3FQRA

Phosphorylation of self-peptides alters human leukocyte antigen class i-restricted antigen presentation and generates tumor specific epitopes
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
275
structure length
274
Chain Sequence
GSHSMRYFFTSVSPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDGETRKVKAHSQTHRVDLGTLRGYYNQSEAGSHTVQRMYGCDVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQTTKHKWEAAHVAEQLRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHEATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRYTCHVQHEGLPKPLTLRWE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
publication title Phosphorylated self-peptides alter human leukocyte antigen class I-restricted antigen presentation and generate tumor-specific epitopes
pubmed doi rcsb
source organism Homo sapiens
total genus 77
structure length 274
sequence length 275
ec nomenclature
pdb deposition date 2009-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3fqrA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3fqrA01
2AJVH 5HPMB 4L1DA 3E6FA 1RUPH 4WJ5A 4QHUA 4NGHL 3S3JA 5HYJA 4KI5E 3WE6B 3IDMB 3LH2H 3CSGA 1MFAH 2HLAA 3CFKA 1TVBA 4R7NA 1NFIA 1FL3B 4G8FA 2MMXA 4PGEB 5EB9A 3TJEH 2NYYC 3IKCA 4R7DB 5L0QC 3L3IB 3RL2A 2V7NA 1GZPA 2DWDA 4YDIL 3U0TB 5D7IA 3GJFK 3VDCA 2ATPB 3DHMA 4ODWA 2XZCL 4BSVA 4IRSC 1IFHH 1T1XB 5J6GB 2NY1B 3GEWB 3RKPA 2GSIB 1S7QA 2H45A 1CL7I 1QSED 2CKBB 1I1RA 3V4UH 2P42B 1ORQB 4OF6A 2GSGB 2BJMH 1NFDB 5DJXA 5EIIA 4AG4L 1ADQL 1B6UA 4OZFB 3MMEB 1JRHH 4D3CL 2LE9A 4KJYB 3OXSA 3L3HA 1OVZA 5CD5C 2X1OA 3WD5L 4LBEA 2UY6A 4FZEL 1JN6B 4F58L 2IQAB 1Z0NA 5IMKA 3QH3A 4HZAA 3I50L 3ZYZA 2DQJH 4R97B 3IDJB 4P2OB 4MCZA 4NP4H 2AV1B 1EV2E 1I7ZB 1MPAH 4U1GC 3NGBC 4WI4A 1BQHG 4JFED 3FN9A 1VA9A 4HUNB 4L8CA 3AU1B 3ULSB 4HIHA 4MX7B 3TJHC 2MQ0A 5ADOH 5ACMA 1MWAH 1L7TL 5D8JH 1UM4H 1YY9C 3CH8A 3GI9L 3LS4H 3OB8A 4KROC 2OTPA 4O2EA 2R8SH 4P23B 3RUGB 3F58H 3VXNA 2JJVA 1G9NL 3AB0C 3JV6B 3VI4F 1Z3GH 4M8VA 3D0VB 3T65B 4D9RE 4XNXH 1FSKC 3PHQA 4YQXH 1R24B 4P5TB 1FORL 5HHOA 1IGCH 5CJQL 5C1MB 4PGDA 4RGOL 5CEZD 1QKZH 4K9EC 5E8NB 4YGAB 2VDPH 1MJUH 5DQJB 3JWOL 4U1SA 3DUSA 3OKYA 2AK4E 2QQNH 3F6IA 3NN8B 4C59B 5E5MA 4TRPL 4PJAF 4CU8A 4YHNB 1C08A 1T2XA 2AK1L 3FQRB 5DMIL 4WTXA 4J3OC 3VXOA 2WQRA 1YEIL 1BOGB 1I7TA 1T5WA 3FB5B 4MXQD 1TQCB 4ELMB 3QG6A 4XPAH 4AENB 3ULVL 1PY4A 4WUUA 1ZLWK 1UWEH 1JPSH 2YK1L 2HT4D 3GSNL 2E9IA 5ICZA 2FECL 2VLRB 3RJDA 5ITFA 1XF4A 1YQVH 1WIPA 2NY3D 1KLUB 3G5XB 4RZCA 4CVXB 4IS6B 2DKMA 5CEXB 1SY6L 5JLZA 4FQ1L 4BQBA 5D71H 1N26A 2ZPKL 4FFYL 1BX2A 1GOGA 3VFMA 1RZFL 1MHPH 5C3TA 3JV4A 4DOHB 3LRSA 3U30B 4JVPA 2Y5EA 4JZJB 4ZUSB 5IB3B 2ESVA 4DKFH 5KSVA 2EYTB 3VD7A 1QR1A 1U92B 3O3DA 4PJCF 3SN6N 5ACLA 3H9HA 4PJIB 1ACZA 4NN6B 3CUPB 3TT1H 1MHEA 3U0WL 2AJUL 3GDBA 5B39A 4NN5B 3MLZH 1FNGB 2RAMA 4LVHB 4FOMA 1UWGL 3LRHA 4XCYB 4FP8L 5K9JL 3QUYC 5EOQL 4XCFL 1H0DB 5TQ2H 4IEFB 2VXTL 1PYWA 3E6HA 3I6LD 5D6CA 2CD0A 2NXZC 4LCIH 2EH7L 4OQTA 1VFUA 1EVUA 2BHUA 2BVPB 4FQPA 3WLBB 5JHDE 8FABA 5MHSE 4PBWD 4K3DH 5BS0B 5DEFA 3BDBA 1EBPA 4OIIL 4F7EB 4HZLA 4APQB 5DD0H 4OCWH 1A1NB 5D5ME 3JWDL 3AS1A 3VG0H 4P2OD 3SE3A 4NPYB 1YEDA 2B0SH 2CRMA 4F9PA 1AQDB 3T4YB 4J3WA 3AAZB 1KFAH 3GSWA 4ODXA 3MYZA 5H94A 3GNML 3NCYS 5CEZH 3V6FB 4YPGB 2BC4B 3RVWC 4DGYL 1JF1A 2WK2A 1G1CA 2C7UA 3MO1B 4KI5F 1ONQB 5E24E 3MXVH 4FQIH 4KGLA 4TSBL 3VJ6A 4KRPB 3LKSB 1CE6A 4OI9A 4NZRL 5GISL 1WC7B 2E8YA 4NQDB 5I18L 4MZ2A 1H3UA 1T1WB 5IB2B 4Y4HA 4N0FA 4O51B 2UYLA 2I60H 3V9FA 5I8OH 1Q1JH 5TQ0H 2KPNA 1BJMA 1NCBH 3OAYH 1EO5A 1A6AA 4HWBH 4LEXL 5FO7A 3ZKXC 4JFFE 4ZSOE 4EI6A 3ILQD 4KKBD 4KY1H 2FL5A 3QUZB 4NBXB 3BZEB 2DJUA 1GXEA 4X7SL 3W9EA 4I0PA 2ARWA 2H26A 1UGNA 5FUZL 5IWLA 4I18A 4LHQB 3T04D 4F2MA 5BCAA 3IVKA 1GRWA 5D72L 1WBXB 5LCVL 25C8L 3DECA 3QWOB 5ESQA 1LDSA 5I0DA 3FZUD 4U1NA 3PWVA 4HXAL 3DVNB 3X11A 1A47A 4HKBA 4NNXB 1OAXH 4RMUA 3DVFA 4NQSA 3PHOA 3QXWA 4PJXB 1FVCA 3T0BA 5DQDH 3QI9B 1KEMH 2JJUA 5L8LB 1FIGL 1X4XA 2VLRD 4FABH 5I66A 3UTTB 3CU7A 3UROR 4L9LB 3BUYA 1FNLA 4WGVB 4NQXA 1DDHB 1M71B 1MCCA 5EZLB 3BT2H 4Y5XA 3WS6A 5D93B 2YPLB 3PGCB 2YEZB 3KLSA 4RIRB 5IHUH 4LPWA 1LO2L 3MLYL 3WL9B 3GMPA 2F5AL 2NTFA 4X6EB 2JJWA 5JXEA 4RBPK 1NCUA 1GGBL 1SM3L 2R2CA 4MB3A 5CAYB 2MNUA 1MLBB 1AJ7H 4FQQA 5JXAH 5HI4D 2F53B 4DAGL 1LILA 2V9QA 1DJSA 2YSSA 4NRZA 1FLTX 3D0LA 2HH0L 1ZGLP 2C26A 1IQDA 3MRBB 4R4FL 3V6BR 5FO8B 4OLXH 2W0FB 2RHEA 4F7PA 2PTTB 3D85B 4PB0L 4U7SA 3RZCA 4OV6F 1KJVA 1JGVL 2VSCA 4U05A 4I13B 2VQUA 3JZ7A 4R9HA 1U6AH 3H3KA 3DX9B 3NCJH 3MNZB 5M95B 1FNSL 2F15A 1GIGH 3MFFB 5ALBH 5D1XB 5H35A 4HWEH 1W0YT 5HHNA 2HLFD 1K5NA 3CLEL 4OLZL 5IFJB 3H3PH 5K9QG 4JY5L 3MZTA 2NY3C 9CGTA 2YUVA 3LS5L 3O9WD 4LSUL 4Y5VB 2VERN 4ZUVB 4ORGA 5BS0D 3RU8H 2EEBA 3RI5F 4K7FA 1RZGA 1WVZA 3C8DA 2J12B 4F15B 2VABB 3U4BL 1A7NH 1T0NA 4HQQH 4P2RE 3STLB 5I1JL 5IW3A 2R2HB 1BIHA 3CMGA 5BMFL 2J4WH 3INUH 4NNPH 1OSZA 4PJ8A 3BPOC 1DUZA 2M26A 5HDQH 3U2SB 3B3IB 1QLFB 4M1CD 4GAGH 5E9DE 3ZKQD 1PZ5A 3I3DA 1F90H 1A1MA 4PJDB 3CFEA 2XWTA 3S4SG 1W72H 3RDTD 3BD4A 3MNWB 3MV01 4A6YB 4HAFA 2DRUA 3H7LA 1T4KA 1HQRB 1RZ8B 4NWUL 5EIQA 4KRPD 3QIBA 3VFWB 4ZO7A 3EYVB 2HT2D 4PJEE 2GTZB 4NQDD 5FGCB 4YHLL 3ARRA 1GZQB 2FEDD 3WFHA 3DETD 2E7MA 4WU7B 1DFBH 5F1NA 5ETUA 2WANA 4IOIB 3FB7A 1MCKA 5F7LB 4UT7L 1AO7E 4OAWA 4LRNH 4OLVH 3ALWA 3QEUA 3C9NB 5HVHC 4X9IA 3WNMA 1CICA 1JZ3A 1IT9L 3JUYA 3PWJA 4YE4H 1HI6B 4YIQA 3V8CA 2BSSB 4XVJH 1Q72H 4DN4L 4OD2A 4JFQA 3RIFF 2RJMA 4I18C 1Q9WB 3VRIB 4GMSH 2X4OB 3PP3H 4LIQE 4MVBC 4NCC2 4Q2ZB 5E2VH 4WY7H 4FQXA 4R96A 2YBRA 3LD8C 2Y1VA 3QI9D 1FAIL 3QHZL 3KYKL 4PG2A 3LZFH 3CK0H 2IH1A 3EFDH 1YPZA 3HNVL 2DDQH 3UTTD 4QXTB 5D5MF 1ZHKB 4RGNB 4ZFOA 4LLYA 4B50A 3HPLB 3ARFA 4TPRH 4NYLB 2BXZA 4K3EL 3WKNA 3MBXH 2YPLD 4UQ2B 1UXWA 1YY8A 4QXWA 3ESVF 2VH5L 1U8NB 1KEGH 4JFYA 1MFEH 4F7MB 3FRPG 4UTAH 5BQ7B 4LLUB 1A9BB 1HYSD 3IF1B 3P0VL 4OCSH 2K1MA 1JMXA 2F53D 3MODH 1LEKB 2A77H 3BUTA 5IB5A 1CDGA 1I8LA 1AI1H 3QULA 5SWQA 1OSPL 4OFYD 4OKVB 4D9LH 3BKCL 5EBMB 3QUMH 1NCDL 3B2UD 4WFEE 4RMQA 3T09A 4K23L 5DS8A 4FZ8H 5IK3B 2B7DT 2WBKA 3HNSL 4G80A 3WHE1 3D85D 4KI5D 5CINL 1BGXH 1BFVH 4NO5B 4OCMC 4O02H 1BQSA 5CIPB 3Q5YA 2CGRL 5GZNC 1FRGL 1S7VB 2BNQB 4YDLC 3DMMA 1HQ4B 2HVJA 4OLYL 4HXBH 1UVQA 2VDRL 5E8EB 1P4IL 3DIFB 2V2WB 5EULV 1D5BB 1HZHL 5HTSA 2X70B 1MRDH 4LOUC 4OD1L 3T0DA 4L8BB 4FFWC 1II4E 4C4KO 1J5OL 2OL3B 1HCVA 2Y36L 1NJ9B 2GY5A 1PJ9A 4ZS7H 1MVFA 3DX7B 3SJVA 4WHDA 3T3PF 3S7GA 1LNUA 1P6AB 4OIBA 3RY6C 3CFJA 3T1FB 3KPLA 4JRYA 1NEZA 43CAA 1KJ2B 1WTLA 3MRHA 2RQ8A 3IYLW 3BYTA 4XMPL 5FA3A 4FQ2L 4KK5C 1HHHA 4LLVB 4OM0H 3RWIA 3V4PL 3EYSH 4G6MH 4JN1L 1CXLA 4OFKA 5HI4C 4X4MA 2ADGA 1O7SA 5E5UB 5DURB 2KBGA 1NGPH 1HKLL 3CPLA 3J7HA 5B38G 3BQUA 1ZT7B 1WUNT 1EFXA 2XY1A 4HWUA 4PJ8C 3V5DA 5I2IB 1EUUA 5IW6A 4M1GH 2E7LC 1DVFA 2RCSH 4EN3D 4GS7C 4EXKA 1I1CA 1X5IA 4KUCF 4QRSA 1MRFL 4NRXA 3O41B 3NABL 4YO0A 4HUUA 2GI7A 3FO2B 5EFIB 4EUPA 4HIEB 5JZ7C 1IM9A 4KZDH 3UTPE 1OT1A 4Q9QL 4G6JH 3UPAA 1NAMA 3KPSA 4OD3H 1FFRA 4TUKH 1KN4H 1LO5B 2MKWA 4DTGH 1TTUA 1VGEH 3OZ9H 4NFDA 4RFNC 3S37X 3RL1A 1Q9OB 2AV7B 1L9NA 3MRRA 3UPRA 4WI7A 3MYJA 2WBJB 5IGXL 4WGWB 4D9RD 3DBXB 5BJTB 1DL7L 5IJKA 3O9WC 1XH3A 5I1KH 4JFZH 5BV7C 3VD9A 1F4YL 4M48H 4GRMA 1YDPA 4Z76A 3BESR 1P7KB 2XKSA 3HG1E 1R5VB 5I1GH 1T04A 1S3KH 1V7NH 5DT1L 4NRYA 4PRNA 3MJ8B 4OGZA 4P2QE 3I3EA 1G9MC 4XXCC 5EWIL 2BSTA 1VEPA 1CE1L 3MLWH 3GSVA 5JO5B 5IHZB 4PJ7E 4OZFG 4LARL 1S5IH 3RDTC 4HWZB 4TOYH 1T2JA 5EBGA 3RHWK 4WUUE 4G8GB 2IGFH 1FNEB 4PJHA 3RHWF 1ED3B 2DICA 4PY7A 4F33A 3ZKSD 2HG5B 1B0RB 1P53A 3GSRA 4XX1G 1HWHB 5IMOA 3S34H 4TUOA 4JFDB 5DFVC 1EH9A 1ZANH 3UXFA 2OLDA 1CGVA 2FEDC 1CFNB 4JE4B 4L8SB 4S1QL 4U1MA 5I8CB 4ZQKA 5SWSE 4TQEH 4ZOEA 4QF1A 1EGJA 4ZFFB 3OAZH 1OGTB 4ODUA 3LEYH 4JVWA 4JZNA 5FA4A 4HHAA 4NKIH 3EO0A 3TF7A 2D03L 4GXVL 1OL0A 2B5IB 1A7PL 3KGRA 5F9WB 5EORH 4PJEF 5KSAB 5ID1B 1BVLA 4N8VA 2AJSL 1EVTC 3LAFA 2OSLB 3SDDC 4YFDB 2ESVE 1TNNA 5EOCL 3R8BB 1TJGL 3ECBB 4FQCL 4B0MM 1UM5L 1J1OL 5TDPB 3ARTA 5HGHA 5DUBB 2FJHB 3GBNH 3QQ4A 4OB5L 2P8PB 3EFFA 5DJCA 3QNYA 4GG8B 5EPMA 5IROA 5J56B 4X5WB 3T2NL 1P69B 1K8DA 2E6PA 2GK2A 3HAEH 4H25B 1QRKA 5L0QB 4G43A 4BSJA 3ES6B 2E7BA 1XF3B 3NAAH 2EDOA 3C8KA 5I1EH 1AGDA 4NHUA 1JWUA 2AABH 3DGGB 4YX2H 3FQUB 1X44A 5BOZG 4F7CB 5IOPB 3C2AL 4XPHH 3MCLL 5JHDD 3K4DA 5MHSD 1X6LA 4IMKC 3P9MA 3PL6A 4M62L 3QR2A 5FUCE 3B2UC 5DHVB 5D7JC 1IEAA 2EKSA 1KUMA 2PW2B 4E0RA 4KI5C 2L7UA 2ZG2A 1NUFA 5DJ6B 2YRZA 4WCYL 3F12A 4JQXA 2J6EL 2VLKB 4KK8C 4LEOB 3VFSB 4ZPTB 3VFNA 1QFPA 3GUTB 1ULVA 4PV8B 2WW8A 1N7MH 2HJKB 5CS7A 1IZKA 2Q86A 3KYNA 4X6CB 4FFZL 2O61B 4WHYG 5FOBB 1KENL 5DJZA 2ENSA 1F11A 1WZLA 4N0UE 5F7FA 3U36B 5FK9A 4N68A 1EAJA 2WBJD 5KSUA 5F44A 4AM0B 1FLRH 1ADQA 4KROB 2G75A 1KIRA 4M5ZL 4I3SH 2CDGA 3AB0B 3EW3B 2FB4H 1CFQA 2JCCB 3HC4L 4MJ5B 2F58H 3BKML 4M4RA 2ZKHL 2BVQA 3TO2B 3WXWL 4Y0GA 1SEBB 1A8JH 3N1PC 2ZUVA 2A73B 1JF6A 5F96H 3O11B 1KTLA 2VL5B 2E3VA 4S1RL 4EN3C 3VRJA 2X2YA 4XNYH 2VN7A 1SJXA 4I1NB 1H5BC 1MIEH 4ZMAT 2Z93B 3IXTB 3RNQA 3TNMB 2B20A 4BFBD 5INCB 1LE9B 1A1OB 3RWGB 1MCOL 1RV6X 1CLOH 2W38A 2XNAA 1WFOA 3CC5B 1BQLH 2Y7QA 4U0RC 3IDNA 2V2TA 5CIPH 4L4VA 5B8CA 3G6DL 1P4LA 3BO8B 2BVTA 3D18A 2UZXB 1QSFA 3D2UA 1YMME 1A6VL 5T5FL 1UB5A 5D7KE 3FT3B 4C58B 2EECA 5ALCL 1Q38A 4F8QA 2C4XA 4XC3L 3MRJB 4LKXA 4AEHL 4EDWH 4WTWA 5HY9A 4PGCB 2QQKH 5DMKB 1QEWB 3MROA 3T0AA 3L9RA 4U4BA 4ERSL 4OBRA 4YHYC 5EU5A 3E6FB 4WJ5B 1A5FL 3C09C 4HS8H 5EU3A 5HYSA 5HYJB 4P59H 5IBUG 3GSNA 3MGAA 1E4XH 4UOW1 3QPXL 5LG1A 5AG9A 4QHLA 4RX4D 2HLAB 3CFKB 4HC1L 1TVBB 4R7NB 1NFIB 1TJHL 2RIKA 3X17A 5I19H 4QRQA 1EDQA 5AWNH 3MRPA 1SY6A 3IKCB 5HI3D 2V7NB 1GZPB 2DWDB 3HNTH 3IU3A 4D8PA 5GSVA 4PJ7F 3UJJL 1MREL 5D7IB 3QIWA 3K46A 5D70H 4FA8A 4Q0XH 4O4YL 1B0WA 4BSVB 3AREA 1M4KA 4JG1L 3MLUL 5KS9E 4U1LA 3CVIH 1S7QB 3HB3C 3HPJA 5J6HB 1LO3H 3MREB 4OI8A 3W0WA 4CDGC 5DJXB 5EIIB 2I07A 4WVRA 4P2RD 2Q8AH 4Z7VA 1OTTC 4CADA 2PTUA 4L29A 3OXSB 3BIAX 2VLKD 1YEJH 3WEXA 3KHQA 4LBEB 3T08A 1MAKA 4KZEH 3HCVA 2ZZUT 4XGZA 4QKXB 5IMKB 4WUKH 3QH3B 2DYPA 3P0GB 3PWLA 1MJJA 3AFLA 4Z7QF 4MCZB 1KPRA 4OF8A 4RISL 3SKJH 5TFSH 3W5MA 2ITDB 5CBEA 3ZDYE 4RWYL 4L8CB 1F58L 1ZAGA 4HIHB 3SY0A 1AGEA 3T2PA 1ERNA 2CLZA 4O2EB 3Q5OA 5SWZE 1FNHA 3CCHA 4M9OA 2FX8H 2H41A 3VXNB 2EC9T 3MLVL 3KPQA 4HCRH 1VENA 2P7TA 3C6LA 4G7VL 3PHQB 5FYLE 3BI9X 3O81A 5HHOB 1YC8A 4YXLH 4LGRB 3ROLA 1MNUL 1MCPL 4PJFA 4GRLA 2PXYD 4OJFL 8CGTA 3X3GH 4U1SB 3DUSB 3PNWA 3H42H 4JDTL 3NIGF 1N59A 4WEUD 5DUPH 5E5MB 3TPUA 3CDFA 1C08B 3ZHKA 2NY4D 3QG7L 4NC0B 3T2OA 4YDJA 4XC1H 3VXOB 3TBSA 5CMAA 4TVPL 1I7TB 1T5WB 1YPZE 4KRNA 4LK4A 15C8L 3TCXA 4E5XA 5HYEA 1JWSA 1NUDA 3QG6B 3UEZA 3QBTB 3AUVA 1AHWA 5DLMH 5L88H 4CN4A 1RU9H 3QSKB 4KK6D 5B8CC 1S9YA 2C3VA 2J2ZA 1FC2D 5FCUL 1E4XI 3WHXA 5ICZB 3ELAT 2QADD 3R0NA 3TV3H 5IFHH 2F74A 5ITFB 4N1EA 1XF4B 1TZIA 2VKXA 1Y0LA 4D9QE 1IAOB 4RZCB 1CR9L 2HFTA 5JLZB 4S10A 3S35H 4WFED 1BX2B 3ZHLA 3S8WA 1G7JA 4NUJB 3BISA 5LXGL 5CJXC 1B2WH 2DKSA 3JV4B 1G0DA 3NZHH 3ZMRA 3HKFA 4JM4L 3MX0A 5IQ7L 4BQCA 3QZWA 4YHOH 5CKGA 5KSVB 1MCIA 5J3HC 2C4FU 1QR1B 3O3DB 2WUBL 3B9KA 4LSTL 4XH2A 2PO6A 4NUGL 4Y4KA 3BMVA 1MHEB 3OV6A 5B39B 2DLFL 1YMHA 1C1EL 3F7YA 1D9KC 2BDNH 2H8PA 3TEUA 1OQXA 5C0FA 4ZDHA 1JPTL 3WHE0 1AGFA 3GMLB 1PYWB 3E6HB 1RK0A 4LRIC 1DZBA 5D6CB 4Y89A 2AJ3A 4NJ9H 4YJZL 5IVXE 2D4FA 2XG4A 3BPLC 1LO0H 4RA3A 1EMTH 4EKXA 8FABB 3TA3A 1RUKH 5I1DA 1M1SA 3OGOE 2ERJB 4F37K 5KSBE 4KVNL 5DEFB 1NEUA 1DQQA 1S5HB 1XR9A 4K3JL 4KKCD 4Z8FL 2OR9H 4HZLB 5EU6A 3QCUH 1X5FA 4U2YA 3WMSA 2HFGH 3BPOB 3LKOA 3VFTA 1YEDB 5D96C 2IAMC 1E4KA 1L0YA 1T03H 1HINH 3CXDL 1O7VA 4GRWB 3GSWB 3UTPD 1WT5A 2O5ZH 5SX5H 1CFTB 4QTIH 4ONOA 1VPOL 1NCTA 2KZ1B 3O4LA 4K8RC 5T3XL 3HC3L 1NUGA 3VMOA 1JF1B 2C7UB 4I9WE 2XA8L 3HR6A 1XGRA 5ANMA 3QJHA 5E8OA 1MVUA 3VJ6B 4LIQH 5J1TC 1CE6B 5HGBA 4NKDA 5KOVC 4MZ3A 4LL9A 4YGVA 4Y4HB 4N0FB 1X5LA 7FABH 2UYLB 4AQ1B 2YKLH 1U3YA 5HVHB 4GRLC 5CILH 5L7XH 1A6AB 2FX9H 4XI5C 2JB5H 5FO7B 4EI6B 2FL5B 1N6VA 1G7HA 3W9EB 3ARYA 4WO4A 5KS9F 4I0PB 2H26B 1OTSD 4I18B 4F2MB 3IVKB 1H3VA 1TCMA 2XXCB 4MAYA 4PJHE 4WUUD 5ESQB 1IBGL 3ULUE 4OZ4A 4U1NB 3GMOA 4TTDC 3LKRA 4HKBB 4GSDL 1BJ1J 5GZOC 4NQSB 3PHOB 1LWRA 4ZAKD 2ZUXA 5DC0A 1FVCB 4YEEA 3S88L 4XWGL 1F13A 1D5IH 3ZZ1A 2BK8A 4FHBD 3L3DA 3P4LA 5I66B 2GKIA 3MCKA 5GJTH 1NKRA 5B21A 5BRZE 4GBXD 1PY9A 2XN9A 3WV0A 3BUYB 1BBDL 2VXSH 4NQXB 1EUTA 4FMFA 4Y5XB 1ZWIA 3BN3B 3ZDYF 3GMPB 5DXWA 1QACA 1DP0A 4PGBA 2NTFB 1NC2A 2PXYC 3IDXH 2DQGL 3BDYL 3R4DA 1HIMH 2GITA 3U4AA 4FQQB 4GOSA 5I73C 1P9MC 2J8UA 2X4RA 1E4WL 3L5XH 2ESVD 3NOIA 2YSSB 4NRZB 3GSUA 3D0LB 1PFCA 1IC5L 1IQDB 1QYGL 5CHNA 4YHIB 1JVKA 3T8XA 2E27L 2DQCL 5EO9B 3GJFB 4F7PB 1T5XA 2EDDA 5GSRA 1ZSDA 1ZGLM 5DGRA 4PRHE 2CMRL 1KJVB 4LKCA 5DZLA 3IDGB 1LP9E 2J8HA 2XZQH 3Q2CA 4NJAL 1LK2A 3IDIA 4KWUA 4GKSA 4RDQG 4Y1AE 5B3JE 1NMAH 1RULH 5H35B 1JFQL 3OAUL 2IANB 5I9QC 4ODVH 5HHNB 2DBLH 1WK0A 3BW9A 3R0MA 4OT1L 1K5NB 1S7RA 5E08H 4XVTL 1F97A 2VXQL 1NCWL 1E0OB 4AIZA 2QEJA 1A0QH 4JRXE 3CDCA 2AI0L 4ORGB 2X89A 5J8OA 5DO2D 2VN4A 4K7FB 3HZVB 4AY0A 1RZGB 2W65A 1I8KA 4CVZA 3QDHA 1B3JA 3BXNA 3MJ7A 1T0NB 2E8ZA 4EI5A 1MCDA 1EA9C 1J86A 3HA0A 4Y16C 2WM0A 1MHHA 1PEZA 5I74C 2KZWA 5EZOL 2NPLX 1OSZB 2HTKD 4H20L 4PJ8B 3C5SA 3PUCA 1DUZB 3D3VA 4EQ2A 5D1QA 1CDIA 4UAOC 3V5HA 1TENA 1A1MB 3CFEB 5BO1H 1BM3H 1BMGA 2V5RA 1WT5C 5CJBA 3WUZA 2VTFA 2NXYB 2X4TA 3K3QA 3ZTJG 4TSAH 4YC2B 1T4KB 1J1XH 2W9DH 4BH8A 4L4JA 3WDJA 3I9GL 3QIBB 2DQDL 4PD4K 1T89C 4MQ7A 1J8HA 4Z0BH 1J87A 3EIFA 4Y4HD 3V6ZB 1FGVL 4HJ0D 3WFHB 4Y19E 5F1NB 5ETUB 3FB7B 5BV7B 1PG7H 3VXTA 3FQTA 5FHBH 4OAWB 1OGAA 3QEUB 1CICB 3SDXA 1KCVL 2XYCA 2VISB 4ZNEA 4I0PD 3PWJB 4UZGA 5I30L 4KKCC 4YIQB 3TT3L 4HT1L 3JTSB 2DLIA 4MDIA 4I3RL 4I2XA 5GS1C 4OD2B 4JFQB 1YC7A 4ODTH 5C09E 4HPOH 3H9YA 3MR9A 4YWGL 5IVXF 1Z9LA 4FQXB 4X7TA 5E6YA 1YEHL 1QRNE 2YBRB 4LSPH 3ARBC 5KSBF 4QT5A 5A2KH 2IH1B 5C0ND 4PG9A 5LGKA 2KH2B 3CIQA 3PABA 3U9PL 2YMXH 4ZFOB 4LLYB 3ARFB 1UA6H 4GG6F 1PZUB 2D7TL 2FX7L 3O3AB 3EOAA 1SYVA 1UXWB 1HH6A 1YY8B 1P2CA 2AEPH 4JFYB 4XCCL 2I5YL 1OQOA 1UT9A 5D7KD 5C08E 4MA3A 4MLIA 5JXED 3TYFA 2ZOKA 4NC1E 3O3BA 1KB5L 4ZFGL 2WMPA 4ZXBD 2FBOJ 4RMTA 4H26A 2OJZH 5C71A 5IB5B 1YEFH 4YXKH 3QULB 5SWQB 3MV8E 2WY3A 2X1XR 3SDDB 1PGRB 1RIHH 5DS8B 2XZAH 4KQ4L 4Y5YA 4G80B 2DS4A 4L5FL 3RZCD 1JNNH 4U6YA 4OQTH 3OKDA 5I1IL 3I2CH 4MLSA 4XTRD 4MDJA 3GO1H 3DMMB 3KPRA 5F7DA 2HVJB 4KKNA 5ADPL 1UQSA 1UVQB 4KGJA 5LQBL 4ZAKC 2IPUK 3ORJA 5KJRH 2FATL 4HKXA 3VMPA 4EOWH 1VADA 3IFOA 3SJVB 4GBXC 1CDYA 1QSVA 5FM4A 5E99H 1LNUB 3UX9B 3KPLB 4JRYB 1DQMH 3MRHB 2GJ6A 3CFBA 3JV0A 4JO1L 5FA3B 4PB9L 5D1ZC 5FYJD 1QFUH 4FTVA 4PUBH 1HHHB 1RMFL 3V0AC 4N8CL 2ADGB 2AXJA 3UPCA 1JP5A 3O0RH 4P4KA 5GRUH 2FRGP 3CPLB 5D7JB 4U31A 1DBBL 3HR5B 1FBIL 3DWTA 4U6TA 3UMTA 3BQUB 5AZ2L 1EFXB 3RVVC 4S11A 2D3VA 5CP3A 3V5DB 1SVZA 5HPOA 1DVFB 4OGXH 2YPKA 5D1QC 1IZJA 2AQ3A 1BZ9A 4QRSB 3WYRA 4YO0B 2K9UA 4HUUB 4RFOH 4EUPB 4CDHA 1IM9B 5GJSL 3QIBD 5D9SA 1L0QA 3TFKA 1NAMB 3KPSB 3SE8L 4CUCA 4LCCC 3Q1SH 1BP3B 1RURL 2F5BL 2XI9A 5KZCB 1CXEA 1AH1A 3RL1B 5SWZD 3DOSA 1FFNA 3G9AB 5ERWA 2KUTA 3FHQA 5D2LE 3MRRB 3UPRB 5CZXC 1B0GA 3MYJB 3KLHD 1BJ1H 4U3XA 1XGYH 4UIKH 3IAPA 1GPOL 1XH3B 1LP9F 5IT2H 3B9DA 1CICD 1MAJA 1GC1C 2FDBP 4OZHE 5D6DC 4KMTH 1P7HL 4GRMB 2J6EA 4Z76B 5B3JF 5FUCC 4UV7H 4AIOA 4H0GA 4ONFH 1T04B 2DQTH 3MLTA 2RBLA 5KVFL 5GS3A 4U1HA 3H0TB 3SPVA 3E2HC 4KKLC 1DBAH 2CXKA 4NRYB 4PRNB 2NY6C 1YN6A 2R23A 2EYRA 2A9ML 1PD6A 3KLDA 4KK9D 4FQXD 3SBWC 3GKWH 1OP3H 4M7LL 5JPNA 2BSTB 3BSZH 3GSVB 2D4DA 3HZYA 1CIDA 4PP1D 1N2RA 1RJYB 4DVBA 1IC1A 4BM7A 3ARFD 3QDJE 4PJHB 4OGYH 4I0KA 4M6OH 3SGDI 4PY7B 4F33B 2ZSWA 1NGWA 1NLBL 5EA0H 2VLME 3GSRB 5IMOB 5ITBH 4TUOB 4N0CA 4JPVL 4DN3L 1UKTA 4U1MB 4NCDA 1NL0H 4F7TA 4QF1B 3SE4A 4ODUB 4D9QD 5FA4B 5H37G 4HHAB 3EO0B 4M7KH 4HF5H 1DBJH 4R90L 1ORSA 1BVLB 1EJOL 4JREC 1MIMH 4N8VB 1MY7A 4ZUWA 1RAMA 2VAAA 3G5ZB 1NCAH 1QLRA 3QRGL 3QFJE 3DMMD 3C09B 3BEVA 2VLJA 1W0WA 2IPKA 5HGHB 1J8KA 1WICA 1AIFA 5JMRA 5FYJH 1QUNA 3QQ4B 4X6FA 3EFFB 4KDWA 5DJCB 3AVEA 3QNYB 3TIDA 5HBBA 5EPMB 2G60H 4OFPA 3SJVD 1EIBA 2BY1A 2MFNA 5IJVA 3FFCA 5HHVL 1KJMA 1K8DB 2IPTH 4OM1L 2WLZA 3LQAH 4JRYD 1FG9C 5IR1A 4G43B 5C0GA 1IEBA 5HHMA 2IG2L 3C8KB 1MFDH 1AGDB 3O8XC 5DD5L 5MENB 4NHUB 1MAMH 2A74A 1JWUB 4LGSB 3W39B 3BGFB 4GMTH 4MNHB 3ARQA 1DLFH 2V9TA 4NO3A 3BRGC 5I15H 1FZKA 1TZGL 1QFWM 1KCUL 3P9MB 3PL6B 3S5LG 3P9WB 3V5KA 1QFWL 2PNDA 3BQUD 3GHEH 4HC1A 1Q0YL 1I9IL 2CLVA 1C7TA 3UCRA 1IEAB 2BY3A 2X41A 2EKSB 1VSCA 4E0RB 5FYKE 3TESA 4N0YH 1I3GH 3ZO0A 3HI6L 3TZVA 4QYOA 5EBLB 3F12B 3FN0H 4Z7OE 2UY7A 5C8JA 4M4PA 5CCKL 3K7UA 5DZOA 4UTBH 3KPSD 2JB6A 1WEJH 3B5HA 1ZEAL 1HXMA 3VFNB 3O4LE 1Q94B 1INEL 3KYNB 2Q86B 2HRPH 4ZS6D 4I9WD 1IGFL 4G6FD 3T0EC 5DJZB 3MOAL 1F11B 1SMAA 4YBQC 5AYUL 5FK9B 1JHLH 2R56L 5KSUB 1NSNL 4ZTOL 2G75B 2A6IA 1CLZL 2LTQB 4DGVL 1KIRB 3NPSC 3V79C 2CDGB 3JTCA 5MP6H 2NY7H 5DK2A 1CFQB 3E8UH 1Z0MA 3JVGA 3O3EA 3SGKC 1CGUA 1FVEA 1XCTA 4W4NA 4KTDL 1JUFA 1ZHBA 4MNGE 4HPYH 3U1SH 2BVQB 4OF5A 3THMH 5AZEL 2XTJB 1A3RH 1IKNC 2NR6D 1KTLB 3NCMA 4ONGH 4U6VL 4D0CA 4DGIL 4MB4A 4FQHB 5J1AA 3VRJB 4IRZH 4GKNA 5MI0B 3MRNA 1CT8A 3FMGH 3T0VA 3ULUD 4YZFE 5IQ9A 3P11H 3UTSA 3SDCC 4JKPL 2ICWA 3RNQB 4FQLH 1LK3H 3P30H 5A2FA 1CFBA 2XNAB 1E4JA 2Y7QB 1NLDL 3IDNB 3WDIA 2V2TB 4L4VB 1B4JL 2XT1B 5DI8A 5B8CB 4M9PA 1FIEA 1P4LB 4OZGA 5CZVL 3D18B 1QSFB 3D2UB 4TSCH 2JELH 4MD5B 4X7EC 1UB5B 1CFVL 4KDTC 1R3JB 1X4ZA 3S4SA 4U7MA 3K2UL 1AXIB 5GHWH 1IGIL 2V5SA 1N5AA 12E8H 4LKXB 5ESAA 5D2LF 4UB0H 4YXHH 5HY9B 4I77H 3MLSH 5JHLH 3MROB 4FNLL 3L9RB 1GJIA 1JK8A 4HGWA 5TDNA 4BUHA 5EU5B 4OFDA 5HYSB 5EU3B 4DVRL 4OZHF 4JQVA 4GT7A 2ATKA 5AEAA 3GSNB 4QRPA 3BGAA 5I0ZA 1RZJH 4G9FA 4QHLB 3SCMD 4P2YA 3WIFA 3GHBH 4EVNA 5DK3A 2WZPD 3H7BA 4QRQB 3O2WH 3NTCH 3OJMB 3MRPB 4ODSL 1KIUA 4D8PB 3IU3B 2GFBA 3UDWC 5GSVB 1H3GA 3G6JE 3QIWB 4EUPH 1A7RH 1MOEA 1ZV5A 2ADFL 2NY2D 2FHFA 3NACH 2NW3A 3WFBH 4OCXL 4YHML 4NZTL 3AREB 4J3XA 1UH4A 3PDOA 4P49A 4U1LB 3PJSA 4HWNA 4H1LH 4ZPVA 5T1DL 4Z95H 5JR1L 5LVEA 3W0WB 2R0KL 3EKCA 1ZLVK 2I07B 1VFMA 3QHFL 2BX5A 4OIAA 4NQEE 2Y07H 4Z7WF 3BP4A 4Z7VB 3N0PB 1KGCE 1HNFA 4CADB 2OXGA 4L29B 5F6IB 2EO9A 3DXAE 3SHSA 1D5XA 3D3VE 3WEXB 3TZVC 2BZDA 4Q9RL 3HCVB 4XGZB 2DQEL 1G0XA 3VXUE 3V95A 1QQDA 3PWLB 5AUMB 1MJJB 3K8MA 1Y6MR 3VFGL 5CGMA 3TO4A 1G7LA 4NWTH 1TMCA 4NHCH 1SJHA 2YXFA 2ZP0T 1KPRB 4KC3B 4M61A 3TVMA 1NMBL 3UC0L 4XNUL 4GQPH 1I8MA 5ISZA 1XMWA 1VGKA 3CSPA 5CBEB 3NFSH 1J18A 2A6JA 2R4RH 2VZ1A 3SY0B 4NSKA 4V3EB 1RZKL 2CLZB 4XMKL 5E4EB 4PJBF 3CCHB 4DKEH 1ZTXH 2V5TA 4IJ3C 3SKMA 1LQSR 2GAZA 4Y19D 3KPQB 1XFPA 3C6LB 4J4PA 3ULUH 3MV9E 2IQ9L 5HHPA 1LMKA 5FUOH 4AEIH 3BKYL 1AQKH 3ROLB 1VEMA 2DIBA 4PJFB 4JPKH 4GRLB 2C1OA 5H8DA 1BREA 1CL7L 3OPZL 4HJJL 2YD5A 4PTTA 4XPTH 2EKJA 6CGTA 2EXYC 2W92A 3PNWB 1EGJH 1PAMA 4PRIA 4JFOB 5E56A 1N59B 2FLBT 3P40A 3TPUB 3EDJA 2IBZY 5C0IA 3BIBX 4YDJB 5FGBA 3TBSB 3C08L 5J7CC 4OLUH 3MC0A 4E5XB 5GPRA 1XIWC 1KELH 1XGQA 4L4VD 5F93C 5FB8A 5C07E 2APVA 3UBXI 1AHWB 5EU7C 3MNVB 1U95A 1OAKL 4QHKJ 4Z7OF 1EEUA 2ZG3A 5TF1H 4XBPA 5L9DH 1S9YB 4GQ9L 2C3VB 5C08D 4Y7MA 3WHXB 2UWEA 1EEYA 5JW4Q 2R4SH 2F74B 3NCEB 4HIXH 2H1PH 3TWCL 1TZIB 1BLNA 1I85A 4KQ3H 1JTPA 5DD1L 4JR9L 3ZL4H 1KCSH 3ULVD 1ACYH 3MPCA 2BNRA 3CFDA 1IM3A 3MV8D 4ODHH 4DQOH 5KAQF 1DBKL 2Z8RA 2W0KA 4JHAH 4O2CA 5I8EA 5DRNA 4U2ZA 1OAYL 1G7JB 3VI3E 1SQ2N 1NBVL 3DNKA 3UAJC 4R2GC 3KPRE 4JM2D 5DDHB 2J5LC 5DVMA 3QZWB 1KJ3L 2ZNXA 1FP5A 5DC4B 3RGVD 2EZ0C 2AJXH 3U0TA 3B9KB 1T3FA 3RA7L 4XH2B 2HTLD 1F4AA 4X7CC 5IM7A 3LB6C 4Y4KB 1QPPA 3QIWD 1MCFA 3QUXA 1DQLL 1YMHB 3RWHA 3ARED 3F7YB 4YDIH 2DQUL 2GSGA 3CZFA 3P4OA 1H3PH 4KHTL 3X12A 2A38A 4LLAA 2AJVL 2H8PB 4JJHA 4R4NC 2ORBH 2ZUQC 4G6AC 1RUPL 5C0FB 3H2WA 2H32A 4K71C 4OZFA 5I1AA 3W0WD 4ZDHB 1AGFB 2GUOA 3LH2L 1RK0B 3QWRA 1TJIH 5E1AA 4LCWA 4DWHA 4RMWA 5KOMC 2L7JA 3VD5A 1MFAL 3BZ4B 1JN6A 2W07A 4NO0A 1ADQH 1ZGLA 1AR1C 1D6EA 4D3CH 3TA3B 5I1DB 4X8XA 2P47B 2HFFA 1DQQB 5J0BA 4K9EL 1XCQA 1XR9B 3E0GA 3TJEL 1CS6A 2DYPD 2UUDK 2XWJA 4XPBL 5EU6B 2AV1A 3WD5H 4FZEH 2OJEB 1AXSA 4F58H 3LKOB 3VFTB 1DQDL 3HUJF 3ULSA 3I50H 2AP2A 4YH6A 4AZ8A 3OKEA 2WWKO 3SCMC 3K0WA 1IFHL 2YD4A 3AMKA 3EOTH 1QVOA 4GJTB 1W8OA 1RI8A 2HJLA 3EUUA 3V4UL 1OT2A 1N0LA 1RUAL 2NMSA 2BJML 4X99A 3C60A 5ANMB 2R2EA 5EO1A 3T77A 3C6LD 1U36A 4TUJA 5BW7C 5E8OB 1MVUB 3HMWL 5J11C 1YEKL 2QSVA 5E95B 4B7LA 5HGBB 4UV4L 5FDYA 3IDYC 4NKDB 5GS0C 1UZ6E 1JYVA 4YGVB 3V52L 2LVCA 2N7AA 4OLWL 2DQJL 2IBZX 4Y4FA 1R3HA 4YHNA 4NP4L 5GQBA 1MPAL 2I9TB 4A2MA 3G6JF 4NFBA 2HMID 1MWAL 3VFPB 1G7HB 4WO4B 1UM4L 3LS4L 2X44D 4JQIL 1WV7T 2V2XA 2AK1H 1JZ2A 5E1HB 3WFZA 3GMNA 4MAYB 4X9HA 2OK0H 5CJ8A 5IMMA 3DJ9A 4Z18A 1Z3GL 4P9HH 5GRJH 3QDJD 3GMOB 4YQXL 3PWPB 1HHIA 3LKRB 1IGCL 1IQWH 3WIHL 1T6WA 2YK1H 2VDPL 1MI5A 1MJUL 3GSNH 3L3DB 3OF6A 4AH2A 2QQNL 3MCKB 3MJ9A 4Z7UA 4IS6A 4YNYA 5CEXA 2XN9B 5IESL 1PQZA 2XWBA 2P5EA 3MLPA 2R1WA 3BOVA 3LVEA 3DHJA 1ZWIB 1FFPA 2AXFA 4PGBB 4XCNA 4P46A 1NC2B 5CD3B 3DVIA 3BWAB 4FQ1H 3WXVL 3PIQB 4FFYH 2GITB 3K4AA 4XPAL 4BQ6A 2J8UB 4ZYKA 3AMLA 2X4RB 1UWEL 1XZ0A 1CVSC 5D2NA 4WFFE 1KYOK 5CP7A 2BSED 1JWMA 3D39B 3GSUB 3ALXA 1OPGL 3EYQC 2IC2A 3B9KD 5FIEA 5CHNB 3T8XB 3T1WA 2PO6D 2X4NA 1T5XB 1ZSDB 2HRLA 3HAEG 4Y4KD 4LKCB 1TLKA 2R0ZH 4E41E 1YQVL 1QBBA 2OMBA 3V7AE 1S9WB 1KB5A 1ZLUK 4DCQB 1LK2B 3IDIB 3U0WH 4GKSB 2AJUH 3QUXC 5TPWH 3IETA 5HHME 5KTEH 5MEOA 1UWGH 3IJSA 1MHPL 1BEYL 1AD0A 4M5YH 4ZODA 2Q1EA 5EOQH 3D25B 4NC1C 3BW9B 4XCFH 1S7RB 1KNOA 4ZD3H 5C0AE 4U6XA 3F5WA 2VXTH 2X10A 4P9HC 3QFDA 1MCJA 1YN7A 2VR4A 2PETA 1I8KB 5EU6D 4CVZB 3LN4A 4WW2A 3MJ7B 4EI5B 4PRBA 1J05B 1BOYA 3BPNC 5FYKD 2ADJA 3OJDB 1CG9A 1MHHB 3KJ6H 4HFWA 2EXWC 2JJSA 3JWDH 4HEME 1CLYL 1C7SA 3WLWC 3C5SB 2OI9C 3D3VB 3ARDA 1RJCA 5D1QB 4QHMB 3RGVC 3V5HB 4G3YH 3O4LD 4PJ9A 4ZO9A 2CKNA 1H15A 2HTLC 3SEPA 3TGXA 2X4TB 4LCIL 5DMGD 4EBQH 2G2RA 1MQ8A 4BH8B 5EOTA 3FT4A 4MQ7B 1J8HB 5TF0A 1UWXK 4TSBH 3NIFF 3QXUA 1EEZA 2ZG1A 1NMCC 5J89A 4XB8A 2IMNA 4G59A 3N9GL 4NZRH 2C3HA 5GISH 4U6HA 3DX8B 2ED8A 4LPYA 1ZT1A 3VWJA 2B0SL 4GAFB 3VXTB 4XMLL 3FQTB 1OGAB 4OFVA 4IIQC 1BF2A 1F8TL 2BRRL 1FE8H 4K7PY 3TCLA 4QWWD 3SDXB 5CEZL 4WWKD 4HEPG 4IOSD 3LKNA 4NQCE 2NY6B 5HHXH 5HSFA 4X7SH 4MAYD 4D2NA 4MDIB 1I4FA 1QHOA 4I2XB 4MNQA 1EHAA 3MXVL 4FQIL 3NIDE 1FNFA 5T1KA 3BMWA 2FZ3A 1R0AL 5GGTH 5T3ZE 4YFLF 2P43B 3VG9C 2EDHA 4X7TB 4PRPA 1Z9SA 3VWKC 4QT5B 1U3HA 5I8OL 3VW3H 4PG9B 1Q1JL 5TQ0L 3Q5TA 3PABB 4X5XB 1EHLL 1FIGH 1NCBL 2XN9D 3NA9H 5HD8D 4HWBL 3E3QA 3BZFA 4FXKA 1HH6B 3L5HA 1P2CB 4JB9H 4XAWH 2VMFA 4V2BA 4MA3B 4X6DF 3BEWB 1G7IA 3TYFB 5DWUL 2ZOKB 3O3BB 3RKDD 2GCYA 2F5AH 4H26B 1SM3H 4IDLA 3QDGA 4J6RH 2BXYA 4LSQL 1OAXL 3SE9H 4JREB 2PTTA 3EZJB 4M00A 1XR8A 3P0YH 2HH0H 1UZ6F 1VB9A 4Y5YB 5E6ID 4R4FH 4U6YB 3TN0A 4C83B 3OKDB 2JKXA 1G7PA 3FO9A 2R29L 4MDJB 2B39A 3KPRB 5F7DB 3RWJB 5IHUL 3PDGA 4XWOD 1OAUL 3ZT6A 2VDNL 3BPCA 1KCGC 4HKXB 3AS2A 4P3CL 1VADB 3IFOB 1AJ7L 2LU7A 4F9LC 5JXAL 5FYKH 4MS8C 2EDNA 1QSEE 3HFML 1HHJA 4OLZH 3OG6B 2X89D 4JY5H 3GFUA 1DN2A 4OLXL 7CGTA 2GJ6B 3CFBB 1I9JH 2YRLA 3U7YH 4FTVB 5EOCJ 2OBGA 4HLZG 1H8NA 4NQED 1J12A 4HUKB 1KGCD 1F4HA 4LMQE 4LNVA 4V2CB 4MCYA 4WRLA 4PJDA 4TYUA 2WP3T 1U6AL 3DXAD 3D3VD 3NCJL 3BWUC 2Z31C 3CVHL 1DCLA 1GIGL 4QOKA 5ALBL 3MJGX 3MNWA 2CK0L 1UJ3A 2H9GB 1WZ1H 2YPKB 4JFEE 1QFHA 1F2QA 3BX7C 1BZ9B 4PJGA 5IKCA 4PJ9C 3BKJL 1JF5A 5ISZE 4R0LA 5D9SB 2PYEE 1J8HD 3SDAA 4KU1A 3QDMA 5HGAA 3BP6A 3CX5J 4K7PX 1A7NL 5INDA 1YNKL 5J9PA 1FFNB 3C5ZA 4HQQL 5ERWB 4YHLH 1HN1A 3HE6A 6FABH 4IRJA 4WV1C 1B0GB 1OF2A 3MBEC 2J4WL 3INUL 4NNPL 4PYHA 3MV9D 2ICCA 4UILH 3PG2A 5HDQL 1CXHA 4UT7H 4O9HH 2VDOH 1F90L 1TIUA 3ARGA 4JGJA 1W72L 1A21A 4FN0A 1MCBA 3MLTB 2BVOA 4PRIE 4U1HB 3AROA 1FYTE 3I75A 3SPVB 2DMBA 2F8VA 4HBCL 3K74B 3UYPA 2R23B 5IBLD 2EYRB 1KBGH 5EUOA 5JPNB 5E2TH 4KUZH 3HZYB 4LVNC 4MWFA 1FAIH 1N2RB 4DVBB 3KYKH 4UQ2A 3G04A 3WFEH 5C07D 2PR4L 4LRNL 5HI5D 2ZSWB 1NGWB 5BQ7A 2C9AA 3IF1A 5DA4A 1MFNA 2VH5H 3QXAA 4XVJL 4F7TB 2R1YA 4KFZC 2Y9RT 1YEGH 4AL8L 1LEGA 4GMSL 1E28B 2HKHL 5EBWA 5DD6A 1N3NA 5HYQA 1TQBB 1CXKA 5IK3A 5E2VL 2OR7A 4WY7L 3C6SA 4QWWC 1WCBA 3G5VB 3RTQA 1P84K 4OZIA 4WWKC 1OSPH 1ORSB 3CK0L 1AGBA 3BKCH 3EFDL 4ZUWB 5AG8A 1NCDH 2DDQL 2VAAB 4F80A 3UJIL 1A64A 1AKJA 2DQIL 4K23H 1MCHA 1QLRB 4Y2DD 3HNSH 4TPRL 3KPRD 3MBXL 3BEVB 2VLJB 1W0WB 1T7WA 3KXFA 1KEGL 1FRGH 1DN0A 2IPKB 1AIFB 3O6FC 1CGSL 3WFCH 5GRXG 4X6FB 4L8DA 4M93C 4XB7A 1P4IH 2QKIA 3TIDB 4OCSL 5IEHA 2OR8A 4OD1H 3MODL 4HJGA 1M6OA 3T1FA 1J5OH 5IJVB 3FFCB 1KJMB 1AI1L 4FG6D 1NFDE 1MJ7H 3Q6GH 1BF8A 4J3SA 4D9LL 2QQLH 5IR1B 1NBQA 5C0GB 1BECA 4M7LT 4KKAD 4N9OB 1XF1A 5HHMB 4FZ8L 4F8TA 3RVUC 1BGXL 1BFVL 2A74B 4XMPH 4O02L 1F02I 3RKDC 4XNMA 4NO3B 4K07A 4P4KD 4XX1E 3V4PH 2XICA 4HXBL 1FZKB 3V5KB 2ZUSA 5DA0B 3FAXA 2GIYA 2NY5H 4O58L 4CJ0A 2CLVB 1FQ9C 1QPXA 4ETYA 4UU9A 3KJ4B 4ZS7L 3TZVB 4BA8A 4QYOB 5F72S 1LO5A 3MRKA 5C8JB 4PD4J 1CZ8L 3TFKD 2P5WB 3RUGE 4DJMA 3TNNA 1C5DA 1HXMB 4F57H 1NBYA 1RFDH 4H8WC 1OAZH 3P4MA 4Q9QH 4U49A 1K8IA 4MA1C 4Q6IC 2X1PA 1IGYB 1VKXA 1GGYA 4OM0L 3N1MC 1EERB 4S0SD 2M8XA 3EYSL 4G6ML 3JV5A 4MJIA 2BERA 1GHFH 1NGPL 2A6IB 4G9DA 4IJ3B 3WJJA 5C0RH 3BRDA 5IGXH 1F3RB 3X14A 5DK2B 2AJYL 4M1GL 1JTTA 1FVEB 1XCTB 4BFGA 1I1YA 1JUFB 1BZQK 5FECA 5J06A 1ZHBB 2X4UA 1KACB 1UACH 1CVRA 4KVCH 4TUKL 4OD3L 4LPTA 5DT1H 4W6YB 4ELME 3IAGC 1VGEL 3OZ9L 2OXHA 4G8GA 1FNEA 4LP5A 1CE1H 5J1AB 4GKNB 5DEZA 4M7ZB 1SVCP 1CT8B 1HOCA 3AM8C 5IQ9B 3N06B 3UTSB 4JFZL 2VLRE 2ICWB 1U0QA 2D7QA 4M48L 2NY5C 2ICWJ 5HYIA 4XVSH 3DPBA 5I1GL 1MCRA 4CVWA 4EZMA 4M6NH 3QO0B 1V7NL 5DI8B 1U8OA 1CTOA 2P5EE 5E70A 3ZYJA 4OZGB 5KSAA 4IOFC 5KVGH 1D5ZA 1QSZA 5JOPE 2XPGA 3RGHA 4DOHE 5IHBA 1LHZA 3S4SB 2D03H 3QNXA 1BVZA 4GXVH 4L4TA 1S5IL 5B3NA 3KPNA 1A7PH 4TOYL 3RTQC 3ECBA 4XPGH 2QLVB 2IGFL 5D2NE 1TVHB 2AJSH 2IBGA 4QHNA 4WFFD 3AS3A 2HJFB 4GAYA 4PJIE 5IBLC 5L2KA 2UVFA 1JK8B 5I8KL 4XNQA 1P1ZA 4HGWB 5EOCH 5TDNB 4GG8A 1ZANL 2VYRE 2BCKA 3B9VA 3EJYD 1MF2H 4FQCH 2KDGA 2ATKB 4QRPB 4OB5H 3LEYL 4G9FB 1PKQB 2DTML 4E41D 3FFCD 3EYUH 3FOMA 4NKIL 4P5MA 1MSPA 2R1XA 5TE4H 3WIFB 5A16A 4EVNB 4YDVA 3DVGA 5EORL 1T7XA 3H7BB 1KCRH 4GW5A 4IRSA 5HHMD 5CP3H 3SKOA 4OGAC 3OAYK 3F8UB 5IOPA 4BYHA 5KBNC 1Z6JT 2GFBB 4MJ6A 1IVLA 5BS0E 2NW3B 5C0AD 1ZA3A 2ZUQB 3QIUC 4R4BA 1K3IA 3T3ME 3PDOB 2O93L 3SOBH 4I5BA 1RIVH 3PJSB 3PGDA 4UMGA 3GSQA 1L4IA 4ZPVB 4J1UB 5IBTH 3GBNL 3GGWA 5HJ3A 5CGYD 3EYOA 1T83C 4OI7A 3BP4B 2HKFH 3BP7A 1K85A 3UYRH 5I71C 5ABDE 1D5XB 3GSOA 3B5GA 3S3PA 3DSNA 5F9AC 1M7IA 1R5WA 2D7NA 3ARSA 3NAAL 1A4JA 5I1EL 3TJHA 1C5CL 1QQDB 5FV1L 2W0LA 3TO4B 2AABL 4YX2L 4PP8C 4LPCA 1G7LB 1N5YH 5C0CA 1TMCB 1Z9OA 4O5LH 1SJHB 3TVMB 4L1HA 4M61B 4FFZH 3VXRA 4WI5A 1KENH 4XPHL 1I8MB 1VGKB 4FG6C 4MA7H 3MRMA 4LF3A 4ENEC 4NSKB 5CGTA 3LPFA 1CK0L 2DLEA 1LQVA 4M5ZH 3SKMB 2R15A 2GAZB 3WJJC 5HHQA 4OCNC 4ORZC 1R3IH 4J3TA 4AT6B 3VXMA 1LGVA 2G5BA 4XHJC 5HHPB 5E94A 3UJTL 2VL5A 1QA9A 3BKMH 4JY6A 4RMRA 1GGCH 2ZKHH 1NFDF 2XKNA 1B4RA 5T5NF 2VUYA 1KLGA 4YHZL 2C1OB 2BMKA 4PTTB 3FRUA 1V5JA 4ETQA 2ILLA 2IADA 4PRIB 4PJXE 1I1AA 4S1RH 3SO3C 4WFHE 5GGUA 3UTSD 4UT9H 5INCA 1RZKC 4DZ8A 5T3ZD 4I3SL 1U91A 3PHSA 5C0IB 1CGXA 2FB4L 4MAUL 3LDBC 1UM6H 4X7DC 3BO8A 2YPLE 4PS4L 4DEPB 2EDKA 2YXMA 4Y8DC 5E2JA 5FB8B 4OSUH 3BE1H 3E3QE 4JEGB 3L3GB 3EGSA 1JE6A 3V7MA 1U95B 3U7WH 4HS3A 1SBSH 4XBPB 5DTFA 3G6DH 4L3EA 5DJ2B 1M7DA 5LGHL 2F53E 3GKZA 3O6KL 1UZ8A 3H3BC 2UWEB 1EEYB 5T5FH 1QTYT 1MWAA 1QEWA 5ALCH 5DD3L 2P24A 4XNYL 4YFLI 1BLNB 4XC3H 4JFXA 1MIEL 1A22B 2BNRB 1A2YA 3CFDB 1IM3B 2JF1A 4BQ9A 2W0PA 4JFPA 4O2CB 1DQTA 5I8EB 1KN2L 3MRFA 5DRNB 4ERSH 1KTKE 4MXVF 1BQLL 3WIHA 1A3QA 1NGQH 3ARPA 4H0IA 4QGYA 1A5FH 2Y6SD 2VXVH 1DQJA 3AXLA 4HMDA 3QPXH 4N5UA 3MV7A 1GGTA 2B4CC 5F6HI 5C0DB 1T3FB 4ELMF 2DJ4A 5DR5H 3QUYA 4ZTPL 3IXAA 1PX3A 5IM7B 3V6OA 4EDWL 3QUXB 4S1DD 3SGJC 4BZ2L 4MQSB 3RWHB 1UJTA 1T66D 5J6HA 3MREA 1MREH 1MCQA 4J7RA 3CZFB 3P4OB 3X12B 1U8JA 2WIIB 3L5JA 2BHYA 2H32B 3LSOA 3MLUH 4HS8L 5I1AB 1DEEA 3PP3K 1XGUB 3OSKA 4P59L 2YPVH 2GUOB 5C0BA 4LSRH 1E4XL 3QCVL 4LCWB 5E1AB 3HE7C 2CK2A 3CDGA 4HUVA 4PJDE 4NO0B 1ZGLB 3P3YA 4NM8H 4ACPA 1D6EB 1DANT 5DC9B 2HFFB 5I19L 1IGML 1XCQB 2XWJB 2MSPA 3GI8H 3C5JA 1AXSB 1YA5A 3TO4D 2ITDA 5AAMA 3ZE2E 3TVMD 5GIRA 1D6VL 2GK0A 5D70L 5FGCE 4Q0XL 2VB5A 3OKEB 5ISZD 4XP5L 2APTA 4EQ3A 2PYED 1QVOB 3CVIL 3GSXB 5K33A 2HJLB 4PJIF 3O4OC 4LPUA 1LO3L 2OCFD 4RWYH 1A6TA 1WWBX 1I7RA 1FH5H 1BAFL 3CH1A 4NKOA 4X99B 3C60B 4C55A 2Q8AL 5CBAA 2R2EB 4G8EA 1I3RB 5EO1B 2CSPA 3ZKMC 3T77B 1UEYA 4TUJB 3MLVH 1YEJL 3SQOH 5T3ZH 1N6UA 4YUEH 3EO1A 4FFVD 3L7EB 4Z6AT 1CFSA 1WWAX 2EYSA 1MNUH 3VGGA 4RCAA 4Y4FB 1NGXA 1R3HB 4PRID 5T3XD 4OJFH 2J8OA 1FYTD 3SKJL 5TFSL 3O6ML 1EFQA 1CDUA 1NBZA 4JDTH 1I9EA 3PWUA 4LDEB 3T3MF 1I1AC 2NY0B 4RAVA 3W82A 4RWHA 4RGNE 1HKFA 2V2XB 1MJ8L 1WBYA 2BFVH 4HCRL 1LO4L 3GMNB 2PN5A 1UKSA 4LHUG 5IMMB 1CD9B 3M8OL 1HHIB 3S5LA 4Z77A 1GOFA 4YXLL 3RX8A 1JPFA 2D31A 4KJQD 4M7JL 3DX6A 1MI5B 3V0WL 3X3GL 4AH2B 2X6MA 1IAOA 4Z7UB 4KRMB 4YNYB 3O2VH 4M3KB 3MRCA 4MA8H 1L8JA 1PQZB 2XWBB 1N64L 2P5EB 2R1WB 1RSFA 2MHAA 4NUJA 4OZIE 5GRWA 1FFPB 2AXFB 2QTEA 2EE9A 4XCNB 4P46B 2O5YL 3VMNA 4KTEL 2BNQE 4PREA 3L5WA 4LP4A 4WEBL 5LXGH 4ZYKB 1XZ0B 5DLML 1EXUA 5D2NB 5CP7B 2Y06H 1JWMB 1CLCA 2IBBA 1RU9L 1JRHI 4HWBA 1HCFX 3MCG1 4ESKA 2X4NB 2X42A 4U33A 3TV3L 3LIZH 4WFGD 2WUBH 3EJZD 2NY1D 3DUUA 2X9XA 4LSTH 4PLJD 4B53A 3GMRA 5T1LA 1KB5B 1BD2A 4PJXF 3V6OC 4WI3A 4R8WH 2DLFH 3GMLA 1C12A 5GGVY 1C1EH 3IETB 1WFUA 4YBLC 1S78C 4N5EC 5MEOB 4ZO8A 3MUY1 4K8RL 4HG4J 3FKUS 3IJSB 1AD0B 1B2WL 4LCWD 5IF0A 3EYFA 1KNOB 2DTSA 1HK6A 1JPTH 2V17H 4U6XB 3F5WB 1I8IA 2VLLA 1S5HA 3QFDB 4CMHC 5A40E 1YN7B 4YHOL 5HVWA 4HAGA 3IJYB 5F7EH 3MXWH 3HZMA 3LN4B 4G42A 4HS6A 4WW2B 4PRBB 4LVOB 4KVNH 4OF3A 2ADJB 3SO5A 1CG9B 2Y6SC 4HUWA 1CFTA 4HFWB 4P2CG 5HDLA 1CBVH 4PJBB 4XPFH 4P23D 1X5KA 2BDNL 4R26L 5ID0A 3ARDB 1I75A 3GRWA 4CW1A 5J13C 3OAZK 3WSQL 4PJ9B 3C60D 1WGOA 5E2WH 1H15B 1AXTL 1NGYA 4P5TD 4OF7A 4CL7A 4CU6A 1J7VR 4MJIE 2G2RB 3I85A 2XA8H 5EOTB 3FT4B 1WBZB 5DVNA 4K3GA 3RJQB 1EEZB 1JZ5A 2OR9L 5IBUB 4WV1B 3QCUL 3BH8A 4MD4A 3P73A 4U6HB 3CVHA 4DK6A 2HFGL 4JDVA 5TE7L 1ZT1B 3VWJB 2YN5A 5LWYH 2DBJA 4HDIA 2CPCA 4HV8A 2IFFH 1CIUA 3TCLB 3MRGB 4QTIL 1OW0C 1IJ9A 3O45A 4UUJA 2NY0D 4MVBA 4WIQA 4G8GE 5HVGB 4HKZA 5FKPA 3LKNB 1I4FB 4OFIA 2FH6A 1YZZA 4MNQB 3HI5H 4DW2H 4JFDE 3ESUF 5T1KB 4LIQL 2FO1A 2FZ3B 3LQMA 3D9AH 1IBGH 1MHCA 1FG2A 3TBWA 5C9KA 4PRPB 1QHPA 4GSDH 1U3HB 5A3ID 4XWGH 2YKLL 5CJ5A 1W72A 5L7XL 1K9TA 2FX9L 1ZLSL 2JB5L 2P5ED 3MRIA 3BZFB 3WUWG 3U0PA 2LAGB 2EDEA 4FXKB 5C6TH 5JOPD 3UP1A 4YLQT 4EIZC 5BVJA 3G08A 3KPOA 1G7IB 3UBXG 3MA7A 1F45A 2KQNA 2GCYB 3NH7H 3WO4B 2ZSVB 3I02A 4LMQI 2DQGH 1QG3A 5JW3H 2DIJA 1TITA 3IFLL 3QDGB 2CKBH 4YHIA 5EO9A 5F7UA 3GJFA 1E4WH 1S9KC 4MXQC 2ARJQ 4OZFH 1XR8B 1ZVYA 3IDGA 1LDPH 4CN1A 3QJFA 3BD5A 5GJTL 4P9MH 3TN0B 2DB8A 2EDQA 1G7PB 1C5BH 4JY4A 3FO9B 5IIEB 2CDFA 2HT4C 2VXSL 3CDYA 1Q9KA 3EOBA 2IANA 2BOCA 4RRPG 4PJ5B 3BPCB 3CD4A 3RY6A 1AC6A 1NDGA 1WAAE 3RI5K 1LEIA 2PYFA 1PBYA 2Z4QA 4UNTA 5ILTH 3L5XL 3HZVA 4OT1H 1QLEH 3SKNA 1HHJB 1FL6A 4APQD 4OBSA 1NCWH 1G1YA 3P77A 2YA0A 4Z5RA 5E0QA 2AI0H 1CD1A 2VLKE 5J12C 3OB0H 3N1FC 1UXSB 2F54B 2E7LA 1MUJA 2XZQL 1MFBH 4MCYB 1ZVHA 4X6CE 1CDBA 2VOTA 5EIVA 1RULL 1X5YA 3OKKA 3EO9L 3L3JA 4QOKB 4KRLB 1UJ3B 5F3BA 4ODVL 3L3OA 3BHBA 1F6AA 3H9SA 5E08L 5HYFA 4PJGB 3E1F1 5GRZA 5IKCB 3B9EA 2AEWA 2G9HB 1S7TA 2NX5A 2IPUG 1KC5H 1IC7L 1WTGT 4X80H 4R0LB 4LDOB 2JCCE 1D3CA 3V6ZA 4YK4B 3SDAB 4YFEA 2A9NL 1VHPA 3QDMB 5HGAB 4PJAA 3BP6B 4N8PA 2DQDH 3O9WA 3QAZB 5INDB 5J9PB 3C5ZB 1DSFL 2VDQL 4AEEA 3HE6B 4XCEA 3QUZD 4IRJB 3W9DA 1OF2B 3IGAA 2VISA 3VXSA 2YD7A 1OB1A 3JTSA 1IAIH 1OD9A 5DMJB 1AE6H 1TZHA 2VITA 2ZJSL 3RIFK 4P2OC 5BO1L 3ARGB 4XXCA 5I16A 3FONA 4D94A 3MJ9H 2BVOB 1J1XL 1UCBL 3I75B 3RDTA 5T1KD 4EIGB 4I3RH 4WFHD 4WI6A 4Z0BL 1VFAA 4P23C 5EUOB 4XP9H 4JKMA 4YWGH 4WHYH 4KXZH 2DI8A 5L6YL 4MWFB 4P5TC 3O3AA 5CUSH 3G04B 2NZ9D 5FHBL 3U9PH 4X83A 3STZA 4NC2B 4HIJA 4MHHI 2D7TH 4GH7B 5TH2A 4PJCA 3QXAB 1MELA 2I5YH 3KYOA 2R1YB 1YYMH 4XNZC 3ILQC 4KKBC 4ODTL 1LEGB 1NKOA 3VD3A 5EBWB 3SDDA 5DD6B 1CXFA 1N3NB 5HYQB 2VZ3A 3UTQA 5HYJE 3C6SB 1WCBB 2C3XA 3IJHA 2EIBA 1J1PH 3WFDH 4EDXA 1TQCC 3RTQB 4OZIB 2YZ8A 4KDVA 1SBBA 1JNHA 5DVKA 1AGBB 3HTLX 2FEEI 3FZUC 3TN0D 4FRWA 1AKJB 2YMXL 4S1SL 2EH8H 1UA6L 5K9KA 1S9XA 1KIPA 1U8HA 5D1XD 4BJLA 4NZUL 5I1IH 1HSAA 2B1HH 4W4OC 3TLRA 1O0VA 1IARB 1A4KA 2VUOA 3KXFB 1DN0B 5TE6H 4I8DA 5D7IE 3IU4H 1XGPA 2EO1A 3B43A 4L8DB 1AC0A 1MCLA 2X1WL 3QEQA 5LQBH 2QKIB 5IEHB 4DKAA 2FATH 3MRDA 4HJGB 1I7UA 1M6OB 3DI3B 1YEFL 1JNLH 2QHLA 1B88A 2XQYK 1HDMA 1QZ1A 1DBMH 4QXGL 1L6ZA 1T7VA 2PF6A 3SGEH 1KULA 4OFYA 1RIHL 4JZJC 1E6OL 4IMKA 4NNYA 4P3DA 5CSBA 4JO1H 4P48A 4JFHD 1HXYA 5F70A 3I2CL 5D7JA 3HR5A 4XNMB 5DFWH 4NN6C 1GC1L 3DO7A 5IB1A 5JDSA 1DBBH 4NN5C 4UU9B 5I71B 3PP4H 1K6QH 2CR6A 2P8LA 4LSSH 4LVHC 3OXRA 4R3SB 3MRKB 1IAII 4PR5A 5T1MA 3SDAD 2HYMA 3QDMD 3TNNB 1C5DB 2CDEA 4PRDA 5GJSH 1X9QA 1NBYB 2HLFC 3P4MB 4LFHG 4JO3L 3PQYA 1GVIA 1K8IB 1T80A 3C5ZD 4PUBL 3D48R 1VKXB 5HHOE 2VQ1A 1OD7A 3O0RL 4MJIB 3U4EA 3VXQA 5GRUL 3UZQA 4APQC 4G9DB 5GGSY 3DI2B 3ROOB 2VZOA 3X14B 1GPOH 1JI2A 3HAEA 3H0TA 3NCBB 2ZCKL 4OGXL 1PVHA 5F1IA 1I1YB 2PTVA 4L3CA 5FECB 5KVEL 1F6FB 2X4UB 4RFOL 1WAAF 2XACC 2ITCA 4EN3A 4M1CC 3O2DH 1QP1A 3Q1SL 1H5BA 3OHXA 3CSYA 1JGLH 1RJYA 2A9MH 2X4QA 4RGND 2VAJA 4MSWA 4M7LH 1REIA 4KRPC 2NW2A 3EHBD 2EC8A 2HT2C 1JZ4A 1HOCB 4X6DB 2H3NA 3KPMA 1E27A 4UIKL 4X9FA 3KYMA 5IT2L 2X4SB 3DETC 4X6CF 1NLBH 2MQ3A 1PSKH 4ONFL 4JPVH 3D87B 3U48A 3CMOL 3FB8A 2AKRA 3QUZC 4WDIA 1U8OB 2V5MA 2AK4A 3KDMA 1D5ZB 1A6WL 3VE0A 2RR3A 2XPGB 4XP1H 2D0HA 2JCCF 2VWEC 3G5ZA 2YN3A 4BSWA 1DEDA 3QNXB 4L4TB 1AP2A 1FPTH 3KPNB 2YD9A 1K3ZA 4TULH 2BNQD 5IVZA 3VA6A 4R90H 5SX5K 3WNOA 1AKJD 4RQQA 1EJOH 3OL2A 4IBLT 5F1OB 1PW3A 4OGYL 2CUHA 5FHAH 4QHNB 3QI9C 4GAYB 5L2KB 5EA0L 3SGEI 2OS7A 1P1ZB 3QRGH 4XNQB 3KXFD 4BQ8A 5ITBL 1C8PA 4JJ5A 4QCIA 2BCKB 3K80A 5FM8A 3BYYA 4L9LC 5FV2A 5F9OH 1W2KT 1ODAA 1N6QH 3LPGA 1EBAA 2NZ9C 2GJZA 3DYMA 3FOMB 4AMKL 1OP5H 1F3DJ 1JIBA 4P5MB 2R1XB 1OTUD 5A16B 5MENA 1QBLL 1XGTA 4K7PL 4YDVB 3DVGB 5JORB 1A6PA 4GW5B 4IRSB 4OM1H 4A6YH 1DBJL 1HYSC 3SKOB 4URTB 3W39A 2ARJA 1MIML 5ENWA 3CFCH 4MNHA 5DURD 5FDWA 1NCAL 1U3JA 5EC1A 4MJ6B 5DJ0A 5DD5H 43C9A 1ZA3B 4R4BB 5DEGA 4LPXA 4I5BB 1Y6KR 5CSZA 2C3WA 3F7RA 3PGDB 4LSVH 3GSQB 3GGWB 1V8HA 1TZGH 4X0KB 1KCUH 5EBLA 5HJ3B 3FHAA 4GRWE 3EYOB 4OCYH 2G60L 1Q0YH 3QCTH 5F7HA 1I9IH 4ELKA 2B2XH 3BP7B 5BZWA 1MFCH 4WI2A 3FOLA 3WKMH 3MOBH 2IPTL 1Q94A 3GSOB 4S0UC 4U1GB 1M7IB 1R5WB 3NGBB 3QHTC 2Q6WB 1A4JB 1T21A 1MFDL 1ZEAH 2YS4A 2APFA 3FJTA 1INEH 4Y5VC 5C0CB 5SV3A 2ZUYA 4MJID 3VXRB 1U8KA 1CGTA 1WIUA 4F15C 3B8SA 5I15L 3DRTB 5AYUH 1R3KA 4NM4H 3MTRA 1FSKB 3MRMB 4LF3B 4RSVA 2F19H 5SX4H 2CIKA 2LU3A 2WINA 3GIZL 4DGVH 2D2OA 3A67L 5JHDA 1INDH 4OTXL 5HHQB 4XP4H 4N0YL 3P4NA 4Y8AA 1BVKA 3GBML 2DIAA 3FN0L 2H2SD 5D5MA 3VXMB 2G5BB 5FYLL 5E94B 1NAKH 1QA9B 4JY6B 2XKNB 4FQHA 1KLGB 4G8GD 4UT6L 1Z5LA 5AZEH 2D7MA 2BMKB 3FRUB 4ETQB 1CI5A 3OWEA 1RZIA 2IADB 1JHLL 2NLJA 4MJ4A 4QY8B 5T33H 4JFDD 1I1AB 4PBVC 5GGUB 4DZ8B 2OZ4L 3V4VL 1PKOA 2XG5A 1LD9B 3C2SA 3ZHDA 1U91B 4U1IA 4RAUA 1FHGA 5I17A 3MZGB 3NCFB 2E9BA 5ACZB 1MH5A 1KOAA 1UH2A 3KHOA 4V3DB 4MD5A 3U1SL 4M6ML 3EGSB 1R3JA 5KSAD 3THML 4HS3B 4RMVA 1A3RL 5DTFB 1P84J 2OL3H 4L3EB 5EUKA 1M7DB 1OHQA 4M1DH 4ONGL 4JFFA 1UZ8B 4ZSOA 4L4TD 2DLHA 1MWAB 4TNVK 3K2UH 3RBGA 4DFIA 2P24B 3BJLA 3LEVL 1QO3A 1KJ2H 5CJXA 1JGEA 4HCRA 4JFXB 4TNVF 5L2KD 1A2YB 3QO1B 2BY2A 4JFPB 4FQLL 2YUWA 3P30L 3MRFB 4HBQA 3EBAA 5C2UB 2DD8H 2AJZA 5FAAA 3TIEA 1XAUA 1AR2A 1RD6A 1ZMYA 2NYYD 4DVRH 5I1HH 4BKLA 2QL1A 3EHBC 1DQJB 3AXLB 4WU5A 2IANE 3MV7B 2P48B 4TSCL 4NZJA 4YR6A 1D9KA 3S37H 1SHMA 3QUYB 3IXAB 3HI1A 4UB0L 4ODSH 4EXPX 3VD4A 4LRIA 3MLSL 5KANG 2NXZB 5FYJE 4HW6A 1NH6A 2ADFH 2FO4A 1U8JB 1JZ8A 1UYWH 5CD5D 3H8NA 3LSOB 1RK1A 3TH2T 1DEEB 5KAQG 1ZT4A 2GEEA 5C0BB 5JR1H 4OCRL 4CMHB 3CDGB 2Z8WC 4HUVB 2P44B 2IAMA 3VRLE 5GGRY 1IC4H 5SX4I 4RX4A 5AUMA 1P4BL 3O2WL 1T7ZA 3RNKA 3TJHD 2EICA 3C5JB 4NOFA 2DQEH 4KROD 1A6UH 3CAFA 3FQWA 2Q87A 5JOFA 5GIRB 1A7RL 2GK0B 3NACL 3WFBL 5J13B 4G8IA 3VXRD 3VFGH 2GY7B 5D7LA 4FMKA 1OTUC 3ILPB 1NMBH 3UC0H 3LN5A 1A6TB 2QSCH 1I7RB 3CX2A 3CH1B 4NKOB 4RFEA 4CMMA 5CBAB 3PGFL 4G8EB 3QRFM 4XMKH 4M02A 3AY4C 5EU4A 3OJ2C 3VXMD 4J2XA 4X4XA 4P2RA 1WFNA 3IFPA 5D7SH 2VR5A 2IQ9H 3EO1B 3LKPA 3ZKXB 4NQVA 1CFSB 5DFTA 3MUHL 2EYSB 2IJ0C 4IDJL 4JFOA 4QEGA 5F9JA 5E9DA 1NGXB 4NWTL 5DK0A 4NHCL 1CL7H 4HJJH 3R06A 4JO2H 3MGOA 4WTZG 3CFIC 3KAAA 3NFSL 2R4RL 1NBZB 5CKAA 5FO9A 3PWUB 5IV2B 2DQFA 4RAVB 2WSKA 5FYKU 5F7MC 4DKEL 1ZTXL 2ZCLH 1WBYB 4PJEA 3RWEA 3ZTJH 2WBJC 3VXPA 3MNVA 3VFUA 4GRWF 4ZUTA 4K3HA 2D9QB 3C08H 3GK8L 3PV6A 4I3GA 1GGUA 3S5LB 4LQFL 4Z77B 4JRWA 3WDHA 1AO7A 1WQVT 4L3ED 1IL1A 2W9EL 5DHYA 4B7IA 1JPFB 2D31B 3QB7C 4JPKL 1KPVA 4H88L 4PJCE 3DX6B 4XPTL 1A02N 2PXYA 1U8IA 3MRCB 3LN9A 3GMQA 3TWCH 1E6JH 1P9MA 5HYJD 2MHAB 5DD1H 5HDOA 5JQ6H 2CRYA 4PREB 1J0YA 1UG9A 3TPKA 5DDHA 3L5WB 3AC0A 1OAYH 1ND0A 1A7OH 3CLFL 2B1AH 1EXUB 1NBVH 5E6ZA 5DHVH 4JN2A 4L8SC 5I1CH 3SJVE 1KJ3H 1RJLA 2XKUA 3QUYD 2OTWA 4JKWA 2V9RA 4HIXL 4X6BB 3DUUB 4JRYE 5DGQA 2N1KA 5F88A 1WLHA 2B5IC 3GMRB 1CN4A 4W6WB 2NXZD 5F9WC 5T1LB 1K4DA 1BD2B 1KCSL 4XZUA 4DQOL 2NY3B 1C12B 1DQLH 2YC1B 4X4ME 3BZ4A 1B90A 5C0BD 1BZ7A 5I75C 3PXJA 2DN7A 5IF0B 3EYFB 4UOJA 1OP3K 1U8LA 3FO1A 4U3HA 1I8IB 2EIEA 2VLLB 4Y16A 4O2FA 4HH9A 5C7XL 5GS0L 2OJEA 4LHJB 3T0XA 5J12B 2VSDA 2AJXL 4LAQL 3HZMB 2ZCHL 4G42B 4GLRH 4HS6B 5DYOA 3VGFA 2Q8BH 5EN2A 4LVEA 3KPSE 4K9EH 1NQBA 3RVWD 4XPBH 4HUWB 2AS5M 4MD0A 2XA3A 2Q76A 2FGWH 1DQDH 1H3PL 3MUGB 4PV9A 5ID0B 3OKNB 2ORBL 5HI3C 4CW1B 1Q0XL 1T89A 3PQYE 4NCC1 1PLGH 2XXMB 3ZE1E 1G6RL 5F7YC 1NGYB 1TJIL 2JJTC 5HHOD 1RUAH 2E7HA 3W81A 3AGVA 1ZHNA 4HKJA 4XBEH 2X9WA 2FWOA 3QA3A 2YZ1A 3HMWH 5KVDH 1S9VA 1YEKH 3BGMA 3CU1A 2HWZH 4MD4B 3BH8B 4UV4H 3P73B 3CVHB 3DURA 2I9TA 4JDVB 3V52H 3LV3A 4OLWH 3K2MC 3VFPA 4HDIB 3Q0HA 3ZT5A 1T1ZA 3ZLQC 5GS1A 2Y4SA 4HV8B 3JWNC 3EOTL 3WJLC 3MACL 1JHKH 3O45B 3BP5A 4UUJB 2OP4H 3MLXL 4WEMB 1EJ6A 2N56A 4HKZB 5FKPB 4UDTA 4K94H 5TGBA 5L2JA 3LD8B 3ARBA 1AY1L 3PWPA 4JQIH 1N8ZB 3QXVA 2IH3A 3CXHK 3ERYA 1MHCB 1FG2B 3TBWB 4RNRA 3VRLF 1RIUH 3QEHA 3WIHH 3EOYG 1IKFL 3LY6A 1W72B 4P3WA 5C9JA 3HG1A 3MRIB 5CWSA 5EG6C 5CD3A 3U0PB 1FN4A 1J88A 3BWAA 3OG4B 3PIQA 2D9CA 5IESH 4XNZB 2VNCA 5BVJB 3G08B 1MQKH 4AYFA 2ICES 4XT1C 3S96A 2AVGA 3KPOB 1V3JA 4YAQA 4P2QA 3MA7B 2VXUL 3ZYOA 1YYLL 4JPWH 2OK0L 3I02B 3D39A 2NY4C 4P9HL 4PJ7A 5GRJL 3WXVH 4QNPE 1JHTB 2M1KA 1SEQH 4N90E 5F89A 1IQWL 1OAQH 1T6VN 2WBWB 4YDLB 3NMEA 1BIIA 4JG0H 4LLMB 1OPGH 4HUXA 1S9WA 5E2UL 4ZAKA 3QJFB 4DCQA 4HULB 4G7YH 4JY4B 1RY7B 2X09A 5T1LD 2CDFB 1BD2D 5SWSA 4KK6C 5KW9H 3EOBB 1Q9KB 5MENE 1VFBA 4NHUE 4QLRA 4GBXA 2BOCB 3B6SA 4G5ZH 4FS0A 1JZ6A 1KSRA 2QADC 3D25A 4GLRI 3F6LA 1YPZF 3CSBA 1TTGA 2R69H 4K94C 4GAJL 1NDGB 1TETH 5HVFB 2AGJH 5D1ZA 1LEIB 2PYFB 5H37H 4MMZC 1BEYH 2Z4QB 2O5XH 2DQHL 3SKNB 1FL6B 3P77B 1J05A 2VDKL 3MGTA 2APWA 4Z5RB 3OJDA 1CXIA 2H6PA 5C6PB 5TJWK 1CD1B 5EC2A 3LMJH 2R0ZL 5F97E 4XBGA 1FCGA 4GS7B 1MUJB 4QHMA 5FEBA 4ZG1A 1X5JA 4W6XB 5TPWL 1YNTB 3OKKB 3L3JB 4OCLC 2VL4A 1CLYH 5KTEL 3FQXA 4POYA 4LCCA 4M5YL 5F3BB 3L3OB 1F4XL 3BHBB 1F6AB 3QUMB 3H9SB 4KAQL 4RFNB 2CJUL 4ZD3L 2ZOLA 1NCCH 3U9UA 1VFOA 1S7TB 2NX5B 2JIXA 3HC0A 3A6BL 3DX8A 4G6KH 4PJAB 3O9WB 1DUYA 1IGTA 1U93B 5D6DA 1CF8L 35C8L 4XCEB 1DR9A 3N9GH 5EH1A 3KJ6L 2XTJE 5FGSA 3W9DB 3IGAB 4POUB 3VXSB 3UYOD 4X98B 3RWFA 3E2HA 1OB1B 4XMLH 1OWWA 1TZHB 2VITB 2EIZA 1F8TH 3Q6FA 4MVBD 5J1SC 4G3YL 2BRRH 3OX8A 1OM3L 1K2DA 3SBWA 4CNIA 3UO1L 5I16B 3FONB 4ALAH 4LASH 5IMLA 4EBQL 3RDTB 4GW1A 3TBTA 2CIIB 1ZE3C 4MXWL 4N0UA 1VFAB 3FCTA 2FSEA 1R0AH 4L4VE 4X5XA 5IUSA 2MPAH 1QSFE 4AIXA 2P4AB 3SDYL 3STZB 1FE8L 1EHLH 3BEWA 4M43L 4HIJB 3GMMA 2IMMA 3V7AG 5TH2B 3RZWA 4PJCB 1IAMA 2JK5A 5HHXL 3ULVE 3ZE1F 4UINL 3KYOB 2A1WL 1XEDA 4NKMA 5DWUH 2QR0A 3T3PE 5GGTL 4NOBA 3UTQB 1OTSC 5GZND 3IJHB 4EDXB 1KCKA 4LCYA 4LSQH 1T2QL 4C83A 1JNHB 3VW3L 3KPPA 4AQOA 4CAGA 4LOUD 3VGAC 3RWJA 4FFWD 4BZ1L 3VCLB 3NA9L 5K9KB 1S9XB 1KIPB 1U8HB 1IMHC 2IAND 1RPQA 1HSAB 5DVLA 1FCCA 2R29H 4JB9L 1A4KB 4XAWL 4E42A 1XGPB 1AD9B 2A6KA 3RWCA 3QEQB 1OAUH 1YMMA 2VDNH 4GRWH 4PLKD 4PJHF 4AJ0A 4KK5D 3ULUF 3MRDB 3O8XA 4QTHA 1I7UB 4P3CH 4J6RL 5FF6A 2I25N 2W59A 1HDMB 3W0WE 4ZXBA 2OM5A 1A14H 3SE9L 2W9LA 3GRWH 3MLRH 4Z7VE 1YNLH 3HFMH 3P0YL 3QXDA 4KPHH 4NNYB 4LHUA 4P3DB 3QPQD 4PJ8D 1HXYB 2HN7A 3B2VH 2LV4A 5DRXB 1G6VK 1MCWW 5JZ7D 2H9GA 4BELD 2NXYD 4BFIA 3DO7B 4KJWD 1YECL 5IB1B 2OTUA 5JDSB 3CVHH 3H9SD 5EZJA 5FYKL 2CK0H 2P8LB 5LBSL 2NX5D 3OXRB 4PIRF 4PP2A 3T0EA 5D7LE 2YD8A 4PR5B 5T1MB 4QNPF 5ECJE 3QEGH 2CDEB 3BKJH 5F1SA 4PRDB 1I9JL 3U7YL 4I48A 2EE2A 3PQYB 2EDYA 5KS9A 3QT2A 2VQ1B 1YNKH 3SGKA 2FR4A 4PJFE 3UTZA 2ERJC 3VXSD 5DO2C 3VXQB 3U4EB 2XRAH 3DSFH 3RPIA 1RUQH 3SE3C 5HGDA 3HAEB 4P99A 4F9PC 3VH8G 1FGNH 3BN9D 1IKNA 2VDMH 1WZ1L 3KLAB 4DFHA 3TPUE 5F1IB 1I9RH 2HTKC 4L3CB 1RHHA 1Z9MA 3U6RA 3FO0L 2ITCB 4EN3B 3WNPA 2X5PA 4HK0A 1UKQA 4JO4L 1H5BB 4Q6YA 3OHXB 4HBCH 3CSYB 2XOTA 2X4QB 5GGVL 3SDCA 1YJDH 5K59E 4MSWB 5LKNA 4P4RA 5DFVD 2D7PA 2NW2B 4JLRA 4BK4A 6FABL 4H5SB 5SWZA 2UZYB 2H3NB 3KPMB 4U0RB 1E27B 2APXA 4UILL 5E8DH 2J88H 5IFAH 4P57A 4Y4HC 4GW4A 3KYMB 4BH7A 3GJFH 2PR4H 4O9HL