MHCA 5EC1B 3KPMA 4L8BB 1OTSD 2FWOB 3TO4C 5ESAA 4KKAD 3MRPA 1EO8H 1CGUA 2Y5EA 4AG4H 3H42H 3HI1B 4Y5XB 32C2B 4P9MH 1MI5B 4OZHA 1TDQA 4QRTB 3VXRA 2NY5C 2DAVA 3UTSA 4YHPA 2PO6A 5JHDB 5LCVH 4QRQB 4E9LA 1KPVA 2BNRB 5B4MD 4LHUG 1KELL 3SE4C 3VXUD 4XZUB 4G6KL 1EO5A 2Q76B 3I75A 4QGTA 3AM8A 4PJIE 4AM0A 2DLHA 1NKOA 2E7BA 4B53A 4WI8A 1KJ2B 4C55A 4YX2L 4JHBA 4PJHB 2AERT 5SX5K 1T1ZA 4FQ1L 3BE1H 3EYSL 4OUOA 2C1OA 3DSNA 1I8LC 2DJ4A 3B8SA 1NLDL 2AK4D 4NQCE 4DKFL 4ZFOA 1F8TL 4NIKB 4D9QD 1WISA 1LQVA 4CMMA 2IJ0C 3WKML 1AP2B 4JRXE 1UQSA 1AD9B 2XV6B 4M43L 3U7AA 5IKCA 4N1HB 2AV1A 2Z35A 4HWEL 2Q1EA 1HIMH 2X4RA 4NT6B 4LRNL 3RY6C 2R0LL 3U9PH 1MIEH 3DUSB 2F58H 3FB5A 3P9MB 2FX9H 2G75B 3MLZH 5HHVL 5IG7A 1F4YH 2DQJL 3TGXA 5T1DH 1ORSB 3UTPD 4OLYL 3IJHB 2X4UA 1YC7A 3FO1A 5I16B 4S2SB 2EXWD 1DLHA 4PJCE 2ED7A 1JNNL 3WJJC 3GJFH 2WUBL 2YD1A 4HLJA 5D71H 1CGXA 1EFXA 2AJSL 5GS2H 2RBLA 4P4RB 1G6RB 1IAMA 2DN7A 1CGWA 1A6ZA 3RVWC 3C6SB 5E6IB 4YDLB 4Z7WA 4RAHA 3V7AG 2OXHA 4R2GB 1V3JA 1PZ5A 5D1ZB 5BV7C 2JK5B 3MA7B 3ZL4L 1HH6A 3MRJA 3REWA 3G5XB 1GGBH 1P2CB 4MJ5B 3L1OL 3Q6GH 2BFVL 5C0BD 3ZT6A 1PSKL 2F74A 1JHKH 3R8QA 2BVTA 1FO0A 3U9UB 3JV6B 4TNWF 1X4XA 3G08A 5BW7C 2AJ3B 3PWJB 3IFPA 1DVFA 2P5WA 4LIQL 1X6NA 1UG9A 3DTXB 3V4PL 4YHMH 1KJ2H 5JZ7C 2XWJB 1PYWB 4NKDA 2DQGL 2E6QA 3BGFB 4LF3A 5L2JA 2R69L 3MRKA 4U1LA 3C60B 4U6TA 4X8JB 2R15A 3O2WL 2R56H 3TBYB 2A83B 3BP6B 2XKSA 1VEPA 2Y7QB 1RUAH 1I7ZB 1KYOK 4HWBA 3V0WH 5K9QG 4NGHL 4HF5H 5E5UB 4XPHL 5IBLD 5E95B 3U0TB 1X5JA 1A3LL 4V1DB 1D5IL 3ARZA 3GUTA 4QWWD 1RIHL 4EUPA 1CLOL 3OF6D 5HYSA 3BQUD 1CIDA 1K4DA 4JG0L 4P3DA 2P48B 4RFEA 4PRHB 2XZAL 3F5WA 4OLUH 5JXED 4ZMAT 2R8SH 3MFFA 4PJ8A 1MCFA 3CK0L 3RUGF 5ALBH 5I1HL 5F7FA 4RGNC 1EZVX 1OCWH 5F1IB 4O02L 1G9MC 2YD7A 4XCFH 3OHXB 1OAXH 1G6RH 1AHWB 1YJDH 3JWOH 4ELMF 2P7TB 3CVIH 3HNVL 4OCRL 3NPSB 4N90E 3KYOB 4XP1L 4ZFGL 5IMKB 4OCYH 5IFJB 3ZKQD 2IBZY 5IMOB 5F96H 1QSEE 1S7RB 3CDGA 4Q6IA 4S1QH 5I8EA 3JZ7A 1C16B 4G6MH 1JUFA 4F37K 4OAWB 2X9YA 4NZUL 3NIFE 3Q1SL 1AR1C 3HMWH 1IGCL 1NLBL 1BD2B 4TSBL 2DLGA 4YDIH 2XNAA 3FKUS 4UOW0 4MNGA 1W0YT 4G80B 4ZUSA 1YMMD 3ILPA 3DURA 3MCLL 4LVHB 4FA8A 2VDOH 1KCVL 2RIKA 1FJ1A 1U3HD 2G60H 3FB7A 1JPGA 1EO8L 5EU6B 4AG4L 2FJHB 1L6XA 3H42L 4YNYA 2R9HD 3QIBB 4WEBH 2RFXB 1W0VA 4P9ML 4ZYKB 4KKCD 1NUNB 2VLLA 3FT4B 3KPSE 3K7UA 3UZQA 1F6AB 4XTRD 1OP3K 2R2CA 4OZIA 5LCVL 4LCUA 4HAGA 5C2BL 2VLRB 4P5TC 1FFQA 6CGTA 2EDWA 5KSVB 5TF1H 5HHNB 5CMAA 4F3FA 4U6HB 1NGYB 3ZKND 3C6LA 2O26U 3BE1L 5SWZD 3WUWG 2Z31C 4Y16A 4MHHI 2E7LA 3STZA 3LMJH 4G8EB 1JF1B 2ZUQB 5CJOH 4PRPE 4NN5B 1RUKH 4DFIA 1T89C 1C08A 2CQVA 3QDMD 3B4NA 2GIYA 3BWUC 1EEYA 4QRPB 4ZAKA 5D6CB 1EAPA 2YRLA 5DZNA 1A1NB 4WHYH 1G7PB 2DMBA 5HGAA 1PX3A 3L3OB 3JWNC 4ZPTA 3SDCD 2N7AA 3HCVB 4G8GD 4JZJA 5ISZA 1MIEL 5K9OA 4NRYA 2F58L 1YNLH 2FX9L 3MLZL 3O9WB 1LEKA 4KJQD 1F4YL 4ZSOE 4AJ0A 1P53A 3L3IA 5T1DL 5IMMA 3NCJH 3FO9A 5ABDE 2NY3C 5L8LB 1CICA 3I3BA 1HHHB 1RHFA 4KDTC 5EPMB 1AXTH 2EIZA 1WIOA 2WY3A 5D71L 1ZVHA 2IFFH 5EU3B 5TDPA 2HTLD 3QUYA 1PG7W 4WENB 3MRDB 2X4OB 3TIDB 2OTWB 1VHPA 2ICCA 1GCFA 4I77H 5L2KA 4NRZB 1T1WB 5I15L 2ITCA 4LNRA 3AB0C 3S5LG 2MPAH 4DZ8B 3MXVH 1GGBL 3ARVA 4X7DC 5IHLB 4FXKA 1EO7A 4X83A 4GQ9H 3ARFD 1WWAX 4JDTH 2IWGA 4U6YA 3SPVA 2R2EA 1JHKL 5FYLD 1E0OB 4FFZH 3EYQD 5IESH 4N9GA 5AUMA 2UY7A 1S9XA 5T1KA 1QRNA 5KZCB 5IMLB 1KPUB 3KR3H 3DPBA 1AC6A 4YHML 1KJ2L 3WHXA 1NFDE 2YUWA 1KUMA 3MR9A 1OL0A 1F97A 5EH1A 1UA6H 3NFPA 2Z4QA 3QJHA 4P2RB 4GFTB 3CDCA 1EXUB 2R56L 1VFUA 2PYFA 3BIBX 1TVHB 3AMLA 4PTTB 2NW2B 1RUAL 4PGBA 1JZ8A 3MRNB 1U6AH 3VXME 3V0WL 4Z77A 4P2QE 3U36A 5L88H 3DMMD 4HF5L 5D8JL 1BVKA 2W65B 5HJ3A 4DUXA 2HKHH 4Y5VB 4E42B 1F42A 2JKXA 4JHZA 1FRGL 3CFBB 4HMCA 1XGQA 2W9DH 3TJHD 3D2UA 4L4VE 3OKEB 4MJIB 3REVA 4PB9H 3RWIA 1CFNB 4OLUL 1ZS8A 3C08H 4S11A 2R8SL 3UTQA 4XX1G 3VFMB 1JZ6A 1Z6JT 2XG4A 2D31A 3DVGB 3MPCA 2RGSA 1MJJA 1QTYT 2AK1H 3MO1A 5ALBL 4JDZB 1OCWL 4HPYL 3X14A 4RGOH 3SO3B 2N4IA 4XCFL 2V5YA 2VDNH 1OAXL 4X4XB 1G6RL 5DGQA 2YRPA 3ULVC 4IM8A 1YJDL 3JWOL 5IB2A 3CVIL 2NY0C 1OB1B 2J3SA 2ZG2A 4LMQE 4MD0B 3FFDB 4P23D 4M4RA 4PUBH 1BVZA 3UPAA 4BQ8A 3OAZH 2XQYG 1QQDB 5IF0B 3JUYA 1FV1B 2CDFB 4OCYL 4W6WB 1TTFA 3Q3GA 4FP8H 1IZJA 5FB8B 5DFTA 5F96L 2YUVA 4S1QL 2IANA 4OM1H 4G6ML 2JJSA 3AROA 1IT9H 5GS2D 4KROB 5C0IB 3ZDZE 5T3XE 5HVFB 1JFMA 4EIZC 3HMWL 3RUGA 4Y1AD 2KH2B 4YDIL 4Y4FB 2AQ2A 4HWUA 3QUKB 5IV2B 4APQC 4JKMA 1JPFA 2NY1B 5F7DB 2VDOL 1YEEL 3QFJE 3LRHA 1T3FB 3VGAB 2BC4B 4OLXH 1A2YB 1DVFC 2ESVE 1T7VA 4GXVH 5F9OH 1CL7I 4WEBL 2EE6A 2BNRD 4WO4D 1CT8A 1I1RA 4KXZH 1OGAA 1WZLA 3LRSA 4K3JH 5F6IB 3LB6C 1HQRA 4WHDA 4R7DA 3BOVA 1T21A 4JQXA 3NFSH 5I1LB 2BOCB 1TJIH 3RVTD 3U46B 5TF1L 4POZC 4ETQB 1WQVT 1A4KA 4WFHE 3W9DA 3BO8B 2RAMA 1RK0A 1T20A 2OR9H 3EYFA 4XB8A 3AUVA 3PWPA 4PJDF 4NWUH 5JQHC 3LMJL 1P1ZB 2OSLB 4D94A 4KU1A 5DEZA 5CJOL 3M07A 3CPLA 1NCCL 3ET9F 1U8PB 5F8QC 4ZG1A 1RUKL 2EYTA 3ARED 3TYFB 2NQCA 4QHMA 4I9WE 4OI8A 5FECA 5HDLA 1BMGA 1A9BB 1HSBA 5B8CB 3FQRA 1TPXC 3KPRE 4LPWA 5F9JA 2NXYC 1OF2B 1ZHBA 4L4JA 3SGDH 4PGZA 3QAZC 1T1YA 3FOLB 4NHCH 5LQBH 3I6KB 5CD5C 2XXCB 1KEMH 1MF2H 5IHZA 1RUPL 1YNLL 5DRWA 1Q9OA 1WIPA 4U1HA 3S6CA 2AJYH 1TQBB 1DEEB 3GB7A 3IU3A 3NCJL 4OGYH 3ILQC 4YDVB 4OB5H 4HGMA 3A6BH 1DQJA 2F53D 3U4AA 1AXTL 3GMLB 5E6ID 1PKQE 1KIQA 2W91A 1MJ8H 2EC9T 3M17A 4PJ5E 3MOQA 4R2GD 4NC1E 4YHZH 3IJYA 5DHVA 3VGEA 1VKXB 3X11B 1QPPA 2IFFL 4CN6A 5IOPB 2G5BB 4PRDB 1NMCC 3FRPG 4OCWH 5IVZA 4AT6A 5IEHA 2ZG3A 4U1GC 2WLZA 2HJLA 3HUJB 1SVCP 2VITB 3LIZH 5ILTH 4I77L 4MCZA 4IEFB 1HILB 1J18A 5C0FA 4FQIH 2MPAL 1MEXH 1MH5B 3MXVL 3OXRB 2BVYA 3V7AE 5IW1B 4B41A 5I66B 2ESVB 1JZ2A 1GOFA 4P4KB 1XF2B 4HIEA 3SJVB 4JDTL 1CFQB 3TFKD 3TPUB 3HC3H 5BO1H 2R39A 4FFZL 3BVNA 5IESL 3T4AB 1F90H 4BKLA 5E8DH 4HIHA 3U48A 5MENA 3RWEB 4Y4KA 3KR3L 1YPZE 4DWHA 1IEHA 1BWWA 4XPBH 1LGVA 1UA6L 5DVMA 2EKJA 3CZFB 3BDBA 4NQCD 2YEZA 3F6IA 7FABH 2L7UA 4V1DD 1QBMH 3RQ3A 1U6AL 4IIQB 4OQTL 4WW2A 4LL9A 5L88L 2EDRA 3PXHA 2Z92A 1WSST 2ZCHH 3FQTB 3VFTB 5E8NB 2HKHL 4BFIB 5C1MB 3MV7B 4PRHD 5H94B 2ARJA 2E7MA 2P46B 5D7JA 2W9DL 1U8LA 3HAEB 2FRGP 3IAPA 3VFNA 5D1QB 1PD6A 4PB9L 4M7LT 1OAKH 4P0DA 1G7LA 5IB3A 5T1MA 2ICEB 4JN2A 3C08L 4UV7L 3WLWD 5F7HA 1YUHA 1IM9A 2BVQB 4JFXB 3MACH 2AK1L 5BS0E 1OD7A 1P4BH 4RGOL 4Z0XA 3ES6B 3VFOA 5BOZG 3BIAX 4NO0A 2VABA 2VDNL 3JWDH 4X98A 2GJZB 3NAAH 1QD0A 4Z7VF 3EDJA 1YNTB 5C07E 3SY0A 5LGJB 3RPIB 1KIPA 2OCFD 3VXSA 4YFLF 4KK8C 4QHLA 1GYAA 4JRYE 2DBLH 3JVGC 4PUBL 3BRGC 5EIIB 4N8VA 4QRRA 2FO4A 4NYLA 3RL2B 4HFWB 5FK9A 4MA3B 3ZDYF 4HS3B 3CH1B 5F71A 1NMBH 1VADB 2CRIA 2V2TA 1K4CB 1QACA 1BD2D 1QFWH 3O8XC 4S10A 4FP8L 2Q8BH 3T2QA 1TQCC 3EJYD 1TCRA 1BM3H 4ELKA 4OM1L 4R97B 5D2NC 1J05B 4BSJA 3NCMA 5DGRA 2AKRA 1LO4H 1WLHA 4X5WB 1BIIA 4F7EA 1CDBA 5IR1B 3CH8A 5GS0H 5ADOH 1U42A 2GT9A 3DYOA 4Y0GA 4PJ7A 2XPGA 2DMKA 3KWWA 4CUCA 1A47A 4HD9A 4OLXL 1NAMB 2C4XA 43C9B 4X99B 2PNDA 4WWKB 1CG9B 3KHOA 1KTKE 3ARGC 3QEGH 4GXVL 5F7NC 5F9OL 4JDVB 4XCYA 3MRIB 4TVPH 2LTQC 3SDXA 1KG0B 2VL4A 3RIFK 2VL5B 3ALXA 3W39B 3SDAB 4K3JL 5GGVH 1GZPA 5E1AB 3RTQB 1Q9WB 4HXAH 2X70B 5I76B 2LABA 2W9LA 1WFOA 4ORGB 1FVEA 3NFSL 1R5VA 3VFGH 3HAEH 5TQ2H 3RZWA 3MLRH 3Q5YA 3ECBB 3T04D 4U0RB 3BPNC 3C5JA 1TJIL 3LV3A 3PWNA 2UZXB 1HDMB 1A22B 3WCYA 3ESUF 1UM4H 4N1EA 3GKWH 2OR9L 3FQUA 1XIWD 1Q94B 2EDYA 4NWUL 4IRZH 3ESVF 4YUEH 1A6WH 3HE7B 4KRPC 1NGZB 1S7XA 2VZOA 3RWGA 5CZKA 4JKKA 4YHIA 3PL6A 4MQTB 1CE6A 4MNHB 2H1PH 6FABH 5JPMB 2YPKB 1F3DH 1AGBA 4N90D 2N56A 2HA1A 5KAQG 1AJ7H 3FL7A 2CO7B 3O6FD 4NHCL 1INDH 5LQBL 1MFDH 1U8HB 1KEML 1MF2L 5L8KB 5E2JA 1BBJB 3QDHA 2AJYL 1QSED 5ICYA 5FA4B 1AGCB 2APWA 2FH6A 2V7NA 4WIQA 4OGYL 4I0PC 1MIMH 4OB5L 3A6BL 5DJXB 2C1PB 1OSZA 3T77A 1XF5A 4F7CA 4ZDHA 5AG9A 1CGTA 4LDEB 1MJ8L 4EXPX 3MJ9A 5ENWA 3T2PA 4J3VA 4YHZL 5FKAB 4O2CA 1OT2A 3ME0A 3P4MA 3BH9A 2A74A 4CADB 1KOAA 3RVXD 1AD0B 1NAMH 3MNZA 3LIZL 4Y19B 3S88H 4UIMA 4XBEH 3K81A 4PB0H 3DHMA 1MEXL 2YC1A 4P5KA 5E9DA 2LU4A 1Z5LB 1BQHB 1X3DA 4TYUA 4MD4B 2ED8A 5HI4D 5BO1L 3T3PE 3VDBA 5MEQB 1F90L 5E8DL 4HS6B 5F7YC 1UWXH 5JA9A 1SMOA 4PG9B 4GRWE 5E4EC 4R4NC 1MWAB 4MA7H 2XWTA 4P2RD 4H8WC 4YPGB 5D7IF 4D9LH 3L7FB 5KSBE 3CX5K 4ISVA 3TZVC 3WIHH 4JJHA 1OT1A 5F70A 2QADD 1NSNH 4XPBL 1X7QB 3T3MF 5HPMA 2NX5A 4R0LB 3IKKA 3JBG7 4LSDA 5DJ0A 4PRPD 7FABL 2P5EE 1QBML 3G9VA 3QO1A 1NEUA 4FS0A 5KBNC 5A16A 2IADA 4YE4H 2ZCHL 1V7MH 2NZ9D 4FQXC 3LD8C 1FLTX 1RK1B 1ZV5A 2FR4A 2XN9B 4NQTA 1I7TA 1RUMH 4F7PA 2OI9B 3MBEB 3MRBB 3OKLA 5DJYA 4Z18A 1KT2B 4K3EH 4J4PC 2WBJC 2PW2A 2IPTH 3TN0B 3RP1A 2FIKB 4YXHH 1UH2A 1MCKA 2EE2A 3MLUH 3MACL 2HT2D 4ZO8A 4F57H 2A6KB 4LGPB 4JANA 2OJEA 4RIRB 1P4BL 2P24B 4XX1E 3RNKB 3VFRA 1UJ3C 2VZVA 5HGHA 3JWDL 1BVLB 1FFPB 3PV7A 3NAAL 4ERSH 3GJEB 4EI5C 1P7KB 4LVOC 3QQ9C 3TYGH 1AC0A 5LVEA 4MQXD 1FL5A 4ZOEA 1H3VA 2GJ6B 5SWSA 5J12B 1OP5K 2DWEB 2DBLL 3JSSA 3KXFA 3MGTB 4MQSB 1SVZA 2HAZA 4B0MM 2FL5A 1NMBL 4NNYB 2EXYC 1QFWL 1NJ9B 2P8MB 3HR6A 2Q8BL 5HHOB 1ZLWK 1T1XA 1YECH 1G9NH 1RAMA 4WUKH 1BM3L 1OP9A 1S9WA 2IGFH 3D18B 2NY1D 4LP5A 3L3GA 4PBWD 1LO4L 4G42A 4V2CB 1I1AC 2DWDA 3S5LB 4QHKJ 1NBYB 5J6GB 3P0YH 5BJTB 5GS0L 2DM7A 2JJWA 1MWAH 5ADOL 2QL1A 3NCBB 1BECA 5K93A 4NQEB 5EU5B 4P46A 4XXDB 2VLKE 3T0AA 3H9SE 3K1KC 1GGUA 1S8DB 3TP4A 2O61A 4LRIA 5GISH 3R1GH 1X5LA 3QEGL 2IAMA 2E6JA 4KWUA 2X41A 2R23A 4TVPL 3QISA 4M48H 4OUUA 5DD5H 4LCYA 1ZMYA 4P2QD 3T8XB 4UILH 3DVNA 3KLAB 5GGVL 3V8OA 4BSWA 2W59A 5F9AC 5DMKA 4GUPB 1KTLA 4HXAL 3V5HA 3NVQA 3TLRA 3PJSA 1CE1H 3STBA 4L4VD 4HH9A 3T0EC 3S36H 5TQ2L 3QXVA 2IBZX 3R0MA 2VQ1B 5EIVA 5E2TL 1KIRB 3VXUA 4MXQD 3EYVB 3P0VH 5GGSA 1UM4L 5IVOA 3GKWL 2J8UB 4C4KO 1OTTD 3N9GH 4G59A 2EDDA 1HK6A 4S1DD 4IRZL 2X7LA 1MHPH 4DAGH 1GGYA 3RIFF 1CWVA 3WBDA 5IFAH 4AH2A 1B3JA 2B1HH 5HGDA 5HYEA 3C5SA 3EBAA 2H1PL 4NKQB 4P5MB 6FABL 1N6UA 2AK4A 1N4XL 3KLHD 4LASH 3SQOH 1J0JA 4DUVA 5I0DA 1AJ7L 2CRZA 2YD6A 3HZVA 2FO1A 5GGRY 3NFNB 1INDL 1T7XA 3CMOH 1MFDL 1HHJB 1RZJH 1CXLA 1A21A 3F7VA 3ZLQC 3FHAA 3LVEA 3MA9H 1MIML 4P99A 3OR6B 2J6EH 5DSCA 4DTGH 2PCPA 1T0NA 3ARYA 1FPTH 2UVFA 3OPZH 1HCFX 1BX2A 4NQDE 2GTWB 5DFWH 3QFJD 1UFUA 2B7DT 2MSPA 2GK2A 4RAUB 3EGSA 2ESVD 5GIRB 1UWGH 1NAML 4N5UA 3S88L 3I2CH 3AMKA 4PJAB 4XBEL 2HT3C 4PB0L 4JFQA 3DXAE 2NXZD 2Y72A 3LN5A 1G7MB 3JXAA 1X5FA 4XGZB 2Y25A 5FYKH 4UUJA 5TDOA 3W0WB 3N85H 3CC5B 4U1NA 1E6OH 2MNUA 3WFEH 3FZUD 3O6MH 5D7KD 1U2HA 1IAOB 3FRUB 5CWSA 5DJDB 1WTGT 3IDUA 4LHUD 3QRFM 4MA7L 2XQBH 4WFHD 1IGTB 4PJ9C 4D9LL 5IM7A 4K3DH 3DX8B 3KLSA 4TTDC 3WIHL 4JY4B 2VDLH 4GRMA 2FJFB 1NSNL 4E41B 3BKJH 4PLJD 5IGXH 5C08B 2ZUYA 5DJCA 3TVMC 4S1RL 2GQHA 4L9LC 1FL3A 1RZKC 4I9WD 4IDLA 5CSZA 3L9RB 2VC2H 4Y5YA 1GJIA 3WNMA 4KGLA 1JE6A 3DX7B 4J3TA 2ICES 4WDIB 5D1QD 4W68A 1P7QB 4YE4L 1V7ML 3P9LB 4OD3H 1UH3A 5MI0B 3IDMB 4P57B 4OTXL 4ZUWB 1RUML 1XH3B 4M8QA 5I8CB 4K3EL 1XGTA 4F7MA 2IPTL 1OWRM 2JJVA 4QXUH 4YXHL 3BQUA 1U92B 1NGXB 2WWKO 1Y0LB 4KPHH 1H15A 3MUHL 3EOBA 3MLUL 4F57L 4I48A 1NCDH 2AJZA 4PJ5D 3BN9C 2BHYA 2H26A 2YR3A 1RI8A 3IDNB 5I73C 2P8LB 1T7YA 4WU7A 1PDKA 4M03A 4ERSL 2WAHA 4LSSH 4XNQA 5HI3D 4AZ8A 5JO5B 3PWUB 3TYGL 4PJGF 4Z5RA 1LE5A 3DOSA 2D0HA 4FQQA 4PGCA 4PYHA 5DDHB 1J1OL 4XH2B 5DJ2B 3B9DA 4U49A 4N0FB 3RI5K 2J8HA 1CVSC 1QEWB 4OLVL 4YWGH 3D3VE 4GRLD 2A38A 1U91A 4Y89A 2RHEA 4N0UA 1YECL 1G9NL 3UJTL 4HGWB 4MAYD 4WUKL 4ODSH 3GM8A 5FF6B 1A1OB 2IGFL 4EN3B 3OKDA 5FGSA 3HE6D 1YEHH 4JFEB 1TJGH 5E00A 4TOYH 3P0YL 4NQXB 4NKOA 1MWAL 4JFFB 4WWKD 2FATH 5EBWA 3HS0B 1IARB 4HUUB 2VXSH 5K9JH 1RZIA 5C8JB 3VJ6B 1YMMA 4PJXA 1K5NB 1S7TB 3VFUA 5GISL 3R1GL 3VD4A 1JGDA 4MX7A 1T0MB 1U3HA 3QPQC 1AXSB 3TV3H 4M48L 4WY7H 3ZKMC 5HD8D 4ODHH 5DD5L 1TZIA 1TZHB 43CAA 4UILL 4JO2H 3L3JA 4RRPA 4LKXB 2RJMA 3ZT7A 5IROA 4XHJC 5TGBA 1RV6X 5KSAD 2R0WH 2FYYB 1EHAA 3PP3K 1P4IH 4M7KH 4F15C 2UWEE 5DO2C 5C0CB 3RWCB 3VA6A 2CUIA 4OLEA 3S36L 1HYSC 2PN5A 1WBYA 3VFSB 3BEVA 3F12B 3P0VL 3O3UN 1J0IA 1I8KA 1L0XA 3UDWA 3WUZA 3MV9E 3LKNB 4OCMC 4WHTB 4TTGA 5IK3A 3QA3A 1MHPL 3TF7A 4DAGL 3FTGA 3LKRA 1UVQB 3LKPB 1MJ7H 4WTXA 5DYOB 5IFAL 4LEOA 2B1HL 5C07D 4DGVH 5C0JA 3M8OH 1YNKH 4JRYD 4LASL 2YPLE 3SQOL 2ARWA 3C2SA 3QDMA 4KRMB 3DGGB 4HKBA 4X6DA 3QWRD 3CMOL 3A0OA 2MHAB 2D4FA 2JB6A 1SJHB 1WGOA 4OD2B 1RZJL 3SDCA 4JLRA 4LLMA 4ZS6C 1V5JA 3RWHA 4N0RA 3HC0A 4G8GA 3MA9L 3MREA 5EOCH 1Q9LA 5DUMH 2Q20A 3BT2H 2MKWA 3E6FA 4JGMA 5FHBH 3T08A 1A6TB 3WHE0 2J6EL 4OCLC 1RZ8B 4DTGL 1J87A 2A9MH 4HEME 1FPTL 3OPZL 3ULUC 4QLRA 4BSVA 4Z7NF 4PP2B 5IIEB 5DJZA 3LS4H 2WIIA 3TA3D 2E27H 1KLGB 3O3BA 1UWGL 5A2LH 1U8MB 4GW5B 3I2CL 2WIMA 1D5XA 4HCRL 4P46C 2H6PA 4HH8A 3H9HB 3LQZB 3DBXA 3SGDI 3GBML 4Q2ZA 2B1AH 1ZEAH 5FYKL 3BGMA 3DRTB 4HWNA 5DMIH 3N85L 5C09B 1FNFA 1PLGH 2CK2A 2V7HB 1E6OL 2PW1A 1C12B 3PXJA 5C71A 1NQBA 5E8EB 3WFEL 4HKXA 3ARFA 1FG9C 3BPLC 3O6ML 4LPVA 2V2XB 5T1LB 3RNQA 2ADIB 1MHCB 3HZKA 4XWGH 3ZHKA 4ODXA 3BRDA 2XQBL 5CJ5A 4Y4HD 1J11A 4K3DL 4P2OC 2VDLL 4OV6F 3U2SA 3BKJL 4NWTH 4M1CD 5IGXL 5E5MA 3S97C 4O4YH 5D2LA 3VXRB 3BN3B 2W07A 3UTSB 1JL8A 3VG0H 2PO6B 2IQ9H 4J3OC 1KPVB 3QPXH 2VC2L 5D5ME 3P73A 5GXBB 5IB5A 3ZYOA 2CKBA 4OZGA 4YEEA 1OARH 1M1SA 3FT2A 2HRLA 3N06B 5C0GB 2FLBT 1F4AA 4OD3L 4PJEA 5JIPA 3DMMA 3MGAA 1RURH 4MS8C 5GZND 1IGFH 4AL8H 1FVDA 2NY2D 1IEAA 3PGDB 4JRWA 1T1ZB 4WGWB 1S5HA 2DLFH 2C1OB 4LCWE 3SQBA 4QXUL 3TJHA 1DTUA 4KPHL 1MSPA 4XWOC 5HHME 3HC4H 5IW3A 1XF1A 5I9QC 4JQVC 4ZFOB 1NCDL 2BXYA 2P43B 4CMMB 1LNUA 5EWIH 4Z7QE 1UQSB 2GJ6D 4RDQG 1BBDH 1JYXA 5TPWH 5IKCB 2AV1B 3HR5A 2X4RB 4LSSL 4HJGA 3UXFA 3FB5B 3T1FA 2JIXD 5F44A 5IG7B 3C5ZC 4YK4B 4YWGL 4EXKA 1G0YR 2FEEL 4K7PY 2MMXA 4JZNA 2X4UB 3D69B 3MRCA 4LCIL 4P23A 4CL7A 1UACH 3FO1B 1F3JB 4OIAA 1DLHB 4GKOA 1EJOH 4ODSL 4CU7A 4F9PA 3D39B 5EOTA 1OQOA 4N1CA 3VFPA 4EZMA 1EFXB 5F3HA 2VTFA 4FABH 4TUJA 1A6ZB 1YEHL 1TJGL 4TOYL 1IRAY 1FNGA 2BERA 4OCXH 5EZLB 3LKSA 2WQRA 4ZOAA 1PZ5B 1MUJB 1KCRH 4Y1AA 3AY4A 4IRSB 5FUZH 4LOUD 2FWOA 2VXSL 5K9JL 3MRJB 3WL9A 3REWB 4LPUA 3RI5F 3NCYS 4PJGA 2C4FU 2JELH 4NO5A 4KTDL 4QEGA 3WDIA 1SEQH 3EOTH 2P5ED 5JA8B 2F74B 3TV3L 4WY7L 4ODHL 3OGCA 3GI9H 4JO2L 3PQYE 3G08B 1F02I 5F8RC 2BNRA 4WO4A 1QFWI 3VRJA 2R0WL 1F4WH 4IOFC 4F7TA 2P5WB 1VB9A 4XZUA 1P4IL 4M7KL 4NKDB 4ODBD 1XGPA 4X4ME 5I18H 3HG1E 4LF3B 3WN5C 5I71C 3MRKB 4XC3H 3E8UH 4U1LB 1NDGA 4KK6D 5I1AA 4JVPA 1M71A 4L29A 3QDGA 4OFPA 3BFOA 2EIEA 3S37X 1BEYH 2DQIH 4LCWB 5BZDA 3NIFF 2F19H 1W2KT 3K4DA 4U1IA 5ACMA 1MJ7L 3GI8H 1OTUD 2EIBA 4DGVL 4LEXH 1T6WA 5JXEC 2GI7A 3TNNA 4Y8DC 4EUPB 1WITA 5EO9A 1YNKL 5IBUB 2G2RB 2W0KA 1K4DB 3AREA 4K7FB 4P3DB 1CZ8H 3HTLX 1MY7A 3F5WB 3L6FB 1LO5A 3P9MA 2GSIA 3O4LB 4N0CD 3MFFB 2BRRL 5E03A 2JF1A 1OHQA 2HJKB 2W0LA 2VZSA 5EOCL 3K2MC 5DUML 4S2SA 5FHBL 3G6JE 3Q5OA 1GC1C 4J3XA 4J2XA 2A9ML 4FRWA 4S0SD 3ARBC 4QKXB 5ETUA 4P4RA 4M4PA 2F53A 4I2XE 2J5LB 3JTSA 5E6IA 1G7JA 2JJTA 4R8WH 2E27L 3V9FA 3WFDH 4UT9H 4GAJH 4YBLB 1K85A 3W0WD 3G5XA 2WV3A 3VRLE 2PTTB 3CDGB 4Q6IB 5I8EB 1JUFB 5DD3H 2B1AL 1ZEAL 2VQTA 4BUHA 5B21A 2ZZUT 5DMIL 3JV6A 2XNAB 1PLGL 2A0LD 4MNGB 4ZUSB 5D96C 3ILPB 3DURB 3S8WA 3PQYB 2AJ3A 4H1LA 4F80A 2YPVH 4X80H 4OIIH 3TFKA 1FJ1B 4XWGL 1JYWA 3FB7B 5C08D 1EVTC 2Y6SD 4KK5D 1QRKA 1QVOB 2NNAA 3HFMH 4PJIA 4YNYB 4GBXC 1D3CA 4X8JA 4NWTL 3G5ZA 4O4YL 3TBYA 1DDHA 2A83A 1P7QD 3BD3A 3VG0L 5J8OA 4OZIB 2IQ9L 4LCUB 1NFKA 4AEFA 3QPXL 5HGGS 1MFEH 5DMGC 1MCWM 4OFDA 5DJAA 4NQCA 1OARL 3U0TA 3MV11 3ZKNC 4V1DA 4JRXA 3FB6B 5JW3H 1RURL 1IGFL 5CMAB 1ZGLP 5FM8A 4F3FB 4AL8L 4G5ZH 2OL3B 3C6LB 4PRHA 1DQDL 3ARDC 2DLFL 4Y16B 3THMH 3HC4L 5K9QI 4XNMB 3UTOA 5F1IA 3SDCC 1F4XH 1C08B 5EWIL 4TNVK 1EEYB 4ZAKB 4BUGA 1EAPB 1BBDL 1LD9B 1MCQA 4HBCH 4MZ2A 4NQDD 5HGAB 2GEEA 5TPWL 3ARPA 4PJCA 2D0FA 4ZPTB 1XGUB 5DC0A 4UB0H 3B9AA 4JZJB 5ISZB 3GNMH 4DEPC 1BZ7B 3GIVB 4NRYB 4PG2C 3OAYK 2KUTA 3KYOA 1AGEA 5IFJA 3DXAD 3L3IB 5IMMB 5ID1A 3FO9B 3QI9C 1CICB 1Z9SA 4XT1C 1UACL 4JFED 3L3KA 3TESA 1EJOL 5C0NC 4CVZB 4X7FC 4JFFD 2V5SA 2HT4D 4FABL 1CFSA 2LVEA 2NMSA 4HIIA 2E8ZA 4HS8H 3QUYB 3SDDA 1A7NH 4ZXBC 3WO3B 4RFNB 1KN4H 1KCRL 4KMTH 5FUZL 5L2KB 4JM2C 3BP7A 3DVIA 4LNRB 5E2WH 3VWJC 1YMHA 3JV5A 1N6QH 1YQ2A 2XICA 5FYKU 2JELL 2V5RA 4FXKB 1SEQL 15C8H 4U6YB 2R2EB 3E3QE 1DL7L 2ZSVA 4DVBB 1JZ4A 1FP5A 3GI9L 4ZD3H 1FNAA 5AUMB 1HINH 1L8JA 1S9XB 5T1KB 1QRNB 4JE4B 4CN1A 1F4WL 3AS2A 1SYSA 3RX5A 3I6GA 3WHE1 2E7CA 4ZUVA 1H3TA 2OL3H 4HK3N 5I18L 1TJHH 4XC3L 3E8UL 3NFPB 3TEUA 3QJHB 3SO5A 3GHBH 2PYFB 4ZFOL 2EZ0D 5J1AA 1G7HB 1BEYL 2DQIL 4UBDD 2F19L 4NFCA 3QZWG 4JAMA 1XIWA 5M95B 1EAJA 5HJ3B 4OQTA 1K2DB 4LEXL 1G7PA 4Z7OE 3L3OA 1XGQB 3REVB 1I8IB 3RVVC 3CFCH 4H26A 3RWIB 1CZ8L 3SCMD 5JUEH 1ZS8B 3S7GA 4LLQA 3UTQB 2D31B 4RCAA 3MO1B 3MCKA 1G7QB 3O6FA 3X14B 5D6DC 1HHHA 3WLBA 1N8ZA 1QSEA 4XPTL 5LG1A 3O4OC 1X5YA 1RJCA 1HWGB 1MQ8A 5IB2B 1A6PA 4F9PC 5EU3A 4Y2DA 4BZ1H 1GZQA 2QQKL 3MRDA 1MCCA 2X4OA 3H3BC 3QNZA 5F7LB 4R8WL 3WFDL 2A77H 3R06A 4UT9L 4GAJL 5DRNB 1NANH 3Q3GB 4DK3A 4DZ8A 3GEWB 4KJWC 2IANB 4EOWH 4WHCA 4PLKD 2JCCE 5DD3L 5EFIA 3RUGB 4Y5XC 5DRXA 3R8BB 2HG5A 5J11B 2X09A 1QHPA 3KPSA 1JPFB 4U6VH 3DUHA 2FB4H 1KPUA 3CU1A 2YPVL 2BVPA 4OIIL 4X80L 1JTTA 2NY7H 4FQJH 4W4OA 4ELMB 4MWFB 3S96B 3CZJA 2CIKA 1T6VN 3HFML 3UTSD 1C5CH 3NA4A 4OZFG 1ZOXA 1H3XA 3LPGA 1ZHKA 1CT8B 5CJXA 1RVFH 2ZUXA 4YC2B 2DIAA 3LRSB 2VSCA 2NW2A 3O3EA 3GBNH 3OMZA 3VG9B 1HQRB 3MRNA 4R7DB 2CIIB 1NC4D 2XA8H 3GMRB 1A0QH 3RVTC 3RDTB 1T21B 1MFEL 3SBWC 1KLFA 4PRPA 2NY6D 1EUUA 4OF5A 4H20H 2YPLD 3OB0K 5C0EA 1I9JH 3N1GC 5JW3L 3CFBA 3VH8A 1A4KB 1PBYA 3W9DB 4G5ZL 4J3SA 1TMCB 1RK0B 4UI2A 12E8H 3TIEA 3EYFB 3WO4C 4XI5C 5H37G 3THML 3PWPB 3B6SA 1J8KA 5CKGA 3LQAC 2JJUA 3CPLB 1FL6B 4JHAH 1F4XL 4G6AD 2EYTB 1KENL 3QCUH 4Q9BA 4QHMB 5FECB 1WBZB 2WZPD 4GLRH 4HBCL 1AR2A 3BW9A 1YEJH 1I7RA 3FQRB 1P5UA 5F9JB 1ZHBB 1YPZF 1BZQK 1T1YB 2EH8H 4UB0L 4RZCB 3GNML 5B38G 5IHZB 5DRWB 1OD9A 1Q9OB 3EZ8A 1YJDC 2LV4A 5E6IC 3JWOC 4YDLC 1JMXA 1YN7B 3D39D 3IU3B 4R2GC 1DBKH 4M62H 1EFXD 4G9FB 2EH7H 5F1SA 3O41A 3TBTA 5FB8A 1DQJB 1J88A 5D1ZC 3GMQA 1PW3A 1U36A 3PWVA 1I7UB 1KIQB 2E8YA 3DX9A 5BOPA 5C0IA 3M17B 5C6TH 1CU4H 1G1CA 2VE6A 1N3NA 3IJYB 4TNVF 2V5MA 5DHVB 4ZO6A 1Q0YH 4IRSD 3QUKA 4HS8L 5L9DH 3VXNB 4RQQB 1D9KD 1A7NL 1FIGH 5F7DA 4AT6B 3OJVC 4FQ2H 5IJVA 1JHTB 1KN4L 3ORJA 4X5XB 1T3FA 2FECL 3K4ZA 1OW0A 5FUCE 4X6CE 5E2WL 3VGBA 3K74B 1N6QL 1I3VA 1NFDA 4ZPVA 4LARH 4HIEB 2BY1A 5ID0A 5FCSH 15C8L 4FXLA 3G6DH 3ZTJG 3BGFC 5AAWA 4Z76A 4R4BB 4IOSD 3C60C 1LO3H 3BVNB 4ZD3L 5BXFA 2IC2A 4BKLB 5J1TC 1HINL 2R4RH 3VGDA 4HIHB 2ZOLA 1XFPA 4Y4KB 3HNSH 1T2XA 4P2QA 1O0VA 2GFBA 4U1MA 4UAOB 5GGUA 1ZLUH 3T0WA 4IOIB 5J7CC 5DZOA 5HI5D 1J7VR 2OL3L 4ETQA 4K8RH 2FIRT 4LCWD 2GHWB 1TJHL 3BO8A 4L4VA 3B2UD 3GJFK 5HHMD 2H2SD 3GHBL 3WNOA 1PG7X 5IHUH 5LGHH 2HTKC 3UTTE 1IZKA 4MXQA 4WW2B 3Q2CA 3CSGA 5KSUA 3OJ2C 3TYFA 2FEDD 3QXDB 2VDQH 4NNPH 1F6LL 3UO1H 3EYUL 3O4LD 2QHLA 3V79C 2ARJB 5D7JB 1U8LB 1KJVA 1BOGA 1OF2A 4Z0BH 5JOPD 5GRZA 3CFCL 1AHWC 3PGCA 1JBJA 1F6FB 1G7LB 5JUEL 5T1MB 1IM9B 3NPSC 5IT2H 5MHSE 1NKRA 3QJFA 2QEJA 4YDVA 1JP5A 4Z0XB 3FO2A 5IB1A 3VFOB 3S34H 5DHVH 4QOKB 2VABB 3A6CH 4OFKA 2HN7A 1BIHA 4WFGD 3SY0B 1VKXA 4RX4D 1KIPB 1UZ8A 2CGRH 2G5BA 3VXSB 4BZ1L 2OBGA 4QHLB 1A7OH 3N1FC 5B22A 4CRPA 3KYKH 4N8VB 4QRRB 2FO4B 5FK9B 2A77L 4AIOA 4KKLC 3DO3A 4DKAA 4LVHC 1S9VA 1HILA 2Z91B 5JNYA 4XPFH 3QFJA 5DEFB 1NCUA 1MH5A 2VLME 4XBGA 4I4WA 5SX5H 1TCRB 2ESVA 4ELKB 4EOWL 3PQYD 1A1MA 1CFQA 3UZVB 3QIBC 3V5KB 1BIIB 1RUQH 1A4JB 4F7EB 2LAAA 1ZK9A 4U0QB 4ZO9A 3BIKB 4BFGA 3O2DA 1TENA 2EYRA 2GT9B 1FCCA 4U6VL 2FB4L 1JK8A 2XPGB 1MCOH 3RVUC 3KWWB 2NY7L 4FQJL 1FFOB 4PP8C 3CGTA 2PXYD 4S0UC 1J10A 2X89D 3MOAH 2DBJA 4BH8A 2I27N 1CXKA 4MQ7A 1C5CL 4XCYB 4LHUA 2EDFA 3B8YA 2PTUA 1HKLH 1JRHH 1RVFL 3MRFA 5FXCH 5I30H 2EDQA 2PETA 3GBNL 1BREA 4X6EB 4OLZH 2IPKB 4IIQA 1JN6A 2XA8L 1A0QL 2AXGB 2ZUQC 1FVEB 3VFTA 5E8NA 1VGKA 1R5VB 4BFIA 5IVNA 4H20L 1G0DA 3BUTA 1I9JL 3EDDA 3LV3B 2VUOA 4Z7UE 3PWNB 4XP9H 4YGAB 5D1QA 3V6OA 1QPXA 3FQUB 5DF0A 4BM7A 3EUUA 3IFLH 2NLJB 3WSQH 4WNQA 3ZHLA 4N5EC 2W0PA 3O9WC 4JHAL 3RWGB 4YHIB 4JY6B 4BK5A 4QRSB 1R3HA 3QCUL 5ALCH 4OF7A 2CUMA 1CDIA 2P49B 5T5FH 1RIUL 3P11L 2WANA 1YEJL 4QF1A 1AGBB 1PKQA 3L5XH 4GRWF 5GJSH 4PJ5A 2EH8L 4NHUE 1VGEH 2M1KA 2Q3AA 3UPCA 5GQBA 5EIIA 3PGFH 1JPSH 4MA3A 4WI5A 3T0VA 4LFHG 1IL1B 1DBKL 2XTJB 4M62L 3KS0H 2EH7L 2BY0A 4JM2F 3AAZA 1FZOA 3T77B 2H32A 1LQSR 3H7BB 4F7CB 2XKUA 1FE8H 4PJDB 4HG4J 4GRLA 5ENWB 5C6TL 1CU4L 1K6QH 4X5WA 4URTB 5C6PB 4O2CB 1Q0YL 4RGNE 5EUOF 2P44B 1KCGC 4MAYA 5L9DL 2DYPB 2A74B 1FIGL 3KJ6H 4CVWA 4FQ2L 1IC4H 2Z0BA 1YEKH 3H8NA 3HE6A 2IBBA 4UIMB 2DQUH 1YPZA 1RZ7H 2MCG1 2NYYC 2YC1B 2V2WA 3KHQA 1CG9A 2GSGA 4P5KB 3FN9A 4LARL 5E9DB 4CVUA 4GMTH 4M02A 5D1XB 2GITA 4PY8I 5T5NF 3VGFA 4Q9RH 3G6DL 5DK2A 1CGYA 3JV0A 3VXQA 1LO3L 4LSUH 4U3XA 4Q6YA 2R4RL 5E1AA 3HNSL 3K46A 3U30C 2XWTB 5F93C 1L7TH 4UT7H 4K7PX 1NPUA 4RBPH 4BJLA 4ISVB 5KSAA 5IBTH 3MGOA 4Y5VC 4HAFA 2JLLA 4K8RL 2HJFA 3WIHA 2NX5B 2MTPA 5DURD 5IQ9A 5DJ0B 3MX0A 5IHUL 5LGHL 2NZ9C 2DS4A 4U6XA 3HKFA 5GZOC 2N1KA 3D85D 2IADB 3GSOA 4LAQL 2VDQL 1WF5A 1T03H 4NNPL 5JPMA 4MJ6A 3UO1L 2FR4B 1WCQA 2YPKA 2HLFD 4Z0BL 3LSOA 2XWBA 4F7PB 5C07A 5AD0A 5TFSH 3OKLB 1OAUH 4X6FA 2PW2B 4L1DA 4I18A 3UMTA 1WWBX 1BBJA 4JRYA 5IT2L 1U2CA 3B9EA 1MQKH 4CU8A 3ZE0F 3WJLA 3QWRA 2OJEB 4JANB 1MRFH 1JF5A 2C1PA 2YD5A 4F2MB 2R1WB 3S34L 3VFRB 4FTVB 2XIDA 5HGHB 3A6CL 1FLRH 3CJJA 4ZNCD 1YEDB 3AXLA 4KROC 1SM3H 1KFAH 5SWSB 2CGRL 4NNXB 1A7OL 4Y4FC 4RISH 3FQWB 1RJZB 3KYKL 3I9GH 4M00A 4IRJB 1KXVC 1VFOA 3GRWH 2FL5B 3D0LA 4XPFL 4EQ3A 2KPNA 4PP1D 1KGCE 3O11B 1T1XB 3TA3A 3VGAC 3B5GA 1UXSA 2BX5A 1Z5LA 1UB5A 1S9WB 5JPNB 4L8SA 1QBLL 4MB4A 3L3GB 2DWDB 1RUQL 4U7MA 1QFHA 2HFEA 1E4KC 4LVNB 5F6IC 2HVJB 4Z7VB 4YPGA 2O61B 4WI7A 1UZ6E 3MOAL 1N2RB 4FQLH 3PE9A 3LEYH 4HK3J 4KZDH 2Q8AL 1HKLL 1JRHL 4OUUB 3RDTD 4ODTH 4Y4HA 4LCYB 5CIPB 3BXNA 5I30L 4OFYD 4XCCH 3DVNB 4DGYH 4OLZL 4OZ4A 4BSWB 5EBMA 5DMKB 3V5HB 3S4SG 3SDYH 3PJSB 3WUWA 3KNBA 1U3YA 1N59A 1HXMB 4OZHE 3PWPD 4HUKB 3C8KB 1EHLH 4XP9L 3QP3A 2A1WH 3QZWB 5GGSB 5B8CC 4KUZH 4XBPB 3MRBA 4Y88A 5EUKA 3U83A 3WIIH 3IFLL 4PBVC 2X05A 3WSQL 3UYRH 2X7LB 1OAQH 4MNQB 4GAGH 1MNUH 1T4KB 3LHPH 4CVXA 1BQUA 4LGSB 4XB7A 5JQ6H 3KLHC 1TQBC 2B39A 2QQLH 1YY9C 1JTOA 4AH2B 4EBQH 2D2OA 5HGDB 2IG2H 4LPYA 5T5FL 4YXKH 4G6FD 2EO1A 4OJFH 3L5XL 5GJSL 1P7KA 4CJ1A 1VGEL 2D7TH 2GJ6A 3HZVB 1T80A 3VXPA 1G9MH 1M05B 4G9FD 5D7IE 2FGWH 3V95A 3JWDC 4XVUC 1JZ7A 2XG5A 3PGFL 1JPSL 4UTAH 1GGIH 4GSDH 1GPOH 1QBAA 2JIXA 5DSCB 5DK0A 1WZ1H 2CLZB 1FE8L 4PV9A 1DQTA 1K6QL 4P4KC 4PJFE 3S5LA 5A3IC 3QQ4A 1UEYA 5DJ6A 1R24A 4NZTH 5BJTA 1I1CA 2D7QA 4L4TE 5E94A 1SYVA 3EGSB 4LSTH 3M1BA 3KJ6L 3P4OA 4HK0A 5EU4B 1IC4L 5EU5A 5C9JA 4XXDA 3NABH 1YEKL 3HHRB 5E7FA 3ULVE 2DQUL 4GXUN 5GS0C 2FD6H 1RZ7L 4JFQB 5DQDH 3QO0A 5KSBA 3EYOA 4HCRA 4GMTL 1IILE 5CIPH 1QR1A 1PJ9A 3AS3A 4MCYA 4Y4KD 4Q9RL 5TDOB 3O3AB 3L5IA 4U1NB 1HQ4B 5BMFH 4LSUL 2VAJA 1CFVH 5AZEH 2P5EA 5CWSB 1IVLA 4GUPA 3UJIH 1MAML 4X9HA 5LXGH 1L7TL 2FHCA 4UT7L 5IM7B 4AQOA 5IBTL 3UTZA 2ZCLL 2X4QA 1R3JA 4WW1A 1I1FB 1Y18A 1FZMB 5DJCB 3QIWD 3V6OC 4EDXA 1FL3B 2B5IB 4DFHA 3NGBC 2IPUK 2FECI 5CSZB 2X1WL 2ZUVA 4BQ6A 2VUYA 1T83C 1T03L 3RJQB 4KDWA 5K59E 4GH7B 2VERN 4M8QB 4HLZG 1NCBL 3MUY1 1N5YH 3NFNA 5TFSL 3STLB 1OAUL 3QWOA 1XGTB 1PX4A 4F7MB 4OGXL 5D7IB 3BQUB 2AEQH 3V6ZA 4QOKD 1H15B 3EOBB 1QR4A 1MQKL 4I48B 5GGTA 3GSWA 1MRFL 5ERWB 1T7ZA 4N0CA 1I1YA 1W0WB 3VXSD 4GG6E 4KY1H 4Q7DA 4WU7B 5BVJB 2A9NH 1CL7H 4R97C 1G0XA 4Z5RB 1VERA 2UZIL 5J6HA 1SM3L 1KFAL 4PGCB 1LE5B 5HHQA 3T0BA 3MTRA 4RAUA 1WZMA 4RISL 4FG6D 3I9GL 3GRWL 3B9KD 3RGVD 5EZJA 1HXYA 2XRAH 2VLKA 4N0UB 3H9SA 5C0RH 1G7MA 4U4BA 1JYNA 3OKYA 4XGZA 2AEPH 4WWKC 1C8PA 4CNIA 3OKDB 3CC5A 5EOQL 1UYWH 5E00B 5HVHB 4OKDA 4K94H 4NKOB 2E7HA 5IUSA 3VCLB 4YDJA 5EBWB 3SDAC 5DJDA 4NBXB 1NCTA 3HNTH 2BSRA 1RZIB 3RTQC 1YMMB 1F2XK 4HV8A 4PJXB 1JGDB 2Y1VA 4MX7B 2FJFA 4FQLL 3TO4D 3LEYL 4U0RC 3FQNA 3QHFH 4KZDL 3O45A 3UTTD 5I75B 1IAIM 4ODTL 2H2PD 1TZIB 4RMTA 43CAB 4XCCL 2UV3A 4DGYL 4LNVA 5TGBB 3WNPA 1NANI 3L9RA 5H37H 3BYYA 1KELH 4RMQA 4WDIA 4I5BB 3SDYL 3HE7C 3GSVB 2ZJSL 3QUZA 4YBQD 1WBYB 2AI0H 3QIUA 4X4ZA 3IDMA 3QULB 3BEVB 1EHLL 1J0HA 5I1GH 2A1WL 4KUZL 1UM5H 1I8KB 3WIIL 1XR8A 3QUXC 2EDHA 5IK3B 3RX8A 3UYRL 2C3WA 1OAQL 1Y0LA 3QA3B 3QEHB 1KULA 1M7XA 4GAGL 5CSBA 1MNUL 3LHPL 3FTGB 3LKRB 2NTFA 3P77A 3Q6FB 1D6VH 5DC9B 2QQLL 3VXTA 5JTWA 4EBQL 4LEOB 2WP3T 4M43H 1OAZH 2IG2L 5C0JB 3L3DA 4YXKL 1CDUA 5D72H 2AJVH 3TH4T 4OJFL 1QLEH 5JO5A 4NFDA 3PWUA 3T09A 3QDMB 1ACZA 2KQMA 1Y6NR 2D7TL 3LY6A 1EJ6A 3G5VB 4HKBB 1G9ML 4XH2A 3V0VA 2FGWL 4NQDA 2JB6B 5HHVH 1KEGH 1T5WB 2IBGA 1MVFA 5GHWH 4JLRB 3TBWA 4LLMB 2QR0A 4W81A 3HC0B 1GGIL 4GSDL 2BOBA 1S7WA 1Q9LB 2D9QB 5J57B 1TPXB 1GPOL 4PY7B 2BNQB 3FRPA 1KJMA 5F88B 4OCSH 9CGTA 1WZ1L 1A1OA 2DYPD 3DXAA 4J1UA 5FO8A 4KHXL 2MCPH 3NCYP 2AJSH 2VXVH 2VR5A 5F7KC 2KKQA 3E0GA 4BSVB 2QBWA 1G9NC 3DIFA 3F6LA 5DJZB 4NZTL 3ZTJH 2YD8A 2WIIB 4JFFA 5ANMB 3Q0HA 3QB7C 1U95A 3O3BB 3H7LA 3KPQB 5D1XD 3RVWD 3NABL 1QA9A 1R5IA 4OI9A 3B5TA 1J0YA 5C8JA 4GLRI 3VJ6A 1D5XB 1HHGA 4NN7B 2FD6L 3L1OH 5GRUL 5DQDL 2GY7B 2YA2A 3DBXB 4MA1C 4NQSA 1T0MA 4Q2ZB 4FXGA 4CBPA 3CFIC 4C58B 4WTZG 1AXSA 3BGMB 1T04B 2NY4B 4Z7QF 1W72L 2PW1B 4LKXA 4R0LC 3UCRA 1AH1A 4IDJL 3ARFB 1CFVL 1J8HE 1MY5A 1SQ2N 3RNQB 4POYA 4PRIE 2LU7A 3UJIL 3HZKB 3O2VH 1KF9B 5D2NE 4ODXB 1BOYA 3RWCA 4M1CC 5LXGL 5CJ8A 4R3SA 3UAJC 3VFSA 3F12A 2C4FT 3NIDE 5FGCE 3U2SB 5JZ7D 4JVUA 4M7LH 5E5MB 3MJ8A 1MCDA 2OI9C 4JKPH 3MBEC 2COQA 4ALAH 3TN0C 4NGHH 4FOMA 2Q87A 3P73B 2CKBB 3LKPA 3FT2B 4NM8H 4WI3A 3B9VA 3ERYA 4GG8A 4PJEB 2R2HA 4KKBD 1DN2A 3S98A 4UOJA 4LLYA 1FVDB 1QNZL 3GO1H 3MRGA 1ZLVH 1N5YL 2Q6WB 3EOAA 4WV1B 1NBZA 1ZT4A 5JR1H 1IC1A 3SKJH 1P84K 4IS6A 5J12C 4FTVD 4NO3A 1CDJA 5DTFA 1F11A 3SCMA 5IFHH 2YA1A 4RGND 1AQDB 1CIUA 3LOWA 3HR5B 1DJSA 3RKDD 2A9NL 5FM4A 4IRJD 2YMXH 3MFGB 1CL7L 1AKJD 5IIEA 1DP0A 4HJGB 1FNSH 2IH3A 3RZCC 5ITBL 3T1FB 1N64H 3U1SH 1KLGA 1SJXA 1S3KH 2GKIA 1ZGLB 1EBPA 4JZNB 1KN2H 2FBOJ 4NUJA 2XRAL 3MRCB 4ACPA 3NZHL 5C0RL 4P9HH 5EOTB 3NCEB 4G9DA 5FUOH 2AEPL 3VFPB 1YEFH 3DRTA 2MQCA 4TUJB 1UC6A 5IEKA 5FYLH 4LDLB 1FNGB 3ZYZA 4PPTA 4K94L 4JREC 3QXWA 1AR1D 3GMPA 4UU9A 3FMGH 2ADIA 4Y1AB 4Z78A 3UBXG 3QXAB 3ZE1E 2VZUA 3HNTL 1BFSA 1JGVH 3WL9B 2UWEA 4PJGB 4NO5B 1I85A 3GSUB 1H8OA 3V52H 3SKMA 1V3KA 4LLUB 1QBBA 1BAFH 2P1YA 3KG5A 5DVLA 3QHFL 4PR5B 3OGCB 3G6JF 1INQA 1KXTB 2CKBH 3MV9A 1UEMA 3EJZD 4WO4B 3VRJB 4F7TB 5C2BH 4L3EE 2A6JA 5C70A 1IGJA 3IDGB 4I3SH 5C0GA 4Z7NE 1F3RB 2AI0L 1NC4A 1XGPB 1ZVYA 4PS4H 5I1GL 3TBSA 4MNQD 4WUUE 1NDGB 3PGDA 5I1AB 2YPLA 1RJYB 1UM5L 1M71B 4CKVX 4L29B 1SY6A 3QDGB 1QLRA 4XVJL 3VRLF 1OTUC 3NIGE 5EO1A 3WS6C 2H8PA 5BZDB 2B4CH 2I60H 2Z31D 4U1IB 2RR3A 3KAAA 3SE3C 3PHQB 1D6VL 1OAZL 2VKXA 5D72L 1JRHI 3TNNB 2AJVL 5EO9B 1QLEL 4PTUA 3AREB 25C8H 3PUCA 1LO5B 2GSIB 1KEGL 4R9HA 1NUFA 5GHWL 1J5OH 5GSRA 5C9KA 5A2JH 2W0FB 1JVKA 4BQ9A 8CGTA 3D69A 2GAZA 1F3JA 1U8KA 1WCBA 4OCSL 3D39A 1LK3H 2NY3D 5E7BA 2MCPL 4DK6A 4ZTOH 4MJ2A 5IWLA 2VXVL 3VWKC 5ETUB 5IJKA 3BUYA 2F53B 3GK8H 4LGRB 3JTSB 3QHZH 4PFEA 5EZLA 1G7JB 5EN2B 3MOBH 1U8NB 5HYJE 3BPCA 1MUJA 3QNXA 2R1YA 4IRSA 4NOBA 5I15H 1X4ZA 2WBKA 3IGAA 2JE8A 1D9KA 4PGEA 1TIUA 2UUDH 4V3EB 1VSCA 5I74B 1A7BA 1VFBB 1JNLH 2AQ3A 3KYMA 4KK5C 5J3HC 4H1LB 1FYTE 1LWRA 3O2VL 3RIAK 5D5MA 4HZLA 2VB5A 4L3EB 1LE9A 2X4PB 3CUPA 4MGXA 4JJ5A 2NNAB 4PJIB 5HGBB 1OP5H 4UQ3B 3ARTA 3V6FB 1FIEA 4HC1H 3S4SB 5MI0C 1JGLH 4M7LL 3G5ZB 4U7KA 1DDHB 5MENE 4XAKD 4JKPL 4LCWA 1ORQA 2KDGA 4ALAL 5D8JH 1AO7E 4D9RE 1V8HA 3S3PA 5HHMA 3L3HA 5DJAB 1ITBB 3TZVB 4NQCB 4X7EC 3PNWA 4NM8L 4GMSH 1A7QH 4JRXB 4C56E 1FRGH 5CJBA 5F7EH 1R3KA 2G2RA 1R3LB 3G6AA 4HGKC 1DBAH 4K7FA 4RNRA 2Y4SA 3GO1L 2EYSA 3L6FA 5FYJE 3O4LA 3W11C 5JR1L 3SKJL 3DHJA 3T0EE 1SEBA 1PY4A 2HJKA 1NDMA 4HPYH 4F9LC 4LHJB 4X6BB 1T66C 2FX8H 5IFHL 1OGTA 3MSPA 4X9FA 2C26A 1Q0XL 2PUQT 3IDJA 4PJCB 3E6HB 1MCEA 1QKZH 4L4TD 2YMXL 1YZZA 3I02A 4EN3C 1FNSL 2DD8H 1JI1A 1N64L 3U1SL 1S3KL 1AGEB 3ELAT 1CGVA 4RX4A 2NY0D 3IJSA 3OJDA 5ID1B 3VMNA 1KN2L 1P9MC 4G8FA 5BQ7B 4ORZC 5F7MC 2PTTA 4ENEC 3V4UH 3T2OA 4A6YA 2B8OT 3L3KB 3ZDXF 4P9HL 1BQLH 3CD4A 1H3WM 5FUOL 5AAMA 1YEFL 1CFSB 4EI6A 1IC7H 2YS4A 4HIIB 2I24N 4H1LH 3T65A 5FYLL 3HB3C 3SDDB 4Z7OF 2K1MA 3PQYA 4PDCE 4RA3A 1YEEH 3FMGL 4MVBC 4ZFZA 2AW2A 2VSDA 3S35X 3BP7B 5GRJH 4APQD 3MLTB 1I8MB 1JGVL 1YMHB 2X4SA 2BXZA 1QVOA 1H3UA 2BMKA 3V52L 3DO7A 4DQOH 1BAFL 1UENA 1Z0MA 3K8MA 4PBXA 2ZSVB 1ND0A 2PXYA 4H8WH 4JPIA 1K8DB 2X89A 2APXA 3F8UB 4PJ7E 5J0BA 2CKBL 4L5FH 2AXJA 2OX5A 1WEJH 4TSCL 1SYSB 3I6GB 1FN4A 4I3SL 4ZUVB 3FB6A 3SDXE 3I50H 5TF0A 1S78D 5A43C 4KI5E 4PS4L 1LEIA 2OL3A 2HMID 2DTMH 3KPLA 1Q9KB 2QKIA 5J1AB 2JCCF 2B4CL 5DVNA 4U3CA 4XNMA 1NCCH 2I60L 1GAFH 2VR4A 4JAMB 1XIWB 3V6BR 4FZEH 1QFOA 3ARWA 5AZ2H 1LD9A 2BSSA