2BSRA

Crystal structures and kir3dl1 recognition of three immunodominant viral peptides complexed to hla-b2705
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
276
structure length
276
Chain Sequence
GSHSMRYFHTSVSRPGRGEPRFITVGYVDDTLFVRFDSDAASPREEPRAPWIEQEGPEYWDRETQICKAKAQTDREDLRTLLRYYNQSEAGSHTLQNMYGCDVGPDGRLLRGYHQNAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGECVEWLRRYLENGKETLQRADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA CLASS I HISTOCOMPATIBILITY ANTIGEN, B-27 ALPHA CHAIN PRE
publication title Crystal Structures and Kir3Dl1 Recognition of Three Immunodominant Viral Peptides Complexed to Hla-B2705
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/peptide
total genus 74
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2005-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2bsrA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 2bsrA01
2Y23A 2JCCE 2X2YA 5HD8C 3FQNB 4EBQL 5K33A 3HZYA 1FLRH 1M7IB 3BIBX 2DN7A 2VIRA 3IAGC 1T89C 3VXMD 4L4TE 5F72S 4FFYH 3MRLA 3WYRA 1NJ9B 4DTGH 1QLFA 4K7PL 1MFBH 1Q0XL 3FQRA 4Z7VE 3X3FH 3QAZB 1I1AA 3DUSB 3D87B 1D5XB 2P46B 2W60B 1Q0YL 2EC9U 5KVDH 4R97C 2RAMA 1JBJA 1KJ2H 4C56B 4A6YA 3GBML 1CFVH 4HC1L 4PJCA 1E4JA 2AABL 5CGYD 3RVWD 1LP9B 2BRQA 3DXAD 4LCUA 3BPOC 2G2RA 5AUMA 4IRJD 5J3HC 5ADOH 4X9FA 2BY1A 5F7FA 5ERWA 5SWZA 4Z78B 2Z8VC 3O6MH 4PJ7B 4G8FA 3U0PA 1MRDL 2CKBB 1L8JA 1CWVA 1YNLL 5CINL 4XXDB 4NCC2 4P23C 1JZ4A 1OTSC 2NW3B 2DIAA 3LKSB 4HGKC 1T3FB 5C0FA 2FLBT 5FYKL 4CU8A 5HHVL 2W1NA 2LU3A 1TJHH 1X5JA 4JFFB 3WBDA 3BP5A 3EFDL 4NWTL 2UUDK 1P9MC 2EXYC 3C5SA 3MFFA 1FO0H 1S9XB 3BVNA 1XIWB 4P2RA 3WFBH 3Q48A 4LHQB 5D7JD 4OTXH 3P9MA 3FT2A 5FHAH 2E5EA 1IGFH 4LCCC 1BEYL 5EC2B 4HKXB 4DWHA 3TPUE 4MDIB 1XGYH 3DI3B 3MTRA 5CUSH 1NAKL 3UTTA 1DEEB 1FC2D 2KQNA 2I9LB 2J7LA 2XKSA 1GC1H 1NKRA 1F5WA 4QY8B 5MEPB 1G0DA 5FUZL 2R2EA 6FABL 5L9DH 3RVXD 1NBYB 3LRGA 2Q87A 3R0MA 4F80A 1B4JH 3TBTB 1NC4B 2YPKA 1OHQA 3BH9B 3GMOA 3GI8L 5EU3B 1WTLA 2IPTL 3N50A 3JVGC 1R5VB 3IJYA 3MA7A 1CD8A 1LO0H 3QG6A 3RNQA 2DYPA 3BT2L 3IXAB 5F71A 3ROOB 3L95A 1UH2A 3LPWA 3LKOA 3RWFB 3BKJL 3NFNB 2P5WE 4BH7A 3BPCB 3ILQC 3LVEA 3HC4H 3O2DL 1DN0A 3C09B 4OLUH 4FQPA 2DQGH 4H1LG 2O5XH 4EN3A 2IBZY 1FL3B 1UT9A 5ISZE 4F7MB 1MIEH 5E6IB 3P4NA 3MOAL 4R8WH 1ZLUK 3C6LA 4NRXA 3EO1B 5ETUB 1QFUH 4XVJL 2Q7NA 4HF5L 1QEWA 4DN3H 1GZQA 2K1MA 4PRHE 4KMTL 3VGEA 5MI0B 4PUBL 1U8HA 5C0DA 5DHVA 4NHCL 4HMCA 5A2JH 3RUGB 4MQ7A 3T0DA 4H8WC 4MB5A 4FQJL 5K9JL 4PLKD 2PCPB 4F9LC 4X99B 1D5BA 4N0YL 1N2RB 4PJ9B 3UYRL 1LK3L 1UWXH 1A1MB 4Y5XB 4ZPVA 1VGEL 4YUEL 4X6FB 1RZJL 1VEPA 4KK9C 5FO8A 1H5BC 3AM8A 1CU4L 4WWKA 4QRQA 3TBVB 1NPUA 2BSRA 1IC7L 3EGSA 5DEFB 1HEZA 3M17B 3SCMB 2OZ4L 3C8KB 3K46A 1FFOA 4OM0H 4P5TC 3PP4H 1B88A 3S37L 1AI1H 5HYQB 2R1XA 3VXNB 3VWKA 4NQCA 2ENSA 1XIWD 3MRCA 1NSNH 2J6EH 4U33A 1C1EH 4G8GB 4HWUA 3O9WC 4UUJB 4G9DA 1JYXA 1D5MA 1U8QA 5HYSA 4HK0A 3T3ME 2OTPA 2PR4L 4RNRA 3PL6B 3VCLB 3GHEL 4YC2C 5DHYA 1RQ5A 5DT1H 4XCYB 3Q6FB 1W2KT 4FZ8L 2Q7YB 4MSWB 5GGTL 4APQA 2X4TA 1S9VB 5IBUG 1IL1B 4DOHE 1JL8A 4QXUL 2ITCA 1EEQA 2FB4L 2D7QA 3VFVA 1NC4D 4JPKH 5DUPL 3QCTL 5E08H 3RJQB 3PWLB 5KVGH 5AD0B 3M45A 1WC7B 2X89A 4U6VH 5DZOA 1R3LB 1K5NB 5DJAA 4DW2H 1L7TH 1ORQB 4HCRL 1BVKB 4ZFFB 3EOYG 1HILA 1SYSB 3IDIA 4ZD3H 3W2DH 2ZKHL 3MJ8A 4MD4B 1GHFL 2IALA 4CVWA 1EGJH 2OSLA 2EDEA 1AQKH 4WW2B 5KVEH 3BDBA 4XTRD 4OCLC 5E6ID 4RFNB 4NKIL 2ZUTA 3L3OA 2E7HA 4F3FB 1HH9A 2Z35A 4ONGL 1ODAA 3BQUC 1P6FA 4GKZB 4PB9L 2BRRH 2FZ3B 4WO4A 4PLOB 3SDYH 2VZSA 1YEEL 4HIHB 3O6FC 1VESA 1S7RA 3PWJA 2J8UB 4CN4A 4MA1C 1XF4B 3WHE0 3GSVA 5J9PA 4PJ9D 1RZ8B 4UTBH 4JJ5A 3IGAA 4ONHA 1HXYA 1KG0A 2X4QB 4KKNA 4HWBL 3F12B 1SBSL 1JZ2A 5GZNC 4HJ0C 5EWIH 1B2WL 2IH3A 4TSAL 4PS4L 3F7YB 5T1DL 5B38G 4JRXA 3RWEA 3QQ3B 1FO0B 4HUWA 4XP6H 3RIAF 3SCMD 4TTGA 4NHUE 3UYPA 1KPVB 3BZEA 3SPVA 5F9DC 3GSRB 4TUOA 3HR6A 1I1YB 3SBWA 4WW1A 3TNMB 5L8LB 1FP5A 3IDNA 5ESVB 4JG0L 2C3WA 2X4SB 4C83A 2APWA 1QBLH 2BVEA 1K2DB 1WWBX 4G8GD 4M6OL 1UENA 2D7TL 1AIFB 3QHFL 3IB4A 5HGAA 2MCPL 2HMID 2J2ZA 3UO1L 4YK4B 3ILPB 4WI9A 4X5WB 3PL6D 4OD2B 3S5LG 4K3DH 1MCOL 1CXLA 1PG7W 2D0FA 2FLRT 1MH5B 2WAHA 1A4JA 3OAUL 3QO0A 2NTSP 4DVBA 3KPNB 4L9DA 4PGEB 1FQ9C 4JPVL 1HI6B 5EBMA 4D94A 3J7HA 3WFEH 4PJCE 1ND0A 4EIGB 2OBGA 2SEBB 3CVHA 3VXUA 2EH7L 3TF7C 1DJSA 3CFCH 2NY1C 4TQEH 2XN9A 4G6KH 5SWZE 1OM3H 5IMLA 5C86A 4R7DA 4P3CL 1OP5K 4M1GH 2HT3C 2V5RA 4OFDA 5DEGA 5DTFB 1I3GL 3OKYA 1WZ1H 4JEGB 1U8LB 1OAUH 3GJEA 1F00I 2BY2A 3V4PL 4YHML 3FB7A 5ID0B 4PRPA 5F96L 4XBPA 2FECI 3TJEL 2A77L 3FT3B 4OIIL 1TMCA 4M48L 5JW3L 3CDCA 1A2YB 1FNSH 1I7TB 3U7WH 1XCTA 3ZYOA 4KUCD 3SJVD 1NGXA 3QRFM 1Q9LB 3ZKND 1ZT7A 2DQDL 4FXLA 5EUOB 4PGDB 3JBG7 4M7ZC 4S0UC 5GGVY 3FO0L 3F58L 5CEZL 1LEKB 4H0GA 1MHPH 4NNXA 5K59F 1INEH 1KLUB 2ZNWA 4R90H 1A6PA 3V52L 1BIIB 4BJLA 3HFMH 4BSWB 1BZ9B 4Q74A 5DVLA 1P4IH 2OP4H 3MUJA 5GGRB 2V2TB 1A7RL 3CLFH 3WIHL 3T0WA 1RUQL 4L8SC 4MNHA 3ROLB 3UTTE 1N5YH 2BX5A 1IKNA 3WLBB 5JQHC 5KSVB 4WDIA 2NY2D 1JUFB 4OGXH 5E4IA 3P77A 4P3DB 4RDQF 3S35X 1ZMYA 2F19H 3AY4C 1TZHA 4LP5A 2MHAA 3L5XL 5C2BL 3WD5L 1HHKA 3MLYH 15C8L 1VFOA 2YD7A 5I15H 5T1LB 4P48A 2MNUA 3V4UL 4XVSL 1JV5B 4AEEA 4O9HL 4P59L 4JKKA 1V5JA 4X8XA 2QSCL 4XB7A 3KPLA 3BE1L 4KPHL 1HKLH 1MNUH 1NCCH 5JUEL 1R3JA 2DIJA 3WN5B 1CG9A 4GW4A 3GI9L 3BD5A 3E3QE 1U3JA 3RU8L 1OT2A 4D9QE 1A7PH 3D9AH 1PY9A 1FG2A 5C0JA 4WEUD 3V6OC 2NY6D 4JFDA 1RIUH 1SYVA 2ICCA 2Y5EA 2YZ8A 1S9WA 2YKLL 2R4RH 5IB5B 1ZVSA 4X6CB 4OV5B 4EDWH 3W11D 1XGTB 4PRBA 1CE1H 1DQMH 3EYVA 3QISA 5TF1H 1LE9A 3GUTA 1Z9LA 2EXWD 3FQXB 3LZFH 4I0PC 1LE5A 1K4CB 4OBRA 1AXSB 2C7UB 2AK4A 5F8RC 3HZMB 1OGTB 1RZGB 2R1YA 1BBDH 4BSJA 3B83A 1OLZA 2AJYL 4MX7A 3BKMH 2W65A 1G7MA 4LBEA 2PO6C 1C8PA 4PJGA 3ZDZE 3SQOH 5C0GA 4F7TB 2XWJA 2R56H 3IJHB 3P11H 2Y6SC 1FH5H 4JKMA 1BM3H 2DMCA 3U0TA 3INUH 1DQJB 5JXEC 3G5XB 3FKUS 4HQQH 3HZKA 5TGBA 5GGSB 5ILTH 2O61A 4PPTA 4K2UH 5GJTL 1WBYB 1H15A 1NLDL 4XC3L 2OTWA 1NFKA 1ZWIA 2VDPL 2BCKA 5FHBL 1TETL 1OB1A 5CCKH 5DD1H 3WFDH 3RJDA 3GIVA 2AI0L 5LJYH 1B6UA 3A67L 4OSUH 2R9HC 5FGBC 4D0BB 3QUXC 4UV4L 1XF3A 4Z7OE 4FFWC 4MAYB 5JQ6L 1QSFD 4U0RC 5I8EB 1WISA 5H94B 3GSXB 1S9YA 4ZXBD 3ZKXB 2JK5A 4M7LH 5E56A 5JMRA 3WNOA 1QVOB 3MRNB 4NQCE 4PJ8A 5EORH 4XWGL 4U1IB 3QCUH 2A6JB 4QXGL 3FAWA 3T1WA 1HINL 5SX5H 1I8IB 3ESUF 2V5SA 4POUB 5GS1C 5SWSA 4WV1A 4JN1L 3SDCB 3WUWB 5GSRB 3DNKA 4POYA 1JVKA 1KIPA 1FCCA 1KJMB 3SDXF 1JNJA 1XF1A 3SGEH 4K94H 3QWOB 4HPOH 3OKDB 2V2WA 3IAPA 2XIDA 4LOUC 1X5YA 5FEBA 1ZEAL 1IGYB 2GJ6B 5J1AA 2DIBA 2RFXA 3QULA 1UZ8A 1A6ZB 3OR6B 5FKPA 1FVEA 5IHZB 3FZUD 3S3PA 1CL7H 5T1LD 4OF8A 2E9JA 5EO1B 1F6FB 4KTEL 2XZAL 4NJ9L 5EU5A 32C2A 4YDLC 4U1SB 5EZLB 3FMGH 5C7XH 3L1OH 1O5DT 1FJ1A 2XQBL 2MCG1 1MLBA 2AV1A 4ZYKA 4K9EC 5DS8A 1X5LA 5EOTB 5T5NF 4LPTA 3UYOD 5I1DA 4NZUL 4JPIA 4U3XA 1D6EA 3GMLA 2J88H 2AKRB 4AEHH 4LVOB 3QUZA 4O00A 2ZCKH 4W6XB 5BZWB 1ED3A 3ZTJH 5JHDD 1PSKL 2FEEI 4FFZL 4G3YH 4RFOH 5GZOC 3SO3C 1J12A 1V3JA 3O4LB 3DSNA 4GBXA 5CD3B 5INDB 5IUSA 3O4OB 3ALWA 4V3EB 1YEIL 4P4RB 1HDMB 4FQHB 4NPYA 2YA2A 2A6KB 1JPFA 3ZDYE 5DQDH 3KNBA 4LHUA 2ADJA 4PR5A 5D7KE 3T65B 2FGWL 3ZKMD 2CJUL 5A1AA 3KJ6H 1C5DA 2BDNH 4XPFL 2RB8A 5EBLA 1A3LL 4X5XB 5JW4Q 1YDPA 4AZ8A 3TNNB 1CT8A 3TBSA 4UU9B 3B3IB 2UWEF 1JPTH 4BSVB 5IK3B 2QEJA 2WQRA 1BQHG 1XR9B 1MAKA 2ENYA 3PGFH 4ZUWB 2A6DB 2HRPH 1MCPH 5TDNB 4UT9H 3D2UD 1CFSB 4ZUVB 5D1QB 1MCSA 3D69B 1LD9B 4G80B 1MPAL 3UPCA 1NJ9A 1CDIA 3GRWA 4WVRA 5D6DC 5CZXD 2DOCA 1A7NH 2BHZA 5I8CB 4G8EB 4C56A 1GRWA 4M8VA 5GSVA 2RQ8A 2LV4A 2W38A 4N9GA 3OJDB 4Z6AT 1LP9A 3QBTB 3QYCA 3S36H 5DRZB 4P49A 3CFJB 3HMXH 4EOWH 3LEXA 1AKJB 4XX1G 5AG8A 3DSFH 4Z78A 5IQ9B 4MJIB 5HI3C 5C1MB 2EIDA 1YC8A 4HJGB 4GAFB 3JV0A 5L2JA 1YEJL 2IMNA 1NGYA 4XXDA 3W0WB 2HAZA 3QDJD 1EEZB 3FT4B 3I02B 3TT3H 4TPRL 4YHZL 1DR9A 2UYLA 2BNRA 2Z93B 1PVHA 3MODL 4JZJA 2GJ6D 1V3LA 3FRPA 4QXTB 4XBGB 2CKBL 4XMLH 3VXUE 4BFBD 5IVXB 3QIBC 3D5OF 5F9OH 4TRPL 3QT2A 1KIRB 3NCEB 4JFFA 1AHWC 1JGVH 4L9LC 2PXYD 1QRNA 5KVFL 5EO9A 3QO1A 1G7QA 3SDAC 1S9XA 2XZCL 5GS0L 4PRPE 1QSEE 1N6QH 3HUJA 3SGEI 2K9UA 1FNGB 4FQ1L 4ISVA 4JVUA 5GRZA 1PBYA 4HKXA 2ARJQ 3QEGH 4HIJB 4F58L 4JE4B 1R0AH 4HKBB 1OW0A 2XXMB 1TZGH 1CDUA 4Y4HB 3UBXA 2YPVH 4HMDA 3MLRL 4C57C 1CL7I 1FV1B 4ZFGL 3C60B 5MEPA 2WIIB 3MNVA 3VD4A 4WTWA 1IC1A 2ED8A 2QQQA 3QJHA 5HSFA 2VUYA 4LFHD 4PB0H 4J3TA 5DD0H 5E94B 4XPAH 3UXFA 4N0RA 3TO4C 1UYWH 3BH9A 3NACH 4N0CC 5FKAA 4UZGA 1R5VA 3MLVH 5L7XL 5DJCB 2BJMH 4U7SA 1BX2A 3ROOA 3RWFA 3NFNA 5CD5D 3BIKB 3B2UD 3BPCA 1RIVL 4JDZB 1NMAH 4OLZH 3SQBA 3ZLQC 4LARL 2ID5A 4QHNA 3G5VB 5D1QD 3IXTA 3KPOA 3QA3B 4S1RH 2UZIH 3QCVL 3JV4B 2JJTA 1EHNA 4F7MA 1JHTB 3PGDB 3ME0A 5E6IA 5TE6H 4R6UA 2AGJL 4M6MH 4XPTL 2G60L 4NP4H 3VFOB 5DMIL 4HWEH 1LK2B 3S4SA 3U0WH 1JHLH 4I3RH 1NDMA 1KIQB 4MA8L 4PTTA 3O2WH 4M3JA 4YX2H 1XGPB 2OR7A 1MFEL 4DKEH 3VFGL 3WO4C 4MJID 4E5XA 3W9EA 4K7PY 1IT9H 3PWUB 5I75B 12E8H 1EMTL 4X99A 3I2CL 2PN5A 3RI5F 4ZS7L 4R2GC 3BUYA 3D85B 3W0WD 1P84J 2W0PA 1A1MA 4YJZL 1X5HA 4L8DB 4OZIA 1F58H 2BHUA 4X6FA 2V5MA 2AK4E 4HWNA 1JI1A 3S88H 1FFQA 5GGQH 1HOCA 2DQEH 3LN5A 3LKQB 4CVXB 3L5JA 4AEIH 3W82A 3C8KA 3ET9F 3NTCL 1YECL 4FFVD 1OD9A 4Z9KB 2YUXA 1MF2L 4XVTL 3IFPB 1L6ZA 4ELMF 4OQTL 5I16B 5J11C 2AXFA 1T7WA 3C5JB 2WUBH 3MLWH 3GKZA 4G8GA 4PJIA 4E41A 3L3KA 3VXME 5IT2H 3E8UL 1NFIB 5AZ2L 1AD0B 4NO0B 4LSDA 4UUJA 4ELKB 4QHKI 5IB1B 4OGYL 3STZA 3DX8B 2OK0H 4Q9RL 2CDGA 4PRIB 5GS2H 1P1ZB 2XNAA 4X9IA 1QBBA 1IL1A 5I6XB 4UQ2B 5TE7L 1P53A 1JWMB 3PQYA 4HUVB 5DUBA 3ABZA 2A9NH 4HS8H 2EC9T 1AC6A 5SWSE 3O45B 3BEWA 4KZDL 4PLJD 5CILH 1K5NA 4Z7QE 4JCMA 1ORQA 5FCSH 4ZFFA 3T0EB 1FSKB 1SYSA 4DZ8B 2YD9A 5ADPL 3DO7A 1MCHA 4MD4A 4MS8A 1FLRL 1SJEB 5DK0B 2X70A 1N64H 5ITFB 1KJ2A 4HIXH 4FFYL 5C0IB 3TBYA 4LASL 4HKZB 4MNQB 4YAQA 4QOKA 1FFRA 2N1KA 4Y88A 3C5ZA 3GM0A 4GO6B 4ODXB 2GKIA 3TGXA 3REWB 4JGUA 1RZIB 4AH2B 4AENA 5ALBH 5EZJB 5FAAA 4FQXB 5DQ9B 3DWTA 1EJ6A 3MRJB 2B0SH 2DBJA 4L5FH 2LAAA 3ZHKA 5DMGC 1G6RA 4HIHA 4JO2L 2J8UA 3ZYZA 2ZSVA 1XF4A 3EYFA 1VHPA 4WCYH 1NGPL 3D85D 1RZ8A 1DVFC 5DD3L 5EO0B 2EC8A 2X4QA 2R2HB 3F12A 2HKHH 2MQ0A 1FE8L 3VH8B 1F4AA 2P45B 4M4RA 5FYJU 4JZNB 1MVUA 1I1YA 1EZVX 1J1XH 4PJAA 1I3RA 3TNMA 2X42A 1FO0L 1X4ZA 4WI7A 3FOMA 1E4WH 1IKFL 2X4PB 5EZIL 3U9PH 5E2UL 1AO7B 1AIFA 4LAJH 3ZHLA 4OTXL 1I7UB 4ZAKB 5EOQH 4XI5C 3MYZA 1N59B 3I85A 3ILPA 5I1CH 1R3IH 1MIML 5C0BB 2GTWA 3MR9B 1XGYL 3S98A 5I71B 4C56E 1A6AB 1DLFL 5I30L 1MCQA 4QTIL 3HE6A 5C70A 4Z0BL 1I85A 3AB0B 5I1KH 1LP9E 3C9NA 1DUZB 1I1AC 3STLB 3VWJB 5L9DL 1Z0MA 2DDQL 3GMMB 4BUHA 1YQVH 3BWAB 3MPCA 2R4SH 2EDXA 2A74B 4NO2B 1JGUH 5I1JH 1YEGL 1MY7A 3IDJB 1A5FH 2X4RB 1U92B 3T0ED 5ID0A 4X0KB 4XWOD 4LQFH 4NN7C 1WAAA 1LEIB 1D9KB 3FT3A 4EUPH 3MREB 3RHWF 2BNRE 4RA3A 3HC4L 4WENB 2W0LA 1F2XK 4AEFA 1CDBA 2NYYD 5IW1A 3BN3B 4MNQD 1MIEL 2APTA 5DWUH 4KK6D 1A9EB 5EUOA 4JFFE 2OL3H 3KDMB 4GQPH 2Q8AH 1LEKA 1QFUL 1QRNE 5JR1H 4OV6F 3QIWA 5ENWA 1P84K 4ZUUA 4FQXD 5BV7L 3T3MF 3MNZB 4BSWA 1BZ9A 1S78C 4BZ2H 3HUJE 3UZVB 2B5IB 4W81A 1F3DJ 1U3HD 1TENA 3BMVA 5CFHA 2YRZA 2V2TA 5C09B 2Y07H 5MERB 3MUHL 3PHOA 3OWEA 3ROLA 3BRFA 4P23B 4JREB 3AXLB 4YXHH 3WLBA 5KSVA 8CGTA 3FTGB 2FX7H 3EFFB 1J1PH 1JUFA 3R06B 1L4IA 1JPGB 2JJSA 1HWGB 4P3DA 1F4HA 5D1XB 3PGCB 1OSZA 4E42A 3MV11 1OCWL 3MXVH 3LCYA 2ZUSA 3MRRA 5KS9A 3IFNL 1UQSA 5FGRA 1MI5D 2J6EA 1UWXK 3PP4L 4LSSL 3TIEB 1AI1L 3BXNB 1J05A 4NGHH 5ITBH 1DCLA 4N0UB 2NY3D 1VEMA 2N4IA 2M1KA 2WW8A 4HH9A 1C1EL 4HS6B 3GO1L 4Y5VA 4HUNB 4BQ9A 3BISA 2FJFB 1ACYL 1R5WB 4ZAKD 4ZTPH 4W6YB 3E3QC 5IB5A 3MRIB 5JNYB 4OCYH 5C0BD 1IAIL 1VENA 5F9JB 1XGTA 4NKOA 3KPSB 2FECL 1RY7B 5HHOA 4F7CA 2W9LA 5GRWA 3T77B 1BQLH 3FQXA 3L9RA 2CLZB 4NJAH 2BOBB 3KYNB 4EN3C 4UNUA 5FOBB 1AXSA 2C7UA 2E6PA 4OLXL 3AGVA 4FNLH 1ULVA 1P2CB 4UT7H 3QI9A 3HZMA 1BZ7B 1OGTA 1RZGA 1S5IH 3HNSL 3VWJD 1EHAA 3C6LC 5F7HA 3P4MB 5HYEA 4OF5A 2BVTA 1VERA 3IJHA 3UJTL 5F1NB 3RGVB 1TVBB 5HBBA 5E08L 1KB5H 5KVGL 4KUZL 1FBIH 5I74B 4U6VL 3K2MC 3NIDE 3QUKB 1EGJA 4DW2L 1L7TL 3TBWB 1NKOA 3NCCB 4O51A 1PGRB 3C8HA 2E27H 4I77H 5JTWA 3W2DL 1D9KD 3H3KA 4LPYA 1KCGC 1RZJC 4HV8B 4PJXA 4DAGH 1T1YB 4IRSA 5ALCH 4C58B 1WQVT 2MPAH 5KVEL 3PG2A 3VRLE 1CGWA 3TH3T 4D0BA 4MAYA 4RISH 5I8EA 4WWKC 5I9QC 3FQTA 5H94A 4Y16B 2CUIA 4XPHH 3VFTA 1KCSH 4OIBA 4P0DA 1G7IB 5J3HD 3JTCA 1EAPB 4U1IA 4JG1L 2NMSA 4G8GE 3DI2B 4YPGB 1MREH 2CIIB 1WZLA 3EYOB 1KFAH 2EECA 1FZKA 3QEUB 3SDCA 3VWKC 4OD3H 3WUWA 3BW9B 3MLUH 5C09D 2LAGB 3O0RL 2AXHA 1JTTA 1E0OB 3P0VH 4OD1H 4UBDC 2APXA 1KJMA 2AEPH 2G9HA 4M93B 4P23D 1OTSD 3QWOA 4UILL 4XHJD 4IOFD 2DBLH 4ZNCD 5KTEH 5D1XD 1OOAA 4XNYH 2LVEA 4HEME 3OR6A 3MOQA 4DCQB 4BYHA 2E6QA 3RNKA 3PQYE 3WXWH 1NMCC 3LIZH 1DE4B 3B8YA 4KJPC 5EO1A 2EXYD 2EDYA 4YXKH 1I1FB 2ZG2A 2A83B 4HD9A 1ZGLB 5C2UB 4QGTA 5EOTA 4WFGE 1QFPA 3GMNB 3EYSH 3CXDH 3HE7B 4HJJH 2EDQA 3PXHA 4I3SL 1AR1C 1ZHNB 2NY7L 2AKRA 1DSFH 3WUWG 2XI9A 3RA7L 5GS2D 3U36B 5BZWA 3WEXB 1MFCH 3EO9H 2KPNA 3ZDXF 4CVZB 4K3DL 3KPSD 4H25B 5DC4B 2ZUWA 2VDNH 4QOKE 4LPCA 2OXGA 3O4LA 4LRIA 2H41A 1S7UA 5FUOL 4U7KA 3HI5H 4FQHA 3WFEL 2VZVA 4S1DC 1MFDH 2VL5B 4DN4L 3JV6B 2GFBA 2JKXA 4G9FB 3RWDA 1CZ8L 2AXGB 5ICXA 3T65A 4NO3B 1IAOB 4G43A 4WI3A 4TQEL 1WWAX 1OVZA 3BKCH 5MP6H 2QADB 4G6KL 1WBZA 4X5XA 4MA7H 4LDEB 2J8UE 3NCYP 1OM3L 4ZPTA 3V5HB 4EUPB 4UU9A 3QFDB 4M1GL 3QIUA 5F89A 1WZ1L 4DUWA 3FOLB 4ORZC 5IK3A 2PYEB 3DBXA 4IS6B 4NQXB 2BSTA 2P8MB 3DYOA 4ZUWA 4JRWA 3WFHB 2A6DA 4AIZB 2WANA 1CFSA 1QUNA 1KN4H 4OCNC 1J8HD 1MCDA 5D1QA 3VE0B 1PG7H 5FCUL 5F9WC 2OL3B 2CO7B 1FNSL 2X7LB 1ZANL 5AZEL 3UJJH 1TJGH 5GISH 3TA3B 1KCVH 3G08A 4YFDB 1RD6A 5CBEB 2ARWA 5EU6D 3TM6A 5I8CA 3BAEH 5FYJH 4G8EA 1FZJA 5GRJH 5KG9B 4Y16D 4PJAE 3OJDA 2NXZC 3WFCL 1INEL 5MENB 4L29A 1KJ3H 1ZHLB 4LSQL 4R90L 5CMAA 5K93A 5TFSL 4LFHG 5D70L 1E6OH 1F97A 5DRZA 4H20H 3HFML 1AKJA 2PW2A 4GAGL 3SBWC 1P4IL 3MZTA 2ERJB 2OP4L 4UDTB 1C16A 5IQ9A 5A2LH 5I8OH 2YD4A 4AIXA 4MZ2A 3BSZL 4QRPA 3CLFL 1SEBB 2Y36L 4JQIH 1W8OA 1IILE 1CLOH 3D0LA 4C55A 4G6AC 2BNQD 4XPGH 4EXPX 1N5YL 3FT4A 4KK9D 3KLDA 1MCWM 4D9RE 4J6RL 3RL2B 1DANU 2FEEL 5GRUH 2F19L 2XRAH 4QXTA 4XBGA 2VAJA 3QG7L 1URLA 4KJYA 5FO7A 4D8PA 5I15L 4P5TD 5BMFH 3TVMA 4JFYB 3RQ3A 1KIRA 5ELIA 5KBNC 4PYHA 5CEYB 1CFTB 4DKFH 3WL9B 4UIKH 4YHNB 5C08B 2V9QA 2LU7A 2W9EH 3P30H 3HE7D 2HP4A 1FNGA 4HX1B 1P69B 3BYYA 1RIUL 4Z7OF 5IEKB 4LF3A 1Q1JH 5BZDA 5IR1A 2VWEE 1DFBH 3GSNL 1UB5A 4JANA 4MD0A 4HKBA 4QHKJ 4CBPA 3TYGH 1Q38A 4Y4HA 1Q94B 5EUOE 1DQML 1FV1A 3C60A 3B9KA 3LZFL 3C8DA 3QDAA 4IM8A 4JHZA 4JY5H 5A40E 1VDGA 2WIIA 5IHUH 2NY1B 3K81A 1KB5B 1BBDL 4I8DA 2WWMC 1HHGB 4WHTB 1E4XL 5C6PB 2C3XA 3LQAH 3VXOB 5CBAB 1A0QH 1NL0L 1FH5L 5HVHC 1BM3L 1GCFA 2ATPB 3TCLB 4FABH 2PUQT 1PY4A 1QOKA 2NY0B 4YFLI 3AFLA 5DJ8A 4AIOA 3H42L 1ZA6A 4YQXH 5ILTL 1YEKH 2PYED 1FRGL 3BIKA 4K2UL 1WBXA 2VDOL 1UXWB 3GM8A 4I13B 3QA3A 1IKNC 1JRHL 3EJYC 3JV4A 5CCKL 1QFHA 4L8BA 1BQUA 4M7ZB 3B9EA 5KS9E 5F6IC 3I3BA 2OMBA 1CF8L 3VFOA 4KVNH 4KV5E 3FN0L 4OKVA 3ULUL 1KIQA 3TZVB 4IIQA 4BQ6A 3CSYB 1VGKB 5EORL 4ZUTA 3IJSA 5GHWL 1JE6A 2H2PC 4XNMB 4KY1H 4WHDA 5E8OA 1W0VB 4HBQA 2WP3T 2AJ3A 3TWCH 3PWPB 4NBYB 1LHZA 3CZFA 4OCXH 2E6JA 2HLFD 2ICWB 5BVPH 4JB9H 2UVEA 4K94L 5HPMA 1D5ZB 4L8DA 3KLSA 4Q2ZA 5SX5K 5GZND 1S7SB 2EZ0D 4XCFH 2ZSWB 3LKQA 1A4KB 1IM9D 2UWEB 4Y1AB 2VABB 5KSUA 3BESR 1CL7L 1IARB 3QEQA 3O3AB 1PYWA 2BSED 2VH5H 3QUYC 4KZEL 2OQJA 2OJZH 3L3GB 5GRYA 1MJ7H 3MV7B 3DYMA 3HG1D 3CGTA 4GMTL 3TESA 4ZO8A 4LSTL 3IFPA 2F5BL 5C7XL 3OGCB 5DJYB 4V1DA 3MRQA 3W5NA 4K3HA 4R4BB 4I48A 2M8XA 5C3LD 4WI8A 1OP3H 3V6ZB 3NABH 4O2CA 1AD0A 4NO0A 4R0LA 4LIQH 4HUXA 4KQ3H 5IB1A 5HDBE 1NBQA 2ICEA 2R2BB 3DIFA 4RAUB 5F88B 5LBSH 4P9HH 5J6HB 1H3PH 3U4BL 2F54B 4UOW1 4B0MM 4PRIA 1HYSC 2J8OA 2HVKA 3FCTA 3TT1L 3O3DB 1JF6A 2YN5A 1XT5A 3TP4A 2F58L 4UQ2A 5ESQB 1Y18A 2NY1D 2AJUL 2FYYA 3FFCB 3T8XB 4HUVA 1A47A 5CGYC 1S8DB 2HH0H 3O45A 3KJ6L 5D7LD 2BDNL 2HT3D 2P43B 1NCUA 4PJ8C 4XGZA 3LSOA 1FCGA 4IRJC 2HFGL 2C26A 3CFBA 4O5LH 4DFIA 2NY0D 3BI9X 4IDJH 5BOZG 3WNNA 4DZ8A 1YEDA 3W39B 4WV1C 3DV4B 1EJOH 5GGUA 1M6OB 5H8DA 1OQXA 4PJ5A 1CLCA 5IF0B 4PJDA 2HRPL 4P5KB 4UT9L 3AREA 5ITFA 1M05B 1DUYB 5E8NA 4LU5H 5C0IA 4HKZA 2X1WL 3HR5A 5I2IB 4P9MH 1J0YA 3RZCB 4JO3L 2DWEA 5LQBH 3OL2A 3HMXA 4EXKA 3RY4A 1KACB 4RQQA 3REWA 4AH2A 2FSEB 3SKMB 4HSQA 5LCVL 4LDLB 3GHBL 2YD1A 5IMOA 4S1QH 5JXAH 3TZVD 5D71H 4ZUSB 3RWGB 5H37H 3S36L 3CSPA 3I6LD 4ETQB 3N06B 3MRJA 4UT6L 4XCCL 2CO6B 2W0FA 3I3DA 5KW9L 5ICYB 3W9DA 4L8CB 1UADC 4NN6C 4GRWE 3ULVF 3OKMA 5FV2A 3IDUA 1Z9SA 1MUJA 1T7YA 4HIIB 3QUZC 3O4LE 4OF7A 4B41A 5EO0A 2V17H 5F1OB 2R2HA 3IDYB 2OXHA 5IJKC 1GXEA 1NDGA 3UTPD 1EO7A 4Y1AD 5E8DL 4NZTL 4YDLB 3RDTB 1FFNB 4YBLC 5JIKA 3MV7D 3TO2B 1KC5L 3FB8B 3TEUA 3DX6B 4Y5YB 5I1AB 3VMNA 3H3PH 3MV01 5HGBB 1AO7A 3ZSSA 1X44A 4XZUB 4YHOH 4NQVA 4WFFD 3RWJB 4A2MA 4CJ1A 3RL1B 1N59A 4XBEL 3V6FA 1A3RL 3MRGB 5MHSE 3GNML 3EW3B 5B39B 5I1EL 1A6AA 2YPVL 3DMMA 3P3YA 4KHTL 4OFPA 4OLYL 2ADGB 3IU3B 1KTDA 1KLGB 4O4YL 1DUZA 3QAZC 4AQ1B 4FQCH 4UI2A 3OPZH 1MRFL 3VH8G 3LKNA 5IOPB 3KXFB 5JIHA 1X6NA 4HFWB 1U95A 3BWAA 2Y6SD 1Q72L 4LPVA 1XF2B 4PB0L 4NO2A 2A74A 5DD0L 4XPAL 1I4FA 4Z76A 5JXED 4Z7UF 2YZ1A 2VDKH 3NACL 3UX9B 3IDJA 3MLVL 5KJRL 4QRPE 2X4RA 1U92A 1JGLH 5T33L 1FDLL 1N4XH 3B2VH 4AMKH 1AQDA 4TOYL 4X0KA 3W0WE 4HH8A 5FYLD 1JI2A 2NW2A 4U1LB 3MREA 1UB6B 4PJGF 2D7OA 1RMFH 3V95A 1NMAL 5F8QC 1N0XL 3VXQB 5FYJD 4ZO6A 2AEIT 4MJ2A 2R9HD 4ELMB 4JFZH 4L4TB 4FFWD 3JWOH 3RZCD 3T1FB 7FABH 1CGSL 3FONA 4RCAA 4ALAH 4AK1A 4JZJC 1A9EA 4M6ML 4MWFB 3RX7A 2H1PH 4NP4L 4J8RB 1I3VA 3VW3H 1JHLL 4I3RL 3GSWB 4YHPB 5F21B 2YXFA 4YX2L 5KAQF 3NZ8A 4XMPH 1SHMA 5ACMA 4WI5A 5C09A 4DKEL 4MJ5B 4NZRH 1XIWC 4FXGB 4O58H 2YD2A 2AW2A 3L7FA 5HI4D 3GKWH 4R4FH 3AXLA 1G0YR 4LOUD 1S7WB 3EFFA 3KG5A 4M43H 3Q5OA 5D1XA 4UTAL 3PGCA 5CJOH 3N9GH 2YSSA 1OW0C 1UA6L 2EDJA 1E28B 3QIBB 1UH4A 4AEIL 2E7MA 4M7KH 3O3EB 1WTGT 2QHLA 4L9LB 3L3IA 3RDTD 3KYAA 3GBNL 2LQRA 4JM2F 4LAQL 5IVNA 5E24E 5K9OB 2RR3A 3DVNA 3SDAB 1LDPL 3PWNB 2J4WH 2JB5H 3K4ZA 5HYJA 1UC6A 2X10A 3B5HA 5D9SA 2WUBL 4HS6A 1FVDB 3HC0A 4NM4H 3I6KB 2P48B 1R5WA 3OXRA 3QDGA 5GZOD 4FZEH 4XT1C 2VQUA 1QFWH 5HGHA 4N5EA 3L7EB 2OK0L 2QL1A 3C09C 2YHGA 1FNLA 5FOBA 2XWBB 4QYOB 1CR9L 1SVZA 2JJTC 5E6IC 5T3XH 1CS6A 1BZ7A 1Q9OB 5EFIB 4DVRH 1FZMB 1MHHB 3KXFD 1ZV5A 2WLZA 2A9NL 4JY6B 4EDXA 4CUCA 3RGVA 1TVBA 3LAFA 4WEBH 5MI0C 1QPXA 1V7NH 2EE9A 1IEBB 5CILL 3NFSH 3TBWA 4ODSH 1KYOJ 2GSGB 4YIQA 4X5LA 4Z0XA 5IFJB 4U6YA 2HJLA 1AJ7H 4EVNB 1T1YA 5DRWB 2QSVA 2CDEB 1J0HA 2CXGA 4PJ9C 4HIXL 3RRQA 4GG6A 4L4TD 5GRVL 4Y5XC 3QEQE 2I25N 1CFQA 1GZPB 3QXDB 5D4QA 4XRCB 4RAVB 3HI6L 5EIIB 1QQDA 4EEEA 2UZYB 3T4AB 2HFTA 4V1DE 3SCMC 5BVJA 2VE6B 2ZOKA 8FABB 1EAPA 3WSQH 3RIAK 1PG7X 1T83A 4PRHB 4D3CL 3KLHD 5HI3D 2GITA 3RKDD 5ACZA 3QEUA 3ZKSD 4TNVF 3TFKD 3BW9A 5KSAA 1F13A 4DK6A 4H8WL 3LB6C 3QRGH 1DBAL 4PRIE 1QSVA 5F7EH 4WCYL 5I1LA 2OMNA 1CD9B 1RZ7H 4B7LA 4UIMB 3PL6C 1CCZA 1FIEA 1EVTC 4JO1H 4OZFH 3QIBD 3WIFA 2CGRH 1WUNT 4OCRL 4U31A 3MV8B 2XKNB 4V2CB 2X9YA 2XTLA 4N5UA 1XGRB 1BREA 3SDAD 1YJDC 1I1FA 1J1XL 2XQYK 1ZGLA 1N7ML 5GS3A 2NX5A 5ID1A 5GGRY 1S7TB 2I60H 3HE7A 3V0WH 2DKMA 4XAWL 4PJ5E 1I1CA 1ZHNA 2EICA 3OR7B 4NIKB 4PJDE 2JE8A 2ADFL 4QTHA 1NEZB 5HHMB 2YPLB 3DO3A 4X83A 4PV8B 1O7VA 1S5HA 5EOQL 1KOAA 1YY8B 2NY5C 2XQYG 5I1CL 4MS8C 4GW5B 4MA3B 5T5FL 4H25A 2ICWJ 3X14B 1OWRM 3ARGA 4TSCH 4QT5B 4YR6A 3K0WA 4UQ3A 3HUJF 2IFGA 4RFNC 4UINL 1JPST 5I76B 4G9FA 1KGCE 3QWRA 3S3SA 4CNIA 4AQOA 3NCJH 4NO3A 4F33B 5IWLA 1JGUL 1OPGH 3MJGX 1XEDA 4L3CB 3KYOA 1VEOA 4C4KO 5A3ID 3V5HA 3QFDA 4OKDA 1H0DB 1YYML 1NCTA 1L0QA 3FOLA 5AWNL 4NQXA 2BZDA 1A14H 1U41A 3WFHA 4AIZA 1KPUA 2VAAB 3VE0A 3O8XA 2EYRB 4N90E 2OL3A 2P5WD 3QFJB 2RCSH 3QNZA 3TA3A 1E27B 5CBEA 3MNWB 2RGSA 2WBJA 4LL9A 1R3KA 3JXAA 5ISZD 5L8JB 1MVFA 5MENA 1X4XA 1ZHLA 3QSKB 5EOCJ 2VXUL 2F5AL 1EEUA 1AO7E 4PRHD 4ERSH 5CSBA 4RDQG 4M9OA 4UDTA 3L6FB 1W72H 5GGSY 2DQTL 3MLPA 3LS5H 4EUPG 1M7XA 2Y07L 3REVA 4R2GD 2JIXB 4YDKH 3P9WB 2W0KA 1DVFB 4LKCA 3MOBL 3F7QA 4P2QB 1SJXA 3LOWA 5A43C 4YK4C 1J0IA 1GC1C 4GT7A 4AJ0A 5CSZB 3H0TA 5F6HI 2CLVB 2Q76B 4HLZH 3SDDB 2ADIB 4RIRA 3NIDF 2X09A 1FNEB 3MV8D 3MLZH 1QHPA 4U1NB 1IMHC 3VI4F 1CFTA 2DD8L 5C08A 4OZIF 2EDDA 1T5WA 4WFED 4PG9B 4NGHL 5DJ6B 1JZ3A 2WUCL 2FX9H 1ETZB 1G7LA 5L88H 4DKDC 3KYKH 1LO3L 4HX1A 3HZYB 5HHMD 2YPLD 5IEKA 2VIRB 4ZTPL 3IDXH 2K7QA 3BMWA 4IOIA 3ZHDA 4TUKL 1OAQH 1UWEL 3VGDA 3MRLB 4ZFOA 5HY9A 1NGWA 3FQRB 2PKDA 3B8SA 2FR4B 4ZO7A 4P46B 3LEYH 1I1AB 1MWAH 2VWEC 4L4VB 4PJIF 1I9JL 5DK3A 3V5DA 1EAJA 1KYOK 3HRPA 3CJJA 4FNLL 4UT7L 1K8DA 4HWZA 4NYLB 3IVKB 1KB5A 1HHGA 4WHTA 1CGYA 3S97C 3VXOA 2ILLA 1MAMH 3JWDH 4LCUB 5C09E 1EXUA 1T2JA 4KTDL 1RZFH 1DLHA 5SWZB 4RGOH 2DF3A 1IAIM 4HGWB 5BQ7A 4X6DA 3SE8H 3HKFA 1NANH 4G8FB 3U0PB 4K3EH 4I77L 4OFKA 4YWGL 1BAFL 1AGDB 1XF5B 4KKCC 2JJSC 3VD9A 3BJLA 4K3JH 5C0FB 1CI5A 5L6YL 5FB8B 4Y4KB 1L7IH 4R3SA 2DM3A 3AS2A 4M61B 1SY6L 1F4YH 4C4KT 3FZUC 2JF1A 1GVIA 5JZ7C 3HAEA 4NQEB 2VISA 2EH8L 1MCRA 5HYJE 3SE4A 3EZ8A 3GSOB 4FS0A 3TZVA 3VDBA 1VGKA 2VMFA 5DMGD 3C5SB 3MFFB 1SEQH 1JK8A 3MRMA 4U2YA 4KK8D 4NWUL 4P2OB 2QKIA 4P2RB 2EDLA 3MRDA 3WN5C 3PWPA 1EFQA 2JB6A 3QDGE 2Q3AA 3P9MB 3FT2B 2HYMA 3P0VL 4ZQKA 2H9GA 1RFDH 4OD1L 1CD0A 1JN6A 2AEPL 1DVFD 2GQHA 3UTZA 4LSUH 4OZFB 3HNTH 1G84A 2DBLL 3MACH 1XH3B 3CIQA 5KTEL 1S7SA 4G7YL 1EUUA 1WIPA 3CFDB 1W8NA 1I75A 4IDLA 2MJWA 3O11B 1A4KA 4KRMB 4XNYL 2UWEA 2R29L 2P49B 5T5NG 4J3XA 5E9DB 3WXWL 4WUKH 3LIZL 4TSBH 1QBMH 3QI9C 3TPKA 3DVGA 3L3GA 4ODHL 4MNGB 1LNUA 1RJCA 1UEMA 3V5KB 2YPKB 2V7HB 5IV2A 3MGTA 1ZKAA 4PREB 3BDYH 3CVHH 1ZTXL 3ZKMC 2YK1H 5DJYA 3IJYB 2IPUK 4K23H 3JUYA 4GLRH 1BMGA 3RNQB 3VXRA 3BP4A 2DYPB 4HJJL 4OBSA 4OZ4A 3C6SB 4XI5D 3SKNB 5CJXA 3L95B 3QR2A 4YHKH 3UDWC 1DN0B 4Y2DA 4PJAF 4FQ2H 1YPZA 2F54A 3EO9L 4L3EB 1JTPA 1Z0NA 4IRSC 2VDNL 5DFVD 4CADA 3O3DA 3P4NB 1T2XA 4M6NL 4P46D 1I1AD 1NBVH 5CJQH 5CZXC 4BFEA 3C6LB 4NRXB 3SE3C 1MFDL 4RMQA 1U6AH 2W59A 4MAYC 3FFCA 3T8XA 2X44D 5I0DA 1GZQB 2Z31A 4X98A 1MCEA 3ZKXC 2X40A 2B2XH 4YBHA 3BKCL 4TULL 4X8JA 5C0DB 5EOCL 1F90H 3BIAX 4Z7WF 1FNAA 1DBJH 1NLBL 3VGHA 3ULVH 4MA7L 1ZLWH 2F8OA 4MQ7B 4ODUB 5SWZD 4OLWL 1QP1A 3K2UH 5FF6A 3Q3GB 3W39A 2H3NB 3SDCC 2HT4D 3QXTA 3S96A 3CC5A 5JHLL 5IF0A 3A6BH 4UNTA 4ONFL 4F57H 4EI5A 1KF9B 5D1ZA 5I1GH 2AJSL 1DUYA 4ZDHB 4ZPVB 2VXTL 4LLWB 5FYLL 4Y8AA 4KI5F 4XMKH 5I2IA 5GISL 4JCLA 1KCVL 3UJIH 5FM5O 1CDYA 1WCBA 3FO9A 5DR5H 5FYJL 2BSRB 2D7NA 4WNQB 3EGSB 1BLNA 4GG8A 5DGRA 1WAAF 1DANT 4OZGF 2FSEA 1FFOB 3PHQA 3SKMA 2QSTA 2BHYA 1S78D 1S7VA 1NMBL 2R8SH 1W72B 2R1XB 1KJ3L 5JIPA 3RPKA 4MXVF 2VLRB 4ZUSA 2VDQL 1E6OL 4NQCB 3CVIH 1NANI 3MRCB 4P2RD 1QO3A 3V7MA 5IM7A 5D7IA 4N8VB 5ICYA 1C5CL 4L8CA 2IANB 2D4DA 3IFLL 3OAYH 3ESVF 4QHLB 1U8QB 1EPFA 3ZE2F 5HYSB 1I9RL 3ZYJA 4LVOC 4XPGL 4PRDA 3VG0H 3UTTD 1U8IA 4LEXL 4LNVA 4AY0A 4JHAH 1FGVH 4G9FE 4HHAA 4APQB 2Y5TA 4LRIC 4LSRH 1X3DA 3O4OC 3ELAT 1OAXH 2EO9A 5TQ0L 3TO2A 3DETC 4PGCB 4DKFL 1QKZH 5IKCA 3DX6A 3GMQA 5I1AA 5F93C 4M7JL 2PYEE 1YMHB 2O5ZH 2DYPD 3NFPA 4BUGA 5DLMH 4GKNA 1YEHH 4K9EL 4JPWL 4XZUA 5D2LF 4X7FC 4YO0A 5KS9F 2PETA 1JPSL 1F6AB 4RA0C 1FYTA 1IGMH 1OTUD 5CD5C 1GGYA 4KV5F 1DFBL 1W0YT 3MRGA 4EN3D 5D1QC 5B39A 4KHXH 2QBWA 3H8NA 3L3OB 1KLGA 4JKLA 3T2NH 2FBJL 3EHBC 5MENE 2HTKC 4JY5L 5BS0A 3C6LD 3ES6B 2Z35B 3VRIB 5IOPA 3RTQA 2HJFA 2VOTA 3CCHA 4GLRI 3LQAL 4JFHE 3T0AA 4LLMA 1IEAB 4WO4B 3O3BB 4DGIH 3EBAA 2Z8SA 4X7TA 4PTUA 4WEMB 1QA9B 1S7RB 3PWJB 5E2JA 4OCSH 2VKWA 4BFIB 5DEZA 4J4PA 3GSVB 5J9PB 5IVZA 1J18A 3VXQA 5CJ8A 3VJ6A 4JJ5B 1KG0B 5F9AC 1A7OH 3EYQD 2MMXA 1B90A 5CSGA 1DQLH 5DMJB 1EHLH 4WWKD 1F4WH 2ORBH 1YN7B 3MLSH 2NXZB 4MWFA 3IFOB 4JRXB 4EQ3A 3K74B 3RWEB 5C08E 5C07A 2D9QB 4PJXF 3GSWA 4JFEB 3SPVB 5E7FA 4TUOB 5F70A 4XP9H 2DAVA 4WHYH 4WW1B 3STBA 1A6VL 2QQKL 2ZCHH 3VWKD 1OLLA 2WIMA 4NQCD 4C83B 1E6JH 4KGLA 3HHRB 3MXWH 4FXGA 5B3JE 4NNYB 4OUUA 5HGAB 1JZ7A 4XB8A 4NZJA 2D03L 3QXWA 4HK3J 1H3XA 4PRAA 1ZLSH 3QO0B 5DMYA 2DL9A 1DQTA 2VC2H 2BC4A 4DVBB 1RULH 2VLJA 4Y4HC 2R0ZH 4APQD 3O3EA 3B9KC 3C60C 1GGTA 1JMXA 2R0KH 3BGFB 3CVHB 4M5ZH 3U48A 1X4YA 5BCAA 1KXQE 2VH5L 5K9OA 3O41B 2XN9B 2OJZL 2VKXA 4MDJB 5JPNA 3MRBA 2Y1VA 2X89D 1AR1D 2FH6A 1DP0A 2VL4A 4MB4A 5DEGB 5JIIA 2DTSA 1FVDA 4HG4J 3ZZ1A 3HPLA 2R0LH 2R39A 2EE6A 4Y2OA 3NABL 5E00A 4KRNA 1DEDA 4PV9A 4U6HB 1BBJB 1MHCB 3ARSA 2EIEA 4HXBH 5GGVH 4AL8L 5LWYH 5D93B 2EDHA 4S1DD 2XWBA 1OP3K 4QYOA 4NC0B 1NGXB 5DD6B 5L0QB 2CD0A 1IM3B 3WNPA 4ODVH 1Q9OA 4RMSA 1NCNA 1MHHA 3MFGB 3QH3B 4N1HB 4GRWF 4U6TA 5HVHB 5IFAH 5E4EB 2R0WH 4I2XB 5D7KD 3PWPE 4M1CD 2KZWA 3EUUA 3I84A 4WO4D 3V4VH 1JYWA 5DURD 1IEBA 4PD4J 2EEBA 5M95B 1UFUA 4IDJL 3NMEA 5IFJA 4KTYA 4K94C 4MNHB 3ZL4L 5I75C 5CJBA 4EVNA 5DRWA 2CDEA 2GTZB 3P77B 1LGVA 7CGTA 1GH7A 2EDFA 5J7CC 3CUPA 2UWEE 4Y1AE 4LU5L 1TZHB 2MHAB 1X5KA 4RX4A 3QPXH 4P9ML 2RHEA 5LVEA 2NXZD 5T3ZH 3MV7E 4XRCA 4JRXD 3QB7C 5EIIA 1MQKL 3T4AA 1A6WH 3IETA 3VXRE 8FABA 3KPLB 4S1QL 1LO4H 1R3JB 4LQ1A 1CG9B 1OTTD 4GW4B 1CLYL 1XZ0A 4WFFE 4XXCA 4OLVL 1RPQA 1TJIH 4G6AD 5C0JB 4JFDB 4V2BA 2F54E 2QQLH 1S9WB 3LN9A 1RIHH 4R0LC 1J8KA 2UVFA 1ZVSB 3O6KL 4UIMA 2V17L 1EV2E 5SV4A 1LE9B 4Z7UB 1CFNA 3GUTB 5LGJB 1LE5B 1V05A 1U8KB 5I19L 1KBGL 3FFCE 1QLEL 3OXSB 5I6XC 3WS6C 3VXUD 5FV1L 1LVEA 1G6VK 4QRRB 1G7MB 1UM4L 1XGRA 4LBEB 4PJGB 2XN9D 1QYGL 2E7LA 2XWJB 2DQJH 1AE6H 3U0TB 5BJTA 4KDTA 4S1SL 1IGTA 2FX8H 3LMJH 3HZKB 5TGBB 3LHPH 2O61B 3U30B 1IAMA 1NEZA 4PBXA 4XNXH 1H15B 4PV8A 1FSKC 4XWOC 1BJ1H 5CZVL 1YY8A 2OTWB 4LSPL 5HHXL 1G9MC 2BCKB 4MA3A 1AP2A 1IVLA 3RHWK 3GIVB 2DKSA 5JDSB 3UCRA 1G0XA 1WFOA 3BZ4A 1ACZA 2NNAA 5I76A 4FQCL 2BFVH 3ULVD 3IRPX 1QFOA 3NIFF 4WTZG 3ARBA 4PJ8B 3UMTA 5GXBB 4ORGA 1OSPH 4NFBA 1DBKH 2VDRL 1ITBB 1H0DA 1MJJA 2HJKB 4K71B 3NBNA 1JGLL 2JJWA 3PABA 3AVEA 4MJ4A 4RWYL 4FHBD 1SJVA 3ARFA 5SX4H 2NXYB 2VAAA 1NEZG 4UB0H 2AEQH 4JM2B 5C6WH 3EJYD 2V2WB 2EYRA 4A2LA 3WKNA 3ECBA 1INQB 4O2FA 4TYUA 3QFJA 1M71B 2I07B 3WJJA 4LSVH 2CPCA 1E27A 4JFZL 3MNWA 1XAUA 4DZBB 1KT2A 1BFVH 1UZ8B 5FKPB 5HJ3A 1HIMH 1WF5A 4ALAL 3QDMA 2EIZA 3HLAB 4DGVL 1JP5A 2GT9B 4UOW0 3BZDA 5JPMA 5EU5B 3SGKA 32C2B 2A9MH 2VR5A 3DRTA 4BK5A 1FJ1B 3QPQC 3LRSA 3O6LH 1MLBB 2AV1B 4ZYKB 5DS8B 1NUGA 4M8QA 3G6AA 4XMPL 1O7SA 5JORA 2NZ9C 3GMLB 4X6BB 1FYTE 2JIXA 2LABA 4JFDD 3D1MC 1ED3B 5D72L 4P2QA 4ZAKC 2B1HL 4M43L 3MRPA 5GIRB 5E0QA 5K9QG 4CMHB 5CSZA 4GBXB 2APFA 5I1IL 1K3IA 1YUHB 3BEVB 2CLVA 5I71C 4HG4K 4ZOAA 1GIGH 2J8HA 3DMMC 25C8H 3IKCB 2AK4D 5FUCE 2ADIA 3SDDA 3MJ9H 3LH2H 1JPFB 4I1NB 1PKQA 3KNBB 4LHUB 4J3UA 3AB0C 3GGWB 2ADJB 3KHQA 4PR5B 2AJZA 5C9JA 1GGCH 4ZG1A 1IC5L 3OV6A 5F7LB 4MXQA 2IG2L 1FNFA 2AK1H 4JRYB 4PG9A 2JB5L 1YDPB 1CT8B 3TBSB 1ETZA 2Q86B 1S7QA 3VA6A 4QRUB 5EG6C 1CGTA 4MD5A 1YYLL 2APVA 4ELME 5C71A 1HYSD 1AY1H 1D9KC 1NCDH 1EH9A 2NPLX 2YD8A 3FFDB 1QFWL 1BD2A 2NY5H 2XZQL 2FR4A 4PD4K 4NUJB 4P46A 3UBXI 4GXVH 3RY6A 4GQ9H 4L4VA 2JJVA 3DLQR 5C07E 1NCWL 5GSVB 4U1JB 4NYLA 3IVKA 3OB0H 1YEFH 1CBVH 1M1SA 4N9GB 3A6OA 3FB6B 3TLRA 4PJ8D 2AP2A 1X5GA 3BP6A 4A6YL 3LEXB 2JLLA 1DBBL 1I8LA 1VFAA 4RMWA 5DRNA 2AVGA 2E9WA 2ATKA 5SWSD 3ZE0F 1F2QA 2ZUYA 2B5IC 3NFSL 4JHBA 2DWDB 4HGWA 1I9IH 1RAMA 1PLGL 5TDOB 5L2JB 1N3NA 3G5ZB 3FN3A 3VA2C 2NXYD 1AJ7L 1NGYB 1G6RH 3TIDB 4DK3A 3LS4H 2ZUUA 4JREC 2VLJE 1AGDA 1XF5A 2UYLB 2BNRB 4XHJC 4IOFC 2FBOJ 4JZJB 1MEXL 5D1XC 5FB8A 3QUMH 4Y4KA 4F9PC 1LEGA 4HMEA 4M61A 5IESH 4Q6YA 2ITDB 4N8CH 4PJDF 4NQEA 5LGHH 4LIQE 2L7JA 3GSOA 1CDCA 3BP7A 1UJ3A 1QRNB 3DUUB 3WMSA 5EO9B 3OSKA 3QO1B 4HPYL 1G7QB 4PP8C 4P2OA 1OARL 5CIPH 4U6XB 5SX4I 3HUJB 1GOFA 3O3UN 2Y7QA 3BKYH 3KS0H 3QUZD 4F37K 4ISVB 4PY7A 1AGBB 3QRGL 5EH1A 3LDBB 4OZFA 5E2TH 3I9GL 4Q0XH 3G6DH 1MCBA 4NDMB 4OLEA 3VDAA 1XH3A 3UBXB 3CFDA 3SKOA 4GBXD 3O11A 2O5YH 1B0WA 1IRAY 4TTDC 1UJTA 2CGRL 2NZIA 5E9DA 3MNVB 4LHUD 2ZUXA 2VXVH 3QJHB 4MNGA 1EFXA 1L0YA 4ZTOH 5JW5A 3V5KA 1MJ8H 2V7HA 5FXCH 4PREA 4DQOH 4JRYD 2VZOA 2XKUA 1K6QH 5FKAB 1T80A 3RGVC 3QQ9D 5HTSA 2I60L 3V0WL 1BX2B 5I74C 3C6SA 5F1KC 3SKNA 1TQCB 4XCNA 1QR1A 4OAWB 2MQCA 4QHNB 1TVHA 3IXTB 2MKLC 3KPOB 1B3JA 4L3EA 3UZQA 3K1DA 4KJQC 4LCCA 3HNVH 4QCIA 1C7SA 1RU9L 3X17A 4U0QB 4C56D 1LQVA 2C9AA 3S4SB 1PZUB 4W68A 4LEOB 1NDMB 4Y16C 3NCJL 3JTTA 2VQTA 1Q0XH 4K7PH 4PTTB 2XFXB 3G6JA 2GK2A 1Q0YH 3V8CA 1OPGL 1ZGLM 1OAYL 4ODUA 1WWWX 3TN0B 1T83C 2AXJA 4E5XB 4N9OB 3W9EB 5IFHL 4F7PB 4LP4A 3Q3GA 3PNWA 2H3NA 1H8OA 4WRLA 4PRNB 2P8PB 1D6VL 3HA0A 2NQCA 3EOAA 3BUYB 4U2ZA 3QNXA 1P4BL 4M93C 2FHCA 1X7QA 4ZDHA 1EO5A 2C3VB 5T3ZD 4OZIB 4LLWA 1NAMA 2BNRD 1G7HB 1HOCB 2RCSL 3LN5B 3MV8E 1UZ6F 1MRDH 1FG9C 4WNQA 1YNLH 1DDHB 1N6VA 2F15A 3IT8D 4DEPB 2E7LE 4UV7L 1GL4B 4WFEE 4JFFD 1W72A 3DTXB 1I7ZA 3MUGB 1QRND 1T5XB 2VLRA 4XVUD 5HYIA 3RWCB 3LD8B 2AXFB 5JA8B 1CGVA 1B0RB 3OZ9L 1L9NA 5HHME 2YPLE 4N8VA 1MJUL 2IANA 4PJIB 4E41B 3L3KB 4D0CB 3HE7C 4NWTH 4QHLA 1GGIL 3PXJA 4YDKL 5HVGB 2VNCA 1ERNA 5I1HL 1UACL 3STZB 1KCUH 5AAMA 5DK2A 2GHWB 4X6EB 2CDGB 5LXGH 3EYUL 1ORSB 1UM6L 3U79A 2XNAB 2X9XA 5BO1H 1CE6B 1F6LL 1BEYH 3DECA 3MRFB 4JKPL 4PGBB 3ZE1E 3IU4L 5J1SC 4F8TA 3MLZL 3BJ91 1XR8B 3PQYB 2DQCL 5DUBB 4PGCA 2ZZUT 2VZ3A 5EBWB 4H1LH 2IAMB 3BEWB 3TJHA 2QADC 2Q6WA 5IWLC 1YMHA 1P7QA 4JR9L 3BDXA 3VFPA 2FX9L 2P1YA 5AAWA 3WLWC 5L88L 3KYKL 3L5WA 2IH1B 3DO7B 5A2KH 1F6AA 3QFJE 2X70B 1MWAA 2IPTH 1B9ZA 5HYSG 1GPOL 1QPPA 1BGXL 1KJ2B 4FOMA 1Q9KA 2KH2B 4HLZG 4ODWB 3TBYB 3QDME 1H3GA 4PYGA 4YAQB 1ZGLP 4AG4L 3C08L 4QOKB 3TA3C 4BQCA 3EDKA 3ES6A 3O2DH 3MBEA 3VRIA 2ZUQB 3C5ZB 3N1FC 1FPTL 1RZKH 4AENB 1HHHB 3GFUA 1E4KA 2X5PA 4NQTA 4V3DB 1CGXA 1IGIH 3D25A 1IEAA 3MOAH 4QEGA 1MAML 3O3BA 1G6RB 4HF5H 1QA9A 4P2QE 2ERJC 5ESAB 3CU7A 4BFIA 2ZSVB 3EOBB 5JA9A 2Q1EA 3EYFB 1BWWA 4RBPH 2HLFC 1BFSA 1HNGA 3S7GA 4FQJH 3L3HB 2CSPA 4NZDA 4U1GC 1HXMA 1KENH 1OF2A 1YN7A 2EZ0C 4N0YH 1JFQL 4RAHA 3IFOA 3VXSB 5CS7A 1LK3H 5E5UB 1F4YL 3QP3A 3X11B 3DYPA 4YUEH 4JFEA 5CIPB 1BECA 1MVUB 4NO5B 4PJAB 3HZVA 1I3RB 2O26U 2V7NA 2AQ2A 5IBTH 1WZMA 4GG6F 1SEQL 4MYWB 1J5OH 3BQUA 1IC7H 3FOMB 1BIHA 3RX5A 4MGXA 4RRPA 2OZ4H 2P5EB 4BM7A 3LB6D 4MAUL 4KKBC 4MCZA 4E41D 4NNYA 1FLTX 4JDVB 3S37H 2R15A 5T3XE 4M03A 1RFDL 1F42A 1BD2E 3K8KA 43CAA 2GTWB 3HTLX 4L4VE 4Z7WB 5I66B 3MACL 2ZPKL 2V5TA 2FL5A 3HE6B 4GRWH 3RVTC 3C9NB 2PR4H 5C6TH 4Q9CA 3F65A 3GHEH 4WUKL 5FM8A 4PP1D 4QRTA 4TSBL 3PQYD 3O41A 4MDJA 4FZ8H 4X4YA 3CVHL 2YK1L 3MV9A 4K23L 4QXUH 3MLTB 2FB4H 4IMLA 4WFGD 2NY0C 5DUPH 5J06A 1KUMA 4U6HA 4MS8D 4OZGB 4JO4L 1BBJA 1MHCA 1KIUA 3DRQB 4P57A 4N0FB 3SGJA 1JNNL 4U4BA 1RURH 4FQ2L 3CDFA 4HCRH 3RAJH 4NKQB 2IFFL 4JQVA 5IW1B 5DD6A 1MCKA 1IM3A 3EIFA 2VDLH 1CICA 4QOKD 4NQEE 4PJBB 1UM5L 4BK4A 3C5ZD 3ZDXE 3QIWB 3QH3A 1IFHL 5ENWB 3K4DA 3UTQB 4ZUUB 5EU7E 3ARDB 4P2RE 4I2XA 2D9CA 4NKIH 2CK0L 4GRLB 2EEAA 3WFZA 3ULVL 5FGCB 3TZVC 1Y6MR 4ONGH 3P0YL 3ARWA 3LKPB 3OKLA 3PHOB 4KQ4H 4OI8A 4NM8L 4PB9H 3WXVL 4WUUA 1NUFA 4XNQA 1SMAA 2GTZA 3TV3H 4J7RA 1YEEH 3VFNB 4MQXC 5I1GL 4NN5B 1ZLWK 1EERB 1OSZB 4HK3N 5E9DE 1BHGA 2V9TA 4XMKL 4E42B 3LPGA 1I7RB 4MNGE 5D2LB 5FA4A 5BOPA 2DICA 1N26A 3MRRB 5KS9B 5IQ7H 1UQSB 4ZS6D 4R96A 4NUGL 1YZZA 4NFDA 6CGTA 4GS7C 1J05B 1B2WH 4CN1A 4TVPE 4TSAH 4PS4H 5T1DH 3MBXH 4HH9B 3K3QA 3RP1A 4Y5VB 3GK8H 4U1MA 4L3EE 5CJXC 4JG0H 3HN3A 2YD6A 1G7PB 1FGNH 1NGQL 4NKOB 5E1AA 5HHOB 4Z7UA 4F7CB 2P8LA 3FAXA 4L8SA 2D7TH 5LGJA 3L9RB 1U8KA 3VFUB 3HE6D 4X9BA 2MCPH 4D9RD 3OAYK 5F7DA 3UO1H 3IDMA 3OKOA 3QI9B 4ZODA 4XP4L 3OXSA 1CDHA 3MO1B 4H1LB 1AGCB 1OAXL 1MCOH 3G6JE 4YDVB 4LVHB 3OAUH 4QRRA 4GKSA 2BXYA 2YWZA 3U6RA 3QWQB 1F3JA 5D2NB 2Z31C 5DDHB 3OKNA 1BPVA 3H9SB 3L5HA 4KI5D 35C8H 2DLFH 4NRZB 4ENEC 2O5ZL 3R4DA 2EH7H 4WU5B 1Z9MA 2LTQB 4O51B 5INCA 3JSSA 1YEHL 5C3TA 1WCQA 3VFWA 4PJXB 1IGML 4IRSB 1HHJA 5ANMB 3L3DB 4K07A 1I3GH 4EI5C 3V6OA 5TQ2L 4IJ3B 1OWWA 5JDSA 4KHXL 3V4PH 1RI8A 3TJEH 3NH7L 2A77H 3T2NL 3RZCC 1JIBA 3FQTB 4NOBA 2NTFB 1U8JB 2VLRE 4KI1A 2F74A 3QIWD 5B3JF 4I0PA 4KRPB 3VFTB 3WS3A 1F11A 4JHWL 3RY5A 3X13A 4XAKD 1FZOA 2IANE 1T6VN 4RSVA 2DQDH 4DGIL 1TDQA 1IC4L 2ICES 2HJKA 1FZKB 3H3BC 3FO0H 3F58H 3SKJH 5C0CB 1YMMA 2PO6A 1JYNA 2QSQA 3V52H 2G9HB 1BJ1J 4XP1H 5HI4C 2HG5A 3EJJX 4JM2A 4KKCD 3HS0A 1INQA 1I3UA 1JF1B 1M71A 2I07A 1A7OL 1A7RH 4IEFB 1EEYA 3IDYC 1DQLL 4JFQA 3WIHH 4DZBA 3B9VA 3KR3H 3ARXA 5KAQG 3RNKB 4X6DF 4MVBA 5JZ7D 5DMKB 3HLAA 4FQLH 4RGNB 4HT1L 4S11A 2GT9A 5E70A 5C9KA 1A8JH 3RWHA 3S3JA 2G5BB 5FGBA 3QUXA 1C08B 1RK0B 3RDTC 5B8CB 5C2BH 3WD5H 4HFUH 4ODTH 3H7LA 4D2NA 1T7XA 2A2QT 2WMPA 3D3VB 4Y5YC 1IQDA 4LCYA 1E6JL 5KOMC 4X6BA 3V4UH 1KCRH 4X4ZA 1ZLVH 2QSCH 5FDWB 4KPHH 4EKXA 4F2MB 3PUCA 2VR4A 5JUEH 4QWWC 2ZG1A 4GRWB 1KTLA 3GI9H 4X7SL 5DJXA 5GIRA 4R26L 5HHOD 1TTFA 5HHPA 1VFMA 2BVOB 2X4OA 43C9A 1YUHA 1RULL 3BEVA 1S7UB 4P5MA 3W81A 5TH2A 2VXQL 2R0ZL 3IKCA 1ZT4B 3QI9D 2GFBB 3LQAC 3GGWA 3RWDB 4WHYG 5ICXB 4NBXB 4G43B 3NA9L 3RTQC 1R5IA 2P7TB 1CTOA 5FUCC 4JRYA 1T7VA 4RZCA 1WBZB 3E0GA 3H9SD 1F8TL 1U93B 2R1WA 4FQQB 1OT1A 5E5MB 4ZPTB 2C1PA 2J3SA 2Q86A 5DUML 3QIUB 5F89B 4I4WA 3VGBA 2EDNA 4QRUA 3DBXB 2ZOLA 2BSTB 1RJLB 1QZ1A 2AJXH 1A1OA 2Z91B 4IRSD 4J4PC 1D7FA 3FFDA 4OB5L 4HZAA 5F7KC 4QHMB 2Q20A 3UTSA 1G9MH 4YFLF 3LQZA 4NUJA 3HPJB 3U7AA 3MCKA 1U8MB 3G08B 4JRXE 3NGBB 1NLDH 1T6WA 3VFMB 1FZJB 4MAYD 4U1JA 5JOEA 2FHFA 4JFEE 4Y89A 4ODVL 2RIKA 3O2VL 5HHNA 2GY5A 3GRWL 4LHUG 3FB6A 4KRPD 4L29B 1YPZF 5CMAB 5DD5L 3A67H 4PBVC 5IFAL 4PGZA 3CAFA 5B38B 5JQ6H 2PW2B 3V4VL 5TPWH 3KLHC 1C16B 1EBPA 2JELH 3PDOA 4GSDH 5D6CB 3SDCD 3HCVA 3RKDC 2DWDA 4UNVA 3NN8A 3TFKC 4QRPB 5DFWH 5TDOA 3G5ZA 3D0LB 4OJFL 4XWGH 4TNVK 4QXGH 3TIDA 1HINH 2BVPB 1TCRB 1NQBA 1ZT1B 4JN1H 4K7PX 4HKJB 3ZYIA 2XA8L 3RBGA 3U83A 4KJYB 5FO7B 3QPXL 2P44B 2XN9E 4D8PB 4HS3A 1A6UH 5T3ZL 4PP2A 5L2KA 4M02A 2ITDA 3TVMB 1AXTL 4I9WE 1VFUA 2HKFL 4LPWA 4O02L 3MV9E 3DUUA 1A6WL 4YNYB 1QNZL 4LCWB 4Q58C 1EX0A 3Q1SH 1LO4L 2B1AH 3AUVA 4Z7VA 1ZXQA 4U6XA 1HSBB 1CYGA 1HQ4A 3V8OA 4GRMB 4BQBA 2XZAH 4NJ9H 3UPRB 1J1OH 1CK0L 4P9HC 5IR1B 4LF3B 2G75A 5BZDB 1AGBA 2B4CH 2GYSA 1UB5B 2QQLL 4JANB 1TTUA 3KPPB 4MD0B 5TDPA 1ZHBB 4NDMA 2P42B 4NZUH 5J6GB 5CGMA 3O4LD 3B9KB 5D7IF 3ULVE 3H7BA 3FRPG 3CFEA 1YNKL 3CMOL 1L0XA 4I2XE 1Y6NR 3DETD 1FHGA 2VUOA 1DQDH 1FL5A 2IPKB 1D5IH 4IHOA 1AE6L 3T09A 3LPFA 1AHWA 2Y4SA 2FX8L 5A3IC 3C87A 4DJMA 5DJ8B 3QIUD 1ZA6B 3U7YH 3GB7A 3ARUA 4XPFH 4XNXL 4OAWA 2X9WA 1A3LH 1WBXB 2DQHL 4OM1L 5JO5A 2HA1A 4HIEB 5HVFB 2D3VA 3EHBD 4L8BB 4X7CC 3UBXG 2HTKD 4S0SD 1QHOA 1VSCA 5MHSD 4EIZC 1M4KA 1MCIA 3BUTA 4OKVB 5FGSA 2DLIA 4PJHF 4PJFF 3X12B 2F8XC 4LEOA 2BFVL 2R69L 2ZJSL 5IHLB 3S35L 2YS4A 2XFXA 4IIQB 4ZUTB 3IJSB 2GJJA 1K8IA 1AKJD 1OSPL 4MZ3A 1DBKL 1PAMA 3GSUB 4JFDE 3TN0A 2AJVL 5E8OB 2AJ3B 4F7PA 3T2PA 3CZFB 5JOPE 4XXCC 3TO4A 1BOYA 3QXUA 4PRNA 2AV7A 2P8PA 4QRPD 1T0MA 4EQ2A 1CD1B 4Z7UE 1INDL 1DQQB 1A02N 4UB0L 2AEQL 1AFVL 1ITCA 5HPMB 2C3VA 5I17A 4Q2ZB 1G7HA 5JMOC 2CDFB 1RV6X 5CZKA 4JVWA 1TZIA 5AYUL 5CP3A 5E2WL 4U05A 1YEJH 1BFVL 4QRRE 1DDHA 5KSUB 3KYMA 4XC1H 4PJGE 2LFGA 3QEQB 4JAMA 1PYWB 3TVMD 2VXSL 5I0ZA 2LU4A 4YHZH 2OQJB 3S4SG 2VLKB 3DTXA 3MODH 3MUGA 1MRCH 1T5XA 1NH6A 2A9ML 5IGXH 2ED7A 3BFOA 3EZJB 3RWCA 3O6LL 3MRQB 4V1DB 2E7LC 2VLME 1B0RA 4S2SB 3U9UB 4I48B 1WIUA 4Y0GA 4GMSL 5DA0B 4NT6A 1KCLA 4WGWB 4KDTC 4L4JA 5F7NC 1IAKA 3SOBH 4D0CA 4O2CB 2MSPA 4GFTB 4R0LB 4HUXB 4U1HB 1MFAH 5KVFH 5KZCB 1G7JA 2ICEB 3DIFB 1KEMH 2HFFB 2XZCH 5GS0H 5D7SL 2PYFA 3MJ9A 4X6EA 4Y4HD 1ORSA 2EKSA 2HVKB 3FCTB 4G6FB 1R3HB 2DKUA 4FQ1H 3C60D 3B9KD 5ECJE 1CE6A 3FJTA 1T4KB 5HI5C 3MRFA 4PGBA 4DKAA 1NCBH 25C8L 1HCFX 2AERT 5IB4A 1Y18B 4F58H 3LH2L 2NLJA 4NQDB 3BRDA 1XR8A 2FYYB 3X3GL 3S37X 1M7DA 1GGCL 3MLRH 4ZFGH 3ZTNL 1GOGA 5EBWA 2IAMA 5TE4L 5BXFA 4XGZB 3LRHA 1T66C 1YJDL 3LSOB 2FATL 3T0BA 3PV7A 3CFBB 1QD0A 4WY7H 4B53A 2IH1A 4YHIB 1YEDB 5I18H 1ZA3A 4C54A 1OD7A 5GGUB 3A6CH 4PJ5B 2FCBA 4FTVB 4PJDB 9CGTA 2OI9A 3AREB 5L7XH 4MB3A 4Z8FH 1AY1L 4YE4H 3JWOC 5E8NB 4ODWA 3BWUC 4DTGL 2NY5L 1MFBL 3HR5B 4PJEF 3DUHA 1IQWH 4NKMB 3X3FL 2ZG3A 5L8KB 3WJJC 4GXVL 2DWEB 4XCEA 1RIVH 5KVDL 1KJ2L 1JNHA 4KWUA 1CFVL 5LGKA 4RQQB 1YEFL 4G42B 5B4MC 1P5UA 1CBVL 4KKLD 3N1QC 1HHHA 3QCVH 4ZSOB 4PIRF 5DSCB 5IMOB 1T22A 3HB3D 2AGJH 4XPTH 4CAGA 3BGMA 4DUXA 5ADOL 1QLRB 1U58B 2W0FB 4KK8C 3W9DB 2ZCLH 3OB0K 3TYFB 5ESAA 1QFWM 2QQNH 3EOBA 2CQVA 3O6ML 3OKMB 5TF0A 4MA8H 5DJ0B 1MUJB 2C5DC 5IIEB 1ADQA 3DXAB 1G6RL 3QUMA 3LS4L 1MFEH 4XNZB 3VFGH 1NUDA 3L3HA 5J8OA 1TPXB 1A7QH 1EMTH 1NDGB 2Z4QB 2IJ0C 2EYSA 3VXSA 1JTOA 4H5SB 3QEQD 4FRWA 3CXHJ 3SDDC 3X11A 4JRYE 5CIPA 1TJHL 4NO5A 3B5GA 3UZEA 1KN2H 2NY4C 4V1DD 4OF0A 4YFEA 5DJ2B 4HUMB 2P5EA 3WFBL 5JW4R 2XTJB 5DI8A 1YECH 3ARQA 4OFVA 2L4OA 4JDVA 4NO0D 5FHAL 4NQVB 3WDJA 5J12B 5MEQB 1IGFL 1MF2H 1ZVHA 1P4LA 4OQTH 3UTSE 5KZCD 3NZHH 3ULUF 2V9RA 3V6FB 3D0VA 4LLQB 4K8RC 5CUSL 1MFNA 4PRID 4R7NA 4Z7WA 5I66A 3MGOA 3DMMB 3E8UH 4G6FD 5AZ2H 5D7JB 1GC1L 4QF1B 1KTDB 5JOFA 5DFVC 4P46C 4P2CG 3CLEH 3RY6C 1HHIA 1PQZA 3LKNB 5FA3A 4Q9RH 3T08A 1U95B 2VXVL 1B4JL 3RWIB 4XHQA 1CN4A 1MJ8L 1U8OA 4CU6A 1I4FB 4FMFA 2I5YH 4Z76B 3CD4A 4DQOL 1FORH 1K6QL 5TE7H 2OR8A 2HLAB 1LO0L 3U4EB 4CVUA 3MLTA 3E6HA 4WI6A 2OR9H 4RWHA 1AC0A 1I8LC 1AQDB 2W92A 1U3ZA 2VO5A 5T3ZE 4OZGA 2NW2B 3UAJD 4PJ5D 2HT4C 3ARED 3DRQA 4N0FA 4OLUL 1TNNA 2DQGL 1JCKA 2O5XL 4HUUA 3UC0H 3GJFH 3HNVL 5FECA 5L2KE 3BPLB 5ADPH 3FONB 4R8WL 1JJUA 4PJBA 4CN6A 3ZT6A 4Y4KC 2VYRE 2YXMA 3PP3H 4Z95H 1FL6A 4DN3L 3UTQA 4LASH 3H9HB 1QRKA 4GW1B 5FDYA 3ARDA 4HC1A 1FYHB 1KGCD 5IROA 1NGZB 4GRLA 2GY7B 1UJ3C 2XACC 3NZ8B 2NR6D 4BFGA 2I26N 3AS1A 4YDJB 2XY1A 3K8LA 3LKPA 4M00A 2NCMA 3MJ6A 3OHXA 2FWOB 4P2OC 5EU7C 4W4OA 3L7FB 3VFRA 4R4ND 4M7LT 1TIUA 1A1NA 3ZE1F 4ZNEA 1KCKA 2XV6B 5D5MF 3VFNA 3BN9D 2N7BA 4JO2H 1UVQA 3KWWA 2YSSB 1MOEA 5KN5B 4N90D 5FO9B 1I7RA 2B8OT 2DQUH 1LO5A 1NGPH 5D2LA 2EKJA 4ESKA 5DD3H 3L3IB 3T3PF 4OM0L 4DGYH 3QPQD 3DVNB 1FE8H 4OFYA 2W91A 3IF1A 2NZ9D 5HYJB 1K3ZA 3DV6B 2UZXB 5D9SB 1NSNL 2J6EL 3LN4B 1AO7D 3HC0B 2XTJD 1GYAA 2I9TA 3OXRB 3NVQA 3QDGB 4U3CA 1C12B 5HGHB 1KCUL 1G7PA 1OTUC 1IKFH 5EZIH 4LNRA 5LXGL 5E2UH 4IMKA 5DT1L 3DMMD 5DZNA 4F7EA 3VRJB 5EDXA 3VFUA 3VXPA 4KMLB 5BO1L 4JN2A 1QACA 1U8PA 4RMTA 2BNUB 2GK0B 4LVEA 3MO1A 4H1LA 1MIMH 1AGCA 4YDVA 1DLFH 5I30H 4QTIH 5D2NA 1AXIB 1DTUA 4EDXB 5DDHA 4JPKL 3D39A 3H9SA 4Z0BH 3AC0A 1OAKH 1NCAH 3F6IA 3ARPA 2Y25A 1BJMA 4NRZA 3TCXA 2DDQH 5GJSH 4Q9QH 4WU5A 4C59B 4YIQB 4Z0XB 3U46B 4ZD3L 2BVUA 4U6YB 3VI4E 5IEHB 2HJLB 4OZIE 4MLIA 1YEGH 1EGJL 5ANMA 4NKDB 1AQKL 3L3DA 1BVLA 2FRGP 3O2DA 4FXKA 4TN9A 1TTGA 4LGPB 4GG6B 5AEAA 3OX8A 3ERYA 1QBAA 3EYQC 3H2WA 3E3QA 3NPZB 1CFQB 3ALPA 3AM8C 3OMZA 3WIIH 3LV3B 4NQUA 2NTFA 2HVJB 1U8JA 1J0JA 1HQRB 1QQDB 1T1XB 1RZKL 1RUKH 2EDKA 1WZKA 5BVJB 2ZOKB 5DF0A 1Z3GH 1IGIL 3NCBB 5EN2A 1VA9A 3EDJA 4PJIE 4TNWF 4E41E 2BRRL 2GITB 1U3YA 5ACZB 3SDYL 3HAEH 2QR0A 3P73A 5C0CA 5KSAB 3RIFF 3T2QA 4M5YH 1C5BH 3CXHK 4MQTB 2N56A 4CMMB 5BV7H 4WWID 2JTDA 3KLAA 5GQBA 1MLCA 5I1LB 1JF1A 4UTBL 4HGMA 5FIEA 1ZK9A 3CU1A 2VQ1A 4NRYA 5CKAA 3WCYA 3DGCR 4RGMB 3THMH 2F53B 3VI3F 1KENL 3WIFB 5EWIL 5FK9B 4GKOA 5DMKA 4APQC 4RBPK 4XP6L 3MJ7B 2G5BA 2VSDA 3EJZC 1C08A 1RK0A 5HGDA 1XGUA 2OZ4A 5B8CA 3CK0H 2H32A 2Z0BA 4P2YA 1OCWH 5IBTL 5HYJD 2IQAA 2NX5B 4F37F 3D3VA 5ID1B 1J5OL 1QBLL 5KOVC 3K1KC 3TJHC 3IFNH 3VD3A 5GS0D 1EO8H 5EBGA 4KKAD 4QTHB 5FDWA 1NUNB 4F2MA 4LSSH 3BYTA 1OQOA 3QDGD 2E8YA 4KAQH 1S5HB 3EDDA 4G6MH 1IGCH 4N5ED 3ARGB 2W9DH 2BVOA 4YGVA 4TTDD 3GO1H 4YR6B 1PFCA 1ACYH 2XXCB 4UQ3B 1ZT4A 3ALXA 5GGTA 1UG9A 5C0RH 1IAIH 5C6TL 4CNIB 1DL7H 3CFCL 3JWDC 2X1PA 3MBEC 4LRNH 1ZE3C 2P7TA 3RGVD 1I9EA 4OLXH 4FQQA 1U93A 1E4KC 3KYOB 5E5MA 3WJLA 2V6HA 4OZHA 4YEFA 3OF6A 4M1CC 3HNSH 3D48R 4WO4C 1AGEB 3P4LA 4LGRB 1OAUL 5T1KA 1VCAA 4HCRA 3RVUC 4HUKB 1RJLA 1KXTB 2P24A 1KPUB 1RK1A 3GJFB 3UJTH 5K9KB 4KH2A 3V0AC 4KUZH 5IB3A 2Z91A 3ARTA 3O8XB 4KJQD 4JZOB 2WQ8A 3NPSB 4QHMA 1RURL 1SBBA 2WWKO 3HPJA 3QNZB 3RAJL 3VXSE 1U8MA 3U7WL 2WBJB 4Z77B 1R3KB 3VFMA 4E0RA 2HFEA 2VDLL 5D96B 2WK2A 3M1BB 1MHPL 1TQBB 3SY0A 3I75B 1MCLA 5A2IH 3B9AA 4XNUH 2P5EE 5CP7A 3SJVB 4AT6B 5B38A 1N8ZB 2YC1A 5D6CA 1W0WA 1OTTC 4F15B 5KSAD 3REVB 4J1UB 2OS7A 4HAGA 3F62A 2FIKB 4KQ4L 4JG1H 4LKCB 2CLRA 4Z7WE 2BVPA 1TCRA 2F8VA 5A2FA 3G6JF 2BY3A 2QV2A 1ZT1A 4U1GB 4P3WA 4OGXL 3TV3L 4TVSa 4HKJA 3O0RH 5GRXG 3H0TB 1I1RA 4LLYA 2F53D 4YHLH 3WO3B 3MLYL 4OF3A 4HWBA 3OJVC 3S5LA 1T20B 4RIRB 5I8KH 3T2OA 2NY2B 4KVCH 4UILH 3BGFC 5IQ7L 2FJHB 3IDGB 4HDIB 3WNMA 4KI5E 3JV5A 4YNYA 1IGJA 4LCWA 1HKLL 1MNUL 1NCCL 1T5WB 3NCFB 4IRZH 2E8ZA 2CRMA 2NX5D 5EA0H 5F44A 1HH6A 5E8PB 1WAAE 3E1F1 1G7LB 1HSBA 4OZGE 3MBXL 5KVMC 4GRMA 1A7PL 3D9AL 3UPRA 1G9EA 5IVOA 3GK8L 4LVNB 4I5BA 2OTUA 5ICZA 4MXVE 5BRZA 4IOIB 3KPPA 1ZHBA 2R4RL 1HKFA 4EDWL 5J6GA 4ZFOB 5HY9B 1NGWB 1Z5LA 1FGNL 3MCLH 3ARGD 1CE1L 1S7XB 2VB5A 2NY7H 4I3SH 1KNOA 5TF1L 3SGJC 4PJBE 3CSGA 2YUWA 3KPMA 3RA7H 2NY6B 5D93C 3V5DB 3ZE2E 4JQVC 1K8DB 4HWZB 5C0NC 4XAKE 2N7AA 5L0QC 4G9FD 1CICC 3QWRD 3DX7A 4Z5RA 3BKML 1UCTA 4MXWH 4YBQC 3ULVC 5FGCE 2DS4A 1KSRA 1XGQA 2QADD 3SQOL 2IPKA 2R56L 2XPGA 3P11L 5FUOH 1EXUB 5E4EC 3INUL 3WLWD 4DN4H 1DLHB 5ACLA 35C8L 2DLFL 4HQQL 2PNDA 1CZ8H 5BQ7B 1B0GB 4X6DB 4ZNEE 2XOTA 5KANI 4WU7B 3GSQB 5E2VH 1YY9C 3F7PC 3G5YA 4UAOB 3KPQA 2BVQA 4XP5H 4YZFF 5FOJA 3O8XD 2A38A 4HIEA 1IJ9A 3MMEA 1F3DH 5DD1L 3WFDL 3TA3D 5D2LE 3E2HB 4OSUL 2WBJD 1IAII 2BMKB 1QSEA 1K4DB 1UWGH 5FYKE 5E8EB 4G6JH 4R3SB 1N0LA 2MOVA 5FCUH 3X12A 3HAEB 4M7LL 5MEND 1ZANH