4WDIA

Weak tcr binding to an unstable insulin epitope drives type 1 diabetes
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
277
structure length
277
Chain Sequence
MGPHSLRYFVTAVSRPGLGEPRFIAVGYVDDTQFVRFDSDADNPRFEPRAPWMEQEGPEYWEEQTQRAKSDEQWFRVSLRTAQRYYNQSKGGSHTFQRMFGCDVGSDWRLLRGYHQFAYDGRDYIALNEDLKTWTAADTAALITRRKWEQAGDAEYYRAYLEGECVEWLRRYLELGNETLLRTDSPKAHVTYHPRSQVDVTLRCWALGFYPADITLTWQLNGEDLTQDMELVETRPAGDGTFQKWAAVVVPLGKEQNYTCHVHHKGLPEPLTLRWKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, K-D alpha chain
publication title Distortion of the Major Histocompatibility Complex Class I Binding Groove to Accommodate an Insulin-derived 10-Mer Peptide.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 67
structure length 277
sequence length 277
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4wdiA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4wdiA01
1JGUL 4POZD 3TT3L 3ZDYF 2WIIA 4MJ5B 1T21A 3S98A 3WXWH 4WTXA 1OD9A 3DHJA 3GJFB 4GKSB 4KQ3L 4J8RA 1JPGB 2PO6C 4IDJH 1SM3L 5EIQA 4MCZA 1HWHB 4HG4K 1RURH 5BV7L 4WI4A 3O4LD 2L7UA 4BJLA 2UY6A 4I0KA 4FQ2H 3MJ8B 2VDKL 5EO1B 2BOBA 4U2ZA 5CSZB 3QDGE 5C0NC 1QA9A 1H5BC 4TNVK 3QEHA 4P9HH 3EDDA 3SJVB 4TVPE 1U92A 1BQHG 1HYSC 2GK2A 3B6SA 2A6IA 1HNFA 1W8OA 3C6LC 5H94A 3LSOB 5GGSY 4Z9KB 5F1NA 2EYSA 4PJBB 5HHXL 3RVWD 3W5MA 1VPOL 2G75A 2AGJH 3QDME 3TBWA 4WCYH 1NGZB 3QG7L 4E42A 4LLYA 3MV7A 1V3MA 4S10A 2Y7QA 2GTZB 1AGEB 1YEFL 4G9FB 2R69L 1GOFA 2VXUH 1QVOA 1PY4A 5GS0H 4Q0XH 3MNZB 1ZLWK 3KYNB 4H88H 1N2RB 1M71B 2VE6A 3O6FA 2V2WB 3L7EA 3MRRA 5DZOA 2BNQE 5TGBA 1DZBA 1MELA 4LKCB 3CFBA 3VXSE 2H32B 5TQ2L 1M1SA 3MODH 5ALBL 3MRNA 5FO9B 3EUUA 5TDOA 2Q8BL 5MP6H 4J12A 3DYPA 5DFVC 3RUGA 2ICCA 1U8MA 3GMMB 1S7TA 3R0MA 2DQHH 4F7EB 3BP7B 2R4RH 3MV7D 4XP4L 3G5VB 1DL7H 2R2BA 3KPMB 4GFTB 1LP9E 4HLJA 1UM5L 2E7HA 5CIPH 3O6FD 1WTGT 2ZOKA 4KQ4H 1CT8B 4EN3B 2OJEA 4LGRB 3MLVH 4OGZA 3WJJA 4XMKL 4HIJA 3HNSH 3O3DA 2OJZL 4K8RH 5ICYB 2X4NB 1BD2A 4UQ2B 1YMHA 4F9PC 1MPAH 1MCWM 1ZA6B 1A3LL 5AUMB 3KLSA 1MHEB 4HIIB 4YFLF 2OR8A 4NKQB 1DLHA 4BYHA 4JO4H 3ZTNL 4OGYH 4WUKL 2XZCH 3WMSA 3WDJA 5IBLD 2J12B 1JNJA 5FV1L 2EDXA 4H26A 1A7NH 3HZMA 3IDNA 3UCRA 5D7LB 3MRPA 1Q0XH 2ITDA 2KBGA 4NZTH 1WBYA 3SY0A 4XVSL 4N1EA 5KN5A 4K9EC 2DQTL 3K46A 4R7NA 2FX9H 4XNYL 3HI1B 3TJEL 2AXJA 1T1ZA 4MB5A 5C09D 1F5WA 2LAAA 3P0VL 4NWUH 4Y19A 4JFDB 4JANB 4UUJA 1YPZF 2XYCA 3U1SH 3W0WB 2IBZY 5I1KL 4LLVB 4KWUA 3FQNB 1D9KC 1YEKL 3PQYB 3I2CH 4PTUB 3TWCH 2EDLA 4I77L 4NRZA 4X4XB 3MRKA 4GBXC 1MCFA 3VXRA 5LAXB 3UTZB 4JM2A 3OPZL 2XA8H 5F7MC 1G7PA 3M17B 2HTLC 1JFQH 4YJZL 2D2OA 2XN9E 1J05B 4P2RB 4XC1L 4Y19D 3MO1A 2F58L 3PHQB 2JE8A 4FFWD 4QEGA 3WS3A 3QIWA 3MJ9H 3OGOE 4KFZC 2X44D 4HBCH 4TSBH 5ICXB 5FYLE 2Q3ZA 5AD0A 4APQC 1E6OH 3IF1A 2J8UE 4HGMA 3FQXA 4HX1B 4OQTH 4R0LC 5FGBA 5F7YC 4NM8H 5J3HD 3MLTB 1X7QB 1CL7L 2IH3A 2HA1A 3P40A 3TCLB 5J13B 4ZOEA 2CLZB 4JQXA 3VXRD 5C70A 1Z9MA 2QV2A 3OMZA 4JM2D 4KGJA 3WNKA 1E4WH 5JW4Q 4YE4L 3BIKA 3HE7B 3QUKA 1S78D 2JCCA 2BDNH 2G5BB 2BHZA 3QQ4A 5I8EA 4LARH 1EJOL 2PYEA 1OAQL 4XXDB 1INEH 2GQHA 5FGSA 4WU5A 1MFAL 3BOVA 3VFMB 1IC4L 4PRHA 1HK6A 5ILTL 3MCLL 4U31A 2AK1H 4F7PB 3FOLA 2IGFL 3L3JA 5BVPL 3NABL 4HFWB 1UT9A 5CBAA 3DX7B 1TIUA 3BT2H 5DJ0A 4NT6B 3C09B 3EW3B 5L7XL 4EDWL 1NBZB 4NNXA 1F6FB 3D5OF 4JKKA 5D1XB 1TVBA 1XIWA 2BMKA 5LQBL 2DD8L 3U9UA 2VQUA 2HKHH 1MF2H 2QQKL 3GBNH 3KPNB 4ETQA 2PW1B 2HFFB 3SE9L 2XPGB 5E5MB 3G6AA 1H3WM 3VI3E 4JFFB 5HSFA 2BVYA 4OGXL 5JXEA 4TOYL 4PRHD 5IQ9B 3F7RA 5JXAH 1EBAA 1N59A 4RGOH 2P46B 4N5EC 2A9NL 2CRMA 2I24N 4GMTL 2VIRA 4S11A 3F6LA 5FUOL 3GMPB 2AJSL 4KK6D 3DYOA 1EX0A 3TVMD 2FZ3B 4KJYA 1RZIB 1AGDA 4Z6AT 5K9JL 4L4VB 1IFHH 5M7QA 3AAZA 1ZGLB 1WAAE 4PJ5D 1HHIA 3O11B 4LNVA 4Z7VB 3P4OB 3MFGB 5IUSA 3SJVE 2PETA 4MJ4A 1EO8H 5E2UL 2ITCB 2BHUA 1G7QB 4W6YB 5D1ZB 1HE7A 4O9HL 3FO1B 3KJ6L 5JXED 1YEEH 4PRAA 1U8IA 3PL6A 4PJBE 4CN1A 3DVGB 4N8VB 1QKZH 4HW6A 4NQDA 2FX7H 4FP8L 2XACC 3L3HB 4KKLC 3FQWB 4MQXC 2Y4SA 3OKKA 4O2EB 3FB6B 3T4AA 2OXGA 1IGFH 4PYHA 5HVWA 3GMNB 4G8EB 3HE6C 3VFUB 3WXVH 3UX9B 3QFDB 4ONOA 1P69B 2B5IB 5B38A 4NJAL 1IT9L 2ARJQ 1R3HA 3T2PA 2GHWB 1P4LA 4G9FE 2ICEA 4PS4L 4ZUUB 3ZHKA 4KI5D 3VWJA 1LNUB 2FLRT 1OOAA 3BE1L 5C0JB 4RMWA 4LSUH 5FA4A 3U4BH 4RMQA 3G6DL 5TF1H 5I19L 1S7SA 3L95A 4JKLA 5ESVA 5AZEH 3HI5H 3EGSB 5IHUH 1DBML 1ITCA 2DMBA 2FYYA 4DUXA 3TYFB 4Z7WB 3T1WA 1OAXL 2NY2C 2I9TA 2UVEA 2FGWL 4ZG1A 3BEWB 3WFDH 4NQDD 2VDOH 2D31B 2X1XR 3VCLA 2AKRB 4OZ4A 1INQB 5DJZB 3WUWG 5AAMA 1C7SA 2EH7L 4GKOA 3S5LB 4JQVA 2Y06H 5CLTA 2CKBB 5IMMA 1QSVA 4HWEH 4LBEA 3WHXB 4IS6B 1NCAH 3TNNB 5FA3A 3LHPH 4GAJL 4G6JL 2I5YL 4OKVA 4B50A 3HFMH 1A6AA 1BREA 4U1GC 1CTOA 3QWQB 4I0PA 4OZGE 4Z0XB 5AYUL 1MFCL 1RUQH 3BUTA 1U3HA 4WFEE 3HZVB 2BP3A 4P59L 4RSVA 4OLXH 4D3CH 1PX3A 4OM0L 4XCCL 4UIMB 3IFNL 3UJIL 1B2WL 5D2LF 4RGMB 2FJHB 2RB8A 1B90A 1JRHH 5DRZB 5DRWA 3L3KB 1D6VH 2VXSL 2Z8WC 3V6BR 8FABB 4Y8AA 1MI5B 4Q97A 1WIPA 4MNHB 1CFQB 4PGZA 1Q72L 3ISWA 4YHZH 1CDYA 2L7JA 3B83A 3PABB 4R97C 5D7LE 1FAIH 4BELD 2CXKA 1ZHNB 1WZ1L 5IBUB 4MVBA 4R4BB 1K2DA 3O3AA 3MUJA 5KVGH 3QDJB 3V4PH 1NC4B 3QCVL 4I0PD 3TJHA 3MV8B 1FZJA 5IT2H 2X4RA 1BM3L 2R2EA 2Y72A 4JDVB 4JFDE 1ZEAH 2WWMC 5HYIA 3EYUL 2Y6SC 2YD6A 4M02A 3W0WE 1DQJA 5I75B 5H2BB 2A6JA 2NY3C 1BFTA 4Q2ZB 3KPTA 4GUPB 1IGCH 2IJ0C 4LU5H 5CWSB 3PQYE 1ZGLM 2FEEL 3HNVL 1SYSB 5FYJL 4UZGA 4WV1C 3M8OL 1KB5L 3KJ4C 1E6JH 4R4FL 5IJVB 5D8JL 4QWWD 3FT4B 1BJ1H 4TULH 3CPLB 4M7KL 3TJHD 2QADD 2Y25A 3OR7A 5DEGB 4YXLH 4P2RE 5A16A 4G7YH 4WVRA 2DJUA 2IAND 5DD6B 5BQ7B 2FIKB 4FXKB 4L9LC 1HILA 2EO1A 4XRCA 2C3VB 3CDCA 1XF4A 2DI8A 3N1MC 1FNEB 5IROC 1FE8H 2IBBA 3S3PA 5IB1B 5DMKA 3DIFB 5EORL 3P4MB 4L9DA 5E8OB 5J12B 5D93B 2X4UB 3D85A 4I4WA 4M00A 4FMKA 4DAGL 2BCKA 2D3VA 2HTKD 4HIHB 4LCYB 1KTLB 3SDCA 4M1GH 4DQOH 5E56A 3RGVC 2IFGA 1HHKB 2PO6A 1NBYA 2H1PL 3E3QE 5GGQH 4TNWF 4RWHA 3VG9C 3SOBL 1CE6B 1F02I 3ULUF 4L4TB 1QZ1A 4CW1B 1RIHL 3BP4B 1MJJA 4N8CH 3U0PB 1H5BA 4NDMB 1S7XA 3T0ED 2EEDA 3RVXD 4F3FB 1GH7A 2DDQL 1MJ7L 1T7XA 1FCGA 4P46D 5E99L 5IHZB 2GT9A 4XVUD 1X4ZA 2IH1A 1I9IL 3D85D 1DN2A 3HG1A 1DN0B 4GRMB 3LRSB 5FXCH 3SDCD 5DK0B 1LK3L 2PO6D 2V9TA 2YD2A 1I1AB 4J3SA 3C87A 4AM0A 5JNYB 2IAMC 1FORL 5E5UB 4ZFGL 1EBPA 2BC4A 2QR0B 2QSCH 4OF8A 1DANT 2F74A 2BOCA 1JWSA 1AQDB 1R0AH 4P4KB 1Y0LA 1FL5B 2PCPB 5MEQA 3OR6B 1T2QL 2DYPA 3BDBA 5DRNA 5DDHB 4G3YH 5F7EL 3JXAA 2DWEB 2NXZC 4B0MM 4DGVH 3UJTL 5I16B 4HLZG 4ZNEE 3HG1D 3TBVB 3WFEL 5FHBH 4DKFL 2F5AL 4NNYA 3AB0C 2FH8A 1HXMB 3O3BA 4DKAA 2ADIA 3EYOB 4L4VE 3HC3L 4P5MB 4ELMA 1SY6L 3SDDB 1KJ3L 3GIZL 4LHQB 4Z7VE 5GGRA 4DFHA 4CU8A 2DF3A 1A5FL 4I1NB 3MRCA 4J3TA 1K4DA 3BQUD 1U3ZA 3B9KB 4K9EL 3F7VB 1DQLH 2VKXA 1A7PL 4R8WH 3O4OB 5IFHH 3KDMB 4UV7L 1A3RH 1UB6B 2VO5A 4LIQE 4X7DC 2YD4A 3N0PB 2C1OB 1S7QB 1J88A 3U0WL 4WI8A 1EIBA 1KBGH 3MROA 2OTUA 4OLVH 3WN5C 2C9AA 4NUJB 1HSAA 2CSPA 1QQDB 4AJ0A 4H1LB 1T83C 2DMCA 4AG4H 3O8XC 4F9PA 5CKGA 5ANMA 4D9RD 4GAYB 3DXAA 1UM6H 1W0WA 3BGMA 2YUVA 3MUY1 3KYMB 4KH2A 4OI9A 5GGVY 2E3VA 4HXAH 3V7MA 1AO7A 2RBLA 1SY6A 1FNFA 3V8CA 1DANU 1A4KA 4PG9A 4KVCH 1WLHA 1FL6B 5I8OH 3HMXL 2ZUSA 3GKWH 4XP5H 5C6TL 5EOQL 5HY9B 4Q9QH 2FSEA 4U0QB 2ZSWB 5IQ7H 4Z7WE 5FF6A 1FBIH 1O0VA 5KVEH 4ISVA 4RZCA 4LQ1A 2VZ3A 4X6EA 4MJID 1TQBB 3VGFA 3C8KB 4XCFL 3FFCA 2ZOLA 4PGJA 2D9CA 3JTTB 1S5HB 2XOTA 1P84K 2FECI 3S4SB 5KG9A 5FGRA 3DXAD 2CK2A 2FCBA 1G0YR 3U83A 5C7XL 3QUMA 3RZCC 3P0GB 1AO7D 3NFNA 1FO0H 1MFEH 1CGSL 5K9OB 1KJVA 4G9DA 1BZQK 4GBXA 4ORZC 2H9GB 4O4YH 5CJQL 3U4AA 4CAGA 3PGDB 2YWZA 1DQQB 5ID1B 3DUUA 3HUJA 4I3SL 1G7JB 3W81A 3K2UH 3FFCD 3M07A 5GGUA 3QR2A 1WF5A 3CVHA 5EU6A 4RWYL 4V3DB 4D9QE 1A2YA 4OZHF 4F7MA 4MSWA 5EO0A 1YQVH 4ZFOA 2PXYC 2IMMA 1JZ3A 4AMKL 4V2BA 1J12A 3ARZA 1MI5E 2X1WL 3KG5A 4ZSOB 4APQA 1TZGH 4UNVA 3O9WC 2GJ6B 1QNZL 3TF7C 1BJMA 2E9BA 4P3WA 4PJ8D 2DLEA 1I8LC 4JLRA 4LKXB 3VD4A 1YEGH 2MSPA 2DQGL 4N8VG 3F5WB 3ZKQD 1F00I 3QDJE 4BSVB 1ORSA 1AH1A 3UYOD 3MV8E 2R1XB 3M1BA 4MHHI 4XNZC 5F9OL 4M1DH 1J86A 1A22B 2R29L 5E6YA 3H3KA 2LTQC 3BRGC 2WSKA 1NAKH 5EU6D 4U1SB 1K3ZA 2FB4H 5F44A 3MREB 4UT6L 1M7DA 1FGNL 2H6PB 4HDIB 3EYVA 4APQD 2HLAA 1G7LA 3ECBB 3IXAA 1LK2A 1JGEB 2OQJA 4Y8DC 3WNLA 3BP5B 4CN6A 2F8VA 2AERT 25C8L 4F7CB 4UT9L 1TFHA 4GW1B 4MA1B 5I17B 1AFVH 3NIDF 1EDQA 3GMOB 3CLEL 3G6JF 4XNUH 1D3CA 1TJGL 3IXTA 4GKNA 4X98B 4PJFB 3DV4B 1MHCA 3BSZL 1A6UH 1KCSH 4YO0B 4A6YL 3RBSA 1NLBL 1AHWC 1GVIA 3BO8B 4XNQB 1UM4H 5JPMB 5CSBA 4V1DA 3HZYA 2VXQH 4NZDA 5T3XL 1M7IB 3PDGA 3P30H 5JOPD 3RWEB 3KPSA 1FV1A 4N5EA 4PD4K 4D0CB 1FLRL 4DVBB 5EZLA 4QOKB 3K1KC 1QLRA 3QIBA 1NCDL 4OD3H 5A3IC 3S96A 2W9EL 4FABH 1A6ZB 1VFBB 2YPLA 4KJPD 4LF3A 2O5ZL 5E2TL 5CIPB 1NMCB 3DI2B 4L4TE 3A6CL 4XCYA 3MRQB 1GGIL 4OFVA 3MNWA 4N0UB 4YH6A 4FHBD 5DC0A 3HB3C 5I1AB 3GSXB 5E0QA 4X4ZA 4WJ5A 3KYKH 4Z7OE 1CFVL 4OZFH 4LCIL 4A6YA 3CDGA 3BAEL 4V1DD 3EFDH 4FZEH 2NY4C 4KV5F 5TFSL 4FQHB 3CXHJ 4PP2B 2JKXA 4RAVB 5IBUG 2NY1C 3KPSD 2QKIA 4FTVA 1NL0H 1IC7H 3GUTB 4N5ED 1CCZA 2Z8VC 2CUIA 3V9FA 3QIBD 3BN3B 1I1CA 2DQUL 4JQIL 3HE6A 4DTGL 3IDGB 5CGMA 2YPLD 1ZS8B 3ARBB 1V7ML 1UB5A 3OAYK 4OZIF 2OTWB 2Y1VA 1Q9WA 5TQ0H 5IGXL 3MUGA 4E41A 2OMNA 5BRZD 1MJ8L 1OT2A 4QXWA 1EEQA 2E8ZA 1A6WL 3P11L 3LKNB 4PDCE 3QXDB 4G8IA 1NFDA 2J8OA 1Y18A 2GJZB 4EQ3A 5FECB 1MWAL 1FNSH 4OLUL 3OKMA 3X14B 4HZLB 1QEWB 4PJHA 1R5IB 5KSBB 4FTVD 4OCRH 3SE8H 4PYGA 1HHGA 1N6QL 4NFDA 3AM8C 5DJYA 4X7CC 2XWJB 1CDHA 5GS3A 2ADJA 4LPVA 3ROLA 4XPGL 2GUOB 1R3KA 3RX8A 3QNZB 4O58L 3O45B 4XHJC 6FABH 5LWYL 3ULVF 4Z95H 4QGTA 5IB2A 3O2DL 2VLJB 3QEGH 4LVHB 2P48B 4E41D 3UTQB 5HYJA 4QRPA 3CNKA 3GO1H 3WL9A 4LCCA 3NCEB 4QXUH 2WY3A 1Q1JH 5ITFA 3D0VB 1T0MA 5ICZB 3WFHB 1MWAA 5CD5C 3S35H 3KLAB 1UWGL 2V7NB 4U3HA 4NBXB 2XZAL 4IRJC 3EO0B 3QEUA 1N6VA 4RRPG 4M7JH 4GSDL 4X7TA 1F3DJ 5L88L 5GS1B 1RZ8B 1JRHI 3PNWB 3NCYS 3PWJB 4ZQKB 2OR7A 4NYLB 5JPNA 5D5MA 4YHOL 1HINL 4Z7UF 1N0LA 3S8WA 5HYJD 4QRPD 1BWWA 4RX4D 4XC3H 3RDTB 5I1IL 1AQKL 3Q48A 4PJCF 1GRWA 2D03L 3QQ9C 1EO5A 2NXYC 5D9SB 3SO3B 1HCVA 4QLRA 3O3EB 4YAQB 3PGCB 1QR1A 3TO2B 1OP3K 4M3JA 5TE4H 4PB9L 5ACMA 2ZCLL 1A6TB 4JDTL 4UILL 3R8BB 1HHJA 2MCPL 3ME0A 5DHYB 5HGGS 4PREA 3K2MC 5D2NB 4KJQC 2VWEE 2I27N 2EEAA 5JLZA 2CUHA 3QIUC 1CFNB 2P5EA 1TQCB 4WV1A 1KELL 4HT1H 4QRQA 4Y4FB 1S3KH 4ZODA 2NY0C 3SDAC 1CFTA 2IPUG 4FFYH 3MCKB 4KY1H 4YUEL 2FJFA 2XZZA 5L2KB 1WICA 4AIZB 1JZ4A 3LY6A 4TTDD 1GC1H 3HC4L 4EUPH 4L9LA 4L8BA 1T66C 3RA7H 3C08H 4X4MA 2E6JA 5IROA 5EBMB 1BBJA 2NY3D 3OKNB 2GJ6E 3T3MF 4M93B 3GM0A 4GXVL 3V0AC 2DQDH 3LS4H 4RFOH 3VWKB 5CEZH 3SDXA 1UZ6F 3RGVA 3GMQB 5C08B 4JR9L 2A2QT 1BFOB 3LQZA 1MCCA 3L1OH 4LQFH 2FRGP 1IC5H 4HC1L 5DC4B 3T2QA 4JKPL 4IOSD 3GSOA 4HJ0C 1IEHA 5DMIL 4PBWD 5I8CB 3FRPA 1JF5A 3QULA 3E1F1 3HI6H 2AJYH 4XVTH 5KVFH 1ZT1A 2XRAL 3I3DA 3VDBA 1RV6X 5FM4A 5HHNA 4XCEA 2EIZA 4P49A 1AXIB 5FOJA 3RKPA 1PZUB 4H0HB 1NCBH 3QO0B 4GH7B 4Y2DB 3V8OA 1L8JA 3RGVD 5F7DA 3FB5B 1JGDB 1C5CL 3CX2A 4FS0A 2V5RA 3MFFA 1U42A 1R5WB 5E2VH 1EFQA 4FZ8H 4LPWA 4PJFE 2IAMA 3J7HA 3JWOH 3ZE0F 3RKDC 3IJHB 5T1LA 4AEFA 1WISA 3SCMB 1Z0MA 2FR4B 1A0QL 4WWID 3PV7A 2Y07H 4PJAF 1PKQA 4HUXA 4KHTL 1B9ZA 4P3CL 1XH3A 2ZUTA 4UBDC 4QOKE 4D2NA 1XCQB 1IAOA 5FKAB 5HTSA 32C2A 4AH2B 4W81A 5DJ8B 5SV4A 3V0VA 3SKNB 5HGBA 5FUZL 2NTFB 4QNPF 4WFFD 3V0WH 4U1LA 1QRNA 4PR5B 5GSVB 4EDXB 2JF1A 1ZVYA 2XICA 4JFEA 3OX8A 3Q6FA 5DJXA 3H0TB 4N0UE 1K8DA 2A73A 1ULVA 4X6CA 1SEBA 4U1HA 2QBWA 3QRGH 2VDRL 1OP9A 4ZD3L 4PV9A 5T1LD 1CDUA 2YD3A 1AY1H 3GI9L 1I3GH 3PE9A 4JVWA 3G5ZA 4M6OH 3P9MB 2NY5C 3EFFB 3KPLB 3QDAA 4TNWK 4EIGB 4ELKB 1ZT7B 3O4LB 4ODVL 3WN5A 3QUMH 4TUOB 1GIGH 4KKAC 4DEPB 2XKNA 2XWBB 2EDRA 1TJHH 2EKSB 5C0FA 1T83A 3O8XA 3EYFB 1E4XL 4L3AA 4KMLB 1KN4H 3R06A 4CJ0A 4DGYH 1F97A 1S9YA 3QPXH 1QRND 4M7LL 2Q3AA 3TCXA 3U48A 3GM8A 1XMWA 1RVFL 2AJ3B 5DT1H 3UP1A 2NCMA 4JFED 2X09A 2OP4L 3GHBL 4XNMA 4ZO7A 4H8WH 4UQ3B 3EKCA 1PGRB 4LAJH 3RPIB 1T21B 4EN3C 5E8NB 4ZFZA 3CVHH 1I1FA 4HH9B 4X6DF 1RUAH 2HFEA 3LIZH 4YZFE 1R6VA 2GEEA 1F4HA 1F11A 2AQ3A 2FBJL 4MCZB 4XWGH 1FPTH 5KSBE 1ONQA 1IGYA 1IZKA 4U05A 2IG2L 4W6XB 1QA9B 1BQHA 1NFIA 3O8XD 4I3RL 4R9HA 3QEHB 3PDDA 2IADB 1U92B 5LGHL 1UKQA 3B6SB 2A6IB 4HGWA 4OCWL 3B43A 5FYKL 3RZCA 2LV4A 4KK9D 5F1NB 4BM7A 2EYSB 3P4NA 1BVZA 2VLJE 4FQIH 3G5XA 1HKFA 2G75B 1RZJH 3TBWB 4PB0H 3SBWC 4BH7A 3PDOA 3MLWH 5F1OB 3MV7B 1BGXH 1MQKH 3REVA 4NIKB 5F7NC 3UEZA 2AXGA 2FL5A 4K3EL 5ADPH 4NQED 1I9JL 1U8KB 1QVOB 2DTMH 3HC0A 1QFWH 1XR8A 4KKBC 3ES6A 5IW6A 2PXYA 5BVJA 1YN7A 5HYEA 1PYWA 3MNVB 2ORBL 2VE6B 1LO2L 3O6FB 5INDA 3DETC 1U36A 3O9WA 3TF7A 1NMBL 4XMPL 4EOWH 5TGBB 3RIAF 3RZCD 4MJ6A 3CFBB 3ZMRA 3LZFH 2R8SH 1H3PH 2IFFH 3MLSL 2XKUA 1TCRA 2CIIB 3MRNB 3LMJL 2R39A 5TDOB 4IJ3B 1EVTC 4TVPL 3A6BH 5DD1H 1A7OH 3IFLL 3RUGB 4AQOA 4I3GA 1S7TB 1OTUD 2DQEL 5HI4C 1ZTXH 2AEQH 1YDPB 1OW0A 4IMLA 2YZ8A 2DIAA 1IVLA 5HVFB 2YUWA 2IF7A 1V7NL 4RFEB 1L9NA 4JREC 4HBQA 4YR6A 1FIEA 4H20L 2BSRA 5DEFB 4JFPA 2ZOKB 5J13C 4MXWL 5D2NE 2Z9TA 3L5WA 1OAKH 2OJEB 5I30L 5C09B 1JHKH 5J1AA 5ESQA 3E3QC 4H25A 2ZJSL 5A2KH 4ZOBA 3O3DB 1D5IH 3EJJX 5HPMA 3QDGA 1YMHB 2VR4A 4ZS7L 3ROOA 2V9QA 2KUTA 1FGVH 3BESR 3N1QC 5L2KE 4ORGA 2P7TA 3O0RH 1AHWA 2APWA 4UOW0 2BXZA 3BEVA 7FABL 3WO4B 5J6HB 4H26B 3IDNB 3HZMB 3ZYIA 1MCKA 2ITDB 5J56B 3SY0B 4WHDA 3QDMA 5SWSA 5ERWA 4BZ2L 3C09C 1ZSDA 3GSUA 3WHE1 5IKCB 1VACA 3DI3B 1CXIA 5D1XC 4CMHB 4MDIA 4MD5B 4YGVB 2E6QA 3ARTA 3MYZA 5C08E 3TT1H 1L7IH 2VN4A 4Y19B 3GK8L 1QLEH 1KENH 2FHFA 2VABA 3BKCH 1JP5A 1OP5K 1KT2B 3H3PH 2VLKA 2W9DH 4QCIB 4L8CB 4TVPD 4MHHG 3EOTL 3PGFL 3SGDH 4NRXA 1WWBX 5BO1H 3U79A 1TPXB 2KL6A 1KN2H 3K3QA 3MRKB 4P57A 5F96L 1MSPA 4WW1A 3VXRB 1WC7A 3QDMD 2G5RA 1JGVL 4JRYA 4JM2B 5SWSD 2CD0A 1K3IA 1L4IA 3PWUB 4XPAH 2IPKA 4G8FA 1H3XA 5ISZA 1KC5H 2XQBL 4XPFH 1X4YA 2CRIA 3FOMA 3RNQA 1QHOA 2NZ9C 1CXEA 4OIIL 1LP9A 2VLKD 2XZQL 1JN6A 3QCUH 3RWCA 1OAZL 4WW2C 2ATPA 4OCMC 2WW8A 1F90H 3IF1B 4XBPB 1CIUA 2EH8L 2Q76A 5SX5K 3UC0H 3IDXL 1A1NA 4QRSA 4M5YH 4JRYD 2KQMA 2YRPA 4NBZB 5CHNB 5CUSL 2B5IC 2EDFA 4ZTOL 4OM1L 3JV0A 2JCCB 5ISZD 4NUGL 3AM8A 1FO0B 5E8EA 3QQ4B 1QBLL 5I8EB 5LGJA 1FH5L 1UENA 2MHAA 1JZ8A 4WU5B 4KMTH 5IVZB 3T8XA 4JY5H 5JDSA 1A7QL 1ZHKA 3WKMH 3PXJA 5DEZA 1WBXA 3FOLB 2ESVA 1I1YA 3EYSH 4P2YA 4N0RA 1O7SA 3DLQR 1NUDA 1CVSC 5DJ0B 3GSWA 3TVMB 3CVIL 1T80A 4NNXB 2R4SH 1JE6A 3O4LE 4NBYB 2BMKB 2X7LA 1F3JA 4QTIL 2R0KL 4PJ5B 5FYLL 3MV11 5IEHA 4ETQB 1AXSA 3T65A 2MPAH 4L29A 2M1KA 1MCNA 3G6AB 2H45A 4C59B 2A6KA 1MAJA 1NC2A 3BXNB 1I7ZB 4G7VL 5B3JF 3CLFH 1VFAA 3ARSA 1N59B 1SBSH 2ESVD 4NM4L 3JWDH 5A43C 4I2XA 2VIRB 2IQ9H 1U3YA 1G9NH 2D0GA 2XN9A 4XNXH 1CXKA 3MRLA 5ELIA 5L2JA 5I1HL 3SKOA 3MA9L 4KJYB 1AGDB 4RGMC 3L3DB 5TE6L 3NH7L 3QXTA 4KJWC 3T3PE 3E8UL 3AAZB 2DWDB 2WP3T 1HHIB 3K4DA 1P5VA 2UZIH 4EI6B 1JPTH 2J8UA 5F7KC 1BAFL 4JPIA 1FVDA 1NC2D 3BKML 4CVZB 5GXBB 1D5BA 1LQVA 4G6KL 4F7TA 4ONGH 1U8IB 3VI3F 5L9DL 3QCTH 1BEYH 1SJEA 5JW3L 2AS5M 2BZDA 3ZHLA 1XGPA 3BPCB 4NQDB 3DSFH 2BY0A 5EFIB 4LSSL 1U91A 3CMOH 1S7WA 2XN9D 3OKKB 2XY2A 1TMCA 1Z5LA 3SDAA 2OI9C 4U1JA 3MV7E 5B38B 5T1DL 1R3HB 1P4LB 5I75C 3NMEA 2BSED 5DJAA 4TPRH 5JR1H 4PGEA 5JW5A 2YA1A 4LNRA 4HPYH 5FA4B 2DQJH 3NA9H 3L95B 1JNNH 1S7SB 5ESVB 1HN1A 3BGFB 1NCCH 3X11B 1J0IA 1MVFA 3QJFA 4W70A 3WSQH 3Q6GH 3WUWA 2GTWB 3O2WH 3RUGE 4OZ4B 3OKDA 4MXVE 4XTRC 3V4VH 2X5PA 3STLB 2P4AB 3SDAD 1UYWL 5HGAB 4FQJH 1ZLVK 3MRMA 4E0RA 1HOCA 1NGPH 3NCJL 1DEDA 4LBEB 3RNKA 3QUZC 5DLMH 1FG9C 5FA3B 4G43A 2Z92B 3LD8B 5IMLA 4G6MH 5D93C 5T3ZH 4OKVB 1JGUH 1GXEA 3TT3H 1A6AB 1CXFA 3BDYH 3MUZ1 4OSUL 5BJTA 3C60D 5C09E 3SGKC 2XA3A 5JO5B 4JGUA 4YHIB 4CVXA 1WEJL 4HPOH 5DVLA 1HI6A 1WAAA 2F15A 4KQ3H 5E7FA 5J1TC 5CSZA 1Z9LA 4K3JL 3RPKA 5ETUB 5BV7H 2FLBT 5CJOL 5DRWB 2F5BL 5GGVL 2VDKH 4PJXA 4LOUC 4ODHH 1ZKAA 4WDIA 3LSOA 3FQRB 2E7CA 4PJBA 1EEYB 1T20A 1GGYA 1ZK9A 4ODSH 1H0DB 4HUVA 4NHCH 3X3GL 1I75A 4PUBL 2OK0L 5DK3A 4K3HA 1NGZA 2AJUL 5CZXC 1K2DB 1JI1A 2DOCA 3PP3K 5HHXH 5HVGB 4F58H 5IR1A 2WUBH 2QADB 1FZJB 2X4RB 1H9VA 3IRPX 4LPYA 3B8SA 1I1AC 1AGEA 2YSSA 4U6VL 2IANB 3QG7H 2HYMA 4G9FA 4Y19E 1NSNL 4NKMA 1HXYB 1H15B 2I26N 3VFRB 4R96A 2H41A 3KYNA 1DQJB 2ATKA 2V2WA 3EOYG 4P4KC 5FYJU 2E27L 5EWIL 3CX5J 1I9RH 1FNGB 3GFUA 2P43B 1RIUL 1LDSA 5DQJA 3VXRE 3QO1B 5HHQA 1CVRA 2YR3A 1F42A 4Z0BH 5TQ2H 3THML 2D7QA 4M9OA 2PNDA 2K7PA 3OR7B 3LCYA 3SDDC 3T0EB 3D9AH 4G9FD 3EOAA 1CU4H 4HGKC 3NCBB 5MI0B 1HILB 3DRQA 4NGHH 4XRCB 3MOBL 1MIEL 3R8QA 3TPUA 4P46B 4GRWH 4Y5VC 4S1SH 5EBWB 5DMKB 5F1KC 1X5AA 4OZGA 5F88B 1EEZA 4FQLL 3D85B 1M05A 4QHUB 1U9KA 4YHPA 4FFVD 3U7YL 4LASH 1UM5H 3SDCB 3EJYC 4XGZB 5ICYA 3WIIL 2J88L 3RVUC 4NWTL 3DO7B 1NBYB 4PGDA 3C2AH 4K3DH 1RMFH 5AUMA 5F3BA 1Z9SA 4KKAD 5J8OA 2JCCE 3KS0J 3O2VL 3VA6A 1MJJB 4XX1G 3ULUD 2AQ2A 1S7XB 4N1CA 1A3LH 4HWZB 5ALCL 1G1YA 5D7LA 4KRPB 4YBLB 3ZTNH 4WUKH 2D7NA 2GT9B 3FHAA 5JUEH 3HI1A 2IH1B 1CD8A 2GW5A 5AZ2H 3HG1B 1J9CT 1F6LL 1TQBC 4EUPB 1FRGL 3QWRA 2DQTH 4JFDA 1M6OA 1QOKA 2YUXA 4JCMA 1K5NA 5CP3H 3SBWA 3TJEH 4NRYA 3NFSL 1MRFL 4PJ5E 3U9PL 1G84A 3FMGL 4AM0B 3BQUB 4PLJC 1MVUA 2BC4B 4L3CA 4PJIB 4PTUA 1LO0L 2F74B 2VWEC 1JWSB 2ZG2A 1U8HA 2XXMB 2GSIA 5I1KH 1Y0LB 3UTSA 1QFWI 1JK8A 5MEQB 5LAXA 4BK4A 1NUFA 1YEKH 1ZAGA 1WTLA 2IALA 2NW3A 3M17A 4JJHA 4NOFA 4WI9A 1NPUA 4P2RA 4XVJH 3T04D 2PTVA 4NNYB 3QWRD 3OPZH 4JN1H 1W72H 2ADIB 3WKNA 5JTWA 4URTB 1UC6A 4LRNL 1TTGA 4KI5E 5GGRB 4CU6A 1K4DB 5EU3A 4DJMA 4S1DD 4LK4A 4G42A 5BW7C 4HX1A 4C55A 3LPWA 3MLTA 1CWVA 1XR9B 3DETD 3X17A 5EC2A 3UTSD 2CLZA 2RAMA 4ZDHB 3MROB 1CDCA 4MJIB 5GRVL 3QHFH 1DBAL 1BECA 1NCNA 1E28A 2D7MA 4NQDE 5EZOL 1HSAB 4CGTA 2G5BA 1DSFL 4PJ7A 2C4FT 3HLAB 4P2RD 4XXDA 3DXAB 3BD3A 1PSKL 1W0WB 4YE4H 4GMSH 1KTDA 4POUB 4DN4L 5T1MA 3OKLA 1BWMA 1Q38A 1CG9B 3NGBC 5DMGD 1EJOH 1N3NA 1OAQH 1AO7B 4K2UL 2DKMA 4ZPTB 1A4KB 4PG9B 4Z7VF 3DX7A 4EKXA 2BERA 5DUMH 3MCLH 1HEZA 2GSGB 5GS0C 1GAFL 1NBZA 4X7SH 4M7ZB 5BVPH 4FQCH 2FSEB 1CR9L 5FF6B 3CXHK 4MA1C 1ED3B 4JO1H 4ISVB 5CP7A 2IQAB 1CN4A 3FFCB 3OAYH 4L1DA 4MMXC 5L7XH 1OB1B 4KMQA 2ZOLB 2PW1A 2HFFA 4LVNB 4KGLA 3V52H 1JZ6A 5HHOA 4LIQL 5KG9B 5LQBH 5EUOF 4BZ1L 2NY6D 4CUCA 1CDGA 1CK0H 4Y2OA 3SE9H 4IIQA 3RIAK 1RU9H 1WT5C 3QP3A 3KYAA 3QUMB 4OTXL 5IQ9A 2OL3A 4PJ8B 4MAUL 4XHQA 3HKFA 3NFNB 4F8TA 3SE4C 3DUSA 2WIMA 1KJVB 4OGXH 2PF6A 1B4JH 3GMPA 4ZNEA 1NDMA 2QLVB 3SGDI 3VFVA 1N7MH 2NQCA 2VXVL 3VW3L 1CLYH 2LU4A 4MQ7B 2FZ3A 5JOEA 3EHBC 3HUJB 4GMTH 3MPCA 1NMCC 5I76A 1ZGLA 2FO4A 3BPOB 3O11A 5FKPA 3P4OA 1Q0YH 5GGUB 3CVHB 2C4FU 3FCTA 2R0WL 5EU6B 3W11C 1W8NA 4MSWB 4ZFOB 5HHOD 2ITCA 5EIIB 1G7QA 1MNUH 4K8RC 4PY8J 2EDYA 1G9MH 4PRPA 1DP0A 4WW2A 4G8GA 5E2UH 3DVGA 3GZKA 3IKCB 4N8VA 4JLRB 3TBSB 4X6FB 5IJKC 4O9HH 5EBLB 3WIHL 3L3HA 4O2EA 4Z7QF 3FB6A 2GYSA 2CKBL 3L5XH 3VFUA 3RRQA 1DBJH 2FX8H 2QHRH 1MCPL 3ARBC 4IOFC 3NAAL 5CJ8A 3G6JA 2IANE 4ZUUA 3S88L 4ZOAA 3HMWL 2WBJA 2VZSA 3DVIA 4NJAH 4O02L 4B5EA 2XQYG 4JM4L 1BQLL 1I8KB 4XWOD 5KSUB 4PS4H 2BVOA 5GRUL 1M7DB 1GPOH 4FQ1L 4PRPD 1A1MA 3I6GA 4G8GD 2HLAB 1G7LB 1LK2B 2OQJB 2OLDA 1AE6L 1TJIH 5I19H 3ARRA 1FIGL 1RHHA 4ESKA 1ZOXA 3CMGA 3PIQA 2D31A 3OAZK 4LLQB 1INQA 5DJZA 1B6UA 3WIHA 5C8JA 1ZVHA 4U49A 1NLDL 4QHKI 3IXTB 3BFOA 3R1GL 4YDLB 4OZFG 4YEEA 2CKBA 4GRLB 1DLFH 2B1AL 1MHCB 4RIRA 3T0EE 3PWVA 3TNNA 2EE2A 1AR1D 5FM5M 4YXHH 1A7RH 1UXWB 2WBJD 4LVHC 4V1DB 2R9HD 4GG6F 3HZYB 2VDNL 4RA3A 1GZQB 4QYOA 1QBBA 2V2TA 5IVXF 3KPSB 5GS2D 1FV1B 2J7LA 1QFUL 4NQVA 5EZLB 3HZVA 4M43H 2ICWI 1J8KA 3WLWC 4AQ1B 4ZXBB 4FXLA 3QIBB 3IKKA 4F15C 1XEDA 5DJCB 4QKXB 3S96B 1XZ0A 3VFSB 2XFXB 1A9BB 1MFCH 1ZANL 1QTYT 4HWNA 4JPWL 4J6RH 5E4EB 4L5FL 1BMGA 1RI8A 4J1UB 3IFNH 1A4JB 2B39A 5JHLL 1MI5A 4OZIA 1K9TA 4LPCA 5BRZB 1CFQA 4Z78B 5GS1C 1ZLSL 1MAML 1KFAH 1LEKB 2AJXL 1NANH 4WJ5B 12E8L 1KG0B 1IBGH 1OY3B 1ZHNA 3CDGB 4OV5A 3MZGB 4JFOA 3UXFA 2W07A 3VXMB 2HJKB 3D1MC 4NC1E 1NC4A 3RDTC 3OQ3B 1JWUB 2QKIB 3B5GA 4FTVB 2W9LA 3HG1E 1WZ1H 4NQCA 1DBBL 2MJWA 3D25A 4JDVA 1CF8L 2OI9A 1RZ7L 4LDOB 1BM3H 1UADC 4M6MH 3F65A 1UB5B 3WYRA 5H2BA 1Q9WB 3DUHA 5CEZE 4MA8H 4IRZL 4PJIE 3GKZA 3OAUL 3MUGB 4E41B 1SYSA 1QSZA 1OSPL 1D6EA 4BQCA 2EO9A 1D5XB 1TQCC 1Y18B 4YHKL 2X1QA 2XY1A 3CZFA 4Y4FC 3VFWA 2Q8AH 3SGJC 4KKCD 3OKMB 4MLSA 4PJHB 4JRXA 3GSRB 4LLAA 3GNML 1YYLL 3M8OH 1J1OH 1HHGB 4R4FH 4D9RE 1JI2A 4NQCD 4PY7B 1TTUA 5BQ7A 1MQ8A 4PTTA 4M7KH 4Q74A 3G5YA 5F6HJ 1VA9A 3BP6A 2C3VA 4NCC2 5IG7A 3QUZA 1FNEA 2WLYA 2FHCA 4JHWL 1LO4H 3DIFA 5IB2B 3P4MA 4M93C 5E8OA 2X4UA 2VJXA 3D6GA 3H9ZA 3JV6B 5IMOB 4GG8A 3VWKC 4HIHA 1KTLA 5HYJB 2FD6L 4QRPB 5IMKB 1HHKA 4LCCB 4Z7UA 3QG6B 3SGKA 1EXUA 3LN5A 4HEME 4MJIE 5D7SH 4RGND 5ADOH 1J0ZA 5ITFB 1ADQA 1IAKB 1CE6A 4JRXD 1T0MB 3MOQA 3QUYC 4L4TA 1EO7A 5DA0B 5CINH 1MFDH 4NSKB 5JMOC 1QFWM 1P4IL 4U2YA 4RRPA 3DXAE 1T7ZA 3V7AE 2FH6A 3CFDA 3RVTC 3QEUB 1NAMA 1QPPA 5EOTB 3P77A 3AGVA 1AO7E 3QUZD 4J4PC 2ED7A 2RR3A 4JAMA 3QWOA 1WV7T 1JPSH 3ULUH 4P4RA 3GMRA 5JPNB 3LQMA 5D5MB 2DDQH 4DVRL 1MJ7H 3LRSA 4Y2DC 4EUPG 3HPJA 1T0NA 1T7VA 3KR3L 4K71B 4YDIL 3IAGC 4YPJA 1W0VB 3FFCE 4XAKD 1IJ9A 2QQQA 4YBQD 2BHYA 4ERSH 5JNYA 2JB5L 5GHWL 1CGTA 2WK2A 1QR1B 3WFCL 2JJSC 4YK4C 2B8OT 3SCMC 1KEGH 1T2JA 3VI4E 1INDH 4LFHG 2PCPA 1HHJB 3N1GC 4PREB 2VL4A 3BMVA 2DWEA 5FHAL 5JLZB 3IVKA 3LPGA 2EKJA 3BZ4A 1CZ8L 2EC9T 4LSTL 3TBVA 1T2QH 5C86A 5F7EH 2D4FA 3S97C 3HUJE 3ESUF 1CFTB 3VE0A 5HHPA 3UJTH 4R26L 2YA0A 2FJFB 4LSRL 3MLZH 3NBNA 3TV3L 5EU6E 1YEJL 2KQNA 5IB3B 3TFKC 5I74B 1MRCL 4L8BB 5E2JA 1GOGA 3KDMA 3GIZH 4Y5VA 1BBJB 2G9HB 4Y5YB 5DXWA 2YKLH 5DSCA 1ZHBB 3AS1A 1NJ9A 1H3UA 3K8KA 4B7IA 2EDWA 4Q7DA 1A9EB 1PG7L 4TVSa 4NUJA 4U7MA 1D5MB 1QQDA 3IS0X 3KWWA 3ALWA 1D5ZB 4NHUB 3U0WH 2YXFA 3MR9B 5CCKL 4J3XA 5KOMC 5HYQB 2AV1A 4HLZH 3V7AG 3SPVA 3FTGA 3GSOB 3BN9C 5E24E 3RVWC 1PKOA 5E2WL 3P4LA 5DFTA 4LPXA 3QULB 3BJLA 3W5NA 1T3FB 1RUPL 1DFBH 4AZ8A 3N85H 1Q94A 2UWEB 1ZT1B 3KYOB 3OJ2C 1VEPA 5JOPE 1PW3A 5HHNB 5LXGL 1RUKH 4XCEB 5HY9A 4AENA 3TO4B 2BY3A 2YHGA 2Q7YA 4GS7B 5HHVH 4X83A 3WXWL 2EC9U 3HMXH 3EJYD 5F7DB 1S5HA 4YFLI 1T4KA 2CK0L 4K23H 2C4XA 4JHBA 3JZ7A 2XWTB 4FQ2L 1EHAA 1JHLH 3DROB 1MJUL 3FJTA 3ARPA 4YNYA 1TVDA 2DIBA 4I48A 5T1LB 5K9OA 4V1DE 5IVOA 1UA6H 1HZHH 1RFDL 5C7XH 2CO7B 3GJEA 3QT2A 4LDEB 3HS0A 4DKEL 3KPSE 4NO0A 1U93A 3PGDA 4HUXB 1DQQA 1XH3B 1CGSH 4OB5L 2RFXA 3BKJH 1WK0A 1G7JA 3AU1A 2AGJL 1IAOB 4QRUA 4LSVL 5CJQH 3V0VB 4JHAH 1PEWA 1T5WB 2UVFA 4K94H 4CADA 1QRNB 4Y1AB 4I3SH 2Q6WA 1Z6JT 1TZHB 3QNYA 1I3VA 4JFEB 3OX8B 2PR4H 3Q6FB 1WZMA 5DJXB 3O6FC 2APFA 1K8DB 4RWYH 5BRZE 5CZVH 5GS0L 2A73B 1N4XH 4Q0XL 1BBDH 5BW7A 3V5DB 1SEBB 4N9OB 4U1HB 5IBTL 4PJFF 4H88L 4LKXA 4HV8B 1MREL 1IGIH 4HIEA 1I4FA 3RQ3A 1OQXA 2BVEA 4IJ3C 3B9VA 1QNZH 3KNBB 4GLRH 4HS3A 4Y16C 3MGTB 4UOJA 3VXME 2F54A 4NC2B 4FTVE 2HVKA 3WN5B 4NO0D 5KAQG 4FNLH 3WD5H 1CGWA 3MODL 5C6WH 1ZXQA 3MRBB 2DQGH 3MACH 1S7RB 1UJTA 4RISL 3O8XB 2JELH 1T0PB 5DMJB 3UO1H 3QHZH 2I60H 3U2SA 5AG9A 4WHYH 4JZNA 4U1SA 4PRIA 2DQHL 5H35B 4DUWA 1JYXA 1WWCA 2R4RL 5D1QC 5F6IB 4IEFB 1PG7X 4N90D 1DL7L 3Q3GA 1FFPA 1YN6A 4XNMB 3G9VA 4E41E 4EIZC 4GW5A 2VXTH 3ECBA 5I1GH 1XGRB 1JGEA 4ZUSA 1I1FB 2WWKT 5B3NA 4YHMH 2HFEB 1PQZA 3E6FA 4KQ4L 4F7CA 4PJHE 3MLVL 1ONQB 2F54D 1IGYB 5GGRY 4NQEB 1WWWX 2VQ1B 4X98A 25C8H 2R15A 4PJ9C 4KUZH 3TZVD 4K8RL 1LD9A 4YO0A 5EB9A 1BQHB 1G7IB 1NFIB 4HH8A 2ERJB 5FYKU 4V2CB 3WO4C 2R1WA 4PRID 3C8HA 2O5YH 5SX5H 4KI1A 2FO1A 4MNQA 4JO2L 2HP4A 1WT5A 4HGWB 3RZCB 1M7XA 2ZG1A 3P4NB 4JO4L 2X4QA 2XZCL 4GO6B 3SE4A 2B4CL 3G5XB 1BVKA 4D0CA 1PVHA 4NNPH 5DJ6A 1A7NL 1Q0XL 4NZTL 5HYJE 5T3XH 4QRPE 3RWIA 1EGJH 4D9LL 4ACPA 4OCNC 2FX9L 4FFWC 5I15H 1KEMH 4BH7B 4X4YB 4MJ2A 1FJ1A 2AXGB 2FL5B 3LKOB 4NWUL 3MRQA 4AEHH 4WWKD 1J1PH 2W9EH 4N0UA 2V17H 1BLNB 1FNLA 5EBGA 3ES6B 5E2TH 5IW6B 3K74B 1YN7B 5E9DB 5J3HC 1PYWB 3U1SL 2DM2A 5KVMC 2FEDD 4XI5D 3A6CH 1RZKH 4Y4KD 5INDB 4MNQD 4FQHA 1FFNB 2BX5A 4ONFH 4PP2A 1P5UA 4JM2C 4MJ6B 4RAVA 4X9BA 2CDGA 2F53A 1YC7A 5D5ME 5I8KH 3GUTA 1TCRB 5LGKA 1S78C 1BFVH 5TFSH 3QXUA 3L6FB 3HPLA 5IP4A 1MFBL 5DVOA 3AMLA 2XA8L 3IDGA 1JNLH 2V5YA 1ZS8A 4FQXC 1OLLA 3TEUA 2EDDA 4X9GA 1MEXH 2OTWA 4M6NL 4IMLB 3VRLE 3VRJA 1MOEA 3QYCA 2DS4A 1V7MH 4YR6B 2EE6A 3UROR 2BSRB 2A77L 3MJ9L 2QSVA 3LKNA 4BA8A 4K8RD 4K55A 1V3LA 4JFPB 4HBCL 4TSBL 3RWGA 5I6XB 2GJZA 3L5WB 1WFNA 1MJ8H 4OQTL 3X14A 1URLA 1PG7W 1QEWA 5ESQB 5C3LD 1A6WH 2F53D 4O2CB 1EEUA 4XPTH 4H25B 2MNUA 3TBTA 4OLUH 1E4WL 4RAUA 2UY7A 1X5XA 5I2IA 1YPZB 4IOFD 2LE9A 4ORGB 2P7TB 4KTYA 2BDNL 4LARL 3D3VA 3R0NA 3OZ9H 1INEL 1DDHA 3HRZA 4M5ZH 3OB0H 1TZIA 2P47B 3BEVB 2VLJA 1DR9A 1UWXK 4JGJA 3UTQA 3GSQB 5SWSB 1G7HA 3WEXA 1W72B 1FC2D 3TVMC 1KIQA 1PD6A 3GSUB 3O2DH 3UMTA 1C7TA 1VACB 3STZA 1BIIB 1UGNA 3BT2L 1YY8A 4U0RC 4OCXH 5ICZA 4LL9A 1PEZA 3ULVH 3RGHA 4NHUE 3IJSA 3KLAA 2YD1A 3CJJA 3TIEB 2VABB 3EO0A 4P2QD 2VLKB 5LCVH 2OZ4L 1EK3A 2HKHL 5IB4A 1MF2L 2AJZB 2X89D 3GBNL 4EBQL 2X4SA 3CFCL 5D96B 5JXEC 4M9PA 1MCQA 1UWGH 1PZ5A 4LLUA 4NRXB 2H2SD 2Y5TB 3D3VD 1U8JA 3PWJA 5HBBA 4ZQKA 4NYLA 2VLJD 4U7KA 2UWEE 4PGBB 1MCLA 1WC7B 5JXAL 4JRYB 4X8JA 1E4JA 3A67L 1NANI 1S7VA 5EN2B 3I9GH 4RGOL 4GKZB 2IPKB 4G8FB 1ZLVH 1HINH 1KV3A 5ISZB 1MCRA 4WFFE 4N0FA 3WLWD 4S1QH 5I1IH 2GK0A 2K7QA 5C9JA 3FOMB 3RNQB 2D03H 3TO2A 4JPVH 1IFHL 1OD7A 5HJ3A 1A6TA 5GISL 4QRTB 1YECH 2YN3A 3RWCB 1ADQH 5DHYA 2ATPB 3M45A 4YDVA 1EO8L 2YS4A 1FFOB 1CFNA 4UT7H 3FT3A 5C0GA 2MCPH 2BNRD 1A1NB 2Q86A 3ALPA 4Y4FA 3NPSB 4QRSB 3SGJA 1RK0A 1IQWH 1F6AB 4L8DA 1QKZL 1V3JA 3MCKA 1KELH 2FX7L 1OARH 5L2KA 3FN9A 3UAJC 4KZDH 2FEEI 1GJIA 4AIZA 2JK5A 5T3ZE 1IGFL 1QRNE 4Y1AE 2MHAB 3QUXB 3T8XB 4JFEE 5JDSB 1ZHKB 3WJLC 1HQRB 1WBXB 2QL1A 1L9MA 4WGWB 1KXQE 3BGFC 2ESVB 3PP3H 3QH3A 1FDLH 3ZDYE 1I1YB 1J18A 3RTQD 3U4BL 4LSUL 1L0YA 4ODUA 5IEKA 5TF1L 5SWQB 5AZEL 5C08A 3HI5L 5IHUL 3NIGF 1BFOA 4GXVH 4OAWB 3DWTA 1UVQA 2X7LB 1F3JB 4Z76B 3KPPB 3QEQA 3QUYA 4JQVC 3G08A 3G9AB 3I75B 3WFDL 5IEHB 3T2OA 2VDOL 1AXSB 3T65B 4L29B 1KIPB 5EPMA 1IGMH 2A6KB 1NC2B 3INUH 5J11C 4HC1H 3AC0A 3VJ6A 2BJML 4JKPH 4KZEH 2BRRH 4WEUD 1NCAL 1VFAB 3CX5K 3JWNC 1MHPH 1QLFA 3LHPL 4O51A 4I2XB 2GAZA 2VOTA 3HFML 3VXQB 3P73A 3MRLB 5HYSG 2UUDK 5L2JB 3OV6A 1I7TA 2D7OA 2NR6C 1II4E 4N0YH 5C08D 1KGCD 1RUQL 4HHAA 4CMMA 2VZVA 3WE6B 4NQEE 4OLXL 5K33A 2V5SA 3GMLB 3QEQD 3QUYD 3HCVA 4LVOB 4LP5A 2OSLA 2JJSA 1JRHL 3SCMA 3RVTD 1CI5A 1FVDB 4JFXA 1D6VL 1D5BB 4D0DA 1R3IL 4XB8A 3SKUD 4F7TB 3BMWA 1OAYH 4YHZL 1SJEB 5DUPH 1QO3A 1P6AB 3H2WA 2QADC 3ET9F 5GGTH 4AY0A 1FAIL 1A0QH 1F2XK 2Z4QA 3T09A 4Q6IB 3RWFB 3SKJH 3GHEL 1U91B 3SKNA 2NTFA 1TMCB 4KHTH 1Z5LB 3SDAB 3V4PL 1FFRA 4PR5A 5TE7H 4U1JB 1ZGLP 3FQUA 4EDXA 5DMYA 5IT2L 2P44B 5FIEA 4PP8C 5FUZH 15C8H 3KPRD 4YBHA 2GCYB 1ZEAL 4HAGA 5DJAB 4BZYA 4PGEB 3SDYH 3TFKA 5JW5B 4U1KA 4BQ9A 2EYRA 5E9DE 2OS7A 2DQCH 5M95B 3T4YA 3SCMD 4Z7NE 2X1OA 5C0CB 3C60B 1ZT4B 1IGCL 1C12B 2K3TA 4LU5L 5EZJA 2DI9A 3KPLA 4ODTL 3VGAB 3S6CA 1YNLL 4ZD3H 3QJFB 3AXLB 1CS6A 2PTUA 5BCAA 2COQA 3WUWB 5E00A 3QZWG 43CAB 5IESL 3MX0A 3OKDB 3T0EC 5EZIL 4ODVH 3CSBA 3UPRB 3V6ZB 5D2LB 3RVXC 3WV0A 1JYVA 3BWAA 5MI0C 3MRMB 4QGYA 3MTRA 1HOCB 4E0RB 2NLJA 1TENA 4YXLL 1E4XH 1JV5B 2AJ3A 3RNKB 4P46C 4UQ3A 4XVUC 4G43B 3RPIA 5IMLB 3TFKD 5E8NA 4M7LH 1JNHA 3VD9A 4X80H 4HH9A 4UNTA 3IDJA 1I8MA 3SDCC 4W4NA 5BJTB 5GJSH 1UEMA 1JZ7A 2GJJA 2OMBA 4UINH 2DICA 1CDBA 2WINB 1G0DA 4GAGL 2YD7A 4WY7L 4CVXB 3AY4C 2PKDA 4DQOL 1HI6B 4UIKH 3B2VH 4WFGE 1I9EA 2IADA 2UYLA 4CU7A 3C5ZA 3RUGF 1YPZE 3JVGA 1R3LB 1A14H 4PJXB 5FOBA 4YEFA 4WDIB 1EAPB 4N9GA 3LEVH 4N8CL 1F4XH 3RJDA 3TBYB 4KRPC 4YBLC 3BN9D 1T20B 4CDHA 1MCEA 3DPBA 3LKPB 3UZQA 4NC1C 5TPWL 4EZMA 4HUVB 1GC1C 4OCWH 5SWSE 3ABZA 1LDPH 2ZUUA 2D9QB 5IR1B 1RJYA 3IFPA 2Y9RT 3CU1A 3LS5H 2YSSB 1XF5B 1U8KA 3CGTA 4HKJB 3BQUC 4NKMB 1KYOK 3LAFA 4R96B 5D7IA 2VLKE 4OLZH 3MGOB 3MNVA 5KVDH 2ATKB 1XCTA 1ZVSA 3C5ZD 4ZUTA 1OPGH 3DYMA 3T2NH 2Z31C 2EDQA 3U7AA 3T0DA 1QD0A 5DQJB 2ORBH 3LDBB 2CIIA 3LOWA 3DX9A 4K7PH 5F8QC 4DOHB 2DBLH 1HH6A 1A6PA 3IB4A 4YGAB 4Y16A 5HHQB 4JRYE 2HN7A 4G3YL 5IW3A 4GRWF 1G7MA 1WBZA 1QR4A 5ISZE 1J5OL 4DGVL 4GLRI 4QRRA 1YDPA 5FHBL 5GRYA 3EOAB 3ZHDA 3BD5A 3MYJB 4HK3J 5D1QA 3DRQB 3R4DA 4RFEA 3RX7A 5DEFA 4OF5A 4NKDA 3TPUB 2HT3C 1IEAB 2FIRT 2W0FA 2X4PB 5SWZA 2IBGA 4OZGB 3VFNB 1QRKA 3ZDXF 1EEZB 5C09A 1DQLL 1M05B 3GBMH 5IFHL 1AD9B 4YHPB 3JWOC 1A3RL 2DLFL 3CXDL 4MXWH 5C92A 1L0QA 4Y16D 4PGDB 2O26U 4OLVL 3V5HA 2F8OA 4OCYH 3TNMA 5F3BB 2Q20A 1J87A 4TUKH 4PJ9A 5EA0L 5DJDA 4MNGB 5E95B 4AG4L 4QRRD 4CRPA 2G2RA 4Y5XA 1DE4A 4ZS7H 5T5FH 1UM6L 5J6HA 3BPNB 5D1QD 4U6YA 4UNUA 4HXAL 1MAKA 2ESVE 3Q1SH 1VSCA 5I0ZA 4M7ZC 1TTFA 1RZFL 7FABH 5IKCA 5DO2D 5SWZD 2BSSB 4MD5A 1H8SA 4YGVA 1ACZA 1CFSA 2WAHA 4BZ2H 1RY7B 3H7BB 5I8OL 3GKWL 2X41A 3BJ91 4KHXL 4XP5L 1M6OB 1W0YT 4LVNC 1K5NB 4Q9QL 4FFZH 4NRYB 1KT2A 3HNTL 5K59F 3B8YA 2H2PD 4QCIA 3LN4B 4L8CA 3UTOA 1IAMA 4HFUL 5HXMA 4PJ9D 1MVUB 1F3DH 4AL8H 3FFDB 1KJ2H 4L3CB 5I1EH 4PJ8C 3PG2A 3NN8B 2JCCF 1X5FA 1U8HB 2DL2A 2GSIB 3UTSB 1JK8B 3PGFH 3OAZH 2A6DB 2D7PA 3STBA 2IALB 2NW3B 1WCQA 4X7FC 3PWUA 1FO0L 4I2XE 5EC1A 1IQDB 4Q58C 4H8WC 3GSVA 4HKBA 4DN3H 1JF1A 3BPOC 1JGVH 1NKOA 1N5AA 1N0XH 4FQXA 1FZOA 4CKVX 3VFGH 4MGXA 3PP4L 1P9MC 2NPLX 1SJXA 5EU3B 4BUHA 4I0CC 2YPVH 4G42B 2NW2B 4JREB 4XBPA 5KOVC 4WRLA 2YC1A 4YHYB 5EC2B 1TZGL 1A6VH 3RHWK 4XCNB 3VFPA 1EA9C 2J4WH 5CHNA 1E28B 1CGYA 1YEGL 2DN7A 4N0CC 1FO0A 4PJ7B 5SX4H 2CRZA 3BRDA 2NY6B 2R0LL 3PXHA 1RZJC 1KTDB 5IVZA 4M1DL 5DUBB 3OKLB 5EOCJ 5T1MB 4FQXD 4WFHD 1WFUA 1CE1L 1QBLH 1N3NB 1WITA 2SEBA 4YHLH 5I1JL 3U30C 2VRAA 4M3KB 3MLUH 4KI5F 2IWGA 5HDBF 1MCDA 5T33L 1H3VA 1HEZB 5C0CE 1ODAA 3TVMA 1UJ3B 2ZUVA 5EUKA 1YNTA 4KJPC 4RBPH 5A1AA 5CP7B 2ZZUT 2W65A 5E1AB 4PJ5A 3IDMA 4YXKH 4YDLC 2Y23A 3DRTA 1KJMA 3CVIH 1ES0B 4GRLC 3FN3A 3DX8B 1U2CA 5HHOB 5D2LE 1AFVL 3VXPA 5CJXC 4QTIH 4XNUL 5FYLH 4OZHB 1S9VA 2APBA 2GITA 3BXNA 3MQIA 4NN5B 1I7ZA 3CCHA 4XBGB 2WQRA 1BQUA 3PF2A 4IIQB 1XAUA 1A6UL 3G04B 1NGQL 1AD0B 1CTNA 2OL3B 4R3SA 3SQBA 3O41B 1LMKA 1MLBB 1KLUA 4KVNL 1HSBA 3DUSB 1UM4L 3ZYZA 4P48A 1JVKA 1PX4A 2VXQL 4LLMA 4P9MH 1NDMB 4ZXBC 5KW9H 3DOSA 1PFCA 3QIBC 3PUCA 3VFVB 4P5TA 1BZ9A 3L3DA 1MCHA 5E4EC 4PP1C 5I76B 4TRPH 2DWDA 2FO4B 5I1HH 5FKPB 2P45B 4KKNA 4FABL 3MA9H 3FCTB 2M2DA 4EI6A 5TE6H 1DQML 3QISA 2C5DC 3E8UH 4PJXE 4JJ5A 4CVZA 1IL1B 4PRPB 3RY4A 3U7WL 4WW2B 4G8GB 5K9KB 5HHMA 1YZZA 4CVUA 1LE5A 1C1EL 3W9EB 1U95B 3JTSB 1FAKT 4AK1A 2J2ZA 3BKMH 3KYKL 3BPCA 5FDWA 5EFIA 4HJJH 4G6KH 3EFDL 5KS9F 4XP1H 4M4PA 3KPQA 3VXNB 4P5TD 1OAUH 4D8PA 2W59A 3G6JB 3GIVA 4LSSH 3CFJB 1NBVH 1IM9B 4GQ9H 3TA3D 2WBJB 3UTTA 5E8DL 5C0RL 2X1PA 3TYGH 2YRLA 4LAQH 3WJLA 4JFHD 1YUHA 2BVOB 3K81A 1B0RB 3X11A 5KANI 5TQ0L 1A1MB 1FYTD 3GJFH 3I6GB 4RFNB 5HHMD 1NKRA 5IVXA 2WP3O 4EXPX 1ZLUH 4DOHE 1RHHB 35C8H 2GTWA 2RGSA 5D71L 5E8PA 3PIQB 1U6AH 2DKSA 4OZFA 1RJLB 5C8JB 3STLA 2EDJA 1FZMA 2I9LA 4O5LH 5K9QG 5HGAA 2VAAA 3FHQA 5JQHC 4KAQL 1H8NA 4OF6A 3ULUE 4RIRB 3UAJD 4YFDB 3PWVB 1FVEB 2Z92A 1G6RA 4LLWA 1NMAH 3IU3B 4FA8A 2DQIL 2HKFH 3UTTD 1E0OB 3IGAA 3SGEH 3TPUE 1A8JH 2CGRL 4QYOB 1VDGA 1X5IA 2EZ0C 4Z95L 2V2TB 5K93A 4LCCC 2JB6A 2GI7A 4NQVB 5JO5A 3B9DA 5FUCE 4YHIA 1UH4A 4OSUH 2VLMD 4QXUL 1XZ0B 3TC9A 5ETUA 4M8VA 1Q1JL 4ALAH 1SJHB 2RCSH 2UZXB 4MNGE 3S35L 3P0YH 4WTWA 3FQRA 5DGQA 4OZIB 5DC9B 1H8OA 2YN5A 3UJJH 2D7TH 1EEYA 5CJOH 5CGYC 5GGVH 1H0DA 3UYPA 2H32H 4NN6C 4PJDA 4OV5B 4JFOB 2VZ1A 3UTPD 3RL1B 2P5WA 3MA7A 1V8HA 2HT4C 3OJMB 5KJRH 3EYQC 4EJ1C 1ND0A 4K71C 3RI5F 3CSPA 1VFUA 2OK0H 2IANA 4NQCB 3D25B 3K4ZA 4TTDC 1EHNA 1HXYA 2NR6D 2OI9B 1H15A 3V95A 1I3RA 3VFRA 4UV4L 3FB8B 1XGQB 1OCWH 1NUGA 5F21B 5JIPA 4U6VH 1UH3A 1VESA 4ZTPL 4A2MA 1NSNH 5HYFA 1FNGA 1E27B 1N64H 2XNAA 4CN4A 2KPNA 1OSZA 2VLRA 1QBMH 3BH8A 1D6EB 1CBVH 4PRNA 3UTSE 2GFBA 5TE4L 4JG1L 3RY6C 3V4UL 3U6RA 3HAEH 3WS6C 4LRIC 3QO1A 2V9RA 3CZFB 4RGNB 1IZJA 4PJGF 3O6LL 3VFWB 1YY9C 2P5WD 1ROWA 3MV9A 4ENED 4JRXB 4HT1L 4WHTA 4MA7H 1YEIH 3T0EA 3JWDC 1S3KL 2D4DA 2UV3A 2HRLA 1HKLH 3QQ3A 3THMH 3DECA 4PTTB 3G5YB 5I74C 2ZSVA 3Q5OA 4JG0H 5HGDA 5BOPA 4ZPVA 1OHQA 2ZUQC 3BP6B 5IG7B 3EO1A 3N06B 3QUZB 5DYOA 4P46A 1JGLL 1GC1L 5EBWA 1UKTA 2RHEA 2X6MA 4Y5YC 1VADB 5F88A 4O00A 5HD8C 4QHUA 5ID0A 2VLRD 1QPXA 1E4XI 4S2SB 4GG8B 3H3BC 3RA7L 3C08L 1JPFA 4XGZA 4BFIB 2ARWA 4Z7UB 4IMKC 1EXUB 3LN5B 3DO7A 3LS4L 5INCB 5CEZL 3MV9D 1F4WH 1T1XB 3AY4A 1V3KA 4PJCB 5AWNH 3WFBH 4PJ7E 3WIIH 2J88H 3FL7A 4MCYA 1A02N 5GGSB 2N56A 1BF8A 3CFDB 4BQ6A 4HWZA 4AIOA 3P3YA 3ZKMD 3L1OL 4KRNA 4LHUG 4LQFL 1NAMB 4TSAL 4OCSH 3ZL4L 1IC5L 5D6DC 3LRHA 4LEXL 3P77B 5FCUH 1K85A 1A21A 2EYTA 4JAMB 5CLWA 1C8PA 3QWOB 4OQ1A 4TTGA 4ELMF 3BIBX 3TO4C 3HI6L 4P4RB 3GMRB 4G80A 3OKOA 4GS7C 4XVTL 5KVFL 4EUPA 4MLIA 1JUFB 4NQUA 3S35X 4MXQA 1WFTA 4GAFB 3HPJB 3HA0A 3ULSA 5ESAB 1T0NB 2C7UA 5HDQH 5CEXB 1NCBL 4KROC 1NGYB 3F6IA 5L8KB 3BQUA 3MRFA 5HHOE 2CLRA 4PJIA 3NFSH 1I7UB 1L7TL 4QY8A 4OZHE 2CMRH 4KC3B 5E2VL 5A2JH 4FZ8L 1XF3A 3KHOA 3JWOL 2Z31A 4XP6H 5IB5A 4JZJA 4KRPD 1LO0H 2BVQB 3IVKB 4U4BA 3BZ4B 2WQ8A 4Z8FH 5DWUH 2Y07L 1S9KC 4OLWH 5DFWH 4MXQD 2OYPA 3VE0B 5HHPB 3ZLQC 1GHFL 4NCC1 3S34L 2XTLA 3V0WL 1T89A 3JV5A 2XKSA 3MXWH 1Z0NA 4U1MA 4OBSA 5CEZD 4LRNH 5DD5H 4LFHD 5GRXG 4UTBL 2YWYA 4PRPE 1XR9A 1KXVC 5JIHA 4G8GE 4Y5VB 3D69B 4PPTA 3N9GL 1F58L 2Z31D 4ZDHA 5DSCB 3WFZA 1NJ9B 4MJIA 4GW4B 2IPTH 1I3GL 4M6OL 3KWWB 3U82B 5EOCL 3HLAA 2ZUXA 1F45A 3ARVA 4ZFFB 3QUML 4NKOA 1J8HA 1GIGL 3G6JE 2AV1B 5F6IC 3L3OA 3RU8L 2QQNL 1CG9A 3SPVB 3FTGB 4KK9C 3MJ7A 3HUJF 1KN4L 3DTXA 1PSKH 4DGYL 4ZPTA 3QPXL 5FK9A 2EECA 3VH8B 5JZ7C 3BISA 4TUJA 1Q94B 2H3NB 2GSGA 5DT1L 3L7FB 4H8WL 4JB9H 4DW2H 1GGBH 2HT3D 3LQAH 4OI7A 4AENB 1NH6A 4PJAB 1ED3A 5F8RC 2Q7YB 3CVHL 2IQAA 3C6SA 5GPRA 3LIZL 4X6BA 4ZFOL 1OB1A 3UPAA 2CR3A 3UDWC 4Q9RH 1T4KB 1CR9H 1U41A 4XWGL 1FPTL 1ZV5A 2ERJC 5B21A 4K7FB 1J8HD 2AXFA 4H5SB 5HVHB 3I02A 5T1KA 4YNYB 1VKXA 4PJ8A 4LIQH 2YD5A 4I48B 5ITBL 3WNMA 1EHLH 2XTJD 1P7KB 1FP5A 4FOMA 2NNAB 4U1NA 1WJ3A 1AGBA 5EO9A 4OTXH 3GJEB 3HS0B 1OWRM 4MQ7A 4MAUH 4NO0B 1U93B 4J3WA 4WHYG 4FQIL 1OTUC 5C0DB 2RFXB 3DBXA 1CYGA 3AU1B 1HH9A 4QRUB 1RZJL 1OM3H 1RK1B 1FHGA 4PB0L 2VXVH 4J3UA 4OD1L 3VW3H 4CADB 2HVJA 3O6MH 3CSYA 1UWXH 2Q6WB 5EIIA 3VRIB 3QNYB 5ADPL 4RCAA 4HZAA 1P9MA 4S0TD 5DURB 2DTML 4OZIE 1QFWL 5T1KD 4FXGA 4RMUA 5BMFH 3IKCA 4R90H 3TBSA 4X6FA 4J3OC 4LSQH 4HIEB 5EBLA 1I4FB 2HH0H 5D7JA 1S9XB 4X6DB 4HS3B 4EOWL 2KH2B 4OFDA 2F54B 2HVKB 2EDTA 2IFFL 4N0CA 3TZVB 5B39G 3MLRH 4NQCE 3KLDA 5DD1L 3A6BL 2VZTA 1A7OL 1OW0C 3CFKB 3U2SB 2AXHA 4JZNB 4PRIB 1ZA3A 1MCPH 5J06A 1BP3B 1I8KA 3NGBB 5KSUA 1JYWA 1ZTXL 5SX4I 2B1HH 3Q3GB 1FFPB 1YN6B 3S88H 2VR9A 2BVTA 3HMWH 5I6XC 3LKSA 4GW5B 5FV2A 3ULVE 4O02H 1T6VN 3H7LA 4ZAKC 4ZUSB 3QAZB 1G9EA 1PQZB 3QI9D 4FQ1H 3F12A 5D7JD 3E6FB 4RGNE 2R23B 4LLQA 1BOYA 1CXLA 1OAKL 5DI8A 1JHKL 3ARYA 4JRXE 3EZ8A 3BKYH 2APVA 2A38A 3KPOA 4NZUH 2QTEA 4WWKB 1UCBL 2W60B 4GRLA 2CLVA 3FAWA 4N0CD 3A0OA 3BW9A 1LD9B 2DB8A 4PIRF 4QT5A 5CJXA 1NLDH 1Q9OA 1UXWA 4Y4KB 5A2LH 2R1WB 1KOAA 1FGVL 4MNQB 3RVVD 1GZQA 1EMTH 3O0RL 4NFCA 5TF0A 5DRXA 3EJZC 2EXWC 5JA8B 2X4QB 2R1YB 4MD0B 1YYMH 1BVKB 5DJ6B 5F7WC 4RDQG 4ZXBA 2P1YA 3RWIB 5DJCA 4Z7UE 1LILA 2ZCHH 3VFSA 2XFXA 1A9BA 4KDVA 1U3JA 4HEPG 5I1CH 1B0GB 1CD1A 3K80A 4QO1A 4XAKE 4Z77B 1NFDF 1X5HA 4PJCE 4X0KA 1FJ1B 5E03A 4J1UA 2YRZA 4LPTA 1L7IL 1A4JA 4HMDA 4B53A 5D96C 4GRLD 4XBEH 2VERN 5BRZA 1QLEL 1Q9KB 4Z78A 1KENL 1EPFA 4W68A 3FO0L 4JPWH 1WGOA 1LEKA 3H3PL 4PJEA 4IBLT 4UDUB 2W9DL 4WEMB 1DTUA 1KG0A 3FAXA 5JHLH 1ZWIA 4DZ8B 4Y0GA 4RDQF 1WUNT 2CR6A 3U36A 3VXMA 5BO1L 2HJKA 4L3EB 2QQLL 2VDMH 2CDGB 2F53B 1JWUA 1KN2L 3MOAH 2Y5EA 3ZDZE 2YA2A 1G6RH 3NVQA 4ZXBD 1OVZA 3HPLB 1QSFA 2NYYC 3B4NA 4XPAL 1RUMH 3F7PC 1B6DA 2A9MH 4PP1D 1PY9A 1KC5L 3KAAA 3L5HA 3SKMB 2ENSA 4XPFL 3VRJB 1UEYA 2KDGA 1CGXA 4R6UA 1RZ7H 1D5XA 3L3IA 5DVNA 2UUDH 3RWGB 43C9A 3QCUL 4IRZH 4L8SA 1F90L 1HIMH 3NPSC 1L6ZA 1YEHH 5DA4A 3T3ME 3VXMD 1EERB 2LVCA 1FNAA 3GSRA 1C16A 1KJ2B 3CK0L 5DD3H 5GIRB 3ZTJH 1UZ6E 3UC0L 2MMXA 4PD4J 3FQTB 4PY7A 5A2IH 3TBTB 5MENA 4M5YL 4JY4A 3TN0A 4P2QB 5H37H 1QSFD 4JHZA 3GNMH 4JGMA 4RAUB 1YYLH 5LJYH 5I2IB 3FO9A 3QUXC 1ZE3C 3LEYL 3HZKB 2AJVH 3D3VB 1VFOA 1DDHB 3HRZB 2DM4A 1RJZA 3GSNA 2JJUA 4LP4A 5M94B 4YDKH 1TZIB 4WI5A 3EIFA 4KMTL 3RJQB 3JV6A 1GZPA 3OXRA 5IMOA 1LGVA 5DS8B 4UTAH 5GRJH 4JY5L 1AP2A 5DR5L 5IIEB 2R0ZL 1G7HB 3WEXB 5IMKA 4RX4A 4JHWH 1KIQB 1DVFD 3QG6A 3EYSL 1C08A 1G9MC 3SGEI 3STZB 1KUMA 1TNMA 3ILQC 4N5UA 1IAKA 5E4IA 1YY8B 2YMXH 4OCLC 4F15B 5IM7A 3IJSB 1FN4A 4NSKA 3E6HA 4QTHB 2M8XA 3KS0H 5D70L 4OLEA 3V6FB 3OJVC 3NZHH 5MEND 1ACYH 3TN0D 1PJ9A 2F19H 4RA0C 2B0SL 5IB4B 2X4SB 5EOTA 1LQSR 4FMFA 1T6WA 5FM8A 2MPAL 1PZ5B 4LLUB 3X13B 2HFTA 2A0LD 3ZE0E 4DFIA 3ALXA 5L6YH 1U8JB 5HI3D 4TSCH 1KCUH 2DJSA 1AGCB 4AEEA 2BNRB 4RNRA 1DEEB 3LKQA 2EZ0D 3CLFL 4X8JB 1S7VB 2W0PA 4PJAE 4RMTA 5DHVH 2CJUL 5KANG 3VGEA 2P8MB 1W0VA 4YDJA 3TM6A 4N0FB 4XNXL 5IVNA 4NKIH 3VD3A 2PYFA 2NTSP 2GK0B 4LVOC 4QNPE 3SDXF 1ZMYA 5C9JB 3DVFA 3NIFF 2XV6B 1RAMA 5F9JA 5HJ3B 1GYAA 2VDLL 3FKUS 2BFVH 5GHWH 2UZIL 4XXCA 1VGEL 3RTQB 4YDVB 1JPTL 5BS0B 5CGYD 2EXYD 3RY6A 3FT3B 4C4KT 2R56L 3KXFA 3WS6A 5C0GB 2B2XH 4LRIA 1NDGA 4Q6IC 4ONGL 2Q86B 2VDQL 4UMGA 4H1LH 4YWGH 1BEYL 1DUYB 1RK0B 3BRFA 1MHHB 1AI1L 4L8DB 2HT4D 3MGAA 2ICWA 1LEIB 1CZ8H 3EYQD 3DSFL 4KPHH 1IGJA 3CMOL 1KB9J 2JK5B 3BUYA 4JKMA 3GRWH 5IB3A 4N90E 4YC2B 3MCG1 1YNKH 4WGVB 2G9HA 5JR1L 4TPRL 4Y5YA 1YEJH 3C60C 3I84A 3QH3B 1ZHBA 1FCCA 3BH9A 1BZ7B 3VGAC 1Y6KR 4EI5D 4ODUB 1A9EA 2DQJL 5IEKB 5GJTH 3F7YB 1D5MA 1JNNL 1AJ7L 4M62H 4X6DE 3KXFD 1NCCL 4QHNA 1D5ZA 3MBXL 4IMKA 4NHUA 4MB4A 2XT1B 2F54E 3MR9A 1UVQB 4BUGA 1YY9D 3WSQL 3QEQB 3QUYB 5HYQA 4YQXH 3G08B 2JLLA 3PWPD 3O2WL 3WIFB 5F70A 5EPMB 3OHXA 1LO5B 3V4VL 5CCKH 3NACH 4PRIE 3LV3B 4FQJL 1T3FA 4KU1A 5D6DA 3D2UA 3VJ6B 2UWEA 1OGAA 3KYOA 5D72H 4JCLA 3VH8G 2AVGA 3TO4A 5J4MA 1QLFB 3RI5K 5HYSA 4UB0H 1F4YH 4O51B 5HD8D 2GAZB 5T3ZL 3BX7C 1KLGB 1N6UA 3P73B 2RIKA 4XH2A 4X6CF 5C07D 1N8ZB 3BDYL 1I7TB 1OTTD 5LXGH 3U0TA 4HHAB 4CMMB 4WI6A 3V5KA 1J0YA 2XWTA 2VKWA 3KPRB 4HPOL 2AW2A 1H3TA 4W4OC 4M4RA 3DROA 3FRUB 5EU7E 3MXVL 3HCVB 1YJDH 2CK0H 2OSLB 4YK4B 1CLZL 4YX2H 2ADFH 4JFXB 3BPLB 3LB6D 4MNQE 4DWHA 4ODHL 3S9DB 1MJUH 3D2UD 2F9BT 4D0DB 2FJGB 1OGAD 1S8DB 2D0HA 4OLYL 5C6PB 3KLHC 1QO3B 2ZPKH 1OTSD 3FZUC 4ODSL 1CICC 3TO4D 4O2FA 1RFDH 3MMEA 4NHCL 2FDBP 2JJTC 2Z4QB 5CKAA 3OSKA 4X99B 4DKEH 1KCRH 1JZ2A 3WLBB 3X3FH 1T5WA 4F58L 2WUBL 4Y1AA 4OB5H 1VB9A 4HWBH 3FQUB 3ARQA 4LCUA 3JTCA 1TZHA 4LSVH 2HLFD 2YK1H 4KROD 3IETB 4U1KB 4F33A 2EYRB 2V2XA 3V5DA 4FFVC 4HV8A 5ACZB 3T4YB 1MCOL 3LDBC 4OI8A 1I9RL 2HJLA 5EZJB 3KNBA 3MGTA 4L3EE 5IBTH 4NO5A 3ORJA 2ARJA 2F53E 3QZWA 4IRSA 5CMAA 1MREH 4JN2A 3IS1X 1I85C 3MRBA 1JFMA 5E00B 2AABL 3ZSTA 1S7RA 1PAMA 3ULUC 5IOPB 2DBJA 3X12B 4Z0BL 5T3ZD 1YMMB 5H35A 4F80A 4LSPH 3BWAB 4Y1AD 5LVEA 1Q8MA 2HRPH 2ZCKH 2NLJB 4RISH 4M1CC 3D9AL 1CU4L 3CFEA 1XGRA 1JNHB 3CFIC 3GI8H 3MRGB 4WO4C 4BSWA 3IDJB 4NGHL 1I8MB 5FUCC 4J7RA 5DZNA 1PDKA 1WWAX 5LBSH 4S1SL 3S36H 1RQ5A 4PGCB 4Z7NF 4GQPH 4IRSD 4HK0B 1TVHB 4LASL 4NQEA 2VQ1A 2WZPD 3UDWA 1G7IA 2VL5B 4P2QE 1XGUA 3HAEB 3NA4A 2UYLB 3C2AL 4K3DL 3C5ZB 1RMFL 5FOBB 3BPNC 1IEBA 4N9GB 4YIQA 3D3VE 5ENWA 4F57H 1MIMH 2HG5A 4W6WB 3T08A 3BZFA 4JO2H 5JZ7D 3S37H 5IK3A 4C56A 2B4CH 2N7AA 1RJYB 3BZDA 5JUEL 3IFPB 1F2QA 1KCVL 3T1FA 2LVEA 1K6QH 4X4YA 5AZ2L 3NCCB 2HFGH 3LKOA 4PBXA 5F9DC 4D9LH 5JW4N 1BLNA 4S1DC 2WWKO 3QDHA 5D7IB 5E9DA 1XCTB 1ZVSB 1U8LA 4ZUTB 1U8PA 3IDYC 1EZVY 1FFNA 1BD2D 3QPQD 5I1LA 1CGVA 3IAPA 1A1OB 4JFYA 2JIXB 3DGGB 3DX9B 2BNRE 5MERB 1CQYA 1HH6B 1BPVA 3L6FA 4Y16B 3RY5A 2HN7B 4N8PA 5IFAL 1U2HA 4C56D 1G7MB 3K4AA 1MLCA 1WBZB 5DMGC 3PWLA 4QRRB 1SBBA 4XVJL 1MFBH 1CFBA 4NO3A 4JN1L 1W72L 5D1QB 1M4KA 1F8TH 2HAZA 4HCRH 5E9DD 3QJHA 5CP3A 4M6NH 1R3JA 5I1DA 4NKDB 5TDNB 5KSAA 4YPGB 3RX5A 3OJDB 4YHYC 2W0FB 3IU4L 3TESA 5SWZB 4ZAKA 5BS0E 2NX5A 2VC2H 2A77H 3L9RA 1E4KC 4O2CA 4UU9B 4BFBD 2A83B 1BIHA 6CGTA 4HF5H 5I18H 1OLZA 3JV4A 2NY6C 1SEQH 3MBEC 3QHFL 3MLYH 4OT1H 3V5HB 3TNMB 4OD2B 1LEGA 1YPZA 3D39A 4PJ9B 2J5LB 5DJDB 2G2RB 1DQDH 4Y5XB 2CH8A 1DE4B 4NZRH 4GMSL 4HMEA 3JSSA 4ZO9A 3GSQA 4U6YB 4K94C 5MEPB 3PWNA 1W72A 3TLRA 2J6EH 3D18A 5KSAD 1UJ3C 4QXGH 3WNPA 3MRIA 3VDCA 3EAKA 5B3JE 1LP9F 1BIIA 4ZAKD 4JFZH 1CFSB 5E08L 2NX5D 3QIWD 5DUML 1KGCE 1UQSA 4EQ2A 4PV8A 4X7SL 1JZ5A 4FQCL 3TIEA 3UYRH 4JO1L 4WFGD 5CAYB 3QEQE 2Z0BA 4I13B 2AJZA 4NN5C 2AEPH 2IC2A 3D39D 4IIQC 3V52L 2Y5TA 2ZKHL 5C0EA 2OZ4H 2G60L 2DRUA 1CK0L 1WZKA 3J8F7 4EBQH 2A1WL 3CFCH 4PGBA 3C9NA 4P2OB 1RU9L 2I07B 4XPHL 2PYED 3EJZD 2EXWD 5EN2A 2VSDA 1KPRA 4GKZA 5EC1B 4IOIA 4LDLB 4Y88A 1B4JL 3GSNH 5L8LB 3GSVB 1BF2A 4HKBB 1IAIH 1JF1B 4K7PY 5HI5D 4HAFA 1N7ML 3A67H 1CLYL 2DLHA 4C54A 5KTEL 3LEXB 1U8NA 3VGHA 1N5AB 1LO3L 1S5IH 1AXTH 4I18B 4FQXB 1FZOB 2HWZL 3OXSA 3HR5B 4XWOC 3KPRE 3AUVA 3RL2B 3ARDC 4QRTA 1P2CA 1Q0YL 1UACL 1KF9B 1XIWD 4K3GA 1FFOA 4MWFA 1MNUL 5C0AA 2FGZA 1G9ML 5GISH 2YC1B 1SVZA 4DCQB 4ZS6D 4WU7B 4KTDH 3VFPB 1F6AA 3O81A 1TNNA 5C2BL 5CD3A 3CIQA 3IAQA 5IWLC 5L8JB 3BI9X 1AKJA 2GKIA 4RMRA 4F2MB 4JO3H 1AR1C 4OGAD 1CGUA 1KIRB 3L5XL 1DBJL 2FX8L 2WBJC 2NYYD 2QHRL 5TH2B 2VUOA 2R9HC 3QUXA 5EUOB 4S0UC 1HQRA 4XPBH 4U6HA 1B0WA 3H9SA 2SEBB 4KRLB 4OIAA 4HUKB 3DURA 3QHTC 4RFNC 5E70A 5SWQA 5DQ9B 5C0AD 1GPOL 2J8UF 1SYVB 1U0QA 4OAWA 2ADGA 5EUKB 1YNTB 3IJYA 3LH2L 1RZKC 1TJIL 2W65B 3KPPA 4GOSA 4Z76A 4U0RB 1QUNA 3IDMB 3O6KH 2YEZA 2MKLC 3DRTB 3I75A 3T77B 2P8LA 1KJMB 4BK5A 4HQQL 4DKDC 1KIPA <