2BSRA

Crystal structures and kir3dl1 recognition of three immunodominant viral peptides complexed to hla-b2705
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
276
structure length
276
Chain Sequence
GSHSMRYFHTSVSRPGRGEPRFITVGYVDDTLFVRFDSDAASPREEPRAPWIEQEGPEYWDRETQICKAKAQTDREDLRTLLRYYNQSEAGSHTLQNMYGCDVGPDGRLLRGYHQNAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGECVEWLRRYLENGKETLQRADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA CLASS I HISTOCOMPATIBILITY ANTIGEN, B-27 ALPHA CHAIN PRE
publication title Crystal Structures and Kir3Dl1 Recognition of Three Immunodominant Viral Peptides Complexed to Hla-B2705
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/peptide
total genus 74
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2005-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2bsrA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 2bsrA01
5CGYD 4A6YB 3HNSH 2PETA 3HNTH 3O3AB 3H0TA 1JHKH 2EZ0C 3EFFB 4HFWA 3WLBB 3PF2A 3QG6A 2SEBA 1WAAE 4EXKA 4XCEB 4LU5L 4U1NB 3WIFA 3VFNA 3ERYA 2YPLA 4ISVA 4NGHH 1VGKB 2X89D 3UTZB 3LEYL 4WFHD 3D39D 4L4TB 3SE3A 5JW3L 2XKUA 2FLBT 3PP4H 1IT9H 3ARPA 1EZVY 1MCBA 4DOHE 2HA1A 1S3KL 2Z31D 1M6OA 2X4RB 3FO9B 1TETL 4KKCD 5GZOD 1LWRA 4PY7A 1VEMA 5DMIH 3QEUA 5TDOB 4QRQA 2J88L 3E6HA 1BIIB 5H37H 5DD3L 3D5OF 3EDJA 4Z95L 5EOQL 4MCYA 3VFOA 1OGAA 4MNGA 3U30B 4YEFA 2GAZA 4NPYB 4H8WL 2R9HD 3KS0H 2KKQA 3FOMA 4LSTL 1HH6A 3RAJH 1U3JA 2GTWA 2ARJB 3ZT5A 1OD9A 3CFBA 2Q86A 4GBXA 5GPRA 5SWSA 1BGXL 4OCSL 1PKOA 1YPZA 4F8QA 1T04A 4QHMB 1I8LA 3K0WA 3DETD 3WHXB 1QSFE 1JPST 2I27N 2HFEA 2V5MA 5D72L 3SDCD 4QXUL 2BOCB 4GRMA 3C60A 1P6FA 1SYSA 2GIYA 1X6LA 2EKSA 5DJ6A 3RZCD 2YD8A 3HS0A 2NY4D 1UZ6E 1SEBA 4NSKA 5C0EA 1CFTA 3JV6B 1DBML 5IROA 4OZGB 5C07A 4LIQL 5LBSL 1Q9KA 5K9KB 3HG1A 3RIAF 5D1XD 4WFFD 1KBGL 4X0KA 1UB6B 4M6AA 1D9KB 2RFXB 4POUB 1EHLL 5MERB 1ZTXL 4MDIA 3OJDB 4P23B 4OT1H 4NQDE 3KJ6H 5F7DA 4UT6H 3TZVC 1I3RA 1EX0A 1QFWH 2C5DC 4KTDH 3PGDA 1RK1B 1CGWA 4L8SB 1UFUA 4KXZH 5CEZD 2ZUWA 3TVMB 3WFHA 5GRZA 1ADQH 2DI8A 3MCG1 1VEPA 3WNPA 5D9SA 5CFHA 1Y18A 1FLTX 3DX9B 5I0ZA 2FZ3B 2ZOKB 1CD1B 3EO9H 1BQHG 3S34L 4PJEB 1MREL 5DWUL 3BDXA 3EZJB 2ADIB 5I9QC 2P5WB 4KU1A 3SGKA 1AD9B 4N90D 4BQBA 4GKSA 4CMHB 5C6WH 4I0PB 3QSKB 4RGMC 2X7LB 3B3IB 2R0LL 5FEBA 3BESR 3RWGB 3BGMA 2HLFC 5EPMB 3B6SB 4Z7WB 3VXQA 4PJHE 4XMLL 1R3HB 1NBQA 4WI8A 5EC1B 1R3KB 5FYKU 4L8CA 4ZFZB 3MBXH 4K7FB 2A38A 3ARBA 1F45A 5C0DB 2FWOA 1N64H 5A2KH 1MFCH 4XTRD 1BQSA 4WEBL 2D0GA 1MIEH 4KUZL 1MCOH 3MNWA 3NZ8B 1LO2L 2A6IB 2AK4B 2P45B 5HYQA 3BRFA 3BHBA 4HKXB 4JFFD 1NMAL 4LK4A 1AR2A 5GS1A 4DOHB 2B0SL 3OR7B 1YN7B 1BJMA 3WIHL 1T4KA 2YOCA 4JRXE 2ADJA 2VC2L 1NGYB 1D5BA 1Y0LA 1KTLA 4LLUA 4U1KB 2B1AH 5KSBF 2B4CL 3GO1L 5E2UL 3KPMA 4K3JL 4YXLH 4JO1H 4E42B 3QRGL 3RDTC 2YD5A 2R0ZL 2QSQA 5I18H 3LHPL 2XTJB 2DWDA 4JO2L 4ZFGL 5FV2A 2W65A 5ADPL 2LTQC 2D7QA 4OF5A 5J11B 4FS0A 4HQQH 1H5BC 2E6JA 1J12A 2EEDA 1A3RL 1JRHI 1FAKT 3DV6B 2MNUA 1A7OL 4PBVC 1Q9WB 3C5ZB 1P4BH 4O2FB 1EPFA 4WEMB 1NKOA 3NAAL 1QSFB 4HMCA 4JPIB 4X80L 3MRCA 1QBBA 2L7JA 1B4JL 4HUVA 4LCWD 3FN3A 3O8XD 5D2LE 4J3XA 1NFDF 3SE9H 5J13C 4TOYH 2XKNB 5EBMB 2FDBP 1S7UA 5IR1A 1AXTL 3DX6A 1HEZB 3QO0A 4NO3B 4OLEA 4QHLA 3DUUA 4P9HC 3FONA 2A1WL 1I85C 4IMKA 3WJJA 4MDJA 1KB9K 3EO0A 3K81A 4P2QD 3RRQA 1AXSB 3FT3B 2ZJSH 1Z9SA 1WIUA 3BUYA 5E8PB 1H3WM 4X9IA 2N7BA 4PG2A 4WFHE 3D39E 2B20A 3GJFB 1MCIA 5GRXG 2GHWB 1NANI 4JEGB 2AEWA 4MXVF 4MHHI 1A6ZB 4OSUL 5E95B 4NKOB 1TVDA 3DPBA 4MD0B 1T0PB 4HLJA 3IDYC 1LGVA 4ZODA 4MA8L 1E6OH 3NIDE 4RFOH 1FL5A 3NA9L 4PJDA 3WFCH 1KGCD 43CAB 2QQLH 1XH3B 5I71C 3KHQA 5C0BD 4F58H 5IGXH 5E2JA 1FPTL 5FYJH 4M1CD 4PP8C 3ETBF 3KG5A 2BNUB 2K9UA 5D2NC 5KTEL 1N5YL 5IIEB 3JWDH 5KSAB 5C9JB 4EN3C 2CDFA 3WJLA 5FDWA 4J4PC 4PJ8C 4TSAH 2Q6WA 4EDWL 1L7IH 2VXUH 1JK8A 5IVNA 3G04B 2GW5A 3IFPA 4EEEA 3BEWA 2BOBB 3SQOL 1FDLL 3D0LB 1C12A 3AGVA 4JCMA 2XZAH 4UTAL 5C0GA 4XWOC 4LSQL 3QQ9D 3RWFB 1AC0A 2VLME 4HXBL 4GQPH 4PJFA 4PJBA 4WFFE 5DQJB 4U6TA 1XF3A 1G7PA 1LMKA 2R2BA 4C54A 5GGVL 2Z93B 4ZXBA 3EGSB 4Z7VE 5KANG 3RNKA 4C56E 1H8SA 3MRJA 3OF6D 3PWPE 4M1GH 5EZJA 5GGTH 3GKWL 1OAUH 4JRXB 1LEIB 5T1DL 4ELKB 5CEZE 1I1AA 3QUMB 1WUNT 4FABH 1F90L 1MCDA 3CFEA 2EH8H 1S7XA 4QCIA 3QUYD 1E4WH 1GOHA 4WUKH 1NUDA 4W4OA 3HAEB 4XP4H 1ZT7B 4OD3L 3TIEA 3AU1B 2EICA 4ONFH 4OFPA 4R7NA 5DSCB 4YUEH 3ZKQD 4P4KA 3TJEH 3B9KD 4N90E 4H25B 5IVXF 5E08L 3ZO0A 3C9NB 3WO4B 3TM6A 1T1ZB 1W8NA 2WY3A 1PKQA 2V17H 3I50L 3TESA 1ZE3C 2ZCHH 3TCXA 2GT9A 5D2LB 5FM5O 3EFDH 5E8NA 1RY7B 3RVWD 3T2OA 5L8JB 3RL2B 4S2SB 5HVFB 5GGRA 3D85A 4ZUTB 4JREB 5L2KA 3DMMD 2KZWA 1BOGB 3ILQD 3FO2B 3GHBH 3QFJD 2FX7L 3KPQB 3MGAA 4FQXD 1BVKB 4CU6A 3OKLB 3QEQD 5JHDD 2D0FA 3V52H 4AL8H 3T0AA 5FO9B 2BRRH 3MJ9H 5FOJA 4L9LA 1HSAB 1ITCA 4NDMA 1MF2L 4U2YA 4WJ5A 4PYGA 5DJ2B 3P4MA 2R23B 3AMKA 3QDMA 4JZJC 5DTFA 4CBPA 1AGDA 3M17A 5D7IA 4YX2H 4WUUA 1VESA 4KVNH 3B83A 5KG9B 2A9MH 4U0RC 1G9EA 5DD6A 1ZSDB 3HCVA 4PP2B 2CLVA 2BNQD 2EZ0D 4O51B 4Q6IA 3BP4A 1SY6A 2IWGA 4UDUA 1U9KA 4OM0H 3UTTA 1JPGB 3GZKA 3CDFA 1ERNA 4LQFH 2G60H 5MEND 4PB0L 2LVEA 1B6DA 2JB6A 1G7QB 2D2OA 4R97B 4XNXL 5CSGA 4X6BA 1A7NL 3S4SB 5DUPL 1YEKL 1NL0L 1KV3A 3DYPA 4E41A 2G75A 3QUKB 3AS2A 4AT6B 3DV4B 2EE2A 2GY5A 1R3JA 4HV8A 1FGNL 3X12B 5I6XC 3CDGB 4MJ5A 4ORGA 3HR5A 4JG0L 2OK0L 3WFZA 1T03L 2ARWA 4Y5YB 3P0YH 4X4MA 5C71A 4LLQA 3LEXB 4U1MB 5JA8B 5F96L 4JZNA 8FABA 1NLDH 4P46A 1N6UA 5B22A 3O4LA 1Y6NR 2AW2A 4N5EA 4X5WA 1U42A 3E8UL 4JFEA 4Z7VB 5J89A 1Q0XH 4C56B 3NCMA 3O2DH 4ZPVA 1F6AA 1WBZA 3PWPB 2PYFB 1U3HC 2FGWH 5C6PB 2WMPA 2CKBH 3C5SA 3KPSD 1CZ8L 1IAKB 4LNRB 3LQAH 2OI9A 3L7FB 1B90A 4X8JB 4IMLA 2VDNL 1CI5A 1TTUA 3WYRA 3NPSB 3V0AC 1I7RA 5F9JB 4K8RL 5MEPB 2EDDA 3UO1L 5EORL 3PL6A 1BFTA 4IDJH 2K1MA 3NVQA 4UU9B 4MJ6B 1RV6X 1UXSB 4DEPC 5C0NC 2R1YA 5JO5B 5I8KH 2HFFB 5EN2A 4DKAA 2CLRA 2J4WL 3TZVD 3LIZH 5IT2H 3Q1SL 2VERN 2IAMA 3GI9L 3CPLA 4QTHB 4RFEB 3MMEB 5BXFB 2G2RA 4NKDA 3T2NL 4JFZH 1VADA 2XICA 5HJ3B 2VR5A 5EWIH 5HI5C 4I3GA 3SDDA 1MFBH 2ZPKH 3MSPA 1IQWH 3EBAA 4YDLC 1MHHB 4O5LL 5LQBL 1JZ4A 3T0BA 3MRQA 1CFVL 3B43A 4JY4A 3HPLA 2OS7A 5EZIH 4YFDB 4ZTOH 4UAOB 1S7VB 3CVHB 3T0ED 1OT1A 4XC3H 3RWEA 4KMTH 4HS8H 2Q7YA 1NKRA 1TVHA 5D71H 3DNKA 1EAPA 2D03L 4L4VD 1GGIL 4AENA 1QSEA 1VB9A 2H8PA 3MLWH 3ULVD 4KZDH 4J12A 5KSBE 3K7UA 2DQHH 3GHEL 5DC9B 2OXHA 2X4UB 3MBEC 4NQED 4GG6F 3DVGA 4XCNB 5TGBA 5DVKA 2XN9E 5I15H 5KN5B 4U1SA 3DTXB 1IEHA 3LB6C 1VPOH 1XFPA 3IRZA 1LE9B 2XG4A 1CFSB 5FO7B 4OLZH 5FKAA 5E8EB 2AJZB 3VFUB 1V7NL 2R56L 1FYTD 3VJ6A 2MKLC 4Y19D 1UM6L 3SJVE 2A74A 1CL7H 1B2WL 4JFOB 1RULL 4F7EA 2FHCA 2WW8A 4LCYB 1VACA 5I2IB 1RUMH 2R8SH 1DN0B 4GS7C 1LO0H 2Y06L 5T3XL 3GIVB 1Z0NA 4JAMA 3RWCB 5DFVC 3G6DL 4KJYA 3MQIA 1LQSR 3SCMA 4CMMA 1KJ2B 4XXDB 4EDXA 3QUZC 1SYVA 2X4QA 1AD0A 3OWEA 5GRVL 4BZ2H 4WHTA 4NQXA 4EIGB 1N6QL 5DMYA 5BQ7B 5TDPA 3RDTD 5IB1A 4LCIL 2EC9U 5FECA 1XCTB 4JQIL 5L2JA 2F74B 2HFGH 5DJ0B 1BJ8A 3QA3A 1U8JB 1OAXL 1GOGA 3U48A 3VXOA 4KZEL 2IGFL 2ZUYA 1IAII 43C9B 3MLZL 3QXAA 4G9FB 4HKBB 3VXPB 3TFKA 1SMOA 4UINH 3VXSA 2YBRB 4PLOB 1G7JB 3TH2T 3IXTB 1WZ1H 2D7NA 1TCMA 3W5NA 4JKPH 4ODXB 3WSQH 1A5FH 3ALWA 5J9PA 2NPLX 1J11A 3VXUB 3QHZH 3RU8H 3PIQB 1E0OB 3BMVA 3H2WA 4HUWB 4BFIA 5EFIA 3PGCB 3IJYA 2IQ9H 4G3YH 1SY6L 3RVVC 4GT7A 4XNQB 5B8CB 4H20H 1QBLH 1UQSA 5IHUL 1EVTC 3E2HC 1U8MA 3TN0C 2VO5A 4M5YH 3UBXA 1ZVSA 2OJEB 4P57A 5T3ZD 1RSFA 2OP4L 5IWLA 3BQUA 4OCXH 3TBTB 1MWAA 1J05B 2AEPL 3CC5B 3ZE2E 3RGVB 4G8EB 3V0WL 1A6TB 4D3CH 3S36L 3S88L 1QNZL 2AEQL 2BVOA 3LZFH 3QIUA 3LD8C 4U3HA 4M6ML 2A2QT 4I4WA 5ISZA 3O6KH 2WBJD 3KPNA 2R1XB 1TNMA 4OLWL 3GMMA 4N0RA 2NXZB 1SJEA 2UWEE 1IFHH 2P8PB 4XPHL 3L5JA 3SHSA 1MRCH 2HT3C 5DYOA 3HI6H 2DB8A 4X4XA 2MOVA 4JN1H 3DI2B 4I18A 2A73B 5E56A 2Z92B 1A4JB 1DLFL 4NQUA 1F13A 5L8LB 4KFZC 5DEFB 3DO7B 3DRQB 2HVJA 3U83A 3AM8A 4PTTB 3OZ9L 5D8JH 5KSBB 5JOPD 4EN3D 5HXMA 2IH3B 4JJ5B 4D0BA 1IBGH 4J4PD 5CP7B 4BZ1L 3WIIL 3BZEB 4UILL 2XN9B 3E1F1 4QOKA 1T2JA 3UTSA 3ZKXB 4TNWF 1GGYA 5E99H 3BZFB 1AQKL 1ZLUK 3RBGA 2VDQH 5CD5C 2BC4A 4WI7A 2E27H 2YHGA 5IVXE 1MEXL 4FTVA 1J86A 1KNOA 3PV6B 4KHTL 1TCRA 4BSVA 1GZQB 5CBEB 3SJVB 3AY4C 4P5TB 3D69A 2YD9A 4NZRL 3WL9A 2L7UA 3VFSB 1A47A 2NLJB 2ZUQB 4Q9CA 2K7QA 1EHNA 3RWJB 4JRYA 5I17A 2GCYA 3TO4B 2DDQH 5I1JL 4HS3B 3QXDB 1E4XL 3T0WA 1AR1C 3KS0J 2ZUVA 5TDNA 3QG7L 3V5KA 3L5IA 3V6OC 4JY5H 2DMCA 2QADD 4EUPB 1BZ7A 3OKOB 5HVHC 4JCLA 3SDXF 4K7PH 1W0YT 4RMVA 1OCWL 3RUGF 1FZJB 5I19L 4F9PC 2C3VA 4NC1C 1TIUA 2V2WA 2G5BB 4QXGL 3EYUH 5HTSA 2Y6SC 5ETUB 2AJSH 3I6GA 2FBJL 3FHAA 4L4VE 1BX2A 4M48L 4CW1B 4D8PB 3O3DA 1IILE 3QDGE 5D1QA 5BZDB 4MX7B 3OR6A 1AXIB 1MFAH 4NQEE 3QJHA 1A4KB 4D0CB 5I66B 2BDNL 3VXRE 4XP1H 4A6YA 4E5XA 4YHLH 5AAWA 3A6BL 4G8FA 4PJGF 2ZSVB 1WTGT 3QQ3B 3IXAB 1JUFB 2JJVA 1FYTE 4U1NA 5I74C 4Y19E 2JJSC 2ED7A 1EH9A 2WUBL 2FL5B 2AABL 5FYLL 1MIML 3MO1A 3ARDD 3TO2B 1AHWB 4Q9RL 4K7PX 3LRSB 2UYLB 1S7SA 1UWXH 4WW2C 5DHYB 4HJ0C 3ULSA 2YUXA 3GMRA 3NACH 2A6JB 5GGVY 4XAWH 3TBYB 3MRHB 3VFRB 4I48A 3O6LL 1P1ZB 3KLAB 2UWEB 4JO3L 3BH8B 4I77L 5DR5H 1BIIA 4IJ3C 1MHEB 4MXWL 3N1MC 1IL1B 4P3DB 2R69H 3PHOB 5EU7C 4Z7QF 1WZKA 4PRDB 4X99A 2ARJA 1UCTA 1KEMH 2XPGA 1H3PL 3N1GC 3G08A 5CLTA 5DJCB 3ZDZF 4PJ9B 4WDIA 3TCLB 1FN4A 1PSKH 1U8KB 4CRPA 1ZGLA 4KGLA 4KTEH 5L88H 1QVOB 3SY0B 2PW1A 1KCSL 3IJSB 5T1LD 5E03A 5IP4A 2CO6B 1NC2B 4JFDA 1H3XA 1DL7H 5EZOH 3ZYZA 2DLTA 1CBVL 4FMKA 1EO5A 2BOCA 1YJDH 1F8TH 5HHMD 1J0KA 3AROA 4M7ZC 5BRZD 4XVJL 1AIFB 4U6YB 5D7SH 2P5EE 4ALAL 1T3FB 5IVXB 5F3BA 5CINL 3MRIB 1MWAL 1ORSB 1YEGH 5BO1H 3N9GL 1O5DT 1FCGA 5HYSA 3PQYD 5FK9B 3QDAA 1KELL 1UYWH 4WI6A 1ZLSH 3V7MA 4MA7H 4XPBH 2DQJL 5MERA 1DSFL 3P30L 4P23A 2HJFA 5DJYB 3NIFF 35C8L 3VFPA 3IDXH 5LG1A 4LLYB 4XNUL 1VSCA 1T21B 3TBWB 2APFA 3L3OB 4XBPB 2C3HA 4R4BA 4MNQA 4KY1H 4MD5B 5AYUL 5KZCD 5D1ZC 4RCAA 5IUSA 2ED9A 3CH8A 2CRIA 4P2YA 1B4RA 2FSEB 4QO1A 3F65A 3EYOB 1JIBA 5F89B 1UADC 1WEJL 4MQ7A 2CK0H 2XWTA 3O41A 1CGXA 4NO5B 4DTGL 4GAJL 5I9QB 4NRZA 4H1LH 5D2NE 5IF0B 2XZCL 5HGHB 4EOWL 1BAFL 4TRPH 2GSGB 3ZKND 3VDAA 5FFLA 5I75C 3B3IA 3O3BB 4OM1L 4X7EC 3QDGB 5LCVH 3MUJA 5MEQB 1NC4D 3ZDXE 1I1FB 4WO4C 1K9TA 4Z7WA 3F7RA 5SWZE 3IETB 4LNVA 3UJTL 1A6UL 3BZDA 4JKWA 3VFGH 3VXRB 4K7FA 4ODSL 3R4DA 4OLYL 4O4YL 3M8OL 4DZBB 3U0PB 4KKAD 4M7KH 1H0DB 3RWDA 1M05A 5GSRB 3L3GB 4UIMB 4QRRD 5K9QG 5J56B 4JO4H 1K8IA 4A2MA 4ERSH 2ZWLT 5DVOA 4APQC 1GXEA 3QAZB 4WEUD 4FFWD 4HKXA 1EFXB 1W72H 5BZWB 5A43C 3HZVB 1PLGH 3HA0A 5D7LA 1GC1H 1JV5B 1DQTA 5E94B 5DA0B 3OKEB 3EW3B 3FO0L 2Y36H 5JMRA 3WE6A 1DR9A 1G9NH 1EO8L 1JNLH 4M8QB 4KVCL 4MWFB 3P9MA 4HAFA 1G0YR 4U6VH 3QPXL 4HGMA 4QF1A 1IARB 4E42A 4MMXC 2VN7A 1A3LL 1HSBA 2ZNWA 1YZZA 4G9DB 1H5BB 3MPCA 4NQVB 1U8NB 5FOBA 5IV2B 2Q1EA 3DV6A 3FQTB 1A1NA 1IZJA 2NY6B 1A2YA 5C6TH 2ICWJ 4OI8A 3R1GL 4J8RA 2OR9L 1K6QH 3L5WB 1EHXA 4ZYKB 5DQ9B 2RGSA 2ADFH 5DFVD 1Q94A 2HH0L 2GFBB 4A6YL 5J13B 4ZUVB 2QLVB 2BSSB 3T1FB 2H2PC 3QUZD 4IRSD 1OB1B 2P5EB 3BSZH 1QG3A 5E9DB 3BYTA 5D6CA 1OAYH 5F93C 4DVBA 1L7TH 1LD9B 3H9SB 3BKCL 5LJYH 1YEDB 5E00B 3SKNB 3LN4A 4ZUSB 5KANI 4PUBL 2E7HA 4KROB 2CDEB 4NQDA 1MCPH 3GJFA 1MRFL 4OFIA 3IRPX 4YIQB 4U1JA 5CMAB 2MSPA 3IFOB 5F6IC 3IDYB 4FXLA 2RB8A 4GOSA 1H3GA 5B38A 3P73B 4JM2F 4F33B 3MLXH 1F4AA 2HWZL 1I4FB 1RU9H 3U6RB 2JELL 5AG9A 4KMLB 4M9PA 3UC0L 3TN0D 5DD1H 5E8DH 5JUEL 1KPRA 2A6KA 5ID0A 4M43H 4QRUB 3FTGB 2MJWA 5H94A 1NAMB 4R0LC 5CJXA 3N85H 5D2NB 5ESQB 5DO2D 3TV3L 4Z7NF 2GITB 2FLRT 5KSAA 3GB7B 2N1KA 4MAYA 4DN4L 3CFJA 4PJ8B 1RZJH 4U1IA 3IDJB 4PJHA 5SWZB 2BSTB 3ARZA 1N0XL 5F72S 2EXWD 3RIFF 3TC9A 4BZYA 1CQKA 2BOBA 1BBJA 2VLKE 3D0LA 3NH7H 2OL3H 1HQRB 1TJIL 4IRZL 5E5MA 5J1AA 2HT3D 5IBLD 1A1OB 5GGRY 3VDCA 3FZUC 4NQCE 4FFYH 2J8UF 4J1UA 3EYVA 3MLUL 3FQXA 3I9GL 5CJOH 1BLNB 2YEZB 3MOBL 2JB5H 2NX5E 3LS5L 2RAMA 1HYSC 1DLHB 4KRPD 4HS6B 2ICWB 2X40A 2YMXH 1KSRA 5E2WH 3SDXE 5EC2A 4Y4FC 4Y4HD 5CIPA 4EKXA 3LMJL 3RVXC 4JRXA 5FM5M 5E6ZA 3L1OL 1NGWB 1PG7W 3O3EA 3UJJH 1N2RA 2AAVA 2BSRB 2XFXB 3WLWC 5CD5D 1IGCL 3PNWB 2E9IA 4MAUH 2BHUA 1CGUA 2HVKB 3QIBC 3U36A 4PJ5D 1RZKC 2BSED 2DYPD 1P4LB 4NWUL 5I0DA 3QPQC 4XX1E 5T1KD 4U4BA 3F6LA 3U4EB 3FB5B 4FNLH 4HJJH 4QNPE 2JK5B 5JDJA 1IAIM 4PRPD 3SDAA 1AR1D 1DQJB 5I1LB 3BVNB 1KUMA 1XGQB 2VITB 4P2OA 4NQSA 5DVLA 4EJ1C 1BFVL 3B9VA 3RL2A 4G42B 3FT2B 3JWOC 4XT1C 3S37H 4XPGH 1JYXA 1YNLH 5C70A 3MRPB 3WN5C 5KS9A 5EUOE 4JDZB 3GBLA 3KPQA 4ZSOE 5INDB 1YY8B 3ULVH 3EO1A 1AJ7H 3DYMA 4HSQA 3MODH 1CLZH 2Z91A 5FO9A 2Y6SD 3QIWD 5EDXA 4OF0A 3WDIA 2VSDA 1HSAA 3BO8B 2X89A 3PHQA 5JW4N 3D39A 2UVEA 2H1PL 2Z4QB 3ZT6A 3GSXB 2N7AA 4HUMB 2GK0B 4RBPH 5DDHB 1NCCH 1OW0A 4N1CA 4QT5B 4H0HB 3LKOB 3GFUA 5CZXC 4JZJB 4DK3A 2V5TA 2Z31A 5HDQH 4QYOA 5FF6B 3ARFC 1DBBL 1JPFB 1NUNB 3ZLQC 1XEDA 5GS0D 3B5TA 2FJFB 4U0RB 1WBXB 4Y5XC 4DK6A 2AERT 3EJYC 5HDLA 3MLSH 3WFBH 1A22B 3ZDZE 1LK3L 2DLFL 3OKKB 2KDGA 4JZOA 1AGEB 4JPVH 2C3GA 4XMPH 3HN3A 1X7QB 2H6PA 5D7KD 5JW4M 2WBWB 3S37X 4JFYA 3LS4H 4XRCB 2X9WA 4HJ0D 4JM4L 3B5GA 1XIWC 4NUJA 4TQEL 3MLYL 3SDCA 2HRLA 1JHTA 1DBAH 4NRYA 3I6LE 5T5NF 4XVUC 3VW3L 3EYSL 3SGEI 3RZCA 2VLKB 2V2XB 4BH8A 1KTRL 3S5LA 3OG6B 3CDGA 1WV7T 4UZGA 1A0QL 1JF1A 1WTLA 2DQUL 2XA8H 5E7BA 2FX8L 5ACMA 5KJRL 5ADOH 4K23L 4IRJC 4NQCB 4MB3A 4PS4H 5D1XA 4L3AA 4OAWB 4DQOL 5GSVA 2NX5B 2QQKL 1HHKA 2RHEA 3KYMB 4Z7VA 3VFVB 5I73B 4OKDA 1U8HB 1DVFC 5L7XH 3H6JA 3SDXB 3PWPA 1U3HB 1JZ6A 2Z9TA 2AGJL 2AV1B 4WWKC 3RUGB 1QQDB 2AKRA 2PO6D 3VI4E 4LNRA 5DEGB 4LSUL 2WSKA 2VMFA 2P8LA 3QZWG 4NHCH 1T20B 2DQEL 5CJQL 2X9YA 1RMFL 4KKNA 4CADA 4TTGA 1PQZB 5MEPA 1A02N 4JY6A 5F1NA 1OSZA 3HMXA 5LGHL 4XVSL 4NCC2 4AIOA 2VISA 4KI5C 4LGPB 1NGZB 2CKBB 3RKDC 1RZ7H 2ITDB 1ED3A 1MCQA 4KV5E 5DGRA 1II4E 2QKIB 3KDMB 3MGOA 3O81A 4M6NL 5EO0B 5TF0A 5JNYA 4IOIA 1G7HB 3MRGB 4DJMA 5HY9B 3UCRA 4QTHA 3MMEA 1XGTA 5FA3A 2VDML 1PX3A 4BSWA 5HJ3A 3BWUC 1FNSH 2O5YL 4YDLB 1I9EA 3BDYL 5E4EC 1MHHA 3O11B 1LNUB 1FL6A 1F97A 1JPSL 4ZSOB 5EBWB 1HHHB 1AI1L 3FT4B 2APXA 4PRIB 1ACYH 2EC8A 1D6EA 4FQIH 5F88B 3W9DA 3C6LC 1Q38A 2W59A 2ZUSA 3L3JB 4XP9L 4C59B 1T6VN 4HUUA 5DD5L 5GHWH 5JXAH 1UCBH 4JFFA 3H42H 4G6AD 1WT5C 2XXCB 3I75B 4OGZA 1TQBC 4Q9BA 1YMME 3MBEB 4WO4D 4YWGH 4UNUA 2YK1L 4Z18A 5LGKA 3F12B 4DGIH 4NN5C 2H26B 3M1BB 5ICXB 3DTXA 1U8QB 2B8OT 5I1EH 3U0TB 3BT2H 1BIHA 5DUMH 1LE9A 2GK2A 4R90L 1S9VB 1AY1H 1UWGH 4RGND 3BZ4A 1MRDH 4OV5B 3VFUA 3Q3GB 4PJ5E 4KKBD 1XCQB 2H9GB 2NCMA 5LAXB 1T5WB 2VLJD 3NFPB 1S8DB 4LCYA 4HC1H 1CF8H 5CGTA 4I5BA 5DMJB 1JGUL 3G5ZB 4K71B 4PRPE 3GIVA 5KVGH 4LCWA 4U7SA 3O8XA 3N1QC 1FNEB 1W0WB 4D9LL 1JE6A 3V6OE 1KJ2A 1ZT4B 1BZQK 4HKZB 5D5MF 4GMTH 1RUKL 4GKNA 2ZCKL 3TYFB 4AEIH 4EUPG 5T5FH 5FV1L 3W2DH 3P4NA 2YC1B 2XKSA 4LSSH 3QR2A 3DRTB 3VXTB 4NC1E 4K9EC 4HPOL 4JFPB 5DJXA 2F74A 5HPOA 5BV7L 5DJ0A 4ODHH 1KN4H 1MAJA 1VERA 4KJPC 1U8JA 2VNCA 1ZLVH 3G6AB 3K4DA 3OAYK 4X6CA 1HINH 4HKBA 3RY6C 2XNAB 3FFCB 4UB0H 1WQVT 4LLMA 3IXTA 1QHOA 4OCWL 1RUAL 4F9LA 3BD4A 3QO1B 1KJMA 1A9EA 4HWNA 1QHPA 5IFAL 4TYUA 5FHBL 1DE4A 4HCRA 2H2PD 5IEKB 3PGCA 2CJUH 1QFOA 3V6FB 4XNQA 3VWJB 1OF2B 2NXYC 3E2HB 5TH2A 1WWBX 1J1OL 2E7LA 5C0BA 4Z7NE 2Z8WC 4UMGA 4ELMA 1OAKL 4HD9A 3MNZA 3AREC 1I7TA 4PGZA 3EOYG 2H32B 4X98A 5L9DH 1P9MA 1NJ9B 5D7KE 2DMKA 1FGVL 1U36A 5KVEH 3LQZA 3P77B 3FHQA 4G8EA 5I16B 4G7YL 4Z5RB 1XF2A 4L8DB 1PW3A 1UT9A 3MV9B 3LKNB 3H9YA 4LAQL 1RZGA 4NIKB 1AO7D 3E6FA 1TXKA 5EOCL 3MRDA 1ZK9A 2J8OA 2A0LD 4DKEL 4JB9L 3F62A 3V5DB 3IVKA 1OY3B 3Q6GH 4HT1L 4TSCL 3TT3H 2IH1A 2NY2C 5EU7E 5ERWB 5GXBB 3ULVF 1I1CA 1KEGH 4YXKH 3RIAK 1A4JA 3QNZA 5B3JF 1FZOA 1GGBL 1KXQE 2WUCL 4HZLA 4YPJA 5JQ6H 1J8HB 5HD8C 4PRAB 4S11A 4NWTL 3OF6A 1G6RH 3LQMA 4N0YH 1SBBA 1YMMB 4KDWA 4KPHL 3HLAB 5CEZL 2JCCE 5HI3C 5CP7A 1OP3H 4LRNH 5C0RL 2XN9A 2DQFA 3RKPA 4NRXA 3VRIA 5ANMB 3EIFA 5IVOA 3HPJB 3QUYA 1GAFL 4JHAH 4F80A 5JR1H 3HMXL 5JORA 2Y7QA 5DI8B 2PCPB 2XQYG 2LAGB 4NP4L 3SJVA 4P5TA 1EZVX 4UQ2B 4FQQB 2ZCLH 5T1MB 1URLA 3U9UB 5CSZB 1HYSD 5I8CB 2A9NH 3P9WB 5GGQL 1KB5H 2YN5A 3R0NA 5CP3A 3RWJA 5FYKH 4PLJD 3KPRD 2C1PB 4MD4B 4NNPL 3TBVA 2ICEB 5F9OL 3CFKA 4XHJC 2GJ6E 2JJWA 1NCBH 2YRLA 1WLHA 3FRPA 4NJAH 4W81A 1KCRL 1D3CA 3P11H 3OJVC 2NY0D 3D9AL 1A7RL 4Y5VB 1NGQH 2JIXB 3DMMA 3KPPA 4IS6B 3WLWD 3CVHL 4C4KO 2YPLD 3QFJA 4FQXA 4YNYA 3QIBD 3VA2C 1U8PB 3QEQA 2AJVH 3U0WL 2FJHB 4NUGL 4UOW1 2FHBA 1PYWA 2G5BA 3WCYA 1JGDB 3F7VB 3MV7E 1TZIA 3QPQD 5FCSH 1P7QB 4IIQC 2DLIA 4JM2B 3B9EA 2GJZA 5J57B 3GBNH 3UBXG 2XZQL 1LP9E 3LN5B 3CVIH 1INDH 1YN6A 2EDYA 4GH7B 4PV8B 5BZDA 1CLYH 1UGNA 4RIRB 4RWYH 3U1SL 1S9YA 5B3NA 3V79C 2I5YL 1IKFH 1ZHNB 2PYED 3K2MC 4NN6C 3T8XB 3NOIA 1PZUB 3X13A 1WGOA 2ED8A 4JANB 5DRZB 1OTUD 2O61A 4QEGA 3V4PH 1KC5L 1FH5L 2BNQA 4YGVA 2X2YA 2P24B 5SWSD 3QNXA 3S3SA 4FQCH 4XB7A 3IXAA 4P5KB 5I74B 5L6YH 5MENA 4LCCB 4Y4KD 2XRAH 5FYJU 2FL5A 3W39A 5K9OB 1G7MA 1VFAB 1FBIL 2Z35A 3I02B 3LRSA 1S7WB 3A6OA 3C60D 1ZHKA 1MLBB 1W8OA 4JPKH 2A6JA 1KJ2L 4PBWD 4YPGB 1XZ0B 3C5JA 1LO3L 3ARFD 1YYML 5BS0D 1ZT1B 2BVQB 2UWEA 5BVPL 3BI9X 3EJYD 3MXWH 3QI9B 3BH8A 1E28A 1OGTB 2W9EH 3MACL 1MHEA 2HLAB 1HQ4A 1CQYA 5LXGL 3DIFA 1RJLB 2WINB 1I8KB 3TA3C 1PD6A 2P44B 1T0NB 3R06B 4RISH 4NHUE 2J1KA 1CICC 3EDKA 1U8KA 1GHFL 5DVMA 1NFIA 4L8BA 1QVOA 1S9XA 1XIWD 4CVXB 5C08E 5IJVA 1S78C 1MCNA 4HCRL 4MJ4A 5BVJA 3ZE0F 1YECL 3FB6A 4JPWH 4Q2ZA 3KPSA 4CU8A 1JCKA 3T3ME 4U6XB 1RJYA 3D2UB 1U58B 5GRYA 2JJUA 4YK4B 4TNVF 2QHRH 1MAMH 1ZHBA 5K9QI 2Q8AL 1NCAL 4X7TB 5ALCL 1C16B 4O2CB 1MHPL 5F71A 1MFNA 5FCUH 1CT8B 3SDYL 3UX9B 1F2XK 4MLIA 3T4YA 4XBGA 3B2VL 3RWIA 3HC3H 4GO6B 4HIJB 1DVFD 1LDPH 2CIIB 3TZVA 4P2QB 3FN0L 4X83A 3MRBB 2AV7A 3GUTB 1T21A 1GIGL 4QRTB 3L3OA 4OUUA 2GJ6B 4WWKD 2ZG1A 1RFDH 2Y5EA 3QWRD 5D1ZB 4MD5A 3N1FC 3ZTNL 3O0RL 3MGTB 1B3JA 2FSEA 2LFGA 3I85A 4PBXA 3PDOA 4LDEB 5ICZB 3D0VA 4GRLC 4U1LB 3W9EB 1MNUH 3AS1A 3CNKA 3Q5TA 4XBEL 2XT1B 5EH1A 4OCYL 1T1WB 3SBWC 2Y07L 2YRZA 4KI5D 2R2CA 3RKDD 5F9WC 3MV7B 3EOAB 4L4VA 3LH2L 5HGHA 3X17A 2GSGA 3K2UH 4OQTA 2V2TB 1F58L 3QT2A 1FNLA 1LP9B 3O3BA 4PGCA 4GAFB 1GH7A 4NQEA 5KOVC 5JPMB 3AMLA 4HWUA 3O9WB 1R24B 4XI5C 3MV8D 2MCPL 4AK1A 15C8H 2X41A 1LO4L 4H1LB 1ZS8B 1XMWA 3ULUC 1K4DB 4QXWA 4OBSA 1L9MA 4DZBA 3U0PA 2CK2A 1YYLL 2XXMB 1GGUA 1Q1JH 1FJ1B 3KYKL 5ACZA 1UWEL 3RVTC 5INCB 4RGOH 1B0GB 1FYTA 4ESKA 1HILB 3I3EA 4Y19A 1QA9B 3HE7C 5MI0B 1GGCL 1N7ML 4F7MB 5DJAB 4APQB 4XGZA 3SKOB 2WANA 1X5IA 2Q76B 3RPIA 2IFFH 2O26U 3VFWA 1IRAY 5D5ME 3FFDA 3KPRE 4UBDC 2FJGB 4ZTPH 1JV5A 3OKEA 4ZAKD 4LFHG 3RTQD 2C4FU 4PLNC 1CDYA 4L5FH 4P2RE 4X6DE 1MFDL 4WW1B 2M1KA 4IHOB 4UDTB 5CSBA 3BPOB 1FAIL 1U95B 1X5KA 3RDTA 3IFLL 3SGEH 4H0IA 4YJZL 1EUUA 4HHAA 5F8RC 4D9RE 4Y1AE 2BMKA 3G5XB 4Z7OE 1EO7A 4I2XE 1PJ9A 1UZ8A 4S1QH 5BMFL 1RUQH 2J6EA 2HJKA 4JLRA 4NHUB 3UAJD 4LEXL 2X10A 3FQTA 3F5WA 4GW4B 4X6FA 2DBLL 3PGFH 5A2IH 5C08B 4HXAH 2X70B 5DQ9A 3KWWB 5HYSG 4LEOB 2R2HA 5D70L 3OXSA 1CWVA 3U7YH 2BSSA 1RZ8A 1S7RA 2P5EA 3WD5H 4PTUA 4WCYL 5TF1H 1JWUB 1I85A 4P5MB 5FAAA 4ODTH 3ROLA 4YEEA 3OX8A 4ZFOB 4KQ3H 1RURH 2MPAH 1NQBA 4KJPD 4AY0A 3ARVA 1C5CH 4ZUSA 1SQ2N 4YXHL 3IFOA 1JYVA 1D5MB 2PXYC 5HHVH 4ZOCA 3ORJA 3D3VE 5DLMH 3IDGB 2VOTA 2VR4A 1QPXA 1MI5B 1CXIA 1F00I 1QR1B 1V7ML 5BS0E 3P73A 1PG7L 5CZVH 2DKUA 3DGGA 4F33A 5EA0H 3X3GH 2PF6A 1IT9L 2NXYD 3GMQA 5IK3B 4FQHA 5FUZL 1DQMH 4YHML 2HJLA 2NTFA 2XQBL 5TE7L 2FX9H 1AGBB 3ARED 3M07A 3GSNH 4MQTB 2YUWA 5J8OA 2GQHA 4WVRA 4MS8C 4R0LB 4AH2B 2X4TB 3FTGA 4TVPH 1IGIH 1NAMA 4HKJB 5C0JB 3PWJA 2NNAB 1F4WH 5ESQA 4I0KA 2IBGA 1UKTA 4NCC1 1RPQA 4EN3A 2I26N 1ORQB 3EYQD 3VXMD 1T6WA 3GMNA 2AJUL 4J4PA 4PJ8A 4AIZB 5HGAA 4YH6A 4G8GB 1QOKA 1AKJD 4JFQA 3CX2A 5IEHB 4K3DL 1HXYB 3VGAC 3MLVH 3VGBA 1CK0H 1NBZA 3C2AH 3O6FB 5IB5A 3HE6C 2VXQH 2ZSWB 4X6EB 2AVGA 2NY2D 4ONHA 2VWEC 3VH8B 4D9QD 5K9JL 1FG9C 5J6GB 1MVFA 1A6VH 1M7XA 4YDVA 4HK0B 3MRLB 4H5SB 2E8YA 4HUXB 1BLNA 2KL6A 1N3NB 4LSRL 5A2LH 3U46A 1BREA 1FLRH 1C5DB 2DQCL 1UACL 5HI4C 1NSNH 1YNKL 2ICWA 4YDKH 5D5MB 4X4YA 5HHPA 3WHE1 2OL3B 3JV4B 3DUSB 4Y4FB 5T3XD 1TPXC 4HDIB 5HI3D 4OI7A 4QRPE 4MA3B 3D85D 1MJJB 3IAPA 2VQUA 1O7SA 3Q6FB 4P2RB 4OGAC 4X6DB 1G7IA 2X05A 1ACZA 1IC4H 2MMXA 2V7HB 3GI8L 3MLTB 3UJIL 2YA1A 5I1IL 1EGJH 1YNTB 4Y1AB 2D7TL 2HVKA 4U7MA 3H3PH 4KI5E 5CD3B 4LP4A 3RY5A 4OQTL 5D4QA 4LHUD 2W0FB 1HNFA 1QSVA 4Q74A 2DIBA 2PTTA 1G0DA 1NBVH 2PW2B 1IGML 5F7NC 1F6FB 2JK5A 3BPLC 1K4CA 3H3BC 3TNMB 2IMNA 5DJ8A 4XHJD 3CSGA 3BFOA 3MYJA 4B0MM 4LVOB 4UQ3A 3MV8E 1AGFA 5DJDA 3KJ4B 3ME0A 5EU6D 3UTTD 4G42A 3FT2A 2EDRA 3HRZA 3LEYH 1T0MA 2VAAB 4XXCC 3WN5B 4XP6L 1R3IL 4QHKI 3MRPA 5JW3H 3PDDA 1FVDA 1UXWB 3DX8A 4FQJL 5B38G 3F7YB 1IEAB 1S3KH 3ARTA 2C7UB 4FHBD 3REVB 3ARDA 4N8VG 1TETH 3SKJL 4X5XB 5I1HL 2VR9A 4FN0A 2Z4QA 2J88H 4E41D 1CXEA 2YUZA 2L0DA 5DD3H 1HHIA 1KT2A 1ROWA 4Z95H 5EOQH 4OLVH 5F9DC 1KTDB 4FXGA 4UV4L 4JZJA 3HFML 4OB5L 1CLOL 3D3VB 2Q8BL 4H8WH 4ZQKA 5DUBA 2E9BA 4LSTH 3UXFA 4Z0XB 3VD9A 4Y5XB 2QSCL 3S7GA 4EQ2A 5BJTA 5F1SA 2EYSA 1BGXH 4M1DL 4OCSH 4FZEL 1FVEB 2CRMA 5C0FA 1D9KC 4FG6C 1T7ZA 1JN6B 4JFED 2J6EL 4L3CB 1PFCA 4Y16B 2VRAA 5D72H 5C3TA 4QXUH 2B1AL 3MRFA 2AQ3A 4CN4A 5CKGA 4P9MH 2M26A 4L8SC 4LPXA 4D2NA 4QKXB 3SKUD 5T1LA 5SX5H 1OVZA 2V6HA 4OCMC 3MYZA 4LIQH 5LBSH 1R3LB 4F7TB 5DURB 5HHMA 2A83A 4NO2A 1KBGH 2VLKA 3QULB 4RX4D 4P9HL 1EHLH 3FB8A 4F57H 1ZTXH 1RJZA 3OJ2C 1YEHL 4PGEA 1OTSC 4Q0XL 4N68A 1LEGB 4IRJB 2EDTA 5C09D 3TA3D 3G5YA 3T77A 2VLRB 3PQYA 1HCVA 1GRWA 4CMHC 3AXLA 4I0PC 3VRLF 5DMKB 2YKLL 1RVFL 2C1OB 2IAND 1C7SA 3LOWA 1S9WB 4KUCF 1MPAL 1IGFH 4WU5A 1TZHB 5F1IA 2LU7A 2ZOLB 3SDDD 4QRPB 3PWNB 2VL5B 1T80A 1X9QA 4E0RB 5JOFA 1WFUA 3S34H 1MREH 5DWUH 4XCYA 3EZ8A 4NZDA 2AJ3B 4KHXL 2XA3A 3RJQB 4PD4J 5IW1B 2CDGA 2GSIA 3MJ7B 1EEYB 1A6AB 2R0LH 1FYHB 1NAML 5HYJD 1NGZA 4FQPA 2ITDA 5F44A 4XMLH 3C87A 5IKCA 4M62L 2ESVD 5EO0A 1KLUB 4XC1L 4PGBA 4PJ7F 1IC1A 3VGEA 2VIRA 3DURA 2WLYA 2C9AA 5CJ8A 2VE6B 1NC4A 2DTSA 2DIJA 5AZEL 1UM4L 4WEBH 3FQUB 3TEUA 4KUZH 1HIML 4OGYL 2KBGA 4QHNB 1FC2D 2B1HL 2XTJC 1HHGA 2ATPB 1LO2H 2WBJB 4TNWK 5GS2H 5J11C 5DK2B 5EUOA 4ZSOA 1XR9A 1HHHA 4F7PB 5ID1B 4QRRA 3C6LB 5FYLD 4OUOA 3C5ZC 3WIHH 5EO9A 3S96A 2EDWA 1P84J 2VC2H 3WNKA 5DC4B 4DW2L 1PGRB 2B4CH 1TQBB 3GO1H 1U93A 5E2UH 4RNRA 4K3JH 3SCMD 4OZ4A 5ENWA 3QRGH 5KSUA 2R0ZH 3MNVA 4YAQA 1NUGA 3LHPH 3MUY1 4JO2H 4ZFGH 4QRSA 5ADPH 1EEZA 4LQ1A 4U49A 4LRIA 1A3RH 2H26A 3BKJL 2FECL 3ULUD 1NGPL 1A7OH 4V1DD 1E4XI 4QTIL 2AP2A 1OAUL 2FB4L 3NAAH 1YEFL 4R2GB 4X80H 4OV5A 1QP1A 2NZ9C 5JIKA 3WUWG 1IGTB 4P99A 3VXSD 1B4JH 4B7LA 1XCQA 4R7DB 3S5LG 5F7HA 2R0WL 1MLCB 1FG2A 3D48R 1T5WA 4O58L 2J5LC 1DN2A 1S8DA 4UBDD 4TUJB 1AXTH 4GKZA 5IB3A 4P48A 5I76A 2ADGB 1HHJB 3IKCA 1PX4A 3OGCA 2A1WH 1HI6A 1FNEA 1BQHB 2N56A 5CEYA 3QUZA 3G6JF 4HKZA 4N9OB 3KHOA 1YUHA 2IQAB 4U7KA 5FYKE 1IC7L 2PNDA 3VXTA 3C6SA 3ARWA 4OSUH 4ORZC 3EFDL 4MA8H 3QIUD 2R29L 4YHPA 1EXUA 3NA9H 3DX7B 2XNAA 2EDXA 1OT2A 2P7TB 2LU3A 3IU4L 2IMMA 3ZYIA 2DLGA 2DTML 3NFNA 4HF5L 4BJLA 3CFDB 3LKPB 1T1YA 3D87B 3JTTB 1SBSL 1FPTH 2IJ0C 4UTBL 4HLZG 2A6DB 4PYHA 4OZHF 5IEKA 2EDQA 3P4OA 3BP5A 2E5EA 3PUCA 3D25B 1WCQA 4Z77A 1OF2A 1JZ5A 1N5YH 3TYGL 4KDTA 4NM8L 3E2HA 3TN0A 1FL3A 2CSPA 3CK0L 1VFBB 4LKXA 3U2SB 1MJ7L 1KLGB 1V3KA 1UH4A 2BNRD 2H32A 1LE5A 4EDWH 3BIBX 3TPKA 3MXVL 4DUXA 3NCEB 1RIHL 5MEOA 5CKAA 2IALB 1EUTA 3SQOH 1FDLH 1ODAA 5I16A 1GGTA 4L8DA 2F54D 4OM0L 1SJHB 4EQ3A 2PXYD 4UTAH 4O2EA 4FQ2L 4HXBH 1QLRB 5CHNB 1C08A 4FTVD 1MH5B 2ZG2A 4CNIB 5GGVH 3L3HB 5FUCC 2AXGA 2V7NA 4YBLB 3U9PL 2X1XR 1QFWI 2JE8A 4MS8D 4JRYD 4TN9A 3CDYA 4G6FB 3WO4C 1NMCB 2V9QA 5IMKA 5T1DH 1X4ZA 5IBUB 4OZIE 1IGYB 3UBXI 3KNBA 3P0YL 1F90H 4TUKL 2ICES 3S98A 1YMMA 4XCFL 2Y5TB 3DI3B 4OD3H 5JPNA 2W92A 2FNBA 1OSPL 1BQUA 4P59L 4HK3J 4F2MB 3MRMB 5A3ID 1JFQL 1T7VA 5E08H 5DI8A 1N6VA 1ZWIB 5BRZB 2PCPA 5CEXB 3I50H 2ORBH 3ZE1E 1ZAGA 1C1EH 5GIRB 4PJ5A 3AY4A 1B6UA 2AXFB 4WTXA 2DYPA 3DROB 4FQQA 4LLDA 4PY8I 1P2CB 2ESVE 3SGKC 5IVZB 4PRHE 2VXSL 2DI7A 1FO0A 2C1PA 4PRPA 1S7TB 4RRPA 1ONQA 4OGAD 5HPMB 5EB9A 4Z9KB 3V6OA 2FATL 2R1WB 3UYOD 4CVZB 3L9RA 4R6UA 2J12B 5H8DA 1BJ1H 5IT2L 4OD2B 1KB5B 1MF2H 2E6PA 1OPGL 1KFAL 4L4TD 4R97C 1A3QA 5HDOA 3QIWA 4PJCE 3I2CL 1Z3GL 4IIQB 1J5OL 1R5VB 1VENA 2IG2L 1ZA3A 4WI5A 1D5ZB 2VL4A 3GJEB 5GS1C 5HHXL 2CQVA 4NN6B 2BVUA 4N0UB 3T8XA 3IDMA 3PHSA 4PREB 4S1RL 4PB0H 3W11C 5DQDL 3ULUE 3QH3B 4D0DB 4BA8A 1KCVL 2DQHL 4V1DE 1FZKB 3ALXA 3ARGB 1RHHA 4H1LG 4XNXH 1GSMA 3ECBB 1DCLA 4N0CC 2VLLB 2YD4A 4Z7UF 1FV1A 3GSOA 1A7NH 2OQJB 2Z8SA 5DUPH 4AG4L 1YEKH 5GS3A 1NL0H 4H26A 2F8XC 3O45B 4KK8C 4ETQB 4XHQA 4HIXL 1CGYA 4LF3A 1FGNH 1S7WA 4WW2A 2I9TA 4JG0H 5BOPA 2OK0H 3PJSB 4M6OL 1T03H 3GSUB 3FO1B 2HKHH 1SVCP 1KIQB 2DICA 3ARSA 4OFYD 3PWUA 1NCNA 1BWWA 1KJVA 5DRXB 2FYYB 3VRLE 5IQ9A 3E8UH 3CCHA 4NNXA 1A64A 4JDVA 4MJIE 1PZ5B 3IS1X 3M45A 3CXHJ 4PRNA 4GQ9L 4P23D 1IAMA 3U79A 3VD7A 1EJOL 2DL9A 3NTCL 1UKQA 1CICB 1CZ8H 4P3CL 2BK8A 2HTLD 1W0VA 3TVMD 4YFEA 1UH2A 2VDNH 2HFTA 3FOLB 2JCCA 1NH6A 1U0QA 1IM9B 3SKMA 3X14B 4K8RH 1QBML 4BQ6A 3UO1H 1I9JL 2WWMD 2YRPA 5EORH 3BGFB 3S97C 2Y1VA 3QQ4B 1GZPA 3C8KB 3QXVA 3BD3A 3NIGE 2VYRE 2J4WH 3FRPG 2P5WD 3G5VB 4KK5C 3Q1SH 4ODWB 4LMQE 5FKPB 4GSDL 1CT8A 3T2NH 3K8LA 4PRHB 5EOTB 3BAEL 4QXTB 3NABL 1OP9A 4O5LH 4YFLI 5LQBH 4M5YL 1CFVH 1U41A 4JR9L 3H7BA 2GJ6A 3P0GB 1K85A 1Q9LA 3N06B 5E4IA 4YO0A 3RIFK 3Q5OA 2CD0A 4EI5B 1U3ZA 5JIIA 1CDGA 4GRLB 3KPLA 5JW4Q 5E1AB 4Z8FL 1L8JA 2D03H 4M7LH 1SM3L 1GGIH 3X3FL 1I8IA 4MLSA 6FABL 2AK4D 2FIKB 4JHWL 1T1WA 4NN7B 4OF6A 3GHEH 4YHNA 3RHWF 3EJZC 4OKVB 5IMLB 1BVLB 2COQA 1ULVA 1U8OB 4HW6A 3UZVB 4ZXBC 4HWBA 5D7JC 1YDPA 1UWXK 1LP9A 4OBRA 2NY5C 3LPGA 1KLFA 2ATKB 1JYNA 4WO4A 1WK0A 3MCLL 1LHZA 2X4PA 1V7NH 2R56H 1HXMA 1R24A 1YPZF 1UM6H 2XTJD 1B2WH 1RULH 3K46A 1ZS8A 2OLDA 4G6ML 2HMIC 1JZ7A 3WEXB 2VWEE 4WWID 4YE4L 3AAZB 3DSNA 2VDPH 1G9MC 5HGBB 3BRGC 1RK0B 3QNYB 5TQ2L 1B0GA 3LKRA 2Y06H 1N8ZB 3HE7B 5H2BB 5F8QC 5T3XH 3C5ZD 1MUJB 4S1SL 3L3KA 3BN9C 1U91B 3G6DH 3ARXA 1QSFD 3QHFL 5I1AB 1JWMB 3CZFA 1FO0L 3SKOA 2VLJA 4Q9QL 5I8EB 2P8MB 2YS4A 4OF7A 3GSRA 5J6HA 1N6QH 5FM4A 2EC9T 2I07A 4BQ8A 4LCIH 1PEZA 4JQIH 3MFFB 2GTZA 3QEHB 5B8CC 3C08L 4AEHL 4DWHA 1WICA 3DHMA 4IHOA 4ZUUB 1JRHL 1OAXH 4KZEH 3T65B 1UA6L 2IGFH 3OQ3B 3MLZH 4MJIB 2GI7A 3HB3C 3VMOA 5BOZG 5C1MB 2WIIB 2NW2B 4GW5A 5DRWB 4PJXA 3CAFA 1TVBA 1I1YB 3ES6A 3BEVA 3RGVC 4YHIB 1I7UB 5F6HI 2EE6A 3QJFB 3QDHA 1EEQA 3H9HA 1F4YL 5HHOB 3IJHB 4NO0B 3MA7B 2CMRL 4ZS7L 3RWHA 1SY6H 5C08A 4LKCA 5GS0L 5T1KB 1T22A 3LVEA 3VE0B 3VWKC 2DKMA 3EYFA 1X5GA 1BHGA 1LQVA 2OP4H 4L1HA 4AM0B 1ZV5A 6CGTA 2C4XA 2AEPH 4M61A 2F15A 3V0WH 4MXQC 4PJ7B 1MFAL 3S36H 5IB4A 1JWSA 3S88H 1QNZH 5DFTA 2AEQH 1N59A 2EYTA 1AQDB 4ZFOA 4RSVA 4M6MH 4XP5L 2EDHA 5KSAD 1FFOA 4R26L 4UIKL 2BY1A 4OLWH 4ZPTB 4XPHH 5FHAL 4ODUB 5A40E 1KF9B 1DJSA 5KVDL 3S6CA 4NBZB 1DLFH 4HIIA 5CWSB 3DBXA 3U4BL 5IM7B 4WTZA 3RGHA 3FQNB 3OZ9H 3H7LA 3WNLA 3LKQA 4EI6A 3VG0L 2B7DT 2GEEA 1IQDA 4K3EL 5JW4R 1AGBA 4GW1B 2ZUQC 3OXRB 3BPNB 4P46C 4BZ1H 4RFNB 3TO4C 3JXAA 3WIIH 2X6MA 4UILH 2BJML 3MRRB 3OKDB 1CTOA 4JRXD 2OJZL 3S36X 4YC2B 5GJTL 4ZO8A 1MEXH 4KHTH 1HOCB 1DFBL 3GSNB 3NCYS 3UMTA 5IMMB 3VGAB 4TTDC 2OI9C 3HE6B 4DVRH 5IW6B 4NZRH 4H88L 4PJEE 1V8HA 32C2B 5ESVA 5M94B 3FQRB 5E8OB 5I1JH 5J6GA 3BH9B 3UTPE 3V5HB 3LY6A 1E4XH 4YR6B 4G8IA 4HUXA 3LV3B 1FNGB 1S7QB 3QG7H 4OD1L 5JW5A 1U8LA 3RNQB 1CU4H 3G6JB 3TBSB 1DDHA 1Q72L 3L7EB 4EIZC 2L4OA 3KPRA 1TPXB 4TUOB 4X7FC 4Y4FA 3DUSA 3GGWA 1A1MB 3IYLW 1OCWH 1KN2H 3MR9B 4ONGL 5I19H 1XGPB 1A7QL 4ONOA 3SE4C 3IDUA 4QXGH 1MVUA 1ZHLA 4RA0C 1DANT 2FBJH 2VXVL 5K59E 2PO6B 3V6ZB 4M48H 1F02I 4W6WB 1J18A 3B2UC 2AK4E 3CZJA 3QIBA 1AHWC 4PJAF 4I2XA 3SGJC 1QYGL 5CD3A 3QFDB 2DN7A 4PJDF 4RAVB 4HWBL 5EUKA 3PWVA 4OZHB 1ETZB 1X5HA 2BDNH 3BPCB 3BPLB 4N9GB 3ARQA 2R2EA 3A6BH 4X9HA 4HIEB 3P9LB 1CE6B 2PYEA 4Z7UE 3GMOA 1CL7I 3UTOA 2XTJE 3OKMA 2WUBH 4YBHA 2AABH 5FYLH 1MIMH 4Y8AA 4Q9RH 3WN5A 5C3LD 5F1OB 1MHCA 1UXWA 2I24N 5DHVA 1J8KA 4GFTB 4PJ9C 4LPYA 3F7YA 4Y4KA 1CG9B 2EH7L 2FR4A 5F7EL 2EKJA 5IG7A 2AJXL 5D93C 1BFOA 5GJSL 3OHXB 1SVZA 3RFZC 4YBQC 2OTPA 3O6LH 4JO3H 5A16A 2HRPL 5AWNL 4GG8B 4I77H 1UJ3B 4XPFL 5GGUA 1P5UA 4PJFF 2HG5B 3R0MA 4PJBF 4MXWH 2BHZA 3ARFA 4ERSL 5BS0A 3W11D 1XT5A 2VLMD 1S5IL 1H3PH 5C0AE 1IAOB 1T83A 4N8CL 3MCKA 4HIHA 1M7IB 1RUPL 1U6AL 3P0VL 4L3CA 1KCSH 4C56D 1INEL 5KW9L 1KIPA 1CBVH 3PWPD 1IC5L 1QFWM 3RP1A 2Y9RT 4UT9L 4XVJH 5H35B 2NZIA 1I8MA 2HAZA 1XIWA 3O3UN 4RAUB 4ALAH 1HH9B 1WF5A 3MC0A 3LKSA 3NCYP 5CINH 5ESAB 1FZMB 1WITA 1X5XA 5CGMA 1MWAH 2OM5A 3ROOB 3N9GH 4W68A 1I75A 1KELH 4ZMAT 5MP6L 2DQJH 1DSFH 1B9ZA 3P30H 1DP0A 4QHUA 1EFQA 4N0FB 5AUMB 4XVTL 4ZFOL 5DK0A 4IRJA 2V5YA 35C8H 3I6KB 3QWOA 3QXUA 3QCVL 3HZMA 4XNUH 4MCZA 4RMUA 4XZUB 4WENB 5B39A 5DMKA 2UY7A 5AYUH 2EIZB 2JLLA 1VFMA 1U8IA 2X4SB 5FGBC 1A7PL 1S9WA 1DVFA 1P7KA 3R8BB 2YSSB 1WEJH 4WWKA 1FE8L 1Q9OA 1CDBA 3QWRA 4KDVA 3JTSB 3BP6B 4DTGH 4GAJH 4O02L 2DI9A 4C4KT 2XZCH 4EOWH 1BAFH 4HG4J 1CFQA 1JGEA 4KK5D 4UT7L 1DBJL 3MV11 5D7IF 4OM1H 5K93A 1KPUA 1BBDL 3QAZC 4QY8B 3RJDA 3DSFL 4PFEA 4ZUWA 4LCUA 5MHSE 2D9CA 3UJTH 1A6UH 2DIAA 2DJSA 4OTXL 4RBPK 5ALBL 3B4NA 5JTWA 4ODSH 3NN8A 1GOFA 4OLYH 4O4YH 4HBCL 4BH7B 2R39A 4OIBA 4MGXA 1CFNB 5DS8A 4Z7UB 5AD0B 3WXWL 4ENED 3MV8A 2ZUTA 1IVLA 1QRKA 3MUZ1 5FUCE 4NFBA 3T1WA 1KPVB 3WS6C 5EBLA 5FB8B 5ECJE 2E3VA 3W0WE 2VDOL 5C07E 4ZDHA 2NY6C 3C6LA 3EJZD 3HG1E 1OARL 1Z0MA 4AEEA 3FO0H 2I9LA 1EO8H 4KVCH 5IHBA 5IBUG 1UM5L 1A6WH 4POYA 5FO8A 3G9VA 4F3FB 4ZAKA 1A3LH 4I3RL 3RTQA 1J1XL 4UI2A 4U2ZA 5CLWA 3O6ML 4YZFF 2MFNA 1VCAA 4WV1B 2DF3A 3FCTA 3FKUS 4L3EB 5C0AB 4KRMB 4MZ2A 4S1DD 4MZ3A 4JN2B 3R1GH 1JF5A 2OR9H 3TPUB 3QYCA 1RZKL 4LLWA 4G9FD 5E6IB 1D6VH 3FL7A 4KROC 3PP3H 3QUXB 4UOJA 1IGTA 1NGXB 5I1CL 3BN9D 4LVHB 4OLXL 2HH0H 1NBYB 4A6YH 2J5LB 4IOFC 3C8HA 5HDBF 3V4UL 3VXUD 5HHQB 4PJAA 4XH2B 2DM3A 2IPKA 2OSLA 3MJ8B 1A9BB 3BKCH 3JWOL 3MROA 1QO3B 4FXKA 4PIRF 3LEVL 1TTFA 4PUBH 3AC0A 4BKLA 1F2QA 1IAIL 3T08A 2EXYC 4OCRL 4DN3L 4X9GA 3H0TB 3LPFA 3HB3D 5DA4A 4KK9C 4HFWB 1MRFH 1JGVL 3QG6B 4PGDA 5LGJB 3RGVD 3WIFB 1PY4A 3VFNB 4ISVB 4ZD3L 1Y6MR 3CUPA 3RY6A 4GAGL 3NFSL 4HJGA 3ZSTA 2HWZH 2JELH 4JFHE 2NXZD 3UC0H 5JUEH 1M6OB 3VGHA 3VRJA 1A14L 3CSBA 4PY7B 3JWDC 3QEUB 4QRQB 3A67L 2BY3A 2QR0B 1NCCL 4F37K 4MCYB 3VFOB 1OGAB 4LDLB 3HMWL 3TV3H 4MNGB 3GMLA 3NCJL 4MQXD 3MUHL 3FOMB 4DN4H 1HH6B 3AREA 1XGRA 5L0QC 3CFBB 4X5LA 2W9LA 2Q86B 4GBXB 4FQLL 5SWSB 1N0XH 2RR3A 1YPZB 1BJ1J 2NY1C 1SJHA 3H3KA 2XN9D 4HULB 3BJLA 1TJIH 4IRZH 3VXMA 1FVCA 2BVPB 2O5ZL 1RZIA 3VFTB 1AKJA 1HNGA 4X7SL 1TJGL 4GRMB 3C60B 1DEEA 1SYSB 3MLUH 5DJ6B 4QWWC 3I9GH 1MH5A 2CO7B 3MOBH 3HS0B 1SEBB 4TNVK 3PDGA 3SJVD 4NSKB 4P5TD 4DZ8A 5C0EB 1CFTB 1S5HA 3W0WB 5IB2A 1OAQL 5C07B 3C8DA 4YHZL 1Q9KB 3HG1B 1RIVL 2LQRA 3LMJH 4X0KB 1R5IA 1TZGL 1Q0YL 4KAQL 4XMKL 5FA4A 3TO4D 4MDIB 1GYAA 4PD4K 1F3DH 4HFUL 3L1OH 5CZKA 5F7DB 1OAZL 4PV9A 4Y2DC 1I3RB 2YD1A 1OP5K 4OGXL 2RJMA 3PGDB 3CSYA 1NMBL 4HWEL 1FORL 1IEBA 4PJDE 4TTDD 1CDCA 3MRMA 1Z9MA 4NWUH 5D9SB 1Y18B 4L9DA 1NFKA 1TTGA 5TE6L 5I30L 4I3SL 1ZWIA 2DWEA 4RMWA 4G6JL 4B53A 3HUJA 1A21A 2AXFA 1ZLVK 3DROA 4MNHA 3QCUL 4LHUA 4B7IA 4AQOA 5A2FA 5IVZA 1BFVH 4GKSB 3HC0A 2YD2A 1KXVC 1I9RL 2VTFA 1QKZL 4UV7L 1BD2E 1L9NA 3GIZL 3BGMB 2XWBA 4OZFA 3OB0H 4YHOL 5HPMA 1P84K 2OTUA 4L8CB 2WV3A 1T5XB 3S8WA 1Z5LA 5EU6A 2AI0H 3STLA 1WWWX 3IB4A 1ITBB 5SWQA 1CGTA 4OD2A 1K2DA 3ARBB 1CXLA 2H1PH 5E70A 5CBAA 2F53E 4KQ4L 1WBYB 1FSKC 1E27A 4R96A 3KPTA 3MNWB 3SO3C 4IIQA 1DBBH 2D4FA 5HYQB 1R5VA 3BHBB 1D5ZA 1UVQA 3GSWA 4LSPL 4OLUL 5GS1B 1IGJA 1LK3H 3GJEA 2DLFH 5J1TC 2BP3A 3ZKMC 1RJCA 1N4XL 2VQTA 2NW3A 4UNVA 1D5BB 1Y0LB 1KTLB 4LLUB 1N5AB 3MUGA 3KPMB 4LHJB 1FZKA 4XPAL 4HX1A 4RWHA 3GK8L 2W65B 4G9FE 4PJ9D 4JM4H 4TQEH 3MLYH 2X4NA 1QEWA 5I73C 1BP3B 1ZANL 3VW3H 3EYSH 3T0DA 1NC2D 4D94A 1KCLA 4R4NC 5HBBA 1AY1L 3CLEL 3UROR 3VXUE 1PKQE 5C0IA 3REWA 1XGYL 3MRCB 3GSUA 1A0QH 2DQUH 4WFGE 5KJRH 2FX8H 1F3RB 4HUVB 4K23H 3BN3B 3BP7A 4WHYG 1OP3K 4QHKJ 2FYYA 4PJIF 4RX4A 5EU3A 4DQOH 1S7UB 3GJFH 5IR1B 3HZYB 3DX6B 2CIKA 2QQKH 4K9EL 5L2KE 3QO0B 2ARJQ 3CU7A 3DVNA 3MFGB 2WZPD 3DUUB 3FONB 2N4IA 5C09A 3TA3A 4MDJB 3KVQA 1VKXA 3LQAC 3EO0B 2AGJH 3L5XL 5HSFA 2IANA 3BUYB 2VZTA 4OZIA 4JG1L 5T5FL 4LSUH 1QLEL 2DQEH 5CJQH 5I8OL 1RMFH 1J1PL 5IMOB 3QDME 3OMZA 3INUL 5C7XL 5D7IE 5LGHH 2FH8A 4WUUE 4XVSH 1FL5B 5KVMC 4PJDB 1FFPA 3CU1A 3C8KA 1J9CT 2Z8RA 2OTWA 4M6NH 4ZS6C 1O0VA 4GUPA 3QB7C 3HI5L 3D1MC 5DRNA 3GNML 3WFEL 4ZOEA 5HYJA 2APBA 2FHFA 2BFVL 4U6HA 2VDMH 3QDGD 2HLFD 1ES0A 2ESVA 5CAYB 2O5YH 3GMPA 2CDFB 2ILLA 1BD2B 4JFXA 3WMSA 1JMXA 3VXRD 1IMHC 1JPSH 1L4IA 1D5XA 1JK8B 1AI1H 3IFPB 3BEWB 5JZ7C 4GRLA 5SX4I 4XP9H 2DQIL 2DKSA 4IM8A 5DD5H 5CIPH 4XB8A 4CL7A 2XWJA 3F58L 2F53B 3BXNB 4JGMA 3SBWA 3BE1H 1KENL 1NFDE 2NY3B 3E0GA 5ITBL 4PJFB 4PJBB 1EFXD 3VGGA 1IM3B 1XF4A 1XF3B 2YK1H 4PJCA 1G7PB 4EBQL 5ITFA 4X7DC 4ZXBB 2VZSA 4K71C 1JNHA 3Q6GL 5D7JB 3WXVL 4Z78B 5KBNC 4PR5B 2RCSL 3V7AG 5F3HA 3MREB 1KEGL 4I9WD 4R90H 4C83A 4YFLF 2I60H 1I1AB 4WI2A 5DZLA 4AYFA 3T4AB 1NEZA 3CFEB 3L6FB 4QCIB 1S7XB 4MXVE 4V1DA 3WEXA 3WS3A 3WNOA 1DQDL 3TNNB 3ISWA 3NCFB 2QQNL 2EYRA 3RVUC 3LN9A 3TIEB 1JGUH 3QNYA 2NY6D 5E2VL 1UB5A 1X5AA 3AUVA 5JOEA 4R7NB 4XCCL 2IEPA 4P4KB 5I1AA 4D9LH 4RDQF 4KKLC 4V2BA 4AQ1B 1RUKH 3L3IA 1PKQB 3QZWB 1L0QA 4UUJB 2ZCKH 2Y4SA 5DFWH 4LVNC 5GRJL 5F21B 2P5ED 1FHGA 2DLHA 5E9DD 4RMTA 4M3KB 5EBGA 1KULA 4HPOH 4FFEX 3QEHA 3VWJC 5E8NB 5BV7H 3WNNA 3H9SD 1LK2A 4OJFL 1X4YA 5GGRB 5FYKL 5CGYC 3SPVA 5L2KB 3MJ6A 4MJIA 3PG2A 3GSVA 3KPOA 3UPAA 1J87A 3E3QC 4LBEB 4KROD 4OCWH 3JUZA 1RUAH 1I1YA 2DM4A 2RIKA 4YHIA 3DXAE 4RMQA 5IFAH 5FHBH 4NDMB 4Z0BL 2X4OB 3IJHA 4WJ5B 3MOQA 3MA7A 4FZ8L 5CUSL 3P4MB 1OW0C 1I3VA 3QDMB 1HZHL 5DTFB 1TMCA 1B0RA 2Z31C 1AGDB 3VWKB 1AGCA 3M17B 3UTQB 1OAKH 5D7IB 3O4OB 4WUUB 5GZOC 1DUYB 2VXTL 5DD6B 4AM0A 3HCVB 4ZNCD 1DTUA 1FGVH 2EXYD 4KC3B 2PTUA 4KK9D 5HHNB 2K7PA 4KMQA 4G7YH 4Q6IB 3BP4B 4GXVL 4UDUB 4Z7WF 2FEDC 4GXUN 2MKWA 3V8CA 4NZTL 2BNRA 4LAQH 5D6DC 1YMHB 2JB6B 3VI3F 5EOCH 4PJ8D 4BYHA 3GRWA 4NYLB 4DKEH 4JB9H 2YZ1A 4RZCA 4WHCA 2F54A 3F6IA 4X6BB 1YQVL 5SWZD 5FYJD 3CXHK 3DETC 4HT1H 2PXYA 4TSCH 3HZKA 4JQXA 2J3SA 4XWOD 3K1KC 3A0OA 1GGBH 2WUCH 4HV8B 4PPTA 4ORGB 2CXGA 5GGSA 3EKCA 4JPKL 3DYOA 4HEPG 4NWTH 4LLQB 1M7DA 4GXUM 4JZNB 1NFDB 4KPHH 4P46B 4HWZB 5CEZH 4PJIA 1WCBB 3O4LB 4YDJA 4MS8A 4X5WB 4DGYL 1QRNE 3AS0A 1KXTB 3BD5A 5GISL 1ND0A 5C0RH 5I1KL 4TSBL 4OI9A 1F6AB 1TJHL 4WFEE 1WBZB 3L3DA 3WFDL 3IF1A 1GAFH 5GRUL 3HMXH 4Y5VC 1EDQA 3OB8A 1FRGL 4NP4H 1CXHA 3C5SB 2IADA 1JTOA 4QWWD 2Q7NA 2OI9B 2W0KA 4HLZH 3BW9A 1JZ3A 5GGQH 1T2QL 4DAGL 1I7RB 3IFNL 1AH1A 4JM2C 5F9OH 3PL6B 3PWLA 1Z9LA 1U3YA 4JGJA 3K74B 3OAYH 1FNGA 1EIBA 1KCRH 2R1YB 2VDRL 2VDKL 3D9AH 5EN2B 1A7RH 2CLRB 4WY7L 1INQB 1M4KA 3WUZA 3CVHH 2P46B 1OHQA 2IAMB 3UZQA 3CPLB 3MR9A 4HMEA 3O3AA 2G2RB 1VADB 4NM4L 3CLFL 4NUGH 2NQCA 3WLBA 3EFFA 4LLVB 4XCEA 1KTKE 3MRQB 3V6ZA 4LCCC 4JY4B 3HPLB 1MCEA 1DQLL 4YDIL 1VGKA 2XZQH 3UTZA 4XTRC 5DT1L 4L4TA 3ZZ1A 3RWEB 3U1SH 2GUOB 4FOMA 2Q7YB 3DXAB 4RAVA 1FQ9C 1TVHB 2I5YH 1EAPB 3ZDYF 1V05A 4WGVB 2B5IC 2F58L 1QSEB 2H8PB 4GRWH 2PR4L 2X4RA 4N9GA 3FO9A 4FMFA 1KC5H 1FH5H 5TDOA 2VUYA 4I9WE 3P9LA 1AFVL 1CE6A 1V3LA 3DVGB 3QI9C 5HYIA 3ULUL 5TGBB 1XAUA 4NPYA 4U1SB 4QOKE 25C8L 4XXCA 1FBIH 2BY0A 2D7OA 1F5WA 1P5VA 4PY8J 5FKAB 4PJHF 4LARL 4QHMA 3VJ6B 2JKXA 3TLRA 1KJ2H 5D93B 1LO3H 3WHXA 2FECI 1YYMH 4W6YB 4WTZG 4F7EB 1FIGL 5BVPH 4GG8A 3MACH 2FD6L 3L95B 2HG5A 2VLKD 4JAMB 5LXGH 4OFYA 4KJYB 1YQ2A 4YK4C 5E9DE 3O8XC 4CMMB 4EDXB 3JV6A 1SYVB 2X4QB 3H9SE 4NQCD 1AD0B 4OZGA 5K9KA 4WHTB 5TDPB 5IB1B 1UB6A 1D9KA 2RFXA 2WWKT 4J3UA 1GHFH 1YJDC 1GL4B 2NX5D 3OJDA 3MX0A 5L2JB 4HCRH 3QA3B 4ZFFB 3VXOB 1YECH 1U3HD 1QRNB 3QXAB 1RK1A 4L8SA 3GBMH 1JPTL 5TFSL 4HZAA 3TVMA 4LLAA 4F9LC 1CIDA 4S1QL 2Q8AH 1NCAH 5J9PB 5ALCH 3DX9A 2FZ3A 2ZOKA 4BFIB 5EFIB 1MHPH 1CD1A 3IJYB 3SDYH 3VDBA 1U92B 4PJEA 5AUMA 2F19L 3B2VH 2ZNXA 2P49B 1UQSB 2ADIA 4GG6E 3UEZA 4WRLA 1U8MB 3I6KA 5D2LF 2P5WA 5C0ND 3FN0H 1AD9A 3UBXB 1GIGH 3GRWL 4I0PA 5AG8A 4M1CC 3BQUB 4P3WA 1MWAB 2X7LA 1T1XB 3THML 3UDWC 2E7MA 3ZTNH 3O0RH 3RWGA 5EPMA 2PKDA 3B6SA 5KS9F 5HI5D 1R3HA 5FYJE 5EC1A 2BVOB 1R3KA 3O9WC 4ZFZA 2E9JA 4XBEH 4Y88A 4I4WB 4OCYH 5ISZB 3KPNB 2Y07H 3GMMB 5C0DA 1SJEB 3EJJX 3R8QA 1WAAA 1G1YA 3KXFE 1BM3L 5EIQA 4PRID 3LH2H 4PB9L 4ZS6D 1F6LL 3QQ9C 3NZ8A 2A6IA 1EMTH 1F58H 2AK4A 4POZC 5AEAA 5MI0C 2OX5A 2YUVA 2OZ4A 1R5WB 2HVJB 1J0JA 3S3PA 2DD8L 3MBED 3OR7A 2MCPH 1YN7A 1LO4H 3KYAA 2DQTL 2M8XA 1F4XL 4JHZA 4ZNEE 1NGYA 4D0BB 4U1KA 4FP8L 1YYLH 3LB6D 3BPOC 3KYKH 1MJUL 1UWEH 4FRWA 1OTTC 1UJTA 3ZL4L 1MCJA 4EZMA 5DMGC 4HUNB 4QOKB 1GGCH 1N7MH 2VH5L 3IU3B 1MY7A 4LPTA 3UTSB 4B5EA 5CP3H 3FAXA 1IE5A 3UPRB 1GC1C 3QUYC 2BC4B 1KNOB 3B8SA 1TCRB 1G9NC 4BSVB 1Q9WA 3C5ZA 4O2FA 3D69B 1QSFA 4JPIA 3VG9B 4CDHA 3B9KC 5I17B 2GCYB 3I6LD 1FAIH 5SX5K 1F11B 1AE6L 3IFLH 2XKNA 1DEDA 5EBMA 3ARYA 4MNQE 1HEZA 4NO3A 3AB0B 5TDNB 4Z7VF 3CJJA 5BMFH 4YDKL 4KGJA 1BZ7B 4U1GB 4LEXH 5DD0H 1ZEAL 4XWGL 2DBLH 3ILQC 1AXSA 3FT3A 3VGDA 5E8PA 1E6JL 2C3VB 2EDKA 3HC4L 3EDDA 2V2WB 2MCG1 5D70H 1OL0A 3FFCD 1IKNA 5TJWK 1A6ZA 4KKLD 4NKOA 2YD3A 1BX2B 3JSSA 5TQ0L 4MD0A 3O3DB 4MVBC 1Z9OA 4XH2A 5D1QB 1SEQL 43CAA 5B39G 4WCYH 3RVVD 1XF1A 1QACA 3S3JA 1XH3A 3QJHB 3VWJD 3T3PF 1QO3A 2HTKC 3V0VB 3P2TA 3VI3E 1F3DJ 4E5XB 4G8FB 4MJ2A 4GG6B 1OQOA 4NOFA 2BNUA 2F8OA 4YXHH 2UZXB 5LGJA 5IIEA 2FEEI 4G80B 5C9JA 3MO1B 3MV9D 4HAGA 1V7MH 5E2TL 1PG7H 4HH9B 3QRFM 2Y25A 2BX5A 1S7SB 3G04A 2AS5M 3SGDI 4LSVL 3ULSB 3GMRB 5D7LE 3RPKA 5FUZH 1L0YA 3V4VL 3O6FC 4YHMH 2XQBH 5TE7H 2FCBA 3P4LA 4JKKA 4I48B 3RWFA 2XG5A 3KXFB 5FUOL 2QR0A 1RZJC 5F6HJ 2HP4A 5DQJA 4OLVL 4BM7A 4C55A 1J8HD 2Z93A 5SX4H 2FEDD 3EGSA 5IQ7H 1I3UA 1JI2A 2AJUH 4X99B 5L0QB 4OF3A 4DKFL 2XPGB 1YMMD 3G08B 3MA9L 3QDJE 4GRWF 4WDIB 1FN4B 4K3DH 1ZGLB 2NY1B 3RUGE 1LEIA 2EDJA 1BVZA 4ELKA 2PW1B 4TULL 3QUMA 2B39A 4JFDB 2BVPA 1KIRB 4G7VL 3VFTA 5K9JH 5EU4B 5J06A 2YD6A 1YEJH 3D6GA 3WKML 3HAEA 4M02A 1ZT7A 4P9ML 1PG7X 5JQHC 4OFDA 4NKIL 3T0XA 1MAKA 3AU1A 4LSRH 2UZIL 2VJXA 2CLZB 2DQCH 1UACH 5DSCA 1YNKH 5F3BB 3W0WA 4H25A 3DWTA 4JE4B 5HYSB 3C9NA 5IESL 1T1ZA 4WU7B 5C0CE 4WNQB 3DARA 4F57L 4PJGE 2HJFB 1HWHB 1TENA 4FFVC 5D2LA 4Y2DB 4U33A 3VFPB 3GI8H 4HG4K 5E6YA 1E4JA 3UJIH 4LVOC 3LSOB 2H45A 4S2SA 5I1IH 4R4BB 4MNQB 4ZUTA 2JIXD 3KJ4C 2D7TH 4X6CF 1BOGA 1K5NB 3FO2A 2WK2A 2F5AL 1Z6JT 4OQTH 1BVKA 1IGFL 3OKLA 3ZDYE 2NY7L 4PRIE 4M93B 2VDLL 2AXJA 4MQ7B 2OZ4L 1IGMH 5J1SC 3LRGA 1P7QD 4B41A 2XWTB 4JM2D 4LASL 3O41B 3T0EC 5BW7A 3RHWK 5IOPB 2P42B 4NRZB 4PP1C 2EIEA 5DJ2A 4JDTL 2R23A 1CDJA 3NGBC 4XNMB 1FNAA 3BX7C 4FQ1L 3ULVC 4RMRA 4ELMF 4Z7QE 5CILL 5KG9A 4XP6H 1R3IH 4Y7MA 1ZSDA 3QXWA 4PP2A 4FQJH 4OCNC 4O51A 1T5XA 4O9HH 1HE7A 1JPGA 3SKJH 5I1HH 1WIOA 4Y16C 5AYQA 5HGGS 4ETYA 5DJZB 4ACPA 1G7QA 1M05B 3DHJA 3RWDB 1FSKB 3CFCL 1WBYA 3Q2CA 4UV4H 3HFMH 4OB5H 1CLOH 1QFUL 1NDGB 3SO3B 1K8IB 2Q8BH 1KJ3L 4K2UL 3RBSA 3S4SA 3HNVL 2QSCH 4OIIL 2IF7A 3QUKA 4M1DH 4AT6A 3DV4A 4FZEH 5D7LB 2A77L 3QI9D 3X12A 1ZVYA 2J6EH 3VCLB 4Y5YA 3WE6B 3NIFE 4XPTL 3CGTA 3LEXA 4U1MA 1N5AA 3P9MB 4M4PA 4W70A 5B4MC 4QF1B 4BK4A 3JVGC 4N0CA 1HSBB 3NCCB 1KCKA 1VHPA 2WQRA 4C56A 4P4RB 4HGKC 1YC7A 2ZKHL 3FFCE 4G6KL 5FOBB 1CD0A 2PYFA 2X1PA 3QDJB 3RZWA 1A1NB 1UENA 2ZG3A 5FGSA 1A2YB 4J8RB 3EOBB 1AC6A 4P9HH 4LDOB 1RIUL 1IAKA 1YEHH 4Q0XH 3D2UD 5T3ZH 2O5XL 3L7FA 1Q94B 4X8JA 3RQ3A 5JLZB 5F9JA 2YKLH 1RVFH 3HZYA 1I9IL 5D6CB 4DVBB 1MPAH 3E3QE 4UU9A 4MJ6A 1UXSA 5KS9E 5J3HC 5JO5A 2HFFA 2I25N 3LN4B 1TITA 3FAWA 5DHXB 5C0CB 5AAMA 3OPZL 3MV9E 3MRNB 4PJGB 2GJ6D 3VMPA 4YHKL 2F5BL 4NQDB 4RFEA 5D1ZD 5BXFA 4KHXH 4PDCE 2BRQA 4U1JB 1QBAA 3ZT7A 1V3JA 1W2KT 3OKNB 5IMOA 4M5ZL 5EG6C 4LHUG 2WBJC 1NAMH 2WP3T 5B38B 3CIQA 5J4MA 4WHDA 1S7VA 1XF5B 1CR9L 3CVHA 2Q20A 4M62H 1F3JB 3TWCL 4N8VB 4NBXB 1D5IH 4XC1H 4OZFG 3MV7D 1J8HE 5HVWA 1KPRB 2A6KB 4AMKL 5ID0B 1QTYT 4M7JL 1LDSA 5AZEH 3EHBC 5H94B 1WSST 1UM4H 2VZ1A 3J8F7 4R4FL 1HIMH 4OGYH 2X4UA 2B2XL 2JJTA 1JZ8A 3QUML 2B1HH 4XCNA 4JVUA 5DC0A 4MAYB 3O9WD 4RQQB 3CFJB 1YEEL 1BD2A 5KN5A 2VKWA 4U1IB 5ANME 3SE8L 5J12C 4PJHB 3ZE2F 1CDUA 1CFSA 5FO7A 2AJYL 1BBJB 4LOUC 7FABL 5E8EA 2AJZA 1NCDL 4R2GC 1G6VK 5J1AB 5E5MB 3FQWB 1FFNB 4POZD 3OAUL 2QJDA 4JFOA 4DW2H 4APQD 2F53A 3CMGA 2W9DL 3BXNA 4TVSa 3MOAL 4J1UB 2BXYA 3EYVB 4N5UA 3FQXB 2UWEF 4NKMB 1IM3A 5I2IA 4DFIA 1DN0A 2VKXA 1R6VA 5D7JA 3RWCA 4Z78A 1NAKL 4K07A 3BKJH 1NGPH 4PR5A 5EC2B 3MREA 5C9KA 5CIPB 4XXDA 3AS3A 4QTIH 4U31A 3CXDH 1MJ8L 1PBYA 2FB4H 1OTTD 1YEFH 5BQ7A 5IJKC 5DMGD 1XCTA 3O3EB 1N2RB 3T4AA 5EOCJ 2QADC 2R0WH 3L6FA 3KGRA 1NCWL 2BVEA 2LVCA 2LE9A 1XR8B 3NMEA 4O58H 3TNNA 1B0WA 5IBTL 1RZFL 43C9A 4G9FA 4L4JA 3SOBL 3U36B 3VXPA 1X44A 1DBKH 2YBRA 1G7JA 1I1RA 5C08D 3V8OA 3T3PE 4ODXA 3VXUA 3PIQA 2ORBL 3QZWA 2X1WL 4UUJA 3S35L 1C1EL 4HUWA 3SDAB 4LVNB 3GDBA 3NZHL 1KOAA 1IC7H 5B8CA 1BEYL 3KYOB 4P2OB 4NQSB 3S9DB 1CYGA 1NLBL 4WGWB 4J6RL 2OJEA 2R29H 3Q0HA 3TBTA 5KS9B 4P49A 1J05A 3CC5A 3IU4H 4LBEA 5GGSY 3EO1B 1KYOJ 1UKSA 3RGVA 4BSJA 1A6TA 2Z91B 4GAYB 2DTMH 2IFGA 2CGRL 4HF5H 4ODVL 1SBSH 1PVHA 1CXFA 3ARDC 3PHQB 4UTBH 5BV7B 3D39B 2X4OA 4JFFE 1MI5D 2WBKA 2R1XA 1H8OA 2CUHA 2J8UE 4MVBD 1MQKL 4C57C 5IFHL 3TYGH 4NM8H 2Z31B 2P8PA 3ZSSA 3CK0H 4QYOB 3VWKA 3UTQA 1MJ7H 5TPWL 3TT1L 2DQDL 1MCCA 2HTKD 2WQ8A 4YBLC 1DUYA 2A73A 3MXVH 1RIHH 2Z92A 3TF7C 4GRWE 5DEFA 2H41A 5HHNA 3DO7A 3DRQA 1IZKA 4MXQA 1NMCC 4JZOB 4PTTA 2NR6C