3FQRA

Phosphorylation of self-peptides alters human leukocyte antigen class i-restricted antigen presentation and generates tumor specific epitopes
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
275
structure length
274
Chain Sequence
GSHSMRYFFTSVSPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDGETRKVKAHSQTHRVDLGTLRGYYNQSEAGSHTVQRMYGCDVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQTTKHKWEAAHVAEQLRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHEATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRYTCHVQHEGLPKPLTLRWE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
publication title Phosphorylated self-peptides alter human leukocyte antigen class I-restricted antigen presentation and generate tumor-specific epitopes
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 77
structure length 274
sequence length 275
ec nomenclature
pdb deposition date 2009-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3fqrA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3fqrA01
3IDIA 1U41A 1S9YB 4QRPA 2EICA 1RZIB 1FVEB 3MBEB 1OWRM 1P4BL 4QRUA 4NQCA 3TJHD 2AABH 4NO0B 2ZPKH 4FZ8L 4LLUB 1L6ZA 4M3KB 1WCQA 2OJZH 4WFHE 3LH2L 1JGEB 4LEOA 1EFXA 3CVHL 1NFDF 4PLKC 4ELKB 1B4JL 1CLZH 1HXYB 2P5EB 1S5HB 3O4LA 1NEZB 4XXDA 1OP5K 3QCUH 3TO2A 3HE6A 3QBTB 5D7SH 2W65B 4JHWH 1CICC 3HB3D 5IB1B 3ARGD 2Q7YA 3LN4A 5E1AB 1UJ3C 3VE0A 1KIPA 5I1GH 1T7ZA 3PWVB 3IRPX 1NGPL 3B2UC 5BV7C 3ORJA 4P2QA 1Z9MA 3IDUA 1FNFA 5E9DE 2MPAH 3C09C 3QG7L 3MMEA 1IGJB 2W60B 3NGBB 2Q6WA 5CBAA 5GGTH 3IJHB 3GBML 3BQUC 3MJGX 3C8KB 4KQ3H 5FYLD 5F89B 4PR5B 1OVZA 1X4ZA 3B9KD 2WM0A 1RZFL 3NZHH 3GJFB 3T0WA 5LJYH 1EO5A 5I1CL 1A7RH 2Y7QB 1GC1L 1I3RA 4K94C 3BD3A 3INUL 4LHUG 3IDGA 1E6JH 3QULA 1IBGL 4POZC 2BZDA 4NQXB 3SGEI 4QRQB 3PGDA 3GMMA 3PP4H 4CNIB 5ESAA 5DRWA 4IBLT 4UTAL 5CHNA 1FNGB 1A5FL 4Y4KA 1QLEH 3L3KA 2IBBA 3EGSA 2DKSA 4X9FA 2NXZD 1YMMB 4X7DC 3QXDA 3MBXH 5J12B 1U36A 3QWQB 1WUNT 1M7IA 3LD8B 3MXWH 4Z95H 4LBEB 2NW2A 4Z6AT 3VFWB 3RVXD 5HHOE 5IBTH 3TA3B 1FYTA 3DPBA 1N3NA 1A6ZA 1EZVX 2X44D 2J8UE 4HPYH 4O4YH 5A43C 1O5DT 3MNVB 5EUOE 5GS0D 4LCUA 2HFFB 5CJQH 5K9KA 1XIWD 1ORQB 5CJOL 1S7WA 3U48A 4K7FB 2D7OA 1GRWA 3DYPA 5D1XC 2ZCHL 1D9KB 1KTKE 4YHYB 2A6IB 1KBGL 5JZ7C 5I1EH 2IBGA 4JO4L 4ZAKB 3RWCA 4DGIH 2AJUH 5FYLH 4Q74A 3EO9L 4QXUL 1XF5B 4LVOC 4UV4H 3VXQA 2R8SL 3MCLH 1XGUB 5I76B 1TNMA 3ARBA 4M7KH 1U8PB 1UM4H 4HIXL 2JELL 2NY0C 1J0JA 2CDGB 2F74B 2NPLX 1YEIL 1NEZG 2Y07H 5C07D 1PG7X 3O45B 1CR9H 1TQBB 3DXAB 5JPNB 3TYGH 1F90L 3TYFB 4ONGL 2YKLH 3OZ9H 2NY2C 3WXVL 3MRQB 1I9IH 3UTPE 2RFXB 3CVIH 1OP9A 3JV5A 3MV8D 2YUXA 5TF1L 3EYOA 4Y2OA 2XTJE 3C08H 4JJ5A 4OCYH 2DBLL 4X9BA 2E9BA 1AFVH 4F37K 2PKDA 4HKZA 3AS3A 3NCEB 1AXTH 4Y8AA 3V4VH 1Y6NR 5F96H 4NKDA 4YPGB 2YD7A 1U8IB 4U1HA 2EH8H 1MWAH 2OSLA 5I8CB 3X17A 5EBWB 5ACZB 2VABA 1WWWX 1V3LA 2P8PB 3NA9H 3D39E 5GS0H 4QHNB 3K1DA 5C7XH 3EJYD 5BRZB 1BZQK 4S1QL 1T7VA 3HC3H 4OF3A 1PZUB 2Z9TA 4YXLL 4F9LA 1NC2A 2ZWLT 2PR4H 5CEZL 4BUGA 4ZOBA 4MLIA 1FC2D 4AG4L 2AGJH 4RSVA 1KIUA 4KROD 3QT2A 5C08B 1U3HB 5A16A 5IMOB 4ODUB 1NGQL 2X4RA 1KNOA 4GXVH 5F3BA 4HV8A 2Y72A 1IM9D 1LP9B 5KSUB 4RX4D 3QRFM 3DECA 1G9NC 4FMFA 5D96B 1EEYA 1RUAL 1HEZA 4I18C 2R0ZH 3MRLA 4NQSB 1TJHL 2UZYB 2ENYA 2FGWL 3IDIB 4QRPB 1JZ3A 1L7TL 5DHYA 2K7QA 2YHGA 4QRUB 1MSPA 4OM1H 4NQCB 4Z7QF 5GRWA 1CVSC 4DK3A 2VDQH 2ZOLA 3JV4A 2MKWA 3LQZA 5C0IA 4LEOB 3DMMA 2YA1A 3I3BA 3O6FC 1OCWL 1Z5LA 2CXGA 2R0WH 4FNLL 4PB0H 1BVLA 1NMAH 5I15H 5IESH 3O4LB 1LMKA 3RTQD 4LLYA 1J1XL 3GSVA 3GSOA 4XXDB 3TO2B 3HE6B 3MRHA 5LBSH 2H26A 2MCPL 4IRJD 2RR3A 3BPLC 4O9HH 5DUMH 3LN4B 1U0QA 2Q7YB 4P9MH 3VE0B 1KIPB 3S6CA 1E4WL 4LAQL 1N4XL 5C0RH 2WP3O 4P2QB 3U0WH 2VDOH 2V6HA 4JRXE 4MVBD 3VRJA 3MMEB 2PO6A 2Q6WB 3RZCA 4YFEA 5CBAB 3NACL 2LABA 1LP9F 4ZO9A 5C0JA 4YDLC 4KKLD 1VFMA 3JWDC 5CEYB 2AJZA 5DJAA 1KJ3L 3SE3A 4C54A 3EAKA 3DSFH 2J6EL 1H3XA 5F9DC 4GRLD 3NH7H 4DW2H 4JPKH 3IAQA 3UX9B 2MQCA 3IDGB 3OJMB 3QULB 5T1KD 4D94A 2HT3D 1AIFA 3VD5A 1FNSL 3PGDB 4XPFH 3GMMB 4CMHC 5ESAB 5DRWB 4X7TA 5CHNB 4Y4KB 3L3KB 5FHAH 1T83C 5J06A 5MHSE 5J3HD 3EGSB 5I16A 1KCSH 3QXDB 4OCRH 3QHFH 1M7IB 2YPKA 4LLAA 3LHPH 5FF6A 4EN3C 4KHTH 2DIJA 3ULUH 5B4MD 4KVCL 3OAYK 2NW2B 1LQVA 1MFBL 4XHJD 5L6YH 1FYTB 1N3NB 3QIWD 1A6ZB 1HN1A 4JFZH 4CDGC 4KZEL 2QQNL 1RSFA 5E94A 1FJ1A 4NQUA 5SWQA 3DVIA 5DMIL 1JCKA 4ZS7L 4LCUB 4D0BA 4NZUH 3ULVC 5K9KB 3VFSA 1S7WB 4Y5YC 5T5NG 1YEKH 1LNUA 2XPGA 4AEHL 4WHTA 2R9HD 2PYED 1RIHH 3UO1H 3KXFE 4M5YL 4PLOB 4NQTA 2ZKHH 3RWCB 4RWYL 2VH5L 3PQYA 4RMSA 5J56B 2IMNA 1F4AA 3VXQB 3ARBB 3HKFA 2ERJB 4KRPD 2KUTA 4X6CE 2ZJSL 3L1OH 5HYQA 1V05A 3GKWH 1GGIH 4PRHD 3QUYA 3L9RA 1C5CH 4JM2A 4I77H 3TCLA 1JNNL 5FCUH 4OV5A 1BD2D 1UADC 5GRZA 1WFUA 2IGFL 3S3PA 4IIQA 3EYOB 4U6XB 1A0QH 2VUOA 2R4SH 4JJ5B 1DCLA 4LGPB 4JDZA 5SWZD 2VQ1A 4HKZB 3BIBX 1NMBH 3ARRA 5D2NE 3OMZA 1E6OH 1ZHLA 4DKAA 4NKDB 3BPOB 2X41A 1XZ0A 4U1HB 1WBYA 4UQ2A 5BW7A 2OSLB 3NIDE 1KFAH 1DBBL 2IALA 1EK3A 2VABB 3HMXH 3LZFL 4J4PD 3VFPB 2LU3A 1MIEL 2FECL 1L0XA 4KAQH 3U7AA 3QEQE 1MNUL 3OBAA 1QR1A 2HFEA 4F80A 1KEGH 5T1DH 2YWYA 4OLEA 2QHLA 4PJIA 4IRSC 1NC2B 1OD9A 3VXMA 1V7NL 3VGAC 1G0DA 4JRYE 4UT6H 1DR9A 4KK9D 4I4WA 4F9PA 3MRKA 3ARDD 4IMKA 1JTOA 4HT1H 5A16B 5DT1H 3VFVA 4NBYB 2X4RB 1KNOB 5F3BB 4HV8B 1MQ8A 1P53A 4TSCH 4W4OA 1TITA 4JPWL 5CJBA 1U8MA 1HEZB 4CDHA 3HUJA 3MRLB 1L7IH 1CDUA 5CJ5A 4JHAH 5DHYB 1MAMH 3HN3A 4NN6C 2HT2D 1BEYL 3QXUA 2X1QA 5TPWH 4Y19D 3BH9A 1BJ1H 2VR9A 1I8LA 3U36A 3BRFA 4RIRA 1WEJL 2ZOLB 3JV4B 4N90E 3LQZB 5FUOL 5C0IB 3DMMB 2P49B 3LKOA 3QNXA 2P5WA 1NKRA 1DBJL 2VTFA 1Z5LB 2NY3C 5I8OL 1QBLL 2XQYG 1JZ4A 1BVLB 2EDOA 4NKIL 3IDJA 3DHJA 3KDMA 5E4EC 4ERSL 4LLYB 3GSVB 3GSOB 1G7JA 4P2OA 3MRHB 5E08H 1CWVA 2Z31A 4NKMA 2BXZA 3TO4D 4MD0A 1XF3A 3C60C 4YXHH 1JZ6A 4J12A 3RY6C 4P4KC 2I9LA 5C1MB 5GSRA 2HA1A 3O9WC 4JRXA 3T4AA 4H8WL 5GGSA 2ARJB 3VRJB 4P2YA 2PO6B 1NCDL 3EOAA 3PGFH 3RZCB 1OLZA 3LEYH 5IMKA 5BO1H 2BVOA 5C0JB 4WHDA 3OB0K 1NLBL 4UT7H 5KAQG 2AEPH 2AJZB 3MUY1 5DJAB 1GGTA 1F45A 3NIFE 4HHAA 1IEAA 4PRID 2CO6B 5ALBL 1L0QA 2H2PD 4BH8A 1X3DA 4QXWA 4XP1L 2MCG1 2RAMA 5IHLB 1UEYA 3PDOA 1FO0L 1BIIA 2LTQC 1JYWA 3AC0A 1H5BA 2AK4E 1XR9A 1D6VL 1KEMH 4FRWA 3I50L 2CR6A 5F7UA 1AIFB 4ZUTA 1WIOA 4X7TB 2VN4A 3K2MC 2XZQH 5C0AD 1J5OH 2FO4A 3MPCA 5DXWA 5FA4A 3F7PC 1E4XL 3VRIA 5JXEA 5I16B 5KN5A 2DYPD 4Z18A 1MJJA 1T20A 3QPQD 2YPKB 5I6XB 4MA3A 5E5MA 5FF6B 3OKLA 4JFDE 2NTSP 3LS4L 3T0BA 3WFCH 3T08A 3KPQA 5E94B 1FJ1B 4M43L 2XV6B 4WV1A 5AD0A 5SWQB 4XNMA 3J7HA 3MO1A 2W0FA 4D0BB 4DGVH 3B83A 4J3VA 1AHWA 5L7XH 2VLKE 1FV1A 2XPGB 1LNUB 4ONOA 4JY5L 1NLDL 2W38A 1CE6A 3V7MA 1I1FA 2J7LA 4L4TE 1CXEA 3A67H 5F9WB 3OJ2C 3X3GL 5EN2A 3LEVH 32C2A 2OBGA 1AGDA 1ACYL 3CSGA 4AZ8A 3R1GH 1RZJH 3IRZA 5HYQB 3G6JA 2VZOA 4WHCA 3QUYB 4OCXH 4OI9A 2ZZUT 1PLGH 2VWEC 4OIIH 5T3ZE 3L9RB 5I8KL 2ZCHH 3VGFA 4JM2B 4XCCH 3TCLB 5TE6L 5AEAA 1I1YA 4OV5B 5AZEL 4XCFL 1VFOA 4PLKD 3FHQA 3OQ3B 5GQBA 4IIQB 4JFYA 2XTJB 3TBYA 3VWJA 5CKGA 2ICWI 2WP3T 1BBDL 1CU4L 4OQTL 4L5FL 3W0WD 4R6UA 5D2NA 4JDZB 2J8UF 2VQ1B 4N1EA 1YEIH 1IC7H 1ZHLB 4G5ZH 1QFWH 5EUOF 4G6KL 2VL5A 4PJ5E 1XZ0B 1WBYB 2FEEL 4UQ2B 4JFFD 2IALB 1GGCL 4XXCA 1Q38A 3QEQA 4OZGE 3DJ9A 3TT1L 4OT1L 5B8CA 3MJ7A 4IDLA 2OR8A 1CFTA 3T4YA 4WI5A 1QR1B 4XMKL 2B7DT 4UDUA 4JFED 3ZDYE 3L3OA 4PJIB 1X4XA 3P30L 1BWWA 4JRYA 1MFNA 3VXMB 2ZUXA 1EVTC 3UZVB 1I85C 3O11A 1KCUH 3HRZB 3U30B 3RWHB 4I4WB 4Y1AD 5DDHA 1JMZA 3MRKB 4MA7L 4OZ4A 1OAQL 3VFGL 5D71L 5IQ7H 3CSBA 1MRFH 3P9MA 1Q9OA 1KB5A 3VFVB 1KCGC 1UZ6E 4KMTH 1O7SA 2VLJD 4HWBL 1WBZA 4JM2F 1A1OA 4POZD 4LNVA 3S96A 1ZA3A 2E6JA 8FABA 2F15A 1IL1A 1V8HA 4JQVC 3MLZH 4YXLH 1U8MB 3V0VA 3HUJB 3SDAA 3UTZA 4IMLA 4PJ9A 5DO2C 1DQMH 1UA6H 3LKNA 5E4IA 1M05A 5JNYA 3GIZL 3LS5H 3QCVH 1RUPH 4ZD3H 5HSFA 3BH9B 5B39A 5SV3A 4Y5VA 4B0MM 3U36B 1CGSH 4RIRB 3DUHA 1RZ7L 3KJ6H 3ECBA 3QNXB 3LKOB 3U0TA 3VXSA 5LAXA 2P5WB 2YN3A 2ZUQC 4XVTH 5HI3C 4FFVC 4PGZA 5F9OH 1JP5A 1VERA 1ZT1A 4C58B 3IDJB 1FCGA 2FGWH 3KDMB 2W9EH 3O2DA 1G7JB 4P2OB 4PJFE 4JANA 2WLZA 1XF1A 4OFPA 3SKUD 4RMVA 3MYZA 2Z31B 4NKMB 3ZL4H 1AH1A 1TNNA 5JZ7D 2X4SA 2X9WA 3K8KA 1XF3B 4MD0B 5IHUL 4JEGB 5DQDL 5CP3A 2I9LB 1NCWH 5GSRB 4ZNEE 1DBAH 4JRXB 5FV1L 3I84A 4PJGA 4XWOC 4QHUA 3T4AB 3ES6A 5GGSB 1F4XL 1BZ7A 1JGVL 5FM5M 2NY0D 2K1MA 2V5TA 4U4BA 5IMKB 2BVOB 1VHPA 3B5GA 2C4XA 2IPTH 4YHOL 3ZSSA 2QKIA 4HHAB 1IEAB 2O5XL 1FGVL 5D2LA 2NY2D 4BH8B 5GGRA 5ECJE 3PDOB 2AK4A 1BIIB 1DVFC 4XPGH 1H5BB 1XR9B 3ARED 3JWOL 4ISVA 1GIGH 3Q5OA 1NFKA 3P40A 2Y5EA 4ZUTB 2YD6A 1RZKH 1F4WL 2VLME 2FO4B 5FDYA 2LAGB 2BC4A 4OLYH 5FA4B 2HH0H 5MERA 3VRIB 5KN5B 5GS1C 4BQ9A 2O5YH 1MJJB 4XNZB 3MUZ1 1T20B 3G08A 3JUZA 4JFDA 4MA3B 4QLRA 5E5MB 1HYSC 2AJSH 3OKLB 4LRNH 5DJ8A 3T04D 4EUPH 5TQ2H 1X7QA 4C56E 1RU9H 4NNPL 5AYQA 2B4CC 2ZCKL 1KELH 3MJ9A 5CIPH 5IMMA 4XAWH 3KPQB 4WV1B 1GVIA 5AD0B 1DQLH 3S36X 4XNMB 5AWNH 4LSQH 3MO1B 2W0FB 4BQ8A 2VLKA 2YRLA 2DQEL 1AHWB 2BDNH 5E1HB 1R0AL 1RURL 1FV1B 3QUXD 2R0KL 1UC6A 5CJXA 4FQXA 2HKHH 5SV4A 2Z92A 3N50A 1ULVA 1CE6B 1I1FB 4L4TA 5DLML 1A02N 1UACL 1MCLA 2BVUA 2A0LD 5F70A 5EN2B 2AV7A 1TPXC 3L5JA 32C2B 2BOBA 4XB8A 1YQVL 1FFNA 1ZLVK 3G6JB 2FHCA 4RISH 2XI9A 5ADPL 2AJXL 4FQLL 4KK6D 3RUGE 1I1YB 3O6FD 4XCNA 4JFYB 2R69L 5E8OA 1NEUA 1UB5A 2D03L 3VWJB 1VFBA 4JZOA 1JPSH 2C9AA 2HN7A 1FNLA 1MCFA 1UCBL 3QXVA 2X5PA 5D2NB 3EYQD 5DA0B 5DSCA 2AI0L 2VL5B 2IFFH 4KKCC 2AK1H 3BZ4A 3FRUA 4QY8A 5DMGD 4OZGA 2OL3H 3QEQB 5B8CB 1HINH 3MJ7B 1G1CA 2X9XA 4NN5B 1CFTB 3T4YB 4JDTH 4NC2B 1U8KA 4N8PA 4UDUB 4WFFD 2YD2A 3KR3H 4HCRA 3L3OB 4YFDB 4JRYB 3QPXL 4X6CF 3O11B 1C5DA 3AY4C 4ZS6C 1DSFH 1IC4L 5T3XL 5L0QC 5DDHB 4OZ4B 3HA0A 5EBGA 2X7LA 3P9MB 1UM6L 1IILE 1Q9OB 1KB5B 3DROA 3BKCL 5ICXA 5C0NC 5DVMA 2VKXA 1GC1C 3O8XD 1WBZB 1FZJA 4H0IA 4GAGH 3I75A 1A1OB 1HH6A 3DWTA 4H88H 4KH2A 3VWKD 3S96B 1ZA3B 2VC2H 8FABB 1IL1B 5A2JH 4P5TA 2VDRH 3NABH 3V0VB 3ROLA 3SDAB 3UTZB 1SJVA 4IMLB 4JZNB 2L7UA 4KRLB 3LKNB 4R0LA 1M05B 4MNHA 5JNYB 4OLWH 5A2KH 3B8YA 1MVFA 1IQWH 5B39B 1OSZA 4Y5VB 3S9DB 4BFEA 4M93C 3IGAA 3Q0HA 5F6HI 4ZOAA 3ECBB 3VXSB 3U0TB 3JUYA 5LAXB 3MJ8A 1QSEE 1KN2H 1PZ5A 4PRBA 4XNYL 1ZT1B 5EOQH 1T1ZA 4XI5C 5CJ8A 4JN1L 3ULVD 1YNKH 2WBWB 4JANB 5GGUA 3MLWH 3QWRD 4JPIA 5JW4Q 2JJVA 4ZFZA 2X4SB 4OLVH 1I1AA 4P99A 4WWKC 4HUKB 1JWSA 5T1LD 4EI6A 1AXIB 5M94B 1MCPH 2J3SA 5HTSA 4MJ5A 5KSAA 4PJGB 4QHUB 3ES6B 3ARSA 1CXKA 1N2RA 1NGYA 1NCBH 5HHVH 4ZDHA 4BFBD 1BZ7B 5K59E 1J8HD 3MLUH 4AMKH 4FFWD 5IFHL 1T0NA 3R8QA 3RHWF 2QKIB 4XAKE 1IFHL 2DM7A 5EIIA 4X7CC 5D2LB 4NC1C 1HCVA 3MBED 5GGRB 2BVEA 1B0RA 4L3EE 2AK4B 4XBEH 4Q2ZA 4XX1E 5KVGL 3IFNH 4X6EA 1NMCB 3KPSE 1OAKH 4ISVB 1AE6H 4QYOA 5E56A 2DWDB 1LO0H 5C8JA 1IKNA 2EIZA 2JJSA 4OF6A 4MZ3A 2BC4B 2PNDA 4M7LT 5MERB 1YEEL 4EKXA 1XCQA 1EIBA 2LV4A 4KDTA 2DTML 2WW8A 3CUPA 4GQ9L 2O61A 3G08B 4JFDB 2E27L 5JQHC 5DJ8B 3D48R 1X7QB 2VLRA 5HGBA 5IMMB 1MPAL 2QV2A 1VEOA 2DQIL 4QEGA 5GIRA 4DZBA 5HXMA 2VLKB 1CGVA 1FZKA 4G8GE 1MI5A 3NIFF 4MYWB 2NMSA 1OAZL 4FQXB 4JKKA 3OWEA 2Z92B 2CUMA 4JB9H 4XP5L 5KG9A 4L4TB 5LWYL 5B39G 3RDTA 5GHWL 1HSBA 2GJJA 4PY8I 5EO9A 4NUJA 5C86A 1ZEAH 15C8H 2AV7B 1FCCA 1KXTB 1ZSDA 4RGOL 2BOBB 4Y16A 5DURD 4XVSL 1FFNB 5D6CA 5I1KH 1OGAE 3G9VA 4LU5H 2V9QA 4M8QA 3VGDA 2FEDC 2DMBA 3WJJC 3RUGA 2Z8VC 2APWA 2EEBA 3HMWL 1CIUA 2BNRD 4OLXL 4TULH 2QHRL 4XCNB 2EH7L 2NY3D 2WIMA 5E8OB 2Z4QA 5E2JA 4TN9A 4ZO6A 1UB5B 1X5YA 4ZXBD 1VFBB 1MRCL 4JZOB 2VDMH 4WI7A 1AGFA 3D3VA 5EZOL 4BSVA 1XFPA 2A6DA 2DLFL 4MXWL 5DSCB 3QQ4B 5I8KH 1JZ7A 1BVZA 3EDJA 4XC3H 3C60D 2E9JA 3BAEL 3BZ4B 3FRUB 4LASL 3O9WD 2GK2A 4OZGB 2NY7H 1PSKH 1D9KD 4QNPE 2FSEA 3OHXB 4OBRA 1CXFA 5KS9E 4E5XA 3QEGL 2I27N 5FYKD 3IDNA 1QPPA 2G75A 1U8KB 1N5YH 2VR5A 1VPOL 4QTHA 1C5DB 3QIBA 4OCLC 2HLAA 3TZVA 4LPTA 3FB7A 1JRHL 1OGTA 5HYSG 2ADFH 2WUBL 1KGCE 2D4FA 3WXWL 3P0YL 2X7LB 2ESVA 3DROB 5ICXB 1FDLH 5FUCC 5HVFB 5LXGL 2EXYD 1NAMA 2ICWA 1FZJB 3GM8A 4XBPA 3WNPA 3I75B 1HH6B 1NAKL 5FCSH 1WAAA 1YJDC 4YDIH 1F13A 4NJ9L 3GDBA 3T0DA 3MFFA 4L8SC 3M8OH 4KV5E 4P5TB 3PHQA 3KYKH 1UG9A 1FRGL 2A1WH 4NWTH 3ROLB 3S37X 1CD1A 4R0LB 2JB5H 4FFZH 2VO5A 3LPWA 5F7KC 3SGKC 2JB6A 1OSZB 4NFBA 1I7ZA 5D72H 3IGAB 2CLZA 2BERA 5F1OB 5CCKL 4HXAL 2WWKO 4WEBL 4OZGF 3MJ8B 4TSAL 2Q76A 4PRBB 1PZ5B 1HHJA 4U1KA 2C7UA 4G80A 1T1ZB 2APTA 3GSXA 2AJVL 3RWDA 1IGYA 3UXFA 3PNWA 1L4IA 1MFCH 2QQLL 4Z7VA 5GGUB 3ZDYF 2JIXA 3BDXA 4JPIB 2X4OA 2OR9H 4ZFZB 1I1AB 4NN7B 3N85H 1A7NH 2DRUA 2VXSL 1JWSB 4JQIH 4EI6B 5EOCL 4YDJA 2WBJA 3G6DL 3HNSH 1DQDL 3TWCL 3DRTA 1JNLL 4YC2C 2EDLA 5C08D 3WKML 4JQXC 3U79A 4M5ZL 4LARL 1UZ6F 2UYLA 4M61A 5E2VH 1HWHB 2RIKA 1N2RB 4X5XA 4EJ1C 1NGYB 4ZDHB 1S9VA 1GHFH 4EBQL 4NP4H 3STZA 1S9XA 1IGFH 5E99H 3RL1A 3C9NA 5IQ9A 1JGLL 3NAAH 4XMLH 2PXYA 5IUSA 1T0NB 2QSQA 5JIHA 3KG5A 5EIIB 1YNLL 1MAKA 4QRPD 5CILH 1TTFA 4L3EA 1B0GA 2EC8A 5F7HA 2CSPA 3FFDA 3O0RL 1B0RB 3SCMD 4J6RL 2XACC 4Q2ZB 1N8ZA 4YDKH 3VMOA 1E28A 4X6EB 4NZJA 3GMPA 4E0RA 3WV0A 4X9HA 1NUDA 3RNQA 4F7EA 4QYOB 1OAXL 1IC5H 4YLQT 5C8JB 2EIZB 1XEDA 5AG9A 1EO8H 4LF3A 3EOTH 2HRPL 4HD9A 4D9QE 4ETQA 3KPRD 1ZVHA 1J87A 1FE8L 1RZGA 5DVLA 1IEHA 3CUPB 4R97C 2O61B 2QADC 3K0WA 3X12A 3K8MA 1CLYL 3O2VL 3CK0L 2VLRB 5EC1A 3PDDA 5HGBB 4P2QD 1U3ZA 1F4WH 4DUVA 3OKYA 4OGZA 5I73C 5GIRB 2VB5A 4DZBB 1MEXH 4BFIA 4HJJH 4JREC 1R3IH 4K9EC 1MI5B 5AYUL 2UUDK 3PDGA 5KG9B 4ZFGH 3ME0A 5JIPA 2EIEA 5EORL 1LILA 3KLSA 1ZS8A 3RDTB 1AR1C 1GGUA 1HSBB 3L3GA 4JDVA 5EO9B 4NUJB 1TQCC 5SX4H 4LEXH 1ZSDB 4MHHG 5DO2D 4LMQE 4Y16B 1ND0A 2BVQA 5HYIA 3KHQA 5D6CB 2NX5D 3HR6A 2UY6A 1DBKH 4YH6A 4M8QB 4LLVA 3RUGB 1YC8A 2YOCA 1FFPA 2DDQH 1N0XH 4PLJC 3ULSA 3MV8E 2CKBL 4O02L 5HI3D 2W92A 3UTTA 1WQVT 2NY4C 5BJTA 2Z4QB 1JNHA 1A7OL 3GGWA 3BGFB 1I8KA 1AGFB 1U8OA 4CU6A 3BKJL 3SBWC 1TCRA 2A6DB 4BSVB 1N5AA 3BKYL 1ETZB 2XRAH 2FX8L 5I1DA 1MREL 3MUHL 5IWLA 3GNML 3I6GA 4F7CA 2HWZL 4I0PC 1HI6A 3TPUE 2YUWA 1S7SA 2FSEB 4NWUH 2FBOJ 4H8WC 4E5XB 2NW3A 3OKMA 3IDNB 4XPTH 3DIFA 2G75B 1YN6A 2BJML 4PGDA 1BFVH 3LMJL 3LB6C 1T89A 1CK0L 2R4RH 4QTHB 3MV01 3QDGE 2HLAB 3TZVB 4FXKB 5GRVL 4NZRL 3FB7B 4FFYH 1OGTB 5GGTA 4EEEA 1DVFD 4ODVL 3DO3A 2ESVB 1A6AA 2WAHA 3RUGF 3K46A 1MCWW 1NAMB 2ICWB 4XBPB 3FQUA 1CVRA 8CGTA 2DWEA 2ENSA 1C5BH 1W0WA 3MFFB 1DLFH 3PHQB 1FORH 3OV6A 5IW3A 4KDVA 4K3DL 2J4WH 4ALAL 3TJHA 3GBNL 2NY1B 1CD1B 4DAGH 3SGJC 1X5IA 4XPHL 1MVUA 1F02I 5FKPA 1OPGH 2JB6B 2ITCA 1I7ZB 4HS8L 2CLZB 5B3JE 3Q2CA 2ZUUA 4NCDA 2RBLA 4NNXA 5IFJA 5FK9A 4DN4L 2XKNA 5HYEA 2Q76B 1FG9C 4RFEA 1HHJB 3FT4A 4QRSA 3OF6D 1W0VA 4U1KB 1K3ZA 2C7UB 4G80B 4NO3A 5F7YC 3RWDB 1IGYB 2MWCA 2DQFA 3GZKA 3PNWB 4GJTB 4Z7VB 2JIXB 3ARGA 3KAAA 3O81A 2X4OB 3ZZ1A 2QSCH 4Q9CA 4N1CA 3WO4C 4U3XA 5TE4H 5DC0A 4YDJB 1T6VN 2WBJB 1T1WA 4BELD 3DRTB 3U4EA 1FIEA 1UEMA 4UV7L 3TBSA 2UYLB 1K8IA 1LE9A 4IOSD 4X5XB 1U92A 1F3DH 1QFWI 1Z9SA 4LSTH 1S9VB 1KCVH 3STZB 1EZVY 1S9XB 4K8RH 3RL1B 3C9NB 5IQ9B 3OL2A 1YEDA 2PXYB 3CDCA 4JO3L 1J10A 3B9KA 3NOIA 1NL0L 1KLFA 3RKDD 3VFMA 2GY5A 4L3EB 4MAUH 1B0GB 3FFDB 2VISA 4YR6A 4KGLA 1N8ZB 1Z2KA 1B6DA 3NPSB 1E28B 4G6JL 5DI8A 1C16A 4TVPL 3GMPB 4QF1A 4E0RB 3VD3A 5GPRA 3RNQB 1D6EA 4F7EB 1E0OB 3MACH 1JPTH 4KKCD 4LF3B 2YK1H 4ETQB 4AIZA 3X14A 5IJVA 3LAFA 2NLJA 3ZHLA 1RZGB 5I19H 1UJTA 5IB2A 5JHDE 5DJXA 2LU4A 4N5UA 5EDXA 1TJGL 1MWAA 3X12B 3TH3T 3RY4A 1J0IA 1LWRA 5EC1B 4BUHA 1U6AL 5E9DD 1XGYL 1QG3A 1AQKH 5K59F 3Q48A 2PO6D 1UYWH 1OTTC 4BFIB 2FGZA 4DEPC 1UZ8A 3MOBL 2PYEE 3E2HC 3JTTA 4GKOA 4HPOL 5MENE 3X3FL 3B6SA 4HBCL 2XT1B 4JM4L 1ZS8B 3HI5L 3L3GB 3BHBA 4JDVB 2DOCA 1MPAH 1GGBL 4OLUL 3I6LE 1RFDH 1ND0B 2BVQB 2WWKT 2D7PA 1UFUA 4PRHE 4GG6E 2BMKA 4JG0H 1F8TL 5C07A 5DJ0A 4LLVB 1ED3A 1UWEH 2M1KA 2M2DA 5BQ7A 1FFPB 1BD2E 4XGZA 4ZAKC 3U7WL 3MV8A 1KF9B 3ULSB 2DI8A 3ZKNC 4P3WA 1B2WL 3BUTA 3OXSA 3IS1X 3UTTB 5BJTB 3TT3H 1JNHB 3CU1A 3GGWB 4XI5D 4YO0A 3CH8A 3ABZA 3VXTA 5HHOD 1FL6A 2BNUA 1I8KB 3PV7A 4K3HA 4UBDD 1U8OB 3DV6A 3CNKA 1J1OH 1TCRB 3FHAA 1DQQA 1N5AB 4HULB 3IDXL 4KUZL 5I1DB 3C6LC 4WWKD 4X8JA 3S8WA 3I6GB 4F7CB 4WUKL 1HDMA 4XPAL 3QAZC 2VZUA 1HI6B 2R29H 5AZ2H 1S7SB 3CX5J 1G9MH 4NKOA 2A73A 4HFUL 2NW3B 2B2XL 3HZVA 3OKMB 4P59H 1P84J 1UXSA 5EZOH 3DIFB 4G9FE 1YN6B 3ZHDA 4PGDB 3V6OE 3KNBA 4PFEA 2VXUL 4NO5A 1X5FA 2BK8A 1CFVH 4XMPH 3KYAA 1T2QL 1DTUA 4MAYC 1WFOA 1JI2A 3ISWA 1Z6JT 4OTXL 4DKDC 2KDGA 1YYLH 4DN3L 1A6AB 4UILH 4PJCE 1IM9A 4JM2D 4LSUH 4NT6B 2KKQA 1I9RH 3JWOC 2EO9A 1MF2L 2GYSA 3MA7B 3WNMA 3FQUB 5FYJE 2DWEB 4KK8C 3BD5A 1MAJA 2N7BA 3GSNL 1W0WB 4XWGL 2VDKL 2XTJD 4GXUN 1KB9J 4MQTB 1WFTA 5IOPA 5I1JL 4N8CH 1IGML 5FUZH 2LE9A 3P0YH 1MVUB 2RQ8A 5FKPB 3NCBB 4HLZH 2ITCB 3IETA 4GKNA 1B3JA 2HFTA 3EDEA 1X5ZA 4FQ2H 4NNXB 3D39D 5GRJH 5L2JA 1MFEH 5FK9B 4D0DA 5IFJB 4QNPF 2XKNB 3RTQA 2X4QA 2FB4H 4HF5H 2V17L 4RFEB 5KS9F 3FT4B 4QRSB 3SKOA 3V5KA 5SWSE 1W0VB 2N56A 3B2VL 4NO3B 5IT2L 4IRJA 2C3WA 2DQFB 2WANA 1RJCA 2FWOA 3LEXA 3ARGB 2WQ8A 2DJSA 2YC1A 3QR2A 1JFMA 2FX9L 3L5IA 3ZTJH 5CCKH 4XCEA 3UJIH 1T1WB 4N0FA 3U4EB 3TBSB 1K8IB 1YEJL 1LE9B 1U92B 4EI5C 1NCNA 5DJ2A 4OCWH 4ORZC 1HXMA 2P48B 3MRRA 4TSBH 5CINL 2B8OT 1YEDB 4KV5F 2FEDD 4PRIE 3EYSH 4EOWL 1KJ2L 3VFMB 2XWBA 2K7PA 2Q1EA 2HYMA 4GRLA 2VISB 4YR6B 3FZUC 5I1IH 5JW3H 1J0ZA 4JG1H 5T1KA 5DI8B 3Q6GH 1C16B 3W5MA 5EA0H 2Z8WC 4QF1B 4X5WA 1G6VK 4NBXB 3UMTA 1D6EB 5DHVA 2HFGL 3O3UN 3KPTA 1AGCA 4HIIA 5FGRA 1QO3A 4DKFL 2NXZB 2VE6A 5K9OA 4APQD 2EDFA 5KVFL 3L5WA 4KPHL 4P2OD 1KXVC 3X14B 4AIZB 5IJVB 2NLJB 5JHDA 3WHE0 3DX9A 2LQRA 4Q6YA 5D8JL 5IB2B 5IEHA 2UWEE 4N9OB 5DJXB 5I1AA 3W9EA 1KCRH 1A9BA 3LQAH 5ANMA 1MWAB 5DD1L 3QIWA 4Q6IA 2UVFA 3F7RA 4H20H 4JRXD 4LDLB 4XC1L 2GTZA 3RBSA 4NM8L 5CMAA 5EBLA 3ZE0E 4UB0H 4XCYA 4EQ2A 2HRPH 3KPNA 4CJ1A 4GKZA 2PYEA 3HZMB 1UZ8B 3JTTB 3B6SB 4HWUA 3L5XL 4J23A 2EDYA 1NSNH 3MNWA 4P3CL 3WIIL 1CG9A 3IU4H 2VYRE 3VG0L 1BX2A 4LPVA 3MRJA 3RX8A 3BHBB 1E4KC 5MP6H 1KJMA 5JA9A 2J2ZA 4LFHD 4YHMH 4XNXL 4PRHA 4GG6A 1O7VA 1YEHL 1CQYA 5JW4R 2H2SC 2BMKB 3SKJL 2XNAA 5C07B 1X5HA 1I1RA 1MCOL 5DJ0B 3KLAA 4R7DA 5MHSD 1BD2A 1ED3B 2AS5M 2OK0H 4X9GA 1KN4L 2VLLA 5BQ7B 2HJKA 4XGZB 3QUMH 4PUBL 3MV8B 1E4JA 3OXSB 1BQUA 5BCAA 5FIEA 4LP4A 1B90A 4K7PH 4YO0B 1HE7A 5HHXL 3RBGA 1FL6B 2BNUB 5SWZA 2R56H 3DV6B 3BRGC 1FFQA 4YXKH 4HZLA 4DKEL 4M48H 1JHLH 1IGCH 3B3IA 1DQQB 2PW2A 4G8EA 3E6HA 3NPZB 4HEPG 3ZKXC 4NNYA 4X8JB 1HDMB 4J4PA 4JFFE 3WS6C 4WI4A 4YWGH 1DUYA 3KXFD 5D7KD 3QNYA 2VRAA 1T21A 2A74A 3BT2H 4NKOB 2A73B 5F7DA 3NIGE 3HZVB 4F8QA 1PDKA 3QXWA 5DD6A 1UXSB 2DBJA 2I60L 5DR5L 3BKJH 4JFEE 1FSKB 3KNBB 2OMBA 5GGVH 4NO5B 1S9KC 3BPOC 3GI8L 3TN0A 5DD5H 3ARDA 5ICYA 2O26U 4CW1A 4DTGH 4KROB 3IFLL 4PJCA 3U9PH 5MI0C 1NCAH 3RPKA 2BY3A 4XNUL 4X4ME 3GIVA 1IAIM 1A4JA 4XBGA 4GAYA 2XWTA 1CLOH 4QO1A 4N9GA 3FMGL 3V7AE 1CD9B 1DBMH 5E2TL 4FQCH 4CAGA 2CJUH 3C6SA 3V4UH 4XPBH 1SYVA 2H9GA 4JKMA 3GKZA 4Y19A 5IOPB 1EH9A 1INDL 2DQJH 3G5ZA 1HZHH 1Q0XL 3STBA 1YEFL 3IETB 3MLRH 3MRCA 3TH4T 1C8PA 4ZTPH 2YMXH 5L2JB 4D0DB 4JN2A 2GCYB 3RTQB 2X4QB 2ARJQ 4ODHH 5SWSA 1QBMH 3SKOB 5FO9A 3RQ3A 3V5KB 1D5MA 3GSWA 4K3DH 3E3QE 4R4NC 1G9EA 2QQKH 4IRJB 4ODTH 2FWOB 3TO4A 1A6VH 3K4ZA 3LEXB 4JRYD 4YFLI 3BFOA 2YC1B 4FABH 3ARYA 4BZ2L 4EDXA 1A6WH 3CAFA 4MJ4A 4OD3H 1AR1D 4XCEB 1OOAA 5I18H 4N0FB 2P24A 3CXHJ 4UAOC 5F97E 1BAFH 5KJRL 3SDCD 1EXUA 5DJ2B 4GOSA 2JE8A 3MRRB 3V52H 3FFCE 3OXRA 2Q7NA 3BOVA 4RAVA 4PRIA 4OCSL 4WJ5A 1NJ9A 4HDIA 3A6BL 4PG9A 2OX5A 4F7PA 2FD6H 2XWBB 1D5XA 3QA3A 4OGAC 4PJ8D 3K4AA 4GRLB 5IKCA 1OD7A 4GQPH 1G7PA 5T1KB 5GGVY 4D2NA 3OAUH 4N90D 5B3JF 2O5ZH 4YE4H 3RGVA 2NXYB 5HHQA 4X5WB 4OM0L 4CN1A 4RFNC 1QLRA 3F6LA 5DHVB 5C0AA 1CE1L 1YECL 3SE3C 1JGUH 4M6NL 3S35H 5F8QC 1AGCB 1P7KA 1SVZA 1QO3B 4HIIB 4ZFOA 2VE6B 5K9OB 2DYPA 4N68A 3ARFC 3L5WB 4ZO8A 3VH8A 3FN3A 2P45B 4ZUUA 2UWEA 5JHDB 1CGUA 3DX9B 1NAML 4JR9H 5IEHB 1R5WA 2VXVL 3GHBL 5I1AB 3LIZL 3W9EB 4X7SL 1A9BB 5ANMB 3QIWB 4Q6IB 5HPMA 3HE7C 1RIVL 1SJXA 4B41A 5HHNA 5DMKA 3LB6D 2GTZB 4AIOA 5EBLB 5CMAB 1QP1A 4AEFA 4P48A 4NQEE 5F1KC 1SEBA 4XCYB 5CUSH 4M1CC 3KPNB 4LHUD 1HQ4A 4WENB 4U3HA 2PYEB 3ZTNH 2DQDL 1KB5H 4D9LL 3MV7E 4FG6D 4S1RH 1K2DA 12E8H 3WSQH 2X40A 5LGHH 4LRIA 3UJJL 3NVQA 3MNWB 3WN5A 1CG9B 5AAMA 1F97A 1BX2B 3MRJB 1X5GA 1S8DA 1TLKA 2R1YA 4PS4H 1CI5A 1KJMB 3W81A 3NTCL 2NZ9C 4PRHB 1PW3A 4P5MA 4GG6B 5T33H 3TBWA 2R2BA 4M6MH 5I74B 1PFCA 4LPXA 1K4DA 2EDEA 4PLNC 2XNAB 3KLAB 4R7DB 3ARPA 1N26A 1BD2B 4BKLA 5CD3A 3BIAX 2VLLB 5I9QB 2HJKB 4JM4H 4E42A 4BZYA 2PN5A 1BLNA 3QI9C 1QYGL 2AKRA 2DLIA 4JFDD 5KTEL 2NYYD 3O2DH 2R39A 1N7ML 3OB8A 3W0WA 5SWZB 3TH2T 1JZ8A 2VXTL 3EDFA 1IEBB 1CICA 3SE8H 3QUYC 4HZLB 4LLWA 1T80A 4K3EH 3B3IB 1UJ3A 1MY7A 2PW2B 4LIQL 4G8EB 4JFFA 4YUEH 5F1SA 1WBXA 4IHOA 5LQBH 3LKSA 4G7YH 2Q8BH 2I5YL 4LVNB 1DUYB 2DKUA 2ED7A 4U1GB 3V0WH 3QNYB 1T21B 2A74B 5F7DB 3Q1SH 2HTLD 3BQUA 5E6IC 4JFEA 5DD6B 2BSTA 4WFFE 3MXVH 3NZ8A 5EOCJ 3D0VA 5C0CD 2ITDA 4TNVK 3EOBA 4UZGA 4H26B 4HEME 3TN0B 3V8OA 1BM3L 4Y1AA 3O3AA 2EKSA 3ARDB 4P9HL 5ICYB 4CW1B 4GG6F 1CGWA 1NCTA 2W9DL 4OCNC 5T3ZD 3VW3L 4PJCB 2VLJA 4LVEA 3ZKSD 2OCFD 1N64L 4FQIL 3SKNA 3GIVB 1DFBL 4FQJL 3WD5H 4F58H 1W72A 1A4JB 4XBGB 4OD1H 4GAYB 2WNGA 5L9DL 2XWTB 1FAIH 4N9GB 1OB1A 1EGJH 2MHAA 5D70L 3DGCR 4KZDL 2GJ6D 5C0FA 4U31A 3EFFA 1XGPA 1F4YL 1D5IL 1T2QH 35C8L 1F11A 3C6SB 4D0CA 3LCYA 4F9PC 1KENH 1KTLA 1SYVB 2H9GB 4Y19B 4DN3H 3G5ZB 4PJ5D 5SX4I 1J9CT 1TETH 4HC1H 2VXQL 4UNVA 2J5LB 1OAUL 2DJ4A 3I02A 3MJ9H 3MRCB 3QHZL 1VKXB 4LCYA 3LQMA 5D7LE 2I07A 4HBQA 2EEAA 4WU7A 1QBAA 4JN2B 2VERN 1OM3L 1KT2A 4R26H 1MIML 5SWSB 3CLFH 1R24A 4R2GB 5FO9B 1OTTD 5IBLC 1D5MB 1EBPA 4K3GA 4LQFH 3GSWB 4JPVL 4YHPA 3ULVE 4G3YL 2YXFA 3F58H 1R5VA 1ZLSH 4NM4H 1MRDL 1KLGA 1H3PL 1ORSA 3VXUD 1T3FA 3TO4B 2BRRL 1KPRA 4EDXB 4KWUA 4OZHE 1DN0A 2AABL 2VAAA 4AH2B 2ZPKL 2Y4SA 2MJWA 2P24B 4PJCF 5CFHA 5I75B 4HQQH 2OJZL 5ITFA 3IXTA 1EXUB 2CMRH 3UPAA 3MLPA 5T3ZH 4U1NA 3CZFA 4XTRC 3OXRB 1CLZL 1YDPA 4RAVB 4PRIB 4WJ5B 3KVQA 1NJ9B 4P5TD 4HDIB 4PG9B 3QCUL 4F7PB 3BEVA 5D7SL 1D5XB 3QA3B 4JHWL 3ZKND 1QSVA 2EKJA 3T2QA 3MRBA 2OI9A 5HDQH 1G7PB 5I1GL 2H3NA 3O4OC 2X05A 3WUWA 4L1HA 5GGRY 3VJ6A 3RGVB 5HHQB 1JBJA 1R5IA 4PJHE 1CYGA 5CBEA 1QLRB 2JJUA 2MPAL 5C0AB 1CIDA 3C6LD 5EBMA 4PV8A 4U7SA 4YBLB 1P7KB 5GGTL 2QJDA 4ZFOB 5EO0B 3MLTA 2DYPB 2L4OA 3LRSA 4KQ3L 2X6MA 3VH8B 4IEFB 3I9GH 4X99A 4ZUUB 5F7EH 2UWEB 3LKPA 4HFWA 1ZXQA 1R5WB 4NYLA 3DVGA 3NZHL 2Y5TA 5HPMB 1A7RL 4OFIA 5J1AA 2OJEA 4HCRH 5HHNB 3WIHH 1JYXA 5DMKB 2WBKA 2OL3A 3BEWA 1E6JL 2V9TA 1SEBB 4OGXH 4OZFA 4MAYD 4WO4C 2UZIH 3PP4L 3HTLX 1HQ4B 2W0KA 1I9JH 1QLEL 3GI9H 2B39A 1K2DB 2CLVA 3FCTA 5HI4D 3LRGA 4KK8D 3MBXL 3WN5B 4G8IA 3RX7A 3MXWL 1JFQH 1L9MA 4I18A 4Z95L 3BXNA 1EVUA 1S8DB 2R1YB 1RAMA 1EDQA 3SDXE 5IBTL 3AS0A 2P4AB 3LV3A 3SE9H 4P5MB 3TBWB 1VEPA 2R2BB 4HPYL 4JY4A 1K4DB 4O4YL 4BQCA 1IGIH 4S0TD 4BYHA 2F5AH 4PJXE 4W68A 4OUOA 5CJQL 4BKLB 3MRFA 1XF4A 5CD3B 3V4PH 1WITA 2BNRE 3EHBC 3O6FA 5GRUH 4YK4C 1JPGA 5I1EL 1BLNB 2UWEF 2AKRB 3HPLA 3H8NA 5EIQA 4DGIL 2AJUL 4C56D 2YA0A 4Y0GA 3W0WB 5FYLL 2VAJA 3ELAT 2QL1A 1CICB 4HWNA 4UV4L 2UZXB 3MCLL 4LLWB 4U0RC 5DJ6A 5I30H 1JNJA 4M7KL 3ZE0F 1YEGH 1UJ3B 1UM4L 2AVGA 5T5FH 3P77A 2H1PH 4JFFB 3L3DA 3MRDA 1WBXB 4LSRH 5BV7B 3BYTA 4IHOB 5JW5A 2Y07L 3LKSB 2C3VA 3C09B 1CR9L 4PJAA 1EHNA 3TYGL 4C83A 2YKLL 1X6NA 3OZ9L 4Z78A 1I9IL 1HHHA 2D31A 3CVIL 4RMRA 5FYKE 2V2XA 3TCXA 4U2YA 3BQUB 4JFEB 2BSTB 3D18A 3NZ8B 3D0VB 2EXWC 2ITDB 3C08L 3MLXH 3EOBB 3IU3A 4OCYL 3SQOH 5A1AA 1AFVL 4Y1AB 3U7YH 1H15A 3CDFA 3O3AB 4Y16D 2EKSB 5E2UH 4DUWA 1UKSA 1AXTL 3BX7C 3V4VL 5F96L 3FZUD 2VLJB 1GZQA 3VWKA 1MWAL 4Y89A 4ONFH 2DM2A 4FXLA 3OPZH 4F7MA 3SKNB 4DQOH 3PJSA 3NA9L 3S88H 1W72B 5GS0L 5C7XL 1T83A 1OB1B 2MHAB 4HH8A 5IJKC 5C0FB 3EFFB 2OYPA 3VD7A 5KZCD 1XGPB 3T2NH 3HC3L 1ZGLP 4PPTA 1F11B 4D0CB 3TBVA 1KTLB 5HD8C 1OTSC 4WI8A 2PR4L 4Y4FC 4EN3A 1A1NA 1YYMH 3UC0H 1ZAGA 3T0EE 4I48A 6FABL 3CC5A 3MYJA 2AGJL 3MRNA 1Q8MA 3AU1A 4WUUD 5D7LA 2YPVH 3I02B 4JVUA 4QWWC 4LCYB 1TIUA 2I07B 4WU7B 3OG4B 4GXVL 3THMH 1EHLL 1SY6H 1OL0A 1KT2B 3NIGF 3SDAC 3C2SA 4GSDH 1R24B 4PJ9C 4Y5YA 4YHPB 3EYFA 1ZGLA 3QWRA 1R5VB 5T3XD 1T22A 1KLGB 1ORSB 2R0ZL 5D6DC 1T3FB 1U8QA 1N59A 1T04A 3C5ZC 4OZHA 1KPRB 4OM1L 2A9MH 3MRIA 4U49A 3FOMA 4LVOB 1DN0B 4OF5A 2VAAB 4MXQC 2W59A 4U6VH 3JVGC 4XNQA 2EYTA 2VDQL 1EFQA 1J8HA 2EDDA 5ITFB 2NY0B 3IXTB 1Z9LA 2DQHH 3SGDH 3CZFB 2R0WL 5L2KD 1YDPB 1NMAL 2V5MA 5E8DH 4X6FA 5I1HH 5I15L 5IESL 4UT9H 1G84A 2AAVA 3AMLA 2NY2B 1ROWA 1BWMA 3WYRA 5LBSL 3BEVB 1FNEA 3OKKA 2VUYA 3GRWH 3BYYA 5DK3A 3MRBB 4O9HL 1HH9A 5DUML 2NR6C 2OI9B 5TGBA 4P9ML 4NCC1 1MJ8H 2H3NB 3WUWB 5C0RL 1B0WA 4G9DA 1OP5H 5L8KB 3VJ6B 1WFNA 3U0WL 1QFWM 1R5IB 2VDOL 1HXYA 5CBEB 2X4PA 1QSED 3GMNA 5DEZA 5DJCB 3GJFK 3HCVB 5EBMB 2XTLA 4PV8B 1A14H 4G7VH 3J8F7 5JTWA 4Y4HC 3MLTB 3KPRE 1PG7H 3LRSB 4MDJA 2VQUA 2MTPA 4X99B 4R4FH 3LKPB 4FXGA 4HFWB 1WIPA 4NYLB 1CTNA 3DVGB 5HYJE 3DSFL 5JW4M 4GBXC 3UTSD 2Y5TB 3JWNC 4IRSA 5F7LB 4MA1C 4A2LA 2OJEB 3NH7L 4JO1H 4JPKL 4K2UH 4DW2L 5J1AB 3BEWB 1DLHA 2OL3B 1F2QA 3QDHA 1MCWM 4OZFB 5IB5A 5EG6C 4XPFL 6CGTA 3TFKC 2RJMA 4OB5H 5F89A 3G5YA 4XAKD 5FHAL 5CGMA 2CLVB 3TBTA 1GPOH 4L9DA 3FCTB 4PTUA 3OKOA 1KCSL 3RIFF 4L3ED 1WF5A 4OCRL 3QHFL 1SEQH 4G8IB 1PEWA 1BF8A 2HRLA 4I18B 5IGXH 3BXNB 3LHPL 1QNZH 4KHTL 1R3LA 3SDXA 5L88H 3ULUL 4P0DA 3FQWA 4KJWC 3KPSD 4LKCA 1I3VA 2YZ1A 3WIFA 4LLMA 3DURA 1AGBA 5L6YL 3LV3B 4JFZL 5CZVL 4UINH 2NX5E 1RD6A 3S34H 3BIKA 4JY4B 4PJXA 1CF8H 4OGYH 1FH5H 4EUPG 1OTUD 4NZUL 3SDDC 4YEFA 2BNRA 2C1PA 5FHBH 4ESKA 3MRFB 1XF4B 1B6UA 1YEKL 3O6FB 4MCYA 4UIMA 1RIHL 3UO1L 4P46C 4Q7DA 1XGRA 4ZXBA 4Q0XH 1EPFA 5DS8A 1JPGB 3HPLB 4KXZH 4BM7A 2ZKHL 1AP2A 1ZV5A 4TPRH 4KTEH 4JGMA 5DJ6B 3BPLB 3C60A 1XMWA 1P84K 3BD4A 4IOFC 4P4KA 3RY6A 3P77B 2HLFC 2ZG2A 1ZWIA 1NC4D 3GKWL 1GGIL 3O9WA 3L3DB 3MRDB 1C5CL 2QSVA 4G8GD 1D9KA 4GRMA 5JW5B 1SM3H 3WNKA 2C3VB 4I77L 4PJAB 1DL7H 4DVBA 5FCUL 1CDYA 2CIKA 1JVKA 1HHHB 5IW6A 2D31B 4PB9H 2V2XB 4YDLB 4I3SH 3PXHA 3D18B 1A0QL 3S5LA 2R4SL 3IU3B 2YS4A 1RULH 1H15B 1OGAD 4ONHA 1NMBL 2MNUA 4TUJA 1E6OL 1BECA 4AJ0A 1K4CA 9CGTA 2XKUA 1GZQB 1MLBA 2G5BA 1KFAL 1UWXK 4F7MB 1LDSA 4KFZC 3VGEA 4OZIE 4CMHB 3S3JA 3HMXL 5B38A 4AYFA 5CGYC 3PJSB 1S5IH 4KAQL 1NDMA 2E6PA 3CD4A 3FRPG 4Z7NE 1J86A 3ARFD 5T1DL 4RAHA 2HJLA 3TBVB 5BZWA 1T5WA 1ZANH 4EN3B 1A1NB 3K4DA 3F7YA 4ZMAT 2IPUK 4UT6L 5GSVA 1BREA 3MYJB 4CN4A 3MRNB 3AU1B 4IRZH 5D7LB 3HE7D 2D7TH 4HX1A 4H1LA 4HT1L 3IF1A 5DT1L 1BVKA 2E9IA 2AQ2A 2KQNA 1KSRA 1H3UA 4MJ6A 4Y5YB 1WV7T 3IFPA 4LNRA 4PJDA 3EYFB 4WW2C 1ZGLB 2VSDA 3T2PA 1T22B 4F2MA 1L7IL 1IT9H 5ITBH 1U8QB 4JHAL 1N59B 1T04B 3MCG1 5FO7A 1HOCA 1MAML 4OZHB 3HNTH 1S7VA 2OR7A 3HC4H 3MRIB 3FOMB 5TPWL 1KGCD 1JZ5A 3EJJX 3QISA 4XNQB 2EYTB 2RHEA 3S4SG 2R0LH 4HSQA 3GM0A 1J8HB 2NZ9D 2WUCH 3QO0A 4X0KA 4HKXA 4X6FB 1NFIA 4KKBD 5EB9A 3OR7A 2Z8SA 4X6DE 1I3GH 1D3CA 1IKFH 3FOLA 5E08L 3SCMA 1FNEB 2K9UA 3GO1H 3OKKB 4B50A 5KSAC 3QI9D 5D4QA 1HH9B 5DVKA 4YXHL 5TGBB 3O2WH 4NFCA 3ZT5A 4NHUE 4OAWA 2JCCE 3QHTC 4G9DB 1ADQH 3GHEH 2HT4C 1DE4A 2X4PB 4FA8A 3GMNB 1BPVA 1ZTXH 4XT1C 3PGFL 4HIEA 4L9LC 3RVWC 3ULVF 2PYFA 3KPRA 3LEYL 5BO1L 4UT7L 3RY5A 2AEPL 4MDJB 5E8PA 2EDKA 4FXGB 1KXQE 5IFAH 1AI1H 4WVRA 5DD0H 5C6PB 4OZHF 5E6ID 4PV9A 4IRSB 1S9WA 1AY1H 4AL8H 3BZDA 1I85A 3VGAB 3F6IA 1KEML 4KY1H 2CLRA 1DQTA 1DLHB 5JW4N 4WIQA 2EDWA 1X5XA 1J12A 5IB5B 5K93A 4LP5A 5GJSH 5CEYA 1CBVH 4S10A 2XZQL 3BP5A 1J5OL 4NRYA 3G5YB 5DYOA 3H3BC 3TBTB 3BPCA 4Y2DD 1MHPH 4PTUB 1NUGA 2HP4A 3OKOB 1UKQA 4JQVA 3TVMC 3FO9A 4X4YA 2ILLA 1R3LB 4I3RH 3SDXB 5DURB 3FQWB 1OWWA 4LKCB 4N5ED 4XRCA 1GYAA 4G59A 2J8OA 3WIFB 3WFCL 1WZMA 3N1FC 2NX5A 4LLMB 4NN6B 3DURB 4Q9RH 1AGBB 2ADIA 1HKLH 4UNUA 4PJHF 3QEHA 4U1MA 1EX0A 3BIKB 4PJXB 3SO3C 1SBSH 2XQYK 3BH8A 5J1TC 4DGVL 4JCLA 2BNRB 3OAYH 3EW3B 2C1PB 4D9QD 5L7XL 3KYNA 4MCYB 2NY3B 3RDTC 4UIMB 4X6BA 4X5LA 5F88A 2XN9E 5IROA 1J0HA 1XGRB 4ZXBB 5DS8B 5E4EB 4RBPK 3VD9A 1AC0A 4PP8C 5IBLD 4UI2A 3AMKA 2D4DA 1AP2B 3A67L 4MD4A 4A2MA 5HVWA 5F93C 2YPLE 3LKQA 3BSZH 3LEVL 3C60B 3RVVD 4FTVE 4P4KB 1INEL 1FVDA 1G7QA 5ERWA 4PGEA 3R1GL 1RZJL 1ZWIB 2FCBA 3E3QC 3VRLE 5DC9B 3O9WB 4OCXL 4OF8A 3O3BA 1PLGL 4OIIL 4QTIH 2A77H 4FN0A 4GRMB 3I85A 5E00A 4XCCL 3WHXA 4DVBB 4U1SA 1T03H 2CIKB 2DQGH 1LE5A 3BGFC 3F12A 5IW6B 1P9MC 4XTRD 3LOWA 5I1LA 2B1AH 4PD4J 25C8H 2AEIT 1JGDA 3S5LB 4ZFOL 3SDXF 1A64A 4YHIA 4V3DB 2GAZB 4M8VA 3WNNA 4HAFA 4NC1E 4ONHB 3BW9A 1DVFA 1MCHA 2LTQB 4N0UE 4TUJB 3QFJE 1IC7L 3W2DH 4G5ZL 1QFWL 2BY0A 3RU8H 4PJXF 1K4CB 4DZ8A 5HHPA 1MLBB 5F72S 3WBDA 2G5BB 4OZIA 3Q6FA 4R90H 1OQOA 3TPKA 4CJ0A 1QPXA 4M6OH 5HHMD 2YD1A 3KS0J 4OCMC 5B38B 4TRPH 1X5KA 4U6XA 4RDQF 1NDMB 3RVUC 5HVHB 3QIBC 1WZ1H 3G6AA 1P7HL 5GS1A 1HSAA 4NQDD 5J0BA 4ODBD 2HJLB 5BZWB 4Y5XC 1EMTH 1T5WB 1CZ8H 3F7YB 1KCUL 4P23C 5GSVB 2P42B 5HGAA 5IQ7L 1MRFL 1LK3H 3VFPA 4HX1B 4H1LB 3AXLA 3IF1B 1BVKB 3FQTA 4KMTL 5C2UB 3OF6A 3EKCA 1G7HA 1CD0A 3LDBC 5CEZE 4MJ6B 2ICWJ 3VXRD 2NY1C 3CXHK 3IFPB 4LNRB 4PJDB 5GJTL 3MLZL 3RIAK 4F2MB 1KIRB 3RWGA 1DQML 6FABH 3QDGD 1UA6L 5FO7B 1HHKA 1HOCB 2UY7A 4WY7H 3BUYA 4MJID 1S7VB 1M4KA 3LS5L 2DLEA 3QCVL 2CK2A 1RUPL 4ZD3L 4U3CA 2B1HH 1CGSL 1EHLH 3WFBH 1DANU 5HY9A 3KJ6L 3V5HA 3QO0B 4XVTL 4PRPD 5F9OL 5IVZA 4X0KB 4HKXB 2R1XA 1NFIB 3D9AH 3OR7B 4XVUC 2WK2A 2W9EL 3NA4A 4R8WH 3FOLB 4H5SA 1RHHA 3CVHA 3SCMB 3QWOA 4QXGH 1DANT 2P8LA 4GFTB 3ZL4L 3OR6A 4NHUA 4S1SH 4H0GA 4OAWB 1NCWL 1DBAL 5J13C 4UOW0 3CFCH 1DE4B 3G04A 3MA9H 1Q0YH 3H9HA 1KJVA 4HIEB 2PYFB 2KL6A 1RVFH 2WWMC 2Z93A 3KPRB 4HKJA 3BISA 4PJDF 2IPTL 5E8PB 3FO1A 3CJJA 4JVPA 5E9DA 4E9LA 4PV9B 4XPGL 4ZFFA 1S9WB 1PJ9A 2ARJA 2EXWD 3GK8H 3AY4A 2CLRB 1QFUH 1GIGL 3PIQA 5IHBA 1S7XA 3DVNA 4HKBA 4A6YH 1T66D 2ORBH 3I3EA 1MFDL 1RZKL 5E70A 3BP5B 3ZO0A 4NRYB 5DYOB 4OLYL 2BSSA 5FUCE 2HH0L 3BPCB 1GSMA 4HWZA 3ESUF 1MCNA 3P2TA 1GCFA 3FO9B 1RPQA 2O5YL 3BKMH 4X4YB 4M7ZC 2QR0A 2Q8AH 3P4MA 2E7CA 2AJSL 4LRNL 1XR8A 2GUOA 4XRCB 5TQ2L 2F54E 2NX5B 1RU9L 2FYYA 1KELL 2ADIB 2NXYD 4XAWL 3QEHB 1OTSD 4U1MB 1DQLL 2YD9A 3BH8B 5AWNL 2BHYA 1RMFH 4LSQL 3IKCA 2C3HA 2BDNL 5B21A 2ZUQB 2BRQA 4QWWD 3KYNB 4X6BB 5F88B 2HKHL 4JO2H 1S7RA 5JHDD 5FGCE 2B5IC 4OIAA 5HHOA 5DRXA 2DIAA 1HHIA 5CD5C 3H9SE 4MD4B 2J8UA 2H32H 1QZ1A 2DLHA 2DQCH 4RMUA 5CZVH 5D7JC 1A47A 4RRPA 3FT2A 3MOAH 5A2IH 5EUOA 2C3XA 2XA8H 3LKQB 5J8OA 3NBNA 4WWKA 2IPUG 4F57H 5I71C 3C5ZD 5ERWB 1FVDB 1G7QB 4PGEB 3B5HA 4RISL 4XP4H 2FJGA 5TE7H 3O3BB 2NY5H 3SE4C 3QCTH 3U1SH 5MEND 4LOUD 5D7KE 5E00B 3WHXB 1T7YA 3T1FA 4U1SB 3ZT7A 4OKVA 3FB5A 4GMTH 1LE5B 3F12B 2G60H 4I5BA 2NY6C 5D93B 1OLLA 5I1LB 1I7UA 3U82B 1JPSL 1JGDB 2GK0B 5IBUB 3CIQA 3I6LD 4YHIB 4ELME 3BW9B 2XIDA 1DVFB 2VDLH 1BGXH 4DOHE 2XQBH 4HK0A 2NR6D 1DEDA 2IFFL 4DZ8B 5HHPB 3TEUA 1KV3A 2AK1L 4OZIB 3Q6FB 4KHXH 5BVPH 4NUGH 2VL4A 3HI1A 4Z7OE 5DHVH 2OL3L 3I2CH 4NJAH 2R2HA 4PIRF 1HINL 1NBZA 5DJDA 2E8ZA 1T89C 3CCHA 2Y36H 4JDTL 3HHRB 3G6AB 4Y4HD 4HLJA 3KR3L 3OJDA 5GS1B 1HSAB 3M1BA 3RJDA 3V79C 1S3KH 4QHKI 4RCAA 3UBXA 1NGZA 3W11C 3JZ7A 2IAMC 1DSFL 1TVHA 3MRPA 1L6XA 5HGAB 4X4ZA 3D39A 1A6UH 2XFXA 4PG2C 1T0PB 3GBLA 3SOBH 3SQBA 3AXLB 3WNLA 2IF7A 3FQTB 5E8EA 3OAZK 1G7HB 4GAGL 1K6QH 4H88L 4P2RD 3X13A 2VC2L 3NN8A 1QEWA 3O6LH 1II4E 1NUFA 4G9FD 5FM5O 5GZOC 3TFKD 3P4NB 4MHHI 2VDRL 3NABL 3RWGB 1RUKH 1G7LA 1ZKAA 3HRZA 1FPTH 3RWHA 1JYNA 4U6HA 3TN0D 1A3LH 1HHKB 4OLWL 3BUYB 2MOVA 3N1MC 4F15C 2BX5A 1TPXB 1Z0NA 1IQWL 5KVDH 3A6CH 4NZTH 4UIKH 3P3YA 5HY9B 5FYJD 4OZIF 2JK5A 3V5HB 3K1KC 5GISH 3WJJA 3S36H 5IVZB 1KN2L 5GGQH 2R1XB 5EOQL 5IEKA 3SDDD 1MHEA 4Z7NF 5K9JH 1YNKL 1C7SA 2NZIA 4H5SB 1RHHB 5EULV 3W39A 1R3JA 3MLWL 3CVHB 2MSPA 3QWOB 4JKLA 3V8CA 2P8LB 5FGSA 3OR6B 4NHUB 4OLVL 1QOKA 5JOPE 4CGTA 3P9WB 2BP3A 3WFZA 1MCPL 1M71A 3V2AR 3MODH 3QUMA 1C1EH 4XP9H 1NCBL 5HHVL 3B9KC 3G04B 1GAFH 3TESA 5SWSD 2ADGA 3H9HB 1KJVB 4R2GD 4APQA 2V7HA 3MLUL 3OJVC 4AMKL 1TFHA 1J1PH 1P4LA 2CK0H 2Z93B 4HKJB 1IRAY 4Z7WE 2H6PA 2F58H 3BDYH 3DRQA 4NGHH 3ZE1E 3U6RA 5F6HJ 3FO1B 1QRND 2I26N 2XZCH 4XBEL 3NCCB 5E9DB 4ZFFB 3IFNL 2HVJA 4HXBH 1QD0A 1H8SA 1OAKL 5GRVK 3PIQB 1S7XB 3DVNB 2D0GA 4HKBB 5L0QB 3FO0H 4RGNC 1AE6L 1UVQB 5IM7A 4N0RA 1ZVSA 2J6EA 3EO1A 1LO0L 3MRGA 3MGAA 5JXAH 5LGKA 4X6DF 3TP4A 3T65A 2BSSB 5FYJH 3RVXC 3F65A 4HWZB 4LSSH 4JLRA 1EUUA 4WFGD 1BF2A 5CGYD 2QR0B 3PABA 5ETUA 3P4MB 3T0VA 5GS0C 1XR8B 2GUOB 3BN3B 3I6KA 1XIWC 2E7HA 4NIKB 2FYYB 1RUQH 3RGVD 3ILQC 3SGKA 4LSVH 4H25A 4JHZA 3T77A 4ENEC 4M93B 5JR1H 3IKCB 3QP3A 3ZDZE 1PYWA 5HDLA 3MLYH 3SGDI 3EBAA 3L3HA 1G0XA 2V5SA 3BWAA 2A9NH 3O41A 3T0EC 1S7RB 3UDWC 4JB9L 2IPKA 3H9SA 2GFBA 5HHOB 5DRXB 1HHIB 2DKMA 5ILTL 3IFOA 2J8UB 3AAZA 2YPLB 1A7QH 3NCJH 4EIGB 3FT2B 3R4DA 1ZEAL 5EUOB 2DL2A 15C8L 4P2CG 4UTBL 4O51A 4WWKB 5I1KL 4QGTA 4LU5L 4AENA 2FJGB 5DMYA 4M9OA 2IBZX 4JQXA 1ITBB 3KXFA 5H2BA 2GSGA 2DLTA 3T1FB 2HVKA 4OKVB 3FB5B 4TULL 1A3RH 4I5BB 1I7UB 4X6CA 5C0CE 2VDML 4ELMA 2XWJA 1INEH 5KBNC 2EIBA 1U58A 3AB0C 2X70A 3NCFB 3DO7A 4YHLH 2W07A 4KQ4H 3NFSH 4HK0B 3EJYC 4XC3L 2F5BH 3K2UH 3WLWC 5SX5K 2HT4D 3HI1B 4HGMA 2NY7L 4PY8J 1PSKL 1FSKC 5TDOA 2R2HB 3SN6N 1S78C 2I25N 1NBZB 2BHZA 1G6RH 5DJDB 2GJ6E 4Z0BH 1MLCA 1NBYA 3CCHB 3C2AH 4BK4A 4TQEH 1N5YL 3OJDB 3M1BB 1O0VA 5HI5C 1CICD 3UBXB 1NGZB 5H94A 2KQMA 1REIA 3QUZC 3VRLF 2BVTA 1CD8A 2ADFL 3RHWK 1TVHB 4OLZH 3MRPB 3B2UD 3D39B 2XFXB 3HG1D 3O6KH 4L8BA 2BXYA 2QEJA 1FDLL 1OAYH 4GO6B 3CFBA 4JZJC 5E8EB 4D3CH 4YDIL 3X13B 3NN8B 1MCIA 2X4NA 1QEWB 3HLAA 1YMME 4KTDH 3BQUD 3O6MH 2VDNH 1LEKA 3M8OL 3VXUE 3KYKL 4NWTL 2A1WL 1T2XA 1G7LB 5BMFH 4U6HB 4MNQD 2JB5L 4FFZL 4KXZI 3D69B 3TVMD 3GMLA 3H0TA 1EO7A 4R4BA 3SDCA 5D72L 3SJVE 3ULUC 5JUEH 3TM6A 4GAJH 1FYHB 2JK5B 2ZNXA 5INDA 5GJTH 5J6GA 2KZ1B 3EZJB 4HLZG 3RI5K 4OI7A 1KPUA 4IJ3C 3N0PB 5IEKB 2AXFA 1MHEB 4JZNA 4PJ8A 4Z76A 5AG8A 3W39B 1MFCL 1UENA 1R3JB 2ID5A 4LPUA 4QRRE 1MELA 2YUVA 2UVEA 4MVBC 2OR9L 3K74B 3N85L 1A7NL 4AQOA 5DRNA 5CEXA 4JQIL 4U1JA 3HNSL 5IR1A 1M71B 1CDJA 2Q3ZA 3QUMB 5EZIH 4DWHA 4KJYA 2ZUYA 5E2VL 3IXAA 3DXAE 3ZTJG 1GHFL 2ADGB 2CGRH 4NP4L 4I0PA 4APQB 2ZCLH 2V7HB 5BV7H 5E99L 1IGFL 5TFSH 3SKMA 1P4LB 4XMLL 3NAAL 5D1XD 2H6PB 3OSKA 4GRLC 4BFGA 4TUKH 4NRXA 3BWUC 3DRQB 5CILL 3U6RB 4GW4A 5I0DA 2HT3C 4OFDA 5EC2A 2DLGA 3EO0A 2A38A 1BFTA 3E8UH 4YDKL 4UOW1 4LGRB 2HVJB 2X10A 1JHKH 3WEXA 1A6PA 1VADA 1AD9A 3CMOH 4LHUA 5JO5A 3STLA 3V6ZA 3WCYA 1Q72H 3FFCD 1IC5L 5IM7B 4K94H 1ZVSB 1EBAA 3EO1B 3MRGB 3VFOA 3GB7A 1EO8L 5B4MC 4XVJH 3T65B 1P4IH 3EOTL 3QJHB 5BRZE 4YQXH 3QDMD 2K3TA 4JLRB 2DQTH 1W72H 4Q9QH 3QIUC 4PJ7E 4CU8A 1G7IB 3PABB 5ETUB 3K8LA 3RVUD 2IQ9H 3SGJA 3I6KB 1TJIH 1MFDH 5DWUH 1CFQA 2DWDA 5KSVA 4MD5A 4H25B 3T77B 3QDJD 1ES0A 1EGJA 4JAMA 1YZZA 4P23D 1MEXL 4R7NA 4HJJL 1PYWB 3EYUH 5L8LB 1QSZA 2AEWA 1R3IL 1A8JH 1P5UA 2X4TA 3L3HB 3BWAB 5FGCB 5TDPA 5TJWK 3O41B 1A22B 2KZWA 2DD8H 4KRPC 1LHZA 2IPKB 3H9SB 4ZFGL 2GFBB 7CGTA 1VGEH 3IFOB 4HC1A 3B9DA 3AAZB 5M7QA 2GSIA 4NQCE 1CL7H 1EJOH 5HPOA 2P1YA 2FH6A 4LEXL 3S37H 4NQED 4O51B 5C0BD 4DGYH 4HMDA 3MZTA 4GKSA 5EFIA 3K3QA 1E27A 4TNVF 2BY1A 1EEUA 5I9QC 4AENB 2F9BT 1DBKL 4YC2B 3MV7D 3KXFB 3QXAA 5H2BB 3NFNA 2GSGB 2DDQL 1N0XL 1JF6A 2HVKB 1ZMYA 1ZLUK 3LN9A 3BRDA 1YN7A 5DFWH 2RCSH 5FGBA 4X98A 5C0CA 3BJLA 3JV6A 1ZHNB 2J12B 4XVUD 4X6CB 4YIQA 1BJ1J 4ELMB 1JE6A 2XWJB 5LCVH 4HUNB 1JPFA 1U58B 1LO5A 1GOFA 2X70B 3D5OF 4DOHB 3RA7H 3DO7B 3BP4A 2XRAL 4U1GC 2BSRA 3F8UB 3HNVL 5F71A 4LSPH 4OQTA 5KW9H 3D0LA 3TNNA 2D9QB 4EDWH 3L5HA 2GJ6A 4NWUL 5TDOB 1MLCB 1NBYB 2WLYA 2WWMD 2Y25A 4ZUSA 3ARDC 4XPTL 1ZK9A 3QQ4A 1BFVL 1AR2A 4OF7A 4R97B 2OP4H 4PJ5A 1LO3H 2QADB 2R4RL 5H94B 4FFYL 3MLSH 4KRMB 5BOPA 1Y18A 2DB8A 4WUUE 1C7TA 3DLQR 3OHXA 4L8BB 4TOYH 5I73B 4CRPA 3CFBB 4OZFH 1C5BL 3ARQA 2X4NB 4JREB 3HLAB 3VXUA 3E2HA 4WEMB 4LFHG 3QB7C 5T3XE 1DLFL 1LEKB 3WIHA 1FORL 1QR4A 2J4WL 4ELMF 1Q9LA 4HWBA 4DAGL 1G9NH 4MB3A 4K23H 3GMLB 1FYTE 3H0TB 1CDCA 3EFDH 3SJVA 4WW1A 1FGNH 1JTTA 1OPGL 4YHKH 4R4BB 3SDCB 4ZOCA 4ZUWA 4Z7OF 4EIZC 1A1MA 3QRGH 4LL9A 5INDB 5J6GB 1NBVH 3FQNA 4RNRB 2BSED 5L2KE 3TIDA 1KPUB 3N1QC 2AXFB 2J8HA 1W2KT 4PJ8B 4Z76B 4QRRA 1RIUH 1BBJA 5HGGS 4U33A 2NY4B 2QSCL 4EN3D 2F19H 3RWJA 1OQXA 5DRNB 5CEXB 4MCZA 3NIDF 5TE4L 1MCRA 3RAJH 4M1DH 4U1JB 1D5ZA 5IR1B 4LGSB 1MCKA 4JCMA 4O5LH 5D7LD 4NPYA 2I9TA 4KJYB 1CDHA 3C6LA 2GTWA 3IXAB 4LSTL 1LO4H 2OMNA 4HUWA 1YUHA 1KCVL 3V6FA 4I0PB 4PJFA 2FBJH 3PL6C 4K8RL 3SKMB 1RZJC 4LK4A 3WFDH 5I17A 4FZEH 2C3GA 4NRXB 4CVUA 3RVTC 2IG2H 3D2UD 5C70A 2W0LA 4GW4B 4W70A 4MAUL 3G5XA 3JWDH 3UTSE 2NY6D 5EC2B 4ZNEA 3EO0B 5EUKA 4L3CB 3WEXB 4MAYA 4E41E 4YNYA 1VADB 4LHUB 1AD9B 4PREA 5JO5B 3TGXA 3STLB 1SMOA 3V6ZB 2P7TA 4HMEA 4L29A 5GS2D 4S2SA 1S7UA 3MACL 4X4XA 1JPTL 1KG0A 3W5NA 3VFOB 3GB7B 2YK1L 1TDQA 4K71C 4PJ7A 5EU4A 1BJMA 1VCAA 5I19L 5DC4B 5C6WH 1IMHC 5D1ZC 1MJUL 2SEBA 3BGMA 5DD3H 4FQ1H 3FN0H 1CFQB 3E0GA 5KSVB 4MD5B 2EYRA 2EDQA 2GJZA 1AQKL 2XKSA 2IAMD 1ES0B 1VACA 1T1YA 1WT5C 4JAMB 4LMQI 1UYWL 3IS0X 2XZZA 4R7NB 5C92A 1MQKH 4Z7WF 4POUB 4P57A 4D8PA 1NBQA 2X4TB 2ZG1A 5TDPB 4YHZH 3ULVH 3ZE1F 4PDCE 2J1KA 1CXLA 4C56A 1J8KA 3HI6H 1J0KA 2GSIB 5GZOD 2FHFA 2XG5A 4IRSD 2DQUH 4W4NA 5FA3A 1FLRH 1SY6A 2UUDH 1RUMH 1OP3K 4MB5A 3WO4B 3W82A 1RFDL 4GKSB 5EFIB 4PD4K 1E27B 2XY2A 4S0UC 4JG0L 4LCCC 1JWMA 3B9VA 3QXAB 5FO8A 3NFNB 5ID0A 1UWEL 3SDYL 1AJ7H 5ADOH 2XZAH 4EI5A 4N8VA 3UTQA 5GS2H 4FQQA 4XP6H 2X89D 1YN7B 3GSUA 5ILTH 2HAZA 2ZG3A 5JHLH 1QUNA 2E5EA 4X98B 5C0CB 3TT3L 1TMCA 3JV6B 2LFGA 4UTBH 4YIQB 4OJFH 4GT7A 1BQLH 1JPFB 1J1OL 1PX3A 2DL9A 1LO5B 2DM3A 3QZWA 4G6AC 3W9DA 4Z8FH 3BP4B 2EECA 3MTRA 1NCCH 3ZDZF 4DFHA 2BSRB 1QSFD 4JKPH 5F7FA 3D0LB 4U0QB 3QQ3A 2R29L 5AZ2L 3TNNB 2N1KA 1G9ML 2GJ6B 3GRWA 2JJWA 2DMKA 3BO8A 4BZ1L 4P59L 3IDYC 1Q1JH 2FRGP 4ZUSB 1U8JA 4N0CC 2D0FA 3DX6A 4HG4J 5TDNA 5BS0E 1ETZA 4PJ5B 4C55A 1CFVL 4KJQC 4N0YH 4XMPL 1AO7D 4YGAB 2EDBA 4P4KD 4WUUA 4M4PA 3WFHA 1Y18B 1L0YA 3T1WA 1YYLL 1IAIH 1RJYA 4UILL 5KVEH 4YBQC 4YFLF 4GAFB 4LSUL 2B0SH 1I9RL 4GW5A 3SY0A 4DVRH 4RGND 4HZAA 4DEPB 3VXUB 3E2HB 5JIIA 1FIGH 2D2OA 1RZKC 4J7RA 2G9HA 1JWUA 4FXKA 1Q9LB 1ZHKA 2YD8A 1UM5H 4N8CL 1F3RB 5FUZL 1I8MA 4OSUH 1E4KA 3SJVB 4WW1B 3MCKA 3QJFB 4GMSH 4ZUWB 4FQ2L 1A1MB 5GRJL 5L2KA 3ILQD 3WLBA 1MFEL 3O3DA 2FB4L 3FQNB 4HF5L 3CLEH 4ENED 1T5XA 3TIDB 1F58H 5J7CC 2HKFH 3GSQA 1X5AA 4QCIA 4QRRB 4FHBD 4KDWA 1BBJB 3PQYE 3F5WA 3T0ED 1KYOJ 2HJFA 3LRHA 3PV6A 3RWJB 4MCZB 3VI3E 4OIBA 5J4MA 3UJIL 1D5ZB 1FLTX 3MQIA 1T0MA 1QSEA 4NPYB 4M1GH 4KMQA 2I9TB 1N6QH 1NGWA 4LVHC 3C6LB 4V3EB 2GTWB 3MZGB 4HUWB 1YUHB 3V6FB 4YX2H 2GT9A 4OCWL 3QAZB 4PJFB 3WS6A 4TSBL 4GS7C 5I17B 3MLVH 4GUPB 2RB8A 1T4KA 3AREC 1HNFA 1N0LA 3EYSL 3FQXA 5FYKH 4JY6A 2OI9C 1KTRL 5D1QC 3UYRH 2WMPA 4ZSOE 3UTSA 5J6HA 2NTFA 5JDSA 3G5XB 5CS7A 5H35A 1TZGH 4MA8H 4KVNH 5I1IL 5EUKB 5JW3L 1MJ7H 5DQJA 4JG1L 2YBRA 5D9SA 3Q6GL 4E41A 5EA0L 4MAYB 1ZOXA 3LSOA 4YNYB 3N9GH 4PREB 1P2CA 3HFMH 4ZTOH 3GMRA 2P7TB 4L29B 4S2SB 5F1IA 1S7UB 5BZDA 1OARH 4X4XB 1KG0B 4CVZA 1A9EA 4RGMC 5H37H 2EE2A 2YUZA 3BPNC 3WLWD 2IEPA 1WWCA 3EYVB 4PJ7B 5EU4B 4PJIE 1S78D 3KPSA 4D9RD 1KC5H 3VXME 3BGMB 2SEBB 4KGJA 1KCRL 3LQAL 4WI2A 4QKXB 2PETA 3QUXC 2V5RA 5HI5D 1IAOA 4H20L 2EYRB 2GJZB 4UB0L 3ALWA 3AROA 1VACB 1T1YB 3QUZD 4Z9KB 5C9KA 3F7QA 4K3JH 3WFEH 4PJFF 3OG6B 1HNGA 1LDPH 4H1LH 2A0LC 4P57B 2OLDA 4D8PB 1M7XA 3C8HA 1U42A 2L0DA 3HUJE 4C56B 5HYJD 1NSNL 3EDDA 1CN4A 3IU4L 4IS6A 1OW0C 4QHLA 2X1PA 4AEIH 5C3LD 5MP6L 5FA3B 3P11H 4KK6C 4YHML 1NC4A 1EFXB 4M7LH 5FYJU 1UGNA 4G8GA 1ACZA 4LPWA 1HWGB 2P5WE 1JWMB 4MZ2A 5ID0B 5FO8B 2OK0L 4EI5B 4N8VB 3ULUD 3VMPA 3UTQB 3ZYJA 3QUML 2GY7B 4FQQB 2R1WA 3KHOA 3EYQC 3GSUB 5ESVA 2IH3A 4PJ7F 5C6TH 2FX7H 1TMCB 3H3KA 3I3DA 4K7PL 1WIUA 1HILA 4MS8C 1OGAA 1DZBA 2R56L 5ENWA 4YXKL 5DMGC 3KLDA 2BFVH 4M48L 3QZWB 3VG9C 1JHLL 1IGCL 4FFEX 1OSPH 3W9DB 4RA0C 2VKWA 3WJLC 4I8DA 4L4VE 4Y7MA 5HHME 4YWGL 3QQ3B 3HR5A 4FFVD 4I1NB 1GZPA 1MFAH 3MC0A 5T5NF 3BT2L 5KZCB 3BO8B 1JJUA 5F6IC 3ARFA 4FP8H 1GJIA 5DVNA 1RY7B 1ADQA 1U8JB 5EU7C 4NQDE 5BS0A 3DX6B 4P3DA 5TDNB 5GGVL 1I3RB 3KLHC 4L4JA 5FOBA 1YJDL 5DD5L 3O8XC 3VWKC 1LO2H 4OQ1A 4WUUB 4PY7A 4DTGL 3L6FA 1IJ9A 3HE7A 4WGWB 1T2JA 3WFHB 5JQ6H 3HNVH 5EWIH 4XWOD 3U9PL 1NCAL 1RJYB 5KS9A 2JJTC 3DVFA 5F44A 3ETBF 4GW5B 5EU6D 3SY0B 3VXRE 5EZJA 3O3EA 1CLOL 2AEQH 3KJ4B 1DBML 4IM8A 2G9HB 4FQCL 2OZ4H 4O2EA 1JWUB 2CJUL 3TJEH 1QKZH 1ZHKB 3V4UL 4XPBL 1W8NA 4MJIE 4LQ1A 3QIUD 2DQJL 1I8MB 1HZHL 1W8OA 1PGRB 4M62H 4NT6A 3MCKB 4GXUM 3MLRL 5FKAA 3MA7A 1BIHA 1G0YR 4OV6F 4F3FA 1QLFA 4ZTPL 1VFUA 2YMXL 2JLLA 5E2WH 3WLBB 5L2KB 4PRPE 1L8JA 4ODHL 3O3DB 1I7RA 1AGEA 1T5XB 3V6BR 1IARB 3BE1H 1QBML 3P0VH 1ZT7A 3GSQB 1FBIH 2ATPA 2QQKL 4QCIB 4ODTL 1A6VL 3QI9A 5ICZA 3F5WB 3AM8C 1HYSD 2HJFB 4FABL 3PV6B 1A6WL 4HWEH 1X4YA 3G6JE 4OD3L 2ED8A 2Z0BA 4FFWC 4NC0B 1T0MB 4K55A 1CT8A 5I18L 4N8VG 1QSEB 3UJTH 1BAFL 5KSBE 1NGWB 4M7JH 4UOJA 4X80H 3U4BH 3ZKXB 1BQSA 5CZXC 3MBEC 1VGKA 2GT9B 5D5ME 4ZPVA 2QQQA 3V52L 1FL5A 2VDPH 4LCIH 1T4KB 3ARUA 4ZSOA 4MLSA 3FQXB 4JY6B 1I9EA 2FD6L 3DSNA 3QZWG 5E6IA 1CXIA 3UTSB 5J6HB 2NTFB 5JDSB 3PWJA 5H35B 4MDIA 3DBXA 3H3PH 1X44A 5DQJB 2EIDA 2YBRB 3OAUL 4IDJH 5D9SB 4E41B 3CFKA 1EHXA 1F3JA 4WCYH 4ODSH 2O5ZL 4YE4L 3LSOB 1IC1A 3VA2C 3ROOA 1IAKA 1P2CB 3QUKA 3GMRB 2ZUWA 5MI0B 5F1IB 4JJHA 5BZDB 4I2XE 1A7PH 4CVZB 1JGUL 4Y2DA 3S35L 1A9EB 1YQ2A 2OQJA 4S1DC 3TV3H 1TCMA 4TVPE 4L1DA 2FIRT 2IAND 1H3WM 1VESA 4G6MH 4CADA 2GIYA 4RFOH 2D7MA 4JR9L 4N5EA 3KPSB 2ZOKA 3NGBC 2KPNA 4O58H 1FG2A 3D85D 4K9EL 4RQQA 2W91A 1U95A 1KUMA 4S0SD 4AY0A 2EYSA 3C5JA 1IAOB 1JN6A 1UWGH 5BXFA 3MUGA 5CUSL 2YSSA 4L8CA 4TNWK 2VMFA 2B4CH 2Y9RT 4DUXA 3ZTNL 2N7AA 1KB5L 1HCFX 3TF7C 1EEYB 4S1RL 5ISZE 4C57C 12E8L 4NHCH 3WSQL