3RWIA

Rhesus macaque mhc class i molecule mamu-b*17-gw10
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
276
structure length
276
Chain Sequence
GSHSMKYFYTSVSRPGRGEPRFISVGYVDDTQFVRFDSDAESPREEPRAPWVEQEGPEYWEEATRRAKEAAQTHRENLRTALRYYNQSEAGSHTIQKMYGCDLGPDGRLLRGYHQSAYDGKDYIALNGDLRSWTAADMAAQNTQRKWEGNRYAERFRAYLEGECLEWLRRYLENGKETLQRADPPKTHVTHHPVSDHEATLRCWALGFYPAEITLTWQRDGEEQTQDTEFVETRPGGDGTFQKWGAVVVPSGEEQRYTCHVQHEGLPEPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Major histocompatibility complex class I
publication title Structural basis of diverse peptide accommodation by the rhesus macaque MHC class I molecule Mamu-B*17: insights into immune protection from simian immunodeficiency virus
pubmed doi rcsb
source organism Macaca mulatta
total genus 72
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2011-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3rwiA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3rwiA01
3SDAA 1BVLB 4JM4H 3QBTB 5L2KA 5T1DH 2DQGL 2R9HD 1V7NH 2XNAB 1J88A 1UVQB 5BCAA 5FGRA 3FAWA 3P0VL 1YN6A 4JANA 3IJYB 5ESQA 1J0JA 1I1AC 1ZT1B 2HTKD 2W9LA 2OX5A 4HGWA 3RWIA 1ZSDB 2R4SH 4M3JA 1HXMB 5D9SB 3OXSA 4Y5VA 4JDTH 1AGCB 3WHE1 4HS8L 1C08A 4S1DD 5E8EB 3TLRA 5J57B 1Z5LA 5D1ZC 2AK4E 1PKOA 1IC1A 1MCCA 3BIKB 1YYMH 5HHNA 2HP4A 1NC4D 2OZ4H 2ESVA 3ROOA 4IDJH 1J8KA 2R56H 2EC8A 1YY9D 2C1OA 2CMRL 3RIFK 1NCDL 1JWSA 1R3LA 4N0FB 4OZIB 4DGIL 4YHKL 4A6YL 1IJ9A 3BH8B 4OZHB 3G6AA 5LGJA 4M1DH 1FYHB 2ZCKL 9CGTA 1IZKA 1MY7A 3FO0H 1AO7B 4LSTL 3C5SA 4HCRL 3BQUB 4J4PA 2W60A 4Z6AT 3EZ8A 4LP5A 6FABL 5CWSA 2PTVA 4HPYL 1CGUA 5CIPH 1NCBH 1QFPA 5E6ID 4MZ3A 3PGFL 5FK9A 4CDHA 4FRWA 4NQVA 1Y6KR 1TCRB 1W2KT 1AGFB 1PW3A 1A6VH 3E2HB 3IDJB 3OXRA 4KKBC 4TULH 4ZNEA 2A83B 2GYSA 2P43B 1E28B 1IGJB 4QCIB 3C6SA 4OCMC 2IQAB 4UZGA 3T3PF 4JDZB 5K9KA 2O61B 5FOJA 4MDIA 1EAPB 5IG7A 4UINL 2ADIB 3ARUA 5GZOD 4LOUC 1MCPH 2K3TA 1YZZA 3PJSA 1UA6L 1KENH 5TE7L 3LEXA 2XI9A 4ZFGH 4DQOL 4PUBH 4O51A 4UAOC 3C5JA 2F54D 1MIEH 5E8DH 2BVQB 4I3SH 4KXZH 3M1BA 3I02A 1UWEH 1ORSB 3UYPA 4PGZA 1ZLSH 1PG7L 1LWRA 4PJBF 4LEOB 3AREC 4CW1A 2HT3D 4P59H 4NUJB 4PJCA 1A7NL 5SWZE 4KI5F 3VXMA 4PRIA 3WS6A 4P5MB 4Y4KD 1BLNB 4S1RH 3EGSB 2X4NA 1QLRB 3WJLA 1HN1A 1X9QA 2VLKB 5DS8B 3ZT7A 3QP3A 3E0GA 1HKLL 4CGTA 1J11A 4ZPVA 3D6GA 4MAYD 3T09A 2XWJB 4OLUL 1G6VK 5CUSH 3L7FB 3OJDA 4QHUA 2EYRA 2WBWB 4TVPD 2DICA 4XNMA 1ZLUK 1S3KL 1X6NA 2BSSB 2IMMA 2BVYA 3HS0A 5GXBB 4HUKB 4P2YA 3PP4L 3U0PA 4N5EA 1T0PB 2SEBB 1YJDC 4JRXD 5CJQL 1ED3B 4JZJC 1MRDH 4H26A 1ZT7B 5I1EH 3IFOA 1HHIB 3ZKXC 5MEOB 1J0ZA 3QO0B 2EYSB 2JJTC 4Z77A 1VDGA 2CIKB 3OKOB 4X8JA 5A2LH 5C3LD 2IADA 5ILTL 4HF5H 2C4FT 2UYLA 3LN9A 2WANA 4X4YA 5C08B 2F5AL 1XF3A 1LD9B 2JCCE 3NIGE 5ACZB 3LKOA 2Y07L 3MLRL 4EUPH 4APQA 3ARGB 3H7BA 1DQQB 2FL5A 4XB7A 1YMHB 2ADJA 1JGDB 3ARFB 3QIUA 3WIHL 4RGOL 4P2RB 2EDOA 2B5IB 5E2VL 2CLZA 4O2CB 2FEDD 2DIJA 5CS7A 3GDBA 3LN4A 3VFVA 1SBSL 3GB7A 3D0LA 2XZCH 1PDKA 1WFNA 5HI5C 5EUOB 5ESVA 2YA1A 2VUYA 4LVHB 3RZCB 4HWZA 5C0BA 4L8SC 3SQOL 1I7RA 2HMIC 4KFZC 2W65B 2V6HA 1VADA 3F7VB 2C3VA 4F33A 1NFKA 2DQGH 2R8SL 3PHQA 1A22B 2Y6SD 3VGAC 1CICA 4LLQA 3P0VH 3BFOA 2Z35A 5CD3A 3MOQA 4TTDD 1P6FA 3SN6N 5IJVB 1IZJA 3U79A 2PO6A 1ETZB 2ZWLT 4TNWF 4XVJL 2DQUL 2VZUA 4N90D 4YC2B 3VA6A 4HHAB 2XG5A 4HS8H 5EFIA 3GSQA 5CHNB 2X4TB 3IF1A 4WTZA 3B9KA 3QFJD 4LSQL 3WDHA 3JZ7A 1U95B 1AGBB 4N5UA 2BNQD 5KBNC 1WF5A 1N64L 3N0PB 5JUEL 2CIIA 2XZZA 1NCDH 3LKQA 5FV1L 3ULVE 4V2CB 1MHHA 4DGIH 3E3QA 4YHKH 4HD9A 4A6YH 4Y19E 3UBXI 1KG0B 1LEKB 2ZCKH 4M9PA 4LSTH 4HJ0D 4HCRH 1HI6B 3D3VE 1OT1A 5HGHB 2V2WB 5D7JD 6FABH 4HPYH 3UYRL 1BZ7A 4H0HB 1MCBA 4D0CB 4R7NB 1H15A 4R97C 4RZCA 3PGFH 2RJMA 4ERSH 5AG9A 1GHFL 3DOSA 3NAAL 5DQJA 4UDTA 1HSBB 3S98A 3PWVA 4E0RB 2V17L 2WIMA 1Q94B 3CD4A 5BZWA 5ENWB 5CD5D 4OAWA 4KK8C 5KZCB 5B8CA 3IAPA 1CLYL 3IETB 5DJAB 4V1DA 5J8OA 3MMEA 3WO4B 4UINH 3MZTA 1DSFL 4M93B 2PKDA 3MBED 5DHVH 1UA6H 5TE7H 2CLRA 1U8HA 1CGSL 4DQOH 4WUUA 3CUPB 3WN5B 4LPWA 3W81A 2FGWL 4KVCL 4ZXBA 3ALWA 1HSAB 4DKDC 3HNTL 2IH1B 2VL5B 4X9BA 1KJ2B 3VXUE 5JLZB 4XAWL 2NXZD 1PG7H 3DVNB 2Y36L 3TZVB 4XXDB 1BECA 3IDIA 4QHMB 1R0AL 4JLRA 5F1NA 2NXYB 1A7NH 4QXGL 1UADC 4L3EA 1F4AA 1KOAA 3K4AA 4PJAB 5EA0L 3FB7A 4JJHA 2Q87A 3C87A 5D7LA 4P57A 1HKLH 4OKVB 4JO1L 3W39A 1CFSB 4OLUH 5DC4B 3LD8B 4QNPF 5CBAA 5DTFB 5DSCA 3VXRE 3MCG1 4BSWA 5FM4A 3U4BL 1G84A 3V0WL 5C0JB 1EZVX 1OWWA 1S3KH 3CSGA 3UJTL 5CSBA 4ODBD 5HBBA 2PTUA 1V7ML 4RISL 1LEGB 1KPVA 3MCKB 2ENSA 3IU4L 1J1XL 4XXCC 3PP4H 2WINB 4Y89A 1MLBA 3LKRA 3QI9B 5JIKA 4DFIA 4PBWD 5CJQH 3BZ4B 1NGPH 1JGEA 3DROA 5C07E 3VRIB 1ZLWK 3I85A 5D1ZD 4KMLB 3VCLB 3HG1A 2QHLA 2PUQT 4YDKL 4QXTA 5E00A 3Q5OA 3KPRE 4FQQA 1P7QA 1NBYB 2F53B 3T0AA 5ILTH 1M1SA 2F5AH 4P4KA 3G6JA 1NGZA 1ZT4B 5DQ9A 5EZJA 1U8IA 5DJZA 5DFVC 3MUGB 4JM2A 2Y07H 3MLRH 3ZO0A 2UUDH 3GK8L 3NZHL 5L88L 3W0WA 1WBZA 3OKLB 4MNQA 5TE6H 1GZPB 1MWAH 2HT2C 4E41A 1NEUA 3WIHH 4RGOH 5E2VH 3SJVE 3QNXA 1CLOL 1XF4B 4HUWB 2D7MA 4PLKD 3QA3B 1P2CB 4NDMB 1AHWB 4KUZH 4C4KO 2NW2B 4R4BB 1H0DA 4OLEA 5IROC 4P2OC 1SBSH 1JF1B 3RGVC 4QRTB 2AP2A 2BOBB 1UM5L 4IIQB 4G8IA 4O4YL 1RJYA 4DOHB 3KPMA 3F5WB 3I3DA 3WFBL 2EE6A 1UM6L 4NQDA 1N5AA 3JBG7 3JTSA 3HMXL 4JQXA 3UJIL 4BFIA 4L1HA 5IW1A 1EUUA 2DKMA 1NCWL 2WZPD 2R8SH 2NZ9C 1F6AA 2KL6A 1RUQL 3UEZA 3MRGB 2XKNA 5IWLA 2CRIA 3UTZA 1XGPA 2VISB 4P23B 3D2UA 3HC0A 3RHWF 2CDGB 4ODHL 2LABA 1QFUL 5J1AA 3TWCL 5A3IC 3CVHL 4J8RA 4JFOA 4F7MA 2P5EB 4F2MA 2BCKB 4R0LA 2X40A 1NEZB 4NN6B 4MNHB 4NZJA 2W0PA 2Y5TA 3TCXA 4D9QE 2A74A 4XVJH 2DQUH 5B22A 4IHOB 5GS3A 5CEZE 4R8WL 5D1QC 4YHPB 3QDMD 1I7UA 4CJ1A 3ARED 5H35B 5C09A 1XIWB 3O2DA 5DRNB 4YEFA 4NNPL 4LSQH 1VERA 4V3EB 5FKPA 1NLBL 4LHUB 5DJDA 1N64H 2ITCA 3QHTC 5JUEH 3D25A 3QNYB 4PRAA 5KTEL 2PR4L 3TA3B 3KS0H 3VXOB 3EOBA 3MROB 3JV4B 4AY0A 1ULVA 2FD6L 4UQ3A 1WGOA 3VXSD 3GSXA 5FEBA 5L8JB 1AD9A 4TSCL 3SKOA 3UYRH 3O11A 2Z31B 3EOAB 5GGRY 5IIEA 1KTRL 4YHIA 5I9QB 1A6AA 4LSRL 4U6VL 1MCIA 4GG6B 1GHFH 3NAAH 4JFDB 3TYFB 5EH1A 2V17H 4OZFB 3VFSB 1CLYH 3QEGL 1SJVA 4UIMA 1NDGA 3BE1L 3QPQD 1LE9A 4PRBB 5JW4M 1LDPL 1OQXA 5KSAB 5ANMB 3L3JB 5I1AB 1CTOA 2C3GA 2C4XA 1DSFH 2H2SC 1W0YT 3B83A 3X11A 3Q6FA 5CP7B 2OTWB 1CGSH 1RZGA 3HPLA 1ND0B 4DVBA 1NLDL 4L5FL 3ZYOA 3EDDA 4NWTH 4KVCH 1KEML 3MYZA 3BDYH 3KPQB 5TGBA 2CUMA 3HNTH 1S7VA 5EO0B 2WWMC 4EN3A 3GMRA 4DK3A 2FR4A 4ODUA 1J8HD 3QUYC 4XAWH 1WQVT 2V5MA 1QD0A 4NO5A 4J7RA 4HKJA 4GMTL 1R0AH 1EFXD 5HHQB 4IDLA 4PJIB 4JY4B 4QXGH 3CX5J 3HAEB 4WFFE 2X4OB 3CFCL 2HMID 5DRWB 5EA0H 4EXKA 5DVOA 1SYVA 2RBLA 4N1CA 2OJEB 3LRSB 5A2FA 2EYTB 1U91A 4JO1H 4KRMB 1G7QB 4H5SA 3BEWA 1CFNA 2YUXA 3UZQA 3PABB 5SX4H 5F6HI 4NYLA 5SX5K 1VGKB 2CDEB 2FX8L 4M7LL 1U3HB 2VR5A 5TQ2L 1ZLUH 3BKJL 4NSKB 3U4BH 3V0WH 3CMOL 3DRQA 4G8GB 4K7PX 3UJTH 3BI9X 3MV7E 2HLAB 1MQ8A 1V7MH 4RISH 5FYJL 5FOBB 5D1XC 3IU4H 1J1XH 2WBJC 2G2RB 2YSSA 3M07A 3KJ4C 4FTVD 1U93B 3E6FA 4ZUSB 1XFPA 1ZE3C 4ONFL 2VR9A 2BNRD 3VG9B 4G9FB 1Y18A 4Y4HA 4UOW0 3U36A 1X5KA 2G5BA 2CRZA 2Y06L 4PRHD 3GSNL 4YDKH 3AMKA 1A1OA 1HXYB 3CLEL 3C8KB 3D69B 1IE5A 4ZO8A 3P9MB 5TDOB 5LKNA 1Q0YL 3DMMA 4S11A 1P4IL 4ZS7L 5DFWH 4P5TC 1FDLL 4PG2A 1SY6L 5IEKB 4G8EB 1EJOL 3C5ZB 3GK8H 5JW4N 5L88H 3MYJB 2IANA 2VDLL 5E70A 1U8QB 3RTQB 4JCLA 2NY4B 3U0WL 1JI2A 2AJVL 1CLOH 1KJVA 2EDNA 2GT9B 5DD1L 4M8VA 1MUJB 5I1DB 1D9KC 3F58L 3T1WA 3GKZA 3QUXA 3MRMA 4JE4B 1XGRA 1IEBA 4CVZA 2YN3A 4OZ4A 3QG6B 4PJGF 1UM5H 3FFDA 4OZGB 4O4YH 3WNLA 2I60L 3FZUC 4KK8D 3VFNB 3WFBH 1CIDA 1EO8L 2VXQL 3PDDA 2FJHB 3GHBL 1UM6H 1M4KA 1DBML 3V6OE 3HMXH 3UJIH 4RMRA 4U6XB 1TZGL 1NCWH 4XRCA 3P73B 5ITBL 2AABL 1RUQH 5IW6B 3ZYJA 3ESUF 5HVHC 2AEPL 1RZIB 3MREB 3WUWB 1TJIL 4ODHH 4L8CA 1MHCB 1QRND 1M7DB 3MUY1 1QFUH 1B0RB 3QUML 5EU6B 3CVHH 4NRYB 4XPFL 2HJKA 3KNBB 4PGCA 5GS2D 1UEYA 5GGUA 2AEQL 2D4FA 1CD1B 4R8WH 3FRUA 2YPLA 1CL7I 4ALAL 1HYRC 5HDBE 3C60B 3FT4B 5KANI 3O45A 4NNPH 4Q9BA 5FCUL 1BVKA 1IAOB 4JZNA 3CLFL 1IGYB 1NLBH 3WL9B 2NY5C 3P9LB 4PJEB 5AUMA 5D7SL 2A6KA 5KTEH 2PR4H 4NQCD 1UWGL 1Q9KB 1KT2B 4XPBH 1T4KB 4NKDB 4X7CC 4UTAL 5K9QI 3ZKQD 2MKWA 1FFPB 2FD6H 2NNAA 1TLKA 3VFWB 3NPSB 2ICWI 1ONQA 1KC5L 3T0EE 3PL6A 4L4VE 5KSUA 1XF1A 4O2EA 2FHCA 4HH8A 5GRUL 4TSCH 2AJZB 4EI5C 5J12C 5DF0A 4HAFA 1OGAD 1PKQB 2KH2B 3VFRB 3I84A 1ZHNB 4LSRH 4OFKA 4U6VH 4FFVC 5JHDE 4BQBA 2ZUUA 2AK1L 4Q6IA 5KW9L 2BY1A 2J88H 1NEZG 1T0NA 1UGNA 4ODWB 4JFQB 3FCTA 1ZGLA 5FUOL 3QEGH 1NGXB 4Z7WA 4YHYB 4JFEB 3HPJA 1LDPH 1HQ4A 1WK0A 1T1WA 3LPWA 4UI2A 4XCEA 5LCVH 2EIZA 1AQDB 4S0SD 4WW2C 2XQYG 4LBEB 1P1ZB 4RGMC 3MUJA 2P8MA 1IM9A 4LHUG 4X6DB 3CC5B 4ZSOA 4IRSA 4L5FH 2HT2D 3WHE0 1JWMB 5IB5A 1OTTC 5C0EB 2MJWA 1KEMH 5DWUL 1FNEA 3FONA 3GMQA 1KB9K 3NFNA 2PXYC 4R2GD 4QHLA 5CZXC 1LVEA 4GMTH 3UTSB 2ZUQB 2EDFA 1BJ8A 2QSVA 2J12B 1D5XA 3FO9A 3WFHA 3L1OL 4LAQL 5L2KE 3HLAA 3CFCH 1HHKA 3RY4A 3RGHA 1UACL 3RWDB 2NZ9D 3KPLA 3TJHC 4F7TB 2W9DL 3QNZB 2Y4SA 3UTPD 3GZKA 5FYKL 1CU4L 3ME0A 3S35X 1K4DB 1M6OA 2FX8H 4FQXA 5TQ2H 5A3ID 4NFBA 3CMOH 4O02L 1FP5A 5FYJH 4QOKA 3IJSA 1NPUA 1R5VB 4U7KA 1NANH 3U46A 2R2CA 3DVIA 4UUJB 3B2UD 4ONFH 5DO2C 4P2CG 3BP4A 1XGUB 3TBWB 4TVPE 4QYOA 4K71B 4N0CA 3OKKB 2Y06H 3D39D 3GSNH 3INUH 3JVGA 5ALCL 4FFYL 1HK6A 2CXGA 3ET9F 3CLEH 4PY7A 5L0QB 3BX7C 1BZ9A 4WV1C 1Q0YH 3IDNB 2UY7A 4ZS7H 1KJ3L 1CVSC 1JYNA 4U0RC 1FDLH 1SY6H 3HAEG 1EJOH 2VN7A 3IFNL 1C5BL 4PJHF 1T7ZA 2VDLH 1BQHA 4X7SL 5E5MA 3KXFE 3DIFB 3QB7C 1VEOA 3CCHB 1X3DA 3SCMB 4K9EH 4Q58C 4D2NA 2AJVH 3KLAA 4PJDE 1V5JA 2ATKA 4DK6A 2QADC 5FO9A 2X4RA 2H32A 5DD1H 3ZE0E 4X4MA 3F58H 4U1KA 3M17A 5HI4C 1DLHB 1EO7A 1JPST 3VXPA 1GOGA 1DVFA 1K2DB 1U8MB 1ODAA 5I2IB 2I60H 4KKCC 1KNOA 3S37X 4F15C 2ERJB 2GY7B 3G04B 2VXQH 4Y16C 2H2PD 1QO3B 4BQ6A 1TFHA 4KH2A 1DBMH 3S4SB 4YHLL 1TZGH 5JORB 5ITBH 4RA0C 4AEFA 2AABH 5ICZB 4IM8A 4KTEL 1B0WA 5GRWA 2AEPH 1A1NA 1ORQA 1TJIH 4CMHC 5D72L 2AGJH 5IMKB 3TVMA 3QUMH 4MD4A 4XPFH 1NL0L 1L9MA 1K8DB 1VSCA 3QJHB 4U6YA 5LAXA 4C56A 2WWMD 1R24B 2HFEA 3KR3L 1RJLB 2D31B 4MJ5A 3QUYD 2AEQH 3EFDL 4M1GH 4ALAH 1S9WA 1B0GA 4ONGL 3H0TA 4PV8B 4PRIE 3VXME 2XACC 4HIJA 4OCSL 1OL0A 1QEWB 4RGNE 4LPVA 5FCUH 3QEQE 3CLFH 3WE6A 4WI3A 2XN9D 3RNKA 2H9GA 3C6LA 2F19L 5D7SH 1MJJA 4OBRA 4JFYB 1UWGH 3SHSA 3P4NA 3EYVB 5I66B 5MHSD 5C0AD 4UTAH 1A3LL 1TVBA 1IAIM 3RDTD 1U2HA 2JCCB 3TF7A 4Y5YA 1KC5H 4U1IB 3KPPB 4XX1E 2VRAA 1X5FA 3DBXB 4LSVL 1PAMA 3KVQA 5GRUH 3ARDD 4GG6F 2ARJQ 5JQ6L 1OP5K 3WUWG 1T20A 1X5GA 2DQFA 1JK8A 2AK1H 5D6DC 1NFIA 2IF7A 1F02I 2EEDA 4U1NA 4QT5A 3L3DB 3THML 1D6EA 4JZOB 3HNSL 4LK4A 2ARJB 3PNWB 5FUOH 4FQ1L 3RI5F 1WFTA 4JPWL 3EYUL 3TH2T 2QQLL 4WU7A 1ZXQA 2X10A 2M26A 4YBQC 2X1OA 1JHTA 3GMNA 4U7MA 1NC4A 2WY3A 1YNTA 5IBUB 5ADOL 3BD3A 4JDVB 4QRPA 1RJZA 2V9TA 4AL8L 2J8UF 2Z4QA 4YR6B 3MV9B 4XBPA 1MJ7L 4JQVC 5GGVH 4U1HA 5DWUH 3FT2B 4ZFZB 1KXVC 1AXIB 2VERN 3ZE1F 2FX9L 3BD5A 5TF0A 4N0YL 4YUEL 5JXEC 1F97A 5C0BE 2Y25A 5A2KH 3V52L 2QSCL 3SDDB 1HH9B 2YUZA 4FZEL 5E6IA 4LAQH 4B0MM 1ZEAL 4FQHA 2C3XA 2DQTL 2WUCL 3QSKB 3BUTA 5ICXA 1UACH 1BJ1J 1BD2B 4H1LA 1RI8A 1Q1JL 2W9DH 3K46A 1KN4L 3T65B 3EYFA 1CU4H 5FYKH 2ZPKL 5DR5H 5SX5H 4I9WD 2FIKA 4S1QL 3MO1A 1FHGA 2DD8L 5BS0D 4HK0A 1NBQA 4O02H 2GY5A 2GAZB 1R3KB 3FFCD 1N4XL 1RZFL 5HHPA 2R2BA 5IB3A 1NBVL 3IJHA 4AEIL 3DX9B 5F9WC 1PX3A 4YFLI 5IHZB 3D3VB 3F7RA 1UZ6F 2NX5D 3E6HB 4WEMB 3VU2A 4I2XB 1TTFA 1T80A 4JGJA 5ALCH 1CR9L 4FFYH 2V2TA 3D0VA 2VLRE 3T4YB 5K59E 1JZ8A 5FA4A 4NN7C 1DUYB 1DUZA 4LSUL 2E7HA 2BMKB 1QR1A 3U9PL 1KJ3H 2Z91B 3GGWA 4Y4KA 3KPNB 3QXVA 4MSWB 3LDBC 3IFNH 2AXJA 1C5BH 4U6HB 4F3FA 2R2EA 3IS0X 3QWRD 3EJJX 3FOLA 3CX5K 4GKOA 5EU4A 4RAHA 35C8L 4PGEB 4UDUB 3TIDA 1QVOA 2IAMB 1QLEL 4DUXA 1MIML 2AV7B 1JWUB 3B4NA 1P53A 1OY3B 4HLJA 2P7TA 1JUFB 4BZ1H 4UQ2A 1T03L 2A38A 1Y0LB 2AQ2A 4KY1L 5F7KC 2WLZA 1S8DB 3VD5A 1B88A 3OR7A 2L4OA 4LEXL 2YD1A 4O2FA 5CJ5A 3O6LH 2R0WL 2CQVA 4FXGB 1G7JA 4YHLH 4EZMA 5F1IB 3RNQA 4L8BB 3DNKA 3VWJC 3VA2C 4TSAL 4EI6A 4W4NA 1ZGLM 4KTEH 1YECL 2DN7A 3O3EB 5KOMC 3VXNA 3NCEB 4LF3A 4I18B 2FO4B 3I6GA 4ELKB 2P24A 2Z93B 4XGZA 5D72H 5F3BA 4G7VL 5IR1A 3D85D 4TVSa 1YUHA 1FN4B 1NL0H 5C71A 1JNLL 3KR3H 3H8NA 3WNNA 5D5MB 5F9AC 3EFDH 3MRIA 3PWPE 1DQDH 3WLBA 5CZXD 4OCSH 3LS5L 5C0CD 1WC7B 3NFPA 4HKXA 5GSVA 3L3GA 2E6QA 1NMAL 4K9EC 3LRHA 1BF8A 5C6WH 1EFQA 4JKKA 2F19H 4P46D 1OP9A 4LLMA 5KSBE 2NY1C 3TJHD 4IJ3B 4J3WA 2P5WD 1MFEL 1D5ZB 4IMKC 4AEHH 1V8HA 1A3LH 4U1MB 4WNQA 2ZUYA 1CXHA 3LQZB 5I6XB 3RL2B 3H9SD 3LY6A 4Y2DC 5C2UB 1S7XA 4WI6A 4LSVH 1D7FA 3ULUE 4WRLA 4KK9D 3PHOB 4TUJB 2BSED 4BH8B 1E27A 5DO2D 4PRDB 1SYSB 1A02N 1UYWH 5I30L 4MXVF 3SJVB 3IDMA 4HKZA 1ZLVK 1CFVL 4KU1A 2YEZA 3THMH 3HFML 3HNSH 3S36H 3EDEA 3VFPB 4MJ2A 4FQ1H 1AIFA 3QUZA 3NA9L 4JPWH 4HUUA 5DJ8A 4KVNL 2QQLH 3QFJA 5E1AA 3FO2B 3MA9L 2EEBA 4U1GB 4OI8A 4ZFOA 5T3ZE 3RVWC 2XXMB 4CL7A 2BNQA 4LCYA 3IDYB 4E41E 4JGUA 4HXAL 5ADOH 5BRZB 1UWXK 3W11D 5SWSD 1RK0B 5I15L 4AL8H 4Z0XA 3ZKNC 4JFPB 5E4IA 1NDMB 2ICCA 5C7XL 1D5IL 4LKCB 5E7FA 2FX9H 2Q86A 4N0YH 2HG5A 3JTTA 4YUEH 2EXYD 5MERA 3BP6A 1N7ML 5D7JA 2AW2A 1NGWA 4GKNB 3V52H 2QSCH 4LCUA 1IFHL 4FZEH 2YN5A 4KKCD 1SJHB 3BVNB 3AY4A 2DL2A 2DM4A 1ZEAH 2I5YL 3MR9A 2VQ1A 2DQTH 3FO1A 4ORGA 5GGTA 3U9UA 3V5KA 2VITB 4YHZH 3ZYZA 2H1PL 5IESH 5DK0A 3ALPA 2NY0B 1Q1JH 4F80A 1T83A 4QRRB 2W0FB 3GSVB 2B0SL 1NC2A 4DEPC 1WEJL 1MH5A 2ZPKH 3Q5YA 4S1QH 1UCBL 2DD8H 3GSOB 2WAHA 3SDXA 3MBEA 1N4XH 1RZFH 5GRZA 1U8OA 4MJIB 5GGQL 4GRWE 1NBVH 4PP2A 4UU9A 4AEIH 5IOPB 3BKYL 2R1YB 4JKPL 3HE7C 3I6LD 3LRGA 4MVBC 2NW3A 1N6VA 5JO5A 5IF0A 4Z18A 3AAZA 1YN7A 5F7DA 5HD8D 3IFPB 1CR9H 1SM3L 2CJUH 5AAWA 3NCFB 5FECB 1AKJB 4L9LB 2A0LD 3CDGA 3OTTA 3U9PH 2PW1B 5JOEA 3LPFA 3MLUL 3G5VA 5IBLC 4YAQA 5F88A 2QLVB 4HGKC 3GJFA 3IXAB 4GS7C 3SE3C 5KG9A 3TN0B 4MA3A 4OFPA 4BUHA 4XCYA 35C8H 3RL1A 1DBBL 3MZGB 4UV7L 1QLEH 5BXFA 4M03A 3GSNB 1I1AA 3QXDB 1FL3B 2BNUB 2JJSC 3IVKA 1T03H 4C57C 2DBJA 4KY1H 4Y7MA 2WK2A 3BW9A 5GHWL 3U4AA 4LEXH 2XQBL 3DLQR 4YO0A 4PJGA 5C0ND 5IBTL 5D1ZA 2AKRA 2XTJB 1LEIB 3G08A 4X4ZA 3X12A 2OI9A 3O2DL 4TSAH 5EO1B 2GW5A 2E8ZA 5CINL 3VXTA 1YECH 3ZDZF 1EZVY 3V6BR 3BGFB 5DVNA 2X9WA 3B6SB 3PQYD 5DUML 5FB8A 5F96H 1XF5B 4G7VH 4PB0L 5HHME 3B5TA 1JNLH 2ICES 3DHJA 2PYFA 5B39A 3MLYL 5HGAA 5JXED 2F58H 4WJ5A 2HAZA 1BREA 1I8IA 4LGRB 3MV7B 3QEUB 1KEGL 3RP1A 3LS5H 3G5ZB 4G9DA 4AQ1B 1NMAH 5JDSA 5F7LB 1SHMA 2DL9A 3K7UA 4X4XB 5F6HJ 2VKXA 1T22B 3F12A 4Z7OE 1U36A 3MLPA 2WIIB 4CU6A 4GRLB 1MFEH 4MA8L 1EEUA 5CZVL 3ZHLA 3W9DA 5ACMA 3DGGA 3OWEA 3ULVL 1X7QA 3DTXB 3BT2L 5AYQA 4XNZC 3DV6A 2Q7YA 5DHYB 4Y5VC 5C08D 2J5LB 4JG1H 2OCFD 4PJ5E 3MXWL 4ORZC 1OP5H 1XR9A 1BQUA 5EC2A 4S0UC 4LGSB 3N1PC 2ZKHL 3VGEA 5I30H 3EYOB 3MSPA 1CFVH 3ARFD 3HFMH 4L4TB 1DQJB 1XF2A 3ZDXE 2YD2A 3QDMA 4ZMAT 3I6KB 3ILPA 3NA9H 3AREA 4RRPA 5E2TL 3SDCC 5EIIA 4KVNH 1HHJA 2VDML 1J0KA 4XC1L 3U6RA 3HZVA 3FQXA 3SPVB 5GIRB 1EEZB 1JPTL 1FFNB 1LK2A 2IANE 1IVLA 1OHQA 4J4PC 3P0GB 5B3JE 1CF8L 3V8OA 4NQUA 1MFAL 1HOCB 4HXAH 1MCSA 3EO0A 5IQ9B 1FFOA 1IAIL 4KJPC 5I1KL 5I15H 4NP4L 3K8MA 4DGVL 5J1SC 1G7LA 4YNYA 4JRYA 5F7FA 5C7XH 1D5IH 1JFQL 5E9DD 4Z95L 3UBXB 4R7DA 5I1HL 2P49B 4NIKB 3ECBB 4LIQE 1RURL 2D2OA 4ETQA 2BVPA 1N7MH 5JW4R 3OB8A 3PGDA 4R26L 4KQ4H 1ITCA 4GSDL 1IFHH 5DYOA 3TO4C 4Y1AE 3DV4A 5FXCH 2PW2A 1VACB 4X6FB 2I5YH 2ARWA 4MGXA 2CKBL 4Q9RL 2B1HL 5DRZB 4DCQA 2H1PH 4TQEL 2OL3H 5A43C 1VFBB 1DFBL 4FP8L 3TGXA 2JJTA 1LP9A 3MUHL 2B0SH 1TPXB 4PIRF 2X70A 1WEJH 2YWYA 5C0IB 1U8NA 3UMTA 1Z9LA 4NPYA 3QPXL 4AJ0A 3BN9C 3MRJB 3ETBF 3RZWA 2Y7QB 4C83A 3SKNB 2ADGA 5D2NE 5GGQH 4MCZB 3ARRA 3QWOA 3RY5A 2D0GA 3L7EB 3GMMB 3BHBB 3BKYH 3T0EB 1NMCC 4JKPH 2B1AL 5HPMB 2VN4A 3TP4A 3O2VL 1PD6A 1PQZB 2FB4L 4EDXA 1J8HA 5I75C 1SM3H 3EJZC 1N2RB 2FECL 3C8DA 3CSPA 1EFXA 4LFHG 3JV6A 1OB1B 5E8PB 3MLWL 5EO9A 2EDXA 2PYEA 3EDFA 3MLUH 4L8SA 3QRFM 2DQEL 1CQYA 1I4FA 4RFNC 5KZCD 3D39E 4GFTB 5DGRA 3MNVB 5DMJB 2F15A 3MNZB 1PZUB 1DP0A 4M62L 3B8YA 4PJ8C 2A1WL 1TVDA 3ARYA 3CDFA 3GIZL 4UV7H 1QFWI 3ZSTA 4PJFA 1D5MB 1G9ML 4GQPH 2BXZA 1DANU 2FYYB 2YXFA 5DVMA 4RFEB 4CVXB 2ZJSL 3R0NA 4PV9B 1QP1A 2DOCA 5DJYA 2DI8A 2ZOKB 3BH9B 2BVEA 5GHWH 4X6EB 4FTVA 4UNUA 4FQPA 1B6UA 4HS6B 1HQRA 4EBQL 5D7IE 2BNRA 2XQBH 4NQSB 1HHGA 1I8LC 4YHML 4DUWA 3T3PE 2CO7B 1EHLL 2HVJA 4NQEE 1X44A 4PRHA 3TZVD 3SDAB 3VWKC 2VDOL 3O8XC 4OLXL 5L2KB 4YPGA 4GJTB 3O4LA 2NXYD 1YEKL 2YA0A 1K3ZA 4K7PY 4CRPA 1YN6B 2VE6B 4JANB 1WV7T 4LQFL 5ESQB 1JBJA 5D5MF 3UXFA 3SEPA 4M6OH 4HGWB 4HH9A 3RWIB 3P4OB 5GS1C 3FB6A 3MLYH 2DBLL 2HFGH 4XNYL 3OXSB 4F8QA 2L0DA 4PJBE 1KEGH 2D9CA 4GAFB 4W4OC 3WYRA 5LBSL 5JMOC 4ELME 1Z5LB 2IJ0C 5EIVA 4KI5E 3MFGB 5HHNB 5DJ6A 2ESVB 3ROOB 1QR4A 3F65A 3H9YA 1PGRB 3BOVA 4MA8H 4MNGE 1JWSB 4S0TD 5CZVH 1R3LB 3MRPA 5ADPL 3EJYC 3FB5A 1N5YL 4K7PL 4WHTA 1OGTA 5J13B 2AS5M 3ULVH 3G6AB 4QOKE 1NUGA 1F4WL 3BT2H 1RU9H 2NPLX 1WAAA 4KKLD 3C5SB 3V0AC 3ZE2F 4AK1A 3MXWH 2W60B 5CMAA 5CWSB 2IPKA 5MHSE 3TBSB 3HB3D 5LG1A 1QRNA 2OZ4A 3GSRA 4CN1A 5J1TC 3KXFB 4MVBD 1DCLA 2ZKHH 4KK5C 3OX8B 3OGCB 2FATH 2UZIL 4PJDB 5FK9B 3O6KH 1ZLVH 4NCC2 4JCMA 4JVUA 3SGEH 4NQVB 1WWBX 3MACL 5FGCB 3E3QC 4K94L 5E2TH 3QAZC 4XC1H 5A16A 2FJFA 2VDMH 1F5WA 5K9KB 1JPTH 4RX4D 4MDIB 5IBLD 1VFOA 5IG7B 2XIDA 1LE5A 1MRFL 1CF8H 2CLVA 4WTXA 1MFAH 4IRZL 5HVWA 3PJSB 5HTSA 1OAQL 3S8WA 1IAIH 5I1KH 1M7IA 3LEXB 4NP4H 4DGVH 2XKUA 4NQCA 1IEAA 1X4XA 4O51B 1KJMA 1JFQH 4Z95H 1AXTL 3HE6C 5I1HH 1G7HA 4UTBL 4OM1L 1JGVL 4BQCA 3I02B 4HX1B 2BC4A 3U7YL 1P7HL 4XXCA 4UV4L 4GSDH 2P5ED 3OHXB 1OW0C 1OGAA 4RIRA 4CW1B 3W5NA 1KLFA 3EO1A 4PJCB 3VXMB 4PRIB 4LPTA 5T5NG 3JSSA 5IFHL 4RGNB 2CKBH 4Q9RH 2B1HH 2X4NB 3QDGE 3WMSA 1DFBH 1N6UA 4FP8H 4OF3A 4EXPX 1XIWD 1EJ6A 3DVGA 3QEQB 4NRZB 3OKNA 4P3DA 4ZPVB 1QQDA 1LMKA 1GC1L 4ZXBC 4HWNA 4FZ8L 4PGBA 1KTDA 5JDJA 4G5ZL 3QPXH 1MAJA 4LHUD 2FLRT 2X4UA 1CDHA 1XGTA 2EYRB 1YEHL 2UZXB 2XG4A 4XNMB 1G0XA 2D7NA 5TDPA 1FPTL 3HS0B 5D7KE 2ZCLL 1QG3A 3U0PB 2B1AH 3O2VH 4PJ7F 2ICEA 2FH8A 2DWEB 2FB4H 3LIZL 4H26B 3UBXG 1K9TA 3ZDYE 4P2OA 3IFOB 2WQ8A 3N9GH 4RDQG 3VI3E 4Z77B 3HA0A 4QHKI 3LKPA 2BY0A 4MX7A 5TDNA 5F6IB 2UYLB 3MLWH 3RAJL 4X4YB 4O58L 1S5HA 1XF3B 2MSPA 4POZC 3REVB 4FFWD 2NMSA 3LKOB 2UWEF 4NO3A 1LO0L 4BA8A 5CEXB 4APQB 1XH3B 3H7BB 4OGXL 3DSNA 5KSAD 2FL5B 4M62H 4HUXA 5F7NC 3VD4A 2ADJB 3QIUB 2A1WH 3GIZH 4J2XA 1KB5A 2RIKA 2CLZB 5FA3A 2ZJSH 4Y5XA 3NOIA 1MREL 3QIWC 1MPAL 3HUJE 1CDGA 3VFVB 3GB7B 3HI1A 3U2SB 3D0LB 3QXWA 3V5HA 3RHWK 2YZ1A 5D1QA 4EBQH 4MA1C 4HWZB 5C0BB 3DX7A 4EUPA 4YHMH 1I7RB 1KELL 5LJYH 1EHLH 1MVUA 1VADB 4HZAA 2CPCA 2VDOH 4OLXH 4QRPE 2C3VB 2DLFL 2FSEA 3PHQB 4JAMA 3BN3B 1YEKH 1WIUA 1CICB 4LLQB 5TE4H 5ESAA 1MQKL 4KWUA 5I17A 2Z35B 3VFOB 3TPUE 5CD3B 4LQFH 4Z7QE 4HKBA 3ZT6A 3LH2L 4CMMA 1KN2H 3V6ZA 3V5DB 1BX2A 2OMBA 4X8XA 2PO6B 5MI0B 2DBLH 3HI6L 4DAGL 2HT4C 5BJTB 1JVKA 5E99H 3QFDA 1IM3A 3BSZL 5EFIB 1DL7L 1MCDA 4OI9A 2WV3A 1NCAL 3AS2A 5EPMB 5LBSH 4G8GD 3IF1B 2J7LA 4I4WA 3B9KB 1XMWA 4U2ZA 2UV3A 1XZ0A 4YDLB 4ZDHA 2L7JA 3CFBB 4UT7L 1RUKL 1EXUA 1MI5D 3S35L 1C16B 1QBLL 3ZTNL 3SGDI 5ADPH 1M71A 1MHHB 4OCRL 1N5YH 4K7PH 3V6FA 4R0LC 2R1WB 1T89A 4EOWH 4M6AA 4JFXA 1CTNA 3DECA 1A6TB 1ZKAA 4ZYKA 3S5LA 4MAUL 5IVZB 3BWUC 5MEQA 4JQIL 1KBGL 1VPOL 1H15B 1WIOA 2NLJA 4RZCB 4ZAKB 3QDHA 4WW1A 2UZIH 4CVUA 1GGCL 5DQJB 4UDTB 3PWVB 3QUYA 1N59A 5BZWB 3MACH 4P2QA 3DUUB 3FRPA 4OAWB 5B8CB 1LO3L 4K94H 3RKDD 1Q72L 4HCRA 4U3XA 4OFYD 1OTSD 4V1DB 3MMEB 5DK2A 1U0QA 3NN8A 1G6RH 1MRFH 3HRZA 4X6CA 2XN9A 1NBZA 4IRZH 2CK2A 4KRLB 4H8WL 1OAQH 1YPZF 1JMXA 4LRNH 4WUUB 5E5UB 3RVTC 4PJ8D 1NAKH 1F3JA 3RDTA 3NCCB 4HWUA 1LO5B 4UTBH 4OM1H 4E9LA 3S37L 2ICWB 5DD6A 1LDSA 1QNZL 4RFOL 3U7YH 5D1XA 3ULVC 2WBJA 4UV4H 1BBJA 4PD4J 4B53A 3IDIB 2AV1A 4JLRB 5DHVA 3C09C 2FO1A 5F1NB 4OFDA 4XPTL 5DQDL 1LHZA 4L3EB 5IFHH 1FVEA 5C0FA 2FBJL 4KROB 3C60D 2AJYL 3FB7B 3VWKD 2B20A 5DZNA 1OD7A 4AYFA 1K3IA 4P57B 4NHUA 5FM8A 2E7CA 1GC1H 3W39B 1TJHL 4FZ8H 5DUPL 2R23A 4G5ZH 4KTDL 5EUKA 5CBAB 4EN3C 4P5TA 5DSCB 1YEHH 2VZ1A 3AB0B 5GPRA 3U30C 4BSWB 4LVOB 4Z7VA 4YQXL 5A2JH 3C9NA 5J7CC 2HA1A 1R3IH 1S7SB 3VD3A 4L3CA 1FPTH 5LGHL 3GJFK 5FKAA 2APVA 3BEVA 5C0RL 4X6BB 1BFOA 1OAUH 1TZIA 3VD9A 1MLBB 3W82A 4X5WA 2RFXA 1JGEB 1OAZL 4WHYG 3DROB 4WHCA 4D9LH 3LIZH 3VGHA 4FG6C 1D9KA 4EQ3A 3HG1B 3IGAA 5HSFA 4QXTB 5E00B 5B4MC 1B3JA 4WI8A 4FQQB 3QIBC 1P7QB 1AO7E 2CH8A 5JPMA 3RAJH 4AT6A 5GRJL 4O58H 4P4KB 3G6JB 3L9RA 3OPZL 1NGZB 5DQ9B 5GGSA 1QYGL 1S7WA 3EJYD 5EZJB 1U8IB 5DJZB 1GL4B 4NOBA 5AWNL 3OSKA 5EBLB 4I0PC 1JFMA 1LO0H 4U0QB 3RJDA 3LOWA 4GW1A 3LKNB 4JFED 4MWFA 3RVUC 4OGXH 3W0WB 1QA9B 1WBZB 1X5ZA 4MNQB 1OD9A 2QV2A 4E41B 3FTGA 5F9DC 4ZD3L 3MGOB 1JZ6A 3QNXB 5IMLA 4OCYH 5BS0A 5IHBA 1FYTE 3WUZA 1HHHA 2FZ3B 4KK5D 4R4NC 3RJQB 1H0DB 1MPAH 3FFCA 2LU4A 3RWEA 4G8IB 4HDIA 1RJYB 3WKML 3KPMB 5FM5O 1T7VA 2FX7L 1KELH 4QLRA 4PG2C 4Z7UF 4NQDB 3NACL 4BFIB 1MWAA 2OP4L 3LB6C 5IW1B 3WIHA 2X4QA 1RZJL 2DLFH 1F6AB 3PDOB 3EDJA 1AQKL 5H2BA 2YD3A 1MQKH 3IRZA 3UTZB 3D2UB 3HC0B 1R3JA 3UCRA 5H94A 2VDPL 4OKDA 4WFHE 3LH2H 2JB6A 5J1AB 1VKXA 2ZOLB 4F2MB 3CU1A 4DFHA 5BMFL 4JVPA 3HI6H 4DAGH 2A74B 2X6MA 4UILH 5FIEA 4OIIL 5T3XD 3BSZH 3ES6A 2J4WL 4WO4C 5FYLD 1NCAH 4UT9L 1I7UB 4EI5A 3ROLA 2EDTA 5C09B 4WEUD 2VLKE 1P4BL 3MPCA 3QEHA 2AQ1A 3H9HA 2FEEL 4GLRI 1Q9OA 3ARPA 4FQ2L 2APXA 1KACB 4UT7H 1RUKH 5DJDB 1B6DA 3S35H 3OKDA 4Z78A 2ITCB 2BX5A 1I1FA 1QBLH 2IFFL 3FQUB 3ZTNH 2VKWA 3BKCH 4K2UL 5GS0D 1E6OL 5IMOA 4OCRH 1DQLL 2NY6C 3EOBB 1UXSA 2QKIA 1NSNL 3MLTA 4QXWA 5E24E 1JF6A 2VXSL 4WW2A 3WS3A 5ERWA 4PTUA 3GSXB 4MAUH 4ZFOL 1AD9B 1VFAA 4RMQA 3SKOB 4L29B 4XI5D 4JQIH 4F58L 1KBGH 1VPOH 3D85A 5IIEB 1MFDL 4YHIB 5CCKH 4K3DH 3MJ8A 1N0XL 5KVFL 1QPXA 3SCMD 1FSKB 2Q76A 2PXYA 2W1NA 1GGIH 3OAUL 1LO3H 5I1CL 4UIMB 2HRPL 1Q72H 1U58A 4YBLB 5E5RB 4YXLL 1CI5A 3D1MC 3GI9L 2F74B 4P2RE 1A6ZA 4GKSA 1DQML 4H8WH 3T04D 3X11B 3Q6FB 4P46A 4I77L 3TJHA 2NY2B 3HPLB 2P5WA 1RZGB 2IALA 4PY8I 3LKSA 1OCWL 4DVBB 4H1LH 5SWZD 2H8PB 3SGKC 4FMKA 3QZWB 2IPUG 4PJXF 4TPRH 4JPVL 4YGVA 5TGBB 5CJOL 2I07A 1S7VB 3H9SA 3KPOA 3QYCA 4X0KB 1HYSD 3GMRB 2FR4B 3QIWD 1U8KA 4Q0XL 1QNZH 4PJCF 4RFOH 5HHMB 4PJGE 3I50L 5F9JA 4NO5B 5K9JL 4HKJB 3GO1L 3P40A 4I13B 2N4IA 4XPTH 5DQDH 3P4MA 4ESKA 3QO1B 5DMIL 4HC1H 1UH4A 4RNRA 1I85C 2FBJH 2AJYH 5EN2B 4S10A 2V2XB 3MJ9H 2BZDA 1CG9A 3UO1L 1TJHH 4WV1A 5EU3A 3QQ4A 4H5SB 3BEWB 1CFNB 4H0GA 4KTDH 4NYLB 4H88L 5KANG 4K94C 4YQXH 3BPNB 5LGHH 5I1LA 2CUHA 2QSTA 5SWSA 2HT4D 3RU8L 5C0RH 3TN0C 2VXTL 1XCQB 3GIVA 4Y4HB 1CYGA 4XNXH 3U36B 1AGEB 5K9QG 2G5BB 5KSVA 2OXGA 1NUNB 1D6VL 4TVPH 1A1OB 3IDXH 5J6HB 1U42A 4Y16A 1J86A 1HXMA 5GRJH 4LNRB 5D70L 3DMMB 3OPZH 1FG9C 4GXUM 1AD0A 1QYGH 4UMGA 5DI8A 4BSVA 1AGCA 3PIQA 5AWNH 1CT8B 1OPGL 5EZOL 1V05A 2Q6WB 3SBWC 3L5IA 4JVWA 2IANB 1JNNL 2VZTA 3IXTA 5FGBA 3L95A 5D2LF 5E8OA 3RWHA 2PCPB 4KGJA 2YHGA 3BPLB 4XWGL 1KJVB 4WFGD 5CEYA 3JVGC 1WBYB 2ZG2A 1I1YA 5AYUL 4X98A 1EGJL 1GC1C 3BKML 1T2QL 3MRMB 1NGYA 1XGRB 1IEBB 3QUXB 5EC1B 4CVZB 1FZKA 3A0OA 5J06A 4OZIA 4HV8A 4OZ4B 3FFDB 3KDMA 4PRPE 3C08L 3WKMH 4I3GA 4AZ8A 5CLWA 2ZSVA 2YMXH 2CGRL 4OD3L 3HN3A 5JXAL 3NACH 4FXLA 2OP4H 4XRCB 1RZJH 2E9BA 1WVZA 1AQKH 2R1XA 4G6AC 3V4VL 1TCRA 2VDPH 3MLVL 1Z9SA 3FHQA 5CGYD 1E28A 4QCIA 5BMFH 4OF6A 1A21A 2IQAA 4PGCB 2O61A 2EE9A 1A2YA 5GGUB 1QLFA 1BEYL 3BJLA 4OIIH 5ALBL 2YPLB 4ENEC 2J4WH 1OWRM 4UT9H 5D2NB 3O45B 1P4BH 2N7BA 3GMOA 3QHFL 5D6DA 1BVKB 4JZNB 1W0VA 3CFDA 4FQ2H 3D3VD 2DKSA 3QRGL 5F3HA 5KAQF 5AUMB 2BVQA 3ESVF 2IFFH 2A6KB 2VLJE 4XVUD 4K2UH 1E6OH 1DQLH 1ORSA 4MLSA 1NSNH 2YPKA 2V7HA 5FFLA 1MRCH 4F7EA 4LEOA 2VXSH 4KC3B 2XWTA 2MCPL 4PRNB 1ONQB 4NUJA 3PL6B 5KSUB 1J0HA 1FZMB 3EGSA 1KIRA 3PQYA 1QLRA 2AXHA 2AI0L 4F58H 5IT2L 1MHPL 3B5HA 1MFDH 4JQVA 1Q9LA 2LV4A 1KTKE 1C5DA 3QR2A 1G7MA 3F6IA 2F53E 1N0XH 5KVFH 2XWJA 4Q6IB 5EORL 2J6EL 5JXEA 1T0NB 1RD6A 2PYEE 4AIZA 2IWGA 3OKEA 1VEPA 4BELD 3OAUH 3T4AA 5I1CH 1ZGLB 2HRPH 4Z7WB 1QZ1A 3HPJB 4YXLH 3VGGA 4L4JA 1HQ4B 1T66D 2GJJA 1T1WB 3GI9H 4XCEB 4XWOD 3TF7C 2R9HC 4O00A 2SEBA 3VXUD 1WTGT 4YX2L 3STZB 4JREB 4I0PD 1G0YR 1DQMH 2ED8A 4PJHE 4I77H 1KCSL 3RWGA 5E2JA 2P8MB 3SY0A 1IM9B 3MUZ1 4JFZL 4ZSOB 1OCWH 3BAEL 4IRSB 5MEOA 2HTKC 5IB5B 2EYSA 4WDIA 2CIKA 4BZ2L 1CDCA 4JPVH 1FNEB 1U8JB 3MC0A 4DOHE 5CJOH 1DJSA 2W92A 3FONB 5HI3D 4R4ND 4Q0XH 4BFBD 1IC7L 3GM0A 1JNHB 1YNLL 3O41A 3I50H 4QHLB 5K9JH 1A7RH 2BDNL 1A5FL 1D5XB 1AFVL 4UNTA 4PJBB 3WFHB 2ZP0T 5DMIH 3S34L 1K4CA 3HLAB 3O4LE 4CDGC 3ARFA 1HHKB 1FNAA 5T1KA 3MRBA 2DQHL 1J7VR 3WKNA 5GGRA 1CBVL 3UO1H 2G60L 2OS7A 1F8TL 2C1PA 4NN5C 5JOPE 4H88H 1M6OB 4FQXB 1DBKL 4MNGB 4HBQA 2BVOA 1F45A 3TNNA 1FCCA 3GJFH 3KPRD 4QOKB 3IJSB 2W65A 3RU8H 5EB9A 2VXTH 5BW7C 1X5XA 4M00A 4H8WC 1ZHBA 3BP4B 5CP3H 5E9DA 3NGBC 2J8HA 4DGYL 3L3IA 1UJ3C 3QZWG 4QYOB 2ZNXA 1B2WL 4PJ7A 1D6VH 3BPCA 3NCMA 3FQWA 4OQTA 3V79C 4JM2F 2VNCA 1CDUA 3L6FA 4OLWL 1BZ9B 1INEL 3SJVD 3MJ7B 1V3MA 1CE6A 5AZEL 2YPVL 4G6FB 1OPGH 5EZOH 2VZVA 4PD4K 4H0IA 3IB4A 3WEXA 2VZ3A 1KPRB 4XP1L 4EIZC 1JNNH 2GIYA 2UWEA 1BQHB 4GG6E 5E5MB 1WWAX 4GKZB 1AGBA 4JFDE 2ATPA 3KLAB 4XWGH 1BFTA 4N0RA 1ZHKB 2Z92B 2H32B 5AYUH 1EGJH 3BKMH 1T2QH 4U1KB 2Z0BA 4O5LL 2I26N 3NIGF 3VXPB 4LSPL 1DVFB 2HT3C 1SY6A 3JUYA 3C08H 5IFJA 1HZHL 1R3HA 2CGRH 4OD3H 1HI6A 4Z0BL 5JXAH 1JL8A 2LTQB 2NYYC 4LFHD 5C92A 4D9QD 1IBGL 4D0CA 4R7NA 1A4KA 2VSCA 1AI1L 2APFA 3HNVL 5L8LB 4MAYC 5CEZD 1MLCA 5IVOA 4ZFFA 4LGPB 3V4VH 2MWCA 3QCUH 3AGVA 3UDWA 1KLUA 1HSBA 2J8UE 1A1NB 3MRQA 1F6FB 2J2ZA 1Q94A 3MLVH 2KQNA 2NY0D 3TVMB 2COQA 4MD4B 2MQ0A 1S9VA 1CD9B 1WSST 5LAXB 4U6YB 3ZE1E 4DJMA 4Y2DA 1Z9MA 2HFEB 1BEYH 2AXFB 5ALBH 1S9WB 3H0TB 2NQCA 1G1CA 3O9WC 4NC1E 4IRJC 1KTLB 3VDBA 1NFDF 3ABZA 3QHFH 4TRPL 3TESA 3CUPA 3U82B 5I0ZA 3VMOA 4Y88A 3WE6B 1PY4A 2C7UB 4IDJL 2H9GB 2GI7A 4MHHI 3QRGH 5J11C 3QUMA 3C6LB 2OBGA 1MJJB 4AM0A 3P4NB 5HGGS 2M1KA 4HIHA 5I8EA 3JWDL 1AKJD 2APBA 5HDOA 1L0XA 4QHMA 2MCPH 4Y5YB 5T1MA 4G9FE 1UM4L 1GRWA 1FCGA 4DZBA 3FN3A 4PJAA 3WV0A 5ETUA 1RZJC 3TN0D 2FEDC 5IT2H 1FAKT 1MHPH 1UT9A 1UZ6E 4QHNB 3SO5A 4QHKJ 4OKVA 2DQFB 1JK8B 1NFIB 3ULVF 5HHXL 2VSDA 5EORH 2J6EH 4QT5B 1FVDA 5IB1A 1FJ1A 1D6EB 2P8LA 5B3NA 2XRAL 1J05B 2H45A 1LNUA 5C0JA 1QFHA 3FN0L 1A7OL 3EDKA 5IVXF 1LEGA 4WU7B 3MCKA 3BZFB 4WEBL 2WINA 5C1MB 1MCWM 1JHTB 3GMNB 4YX2H 2Y6SC 3ZHKA 3MFFB 1FZJA 1YNTB 1KCSH 1J10A 4KMTL 4QRPB 1RJZB 4LSSL 4JFZH 3BAEH 4Z7NF 4XBPB 2P8PB 1MCOL 1YPZA 5IM7B 4WFFD 4U1HB 1YMME 5E8DL 3PWNA 1WJ3A 4U1LB 4BZ2H 4QRQB 2ENYA 1W8NA 3GRWL 3KYNA 5I71B 1ZT4A 1IC7H 1FRGL 1UFUA 4HK3J 1YNLH 4RSVA 4WWID 3F6LA 2LQRA 1YDPA 3GSWA 3OKMB 3HE7A 2BDNH 1A5FH 2EH8L 5C0DA 4MVBA 2Y5EA 3TEUA 3F62A 4FQHB 5ICXB 3MV7D 2AAVA 5I74C 2DQHH 4H1LB 4DN4L 2NY3B 3N1GC 4NDMA 5EU6E 1CBVH 4G6AD 3T77A 2G60H 3EYFB 5DUBA 2YD7A 1JF1A 2ID5A 1F8TH 4RX4A 1GYAA 2FIKB 4HJ0C 5CZKA 3TJEL 3MO1B 1DBKH 1J0IA 4HK0B 3SE3A 3MRKA 4GRLD 3PG2A 5D7JC 3WIFA 5FUCC 2R2BB 5AD0A 5IB3B 4PJ9B 3IJHB 1CN4A 4GRWH 5MENE 3MRGA 4FS0A 4DGYH 1DANT 4E5XB 2JJSA 2WMPA 1KB5L 5D8JL 1UG9A 1JHLL 1B2WH 2VAAA 4OLZL 4KTYA 2DLEA 4XVTL 1IC4L 5FA4B 1Q0XL 3S36X 1DUZB 4OLWH 5H8DA 1QR1B 4NCC1 3GMLA 3PWUA 5AZEH 4IHOA 2VLME 2YPVH 1WWCA 15C8L 5L2JB 1WIPA 1H8SA 1PKQE 4JKMA 2R2EB 4X5XA 4XP1H 1N6QL 3RVXC 1G9EA 2DI7A 3K2UL 3TIEA 3TIDB 1QFOA 4R6UA 4LHUA 2FRGP 4GAJL 4D0DA 4I48A 2P7TB 2NXZC 4UQ2B 5F7EL 4MXVE 4O5LH 4XNQA 4JFEE 3UTTA 3VXOA 4NOFA 3TFKD 4LSPH 3JV4A 4YJZL 1HZHH 4MMZC 1OARL 4M6NL 4Z0BH 4O2FB 4EDWL 2X89D 4QWWC 4FN0A 4X6DE 2YZ8A 2QQKL 1EBAA 5DZOA 1IBGH 4MJ6A 4Z7UA 1AI1H 3HNVH 4LARL 4G7YL 4W6WB 4LVNC 4Z5RA 3VXNB 4LF3B 3I6GB 1FORL 1LO4L 3VFSA 1HNGA 5IR1B 4PS4H 1G7IA 4JB9L 4URTB 1YUHB 1P84J 5B38G 3UTSE 5BVJA 4DWHA 3GBNL 3NIFF 1OQOA 5ANMA 1H9VA 3R8QA 3WLBB 1RUAL 4X9IA 1BQHG 1PYWB 3HCVB 4OUOA 1A6UL 3ZKMC 1FLRL 1G1YA 4HKXB 4TRPH 2OTWA 5GSVB 3L3GB 5K9OA 1ND0A 2OI9C 2QJDA 4QY8B 3T0ED 3GBML 4L4VD 4M7LT 1FVCA 4KUCD 2JIXD 5T3XE 3KPQA 5EBWA 4C58B 5DMGD 5GS2H 5FYLE 4Y4FB 1MCRA 3SDCA 5I8KL 5JOFA 4YHOL 1SJEB 4J3XA 3RX5A 1LGVA 5JHDD 4PDCE 3JWDH 2HJFB 4ZPTA 3BP7A 1CS6A 5I1IL 2XZAL 3SO3B 1UM4H 1MCHA 3HAEA 4L8DA 3MRCA 2X4OA 4XT1C 1G9NL 4PLKC 2X2YA 1BIHA 2GJZA 3LS4L 1EPFA 4ERSL 1G7QA 4Z7WF 5HHXH 3IDMB 4LLYA 4E42A 1INQA 2E9IA 1FYTB 4P0DA 2XRAH 2X9YA 5F7UA 1L0YA 3FN0H 1A7OH 2GSIB 3QUZB 4G8GA 4Q6YA 4X80L 5DJ8B 3TO4A 3QFJB 5E1AB 1KCLA 4WEBH 1ADQA 5IB4A 2VMFA 2BNQB 4HJJL 4LCYB 3S96A 1MI5A 1WFOA 2BHZA 2H26B 3LQMA 4KMTH 3IKKA 4LSSH 5DJXB 4Z0XB 2E6JA 2OTPA 1MCOH 4YDIL 5L2KD 5GGSY 3D69A 2BRRL 2W91A 4OSUL 2GJ6E 4PP1C 3ZKSD 2W59A 5IB2A 3GRWH 1OF2B 2Q86B 3JTTB 2BRQA 1FRGH 2MQ3A 4PJXA 5MERB 4M6ML 2Z8WC 1F4YL 3EYSL 2R15A 1AR1D 4LCUB 4R3SA 5T1LD 2ZUXA 5BV7H 5DLML 3BUYB 3LSOA 2EH8H 4G43A 1NANI 1F42A 3ARBC 3CVIL 3MR9B 3V5KB 3FO1B 5DEZA 4ORGB 2NYYD 2IBZX 3ZLQC 3UJJL 4DN4H 1R5IB 3ZDZE 4J23A 1NC2B 3HZYA 1T1YA 4K3JL 3EFFA 4H25A 3TJEH 1NCTA 4OZGA 2MCG1 3SDXB 2H6PA 2FJHA 3MBEB 4XCCL 1GJIA 1U8OB 1CQKA 3P77A 4PP2B 4UU9B 4XCNA 4PJ8A 3HZKB 1NGPL 3QULB 5IHUL 3O9WD 1S9YB 2NW3B 1T7YA 1T04A 3CDYA 1JIBA 1JN6A 4IRJD 5IF0B 3AS0A 1A6WL 1YN7B 5F7DB 5JW5A 1KB5H 4JY6A 5D8JH 1JHLH 3WUWA 5LGKA 1TVHB 4OLZH 4XVTH 1SJXA 3QPQC 1IC4H 3KXFD 1Q0XH 1L0QA 3CDGB 5IQ7L 3KNBA 2YS4A 2EDKA 1I8LA 3G5VB 3O0RL 4LCCC 5F88B 5KG9B 3GJFB 2GCYB 1S7RA 1WLHA 3C60A 15C8H 3VWKA 3FT4A 3O8XA 4MA3B 2BSTB 5TE6L 1N6QH 1FC2D 1MWAL 1YEIL 3RL1B 5SWQB 2NY5L 3K2UH 3P9LA 1T5XA 4FXKA 4Z76A 1I1AB 4KUZL 2F5BH 4GAJH 2Q8BL 5D2LA 1Q9KA 5F7EH 3IVKB 5GS1A 2OTUB 2EO1A 3TBVA 3BPOC 3IT8D 3BW9B 5DZLA 1FFPA 1O5DT 1OARH 2V9QA 4M6NH 5IHLB 4W4OA 4YO0B 3D87B 4PJGB 4WFGE 1Z0NA 5T5NF 4EDWH 1EEYB 3EYQD 3KYAA 5D1ZB 3G08B 2Q7NA 2JK5A 1SVCP 3X12B 2QQKH 4P4RA 3MV9E 4ZUWA 4X7FC 1HILA 4LARH 4G7YH 4POYA 3VXTB 5KN5A 3VXMD 1CFTA 4PRID 1X6LA 2D9QB 4RGND 4U33A 1FORH 5FB8B 1LO4H 2IG2L 4WI5A 1F00I 2APWA 2LAAA 4JB9H 3QEQD 4PGDA 1QRKA 3GBNH 2WUBL 2PYFB 3DO7A 1XT5A 4WJ5B 3JV0A 1H5BB 1RUAH 3NCYP 1YEDB 1A6UH 4QGYA 1FLRH 3B9VA 1BD2E 2DQDH 4G8FA 3GBMH 1JWMA 5C0EA 2GK0B 4PLOB 4HW6A 5J6GB 4KHXL 4X9GA 5I8KH 5DT1L 4YHOH 1YY8B 2MTPA 3P4LA 3W9DB 4I1NB 5IP4A 4XAKE 2ORBL 1X7QB 3MODL 4HGMA 5DVKA 5I1IH 5F21B 2XZAH 5C9JA 3DV6B 2Q7YB 4TUOA 3ZTJG 1TJGH 1HDMB 4I2XE 1VA9A 1EEQA 3K80A 1G9NH 2ZG3A 1KCRH 2AK4A 3J7HA 5EC2B 4WIQA 4APQD 5E6YA 3LS4H 4UAOB 4F7TA 1II4E 4LCWA 3HE6A 4AQOA 3QIUD 4ODXA 3LEYL 4NHCL 2LAGB 2Q20A 1K4DA 3BRFA 1CGTA 1SVZA 1XF2B 3CSYA 5E4EC 4QTHA 7FABL 4X80H 2MQCA 3AREB 4K3GA 5DDHA 1OW0A 3U6RB 4GQ9L 1NCCL 3HZVB 4PRPB 1R5VA 3IFLL 5JQHC 4RMTA 4OUUA 1LK2B 3J8F7 3B5GA 5LWYL 4HJJH 2X1QA 5C0BD 2NTFB 1I7TA 3EO0B 3MXVL 1FFOB 1E4JA 2B2XH 1F11A 4X99A 4NWTL 1G7LB 3RVXD 5F71A 4YDIH 4YNYB 2X1XR 4JRYB 3BDYL 2BRRH 3SE8L 4NBXB 4OSUH 4MQ7A 4R7DB 3UP1A 5HGBA 5AG8A 3KLHD 4HMEA 4M6MH 4ETQB 4OF7A 2BVPB 1F4YH 3JWDC 3EYSH 3O6FC 3PGDB 1ZVSA 1T1XA 5DLMH 2QR0A 3H42H 1A1MA 3T2NL 3DV4B 4DKFL 1CGVA 2QSQA 3B2VL 3CVIH 4JZJB 2PW2B 3DIFA 3WCYA 4QWWD 2I24N 4DCQB 2XV6B 3WXWL 3ZKXB 3UJJH 2V5SA 3ARZA 3B9KD 3BMWA 4NFCA 4MDJA 4K3JH 1U8NB 1K2DA 2VLJB 5D5ME 4NPYB 4TYUA 5E6ZA 1PLGL 2I25N 4UB0L 4LLVA 4C83B 3DUSA 4XCCH 1QO3A 3CFKA 2VLRD 1IGFL 3QWOB 3A6CL 1JRHL 1FO0H 5SWZA 2FLBT 1RJCA 5IHUH 1P7KA 2OL3A 2UVFA 3ZKMD 4GRMA 5D96C 4HULB 1A6WH 3V0VA 4EDXB 3QIWA 3IS1X 1J8HB 4OB5H 4KQ3L 5IMKA 4LHQB 4AG4L 4QRUB 4ZAKD 5IQ7H 1EFXB 1FGNL 1JYWA 5ID0B 2B8OT 25C8L 4L8SB 2PYEB 4HT1L 3O0RH 2D31A 2D0HA 3STBA 1U92A 2CO6B 3NCBB 1I4FB 1RZKH 1QEWA 5BV7C 1QKZL 4CN4A 4AENA 4XVSL 4OGAD 2HH0L 2OXHA 3VGAB 1YEIH 3BZDA 2I9LB 3TNMA 1IARB 1Z6JT 2NY5H 1NAMA 3QXAB 4PJHB 2EDDA 5HYJA 2JF1A 2LVCA 1E4XL 3A6BL 2Q8BH 4R2GC 4DUVA 1M05A 5DJYB 1QSEA 3SDYL 1HQRB 5DGQA 4X7EC 2BNRB 1D3CA 1FH5L 1I7ZB 1HHGB 3MTRA 5BRZE 4GW4A 2HVJB 4PRHB 3Q2CA 1A7QL 2C3HA 5D93C 2DMCA 4W68A 3DYOA 1HNFA 1K6QL 4MS8D 4YPGB 1TQCC 3O4LB 1GSMA 3PWPD 1KV3A 4NO0D 1A4JA 3MV8E 4GOSA 4P5KA 1PG7W 1OT2A 2V5RA 3L3DA 3HR5A 2IG2H 1A47A 4JZOA 3W2DL 3MGTA 4Y5XC 1I3RA 4F9LC 4HH9B 4PP1D 5HJ3B 2WUBH 1VENA 3FB6B 5HHOA 3B2UC 4N8VB 4PB9L 1MAKA 5EG6C 2ZUWA 3FB8B 2OR9L 4U05A 1CLCA 3O3BA 4R97B 4QRRE 3L5HA 3ARBD 1OOAA 4QRSB 3VI4E 1NFDA 3ULUD 3FT2A 4XPBL 4ZFZA 5IFAL 4KHXH 3OF6D 5DT1H 2HTLD 3FB5B 5FO7B 1E4WH 3D18A 1OGTB 4MJIE 2ORBH 1U3ZA 3MODH 3Q3GA 4XHJC 4P4KD 5JIPA 4AH2B 3KGRA 1N3NB 5CBEA 1BOGB 2IPKB 5J9PA 5E0QA 3SKUD 3GSRB 3W0WD 5MP6L 2X9XA 5T3ZD 4MNQD 4ZOAA 2J88L 4E41D 4MB4A 3VMNA 3LEYH 4NHCH 3LHPL 4HXBL 4MQXC 1IILE 4S2SA 3VGDA 2H2PC 7FABH 4LASL 1P84K 5A16B 4NQXA 4Y19A 5DURB 3RX8A 2RCSL 3NTCL 4GQ9H 1NCCH 1T89C 3IFLH 5LCVL 4GAGL 3L5JA 2X09A 5LWYH 1LE5B 4IOFD 2UWEE 5CIPB 3D3VA 5IVXA 2EXWD 3MXVH 4XNUL 1VFMA 4NQDD 4IBLT 3AUVA 4M7ZC 1M7IB 2DM7A 4NQCB 1IEAB 1KJMB 4NGHH 1OAYL 4LP4A 5CFHA 1NQBA 5EOTB 3SE8H 3QDJE 1DUYA 2J8UB 1FBIL 1G7HB 2E3VA 2W38A 3D2UD 4M61A 5EBGA 3KPNA 1U8LA 4MSWA 2XTJE 3MRFA 2HN7A 3FHAA 1OGAB 3D9AH 4RIRB 3OBAA 3MX0A 1J5OH 3T2NH 4DKFH 3S3JA 3B2VH 4K07A 1G9NC 4U1SA 3BO8B 4PGEA 1TMCA 3QXUA 3EW3B 3WXWH 2EICA 4ONHB 1JWUA 2E7LE 5GRVK 2V9RA 1JUFA 1TCMA 3QIBA 4P3DB 3SDXF 3AM8A 1QQDB 3RDTC 4OQTL 4PGBB 1KTDB 1S7TB 2EC9U 2XFXB 4CN6A 1RZ7L 4U6TA 1PLGH 1KLGB 4G6JL 3VXUA 4FFEX 4UB0H 2X4UB 4I0PA 2FIRT 4F57L 3ARDC 4QTIL 3V7MA 1IGFH 3A6CH 4FXGA 1UEMA 1JRHH 1UH2A 5DJ2A 3O81A 4BKLA 2CKBA 3M45A 5TPWL 4B41A 1T0MA 5F1IA 4YDJA 2I27N 2A6IA 2CR3A 4YGAB 2GFBA 4GXVL 2ICEB 2XQYK 3INUL 4ELKA 1ZA3A 2Z93A 3AMLA 1D5BA 4P2OB 5JIHA 4XCFL 4KQ3H 3RGVB 1R6VA 5EOQH 4AG4H 4NBYB 4MB5A 3VRLE 5L8KB 3LKPB 1FGNH 5GJSH 3IU3A 4HFWA 4MX7B 25C8H 4HT1H 1DEEA 3GSUA 1S5HB 3ARVA 3VXRA 4MD0A 5A2IH 5IMMB 4NO3B 1QKZH 4GG8B 1WC7A 4XVSH 3DXAA 2HH0H 1ZVYA 1GGBL 2Y72A 4CUCA 4K9EL 4XPAL 4HUXB 5H37G 5C07A 4L4TE 3V4PL 4D3CH 4HIIA 5FA3B 1E4XH 3A6BH 4F7CA 2NY2D 1SEQL 1HH6A 4OFIA 2BSRB 1YMMB 4ZTPL 3KPRA 3SDYH 5KVEL 1E4KC 1CCZA 3HI1B 4PYHA 3L5WA 1I9RL 4YK4C 1JI1A 1GIGL 5D1QB 2JJUA 4WO4A 4KKAD 3RL2A 1FH5H 1N8ZB 4EUPB 4LVEA 1ES0A 5HHMD 5DMYA 1URLA 1UB6A 1A7QH 4HQQL 4KAQL 2YC1A 1K6QH 2FSEB 5MEPB 4JAMB 1O7SA 2EO9A 5INCA 4F7PA 1I75A 4JG0L 1JHKH 2VQUA 1TQBC 2AGJL 2JB5L 4HKBB 3W2DH 43C9A 4FQCL 1P5UA 3VFPA 4CMMB 1S5IL 1KJ2L 3LPGA 1FL6B 4Q9CA 2VIRA 3V6ZB 1I8MB 3JWOL 1BX2B 3QH3A 3DSFL 2YKLL 4M1GL 5KJRL 1Y6MR 3TC9A 4GBXC 4PB9H 3O6FD 1IM3B 1RZKC 3T0XA 3X14B 1JZ7A 4OD1L 2OR9H 4QF1B 1I3GL 1MCWW 5MENB 4JFPA 4PJ5D 2GTZA 1X4YA 4Y4HD 4ZDHB 1BM3H 3C2AL 1EXUB 5IFAH 5CKAA 2DYPB 3MA7A 1M71B 1EIBA 4UOJA 4GKNA 4Q9QL 3V6FB 3FQNA 2EIEA 1K8IA 5DEFB 1SJHA 3BVNA 4OBSA 5A40E 5GGVY 3DMMD 4JFHE 4ZYKB 1P6AB 5MEQB 3DI2B 1L9NA 3MV01 5FYKE 3SGKA 4TNVK 2AEIT 2IAND 2Z9TA 2NLJB 2W0FA 5MP6H 5IVNA 4NZTL 3GSVA 1A9BA 1BPVA 3LHPH 4HXBH 3QUYB 1N59B 4M48L 4A6YB 4XP4L 4P2QB 3I3EA 4LASH 4N8VG 3QUXD 2RCSH 3NTCH 2OYPA 5FHAL 5EWIL 4GAGH 1VESA 5DK2B 1QSFE 5I73C 1Y6NR 3NN8B 2R1YA 1I85A 1CWVA 2A6DA 2XN9B 4BQ9A 4XNUH 1WT5C 5GGVL 4Y1AD 5FECA 1OAYH 4R4FL 1F3JB 5AEAA 3DURB 1C8PA 1KCVL 1FBIH 2HLFC 1FQ9C 1N26A 5C86A 3L3HA 3OR6B 1OVZA 3MJ6A 5DD6B 5D1XB 2P47B 2WBJB 2QEJA 3TN0A 1G6RA 1MCNA 3KJ4B 2AV1B 3QUKA 5DHVB 4HUMB 4IEFB 4HEPG 1LP9F 3SQBA 5GSRB 1FVEB 5C0FB 1MCFA 4P46C 1IQWL 3IKCA 4OZFG 5GRVL 4LAJH 1MAMH 1DE4A 2GITB 4NZUL 4NHUB 5DR5L 4OQTH 4YIQA 3UTOA 1FLTX 4RBPH 3Q0HA 1RZ7H 2RGSA 5EUKB 3LZFL 5EU5B 4G6JH 4P5TB 4NNYA 4MXQC 5GJTL 3BDBA 4F57H 4KK9C 4QTIH 4Z7VB 3SBWA 3BXNA 4HUVA 4L3CB 2GSGA 3PXJA 5FKAB 3BEVB 5TPWH 3L5XL 1BFOB 4HLZG 1OM3H 4CADA 5EO1A 3L3KB 5CJ8A 2ESVE 4X5WB 2RFXB 2ZSWA 4GXVH 4LLUA 5D6CA 2LU3A 3B6SA 1D9KB 3IRPX 4Y2OA 4MD5A 5I1GL 5EDXA 4XCFH 4GW5A 4WWKC 3HR6A 3NCJL 4HWEL 5I16A 4AT6B 1L7TL 1DN0A 4JPKH 3O3DA 1MSPA 5GGSB 4GRWF 2YK1L 2BOCA 3GNML 3HKFA 1MCKA 3MV7A 2MOVA 4D9RE 3W11C 1KF9B 4PJFF 4GW1B 3PV7A 4XHJD 1GGBH 3TCLB 2P46B 3NABL 4XPAH 2D3VA 5HVHB 3OG4B 1T6WA 2RB8A 3V4PH 4X4XA 4ZNEE 1T22A 4NQED 1EV2E 5BS0B 4BZ1L 1MCLA 5FGCE 2EXYC 1SEQH 1IM9D 1HHHB 3FFCB 4M8QA 4ZTPH 1NJ9A 4B7LA 3RY6C 5KVEH 1GPOL 2GJ6B 4MQXD 2F9BT 1I9RH 3RWEB 1MFBL 1GIGH 2X7LA 3O6LL 5HGDA 2VTFA 3OB0K 1T5WB 1MWAB 2A77L 4HQQH 2E9WA 4KAQH 4WCYL 1CDJA 2X4QB 2DDQL 4K8RC 5FGBC 3DRTA 3RUGF 4UNVA 4IOIA 5H2BB 4JG0H 1ACYL 3EYOA 1IQDA 3BRGC 2P4AB 4J12A 3SGDH 1R3JB 2JB5H 1EH9A 5H94B 4FQCH 4CU7A 4KI5D 1S5IH 1KJ2H 3PHSA 2DWDB 2JB6B 3JWOH 3DSFH 1CDBA 1EVTC 4OGYL 3CXDL 3WLWC 3PWLB 3SPVA 2YKLH 5ISZA 1IKFL 4PJCE 5KJRH 1DQDL 1QBBA 4FQXD 3ES6B 1FG2B 3BQUC 4QGTA 3KPSA 4EI5B 4OD1H 3ROLB 3VRJA 1HOCA 3V6OA 5J12B 5HD8C 5IQ9A 1I3GH 4QOKD 2WNGA 3QEHB 2AQ3A 5FO8A 4JFFA 3MOAL 5F7HA 2IGFL 2A0LC 3TFKA 1Q9OB 1GOHA 3C2AH 1ZMYA 3UBXA 4Z78B 3OKDB 3TBYA 3E2HC 4AEHL 4NJAL 3ECBA 1WAAF 3SGEI 5IMOB 1A64A 4N0UA 1W72A 4Q9QH 2QKIB 3MLTB 1WCBB 3UZEA 3AXLA 4WW2B 4F9PA 1F6LL 2DLIA 1ADQL 4RGMB 1MJ8L 1GOFA 1WZKA 4X6FA 3VFTA 2EDHA 1JZ5A 1T2JA 1VFBA 1UYWL 3I2CL 1IAII 4NZTH 3MJ8B 1LQVA 1OLLA 1FZOA 5C0IA 3S36L 2IQ9L 5TH2A 5FUZL 2A2QT 2Q76B 2PXYB 4M48H 4XP4H 3MRJA 5C0NC 2Y7QA 3CJJA 3IDGA 3MRHA 3D48R 5F93C 2DB8A 5FHAH 5EWIH 4YFEA 4KHTL 5EU7E 3RRQA 1CVRA 3T0EA 4C4KT 3R06A 4N9GB 4L4VA 1UZ8A 3DPBA 2JIXA 5HVGB 4GKSB 1PQZA 4LKXA 2A73B 3CNKA 2A6JB 2IALB 3CX2A 3LKSB 2FHBA 4R4FH 5JHDA 1N2RA 1KCVH 3QDGD 2I07B 5E8PA 3H9SB 2CDFA 3KPOB 4NQTA 1WISA 1U8KB 3KYOA 3BZEA 1FL5A 3CMGA 4HZLA 1BBDL 5BW7A 1JYXA 3DO3A 1GAFL 3RWJB 2EDEA 3P4MB 3GUTB 4XC3L 4YHZL 1UJ3A 5IESL 1MCEA 3RQ3A 4HIEA 1IQWH 4CAGA 5D7KD 2K9UA 4NZUH 1AGDA 4PV9A 4ZUTB 1RHHA 4WV1B 5IK3A 2CKNA 1SMAA 3QQ4B 4YFLF 3AU1A 3LZFH 4JKLA 1ZHLA 4X6EA 5F72S 4U0RB 3MRDA 5GJTH 4PP8C 4XP6L 1OSZA 4XZUA 3QQ9D 5I1LB 2G75A 5SWSB 1IEHA 4HC1A 4GBXD 3ARGC 3L5XH 2F54A 3GIVB 5BQ7A 1ZTXL 3MJ9A 2QADB 3ARFC 1XAUA 2B5IC 2KPNA 4FMFA 1ZWIA 2VE6A 3JV5A 3U7AA 2CJUL 5I1JL 5KSVB 5I1GH 4WU5A 3E3QE 1GGUA 3NCJH 4OT1L 5T1LA 4HWEH 3P4OA 2NTSP 4F15B 5FDYA 1L7TH 4Y16B 1JZ4A 5DI8B 1AD0B 4LVHC 1C12A 4RA3A 2YK1H 3RZCC 4BSVB 3GNMH 2AXGB 3PIQB 1F90L 4PR5B 1IT9L 3HI5L 2V7NA 2XYCA 4MAYA 1GGTA 3NABH 3IXTB 3R4DA 5HYQA 1NUFA 3L95B 3SKJL 4LCWE 1EVUA 2ILLA 5E8OB 3RWHB 2ITDA 3AFLA 4CMHB 5CEYB 5LVEA 5HHVL 2D7OA 4BZYA 1I1YB 4QRPD 3TO2B 4IS6A 4X98B 4WFEE 1NGYB 4OZFH 1FZKB 2KUTA 4HV8B 1GPOH 1L7IL 1GCFA 4J3UA 4V1DE 4W81A 4JRXA 2IBZY 1MFBH 3KDMB 3KLDA 2ZSVB 3O9WA 4YC2C 5IEHA 4IRJA 5IJKC 1H5BC 2A77H 4WCYH 4WUUE 1J1OL 2Q3ZA 3TBSA 4GLRH 2DDQH 2X4PA 3HC3L 1VGEL 1X5HA 3KXFA 1CXLA 2R1XB 4M5ZL 4XBGA 3OX8A 3OGCA 1ACYH 4HLZH 8FABA 1FNHA 4PJDA 5F96L 3R0MA 3MCLL 4MYWB 3S88L 1H3UA 2NY3D 5D7IF 2HLFD 4Q2ZA 3TV3L 4OGYH 3CXDH 3W9EB 2F58L 1A2YB 1IKFH 1QLFB 2HFFA 4L3EE 5CSZA 3VH8A 3ZMRA 3BGMB 2EDRA 3WNMA 3HAEH 1RIHL 2F8VA 1YEJL 5D7LE 3GMOB 3MOAH 4K23L 4PJ9D 2HWZL 4MXWL 1W0VB 2IGFH 3CFDB 4G3YL 1JF5A 3Q48A 3BRDA 3H7LA 1JYVA 4A2LA 5F3HB 3UDWC 5ITFA 3CVHB 2WW8A 4NJAH 3CZJA 1AXSB 3FKUS 5T3XL 2HJLA 4HX1A 2X41A 2YPKB 5FYLL 3TBTA 2V7HB 4D8PA 3S4SG 4F7EB 3OHXA 2F8XC 4JG1L 2XWTB 4MXQD 1AR2A 4RMUA 4ELMF 3WO4C 1ZS8A 1ADQH 1MJ8H 3CPLA 4M93C 3UYOD 1KIRB 3PQYB 4X9HA 3HG1E 2ED7A 1F4XL 1EHAA 3I2CH 1Q9LB 1I9JL 3QEQA 3GJEA 4NRZA 1C5DB 1LILA 3WN5C 5GS0L 5F7WC 1G7MB 2IQ9H 5FUZH 3KAAA 1EMTL 3G6JE 3U4EB 3F7YB 3JXAA 1KIPB 1J12A 4AIZB 3OKEB 4FOMA 3JWOC 4WWKD 4X6CF 3T4AB 4N1EA 4MCYA 1FNLA 3TZVC 1U6AH 3W0WE 4KHTH 4MNQE 2D7QA 2NXYC 1V3KA 5TFSH 4YPJA 1TDQA 3TT1L 4QKXB 2VB5A 3ZYIA 4UIKL 5HYJE 3RWGB 2DWEA 4P9HL 3SY0B 3NBNA 1RUPH 1F2QA 4WDIB 3MV8B 5GRXG 2YD6A 1QSEE 2DM2A 2R2HA 5I0DA 2E7MA 3LD8C 1DDHB 2LU7A 3FL7A 4JJ5A 3REVA 4KQ4L 4M1CC 4NQDE 5BOPA 3O41B 1BBDH 5F9WB 3ILQD 5CEXA 2DMKA 1XH3A 1GAFH 5C3TA 1BFVH 3LAFA 4XC3H 1K4CB 3QI9C 4WTWA 2OL3L 5F8QC 5T1KB 3WJJC 3KYMA 3MRBB 4K8RD 5EZIL 4NT6A 4NN7B 5GGRB 4OFVA 2Z8SA 4Z7VF 1CFQA 1KCUL 2C1PB 3KWWB 3U2SA 3K81A 1AE6L 4D0BA 3T1FA 5CILL 4KKLC 4NM8L 5HHOE 5E8NA 2BVOB 3LDBB 4XP6H 4Y4FD 5E94A 3TNNB 1TZHA 3PGCA 1RK1A 5C09E 5JMRA 3G9VA 5IBUG 3OL2A 3WLWD 5JW3L 3HB3C 4MHHG 1AO7D 3BQUD 1ZTXH 1ZHBB 4ZUVA 5E9DB 1NFDE 1A3RL 4PFEA 3L3IB 1NAML 4OIAA 1Z3GL 5I1JH 4XBEL 2VXUL 3VFOA 4ISVA 1AHWC 4PJ7B 3BPCB 1MHEB 3FQWB 4R96B 3VXQA 5FV2A 5DJCB 4OT1H 3V5DA 3L6FB 1KIQB 4IIQC 4YDVA 2V5YA 2RHEA 3RWFA 1CE6B 5BJTA 1FYTD 2FNBA 3O4OB 4NJ9L 3HTLX 1F90H 5DEGA 1IT9H 2E5EA 3HI5H 3QUZD 2VUOA 5EPMA 3VWJB 2AJXL 2Q3AA 3WEXB 5CP3A 1GH7A 1J1PL 2UWEB 3OG6B 3QWQB 1CGYA 2ADFL 3ZDYF 3SKJH 2ATPB 3N06B 4M9OA 4P23C 2DRUA 3VI3F 3CFBA 5HHVH 2CMRH 1C16A 1UXWA 1KB9J 2R0LL 2VLRA 4LLDA 1X5IA 3QDJB 1L7IH 2R1WA 4NN6C 1T3FA 4LMQI 5IFJB 2DIBA 4JR9L 1R3HB 1A6TA 1FNGA 4WFHD 3OB0H 5E08L 1G7PB 5IVXE 3FT3A 2OQJB 5IVZA 3FQTA 1XIWC 1J1OH 2UY6A 4BM7A 1A4KB 3HC3H 1VGEH 4M5ZH 1MLCB 4ZFFB 1ZAGA 4ZAKA 4MQTB 1EGJA 2NY1B 3HUJF 1KLUB 3MCLH 3MRQB 2VLKD 4Z7NE 3S88H 4WY7L 4M6OL 1X5AA 3TA3C 3DUUA 3U0TB 4NRXA 4MA7L 5BO1L 1S9VB 3TV3H 1JMZA 1NC2D 2HFGL 4Y2DB 3IDUA 5C0GA 2VWEE 3B8SA 3N1FC 3TT3L 3FOMB 1S78C 2VDNL 1RIHH 1YEJH 2OJZL 3CGTA 1EUTA 2Z31C 4NC2B 4K23H 3WDJA 1AP2B 3KJ6L 2HWZH 4MXWH 1IAMA 3GMPA 3O6ML 4Z7QF 4G3YH 4RWYL 5I9QC 1BAFL 4GAYB 3CFEB 3G6DL 1I8KA 1LO5A 3QUMB 5ECJE 4NKMA 3LVEA 4WW2F 2EZ0D 4AM0B 5KS9F 2EKJA 2ICWA 4FFWC 3PWJA 5T3XH 1U9KA 2BJML 4GT7A 5FYLH 1RUML 1RU9L 2VOTA 4HIHB 5I8EB 1R5WA 2EH7L 4EVNA 5KSAC 2GTWA 3VE0A 5JZ7C 4MS8A 5T1MB 3RPIA 3PWPA 2CSPA 1VFUA 4BH7A 1T21A 4NO0A 2X42A 5EZLA 4DZBB 4HEME 3OAYK 5ETUB 3ARGD 1F4XH 2DJUA 4X7TA 1NUDA 1I9JH 5DRXB 5GS0H 2FATL 3O6KL 4OCWL 2ZUVA 1WBXA 1KYOJ 4P2RD 5DMKA 1NGQL 1EMTH 5IB1B 1FVDB 1FJ1B 2P8LB 5KSBA 1KPUB 1CLZL 1I1AD 1I1RA 1LNUB 2O93L 1S7SA 3S6CA 5CSGA 3DXAE 3ARBA 4X6BA 3RZCD 2EKSA 3UPRA 1IC5L 3S97C 3TT1H 2XZQL 4ZQKB 1FZJB 3OQ3B 4UIKH 5F7MC 4F37K 4P9HH 5F89B 4NC1C 3OF6A 5HYSA 4PTTA 4DEPB 5INDA 5FDWA 3T3MF 2J6EA 4CVWA 1YPZB 1L6XA 3PWNB 3QQ3A 1RHFA 3VXSA 3CXHJ 1KIUA 1U3HC 4J1UA 3KYNB 4BUGA