3FQRA

Phosphorylation of self-peptides alters human leukocyte antigen class i-restricted antigen presentation and generates tumor specific epitopes
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
275
structure length
274
Chain Sequence
b'GSHSMRYFFTSVSPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDGETRKVKAHSQTHRVDLGTLRGYYNQSEAGSHTVQRMYGCDVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQTTKHKWEAAHVAEQLRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHEATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRYTCHVQHEGLPKPLTLRWE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
publication title Phosphorylated self-peptides alter human leukocyte antigen class I-restricted antigen presentation and generate tumor-specific epitopes
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 77
structure length 274
sequence length 275
ec nomenclature
pdb deposition date 2009-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3fqrA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3fqrA01
3NZ8B 2PTUA 4AMKL 1DEDA 4L29A 4WUUA 3DRQA 3EJYD 1R3JB 3BZ4B 1CE6B 2EDLA 3LVEA 3SE3A 2G75B 5GSRB 3CDYA 4D0DB 4JGJA 3GI8L 1IFHH 2Z93A 3S7GA 3FKUS 4GW4B 4OGAC 1AC0A 4ZPTB 5FO9B 4V3EB 1SHMA 5F1NA 1G7QB 3HZVA 1MIMH 4G8IB 3FQUB 1EVTC 3MV11 4LHUD 3ARQA 4KRPC 2B20A 1GIGH 1EBPA 2H26B 5EU6E 5CGMA 1VEPA 1SBSL 1FC1A 4TNWF 3CX5J 2YRLA 5ICXB 1PLGL 4IRZH 3MRJB 5EZJA 5EO0A 4PJHE 2PN5A 4GKSA 5CIPH 3BMWA 3DPBA 2X40A 1WZ1L 3ALPA 3HB3D 1KC5L 2P49B 3PF2A 4WW2F 3OKLB 4O58H 1NDMB 5CWSA 4F7MB 4XP4H 4MNHB 3DGGA 3RKPA 2NZIA 2VR5A 3WJJC 5DTFA 3QDGD 2AJ3B 1QSFD 2AEIT 5HDLA 3ZTNL 1NBVL 2R1XA 4HIHA 3GSQB 3ZHDA 3O3BA 5E24E 3NIGF 4U1GC 2AJVH 5E95B 3SBWC 3R1GL 5ACMA 4KKBC 1YNTB 1OGAE 4LNVA 5ISZA 3MRLA 1N5AA 3WO4B 1M7DA 5ILTL 2OSLA 3TFKA 1JNNL 1IGCH 5CMAA 1K5NB 4YH6A 5TQ0H 4XNUL 4W81A 3DMMA 1IAIL 2HH0L 5LGKA 1IGTB 4PJDE 4YDJA 2R9HC 3NH7L 2HYMA 3NABL 4LLMA 4IIQB 4Y1AE 5EUOF 5DJCB 2UZIL 5I1LA 3HG1B 4MAUH 4MB3A 1KJ3L 2DBLL 5FUZL 3H3PL 2R2BB 4KU1A 4HLZG 5EU6D 3PWPE 5IB4A 4FXGB 1B0GB 1BF2A 2IALB 3QUMB 4P9HH 4QCIA 4K23L 3QNYB 5E7BA 1AO7E 4TVPL 3B9KC 2P24A 4G9DB 2I60H 3VW3H 3AY4C 5BS0A 1GPOL 4ZO6A 3LHPL 3KYAA 2P8LA 2EO1A 5LCVH 2EYTA 4EIGB 2BMKA 1UVQA 3MV8E 1JZ4A 5DD0L 3HC4L 2KH2B 4M8QB 5T33L 4ZYKA 2DLFL 5D7LA 4BUGA 1ZHNA 3PGFL 3QRGL 2Q8BL 5KJRL 4DW2L 5E70A 4MNQE 4N0CA 1HSAB 3QXWA 5C0AB 4WI5A 3A6CL 5EBLB 3GRWH 3BRDA 1HI6A 3UJTL 2NY2C 3WFCH 1VSCA 2G5RA 1DR9A 3NIDE 1NLDH 2EC9T 3LQAC 4M1DH 4X99A 3U0WL 1UM4H 3P2TA 2GITA 1A14L 3LB6C 4ETYA 1FV1B 5CIPB 2IBGA 1GL4B 3VXSD 1ZT1B 2EECA 4E5XB 3MC0A 1T7YA 1I3VA 5D72H 5IVZB 3RNKB 3KPLB 1RUQH 4XVTH 3TIEA 5AG9A 1T2JA 3PWPD 4QHNA 2WUBH 5DFWH 1TJHH 3V0AC 4MGXA 4WI2A 2GJJA 3WO3B 1WITA 3X13B 5EBWA 5D1XD 1NSNL 4YHNA 5ENWA 2VDOH 1JZ3A 1LEGA 1H9VA 1AO7D 1PGRB 1PKQB 5D2LE 3GDBA 1RU9H 1U3HC 4NZUL 1XGUA 1NEUA 5LAXB 3E6HA 4NM8L 3IF1B 3EYFA 3FCTB 3X11A 3MJGX 4NQVB 5FYJU 1ZLVH 1T7WA 3OR6B 3PIQA 4NRXA 2AI0L 5ALCH 2PUQT 2R15A 4KK8C 5IFJB 4MNQD 2JCCA 1AHWA 2DM4A 2M8XA 3GMQA 1C08A 4Y19A 5D70H 1P4LA 4NZRH 3PNWB 1KPRA 2A6JA 4HWZA 3W81A 1BHGA 4KGLA 3EGSB 5I0DA 1BFVH 1NCWL 4FQQA 1FAIL 4PJ5B 1XF5A 3KPOB 5I1CL 1Q72L 5D4QA 4BUHA 2UUDK 4HMEA 2IPTH 2JELL 1JCKA 4YDLC 1QR1B 4AIZB 1D5MA 1O7VA 4CN6A 5MENE 1R3KB 2BVPA 2WIMA 2NQCA 4K7FA 3OKEB 1H5BC 3O11B 1AI1L 1UYWH 1MFEH 4OCRH 5IB2A 1BVKB 3Q3GB 1B90A 4L3ED 1ZHKA 2RBLA 2HKHH 3C9NB 1E4XH 3O4LD 4I3RL 1XH3A 4CDHA 5B22A 1ZXQA 2AEQL 1A6VH 4U1NB 1F4WL 1HZHH 4BQ6A 2QLVB 1MIEL 1MH5B 1V8HA 3UZVB 5DD5L 3EO9H 4R6UA 1NC4A 5DMIH 1FGNL 1KBGL 4HS3A 2WBJC 1UT9A 3WXWH 3GMOB 2AV7B 1MUJB 3OHXA 4Y2DB 1P7KB 2JCCE 3ARGD 1EA9C 4RNRB 3A67H 4XI5C 3U2SA 4RFEB 5HYQA 5DK0A 4Y4KD 2NXZD 4XHQA 4W4OC 1DL7L 2PO6A 4YK4C 4KMTH 3MBXH 3SKMA 3HUJA 4KXZH 4YC2B 2VAJA 2B2XH 4ZSOB 5BV7C 4KV5E 4YHLH 1ZANH 4TTGA 4OZIB 5F89A 2YA2A 3D85A 5GS2D 3L1OH 2EDQA 1HXYB 1FE8L 4PBXA 3BWUC 3CC5B 1NMCB 1XIWC 4H8WL 3MOBL 3BSZL 2EDXA 2X05A 4RZCA 3D6GA 1A8JH 1I9JH 1OAUL 4ZFFB 1NPUA 5CBAA 3V6ZB 3QXDB 1BEYL 1HINH 1DP0A 5BZDB 4QOKB 3H9HB 5BMFL 4IRSC 5JR1H 2B7DT 3GIVA 4PJIF 4O02H 5IHZB 3HLAB 1EDQA 1FIGL 2DQIH 2PW2A 1A1MB 4J3VA 1IC5H 4LVNC 5E6YA 5GGSA 3T77B 4C56A 2ADGA 4WO4B 4X6CE 4UQ2B 1KLGA 4LSQL 3QQ9D 1VKXB 1QBBA 4PJ9C 2EDRA 3U79A 4EI6A 2ZCLL 1MCCA 3ZDZE 2AJUL 4AEHH 1QO3A 1HEZB 1MJJA 3LN4A 2DLEA 1A4KA 3U4AA 1JHKL 1AQKH 4QRRB 3DHMA 4L3CA 1F4YH 2VXTH 4LCIL 2AEPH 2C3XA 1MNUL 2R39A 4QXWA 4YNYB 4ZUWA 5FYLH 4GQ9L 1TENA 4DOHE 1JF6A 4WRLA 4U6VH 5IB3B 3QIUC 5E4EB 3U30C 1CU4L 2IC2A 4HC1L 2YPLB 3K4ZA 5C0ND 5DJZA 1CDBA 3VD5A 1J0JA 2JJUA 1HSBA 3TPUE 4JKMA 2QSCH 4N0RA 5C08B 3VRJA 2IH3B 5DD3L 4X4XA 1JMZA 1VGEH 1WISA 5IF0B 3MO1A 1IEHA 1I1CA 2KZWA 3BT2L 3GBNH 4Y4FC 3BVNB 3QEUB 4LCCC 3QFJE 2FATH 3G08B 3WYRA 2J12B 1U58B 3VG0L 4JGUA 3ARPA 3P73B 5F1IA 4DQOH 1L4IA 3G5VA 1K8DA 1IJ9A 2Y9RT 3VFRB 3HPJB 3LMJH 4XWGL 3BP7B 5EORL 1IT9H 1PEWA 3V0WH 1MCIA 2EO9A 3FZUC 5HVHB 5DJ6B 3DVGB 3KPTA 1Q0XL 4J2XA 4GLRH 5DWUH 2P45B 2HVJB 3OJMB 5AWNH 1JP5A 4FFZL 5I73C 1I1FA 1KG0B 4HXAH 2NR6C 4JHBA 1I9RL 1TVHA 1IGYA 4I77H 3L3HB 4JRXA 2A6DB 5SX4H 1VCAA 4G9FB 1RK1B 3JWNC 4ZDHB 1OVZA 4G7VH 1NFDA 3T2QA 4HLZH 3UYRH 1NGPL 3D2UB 4CU7A 2FL5A 3IDGA 1GVIA 4LASL 5GS0D 3INUH 4KTYA 3F7PC 2Q86A 4KHXL 3QFJD 5HHXL 5J11C 3MZTA 5ALBH 2YD9A 3BQUD 1XMWA 3F58H 2NW3A 3EYVA 2FJHA 5HHQA 2AKRB 3BAEH 3KR3L 4O5LL 4QF1A 3S8WA 4MAYC 5TQ2H 2EEAA 5BVJA 1REIA 4OFPA 4M6OH 2D3VA 1Z9LA 4PDCE 3TCXA 4Z7NF 1YEEH 2J5LC 3HI5H 5IT2L 3B4NA 3CH1B 1H3PH 3K1KC 4NC1E 1JYNA 1KJ2H 5JOPE 2EDEA 3KYKH 4IJ3B 3KPSB 4JR9L 5LXGH 1JWUA 5F6HJ 4NWTL 4JN2A 4QTHA 3MV9B 4M7ZC 2WLZA 1RZKL 4PS4H 3TN0C 4HT1L 5J06A 4LAQH 2P48B 3G9AB 5KS9F 1N5YH 4NOFA 5I8OH 2IBZY 1MHEB 1MPAH 2XFXA 3SCMD 2Y5EA 4L9LC 2Y07L 4P5TB 1YNKL 2NY7H 5HHOB 3HFML 1MFBH 1K9TA 3VMPA 1A5FL 5DEFB 1CICA 1LO5A 5C92A 4E41B 3WN5B 3SJVE 1R3LB 4FFWD 1TZGL 3TJHD 1F3JA 4PYHA 1N64L 2JK5B 1FVCA 3NACH 3CSGA 1G7HB 2CDGB 1QD0A 1J8HE 4W70A 5DZNA 4NO3A 1XGRB 4EIZC 5JNYA 3KHOA 1FFQA 3MX0A 4UU9A 1F2XK 4MCYA 4YBQC 4S1SL 5IW6B 3BPNB 1B0RA 3T08A 5I1HH 1KFAH 4S0SD 1CD8A 3V9FA 4J1UB 4J6RL 3F8UB 3RGVC 5C0BA 3VFUB 5K59E 5H8DA 5ITFA 5EC2A 4ZS6D 4G6ML 3REVB 4LLUB 4Y89A 3LEYH 5CJQL 3QWRD 3HMXH 1JVKA 1UKSA 1CLCA 4LLDB 5EZIL 4NQSA 3JTSA 2R8SL 5F8RC 2D7QA 5IQ7L 3SJVD 3CDCA 1P9MA 2Y7QA 4N8VG 4MXWL 3MRFA 1MEXL 3ARDB 5L0QB 3ULVF 1JBJA 4X8JA 3NTCH 3AGVA 1TZIA 1T1WB 4OBRA 4PV9A 3I02B 3M17B 3S37H 2H1PL 3H42H 2HFGH 2FGWH 5IMMA 4HGMA 5LVEA 5I6XB 4MVBD 3T8XB 1KJ2B 3GJFA 4F7CA 3QUML 5H37H 3CX2A 5GRZA 4XZUB 1I9IL 3VXNB 3NCMA 3E0GA 1PX3A 1G7IA 2VABB 5F21B 1YY8A 3K8LA 4WI6A 4XNQB 3FOLA 3PWVB 1JPSH 1JPST 4GXUN 4QWWD 2G5BA 2JJTC 2MNUA 3S4SG 2DAVA 1CLZH 1MJUH 3HKFA 1QFWI 1IFHL 3MXVH 5FFLA 2BSTA 4HKXA 2ICWI 3AREA 1J05B 1FIEA 1H15B 1OTTC 1UCBH 3P77A 4TVPE 1WBZA 1FNEA 2XRAH 2I9LA 5C0BE 5T1KD 3CCHB 3H7BB 1RSFA 4G3YH 4I18A 2WQRA 3KLHC 4YHPA 5F9WB 1QA9A 3C6SB 2R0LH 3U48A 1H8NA 2Q6WA 1GIGL 2EZ0D 4IRJC 4JGMA 2HLAA 3BXNA 5KVDH 1Z3GH 4OTXH 4UTAH 2IANE 4M9OA 4MDJA 2VISA 2Z35A 1L6ZA 5CJOL 3PP4H 2W91A 4O58L 4XP4L 1WK0A 2R2EB 5F3HB 5CHNB 5HD8D 4NKMA 5J1AA 4OF5A 4JY4A 1SEBB 2Q76A 4JFEE 3TBTB 3I75A 5BXFB 4PD4J 4XRCB 1FYTE 2AJVL 2X7LB 1FO0H 3OKDA 5IWLC 1WIOA 1A6TA 3VA2C 2Y72A 1OSPL 3LEXA 1BFSA 1CZ8L 4MA1C 2E7LA 3GSNH 1IGCL 4L8SB 4EDXB 2BDNH 5E8PA 2DJ4A 2VDML 4QT5A 4NJ9H 3QB7C 3IJHA 3QHFH 4TVPD 3QEQE 3RVUC 3MUY1 1OW0C 3AMKA 3TZVD 1HKFA 3RPIA 3FRUA 4MAUL 1FNGB 5CGYC 3H3BC 3OX8B 5GRJH 3T4AA 4NNYA 2C4FU 4CW1B 5D5MF 5F7FA 3S9DB 3GGWA 1U8NA 2VLKA 5BQ7A 2IAND 3CLFH 4P9HL 4RBPK 2I60L 3VW3L 1HOCB 4U1IA 4WWKB 4XPTL 4GRLD 5E56A 5C70A 4JFQB 4R7NB 2P5WE 3IVKB 4JFED 4CDGC 4D0CA 4CGTA 2E7BA 3LRGA 3SE3C 1FYTD 1TJIH 4PJCE 4UV4H 1JGLL 2VWEE 3BKJL 4OZGE 1DUYA 1IM3A 1KPUA 3MRPA 4Y0GA 2R0ZH 5JPNB 4EZMA 4OGXH 4P4RB 3JSSA 2IMNA 4PRBB 4MJ6A 4YUEL 3GRWL 4ZQKB 2QBWA 3V52L 4EQ2A 1YEKL 3C60C 3WHXB 3EJZD 5HTSA 3FFCB 4P23D 1UM4L 4EI5C 3QEQD 3QO1B 1M71B 4O2FB 5FK9B 4X7TB 5EFIB 5D5MB 3C6LC 1KCSH 5T5NF 2ZJSH 4PJXB 4Y16A 1M7XA 1WWAX 2IAMB 3PQYB 4RX4D 1FNSL 4RGOH 2CUMA 1K4DB 1Q0YH 1HH9B 1SVCP 3CFIC 3PV6A 1RUQL 3F7RA 5LG1A 1XGYH 2WUBL 4Y5VA 1TJHL 3QIBA 3CFDA 8FABA 1A6ZA 3P9LB 3QPQD 3NCJH 4ZFZB 2VDOL 3FQXA 1FO0B 4AH2A 4YBLB 1G0XA 5EN2A 1E27B 1RU9L 2ADIB 2EIBA 4G42A 5TDPA 1J0ZA 5JA9A 5D7JA 3O6FD 2ICCA 5KSBE 4AY0A 3GSNB 2P5WD 3GNMH 3U4EA 2EKSA 1L0YA 3TFKC 2VO5A 5ALCL 2C3WA 5HI4D 2NW2A 4U05A 1JI2A 4JFDB 2BXYA 5D70L 1Q9LA 5KAQG 4HX1B 4OUOA 1D5IH 3TBWB 1JGUL 4NZRL 4RIRB 3BZFA 1YPZE 3ZTJG 5I8EB 3CU1A 4G80A 1FHGA 2NY3C 4S1RH 1BFVL 5E6IA 5JHLH 3NAAH 5A3ID 4GRMA 1RURH 2CKBH 4KROC 1MLBB 3DV6A 1CL7H 4CU8A 3NA4A 2VDRH 4HAGA 2BFVH 2XKSA 5IJVA 1OWWA 3I3BA 1Y0LB 5KSAD 3VI3E 5KG9A 4OF3A 4XNYH 5GZNC 3WDJA 4HJ0D 4LPUA 2IPTL 4BA8A 2FNBA 4JDVA 1AGDB 4KI5C 1P84J 3V4UH 1BM3H 5ICYB 3HZKA 2YRZA 2D31A 3STZB 2C3VB 5IOPB 1UYWL 4OCRL 4I0KA 2OJEB 1IRAY 4YPGB 2HKHL 1E4XL 4PJEF 4HIXH 3MA9H 3ZT7A 3IXAB 5BZWA 4N0CC 1A6VL 3ECBB 1N0XH 2W59A 3EO9L 4LCUA 5DMIL 4OCNC 4F9LA 4A6YA 3WXWL 5FA4B 5E8NB 1QSED 3DWTA 1BLNB 2BVOA 1E4KC 2GTZB 4NN6C 4U6HB 2D7TH 4KUCD 4Y5YC 3A67L 4NKQB 5DK2B 5J3HD 3TA3A 3NFSH 3UYOD 2XV6B 3G6JA 1G6RH 3O45A 2XN9A 3MBXL 1S7VA 4KMTL 1XR9B 2X1PA 2B2XL 4JFFA 4YHLL 2QTEA 1ZANL 1T5XA 1X5LA 3BIKB 4MDIA 1WF5A 2FIKA 1FYHB 3U0TA 2QQNH 3QAZB 1AKJD 3QXAB 4XCYB 4PB0H 1F6AB 5I15L 3L3GA 1KJMA 5J6GB 1FFNB 3NN8B 2XXCB 3P11L 1KCRL 5EIIB 3GUTA 3QDAA 4BZ1H 3ULUC 1I9JL 2Q20A 4PLNC 4NDMA 1AIFA 2DIJA 2EXWC 2X4UA 3HS0B 3FO2A 2YSSB 2VKWA 4I0PB 1HINL 4ONOA 5F6IB 1AQDB 4N0UE 4QGYA 1QZ1A 4UUJB 1N8ZB 3MRBB 4UAOC 5JR1L 1Z6JT 5D7KE 4MD4A 1R5VB 5HGAB 1ZLSL 4TTDC 2DQIL 2G75A 5GSRA 2IADA 4YBHA 1MY7A 5DUMH 1IC5L 2EXYD 1OP5K 2J6EH 1EEZA 2AJSH 2LTQC 4FFYH 5CD5D 1E28A 5JW4R 4MXQC 3QQ3A 4ODVH 4G8EB 4ZFGH 5CCKH 4JFHE 2A6KB 1CDJA 4RMVA 4TN9A 5C0GB 5CUSH 4AEHL 1Q94B 2IG2H 3QUYA 4Z7WF 4PB9H 1GJIA 2HT3D 1AQKL 3QZWA 1IEAB 1ZSDB 1F4YL 2H26A 2VXTL 4LSUH 1GGUA 2AEPL 5FYLL 4DN3H 4YHKH 5I1IH 3MRKB 4HH9A 2GFBB 4U6VL 3GJFK 2I9TB 4IMLB 4CMHB 1FFRA 1NDMA 4F7MA 5CINH 4MNHA 5FF6A 1EZVX 4JM2D 3KYMA 2QSCL 1NGWB 5C0JA 1OTUC 4Q9QH 3REWA 2X89A 5CJBA 1VGEL 1OPGH 3O8XB 3T3PE 4S0TD 3TNMA 3L7EB 3GBNL 1GC1C 4OCSH 2FATL 5D7KD 5GIRB 1YNTA 1I1AA 4HPYH 4JVUA 5IB1A 1G6RB 3PWJA 1NCBH 1G0YR 4R2GC 1BD2B 4LHUA 4DQOL 1T4KA 2PO6C 2B4CL 2O5ZL 2X09A 2VDNL 5FM5M 3LMJL 3UTSB 3N06B 4BM7A 4O4YL 2IF7A 1IT9L 3V0WL 1BOGB 5FYKH 3QUKA 2AJZA 4JFHD 2X70B 4G5ZL 5F70A 3H9SB 5DJCA 4XTRC 5DWUL 4UV7L 4JZJC 5AWNL 4F33A 3CVIH 1WBXB 1Q38A 2WLYA 4WW2A 5C09B 7CGTA 1DFBH 2MCPH 1AR2A 4FXGA 2HJLB 5CEXA 4PRIA 1B0GA 2IALA 4LSSL 1F11A 4PGJA 4R8WH 3MRNB 4I77L 5D1QC 5FHBH 3CGTA 3JWDH 1OARH 4QRPB 1KIRB 5C2BH 1MJ8H 1UZ8B 3VGDA 3X12B 2OYPA 4MJ5A 2A0LC 3IDMB 2MQCA 1LDSA 3QI9A 4NCC2 3T0EB 2AJXL 5M7QA 4U7KA 2X4RA 3ARBC 3F58L 3ZKMD 1G7MB 3BAEL 2V7NA 2HTKC 4HIIB 1T7VA 3BP6B 3DSFH 5EUOA 5TQ2L 2ZG3A 1LO2H 2MFNA 4M6OL 4UIMB 3C5ZD 1XF4B 5FGBC 3WFHB 3KPMA 1JPGB 1YEEL 3MTRA 3HI5L 4F7EB 3WS3A 2EDDA 1JNHA 4NO2B 3BPLB 1KJ2L 2QKIB 1MCHA 3KYKL 2VLJA 1BX2B 1BOYA 1EGJH 1MCWM 5DO2D 4GUPB 3F7YB 1HIML 3BN9D 3HG1E 4PS4L 4S2SB 1AXIB 3RDTB 4LAQL 5HYJD 1N5YL 4H26A 4WEMB 5I8OL 1CG9B 4KC3B 1MPAL 3OKNB 3HE7B 3DX9A 4G8GB 3AS2A 1MFBL 4M7LT 4M7LH 3PP3K 1WFUA 2YKLH 3QCVH 5LAXA 1NC2D 5DYOB 5AAWA 1QPXA 3FCTA 1FPTH 5ERWB 4M61A 1L9NA 1U8KA 3NACL 1AJ7H 4ZFOA 4G6AD 2X4NB 3G04B 4RGMB 5IFJA 1GGTA 2A83B 2QADC 1HYSC 4KH2A 4LVOC 1I8LC 2A77H 3V2AR 5C0AE 2WV3A 1DQQA 1RUMH 2UZXB 5FA3A 3U9PH 4L4TA 4R4BB 1KXQE 2A6IA 1KFAL 2Q3AA 2C7UB 2C3GA 4DVBA 4BQCA 4H0GA 4HWEH 4KFZC 1A1NA 1BZ7A 2DWEA 3SO3C 3E1F1 3G5XB 4MQTB 5F1SA 3SDDC 1HHIB 2EC8A 1FNLA 3P4OB 2JB6A 4GKNB 4MXVE 5HHVH 1R3KA 5L2JB 5FCUH 4LLAA 3HMXL 2H3NA 3O11A 5ACZA 1JZ8A 4ZPVA 4P2RA 4X9BA 3WE6B 5IKCB 3AAZB 4EQ3A 1N2RB 1PKQE 1YJDC 1X6NA 2VLRA 1QFHA 2EDYA 1CXFA 2O5XH 2D4FA 43C9A 2WANA 4Q0XH 3VFNB 5F7EL 5DURB 5IB5B 4QKXB 3NTCL 4F2MA 3N1MC 4K8RL 2ZUSA 2FLBT 1ZOXA 3FQTA 2P8MA 4APQD 1J12A 4YLQT 3S37L 3HC0A 2HFGL 4XP9H 1Y6NR 3GMOA 2FGWL 2PTVA 5I9QC 3MUGA 4K55A 1JF1B 5C0AD 3WD5L 1S8DB 1MVUB 3I84A 2DM2A 2GT9B 4U1SA 5JHDB 2AXHA 4C4KO 1JPSL 4ODUB 4PJ5E 2R0KH 3K74B 4RQQA 4CMMA 4XPBH 4JPVL 4M5YH 1MJUL 1T66D 4L3EA 3FT4A 4EBQL 1RZ8B 1QFUH 1UCBL 3NCCB 4FG6D 2XRAL 2C5DC 5GRWA 4HCRH 4HQQH 3QNXB 3E6FB 3LH2H 4KK5D 4RGNC 4N0FA 2JIXB 3WL9A 4PP2A 1CICC 3WDIA 1CFQA 4PLOB 4Y4HD 3VXTA 4U1GB 3VWKD 2R0LL 2VOTA 3ZE2F 3BEWB 5ADOH 2K3TA 4LSVH 1ZT7A 4JKPH 5KVDL 1Z3GL 4LHJB 4UTAL 4Z7UF 2YN5A 3DJ9A 3VFPB 1FVDB 4GKZB 5DLMH 3VH8B 3QXVA 1WFNA 3PP4L 3O3EB 1I8MA 5IHZA 1FG2A 3DX7B 4KJPD 4U7MA 4J8RB 1DJSA 1YQ2A 1OTSD 4R96B 3D39A 1QFPA 4S1QH 3B6SA 1QLEH 1NGXA 1HYRC 4P2QB 3SDXF 5GS1A 1KYOK 1MHPH 2CLRB 1FO0L 1RJZA 1C16A 1YEDB 3SGKA 1K8IB 5KANI 1C5BH 3SE9H 2CK2A 2Z92A 4MJIB 1CGWA 4H5SB 4P57A 1X5IA 2YN3A 4QRRA 4PJ5D 3GSNL 2W9EH 2W07A 4HZLB 4ELKB 2BDNL 3QUXB 4ZSOE 4NJ9L 2PNDA 5GZOD 4OZIE 3QHFL 4XWOC 4ETQB 1PG7X 2X41A 3GB7B 3Q5YA 3B5HA 1JFQL 1VB9A 2DLGA 1OT2A 3FT3A 3SGJA 1NMBH 5EU5B 3H9YA 3CXHK 3GSVA 3RVVC 3IETB 3TYFA 3U7YL 3O9WA 5MEQA 5GRJL 4PJIA 2FO1A 3FTGA 1U3ZA 4BZYA 3FT2A 3MBEC 1CK0L 2E27H 1PQZB 1SY6A 2ENYA 3QEUA 3DUSA 3U9UA 4Z76B 1IAKA 3QEHB 3WUZA 1IBGH 1T5WB 1VACA 4QOKE 2NY2B 3W9EB 4YWGH 1CTNA 3RJDA 1JHTB 5IEKB 1TPXC 3B83A 5B3JF 5E9DD 5C9JA 1ED3B 2OQJB 5KVMC 4RWYH 4MD5A 1TJIL 1F4AA 1EUUA 2X1QA 5FECA 4Y2DD 2RFXB 5IV2B 2DMCA 2R0ZL 4OGXL 3F12A 1EAJA 1R5WA 4ODSH 3AREC 4OQ1A 4EDWL 1KG0A 1XF3B 4NRZB 4PRNA 2R1WA 2ZOKA 4D3CH 1LO3H 5GRVK 4QRRE 3TF7A 1X5AA 1T83A 3BD4A 4JQXA 4DZ8A 2XOTA 3MGTB 5JOEA 1DUZA 3KPQA 1ZE3C 5I75C 4I48A 1GXEA 3V0VA 5AUMA 1RK1A 2V7HB 1KCSL 3PABB 3U36A 2YPLE 1UM6L 2CLVB 4HK3J 2OLDA 3D9AH 3FB7B 1S9YA 5IBTH 1S9WA 5C08E 4BSJA 1IAOB 1I4FB 1P69B 3SO5A 1S78D 3NCJL 4C55A 4LDEB 1KJVA 1FC2D 4QOKD 2ICWJ 2Y36H 1WT5A 1F00I 3MJ9H 5HHMB 4TNWK 3L5IA 3MLYH 4PR5A 5AZEH 5L9DH 4ZAKA 3FHAA 4J3TA 4M1CC 4UT9H 2FCBA 3DUUB 1U3YA 1ZK9A 1L8JA 3DTXA 1DBJL 3HTLX 1TNNA 4KZDL 3GNML 3MUJA 4PLJC 1IVLA 4JY5H 4KK9D 3T2OA 4DKEH 3M1BB 4ODHH 4QRTA 4WO4D 1DBML 5HI5D 3KPRD 3BEVB 4HKZB 3KWWA 3HC3L 1P5VA 1D5IL 1U0QA 4CVXA 3L5WB 5J8OA 1H5BB 2YZ8A 3QDMB 3N0PB 5JHLL 3NAAL 3QNZB 1RURL 3ZL4H 5HHOA 1C5DA 1CL7L 3KYNA 2VDRL 5HI3D 2BFVL 3PL6C 1U8QA 1GOHA 4XNYL 3QDHA 3IAQA 5CFHA 3ARFA 4G9FE 1A9EA 1R3LA 3T0VA 3ROOB 4ZMAT 2WBJB 1VGKB 4FHBD 1HHHA 3WHE1 4HFWA 3KNBB 4S0UC 2NY1C 5HBBA 3V4UL 1FL6A 1BM3L 2CDGA 3GMNB 4H25A 1N59A 3O2VH 4P4KB 5EU4A 1G9NC 2D03H 4UT6H 4HIXL 4YFEA 4KI1A 4FABH 4G6FD 2BNRD 5D2NA 1XGQA 3L3OB 5DRWA 3VFTB 1ORSA 1TTGA 2ADFL 4LFHD 1VFBA 4LEOA 3WUWA 4XHJC 1ZWIA 1BQHB 3SDCA 2PYFA 5KS9A 5FYLE 3WFBH 1XIWB 4N5ED 1DN0B 1KIQA 2D7TL 2ZG1A 1QLRB 6FABL 3KPSE 4KAQH 2PTTB 3NFSL 3MV9E 3MFFA 4EUPB 5DS8B 2DI7A 1G6RL 1CD9B 4GAGH 4XP6H 1YECL 1YMMB 2FEDC 3O6KH 3FMGH 1IC7L 3CFCH 2HJKA 5TDOA 5GGUB 6CGTA 4JB9H 5HVGB 4AL8L 4YHMH 4Y5VC 2BNQB 2CXKA 4NNPL 2QQNL 4XPHH 4G9FD 5K9QI 4C59B 4G43B 4XBPA 4W68A 1FQ9C 4OCMC 3PWNA 3FB6A 1RULH 1UB5B 4E41E 2J1KA 4LVNB 2VZTA 2FYYA 1T21A 1VEMA 2Y5TB 3QT2A 3BKCH 2V5MA 2GQHA 4ELMB 4PTUB 2CIIB 3DROB 4R97C 2EIDA 4PREB 4NQDB 2BHYA 4Q7DA 4F9PA 4Z7NE 5IFAH 3U0PB 3RQ3A 2CDEA 1TMCA 1DQJA 2BSED 4GW1B 3QWRA 4O00A 5E8OB 3HZMA 3QIUB 5FYLD 3U30B 5DUML 5E6IC 5KTEH 1OP3K 1G7LB 4FFYL 4RAVB 5I1GH 3FAWA 4PRPA 4ODVL 4ZFGL 5IVXF 4NBYB 5J12C 1F6FB 5JOFB 1BQUA 3FN9A 5CUSL 3ESUF 1OWRM 5GRYA 3KXFD 4P5TD 2JTDA 1DVFD 3TO4C 1U93A 1BMGA 1LO0H 4LSUL 5K9OA 4DN3L 4X6BB 2QQKH 4YHKL 5I1IL 2GAZA 5I16B 1VADB 3AM8C 4JHZA 2O61B 4F8QA 1GH7A 3IKKA 1UA6L 3HI1B 5CINL 2GSGA 2VJXA 1DANT 2R0WH 1WWBX 4JHAH 3CUPA 4LLQB 3MGOA 3MLSH 3T1WA 4TVSa 2ZUVA 1JYWA 2VKXA 5I17B 3IDJA 4Q9QL 1MCNA 2MJWA 1CXHA 4YAQA 3TBTA 2IQ9H 1OPGL 4LOUC 2W92A 2QJDA 2GJ6B 1YY9D 5T1KA 4B53A 5FEBA 3LZFL 1V05A 4OCSL 2V2WB 5FO8A 1WLHA 1FFOA 2XQBH 4HPYL 3KYOB 4ODWB 3DX6A 1CGVA 3CDGB 4PJ7A 3L3KA 1NCBL 5IG7A 2HLFD 2DQHH 5IVXB 4YDIL 4R26H 3TA3C 1ORQB 3TBVA 3H9ZA 4AG4H 4LP5A 1D6VH 3QJFB 4LVHC 43CAA 5DFVC 4HH8A 4KK6C 25C8H 4HJGA 5FYKL 5TGBB 3IGAA 4YHIA 3OKMB 5A40E 2KZ1B 4ZXBA 5DD6B 5T1MB 5KZCD 3CVIL 1NL0H 2E7CA 3S5LA 2HT4D 4PLKD 1NBZB 5J11B 1DFBL 3FOMB 2P7TA 2MCPL 2UUDH 1MFCH 4BFIA 2OXGA 3C2AL 4MAYB 4R8WL 2OI9A 5EZLA 2DJSA 3VXRB 3JWDL 1BQLH 1OARL 4PV8A 3ARDD 5DJXB 1XCTB 4O2EB 1MJ8L 3QIWD 4QHLB 4AEFA 2LV4A 3VWJA 4NBXB 5K9KB 4UI2A 3BP4A 1Q9WA 2WAHA 3BO8A 3QG6B 1S7RB 3CSPA 4M7ZB 4JKWA 5IIEA 3TN0B 1OT1A 5ESVA 2F5AH 1LK2B 5BW7A 3PWUB 4ODTL 3RVXD 1T1YB 3DSFL 5I66B 2VIRA 1LO2L 4I5BA 2FJFA 3BGAA 3FFCA 3DI3B 3GJEA 3QUYC 4LQ1A 3UAJC 3EHBC 4FZEH 3KGRA 5EFIA 4NQXB 1K4DA 4JFXA 3RTQD 1U8JA 1ERNA 1EGJL 4KMLB 2F54A 3MNWB 1W0VB 4N9GB 4RRPA 1A7PH 1CI5A 3OPZH 3EJYC 1VPOH 5DHVA 4XPGH 4M7LL 3IDIA 2IWGA 4PGCB 3SKOA 5IR1B 2YKLL 3OR7A 1ZV5A 2VZUA 1J88A 1MHHA 1VESA 4WVRA 1FPTL 1I1AC 4CVZA 1YDPA 2LE9A 2ESVA 2EDWA 2PW1B 1YEFH 3ILQD 1W2KT 3RGVB 4HF5H 1CCZA 5F7MC 3OJ2C 1AJ7L 5KOVC 1RHHA 4WGWB 4WTZG 3IU3B 4O51B 2RAMA 3TBWA 4JPIB 2A77L 2BSRB 4JANB 3T1FB 2ZPKL 5FV1L 5E8DH 3HB3C 3U9PL 5IMLA 2QQLH 5EUKA 4X6EA 1LILA 1MFNA 4W6WB 5DJ0A 4HWEL 4XP5H 2OP4H 3FFCE 1I7RB 1NFIB 4HG4J 1UB6A 2J8UB 5I1KH 4HUWA 5D5ME 1SMOA 4PJXE 1O0VA 3O6FA 5I18H 2H45A 2UY6A 3PQYE 2X4QA 4HAFA 3MV7A 4PJFF 5FCUL 3LPWA 5DRNA 3VDAA 3WJLC 1BAFH 3G5ZB 3VD3A 3QJHA 1T1XB 1U91B 3BW9B 4LF3A 5IEHB 2GTWA 4OT1H 3QULB 1P1ZB 1DE4A 4ODBD 3QI9C 1ZGLB 1LP9A 2W60A 3HE6D 1I3RA 3DO7A 1FZJB 2BY2A 3BUTA 3ECBA 3RWIA 5IJKA 4PJ8A 1NUNB 2O5XL 4WWKD 2X2YA 2LAAA 1JHLH 4GMTL 4Q0XL 4X98A 3STLB 5FM8A 3QWQB 3UO1L 5JXEA 1CGXA 1BIIB 5KVGH 4P46A 4FMFA 2CKNA 4XP9L 4N0YH 4NJAH 3GO1H 4WEBH 4JFDE 5DK2A 1XZ0A 1H0DA 3W0WB 3QDJD 1G9MC 3EAKA 3RRQA 5FUCC 3LQAL 3SKJH 4D8PB 3UBXA 4IRJB 3AFLA 3P40A 3MOAH 4HUXA 4KGJA 3WMSA 4XMPH 1A7QH 1UXSB 5FKPA 2R0KL 4M5YL 1X7QB 1KUMA 2DBJA 1UJ3B 4JFYA 4OFYA 3U6RA 3T0DA 1QFUL 1C1EH 2IAMD 3PQYD 5AZ2L 4MQSB 4HQQL 3NN8A 3LH2L 2X42A 1RJYB 2NTFA 4PJEA 4Z0XB 3IDUA 3RNQA 1YN6A 1RZJC 5IESL 1FJ1B 3JV5A 5JO5B 2FX8H 3DETD 1QSEA 5ADOL 4OFKA 3P0VH 4LSVL 4JKPL 2R2HA 2R29H 2YR3A 4MA1B 1JRHI 5DRXA 5DLML 4IBLT 2R23B 1JNJA 4FQIL 1X4YA 4PRDB 2BVEA 4QXTB 4X5WA 1E4JA 5C0CA 1J18A 2AK4B 3PDOB 1SJEB 4HS6B 4JDTH 2XTJD 1I85A 4GH7B 5DRZB 4S1QL 3C5SB 3I2CH 1QLEL 1B6DA 4TNVF 5D1XC 5F9OH 1D5XB 4HLJA 1INDH 1CXKA 1WFTA 3L6FA 5DA0B 4GG6B 1C5BL 3SE9L 4Z95L 3RUGA 2FEEI 4P2YA 3OWEA 4F7TB 4UNTA 1P2CB 5F7WC 2ICEA 3FQNA 1VHPA 1T80A 2G60H 1LDPL 1UC6A 4G7YH 4L4VD 2E9WA 2DF3A 4MA8H 1IKNA 1CDCA 3W9DA 3EDKA 4C54A 4L29B 1NMBL 4WUUB 2AEWA 5CP3A 3DRQB 1TITA 3BI9X 2HMID 3EFFA 3QCUH 5E99H 5HYSA 1D9KD 1P4BH 2Z93B 3LY6A 1ACZA 5DT1H 4G6JL 1IBGL 4LGRB 4V2BA 4ZG1A 4X6FA 5F1NB 4K9EC 3HZVB 1SM3H 4U49A 4DKDC 1L0XA 3H8NA 2Y1VA 4MSWA 4OUUA 5DVNA 3UPRA 4Z7WA 4NIKB 3HN3A 1T22A 1J5OH 4M6MH 3SKNA 5EZJB 5EO0B 4GKSB 4F15C 4HEME 5CWSB 4ODSL 4JM2A 3DGGB 5I1DA 2BY3A 4NP4H 5DTFB 2V2TA 1LO3L 4JVPA 1IKFH 2A74A 4HIHB 3RL2A 4JJHA 3O3BB 3IDXL 5L7XH 4J23A 3MRNA 4H1LG 2IFFH 4TULH 3U46A 1OD9A 2V5RA 2FX7H 4OKVA 4OIAA 2E6JA 1DQTA 2AQ3A 2UWEF 1U8OA 4JZNA 3ARGC 3D9AL 5ISZB 3NCYS 3MRLB 1N5AB 1KULA 1M7DB 2OSLB 5CMAB 5IBTL 4Y4KC 4LGPB 2NXZC 3TC9A 3IDMA 3UROR 2ATKB 3N50A 2ITDA 4YDJB 1KENH 7FABH 2LVEA 4D9LH 4CADB 2NY3B 3MJ9L 4R0LC 5AZEL 3MLYL 1TCRB 5GS1C 3BP6A 4KROB 3DVFA 1QRNA 4EKXA 1EXUA 4XNXH 1BD2E 2GHWB 4MCZA 1XF4A 1ZT4A 2H9GA 2E3VA 3HR6A 4EN3D 1JZ2A 2JKXA 5IB4B 4OZFA 5IW1A 5B8CA 4TSCH 1JTPA 4QCIB 3UTSE 1DQDH 3LN5A 4WEUD 3OKOA 3RWCA 2P24B 4AJ0A 2XA3A 5F7KC 5BS0B 3H9SE 3Q6FA 5T1DL 1LQVA 1MF2H 2DKSA 3RDTA 2P8LB 3MODH 2BMKB 1MSPA 1UVQB 1RVFH 3SGJC 3WXVH 2UWEB 3W2DH 2DB8A 5C09E 3ZL4L 4ZYKB 5D7LB 3G5YA 1PFCA 3ULUF 3GM8A 3JUYA 5DYOA 3QQ9C 1HK6A 1HI6B 1MY5A 2E8YA 1CFVH 2I5YH 4QRPE 3QQ4A 4MLSA 4ZD3H 2QSQA 4UDUA 3C5ZA 4X99B 3MXWH 2X4NA 2YC1A 4PY7A 3DNKA 2GITB 3TNNA 4KZEH 4X0KA 4XH2B 3O2VL 1RFDH 3T0EE 4U2YA 4UT6L 1Z0NA 1IGFL 4XAWH 1S5HA 4MJ4A 5HYJA 1BD2D 4P2OA 3TIEB 1WAAA 3E3QE 3MUZ1 4PUBL 3QEGL 5EBWB 5ENWB 4YHNB 3UTSD 1VDGA 5C6WH 1CT8B 3WFBL 2Y4SA 1T83C 5HHNB 2V6HA 1HHIA 4JQXC 1FZOA 3NPSC 5EIQA 1B2WL 1XGUB 3H9SD 1NC2A 3E6HB 1F5WA 4V3DB 4KAQL 3EYFB 3DOSA 3KLSA 2LU3A 4KQ3H 3X11B 4M3JA 4ONGH 4XCCH 3PIQB 4GAGL 4XP6L 1MOEA 2LAGB 1MRDH 1EAPA 3FMGL 3O6KL 3B8SA 3CFCL 5DJDA 4G8GE 5IKCA 3AAZA 1OAKL 1AHWB 2O93L 4JB9L 1DLHB 3GMQB 4Y19B 1E4WH 5SWSA 4YHML 5DJAA 1KPRB 2A6JB 4HWZB 4XB8A 4M02A 3LKPA 2APWA 4QRPD 5GGVL 5FCSH 4JO1H 1RULL 4FQQB 2A9NH 2LTQB 5IB5A 1XF5B 1JL8A 1U8PB 3HAEG 4PBVC 4FQ2L 4XT1C 3BKCL 4X4MA 3IT8D 5DR5L 1M7IA 5FYKE 3RL1A 1K6QH 4RBPH 1S8DA 5IFAL 1NJ9A 4A2LA 1D5MB 1J8KA 2BVPB 3UTTD 2CLZA 4K7FB 4GJTB 4EOWH 5GS0C 5KTEL 1IMHC 1CLYL 1ZHKB 4IS6A 1SEQL 3S35L 1XH3B 2CUIA 3L3IA 5J1TC 4OF7A 1WWCA 2VXSL 2JIXA 3TV3H 4NRYA 3ARFC 1NC4B 2HWZH 1AD0A 4HHAA 4HS3B 4OLZH 4B7IA 3EOTH 2OZ4A 1LO0L 4CL7A 3SY0A 3OHXB 4BSWA 3WDHA 4FQHA 3T4YA 2QQKL 2YPVL 3B8YA 3MRHA 5HYQB 5DK0B 4AZ8A 5D7SH 3BDBA 2GK0A 1ZHBA 2PO6B 3RX8A 3SKMB 3HUJB 2ARWA 4XPAH 2VNCA 4GRWF 2R0WL 3BD3A 4JHAL 1KCVL 3MLSL 5D2NC 4RFNC 3B43A 4K94C 2VITA 5F89B 5FYKD 5K9QG 4JZJB 3D85B 3SDCC 1U6AL 2A9MH 4X7CC 2LU4A 2V17L 1A6PA 3MRRA 5I2IA 1LEKA 2CK0L 2IJ0C 4MJIA 5T5FL 2DICA 5JHDE 2MQ0A 4RZCB 4Y4HA 2DQHL 5IGXH 4R26L 4FFWC 5C8JB 3ELAT 4WJ5A 3B9KA 4RAHA 5CBAB 1GGYA 2PKDA 2ZKHH 1D6VL 3BWAA 5IVOA 2DQFA 3GB7A 25C8L 5SWZA 3GIVB 3MLXH 2WWMD 4MWFA 5ACLA 5IFHH 5FOJA 1TTUA 4Z7UA 1BBJA 1BZQK 1BF8A 1NL0L 3SGDH 2D4DA 3J7HA 3NPZB 1LE5A 2PW2B 4UOW0 5GSVA 3VD4A 4TRPL 5GGSB 4C56B 2ADGB 2K7PA 3O3DA 1KLGB 3K0WA 1MFCL 4NC1C 3D3VA 1JGEA 4R7DA 4HGWA 4EI6B 5D71H 1MRFH 5J4MA 3FQRA 1QO3B 3SDXA 1BQLL 1MJJB 3LN4B 4F9PC 5FYJH 3IFPA 4ZS6C 4L3CB 1QFWL 5DURD 1CTOA 1UWXH 4IHOA 4QYOA 3QP3A 4M4PA 1PLGH 1JWSA 3UTPE 3PGDA 1V3JA 4LBEA 4P2QE 2NY0D 1WZ1H 5DJZB 4G59A 2X44D 2F5AL 1HSBB 3OSKA 5JHDD 3OBAA 4PRAB 3VRJB 4MJIE 1YZZA 1NBVH 2FIRT 5TE6H 4X6DA 4X4XB 4NOBA 1U3HA 3MO1B 4FZEL 1KEMH 3PABA 4MVBC 4WV1C 3ZE2E 5CP7A 3V8OA 4OFVA 2E9JA 4JAMA 5F1IB 1SBBA 2HH0H 3IS1X 3G5VB 2EEDA 1K8DB 3WLBA 1A7PL 1I75A 2QADB 5E9DA 3OPZL 4LVOB 4QWWC 4H1LH 1VPOL 5EG6C 1TVDA 4UILL 4XPGL 3ARZA 3GSRA 3WFEH 1AGFA 5HHMA 2C1PA 2DBLH 3AB0C 3IFNH 3U7AA 5FUZH 1CDUA 3A6OA 1D5ZA 3QFDA 2A73A 2R9HD 15C8H 1YEFL 3SO3B 4HF5L 2YXMA 3UTPD 4NYLA 1TVHB 2XWTA 1IGYB 3H0TA 4P2QD 4JRXB 4JRYA 2KPNA 2EZ0C 3OB0K 4M6AA 1GPOH 3WIIH 1A2YA 1PAMA 3LHPH 4BFGA 5HJ3A 2K7QA 5K93A 1H5BA 1NFDB 2MMXA 5E8DL 3UX9B 2P5EA 5FUOH 2QQLL 1INQA 2FL5B 3IDGB 5T3XL 3QUXD 2DQCH 2ZSWA 3QRGH 1OP5H 2Q86B 2Q8BH 4XP5L 5KJRH 2OP4L 1GZPA 3TEUA 3DBXA 1RI8A 1J86A 4I0CC 2WQ8A 4BH8A 4H20H 4WI4A 4DEPC 2NW3B 3EYVB 2FJHB 5HHQB 4FQJL 3ROOA 2WBJA 4QF1B 2OI9C 3UJTH 5I18L 2C3HA 3DV4A 5BVJB 2CR6A 4DUXA 3S88L 1BAFL 2FHCA 5I9QB 5TDNA 1A14H 5E1AA 3WSQL 4QRQB 3KPRA 3C8KA 4JO3H 4OT1L 4POZD 3GJFH 3A0OA 4B0MM 2VL5A 1JWUB 4JN2B 2NY2D 4QTHB 4RDQF 4LL9A 5JUEL 3IDNA 5EU3A 5HHME 1SJXA 3B5GA 5FGSA 3WNPA 1RJCA 2QL1A 2XFXB 3VFSA 3CJJA 1NSNH 1RIVH 2CUHA 5KVGL 4Z5RB 4IOIA 1XIWA 2OTUA 4U1HA 4OZHF 4N0YL 4GMSL 4RGNB 3GO1L 4QLRA 1CICB 2W0PA 4NM8H 1LO5B 2VERN 5ITBL 3B3IA 1B3JA 3GIZH 4EUPA 1T0MA 1F3JB 5KW9H 1UG9A 1KYOJ 3SKJL 4R9HA 3TVMD 2YWZA 1FVCB 3QDME 4U6XA 3MOAL 5I76A 1A7QL 4GRLC 4OAWA 3IDYC 4IOSD 4IRSA 4NO3B 5JNYB 4QNPE 3AC0A 2XIDA 4UU9B 2R1YA 4MCYB 3W82A 5F3BA 1WCQA 2X10A 4JQVC 1B0RB 4TPRH 4ERSH 2APVA 3ARWA 4K07A 2XPGA 1VFAA 3HHRB 4PJ9A 3QRFM 2FX8L 3CXHJ 4LP4A 4MNGA 4P23C 3P0VL 3RHWK 3SQBA 2R29L 3LKQA 5ITFB 5EC2B 4PTTB 3VE0A 3IU4H 1DBBH 3RU8H 4EVNA 3U83A 4NT6A 3RA7H 1U95A 4JDTL 4WFFE 1G7LA 4NQSB 3JTSB 2VQ1A 3I2CL 3QPQC 4JZOA 2AEQH 1F42A 1OAYH 2FLRT 5F9OL 5GHWL 1F90H 2NX5A 1N4XH 3MRFB 5JW4Q 5DA4A 4MQXD 1FGNH 1KBGH 1F4XH 1TZIB 3O6FC 4Y4FA 4PV9B 4LCCA 4ALAH 1R0AH 2Q87A 2F19H 1YUHA 1BVZA 1YMME 1QNZH 1YN7A 5IMMB 2G60L 4U1JA 1ZVSA 5FAAA 3GJFB 5I16A 5EU7C 4F7CB 4G7YL 3D0LA 4GBXD 5DJ8A 3F62A 1AP2A 1C12A 2BNQE 3HI1A 5CJXC 4MA8L 5CILL 4PYGA 3ZE1F 1YY8B 1FLRH 5F1OB 3FOLB 1CF8H 3E8UH 2G5BB 4ZTOL 2BC4A 3QCUL 5BVPH 3VXOA 1OAXH 5E99L 4K2UL 5A3IC 1P4BL 2WINA 5JXEC 2BSTB 4HKXB 4ELME 1S9XA 3O2DA 3PP3H 4P4KD 3AREB 3ZDYE 3P77B 1WBZB 1FNEB 2I9LB 4P46C 5KSAC 4H8WH 3LS4L 1H3UA 4NQDE 3RX5A 2DQEH 4HJ0C 1HKLH 4I18B 1SM3L 5CLTA 4YHPB 5I75B 1OAUH 3KXFA 1QA9B 1DVFA 4WFFD 2GUOB 4ESKA 1BEYH 5ESAA 3TCLA 1CFTB 5F72S 2HLAB 3BKYL 3BXNB 1J5OL 4UTBH 4M6ML 3RZCA 1JGDA 4XVUD 4MDJB 2VISB 2LVCA 1ITCA 1IM9D 2Z35B 2IBZX 2GEEA 3CMOH 2P42B 5GGRY 5KVEH 3BRGC 1EMTL 2ZUYA 4NP4L 5J1AB 4NKMB 1YMMD 4XBEH 2W65A 4JY4B 2Q76B 2GI7A 2HTLD 1J10A 4NSKA 1KLFA 4FS0A 4PRHA 2ARJQ 3RBGA 3UBXI 3GMMB 5L7XL 2IFFL 4N68A 3OKDB 2ZCLH 2DRUA 1A6TB 3HR5A 3WV0A 2FX7L 3VXRA 5MHSE 4TUJA 3LEXB 1X5HA 4ZUTA 3LCYA 1QP1A 2CMRL 5J3HC 3RI5K 4FRWA 1UH2A 2EDHA 3ULUL 4GKOA 4QT5B 3OTTA 2F53D 3T65A 3W11D 3TO2A 4CVUA 1CU4H 2NY6D 3IJHB 4XPFL 3HCVB 1PJ9A 3X17A 4NFDA 4IOFD 2GY7B 4FFVD 2GJ6E 4GW5A 4WI3A 5MEOA 3RPIB 4L9LA 3FRUB 2NY5H 5GPRA 4NPYA 5FDWA 1PYWA 3T4AB 5DD3H 1MCLA 3PL6B 5F97E 4NNYB 3QIUD 5IVXE 4HKBA 4HKJA 1DBAH 5D1ZA 1U8NB 2VLKB 1FORH 5BQ7B 3BESR 4MS8D 1WEJH 1P7QD 5TJWK 1NUFA 1X4ZA 1U92A 1DQDL 2D9QB 4S1DD 4GO6B 4NQXA 1S7UA 5DEZA 4PFEA 2NY1B 4U1IB 1MF2L 1IKNC 3MODL 2XACC 1RVFL 3U82B 3DURA 3F7VB 3TBYA 1Q0XH 2EXYC 1DUYB 1IM3B 3MRPB 2AXFA 5IR1A 4BK5A 1Y6KR 5MHSD 4Q6IC 5CD5C 1X5YA 4MJ6B 2HT2D 2HKFL 1CFVL 2I5YL 4O2CA 4ZD3L 2EE6A 5CZVH 3FZUD 3MXWL 3UTZA 1DQMH 2HT3C 4KVCH 4KZEL 2I07A 1VFUA 4UZGA 2X6MA 3LD8C 1RFDL 3GFUA 3LKSA 4Y16B 3ZYOA 1NUGA 3MRCA 3RTQA 3S35X 4XAWL 2EH7H 3RIAF 3HZYA 3BRFA 3ZYJA 3PV6B 4BQ8A 5ANMA 4JM2C 4Y5VB 3QIBB 3CFDB 8FABB 1A6ZB 3V6FA 3QA3B 1EO7A 3NFNA 3FQXB 3CFKB 4G42B 5TDPB 4O5LH 4JQIH 5D7JB 2YD7A 3GSOA 2XZCL 4LLVA 4KQ3L 4ONGL 5T3ZH 2WZPD 4XCCL 1NKOA 2EKSB 3DXAD 5IT2H 1MRDL 4R97B 5IEHA 1T7XA 2YA1A 2NW2B 1BGXL 4DVRH 1ZGLA 2IH1A 4JR9H 4NWTH 4M03A 2FO4A 3LSOA 4Y7MA 2OR7A 1RZKH 1T20A 4G80B 4TSAH 4OCYH 4KDWA 4LCWD 4U6YA 4JO1L 1ZLVK 2IPKA 5E6IB 5C3TA 1MCEA 1WWWX 2A9NL 1YNKH 4GRMB 2PYEA 3DV6B 4NKDA 5FM5O 2ORBH 3PGCA 5IJVB 3OGCA 4JFOA 5KG9B 3JV4A 4K71C 3A6BL 1IC1A 4M93B 5J12B 3G6JF 1K6QL 5B8CC 1Z9MA 1TZGH 4JDVB 4OLWH 2DWDB 2D7OA 1N64H 2FX9L 3VXUA 1LK3H 1X5JA 1MAJA 3HZKB 3HI6H 2D31B 1MWAB 4EOWL 4PJFA 1KNOA 4I3SH 3NIFF 2J8UE 4JHWH 3HE6A 5BRZA 1AGBA 5BZWB 4B7LA 1NGZB 1ZA6A 4ZTPH 3TV3L 3ZKMC 4BSVA 2C4FT 2J88L 4A6YB 2AQ2A 5BOZG 4ZOEA 3PWLA 3C5ZC 5F7HA 4YBQD 3OAZK 1B9ZA 1NCTA 2WWKT 5D7SL 3TA3B 3QDJA 3G6JB 4KQ4H 2XN9B 4U1LA 1S7VB 4M43L 4YQXH 4XPAL 2AK4A 5DO2C 3RGVD 3B2UD 4LVHB 4JFFB 1OW0A 1DTUA 4P2OC 3ZKXB 1T5XB 2EKJA 4MDIB 3MPCA 1KCGC 3U0TB 1W8NA 4HUMB 1D5XA 5DC0A 1UACH 3SPVA 1C7SA 2A9ML 3L3GB 1MEXH 1KJMB 2YBRA 1MI5A 3W0WE 3EOAA 3WKMH 2H1PH 5IGXL 2BSSA 4HK3N 4NDMB 1AIFB 3PHQA 2X4UB 3FO2B 4YXLL 5E4IA 1OOAA 1HHKB 1I9IH 4G6AC 4OLUH 2B5IC 3BH8A 2YEZA 1QTYT 5E00A 3EFDL 4WFHE 4CN4A 4FP8H 3MLXL 5IFHL 4MD4B 5EO1A 2IADB 2HFFA 1WQVT 1EEZB 5AYQA 3FO1A 4HWBA 1E28B 3QQ3B 3TT1H 4NN7C 3C60A 5CZXC 4IIQC 3VD9A 5D71L 1MRFL 4HMDA 4YFLF 2ED8A 1F58L 2OM5A 3P4LA 3QUYB 1NAMA 5FYJL 4EI5A 3LEVL 2J4WH 3QZWB 2D9CA 5T3XE 2H2SD 3C6LA 2AK4E 2RJMA 4HWUA 1EEQA 1JPFA 5E6ZA 2COQA 4BH7A 4HH9B 4L4VA 3GKWH 1F8TL 2VXUL 3GHBH 5CJOH 5ICZA 2A38A 3V5KA 1Q1JH 5FF6B 3W0WD 3VU2A 4YIQB 3KYMB 4GG6E 4IRJD 5C0JB 1N26A 1JUFA 3REWB 5TE6L 1LE9A 3L3DA 3HRZA 4PGEA 1JRHH 2VRAA 3TNMB 4APQC 1KEML 5DMJB 4WFHD 3L95A 1I1AB 1OSPH 5IB1B 1CZ8H 3SDAD 4Z78A 3PWJB 1RZJH 2KL6A 2KUTA 4NC0B 2P44B 4LHUB 3LKRA 4WUUE 2VDMH 3MR9A 1T4KB 1S9VA 4KKAD 1HHJB 2ATKA 3VI4E 4ENEC 1B4JH 1A3LL 4PJAA 3IFLH 2VQUA 1MCDA 5E8EA 5EBGA 4JCMA 3QUKB 2AJZB 5TF1L 4CADA 3P9MA 1FNHA 3WFEL 1T66C 1T6WA 1W72A 1QQDA 4FXKA 3MLVH 1TCRA 2ZOLA 3VD7A 3IFNL 4F33B 3D87B 3FFDA 1J11A 4FG6C 5FV2A 1CGTA 3GI9L 4WW2B 2UV3A 3KJ6H 4KK5C 4AENA 3VXMA 5F7YC 5I74C 2QQQA 15C8L 5CEXB 4PRIB 1PD6A 4Y4HC 1F11B 1FDLH 3VWKC 1R3HA 4N90E 2OXHA 2EYRA 4J4PD 3MCKA 3WIIL 1I8IA 4XPTH 4B41A 2WP3T 5FUOL 2UWEA 4MJ5B 5CJ8A 4DGIH 4NQEA 4KJPC 3DYPA 3QI9B 2XWJA 2DQCL 1JGLH 1OTSC 3BKJH 1OP3H 4Q74A 3MNZA 3NFPA 2X4RB 1OGAD 4GT7A 4H20L 5H35A 2X9WA 4YUEH 1CIDA 4PJDF 3V52H 5CKAA 2V7NB 5EZOH 5EUOB 2H2PD 4RA0C 1YEKH 4OF6A 5ISZE 2CKBA 2IQAA 1E4KA 4EN3A 5FGRA 1QHPA 3KPMB 4KDVA 4XH2A 4Y5YA 3BHBB 4Y1AD 4GAYA 3WS3B 1JNHB 4JO3L 4P9HC 3VRIA 1FNSH 5GZOC 3T3ME 2VLJB 1KB5A 3FONB 5EC1A 3MCLH 3RGHA 3RWEA 4H26B 3HNTH 3ZKQD 3DX9B 1PG7H 4J12A 1RIVL 1CT8A 4XXCA 1RMFH 5HHNA 3ZHLA 2HRLA 4N90D 3GMPA 2DQJL 2IPUK 2LQRA 4KI5E 5EOTA 5BS0E 1PSKH 3GIZL 4M61B 3MRMA 3MV8D 4X5XA 3O2WL 5KW9L 1QPPA 1U8KB 3LDBB 4OCXL 5HYFA 1DEEA 4ZFOB 2UWEE 5SX5K 2P46B 4KRMB 4OI8A 4S11A 1DLHA 5D7LE 3VXSB 4GS7C 1Y18A 1JGUH 3GM0A 2UY7A 3NIDF 3N1GC 1V3MA 1ND0B 3DUHA 1DQQB 5ISZD 1JYVA 5TF0A 5FA3B 2DLIA 4L4TB 3TFKD 4TPRL 2A6IB 4IMKC 1U8PA 3DMMD 4N5UA 4MLIA 3V5HA 1S7TA 4ERSL 4DVBB 3VFGH 4JJ5A 4JY6A 1MQKL 4MXQA 2I24N 1A1NB 1BZ7B 2DWEB 2KQNA 4ZS7H 5B38B 2NY3D 2Y6SC 5GISH 4FFEX 4H0IA 2Y23A 2JB6B 1X4XA 5DQJA 4AK1A 2SEBA 1KLUA 3IU4L 5D2LF 1DBBL 3RU8L 5E94A 1E6OH 3VMNA 2YRPA 2H3NB 2WK2A 5GZND 5HDQH 5ACZB 4ZPVB 1LQSR 4P2RB 3RA7L 1EFXA 4KHTH 4X9GA 1WJ3A 4N8VA 1S78C 5H37G 5KVFH 2VLRB 1OAYL 4KI5D 4PJGA 2NY4B 1BZ9A 4MD0A 1F90L 5DC4B 4JG0H 1N4XL 5C1MB 4U0QB 2ZCKH 43C9B 3ULUE 3MROA 1P5UA 1F4XL 3EZJB 4F2MB 1W0YT 1AGEB 2J6EA 3FQTB 4LK4A 4QXUH 4ALAL 2P8MB 1R0AL 1RZIA 2F19L 4KJQC 3S36X 1QNZL 3HC0B 5D7LD 2OBGA 1JTOA 4KK9C 1JI1A 1SY6H 3MUGB 4N0CD 4Y19E 5HI5C 3IAGC 1B0WA 4U1SB 1GGBH 1QLFA 3DIFA 3EDDA 3MMEA 3UTTA 1QRKA 1EJOH 1S7WA 4HBCH 3S4SA 1FLRL 3N1PC 1CF8L 3E8UL 4GFTB 1JTTA 4RQQB 4CMMB 2XG4A 1OAXL 5BVPL 3BIAX 4FQXA 4L3EB 4JZJA 1LMKA 3FT4B 4N8CH 3OF6A 3O4LB 3R0MA 2VSDA 5I15H 3WNOA 1R3IL 5MEND 3QUZA 5DSCA 3RWHA 4HGKC 3P11H 4N0FB 1N3NA 3VCLB 2DQEL 1KCRH 3WL9B 1A7OH 2EE9A 4OM1H 4PP2B 1HKLL 1T0NA 1CFQB 3VXTB 5C8JA 5KN5A 5D1QA 1C7TA 1I7ZA 4RRPG 3THMH 2BVTA 1ZT7B 2HVKA 5DEGA 3QO0A 4UTBL 1OF2A 3ARGB 2Z31A 1B88A 4JVWA 5ID1A 2QSVA 3CMOL 3JTTA 1VFOA 5KVEL 1I8MB 1FG2B 1ZLSH 4GSDH 5HPMA 2EXWD 4Z7VA 3MSPA 3D39B 4XBEL 2EE2A 4V1DA 1RUKH 3ARBA 3B6SB 1F13A 1NGXB 4I2XB 2ITCA 3D25A 3H2WA 3RWFB 5GS1B 3MJ8A 1T04A 4N9OB 3TT3H 5AG8A 1RJZB 1C16B 4KV5F 3L7FA 1FZMA 2R4SH 5HVHC 4N5EC 1YEIL 2BCKA 2Z92B 3CSYA 5C0FA 5FGBA 2W1NA 5INDB 2JJVA 1PEZA 2XTLA 4P57B 2AAVA 3HUJE 2PXYD 12E8H 2E6PA 5JZ7D 4KKCD 2BOCA 3NA9H 2IFGA 4PY8I 2R4RH 3FT3B 2E9BA 3LPFA 3TYFB 3GSVB 4PRAA 4QY8A 2NY5L 3O9WB 5MEQB 4NCDA 4PJIB 4R4ND 3FTGB 5ELIA 2AV1A 3OV6A 3FT2B 1CFNA 4HJJH 1DBAL 4PJBA 1FORL 1CE1H 3U9UB 1WEJL 3DUSB 1IAKB 2Y06L 3G6DH 4WNQA 3STBA 1VACB 4X9FA 3V6OA 2APTA 3GSWA 5D6DA 3RIFK 1EHNA 5LGHH 4TNVK 4AT6A 2B4CH 2O5ZH 1PBYA 4Y8AA 2VDNH 2OS7A 2NCMA 4E42B 5C9JB 1I8LA 4O4YH 2Q7YA 3VRLE 4MD5B 4Z6AT 2HN7A 4C56E 3ESVF 4G5ZH 4NKOA 3MA7A 3RFZC 5FECB 4UV7H 2VZ1A 3F12B 1R5WB 4JG1H 4IJ3C 4PRNB 2PO6D 1GGIH 2R1WB 2ZOKB 3MREA 5I0ZA 1U8HA 2DLHA 3AROA 2DD8H 3SDDA 4LSSH 4DZ8B 5CZVL 4YR6A 5GGTA 3NPSB 4LRNH 1DQML 1DUZB 3KPQB 4KVCL 1X5GA 4I48B 4P5TC 1DVFC 4XTRD 4A6YL 3V0VB 5GQBA 3D85D 5AUMB 3L5HA 3U36B 3RZCC 5J0BA 4HUNB 1S9YB 3V5DB 4DJMA 2ARJA 2EH7L 1S9WB 4JREC 2MSPA 4MQ7A 2DYPA 1JK8A 5EULV 2AJXH 2VLLA 3VGGA 5B39B 3T0BA 4OV5A 1KCUH 4OCWL 1KJVB 3PE9A 3TBSB 3ARUA 5EDXA 1YY9C 4PR5B 5CKGA 4JQIL 1U8IA 4ZAKB 1M05A 3WIHA 4U7SA 2VQTA 3TWCH 3DTXB 5T3ZL 3WFDL 3LOWA 5A2LH 4QRQA 2AGJL 1HE7A 2DQTL 4QRTB 4XMKL 1FZKA 1SQ2N 1NUDA 3C8HA 4DVRL 3KWWB 3D48R 4WUKH 3UTQA 1HIMH 5DJ2A 4TSAL 4CVXB 4OCYL 5JW3H 4GLRI 1SYSA 3DSNA 1H3XA 1C5DB 1DBKH 3KYNB 4UB0L 2HT4C 4PLKC 2ORBL 4Z5RA 1U8QB 4EXKA 5D1ZC 1NCNA 4JRXE 4BJLA 1TDQA 3ARFB 4FQCH 1A9EB 2RQ8A 3ILPA 4OLWL 2FRGP 5CBEA 1HHHB 4HFWB 2V9RA 1NFDE 4PG9A 2KKQA 1LK3L 1FL6B 3QIWC 3PUCA 4H25B 5F88B 1N59B 3HI6L 3VGFA 1CFSA 3ULVH 5D6CA 3RKDD 4I3SL 5D9SA 5EU4B 2F15A 3JVGC 5I6XC 4FXLA 2O26U 4JHWL 3O4OC 4PGDA 5D2NB 1XGQB 4RFNB 5IMKB 1VEOA 3OMZA 4ZTPL 1U36A 3H3KA 5DRWB 1ORSB 5FYJE 3FAXA 2GSIA 4CUCA 3RVXC 1VFBB 5GRVL 4P0DA 1FNAA 5BJTA 4LEOB 3WUWB 4U4BA 1ZWIB 2QADD 3SDCB 1R24A 2PYFB 5KS9B 1A21A 5JOPD 1UQSA 1KPVA 4NGHH 3UPAA 4LCYB 1KIQB 1Z5LA 4HCRA 4HPOL 4I9WE 2FDBP 4OZHA 4PTTA 3OXSA 1RY7B 4OQTA 3W39A 1OLLA 3MFFB 1HWHB 4BKLA 2BNUA 3RTQC 4KQ4L 4YQXL 5D7IA 3P4MA 2X4SA 1QBMH 2HJKB 5TDOB 4XCEA 3I3DA 1H3GA 3S96A 2VXQH 1UACL 4HV8A 2FHBA 4ZOCA 4RGNE 4XB7A 4XBPB 5B4MD 2FBOJ 3FQWA 4ZNEA 3PWNB 3C5JA 3FB6B 3MBEA 5F7EH 3EDFA 2FYYB 1T21B 4K8RH 3ZMRA 1IZJA 3WKML 1J8HD 1OD7A 2RR3A 4OFIA 4MX7A 2PCPA 4DCQA 5J9PA 3MJ6A 3WD5H 3OKKA 4OLUL 3QH3A 2NZ9D 3UEZA 5I1AA 1AGCA 2CDEB 1TMCB 1DQJB 1F97A 4FP8L 5FYJD 3BMVA 2O5YH 3VG9C 1QVOA 3HZMB 1ONQA 4FZ8L 1CYGA 1JYXA 4JPVH 1AFVH 4L8SC 4EBQH 4P9ML 4JM4H 3OXRA 4I9WD 4LEXH 4PJ7F 4PRPB 3TT1L 5CEYA 3LPGA 1U42A 1J7VR 4PP1D 1TXKA 3MQIA 1UZ6E 4L1HA 4DGVH 2GUOA 2J4WL 2BZDA 2G2RB 4U1KA 1U93B 1EJ6A 1CFTA 5K9OB 2VDQH 2GAZB 4GBXA 1A1OB 5C0IA 3GKWL 3R06A 4POUB 2NNAB 3GHBL 4WI7A 1FRGH 2GSGB 2APBA 1Q1JL 4QO1A 3HE6C 4B5EA 4DZBA 3X14A 1FL5A 3CUPB 1AXTH 3MGOB 1R5IA 3IDJB 4WWKC 5DXWA 1L7TH 2FHFA 4YAQB 1FFPA 2J7LA 5DHVH 1JRHL 3GMMA 3AB0B 1KSRA 5T1KB 2EDTA 5FO8B 1FFOB 1DDHA 3VFMA 3DX6B 4PJ7B 3L3KB 1MCKA 1RZJL 5IG7B 3F6LA 4HXBH 3ZZ1A 4WHCA 1RAMA 3TBVB 3ZLQC 1B4JL 3HCVA 5C0BD 4ZFOL 1AC6A 43CAB 3IFLL 4M3KB 5E5MA 4HJGB 1JFQH 1G1YA 3IGAB 2FEEL 4YHIB 3MLVL 4ZXBB 3U7YH 3IKCA 4DUWA 3S5LB 4NZTL 3EW3B 2IAMC 2H8PA 3PL6A 4Z7QE 3KJ6L 1WGOA 2C26A 1CK0H 4KVNL 2P7TB 3EYSH 3LQMA 2V5SA 4BFIB 1FDLL 5EBMA 3DRTA 4TSBH 3DETC 3S3SA 2OI9B 1IQWH 3CK0H 1KN4H 4RMTA 1MCSA 5EZLB 3RVVD 5JIPA 5DF0A 2FECL 4MB4A 5E1HB 2Z91A 1MVFA 4PV8B 2C1OA 3OAUH 3ZDXF 4XC3H 3D69A 3VWJB 3LN9A 5C6PB 2F53A 3QSKB 4DGIL 1T1ZA 3BP4B 3F7VA 1Q9WB 3ZSSA 2ZSVA 2BK8A 3BO8B 3I9GL 2FWOA 2XTJC 3MRGB 5IIEB 1RHFA 5ESVB 2VZSA 4EDWH 3EOYG 5FM4A 2E5EA 5EZOL 2VIRB 3G6AA 3VFWA 1H8SA 2E7LE 4I5BB 2FJFB 4TUOA 2GIYA 3VFVA 3GJEB 3P0YH 3MYZA 1JNLH 5C07A 1W8OA 2HJFA 4WFGE 1UM6H 1RUAH 5HSFA 4JFXB 1U8JB 2ZWLT 3B2VL 2F54B 1I7TA 4NZDA 3MCLL 1HXMA 4WENB 2X4OA 3HNTL 1F4HA 4GAFB 3I85A 1PG7L 3QA3A 1OSZA 5C0RH 5DHVB 2HMIC 1DLFH 5MI0C 3ME0A 1XGPA 2VLKE 1RMFL 2UYLB 3CFKA 1D9KC 3IDIB 5IK3A 3DVIA 3SKOB 4Q97A 4YGVA 3OR7B 1D5BB 1MHHB 3NCFB 4FTVA 4PJCF 3VH8G 3NMEA 4R4FH 1DBJH 1PSKL 2YZ1A 5F7DA 4KZDH 4QTIL 4CVZB 1H3WM 1YDPB 2ESVB 4MA3A 5DVMA 1LP9F 3BH9A 4OLYH 1DBMH 2CSPA 2ZUUA 3I50H 1TVBA 1RHHB 3OAYK 3HC3H 5C71A 4M1CD 1KN2L 3QPXH 1AD9B 4WHDA 2YD8A 5EPMA 4XX1E 4FA8A 5IMLB 5EUKB 2CRZA 4X6EB 5T1LA 4L8CA 1KTKE 3BP5A 2ZZUT 3RWJA 1ZA3A 5DJ0B 3VFGL 5A2KH 4NO0A 5E0QA 4WFGD 1UB6B 1ADQA 4FMKA 5L2KA 5F6HI 1L6XA 1CQYA 4HUWB 3K8KA 4RSVA 4ZS7L 2V9QA 4K3DH 1AXSA 5GISL 1BWMA 3QAZC 2M1KA 2FD6L 3O6FB 3TO4A 2DWDA 2X4QB 3MV7B 3WIFB 5DRNB 3DXAA 1E6OL 4QHUA 4NQCA 1MWAA 1QYGH 4ZO7A 5EH1A 3AM8A 5HDQL 3QJHB 1P7HL 2VLKD 1U3JA 3EYUH 4LF3B 5KSBF 2GTWB 2R56L 1NMAL 4ODXB 1YQVH 4KHTL 1DE4B 1YEGH 3ZSTA 1LP9B 4P5MB 1RIUH 3AXLA 2W60B 3UP1A 2WUCL 1I3RB 1YEHH 5KVFL 3DO7B 1NGZA 2YUXA 2R69H 3RWIB 4LCWA 1LNUA 4JG0L 4PJ8B 1MLCA 2ADFH 3CLEH 2ZCKL 5CP3H 1XAUA 4X98B 3EYOA 1JWMA 3EO1A 4KUCF 3HNVH 4QXUL 2GCYA 4P46B 3WHE0 4JFZH 4EN3C 2A1WL 2PETA 5EO9A 3RY6C 3W5NA 1SY6L 4D9QE 6FABH 1LD9A 2ERJB 3MFGB 1XZ0B 1SJVA 1CXEA 1H0DB 5JDJA 2OX5A 2CO6B 1MREH 1N0LA 1GGBL 4KJWD 1YECH 4WI9A 3WLWC 1EJOL 4HBCL 3UBXB 1IC7H 1I7UA 4HUXB 2YHGA 3V4PH 3GHEL 5FKPB 4AL8H 1LWRA 4NNPH 4N8CL 4JFYB 3U6RB 2EEBA 4Y16D 4XXCC 3RUGF 4CMHC 4XBGA 2NTFB 4PJEB 4WIQA 1A7OL 4OM1L 2NTSP 3JWOH 4KY1L 3RNQB 1YN6B 1I8KB 3BPCA 3QIBD 4I4WA 4LNRA 4E0RA 1QSEB 1IGJA 2K1MA 3THML 4K3JH 1HHKA 4N1EA 4OLVH 2R2HB 3QWOB 3OB0H 4M00A 3WEXA 5D7JD 5DRXB 3NZHH 2HRPH 4W6XB 4E9LA 1JPTH 3Q5TA 1ZEAH 4X5WB 4GSDL 5EWIL 3EUUA 5C0CB 4ZUSA 4K7PX 5F96H 1P6FA 1OHQA 4OD1H 3VXPA 1ZLUK 1RUKL 4D9QD 1S7SA 5A1AA 1P6AB 3TT3L 2Z8WC 3L6FB 3EZ8A 2R4SL 3FB5A 1IC4L 1YC7A 4YDKH 4XCNA 3RUGB 3G6JE 2XN9E 2OTWA 2ICEB 3TGXA 5C2UB 2WY3A 3FQNB 4KJYA 1LEIA 4JFFE 4OLXH 2VYRE 12E8L 4OZFH 1MCOH 1N6QH 4JM2F 3NA9L 1UA6H 3LS5L 3W9DB 3RZWA 4R3SA 2R4RL 5CSZA 4YIQA 4M1GH 3NIFE 1ZMYA 1K3IA 3EOBA 1BIHA 5T3ZE 3EFFB 1KB9K 1X3DA 4XNZB 3H7LA 1KTLA 5HYSB 5E2WH 1G6VK 1TQCC 2VZ3A 4HJJL 1CE1L 2NXYC 3LZFH 4PBWD 1DSFH 3G6DL 1HCFX 1ZS8A 4M7JL 4F7PA 4XGZA 4X6FB 3ZE0F 2DQGH 5IHUL 3BE1H 4YDIH 5LGHL 4U1MB 1HHJA 4MSWB 4LOUD 4OUUB 3UPRB 3E3QC 4Z7WB 1PZUB 2YPKA 1KEGH 2DKMA 1BQHG 1T22B 1UWGH 4LRIC 3SKNB 1SJHA 3KPNA 4FQXC 5IMOB 2P47B 3D18A 4JG1L 4JM2B 1HNFA 3OJVC 5GRUH 5I1DB 1GGIL 2XN9D 3CFJA 3QUZC 1NEZB 3QDGA 4JLRA 2V2TB 1QSFA 4EUPG 4JFFD 4X7SL 1N7MH 1G7JA 2DD8L 4KK6D 2A74B 1K4CA 3RL2B 3F5WA 4LRNL 3UDWA 3C2AH 1XCQA 3U46B 1Q9KA 4NM4L 4OKVB 4XC1L 3BN3B 3WJLA 4JZNB 3SDAA 1I3GH 1U8OB 2DQUH 2Z31C 3T3PF 3LRHA 5JDSA 5T3ZD 2X9YA 1BJ8A 4X4ZA 2ITDB 1BFOA 5F7LB 3MJ7A 1UWEL 3UPCA 1P53A 1MCPH 3O0RL 1KCUL 4RGMC 1UEYA 1NGQH 5FB8A 4ODTH 5GJSH 5CS7A 3QXTA 5I1EH 2KQMA 1WICA 1QRNB 1EXUB 1QSVA 3KDMA 4Y5XA 3TWCL 5EU6A 2W0FA 4MCZB 4LSPH 2MKLC 1ZT4B 1SMAA 2H9GB 4XXDA 2GJZA 3BZEA 4OZFB 1AH1A 3BHBA 5IW1B 5B8CB 2CRYA 4PJHA 5D93B 4X4YA 3NOIA 4UINL 2CIKA 3VJ6A 3LN5B 3ARVA 3OKOB 3RWCB 1ZLWK 1Q8MA 3DO3A 3FONA 3MLTA 4WUKL 4X8XA 1WAAF 1CFBA 1EEUA 3Q6FB 4KTEH 1GGCH 3FO0H 3JWDC 3KAAA 5IBLC 4MJ2A 5JW3L 3I6KB 2WWMC 1HHGA 3T0AA 3RHWF 2G9HA 1DBKL 2WSKA 1XR8A 2OTPA 3X3GH 4PRIE 3G5YB 2AXGA 2OJZL 2CR3A 1OGAA 1CBVL 1FSKC 2F74A 3DHJA 4FQCL 3NIGE 5F8QC 3QQ4B 3V6OC 3PXHA 1NDGB 4PJDA 4UDUB 5D6DC 3C5ZB 3GSXA 2X89D 1IGML 2YC1B 4PY7B 2VDPL 5KSUA 4RMWA 1G7PA 3TNNB 3QXUA 4X0KB 4Y1AA 2OK0L 2OZ4H 3ULVL 3BISA 3VXSA 5MERA 1PDKA 1CD1A 3I3EA 1ODAA 1ND0A 3LQZA 1I1AD 2ZPKH 1NFKA 3BGFC 4XMLH 1S5HB 2NY0C 4PY8J 2E6QA 1ETZA 5HYJB 3QCTH 2ZCHL 4P2OB 5I71C 3PWPA 5EUOE 3LV3A 4CKVX 5D1XA 1AO7A 3RVWD 5B38A 1FZOB 4NGHL 1XGTA 1IGIH 1NC2B 3HG1D 2V5TA 1IEBA 1YYLH 2VLJE 3CFEA 5FUCE 1Z2KA 3MV8A 4L8DA 1Y6MR 2FJGA 1KIPA 3BYYA 1EAPB 5DHYA 4PRID 2B5IB 4MNQA 1QBML 5DJDB 2E7HA 2DJUA 5SWSB 2VXQL 3L3JA 3F6IA 4ZOAA 5DJAB 5I30H 5DK3A 3BGMA 5I8CA 3LKPB 3Q1SH 4DUVA 1EEYA 5C7XH 3GBML 4GMTH 1FN4B 3UO1H 1GOFA 1AGEA 4WHTA 3FJTA 1ZVYA 4LIQH 4UIKH 3BPOC 3QI9D 4HDIA 3RIAK 1VERA 5KBNC 3IJSA 4NN7B 1M7IB 3Q6GH 3RL1B 2EIEA 3GSUB 1URLA 3V7AE 3VXSE 2DM7A 1NJ9B 3CZFA 3D0VA 4KRPB 2V5YA 5CEZH 3LQAH 4OM0H 2CLZB 4L4TE 4ORGA 4Z9KB 5HYIA 3P3YA 2O5YL 3K80A 4MXVF 5D2LA 1AFVL 1S7XA 1QFWM 1WC7A 3O4LA 3QUXC 3JUZA 4IS6B 5J57B 4JM4L 4EJ1C 1K2DA 4LEXL 3RI5F 2ZG2A 5AZ2H 3L3IB 1WV7T 2VLJD 1XF2A 3VCLA 1CWVA 4NRYB 1FGVL 1ZGLM 5IESH 2WWKO 1NAKL 1AD0B 4HHAB 3PXJA 2KBGA 2VSCA 4DGVL 1ZKAA 4APQB 2D7MA 3O3AA 1W0WA 5DQDL 1U9KA 3SY0B 1J0HA 2EDNA 4P2RE 5INCA 4BSWB 4FQHB 3T4YB 2VDQL 3ARGA 2I26N 5SV3A 3MRHB 4DTGH 2CDFA 4Y4KA 4NHCH 2IPUG 2UVEA 2VLRE 4POZC 2GK0B 1ZHBB 4FQIH 1FRGL 4G6KH 2VAAB 2OL3A 5ETUA 1AXTL 4QRUA 5DUPH 2VITB 1L7TL 4I2XA 4R0LA 2L7JA 3CVHA 3RWFA 4Q2ZA 1NCAH 1M6OA 5MENA 5L88L 1RQ5A 1MRCH 3MRRB 4Z95H 5BO1H 1LEKB 5INDA 5I2IB 5I74B 1IQDB 4L4TD 2BHUA 4Z0BL 4ZO8A 4Y4HB 4HXBL 3VWKB 1JV5A 1LDPH 4YX2L 2QR0A 1KT2A 4WJ5B 1BQSA 3B9KB 4CJ1A 4X7EC 1CR9H 2FZ3A 3TVMC 3BWAB 1M1SA 2X4PB 4FOMA 2DQFB 4L3EE 3QQNA 4WU7A 3O4LE 4NWUL 5CD3A 5SWZB 1J1PL 3ES6B 1INEL 4F57L 4MWFB 3QG7H 4X6DF 4Z7UB 1BBJB 2DIBA 3R8QA 2F5BH 3UXFA 1OAZH 5KSVA 1LE5B 3MNVA 1FL3A 4EEEA 5GSVB 4HD9A 4ZOBA 4P2RD 3EYSL 4G6JH 3DVNA 3O3DB 3DX8B 4FQLH 5DHXB 1A7RH 4TSBL 3D3VB 5E2TL 1JGEB 4CNIB 1IQWL 4R7DB 2VLRD 3CK0L 1KN4L 4HGWB 2NY4D 3FQRB 3SDXB 1EFQA 3MACL 2JJSC 4D0BA 4F80A 3IFPB 2F8VA 4WDIA 1WBYA 4E42A 3OAUL 1CLOH 4XNMA 4XC3L 4IHOB 4QYOB 2HFTA 2PXYA 2HFEA 1TJGH 3D39E 2B8OT 1JWSB 4JDZA 3PGDB 4LBEB 5KOMC 4I2XE 2BHZA 2IMMA 3LKOA 4JPWH 5BV7H 2BY0A 4OZIF 1A47A 3OL2A 3UZQA 4QEGA 2Z4QA 4MQXC 4WTWA 4X6DB 1U3HB 3IDXH 3P0YL 4C83A 1JNLL 3OAZH 4U0RC 5AYUH 1AR1D 1RUAL 3ULSA 5M94B 4GBXC 4JKLA 5CP7B 3V5DA 4JAMB 5LKNA 4EUPH 4QXGL 2DTMH 3T04D 4I8DA 4X6CA 1EERB 3WLBB 4PJIE 5E9DB 2AVGA 4GS7B 1V3LA 4QGTA 5C0RL 5B39A 1C5CH 1G84A 1DLFL 4LSRL 1OCWL 3GSRB 3TBSA 2GW5A 4U2ZA 1AGFB 2C1PB 4P4KC 1J1XL 1D5ZB 2ADJB 4YDVA 1QEWA 3QFDB 2A73B 4R4FL 3IXTA 3D39D 4LPWA 4ZUVA 5TFSH 4AQOA 3O41A 4WTZA 2WP3O 1PZ5A 4OLYL 1BJMA 4YDLB 1QKZH 4NYLB 2XWTB 5DJYA 3I50L 3H0TB 4DKFH 4JRYB 1D7FA 3TPUA 4I13B 2ZUWA 1A2YB 1EUTA 2CO7B 1TZHA 2H41A 2BVQA 5T1DH 5HJ3B 3QPXL 4XVUC 4LPTA 3GMLA 4POYA 4QRRD 2P5EB 5DUBB 5EA0H 1UCTA 5DI8A 3UJJL 1INQB 3PHOA 2I27N 4PIRF 4U3HA 2ZSWB 3QFJA 1GZPB 3DBXB 2YPLD 3BQUA 2HTLC 4BH8B 3ARYA 3VGAC 5DMGC 4K3DL 3PDDA 5C08D 3DV4B 3O9WD 5FOBB 3VXQA 1T89C 5JIHA 5TDNB 5AEAA 5F88A 2FSEA 5E1AB 1QYGL 5L8KB 3HNSL 3KPRB 3EYUL 3C8KB 1YQVL 1V7ML 5IBUB 1YEGL 4YK4B 3W11C 2NY6C 2VL5B 1RIUL 1IGFH 3KPPA 2IGFH 1YEHL 4IOFC 4FFVC 4JKKA 3IDNB 2Q7NA 5EU3B 5IMKA 5BV7B 4M6NH 2XG5A 2R69L 4NBZB 1XEDA 3SCMA 2DL2A 4OD3H 3CLEL 4PUBH 3QEGH 4YO0A 2YMXL 3VFSB 2HG5B 3HNVL 4IOIB 2OTUB 1R6VA 4U1HB 4JFZL 3IFOA 4LCYA 1B2WH 2VR4A 3O2DH 4MS8C 5DZOA 3SGEI 5HDOA 4OFDA 3B3IB 3TJHA 1MREL 4S1DC 1T0MB 4LSTH 5CAYB 1TETL 2EIZA 4U6XB 1ULVA 3IS0X 4LKXA 3V4PL 5I76B 4OAWB 4IRSB 1D6EA 1OAKH 2X1OA 5HHOE 4Z7OF 3VA6A 3LAFA 1O5DT 4TOYH 2R1YB 4RFOL 5F3BB 5GGVH 1T2XA 4G6FB 2BNRB 3K46A 4N1CA 3D2UD 4NNXA 4FQ2H 3JWOL 3JV6B 2XPGB 2HT2C 1VFAB 4PJ9B 3BUYA 2X1WL 1A9BA 5D96C 4OB5L 5DR5H 4OJFH 1II4E 1A6AA 3O6LL 4Q9RH 4MNGB 4K3JL 4NUGH 1SYVA 4OLVL 4UBDD 2XZZA 3LKQB 3AVEA 5JXAH 1TIUA 3NZHL 1MCJA 4ZAKD 3W5MA 3VE0B 2HRPL 1JPTL 5D2NE 3EO0B 4EVNB 2D7PA 5HXMA 1ZEAL 1FG9C 1KF9B 4NT6B 4XAKE 1CGYA 1U95B 5DD1H 1LHZA 5F96L 4OD1L 1CLYH 5KS9E 1SEQH 2VQ1B 1EHXA 3S35H 3KPSD 4JZOB 3SJVA 4IM8A 4NFBA 2NX5B 1OY3B 2VXSH 3MV9D 2X5PA 4FQ1H 1CDYA 1J1OL 1OM3H 4YDKL 2VUYA 4Y4FB 1J8HA 4LCCB 1S3KL 2G2RA 1YUHB 5HHOD 5GXBB 1YN7B 4MVBA 2V9TA 4U1JB