1P1ZA

X-ray crystal structure of the lectin-like natural killer cell receptor ly-49c bound to its mhc class i ligand h-2kb
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
272
structure length
255
Chain Sequence
HSLRYFVTAVSRPGLGEPRYMEVGYVDDTEFVYEPRARWMEQEGPEYWERETQKAKGNEQSFRVDLRTLLGYYNQSKGGSHTIQVISGCEVRGYQQYAYDGCDYIALNEDLKTWTAADMAALITKHKWEQAGEAERLRAYLEGTCVEWLRRYLKNGNATLLRTDSPKAHVTHHSRPEDKVTLRCWALGFYPADITLTWQLNGEELIQDMELVETRPAGDGTFQKWASVVVPLGKEQYYTCHVYHQGLPEPLTLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, K-B alpha chain
publication title Variable MHC class I engagement by Ly49 natural killer cell receptors demonstrated by the crystal structure of Ly49C bound to H-2K(b).
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 52
structure length 255
sequence length 272
ec nomenclature
pdb deposition date 2003-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1p1zA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1p1zA01
5DGQA 4PBVC 5I6XB 4HLZH 3SE9H 4JFEA 3T3MF 3C8HA 4KRPC 1UZ8B 4HUXB 4MGXA 4R4BA 4PJCB 2Z8VC 4KRPB 1F4YL 4NKQB 4P4RA 3O6MH 4O2CB 4D8PB 2D0FA 1QRKA 1MHHA 4PGDA 3GBMH 3BKJH 1ZK9A 1P4BH 3VFRB 4IRZL 4QT5B 4PJXE 2NY2D 4XWGH 1R5WA 5IFJB 1CFBA 3GSQA 4XGZB 5MEOA 2D7PA 4NNPL 3X3FH 2J88L 2D2OA 1NEZG 3CCHA 1T3FB 4TUKL 1T5WB 3U30C 4PGEB 4OCSH 2FSEB 3ARVA 1MWAA 1T7ZA 5CUSH 3LZFH 3U30B 2ZOKA 3KPPB 4BH7A 2Z35B 1CWVA 5E6YA 4ZSOB 3T8XB 1BOYA 1L7TH 2YA0A 3BP6A 1AD0A 2EYRA 3SO3B 4OBSA 3MRKB 3MNVA 2I60L 1A7RL 2PO6A 3KS0J 4JJ5A 1JNNH 4I2XE 2P8MA 4I3SL 3AREA 1A7QL 2V5MA 3QUKB 2K7PA 4G42B 2GQHA 1I3GH 2HT2C 4NQEB 1AFVH 3UYRH 4R96A 3VXMB 3DV4B 1T0MA 3EOAA 5DFVD 3ROLA 3QPQD 2NXZB 5HHVL 1IC7L 1R3LB 3OXRA 4HV8B 2UZXB 4HLJA 2YUZA 4NUJB 3C6SA 3PABB 3HR5A 2ATKB 1FNSH 1P7QD 2GCYA 5TDNA 2Q76B 1ZT4A 1AGEA 4K3EL 2EZ0D 5D7SL 3X3GH 4JG1L 4OLYL 2BSSB 5EZIL 1W8OA 4F33B 3ULSA 2UZIL 1MCJA 3T2OA 4U7KA 3TH2T 4NFBA 4GBXD 4IDJH 4Z7WE 4JHBA 4Y1AE 1CD0A 3QIWA 4JGUA 5F70A 5T3XL 1FNFA 4GQ9L 3RA7L 5IESH 1NUNB 1ONQB 1HQRA 4GW5A 1P7KA 1LK2B 3QB7C 4WU7A 4EI5A 3BKMH 2WINB 1YEGH 3V6ZB 2OXGA 5IM7B 4JREB 2VE6B 5KOVC 1WAAF 4OD1L 5C0AE 2GIYA 1ZOXA 3WD5H 3WJLC 3RY5A 5KJRH 4ZDHB 4YGVB 5T1MB 3O2DL 2JF1A 1I8KB 2ZG2A 2L4OA 3GGWA 4JVUA 1U42A 2FD6L 1U8KB 3IFLH 3JUZA 4HCRA 3P4MA 1EEUA 5HGAA 2GITB 2R2BA 4ZOAA 1RUPH 1RK1B 1IT9H 5TDPB 3O11A 2NY2C 3DVFA 3V0VA 2Y06H 3BMVA 3VFOA 3WIHA 4PB0L 2NY2B 1S7WA 3K1DA 4F7MB 4KUCD 3B2UC 1LEKB 5DK0A 1E28B 2GK0A 2R8SH 4OLXL 1SEQH 3O4OC 2Z92B 5I71C 4JM2A 5JA9A 2C7UA 2X4NB 3ARGA 3DECA 4OF8A 5A2JH 3LY6A 3O4OB 4PV9B 5I71B 4PJEE 1EO5A 4HLZG 1DFBL 2Z4QB 3R1GL 5M94B 3OKMB 5DQDH 4Y2OA 3TNMB 5GHWL 3DX8A 4L4VE 3RZCD 3L3OB 5L2KA 1RULH 4LAQL 1PSKH 4OCRH 4YBHA 1KGCD 3F5WA 2DKSA 1XMWA 4FA8A 3UTSD 1JWUB 2BVPA 3IXTA 3BMWA 1J05B 2NY5L 3NA4A 1CICD 1A6AB 1KTDA 1JFMA 2XPGB 3QPQC 3C6LB 3K2UH 1OQOA 4LHQB 5D2NE 4PJAF 3FRUB 4XI5D 4EQ3A 1HHGA 5I66A 2VZVA 4I18A 4DTGL 1N5AA 4M1GH 4IOIA 3GMRA 2EZ0C 3EFFB 3OKOB 5JHDE 1P7QB 3VJ6B 3D39E 2YD8A 4GBXC 4JY4A 3ZDXE 2JIXD 1KJ2A 2OLDA 2ZG1A 2YPLA 4A2MA 4GBXB 2HN7B 1NAML 1X5IA 2Z31C 4PG2A 1ORSA 5ISZB 1OSPH 1UM5H 1V3LA 1WBXB 3QI9B 3TJHA 3D0LB 5D93B 3HC3H 2VDOH 4H1LA 2B0SL 5HHMB 3V4UH 4M6NH 2VQ1A 2RFXB 4N1HB 4JRYD 3V4VH 1F6FB 5IW6A 4Y19E 5DD6B 3RWCB 4W6YB 1D7FA 2ZKHH 3C5ZB 3L6FA 5KSUA 1FG2A 1F4XL 2V5SA 3TP4A 4X6CF 2WQ8A 2A6IB 4TVPD 4NRYB 5J9PA 3TVMA 3QWOA 3KLDA 3O3EA 1D5XA 4WUUD 4DFIA 5I16B 2Z9TA 4NN5C 4Q6IB 3D2UB 3LHPL 4F7TB 3L7FB 4NP4H 5C08A 4LLDB 1Q0YL 4U2ZA 2A6JA 1BF8A 3DSFL 2HLAA 4JDTL 1ZA3B 5DXWA 5MERB 2EDQA 4PREA 4KY1H 4MA3A 3JWDC 4F7CB 3L7EB 1X44A 5ICZA 3ULUF 2FH8A 1BJ1H 2PW2B 1WTGT 1A6UL 1NFIA 3DX6B 4GAGH 1EJOH 3QCVH 2PXYB 3IGAB 2HTLD 3MRPA 4FFYH 4V1DA 5JPNB 3QDGB 4YHOH 1NKRA 3BESR 1X6LA 4KJQD 3ZL4H 4YHZH 5IWLA 5GJSH 3QH3B 5JW4N 4P2RD 3RZCC 5HD8D 1QLRA 3MV9E 5DVMA 2I5YL 2Y7QA 2C4FU 4F9LA 2PKDA 4NHUE 4HKZA 4BSWB 3M8OL 2WUBL 4HXAH 3VH8A 3UTSB 3Q48A 2VQUA 1NLDL 1WZMA 1CICC 1TIUA 3FONA 4U0RB 1E27A 2BOBB 5DHXB 1Y6MR 1BFVH 1CICB 3R8QA 3GIZH 5HGBB 4IOSD 2H1PH 3UBXB 4XI5C 3KPMA 4RCAA 2A77H 3CSGA 1J1OH 1QRNA 4UOW1 4X6DF 3CDCA 1QA9B 3RTQC 2YRLA 5L8LB 3DSNA 4J3XA 2XWJB 5E70A 5KSAA 3FHQA 4JVPA 1UWGL 4EI6A 4S0TD 5I0DA 1QQDB 3F65A 3QCUH 4QRRD 1IEHA 1NC2D 2YMXH 5JPMA 2JIXB 4JANB 3MRGA 5GS1A 2R0ZH 5CJ8A 4PJIA 4KQ4H 5ALCL 3UJIH 4K23L 2R56H 2GY7B 2VR9A 3VFUA 1QLFA 1IAOA 3GSNH 1ZWIA 4MWFA 3RWFB 5E5MB 4G8GE 4WI2A 1M05B 1TXKA 2EYSB 2I07A 5C0BB 5EUKB 4X5XA 3WNOA 5IJKC 2QKIA 5F7KC 1ZHNA 3P0GB 3QFJB 3WFHB 3SQBA 3EHBD 1LP9F 3VFNB 1W72B 3F7RA 3EO0A 1FO0B 3SY0B 5KS9A 3UJJH 1B9ZA 5ICXB 2IALA 4BKLA 2BSED 1U8JA 4PUBH 3RX5A 3M07A 1Z5LB 3IFPA 1AY1L 3EYVB 5E9DE 2CH8A 3F8UB 1JFQH 5CP7A 3ZE0E 5F71A 4JQVA 1LEGB 3EYUL 3VFTA 3EUUA 1RI8A 4HFWB 5EA0L 5JORB 1JHLH 4RGOL 3PJSA 2VL5B 1DCLA 5LGHH 2HTLC 4IRJB 5HHQB 2X4UB 3EDDA 4CJ1A 2VO5A 5GXBB 5IFHL 2XT1B 4EDWH 3BIKB 2NY0D 2XNAB 3AS1A 3DGGB 4D3CL 4L8DB 4ZUWA 5GGSY 5HD8C 1PQZB 3OHXA 5DF0A 3GSVB 4JLRA 1XCTA 2CGRH 1I3VA 5TH2B 3STLB 3JVGC 3U9UA 1LO2H 4FFWD 4MX7A 1O7SA 3TIEA 2EXYD 2JCCE 2LV4A 4WW1A 1XGRB 3HZVB 4NSKB 3WFEH 3WIIL 2R1XB 3HPLA 5HGDB 1LK3L 4L9DA 3QA3A 5E1AB 3MCLL 4JFOB 2HA1A 4M9OA 5DA0B 3G5YB 4NM4L 5EBLB 4J3SA 1F4YH 4MAUL 5BW7C 1CDUA 3GMQB 4GW1B 1KIQA 4LOUD 1X5YA 4R2GB 3MRFB 3G5ZB 1CD9B 1L9NA 2DQHL 4IRZH 1IAKA 1A6PA 5IROC 1AGBA 3VXRB 2IANA 5JW5B 4NNPH 2J88H 4X7TB 3B9KD 4YFDB 2FECI 5B39B 4TUKH 3IJSB 4Z7NF 1DBML 1QR4A 2CIKA 1J0YA 2GFBA 4Z7QF 3BVNA 3D69B 3WFBL 1A3QA 3HG1A 5DRNB 2EKSA 3FB6A 1AIFB 1OW0A 2EC8A 4M48L 5I9QB 4HUWB 5IEKB 1EEZA 3EHBC 5IQ9A 5DJZB 2R1WA 3P4LA 4A6YL 2OSLA 4C56A 2WLYA 3AC0A 4MB3A 3QWRA 2I60H 3QDJA 1M6OB 3ETBF 3VGFA 1A7RH 3SPVB 4BSJA 2XQBL 4I3SH 1A7QH 1BBDL 5E95B 1V5JA 4KV5E 3OKYA 1ZMYA 2NQCA 3ECBA 1FVCB 1YY8A 3NBNA 4P2QE 5DJAA 5HHVH 1IC7H 1HWGB 1ORQB 1TJGL 4APQD 1OP3H 4V3DB 4PJHB 4HWZA 1JYWA 5E24E 2N7BA 4Y5VC 2FWOB 3TF7C 4P5TA 1GCFA 4K3EH 4GT7A 1J0KA 4Z95L 4Y5VB 3HNTL 5D7SH 4JG1H 4OLYH 5EZIH 2CIIA 1KTLB 5EH1A 2UZIH 4JM4L 1KPRA 2NY0C 4ZFOB 1JMZA 2E7BA 4OTXL 5T3XH 4GQ9H 3RA7H 2QBWA 5EOCJ 1VB9A 3BI9X 5ESAB 7CGTA 5D7JD 1UACL 1U58A 3IDJB 2EDDA 4GAFB 2MQ3A 3MNWB 4FFWC 4U1IB 5F9AC 2EXYC 1TENA 4OD1H 4PJDF 2D7OA 1B2WL 1QEWA 2SEBB 4KMQA 3O2DH 5DMIL 5L6YL 1FVDB 2FD6H 2CDEB 3ESVF 2MTPA 4WY7L 1BVKA 3MO1B 4LLUB 1QSFA 4IRSD 3M45A 1WZLA 2EIZA 3GKWL 1YN6B 4LOUC 2Y5TA 2YKLL 1MCFA 4NWTL 1JYXA 1OARL 2WW8A 3CVHA 2DWEB 1I8IA 4HJ0D 4FQ2L 4PB0H 3B9KC 1T2JA 4FQCL 1MCWW 1VENA 2DLHA 1INEL 2VLRA 3WIFB 3B9KB 2DKUA 4OLXH 3ARXA 1G7LB 2XZZA 1YPZF 2YZ1A 3HI6L 3EYOA 5EO9B 5E8PA 1DFBH 1S9WB 3FRPG 3R1GH 4G6AD 3QNZA 1FZJB 1NC4B 2AJ3B 5F6IC 5GHWH 4BM7A 2H8PB 2OQJA 4WI4A 4TNWF 3VFSB 5C07E 4LAQH 1CDBA 1NGXB 3RUGB 4KDVA 1IGJA 3ULVL 1S7QB 1I3RA 4JZJA 4YEEA 2A83A 4NO0D 1F11B 4X0KA 2NY5H 3FB8B 3T65A 1ZA6A 4C57C 2BVUA 4DCQA 4OIIL 4NM8L 1KC5H 4H25A 3RBSA 4APQC 1T03L 4U6YA 1FIGL 5IEHB 3S35X 4DTGH 4MS8A 4KKCD 1BIHA 4APQB 2HAZA 3D3VD 5C2BL 1JK8A 3BDXA 2YOCA 2HJFB 1FG9C 3OQ3B 5I76B 4O51A 3NZ8A 1DL7L 3O3BA 5D96C 2D31A 2VB5A 4K07A 3LKQA 1G9EA 1HQ4A 2DI9A 1NAMH 3V6OA 5D7JC 4PD4K 5AYQA 1NSNL 4LVOC 3CLEL 1TJHL 1HXYA 4Y16A 3L3JB 5FA4A 4HJGB 5D7JB 4MQXD 5IFAL 1IZKA 1MVUA 3SE3C 3BH9B 2B0SH 1QR1A 3K4ZA 4QOKD 3BHBB 3G08B 2X70A 3UTTB 3PNWB 2JE8A 3U4BL 3V4PL 2B1HL 4JZOB 4OZHE 1F4XH 2NW2B 4P3CL 1QUNA 3PGDB 2F58L 1U6AL 1JE6A 3HC0A 4R8WL 4IRSC 3BYYA 4XNUL 2W60A 3PHQA 5DRWA 5I17A 1T1YA 3BZEB 3EDFA 5GZOD 5ELIA 3BQUA 3NIGE 4IRSB 4MXQD 1YC8A 2NY6D 5IB1A 5HJ3B 5T5NG 1VKXB 3LHPH 3MLVL 4YDLB 1VGEL 4HJ0C 5CBEA 1M7IB 4NPYA 2OR9L 1Q0YH 2UWEE 3KYOA 3DSFH 3I02B 4JDTH 1AJ7L 4ZO6A 2LU4A 4EN3D 4HCRL 4AMKL 1KSRA 1FAIL 1F3DH 3R0MA 5C7XL 4CNIB 2FZ3A 4ORZC 2DN7A 5JXEA 2C4XA 3T0EB 3VXOB 3KJ6L 5EZOL 4CW1A 5FYLE 2UY7A 3WLBB 4R3SA 5EBMB 3X17A 3SDDA 1K5NB 3MUGA 4N9GA 4OZGB 3BZ4B 5I73B 3RGVD 1OGTB 2I5YH 1T7XA 2N7AA 4WCYL 4GRLA 5IBTL 3MMEB 3M8OH 3MRQB 4C54A 1FJ1B 1QFUL 5ABDE 3IDYC 2WUBH 1MI5B 1SEBB 5EORL 3VWJD 4KKAD 1NLDH 1D9KD 4CADB 4BZYA 1FFRA 2E3VA 4QHUA 3RVWD 2NY3D 3LKRA 5GJTL 1INDL 4WFED 4KKCC 5DD0L 3RL1B 4DFHA 3MA9L 5FDYA 1I7ZB 4ZAKB 5BZWB 2AK4E 1QD0A 1CK0L 3D3VB 3QIUA 1UWGH 2NCMA 1LQVA 3MC0A 4XCYA 2WUCL 4D0CA 5J57B 1XGPA 3LD8B 5GRYA 1RZFL 1I1FA 4JY6A 3OKDA 1XR8A 4GW4B 3W2DL 5ALCH 4H5SB 1OT1A 2FYYB 3VXUE 4K23H 4MQXC 4ZFZB 1A4JA 3P9WB 3OR6B 5IHZA 5IVZA 1H8NA 4PRDA 3QNXB 5EU6B 3LEVL 5EIVA 4ZFGL 3FQRA 1KJ2L 1H3XA 3KPTA 4KKLD 1FNLA 4JFPA 1CFQA 2VIRA 3EAKA 4QOKB 3WNLA 4OIBA 5BRZA 2CD0A 2UY6A 5HHOA 1CGVA 5JR1L 3GMMA 4LHJB 5IMKA 3VXNB 3FQUA 2W65B 1QBLL 4NQSB 2BHZA 1ZAGA 1HHJA 3HAEG 3MRNB 1BD2A 4Y8DC 5F1IB 1D5MA 1WUNT 4LARL 4JFZL 4F3FB 4MXQC 5F8QC 3REWA 2NY6C 4S1SL 4K71C 4NDMA 3FT3B 4PJFF 4J3OC 2BVOB 1AY1H 4K71B 3ROOA 1OF2B 4FABL 3MLYL 2X41A 4EN3C 5FGRA 1QFWI 3EYUH 2R4RL 3SKUD 5EA0H 3CC5A 5CHNA 4RFEA 4RGOH 5CJOL 5I2IB 4X83A 1JP5A 3IJHB 1U8OB 4G80A 4L3CA 5IFHH 4GRWH 4D3CH 5HHNA 2HRLA 1H15B 3RGVC 5D5MF 4N9OB 2ZG3A 2ZSVB 3FO2A 4QRUA 3RGVB 5IW1A 3J7HA 4MNGA 1HYRC 4NYLB 3ARTA 3LKSB 3OWEA 3QHZL 4RDQF 1F5WA 3VWJC 4KKAC 4WHTA 1D9KC 2XFXB 5E0QA 4OFIA 4CGTA 4G9FD 3VWJB 1D9KB 1UXSA 4JFHE 3WIIH 3RVWC 2NY3C 5F7YC 1MHPL 4MNQD 1LK3H 5DJ2A 3B5GA 4PJXA 3ARRA 3MCLH 4P46B 4WNQB 4LIQE 2AQ2A 4NM4H 4EIZC 5KW9L 2NY1D 3F7VB 3O9WA 2GTWA 4MAUH 5E08L 2H45A 4Q9CA 4X80L 4MQ7A 1S7RB 1J7VR 4LFHG 1NL0L 2DQHH 1PD6A 3VD4A 1RZIA 3O41A 1JF1A 5TE4L 5LVEA 4HSQA 1CFVL 5ANMA 3GSRB 1D6EA 3NCJL 1FRGL 1DBMH 3MR9A 5J6GA 2AQ3A 2F74B 4L4TD 2J2ZA 4HULB 3OGCB 3WFBH 4KKLC 5IW3A 1MCKA 1MIEL 4M48H 4QLRA 3QXWA 2EDJA 2WWKO 4JFFE 2E9WA 4A6YH 5BXFB 2VAJA 3DUSB 3UO1L 2AQ1A 3QHFL 2Z93B 4YHNA 4M8QB 3ZHKA 1EGJA 2VYRE 1XGQA 4PJAB 1EXUA 3CMOL 4X4ZA 1FL6A 2XQBH 4LRIA 1BBDH 3CMGA 1EVUA 1Q9LB 1HN1A 4XBEL 5E8EA 5T3XD 5I1EL 3PWPA 1C08B 4Y5XC 2QQKL 4BK5A 2XV6B 4RQQA 2X10A 1PX3A 1TLKA 3G6JA 4JO2L 1F02I 1BOGB 1TJGH 2CDFA 3KJ4C 2Q3AA 2YD3A 2V5YA 4IIQA 1BJMA 1PDKA 4YBQC 1A4KB 4LEOB 3KJ4B 4HX1A 1DQDH 4L8SC 3ZT6A 4Z95H 5E8OB 3HNTH 2F54A 4QHMB 2P4AB 4JM4H 4O2EA 5GGRB 1IFHL 3K46A 4UI2A 5C0AA 4HG4K 1FHGA 1ZGLP 4Q58C 2HFEA 4Q2ZA 4OTXH 4NZTL 4NOBA 4WU5A 4PLJD 1NDGA 1HI6B 4OFKA 1CDIA 3DVNA 1U9KA 1UACH 3LS5L 4RZCB 4TN9A 3ZE2F 1QVOA 5CIPA 3RDTD 2ATPB 4L8CB 4D9QE 1B2WH 3MV01 4WEBL 4X6CB 3REVA 3K80A 4CVXB 1OGAA 3LPFA 1EEYB 3MV8E 4G9FB 4GG6F 1PZ5A 4AEIL 5DMIH 3JZ7A 3KXFA 1GOHA 5D2LE 4OZIE 3CAFA 5L6YH 3TFKD 4MNQB 4KZEL 2ORBL 5IMLB 5JW4Q 5E2VL 3SDAA 5J7CC 4WY7H 5GSRA 2NY1C 1MRCL 1LE9A 5BS0D 1AO7B 2DD8L 4Q7DA 4XZUB 3UPRA 3GKWH 5JIKA 2IJ0C 3QXTA 4NKDB 2YKLH 4ONFL 1R3JB 4NWTH 3FO0L 3EGSA 5C0CE 2NXYD 3MBXL 1OARH 4ZXBA 1ES0A 2XA3A 4FQ2H 5DJDB 5DURD 5B4MC 2X2YA 3DVGB 4G8FA 2M2DA 1MJJA 4FQCH 1F6AA 1OY3B 1G7PB 1INEH 4ODXA 4PTTA 4L4VA 4DOHB 1FNEA 5IJVA 1EHXA 2E6QA 3HI6H 5GGTA 1A1NB 5IIEB 3BN9D 1BZ7B 5BJTA 4QGTA 5TDOA 4JR9L 5FDWB 3W0WD 3RNQB 1TMCA 1ZLUH 4ENED 4ODUA 5JUEL 4XTRC 1UJ3A 3GSWB 4U1HA 2ZCLL 3WMSA 4NQCE 4MVBA 5C0FA 5DMKB 3ULVH 3GNML 5A40E 1I1CA 2WIMA 2VAAA 4P5KB 4BUGA 5F1KC 3FQNA 4GXVL 5CCKL 4X6DB 3E2HB 4F57L 5EBWA 5E8DL 3GMLB 4OIIH 4RMTA 4NM8H 5ESQB 5I1LB 4JPIB 1T03H 1FIGH 4LNVA 1HSAB 4ZPTB 3WL9A 3DROA 2Y23A 4YO0B 5C2BH 2AP2A 4QYOA 4YNYA 2MQCA 3WO3B 4X98B 1SVCP 1DL7H 2LTQB 3WDJA 1FZKB 5DMJB 4CKVX 5TQ2L 3T0XA 4TSCL 1CT8A 4PLJC 3VFMB 1VSCA 4ZOBA 1QHPA 5EOTB 3GUTA 1NSNH 3QZWA 3CLEH 1TJHH 2VKWA 3D48R 4K8RL 5IFAH 2DM4A 1LP9B 1LMKA 4YDKL 3CFCL 3RDTB 5DHVB 3OKNB 1HNFA 4ORGA 5T1KA 4MB4A 4Z77A 1N59B 4Y4FA 4ZUVB 3U4BH 3V4PH 5L7XL 2B1HH 1I9RL 2GSIB 3RY6C 3TFKC 4KJWD 1ND0B 3WLWD 4P3CH 4N0FB 2F58H 1U6AH 4R8WH 3FN3A 1F3RB 2CUHA 4GKNB 1T5XB 3HE7D 4K94L 4XNUH 5EU7E 4PV8B 3TNNA 3VFPB 4N8PA 2XWTB 3VI3F 3WHXB 6CGTA 3JTTB 5HVGB 4QT5A 1EEQA 3MLVH 2NXYC 4HIIB 1VGEH 2V2TA 4LFHD 2OR9H 4OF3A 3QEHA 3D18A 4O4YL 1F90L 1T3FA 1AJ7H 2F8OA 3K7UA 1OL0A 5GZND 4HCRH 5ACMA 3U4EB 4AMKH 3KPQA 1FAIH 3DUUB 5B38B 5C7XH 2NY5C 4G9DB 3GBLA 4W70A 4Y4KB 3G5XB 5HPMB 3BN9C 2Z35A 1R5VB 2LU7A 3KJ6H 5EZOH 3QAZC 3S36X 3CVHL 1OAYL 1G7JA 3HZYB 3T4AA 1S7SB 4ENEC 3PP3H 2AV7B 3QAZB 2NNAB 3W0WB 5GRJL 1IEAB 2VH5L 3MRKA 5I75C 3L5HA 4U0QB 1CDGA 4WCYH 2VLKE 5IBTH 5I75B 1ZSDA 3QUKA 1YDPB 1QFUH 4G42A 1T83A 5D7LB 1S5IL 4Q9BA 1XF2B 5KS9F 5EORH 3KYKL 3L5IA 3C2SA 3DHJA 2FX7L 1YZZA 5JO5B 4JGJA 3V5KA 5L2JB 1MLBB 3CFEB 1R3LA 1A1OA 2IBZY 3HMWL 1NAMB 3QDME 1QACA 2PYFA 4NUJA 4KHTL 1LO3L 3O6FB 5FA3A 5GJTH 1INDH 2ZCKL 3PABA 3PWVB 4MSWB 4P2OD 3U6RB 3ZDYF 2ATKA 5DD0H 5TF0A 3MA9H 5CEYB 4XPBL 2ADJB 4YPGB 4KI5D 1CK0H 1RUKL 4LLWA 5BZDA 2WUCH 5KANG 4WO4A 3CLFL 1ONQA 1KB9J 3GRWA 4M4RA 4EUPB 1RZFH 1TNMA 3OX8B 4YGAB 3DXAD 3VCLA 5SV3A 1HILA 5D7IA 3W2DH 3VXPB 4CDHA 2CO7B 2F5BL 3BZFB 2VE6A 1T2QL 2E7LE 1B0RB 5F7HA 2F8XC 1FDLL 3BH8B 3LEVH 5FUCC 4ELMA 4ZFGH 1KJ2H 4YGVA 4ZDHA 1AHWC 5T1MA 5C9JA 5F7UA 5IMOA 4M3JA 3GJEA 1ZGLM 5JR1H 1AHWB 4R7DB 4KJWC 3VXSE 1OP3K 1U8KA 3WLWC 5D6DA 3SDYL 1QBLH 4G59A 4NBXB 3HE7C 4GQPH 5TJWK 2GITA 4H1LH 3FOLA 4LARH 4JFZH 2J12B 1YEFL 4FFVD 2A73B 3HE7B 4XNXL 3BPNC 4S1SH 3HI1B 3VG9B 5CFHA 4BELD 3OAUL 2AJVL 3H9ZA 4M9PA 1H5BA 1U3HD 4ONGL 4PJ5E 2W9EL 4JQXA 1G7QA 3K8MA 1X5GA 2ICEA 3KPOB 4FABH 5C0JB 3MLYH 3QO0B 5GZNC 5HDBE 3DI2B 1JRHL 2R4RH 4XHJD 2AJZA 4L3EB 1TVHB 5CJOH 2IPKB 2M1KA 3V8CA 1FFOA 2J7LA 4O5LL 3SEPA 5KOMC 1XCQB 3BT2L 1MLCB 4AENA 4M7LL 4UNTA 1QSED 2JCCA 3LAFA 1Q72L 2APFA 2HKHL 4JFDD 2O93L 4NQXB 3O8XD 4LHUD 4PJDB 4X8JA 3WNMA 4XAKD 2H6PA 5DQ9B 2XWBA 1MVFA 3QUXC 4KTDL 4PRPB 3MA7B 2EXWD 3AXLB 4TTGA 3QHZH 3BYTA 2XPGA 1U3ZA 3MV11 3KYAA 3C6LA 4NKOB 4NNYB 4U3HA 3QT2A 3QXDB 1JTPA 3FO1A 3H9SA 1MHPH 2QQQA 1P6AB 4M7KL 1IM9D 2WP3O 4PJCE 1NBYB 4P23A 4PLKD 2NTFA 4J3VA 3OKOA 4P2OB 3HS0A 3ARFD 4AIZA 5KW9H 1MJ8L 4KI5C 3VJ6A 5E08H 3N85L 3FAWA 2Q6WA 4X80H 2HLFC 3VDCA 3GK8L 4UQ2B 5GSVA 3IS0X 3GJFH 4LVHB 2Z91B 2HN7A 1NL0H 4M7ZC 1NANH 1G9ML 1M4KA 4F2MB 5K9OA 3BP7B 1YPZB 5TE4H 1YMMD 3FHAA 5C09D 5ISZA 1CFVH 5A43C 4DUXA 3NCJH 1WBXA 1FRGH 3DXAB 3QI9A 3X14B 5C6PB 5LBSL 5HHMA 5B8CA 5DZLA 1I3UA 1BAFL 4CMMB 1CGUA 1Z9OA 3OZ9L 3PUCA 5FO8B 4M5ZL 5EO0B 2JTDA 4ZSOE 1MIEH 4P59L 3TC9A 5IVXB 1Q1JL 1JZ7A 3C5ZA 4LCCB 4M93C 3SQOL 3MRMA 4LLQB 1K4CA 3QO1B 3QFDB 1DEEB 2NR6D 3MXWL 4I0CC 3UO1H 4LP4A 3NZHL 1CIUA 1BIIA 2QADD 4FFVC 3ARBB 3QHFH 5SWSD 4RGMC 2VITB 5I16A 3EOBB 2H3NB 1EJ6A 3CMOH 3D2UA 2YD9A 4F7TA 2DWDA 1ZS8A 2G9HA 4NQEE 5T5NF 3VXME 4XBEH 4WGWB 5I1EH 4QRSA 5J1AA 4PJBB 3CDGA 5GGVL 2QQKH 1YEDA 1S7XB 2DJ4A 4POUB 3PHOB 4U6HB 1U3HB 1P9MA 4JO2H 2JJUA 4H0IA 4NT6B 2PW2A 2MNUA 5I74B 3DX6A 1EZVY 4XHJC 1ED3B 2PXYA 1C5BL 4RAUA 3WHE1 3RWJB 3C5JB 4U1SB 1I8LA 5JPNA 1IQDA 3QDGA 5DZNA 1SJHA 1YNLL 5CSGA 1IFHH 3A0OA 3QH3A 5F7NC 2R2CA 4NZTH 3HRPA 3O8XC 2W0KA 3AB0B 4OFYA 4JFDB 4YDJB 1LWRA 2Q86A 3LS5H 4LHUB 5DYOB 4BSWA 1UEMA 2EXWC 2HRPL 4HDIA 4AQOA 4WEBH 3PL6B 1YEEL 3RX8A 2I9LB 5DA4A 3BOVA 2ADIB 4AEIH 2GYSA 3ARUA 4MXVF 4UBDD 3RWHA 2X42A 2YC1A 4LLYB 4NO5A 3S3JA 1IM9B 4KZEH 2ORBH 3DARA 5E2VH 4K7PL 3ARFC 4P99A 5ID1A 2YPVL 5F97E 1MRCH 1AXIB 1QLEL 4KJYB 2DD8H 5FM8A 1AXSA 2Q8AL 4Y4HA 5D1XA 3WE6B 2HVKA 4ONFH 4RBPH 4QTHA 3FO0H 4DN3L 3KPLB 4JANA 3MBXH 1FYTB 1UKSA 4OUUB 2XQYG 1X4ZA 3QNYB 4LKCB 3WNKA 3K4AA 1FNGA 3W39B 4RRPA 1JYNA 1WCBA 5IBLD 3ULVD 1HOCB 4M02A 5C0BA 1H3WM 5EUKA 1NUGA 4PLOB 4PJ7A 4K3HA 1MY7A 3QFJA 3WFHA 1TQCC 4MMXC 1GH7A 4JR9H 1P4LB 3GMOB 4RMSA 3VFNA 2OI9C 5DFTA 1W72A 4JQIL 4PJ8A 5JUEH 1FO0A 2NR6C 2PO6D 1Q8MA 2ZCLH 3ARED 3W11D 3LN5A 3I3DA 3KHOA 2XG4A 1CFNA 1K6QL 3SCMA 5KSVB 2WWMD 3GNMH 4M00A 5SWSB 2QADB 3TGXA 4GXVH 2W07A 2CRYA 3FQTA 3H9YA 3KWWB 5CCKH 1UQSA 5CGTA 4F57H 5E8DH 1A7OL 3ZTNL 1CG9B 2QSCL 3VW3L 4HFWA 4Z5RB 5JORA 1EGJL 5TFSL 5F3BB 3HE6A 2APBA 3QIWD 2HJKA 2ARWA 5D6CB 1HH6A 4KUZL 3DGGA 4L29A 3SGDH 4EI5D 3MPCA 1Y6NR 4PB9L 5TQ2H 4XH2B 4ELKB 4TSCH 4EKXA 5JOPD 5TH2A 2YD7A 3STLA 3TT1L 2ESVB 2GUOB 3WS3A 4K8RH 3ILPB 2I9TB 3NA9L 3MJ9L 2J6EL 4TNWK 5MENB 3MV7B 1AGFB 3P73A 4YDKH 1Y18B 3CFCH 4MA8L 4X4XB 2AXFB 2KL6A 4JFEB 5E1AA 1RZKL 5L7XH 4UBDC 1I9RH 4R4BB 2HFGL 2VNCA 2G2RB 4U1LB 4GW1A 3UTZB 4K94H 4NFDA 1OWWA 3B83A 4PGDB 5HVHB 1MFAL 3EO1A 4V2BA 1T7VA 2CJUL 3U79A 1UG9A 1OCWL 1WK0A 2EIDA 4U6VL 4WFGD 3VXRA 3HLAB 5MEOB 3SE4A 2FBJL 5JW5A 1WIOA 3CCHB 4QKXB 4O4YH 1F90H 5HYSG 4JM2D 5IBLC 3ULVC 3ARGD 1IC5L 1MWAB 2ZOKB 2OL3L 3RI5K 5C9KA 5DRNA 3V5HB 4BH7B 2BC4B 1XR9A 2G5RA 5IEKA 4YHIB 3CVHH 1OAYH 1A7NL 3BP6B 4PP2B 5L2KD 2EYRB 4YX2L 4FXGA 2PO6C 5D9SB 5GRJH 1CF8L 2VH5H 3MNVB 3W11C 4JJ5B 1M6OA 8FABB 4DVBA 1KGCE 2P8MB 3AREB 1KCRL 2ICCA 2WWMC 2JK5B 5GGTL 1XZ0A 3UTSE 3ZKXC 1S5IH 3S8WA 4QRPA 1AE6L 4R96B 3KYKH 4JRXA 3ZKXB 4FZ8L 3EOAB 3ROLB 2FX7H 2MJWA 3ZYOA 3OXRB 1SYVB 2PTVA 3HMWH 1MHEB 3U36A 3C6SB 5MEQB 4KHTH 1LO3H 3HR5B 2ZCKH 1ZT7A 4OZFA 3S37X 1ZT4B 3TBSB 2J8UE 4OV6F 1J10A 3VXUA 1QKZL 3ULSB 4XPBH 1MAML 2YPLD 3ZYZA 1RUKH 3H7LA 3PV7A 2DQEL 2B5IC 3QIWB 1CS6A 2ZUUA 1ZVYA 1HQRB 4GW5B 3CLFH 1P7KB 4WU7B 4EI5B 1JL8A 2EDKA 3VE0A 5JMOC 3TJHD 1FL3A 4W68A 2DKMA 2C1PB 3MUZ1 2F5BH 4DKEL 3MNWA 2XA8L 3QEQD 1RK0A 3RKPA 1T2QH 5IBUG 5H35B 1FDLH 4JRYE 2NX5A 2VSCA 5BVPL 3JTCA 2QL1A 4I1NB 1A2YA 1XF3A 3SDYH 2YWYA 3P4MB 4LLUA 4TVPE 3P2TA 5HGAB 4C55A 5KSBA 3MCKB 1OTUD 1XF4A 2R2BB 5HI3D 4PJXF 2D7TL 4OFDA 1WEJL 3N0PB 1YEFH 4WUUE 1I1YA 2LABA 3DUHA 4XNXH 3MACL 4HMCA 1OQXA 1NBQA 3V0VB 4RMVA 1MCNA 3OAUH 3VFOB 5DJ8A 1S7WB 2AJVH 4YIQA 1R24B 1JPTL 4ONGH 2W9EH 4UMGA 4JM2C 5DK0B 4NQDB 3ARGC 1BZQK 2GK0B 3RVUD 3WIFA 1LE5B 4ZS7H 1A21A 1JRHH 4I0PA 2LQRA 4JM2B 2ERJB 5H8DA 5AG8A 2C7UB 3ARGB 3VWKB 4V1DD 5I1DA 1YY9D 5H2BA 5EFIB 4O5LH 5FK9A 4AG4L 3BT2H 3AM8A 2OCFD 1NC4A 4M7LH 4JPVL 4HUNB 2V5TA 4PJGE 1T04B 1Q72H 5T3ZL 5SWZA 1RZ8A 5CD5D 2HKHH 5L2KB 3EKCA 4P2RE 2F53A 1VACB 3HC4L 4U6TA 4KTDH 3L5WB 1S7QA 4X4YB 5SX5H 1CQKA 3IXTB 2X9WA 2BCKB 3CK0L 4U1MA 5DJXB 1KTDB 3NFSL 3O4LA 1QRND 4X9FA 3IFOA 3E6FA 1VFBA 1ZLVH 2XXMB 1HHGB 5I66B 1JWSA 4I18B 4M7KH 4XBPB 4S0UC 1HSBB 5KSAD 4IOIB 3GMRB 3UAJD 1I9JL 3IU3A 1JZ8A 4Z7WF 2HJFA 1MJ8H 5J11C 3EOTL 5I76A 4JY4B 3N85H 2ZUXA 2YPLB 3GK8H 2X4TA 1ZLUK 4CVZB 4QRRE 3CU1A 3NCYS 3MGOA 1G9MH 1TDQA 5F9DC 1TITA 3TJHC 2OTPA 2I24N 4PP8C 5E4EB 2GJJA 4MAYA 1D3CA 4H1LB 1J1PL 2VQ1B 4NZUL 5LBSH 1KXQE 3BHBA 1BAFH 3PWUB 3OZ9H 5IW6B 3TZVB 3UTTA 1MOEA 4M5ZH 3T0VA 3GRWL 4P59H 4Y5YA 3L6FB 1Q1JH 1FG2B 3SQOH 3WN5B 1FC2D 5J9PB 3TVMB 3O3EB 1D5XB 1OTUC 3MXWH 3WS6C 5HI3C 5HVWA 3ZKNC 3NZHH 5CGMA 5HJ3A 2IPUG 4NZJA 2DI8A 3O3AB 5C08B 5I15L 1M7IA 2A6JB 2YHGA 4IOFD 4YHYB 2HLAB 5GGVH 4PREB 4MA3B 3NFPB 3MOBL 3RVUC 4NHCH 5ICZB 1KXTB 5DK2A 3NAAL 4PJEF 2X4PA 1YY9C 3VXOA 4ACPA 3MRPB 1ADQL 3T0EA 1C5BH 4V1DB 4DZ8A 5IWLC 4HFUL 1NH6A 3WJJA 2EO9A 1G7MA 1VESA 4MJ4A 3MRDA 1YNLH 5FEBA 2RHEA 1QFPA 4F9LC 3BZ4A 1DBKL 3CFDA 5CD5C 4NQVA 1OGTA 1QLRB 2XKSA 3LV3B 32C2B 2Y7QB 1PW3A 3P4OB 3U2SA 4NZRL 1MI5A 2FB4L 2HRPH 1IZJA 4CADA 3C09C 1E27B 2DI7A 2APTA 1YEEH 2G5BA 3QEUA 4QRTA 4UT7L 5KSAC 3E3QA 3UAJC 4ZUSA 1I7ZA 3ZDXF 4ZAKA 4K7PH 5GGQL 5KSAB 3MBEA 2YPVH 3MJ8A 4HIEB 4XVTL 1QLEH 2Q8AH 5GS1C 4KRMB 4G3YL 5JPMB 3PP3K 4DN3H 5K33A 4PJIB 3N1PC 5CEZL 1BREA 3MNZB 4H5SA 2FYYA 3VFUB 1QLFB 1IAOB 1ZWIB 5CWSB 3HG1D 4IM8A 4PBWD 4L5FL 5EU6A 3OG4B 2I07B 1KCKA 4X5XB 1CU4L 2QKIB 3S98A 3KYNA 4C56D 1SJXA 3GHEL 4LP5A 3QWRD 3EO0B 2W65A 4JQIH 1TQBB 3QDJD 4XNZC 1ZV5A 2YD1A 5KS9B 1RIVL 3RUGE 5MEPB 5E1HB 1QOKA 5J12C 1JPFA 1NCBL 2ARJB 3TN0A 4HK0A 3U7WL 1H0DB 4XNZB 4E5XB 4BKLB 1K6QH 4PGBA 4RMWA 1U8JB 5C0DB 5J12B 5FV2A 3V95A 3NPSC 1KYOJ 3B3IA 3IFPB 3FT3A 1QYGL 4DAGL 3C8DA 4IOFC 2BVOA 4JQVC 4HQQL 5CP7B 5C3TA 3VD3A 1V3MA 3LS4L 1KOAA 1OF2A 2BVQB 4OLZL 3WDIA 3M1BA 3VFTB 1A7OH 3WUWB 4P5TD 1M71B 3ZTNH 2QSCH 4M03A 3VW3H 4K8RD 1VERA 1SYSA 3E8UL 4UQ3A 3PJSB 1EGJH 5TFSH 1T80A 1ZVSB 4KI1A 1WF5A 1QBML 2HMID 4QNPE 5F1NA 1IKNA 1MY5A 4YAQA 3OV6A 1AC0A 1KV3A 9CGTA 4F15B 5GGUA 4KUZH 1IL1A 2EDYA 4PB9H 2P5EB 3OHXB 4JDVA 1HINL 4JLRB 4N8VG 1XCTB 3GMPA 2CMRL 3U9UB 4TNVF 1JIBA 4BQBA 1JNJA 5GRZA 3TT1H 4NYLA 1KG0A 4MX7B 3TIEB 3JBG7 4WW1B 5J89A 1TTFA 4M8VA 3NA9H 3MJ9H 2XFXA 2J6EH 5F7MC 1ZTXL 5TPWL 4OBRA 4S2SA 4MA8H 4XCNB 3HPLB 4ZNEA 1F4HA 2ZWLT 5FGSA 3IVKB 4ZUTB 3SGKC 4IMKA 1RZKH 4P46A 4WNQA 2WMPA 1QSFD 4ZUUA 1QBBA 2HFGH 1JI2A 5CIPH 4MDIA 2AJYL 4ZTPL 5GIRB 1KIQB 2B2XL 2FHBA 2JELL 1MFAH 1EFQA 3X13A 2CJUH 2A6KA 2WLZA 1PG7W 1AGBB 1OCWH 4HUVA 4U6VH 4P4KC 4R90L 2IANB 5DVOA 2FBJH 2VLRD 1RIUL 2J5LC 4CN1A 1CBVL 4NCDA 4UT9L 2F74A 4JFQA 1Q38A 2GFBB 2J5LB 3BVNB 1AP2B 1IC5H 1FGVL 1DR9A 3FQXA 1KCLA 3HG1B 2EKSB 2OL3H 3FB6B 3NPZB 4HEPG 5D7IF 1IM3A 5I18L 12E8L 1L9MA 1Z9SA 3SGJC 2VXQL 5IQ9B 3NGBC 1A6WL 2R1WB 1A7NH 2OSLB 4C56B 4OZGE 4ELMF 2X1OA 2KUTA 3NGBB 1EA9C 4YX2H 1A9EA 1GZQA 1CF8H 2E7HA 3DUSA 4MB5A 4UOW0 2IG2L 3ET9F 5J06A 3TA3B 3QDJB 4XNYL 2Z93A 4M8QA 3IAPA 4PJAA 5IB4B 1KCRH 4YC2C 5GGTH 1ZHBB 4AH2A 5K9QI 3ZE0F 3ECBB 1AE6H 1C08A 1YY8B 1W72L 2H9GB 4AL8L 5DJAB 1FO0L 4MS8D 3ZO0A 2VN4A 4P5TC 4X6FB 4HWZB 1YN7A 4K8RC 3IDXL 5BVJA 1A4KA 4LEOA 4UUJA 1I1AA 4FQXA 4BFGA 3D3VE 2HMIC 2CIIB 5GS3A 1QKZH 1RJYB 1MAMH 1SY6A 5GGRA 2LVEA 2DQEH 1J12A 2APWA 3MTRA 4PR5A 3TJEH 2EICA 2WANA 2PTTA 3X11A 4Y16D 4Z7VE 3KG5A 5J3HD 1U58B 4QXUL 5C0IB 4K94C 4ODHL 2JCCF 1J1XL 3SHSA 4ZQKA 4DKEH 5D1ZB 2XA8H 2QHLA 4X9IA 1BFTA 2ATPA 2WBJB 3OB0H 1P5UA 1QEWB 4NGHL 1Y6KR 4QOKE 4CVXA 2H2PD 1AGCB 5BVPH 1Q0XL 4O9HH 5E2UL 4X6EA 3SKNA 2O5ZL 4JZNA 1UWEL 3GSXA 3V6FA 2OJEA 3BQUD 4JKWA 1QSFB 5CJQL 4KDWA 2P5WA 1AO7A 3DETD 4RIRA 5IP4A 2EIZB 3QBTB 2AXGA 2D7TH 1WEJH 4NKDA 3MACH 2BY1A 1HHIB 1VADA 4N5EA 3CVHB 1I8IB 4LPTA 4PRIA 3P77A 1JPTH 1U95A 3RVTD 4MHHG 5IGXL 1G7PA 2A9NL 2VLRB 2IH1B 3RIFK 4LSQL 2ICWJ 3DVIA 4LBEA 3SN6N 3EYOB 1EVTC 5E8PB 5IIEA 4LQ1A 3SDDD 3KLHD 1BZ7A 3QNZB 4AG4H 3JV0A 4ZFFB 5FDWA 4HT1L 5FV1L 1WAAE 2WV3A 4RFOL 4JPVH 2OQJB 3GSWA 3HPJA 5T3ZH 4QEGA 2YWZA 1IAIM 5C6TL 5DMKA 3ZE1E 3HC4H 1IGJB 5FGCE 4C83A 2HT3D 1I3RB 4JZJB 4KV5F 4P5KA 2PF6A 3EZJB 3WBDA 3ZMRA 1QFHA 3GM0A 4HH9A 4RBPK 3CK0H 4X6DA 1ZA6B 1KIRB 2H41A 2VZ1A 4ZPVB 3NFSH 2IQ9L 3LPGA 4WI7A 1DVFB 3VRJB 4MS8C 1WFTA 3FB5B 4H25B 3EIFA 4OKVB 5ESQA 4U6YB 1HSAA 1LVEA 1KB9K 4WFEE 3QIUD 1I9JH 1DTUA 1JK8B 4YO0A 4MJ6A 4X98A 2WIIB 5E5RB 1BVZA 3EOTH 3S3PA 1UH4A 3TPUB 3O3BB 4HBQA 1NFDA 2WK2A 1FZKA 3V6OC 4U3XA 3LEXA 1W0WA 4LSTL 3LKQB 4Y16C 5EDXA 5J3HC 3EJZD 3GO1L 4D2NA 2Q7NA 4Y16B 5JTWA 3WNPA 4RNRA 1IGFL 5E2WL 3WO4C 1LP9A 1J1PH 1MCQA 4HC1A 1QR1B 1PBYA 4NZUH 3OR7A 5BRZD 4ZFOL 5HHOD 2H2PC 4XHQA 3ZZ1A 4MDJA 2YRZA 2VLJB 3HAEB 4H88L 3GRWH 4X8XA 4Z8FL 1ND0A 1BD2D 5IF0B 5C1MB 5E94A 4N0FA 3BQUC 3HC0B 1CXFA 3MLPA 5I17B 2W60B 3PHQB 5DRWB 4PV8A 4NBYB 3VFPA 3P30L 5IB1B 3JTTA 4CMHB 4YZFE 3S5LG 5C3LD 1UKQA 5CBEB 2AJUL 4NPYB 5I15H 4OT1L 4RFNC 1J86A 4UILL 3RVTC 1SMAA 3S96A 3MOBH 3ZKSD 3QQ3A 4RFNB 1GGIL 3QJFA 3DUUA 3NAAH 2FZ3B 1WIUA 4Y4KA 1OAUL 1R3IL 3G5XA 4XPFL 3RPKA 5HPMA 4OGXL 1ADQH 4OM1L 3KLHC 4HFUH 1C12A 3HZYA 1T21A 1S7SA 3SDDB 3MUGB 2AV7A 4J2XA 4XVSL 2NNAA 5I19L 1U8HB 4PJ7F 1DBKH 3WJLA 3QHTC 4GRLB 4IHOB 1J18A 5HYJB 4FQIL 3PQYB 1UFUA 1U93A 1YDPA 4NZRH 1HZHL 2FGZA 1XF2A 2FB4H 3H42L 2PYEA 1FSKB 1G9MC 3DYPA 3D9AL 4FQLL 4G9FE 4QHUB 4LCWA 2VN7A 5DHYA 3LKRB 4MNQE 3QUMB 3O6FA 5C0RL 1A02N 3O9WD 1RV6X 4UT7H 4AIOA 1U8QA 4OZ4A 3QIUC 4P9HL 3MUY1 1A6VL 2ADJA 5GGQH 2D9QB 4D0CB 2DBLL 1JBJA 3IDGA 5HBBA 1G0XA 2UZYB 4G3YH 1CR9L 4JY6B 4JE4B 3ARDD 4HAGA 1CN4A 2UYLA 3DYMA 3OKDB 1XR8B 5CEZH 1FCGA 3P4NA 3VXPA 5IHZB 2P8PB 5IVZB 4PRDB 4QGYA 3I50L 2CPCA 3T2NL 1YYML 1EUUA 2HP4A 3VD9A 4L5FH 3J8F7 1BFOA 4L4TE 4N90D 3FQRB 3QG6B 1KN2L 2ZP0T 1DDHA 1CFQB 1CU4H 1U8PA 3U1SL 2DOCA 3GHEH 4CN6A 3GMMB 5IMKB 2COQA 4WI3A 1TZGL 1LILA 1HHJB 3NIGF 1BD2B 4F8TA 1RIVH 1D5MB 2JJTA 5DQJA 5EZJB 3QQ4A 1NCBH 5CZXD 3U7WH 2A73A 4G43B 4ZO8A 4WJ5A 3PWPD 1IJ9A 2HFFA 2UWEF 5IOPB 3LH2L 4NDMB 1QYGH 1ACZA 4DAGH 1WWWX 5T3XE 1J8HB 3BGFB 4HQQH 2GJ6B 3ROOB 3LS4H 5I1IL 5C0JA 3B8SA 3QO0A 4OLZH 1KEGL 5FIEA 3MROB 2E6PA 3L3GA 4RFEB 3E8UH 1B4RA 2F54D 1KCVL 4L3EA 1TVHA 1B90A 3AVEA 2IPKA 2Z31A 5JIHA 5T33L 1QBMH 1MLCA 4L3CB 4YK4B 5HHNB 4P3DA 3I3BA 1Q94A 4FTVA 3CZJA 4MCZA 1X6NA 4NQXA 4PJDA 3FO2B 5IW1B 4QRUB 3VMOA 4PRPA 1HINH 5AUMB 4MNGB 4XB7A 2CMRH 4LU5L 2EDFA 5CZVL 1JGLL 1OGAD 1R5IA 4WHTB 4QHKJ 4KJPC 1ZTXH 5TPWH 3KXFD 4NKOA 2DJSA 3QXDA 4XMLL 3BEWA 1I8MA 1HCVA 5DEFA 5DJ2B 4PJXB 5IB5A 3SDAD 4WENB 1QPXA 5F3HB 2R29L 4XXCA 1FFPB 5LGJA 2DS4A 3O9WB 5AAMA 5ENWA 4MQ7B 5BS0E 3JV4A 2AJYH 4ZTPH 1CXHA 2B2XH 4U1JA 1RHFA 3W9DB 2JELH 4ZXBD 1GSMA 3ARDC 1RZIB 2OYPA 1RFDL 1JF1B 5I1GL 3DPBA 1F4WL 4R90H 1WBYB 1D6EB 4WWKC 1BQHA 3TBVA 4L4VD 1RIUH 1IEBB 1P2CB 3ABZA 3MR9B 3GIVA 5J6GB 1CBVH 1HNGA 5DC0A 2P46B 3SDCA 4UT9H 5HHPA 3BRFA 4Y88A 3UDWA 5FO8A 1PKQE 1Y0LB 4I2XB 12E8H 4XP9L 3HZKA 1XEDA 5I18H 4WUKL 1DP0A 5IQ7L 3FT2A 3B8YA 3KNBB 5E2TL 2VXQH 1ZLVK 4LCCA 1A6WH 4LLQA 4V2CB 3W0WE 4MVBD 3QO1A 5BCAA 5M95B 2ID5A 2AI0L 2KDGA 3AAZB 4N5UA 2EH7L 2IG2H 4LRIC 4JEGB 4PRHD 5EU3B 5CZXC 4YHNB 4XNYH 1XGQB 2VITA 4JKMA 1EXUB 3HTLX 4KH2A 5AYUL 2EEBA 4UIMA 4DKDC 5HPOA 5E8EB 4RMUA 2J8UA 1ZHLB 1QG3A 3Q1SL 1BBJA 4LKXA 3RTQA 4QY8B 4RQQB 1SMOA 1W72H 4Y1AB 4AL8H 4IIQC 1CD8A 1FO0H 3G6JB 2CDFB 3QISA 3LKOA 3U0TB 1TFHA 4IIQB 5HDOA 3OPZL 3IDXH 2YN3A 3O0RL 3VI4E 1ED3A 3G9AB 1YC7A 1CCZA 3TBYA 4AEEA 4WHYG 4O2EB 5E00A 5F7WC 5F88B 2YPKA 5C0AB 1RZKC 2HFEB 4WU5B 2CLZB 1NDGB 4NC1C 3LSOA 4LEXL 2AV1B 4Z6AT 2HKFL 2VJXA 4QXUH 4ODHH 2MQ0A 2PR4L 1F4AA 4KTEL 2CUMA 1J1XH 2GY5A 1YMHB 3DHMA 5T1KD 1G6RB 2GW5A 2DQCL 3TCLA 4NGHH 3REVB 4Y4FD 4DVRL 5FUCE 3PL6A 5FYJL 1Q0XH 3KXFB 5E2UH 3SDAC 1OAXL 4UNVA 2O5ZH 1UWEH 3DGCR 4YBLB 5GSRB 3F7PC 5CJQH 5L8KB 4Z76A 3UPRB 5TQ0L 4ZXBC 1NEZA 1R3KB 3EGSB 2E5EA 2FJFA 4PJEB 2E6JA 4TRPL 2AEIT 1ES0B 5T3ZD 1FYTA 4LKCA 2R1YA 3F6IA 1MJJB 4U1GB 4XC3L 1KENL 3W39A 1EIBA 5IGXH 4ODXB 2A9NH 3KYMA 4PJGA 4PTTB 5AG9A 4L4VB 2FHFA 5IJVB 4LSQH 3BO8A 3FO9A 2VWEC 4EXKA 1TZHA 5TDOB 1N3NB 1UJ3C 1RU9L 3DOSA 1TMCB 1P4LA 4HT1H 3GMOA 2PNDA 1CTOA 4RFOH 1UJ3B 2FJGB 4U1HB 3MRJB 5D2NB 1T7WA 5C6TH 1EMTL 3OTTA 5KSVA 2EKJA 3NACL 4ZS6D 3FQNB 3H3BC 4OFVA 3UBXG 3D0VA 2NXZD 5JHDB 2VR5A 2YBRA 3FOMB 5EBWB 1MQKL 2IQ9H 3MQIA 2DRUA 3DRTA 1GJIA 3KHQA 4EDXA 4QRRA 4KVNL 2IF7A 1NC2A 1JGDA 3QULA 4QYOB 4YNYB 1SQ2N 5A1AA 1A22B 1UGNA 3EBAA 4KI5E 3LQAL 2P24B 3MRRA 5D6CA 1E4XL 4HWNA 4HGWB 3CSYA 3HUJA 3QG7L 4LSTH 4NJ9L 4XH2A 4YUEL 1CT8B 1ULVA 4MQSB 5T1LB 4KAQL 2FX9L 1YNTB 3RNKA 3GO1H 3GUTB 1FGNL 5EUOE 3DXAE 3M17A 1KFAL 1JMXA 2QR0B 3H9HA 2ESVA 2GUOA 5AWNL 5LCVL 4I77L 1IGFH 3C08L 5E2WH 4I8DA 4YPJA 1SY6L 3K2MC 5I6XC 5LGKA 4MLSA 4ORGB 5D2LF 5T1KB 3LKPA 4OZIF 4XBGB 1H3GA 5IVXE 4Z77B 4Y4FB 4H88H 2VTFA 4PYHA 5IMMA 4Z8FH 2H2SD 3MOAL 2OXHA 3IS1X 4HS6A 2G2RA 4PJFA 4U1LA 1AQKL 3UTZA 2AEQL 4M62H 3TNNB 3F58L 1UM4L 3P30H 5E99L 3DMMB 4ESKA 4NBZB 4GRWE 3TF7A 2CK0L 2AJUH 2V2TB 3HLAA 4PJBE 3QEHB 3D18B 1D6VL 3G6AA 3PGFL 4OT1H 5DLML 4UILH 4LLAA 1WSST 3C2AL 1ITCA 4KK5D 1GGIH 3KPQB 2R23B 1IGCL 1V3JA 3V5HA 5GGVY 1OAUH 5C0EA 1O5DT 1AC6A 1R3IH 2BC4A 4P48A 5FM5M 2VZSA 4XPFH 5D5MA 4OGXH 4OM1H 1INQA 3SO3C 3ME0A 4YHIA 1G7JB 3T4AB 2Q1EA 3ULUL 4OGAD 4KC3B 4PP2A 1QSEE 1MCCA 4XVSH 3STZA 5I19H 2NW3B 5D9SA 4JFDE 1T83C 4XAKE 1RMFL 5IK3B 3TV3L 8FABA 5F7LB 5ID0B 5AZ2L 1ZSDB 4RWYL 4ZS6C 1PGRB 2JK5A 4FQIH 1A8JH 2EDXA 4KXZI 4LF3A 1HZHH 3F62A 2NXZC 3C6LD 3H42H 4S10A 1KPVA 3H9SD 3RAJL 4FQLH 3D9AH 4S1RL 1ETZB 3V5KB 3HRZA 1NGWB 8CGTA 5CEZD 1A1OB 2DB8A 1SYVA 2PYFB 4LPYA 3ZSTA 3AGVA 5FA3B 1MHEA 2E9IA 5MEQA 1FBIL 5C0RH 2B20A 3TBSA 4P9HH 2BVYA 4EZMA 1A6VH 4LLWB 5BZDB 3B2VL 1MCEA 2DBLH 5FF6B 2P42B 5B39G 1JZ2A 4WO4B 4FG6D 1CR9H 2HTKC 5I8EA 4K7PY 5ISZD 2YSSB 5F7DA 1MCWM 4JREC 3PWJA 4TQEL 1E6OL 3QI9D 3VCLB 1HILB 5D7IB 2OTUA 4WHCA 1YMME 2C1PA 3LIZL 1CTNA 3I85A 5HHMD 4LPVA 5C09E 5HYEA 4R9HA 5IHUL 1OD9A 3I50H 3T2NH 1YYMH 5FO7A 1P84J 3EOYG 4ELMB 5H35A 1JJUA 1MCPL 1CE1L 5C9JB 5ITBL 1KN2H 1X7QB 3C5ZD 5IMOB 3U1SH 4JHZA 2ZUYA 3GJEB 4J3TA 5D6DC 2APVA 4ZO9A 5H94B 1P4IL 1BJ8A 1GGBL 2H2SC 3K3QA 4Z7UA 4I5BB 2V2WA 3IFNL 1TZGH 3VDAA 4X9GA 3MCKA 3FOLB 4HC1L 3D2UD 3U0PB 4MA7L 5SWSE 3FFCA 3SGEI 3BJLA 2IH3B 4JQXC 3LH2H 2O61B 4FRWA 1JWMB 5DS8B 5J13B 1WQVT 1H5BB 1T0NA 1G7QB 1R24A 2ICEB 5I1IH 1FIEA 4NQDA 3Q3GA 4KK5C 1LE5A 3BSZL 3U7YL 1KEGH 3D1MC 5KVDL 1FQ9C 4MJ2A 2PXYD 3BKCL 4M6ML 1NJ9B 5EULV 3VWKA 3OB0K 3HNVL 5JZ7D 2AJZB 3QDGD 1KCVH 2WBWB 5EFIA 1FFOB 3JV5A 3MRBA 1S8DB 2OK0L 5T33H 3FZUD 4OGAC 4AENB 2JCCB 1YYLH 3G5VA 4KK6D 4JVWA 5I8OL 4OFYD 1T04A 1S7VB 4X8JB 2H6PB 4R6UA 2IMMA 1VACA 2XWBB 4LLMB 3L5WA 4R0LA 4FQ1L 4X4YA 4GG6A 4LU5H 5CZVH 3C6LC 2BCKA 1U2CA 1JGLH 5DJXA 1FE8L 4G8EA 5DFVC 1LHZA 4WFHD 4LSSL 3LMJL 3RJQB 3FO1B 3H9SB 4XMLH 2YEZB 4JDZB 4XBPA 3C87A 4P23B 1HSBA 2R29H 4MD0A 2NTFB 3JWNC 4KMLB 3Q6GL 3HS0B 4AIZB 4Y4HD 3I84A 5D1XD 3EYQD 2Q6WB 5GS0L 5JA8B 1L7IL 5DRXA 5ILTL 3TBTA 2FRGP 5GSVB 3RVVD 4FG6C 4CVZA 3DO7A 4YFLF 4HWBA 5K9OB 1RFDH 4HUKB 3QI9C 5I1GH 1F4WH 5D93C 3MRHA 1GGCL 5B8CC 1KIPA 4OAWA 3FT4A 2XICA 4O58L 2E8YA 2WWKT 1AQDA 5C0BD 5TF1L 3ULVE 4GAYA 5B8CB 2UVFA 4RWHA 1BMGA 1S5HB 1CLCA 2Z0BA 3PWUA 3QFJD 4PFEA 3C5ZC 4NO2A 4TYUA 1ZEAL 4O2FB 3TZVA 4XP9H 1L6ZA 4TNVK 4WUKH 5IQ7H 4PJ8D 5E2TH 1KYOK 3MRMB 1K4CB 3WN5A 1I7UA 4GKZB 1RZJL 3CH1B 5MP6L 4OM0L 3SCMD 4YE4L 2DICA 4Q6IC 2EH7H 2V7NA 1BIIB 2ZCHL 1QFWL 1LD9A 3BPLB 3TESA 1JUFB 2JJWA 2DWDB 1ZS8B 5AYUH 3O3AA 2G9HB 4NUGL 2AABL 3B9AA 3GDBA 4L8BB 3Q1SH 2ICWB 4QRSB 5J1AB 5HDBF 3CDGB 3N1FC 2EDEA 1YEDB 5BOZG 3NFPA 3HE6D 3T77B 1UWXH 2PXYC 5MI0B 4IRJD 4A2LA 1I8LC 3OPZH 4J1UA 5CP3H 5JZ7C 4OD2A 3O0RH 4RAUB 5GS2D 5JDJA 1IQDB 1SJHB 3DX9A 3LCYA 2QTEA 4KK6C 4RSVA 2FIKB 1NQBA 1A3RL 3LV3A 32C2A 3GHBL 4FOMA 1F3JA 3PHSA 4LEXH 2Q86B 1XH3B 2KQMA 2HKFH 3P4OA 5D4QA 5JOPE 5F1SA 2PR4H 1JI1A 4KTEH 4B5EA 4U0RC 4HDIB 3G9VA 1BX2B 2DQCH 2X09A 3KS0H 1LNUA 4DVRH 2A74A 5FYJH 4Z7OE 2BDNL 4BA8A 3RWHB 1I75A 1OAXH 2YC1B 4NO5B 2P1YA 4NN6B 3V9FA 3RIAK 5FCSH 4UZGA 4LVNB 5ID1B 5IHBA 4R2GD 5D1XC 4HIEA 1AXSB 3EYQC 1C5CL 4Y4HB 5TQ0H 1XIWB 5D1XB 1GIGL 1EO8L 3RVVC 2DLGA 2HVKB 3VXRD 4QTHB 2AEWA 5ITFA 1JPSL 4TRPH 5FGBA 3MYZA 4WFGE 5KVMC 3ZSSA 1FNGB 3MNZA 4XC3H 1WCBB 1KENH 1NFDF 4PGZA 1DQJA 5CWSA 1DBJL 2BSRA 4KK9D 2RGSA 4LMQE 5EOCL 1RJLA 5C07B 1EFXB 4PJ7B 1TETL 1IC4L 3AMLA 4PJ8C 2BNUB 1RU9H 4PJ8B 5L2KE 5FXCH 3A6CL 2MFNA 5DTFA 3WFZA 3SCMC 4URTB 3UTPE 5BQ7B 5MEPA 3AFLA 3LN5B 3F12B 2ARJA 1S78D 1CFNB 4E5XA 1H0DA 1EMTH 3SCMB 5FYKD 1CYGA 1UB6B 5C0DA 3VXQB 2BXZA 3NACH 4QRPD 5C70A 1JF6A 4JRXD 1WICA 3BFOA 3FQTB 3LRSB 2V6HA 1E4KA 1QO3B 1UQSB 3L3IB 5TE7L 1A7PL 1MQKH 5L0QC 2ZJSL 1JTOA 3T3PF 2BVQA 3WUWA 1J5OL 5L0QB 1M71A 4IRJC 2BNRA 5CKGA 4KVNH 5D7KD 3HE6B 2ED7A 4F7PA 4HIXL 1ZVSA 4GKSA 1JNLL 5L88L 4U7MA 2HJKB 3TBWA 2AJXL 2YPLE 1HH6B 3LQAH 4L29B 4KJQC 1E4XH 4W4NA 3KPSE 1NGYB 5EIIB 3A6OA 3QG7H 2JB5L 2P5EA 4NJ9H 4YUEH 3P40A 4HKXB 5EIQA 3KPRA 3MRIA 1U41A 4KAQH 2FX9H 3S7GA 2BMKA 1FGNH 1ZGLB 2FEEI 1MCSA 1KFAH 1GOFA 5D72L 3WS3B 5AWNH 4MJ5A 3CD4A 5LCVH 4I77H 2BNQA 3WFDL 43C9B 3C08H 3QEQE 2NX5D 2DQJL 3IETA 3P73B 1SY6H 4F7EB 3ZDZE 3CFKA 2ZOLA 2OR8A 4XCNA 1KXVC 5I1JL 3IVKA 1A47A 4ZUTA 4AT6A 3GBNL 1GHFL 2UWEB 3MOAH 4JN1L 4X7SL 3OL2A 4NC2B 4R2GC 2J1KA 4Y5XA 5FB8B 1AQKH 3BKYL 2AEQH 5GIRA 5CBAA 1U92B 3F58H 3DI3B 3EO1B 3WHE0 1UM4H 3SE4C 5E99H 4PGCA 2DBJA 3B43A 4OIAA 5DD3L 3BRGC 1D6VH 3PGFH 5DLMH 4DGIL 2JJVA 1A64A 4I0PD 2FDBP 5FUZL 2X4QB 3C2AH 4HKJA 4KK9C 4RISL 3ERYA 1AP2A 5I9QC 1IGCH 1W0YT 1KJ3L 2HVJB 4V1DE 2CLRB 5DJCB 1NC4D 1XR9B 1UCBL 2NLJB 2IADA 5SWZD 3ULUH 1MPAL 2H32B 4PYGA 2F53D 4FXGB 4K55A 3FMGL 1F8TL 1C16B 5C6WH 3L3HA 3IF1B 1E4WL 3ZKQD 3IDNA 1S78C 3TA3A 3UMTA 1XF5A 4DVBB 1RMFH 3TV3H 5AZ2H 5IB4A 4RWYH 1XZ0B 3D85A 4XPGL 1ZHBA 3O4LD 4QRPB 2AK4B 4JRXB 5CJBA 4X4MA 3MRLA 2H9GA 3RAJH 4S1RH 4JAMA 1P5VA 5C92A 3CXHJ 1QRNE 1IC1A 2ENYA 3N1MC 4OGZA 3LQMA 4X6FA 1MRDL 3U36B 3B9DA 1ZE3C 4UAOB 1FBIH 1ZT7B 4OZFB 3OXSB 4IS6A 2X9YA 2EC9T 1HDMA 3T0AA 3VXUB 1RJYA 1X5LA 3B2VH 1A7BA 5JXAL 1X5XA 2R0LL 1JVKA 2F8VA 2HJLB 4KK8D 4OJFL 4PJIE 3H3PL 5DVLA 4NNXA 3VE0B 4L9LB 4MAYD 4TQEH 4I48B 1FL3B 1E6OH 2RJMA 4B0MM 5C0IA 3NIFF 3LIZH 3K81A 5IHUH 3O81A 5D1ZA 1E4XI 1QFOA 4LCUA 1RK0B 3QIBA 2WBJA 1KTKE 3UTTD 1U8NA 1MCPH 2NX5B 4YWGL 1CE1H 1AGCA 5ITBH 2QV2A 2XTJD 4TSBL 3AY4A 1BZ9A 5DJ0A 2XY1A 4TSAL 4YFLI 1A2YB 3RWEB 1P4IH 5T5FL 1GGBH 4KHXL 1XF3B 2C5DC 3W9EA 1AD9A 5KS9E 3DIFA 3IFNH 5DZOA 1KF9B 5KAQF 2V7HA 5KSBB 1XF4B 4AM0A 4GRMA 4HC1H 2EDBA 4DKFL 4QWWD 4R4FL 1I1YB 4MA7H 5DHVH 1HHIA 4N0UA 3ZDYE 1T89A 5DJ8B 4YIQB 1WCQA 3GSOB 4KWUA 4I0PC 4MNHA 3RGHA 2IH1A 3BSZH 4I0PB 1PVHA 3U7YH 3T0ED 2OMNA 5KVDH 3BKCH 4M6MH 3SJVA 5I1DB 2YUWA 3HNVH 2MCPL 3AM8C 4HS3A 5H2BB 1G9NL 1FFQA 4L1DA 5FK9B 5DD1L 2OK0H 1DANU 3BPOB 4ZFFA 4XVUD 2E9BA 5I8OH 5SWZB 1RZ8B 5CS7A 3AU1A 1MAKA 4P9HC 2F53B 2HG5B 1MWAL 5TE6L 1MI5D 3GB7A 4FQ1H 2DLFL 3UP1A 2WP3T 2QQLL 4U1MB 3TYGL 4BH8A 1FE8H 1KIRA 4ZPVA 2A6DA 3O4LB 4BQCA 1DVFA 3VRJA 4LSSH 3IFOB 3E6FB 1VFBB 3LMJH 3RWDB 3FB5A 4OKVA 1JWSB 4JN2B 3VMNA 2J8UF 1QZ1A 4ZAKD 3MBED 1PYWA 2AK1L 3UC0L 3MGAA 3IU3B 3UYOD 3Q6GH 4LSRL 4UU9A 2WIIA 1AGDB 2R0KL 4HAFA 3GEWB 2W0FA 3ILQD 3TPUA 5GS0H 2XN9E 3HMXA 1L7IH 5ILTH 2X4TB 4XWOD 3SOBL 1K4DA 3P9LB 4KK8C 3MGOB 2BJML 3T0WA 1M7DA 3G6DL 4MAYC 5F9OL 3MGTB 4KTYA 4OCWL 2YD2A 5JDSA 1GGCH 2BHUA 1CDHA 3U83A 4MAYB 5EU6D 3MLZL 4O58H 1FV1A 1CE6A 3HN3A 5TF1H 2ITDB 3HG1E 4GJTB 1OSZB 1JNNL 4JFYA 1NMBL 2XTJC 1BF2A 1ZEAH 5JIIA 2C3VA 4K7FA 4Q97A 2VLJA 3HAEA 4Y5YB 3QSKB 4YR6B 4EUPH 4HF5L 2D4DA 3VRIA 5AZEL 2XTJB 3T4YA 4P57A 1CXIA 4NKIL 1U0QA 3QP3A 5IKCB 5IF0A 2DTSA 3TN0D 1RZJH 1PLGL 3QDJE 5MP6H 4OM0H 4YE4H 1KLGA 4QWWC 2ZCHH 4YDLC 5J1TC 1QFWH 4E41A 1W2KT 4NUGH 1YA5A 2IFFL 2AABH 3SDXE 1UT9A 2D0GA 1YECL 2X1WL 2B39A 4BK4A 4U31A 4NOFA 3UX9B 4XNMB 5DK2B 3CX2A 3T0EC 3GZKA 2P48B 1SM3L 4ODTL 2X4PB 1A6UH 3DBXB 3WJJC 5CLTA 4DZ8B 4G6AC 4PJGF 5FYJD 1G7MB 3WIHL 3ARWA 5I73C 4GG8A 1EH9A 4XVUC 1U36A 3MRDB 4R4ND 3CFDB 1U8HA 4NQVB 1GXEA 1S3KL 3MV8B 4R97B 2Q87A 3ZYIA 1A3RH 1HXMA 3GHBH 1A6TA 4KPHL 3E6HA 1OAZL 4RX4A 5D2LB 4OZIB 3V7MA 4IHOA 3QQ9D 5HYJA 3U2SB 4X6BB 3PQYA 4DN4L 2BHYA 3QXAA 4OQTA 2X4OB 1UXWB 2OTWA 4P46D 2G5BB 1L0YA 1X5ZA 2VUYA 3QEUB 2BDNH 3QUMA 1WJ3A 4QRTB 4ZAKC 2X1PA 4OLWL 4ZUSB 2FATL 3BN3B 1Q9KB 1IGYA 3MBEB 3MJ8B 3LD8C 2VZTA 3ILQC 1C5CH 5ICYB 4XWOC 1GIGH 1EO8H 5IR1B 3JV6B 1CFTA 2NTSP 1JPSH 5IV2A 5B38G 4MJIA 2VLRE 2AS5M 5TGBA 1PAMA 3STBA 5HY9A 2ADGA 2P8PA 3VGAB 3HUJF 4PIRF 2EEAA 1DBJH 1WZKA 5EOCH 3TEUA 1AKJA 1DSFL 3QG6A 2EDWA 1XT5A 1TETH 3QUXA 1B4JL 3KYNB 4DGYL 1IC4H 1VGKA 4HWBL 3O3UN 5CINL 3BWAA 3TN0C 2QSTA 2MKWA 3A6CH 3SKJL 3TN0B 1JPFB 5GZOC 5EZJA 4HK0B 5CJXC 3JXAA 5DUML 4PGBB 2ED9A 2IBBA 4ODBD 4G43A 1T22B 3B3IB 5IOPA 4XB8A 1JYVA 1J8HA 4FXLA 2GJ6A 5TE7H 1A7PH 3CUPA 1MHCA 2ZJSH 4F37F 1I85A 3M1BB 5FOJA 1J5OH 1I1AD 35C8L 4FQXD 3MROA 1SYSB 4UQ3B 4M6OL 3NN8A 1IKNC 4JPKL 4HIXH 1XGUA 4NN7B 4EUPG 1JNLH 5L88H 1FH5L 5F1NB 4YAQB 2AJXH 4YXKL 5K9KB 1FORL 4PRBA 4R4NC 5GGUB 1MUJA 3QUYB 1IL1B 5EC1A 2A9ML 4OI7A 3V6OE 4JDVB 2JB5H 4FMKA 3GMPB 1O0VA 5AUMA 2AXHA 1FN4A 1KG0B 3OB8A 5D72H 2UV3A 5D71L 1I7TB 4WTZA 3TPKA 3WFDH 3VA2C 1AXTL 3IB4A 4KMTL 4Z0XB 2DQJH 1WITA 3UCRA 4S2SB 4P46C 1S9YA 5I1JH 5F3HA 5I0ZA 3GBNH 2P5WD 2EH8L 1AO7D 4B41A 1GHFH 4ZUUB 4JCLA 4JN1H 1FFPA 4X7SH 2LAAA 1N7ML 4MDIB 1B0WA 3BKYH 3ZT5A 4N5ED 4J8RB 3W9DA 2VDPL 4J12A 3ULUD 3X13B 1GAFL 2A6KB 2XZAL 4PRID 1GRWA 2VSDA 4HUVB 5DD3H 3MFGB 2VLLA 1WBYA 1A3LL 1T1XA 5ACZB 3U46B 4C59B 4DGIH 3C60A 1IEBA 1P2CA 1QSEA 5FUZH 4ONHA 3VXTA 1J8KA 4JFQB 3V5DA 4RISH 3FQXB 1KJ3H 1IM3B 2VXVL 1H3PL 1Y0LA 4I2XA 2VLKB 1TNNA 1UCBH 3KNBA 3ALXA 4G7YL 2QQNL 1MPAH 4XVJL 3U82B 2CDGA 1A9EB 1GZQB 3FMGH 1F8TH 5EZLB 3AAZA 3FN0L 1E4WH 1YUHB 5EU3A 3QDMB 4Z7UF 3LQAC 4AH2B 3EO9L 4MD4A 2R0WL 4XPGH 2F19L 4KROB 2BZDA 1ZHLA 2CQVA 2CXGA 4WDIB 3C5SB 4QY8A 4YDIL 3BW9B 4Z7WA 4PLNC 2JKXA 4Y1AA 5IVOA 2EO1A 1IAII 1YN7B 1MRDH 1SJEA 2LFGA 3U0TA 4A6YA 5BVJB 4QNPF 4UUJB 1I1AB 4FQXB 4H8WL 5INDA 4L3AA 1YMMA 2C26A 5ADOL 2BSTA 5F88A 3I3EA 3QUZB 4PR5B 2Y36L 5JXAH 2PTTB 2XKNB 3X11B 2R0LH 1FLTX 4OJFH 3D6GA 3BUYA 3H3PH 2CLZA 4LSDA 1IBGL 2AV1A 4HMDA 4WFFD 4YHLL 5JW4R 2FO4A 4ZQKB 3MUJA 2FR4A 1TZIB 1YMHA 1G6RA 1Z2KA 1EBAA 4UV4L 1JGEB 3CGTA 5BRZE 1TTGA 1X9QA 4YWGH 5HHOE 2QSVA 4DW2L 4ERSL 2LVCA 1FL5A 4X6EB 4TSBH 4GXUN 1RUAL 3BIAX 3SKNB 4JZNB 4TSAH 3GSXB 3DURB 1UWXK 5DUBA 3V6FB 5T5FH 4D0DA 1GGYA 5LXGL 3Q5OA 4KHXH 1BD2E 4PJ5B 1HCFX 2OJEB 4GH7B 2FHCA 4IJ3C 2P5WB 1P1ZA 3L95B 4RIRB 1PJ9A 1D5ZA 2AXGB 4N5EC 4DKFH 4IJ3B 4R4FH 5F72S 3ULUC 4EOWL 1YQ2A 3ZKMD 1R3KA 1VADB 1RUQL 5LAXB 4IMLB 4PJEA 4QHLB 1BLNA 3OJDA 2NY4D 3LDBC 3P77B 4PRIB 5KN5A 1U95B 3MZTA 1MCLA 5IT2L 3LDBB 4Y4KD 2DF3A 4LSVL 4P5MB 3O2WL 4LBEB 4KRLB 5C0ND 5SWQB 1CGXA 5CZKA 2MCPH 1DLHA 1G9NH 5EPMA 4OB5L 1Z9LA 1WVZA 1N3NA 5DD1H 3HCVA 4LHUG 3S9DB 3HPJB 5B3JF 2FJGA 3MRJA 5LKNA 1QNZL 1C5DA 5D2NA 3U9PL 1FZMA 1ZT1A 4MNGE 1O7VA 5D7LD 1MWAH 4C83B 5TE6H 3IJYA 4G8IA 1P53A 2PYED 1VEMA 3CNKA 2E27L 5DC4B 3E2HC 5DUPL 5GS0D 2DLFH 4HH9B 1G7HA 4WIQA 4FZEL 2QQLH 5JHDA 3FOMA 4LCWD 3V52L 3TYGH 4LLVA 3D39A 4AK1A 4CU8A 1WC7A 4W6WB 3O6FD 1DN0B 4GOSA 2F9BT 2PW1B 3P9MA 3VGBA 2BRRL 1BJ1J 3I9GL 2AK1H 3B2UD 1T1WA 3KDMB 3UC0H 4MJ6B 3ZTJH 4ODVL 4LSRH 2LTQC 4HUMB 2HH0L 2R0KH 3BWUC 4X7FC 2ZNXA 2P24A 4HGWA 1BECA 1NFDB 1W0VA 4N0YL 4Z7VF 3SOBH 3LEXB 1P84K 1W0WB 43CAA 3W5NA 4HZLA 2BJMH 4Y19A 4WI5A 5ANME 5T1LA 1YNTA 3G6DH 3Q6FB 5F9OH 5ERWA 4OCWH 2ZUWA 4RNRB 2QR0A 3IRPX 1HHHA 3FTGB 3KR3L 3MLZH 2BVEA 3RDTC 1VEOA 3OR7B 5E8NA 3CFIC 1IVLA 5GGSB 2ZUVA 1OT2A 4N90E 4XBGA 1NMBH 2DM3A 4MDJB 4HF5H 5AZEH 3SKOA 4OD3L 4NKIH 1JN6B 3GSUA 5E94B 1B3JA 1BFSA 1VCAA 1PLGH 1DE4B 2WY3A 5I1HL 4WTXA 4YLQT 2EECA 4OCNC 3ZKMC 2X44D 3DMMA 2W0PA 3PWPE 5HGGS 2QJDA 5B3NA 2IFFH 3GFUA 4KZDL 1YECH 2NY4C 1D5IL 4QXGL 3G6JE 4MD5B 3S96B 3QQ3B 2NY4B 4Y4KC 3QJFB 2R23A 4L3ED 3WV0A 2Z31D 3I6LD 3MV9A 1SM3H 2R69L 4ODTH 5C0NC 3HFML 4OKDA 4IEFB 2DYPA 1H3VA 3S4SG 2K7QA 3ARSA 4EXPX 3BD4A 2F54E 4NHUA 5F89B 3O3DA 1S9VA 1C12B 1T21B 4FTVD 3WIHH 3TYFA 3ORJA 5DJYA 3ZE1F 4J6RL 1UVQB 2OM5A 4PRPD 2NW3A 1S3KH 4XCEB 4KKNA 2R2HA 5IK3A 4KPHH 1TVBA 1JNHA 1OAZH 4NC1E 5ID0A 1BWMA 3MFFB 4BQ8A 5GS0C 1U93B 3PWLA 4DN4H 3ARPA 1B6UA 2PYEB 3EYFA 3FQWA 3OF6A 1OGAE 5E6ZA 1ETZA 3O6FC 4LCWB 3KXFE 1NGWA 5DHYB 1ZANL 3UROR 2H26A 3IDIA 2GTZA 1WLHA 3KLAA 1U8QB 4OZ4B 4ETQB 1NMCC 4OLWH 3PWNA 4XPHL 2FATH 1TCRB 1CXKA 1G0YR 5HSFA 4NQTA 1WWAX 1NMCB 4D9RD 3MYJB 2OZ4A 1G6VK 4WV1A 5GRVL 5A2FA 5FECB 3IDGB 4G8GA 5FF6A 2VABB 3RWIA 1CFSA 2BY0A 5ETUA 2UYLB 2YSSA 1RZJC 1EHLL 3P4NB 1N4XL 4QF1A 3SDCD 3BRDA 4Z0BL 1F97A 4LQFL 2IWGA 1OP5H 4LNRA 1BFOB 1BM3L 3HMXL 1MIML 1DSFH 1DDHB 1MCHA 2VWEE 1X7QA 3BAEL 3JTSB 1U8PB 1CGSL 3QEGL 4LPUA 4RDQG 3RRQA 1L4IA 2NYYD 3VFWB 1B4JH 4HPYL 2PCPA 4DGYH 5CLWA 5C8JA 4HWBH 5H94A 3TWCL 1DJSA 3JWOL 5CINH 3ZTJG 1FC1A 4I5BA 4F9PC 1IGTB 2JJTC 5E9DA 1S7UA 1KB5B 1KC5L 1ZKAA 4P2CG 3SKJH 3ARBD 1Q9WA 2DQDL 4IBLT 5DQJB 3QQ4B 4BFIA 4Y7MA 1YEIL 3U0PA 4YZFF 4PRHE 3VG9C 5CEXA 5DUMH 2EDTA 4WJ5B 2HFFB 3RTQD 2IH3A 1N2RB 3D5OF 2O61A 1JWMA 5DS8A 1K8IA 5BOPA 3SO5A 2FJHA 4LRNL 4Q0XL 1IMHC 3KPSA 4P3WA 1KT2A 35C8H 3L3GB 1NJ9A 5F8RC 4X5WA 4JKPL 4M6OH 2DMKA 1MFDL 4HW6A 2Z31B 5DI8B 5KG9B 4JPKH 2DAVA 1FH5H 4DWHA 1S8DA 1NKOA 4P0DA 2CKBA 4YXKH 1FORH 3QEQA 4M61A 4P3DB 1G1YA 1Q94B 1S7VA 4FTVB 2A9MH 4MCZB 2YXFA 2GHWB 3CZFA 1HEZB 2DL9A 4LDLB 4LLMA 1N64L 3D25A 3Q5YA 3R06A 2VUOA 1R5IB 5D71H 3PL6D 5B21A 1AXTH 4KMTH 5I8CB 4I4WA 4TUJA 3WS6A 4ODSL 3BEWB 4XXCC 1I8MB 5DEFB 3ISWA 3WEXA 2YEZA 5IB5B 5A2LH 4JDZA 5JNYA 4NN5B 4P2OC 2FEDD 4CBPA 1NMAL 4N0CA 2X40A 5GGRY 2EH8H 1NUDA 5LGJB 2ITCA 5KVGL 2W92A 3PG2A 1TPXC 1N7MH 1CQYA 5ENWB 4OQTL 4LVHC 3JV4B 4FFEX 1UJTA 4U1JB 1TPXB 1GGUA 4ISVB 1FYTD 2VDPH 5KVFL 1REIA 1GAFH 2XZAH 4E42B 5JOFB 3QUML 2VXTL 5T3ZE 1A3LH 1BQHB 3SDCC 1RHHB 3SKMA 3L3DB 3NFNA 3TBVB 4WEUD 3GIVB 4PJ9A 3SDCB 1NPUA 3UDWC 2VXSL 5HHPB 3CH8A 3RWGB 1S5HA 3RZCB 4WI9A 1K2DA 2VXVH 4LCCC 3BP5A 4O2FA 1H3PH 2NYYC 3HZKB 4ZG1A 3FT2B 3QXVA 1N6UA 5A3ID 4HD9A 4G7YH 2QQNH 4GMSL 3GJFA 4GKZA 4IDLA 4XVJH 5DT1L 3BEVA 5GRWA 3EW3B 3ARBC 3CH1A 1CLZL 1T2XA 4LGPB 4P2QA 3FN0H 4D0BA 1A5FL 1JPST 3UJTL 4TUOA 3DV6A 4R26L 4GS7C 1JUFA 3VGHA 4UIMB 2DQGL 5C0GB 4GS7B 2J8UB 3EO9H 4L8BA 2R0WH 2F19H 1BBJB 1F13A 1YEKL 3EJYD 3OKEA 2ICWA 1U3HC 4LKXB 3RTQB 1HH9A 4YDIH 5DVNA 5I74C 2XZQL 4M7JL 3LKOB 3T77A 5DO2D 4R7NB 4HJJL 2KZ1B 1P7HL 4H8WH 1DANT 3TO4A 2GKIA 4E0RA 3TBYB 3GM8A 4KDTA 5ADOH 5E00B 2X89A 2YPKB 2YA2A 3AB0C 2FIKA 2KPNA 2IQAB 2Y36H 4MYWB 4HK3N 3VMPA 1T20B 4JRYB 4H1LG 4ZYKB 4D9LL 5D7IE 3LSOB 3IDMA 2ESVD 2NZIA 1IBGH 1XH3A 4YHLH 4XPTL 3BP4B 4GKOA 5A16A 5MEND 4FN0A 3MV7D 4ELME 1BX2A 3PL6C 2EIEA 1K85A 3TCLB 2R4SL 4UV4H 5E6IA 1RJZA 4JFED 2X4SA 3SE8L 4WUUB 1N26A 4DW2H 3W82A 4ERSH 3BZDA 1RUAH 4XNQB 2FEDC 2W9DL 1N8ZB 4PLKC 5E03A 5LXGH 1EX0A 5C71A 7FABL 3G04B 4Z76B 1EERB 1V8HA 4U6XA 4OCYL 1XIWA 4TOYL 1NEZB 4MCYA 4I9WD 4EOWH 5HYSA 1RUQH 2FJFB 3OKLB 2CRZA 3LN9A 2R1YB 1RZ7L 2XY2A 5IB3A 3P0VL 1BQSA 1FYHB 3CFJB 1KLUA 4MMZC 5IT2H 3KYMB 4PJGB 4M1CD 4EJ1C 4K2UL 1U8MB 4P2RB 4LSVH 3BO8B 3FO9B 5C07A 3O2WH 1VDGA 1EFXA 1WBZB 3H0TA 3MJ7A 5K9JL 4QHNA 1UENA 1J9CT 3VFGL 5F6HJ 3QR2A 1TZHB 2VISB 4J4PA 4XRCA 4OB5H 2BNUA 5A3IC 4N1CA 1YJDC 4ZOEA 4ONOA 3VH8G 3B5HA 1BWWA 1QNZH 5BQ7A 5CMAA 3U9PH 3F12A 2QADC 2VDNL 3CXHK 3SGKA 1UB6A 5DUPH 3VXQA 3BISA 2E27H 3NCMA 3D0VB 3LRSA 3V7AE 2YBRB 1ERNA 3EJYC 4FZEH 1RURL 1JV5A 1QO3A 3TT3L 3V52H 3L3IA 4PP1D 1HKLL 1KJVA 1L0XA 3N06B 4AY0A 3H9SE 4OF5A 5DSCA 2XN9A 3DRTB 1AI1L 5CEZE 1F3DJ 4EDXB 3B6SB