1P1ZA

X-ray crystal structure of the lectin-like natural killer cell receptor ly-49c bound to its mhc class i ligand h-2kb
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
272
structure length
255
Chain Sequence
HSLRYFVTAVSRPGLGEPRYMEVGYVDDTEFVYEPRARWMEQEGPEYWERETQKAKGNEQSFRVDLRTLLGYYNQSKGGSHTIQVISGCEVRGYQQYAYDGCDYIALNEDLKTWTAADMAALITKHKWEQAGEAERLRAYLEGTCVEWLRRYLKNGNATLLRTDSPKAHVTHHSRPEDKVTLRCWALGFYPADITLTWQLNGEELIQDMELVETRPAGDGTFQKWASVVVPLGKEQYYTCHVYHQGLPEPLTLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, K-B alpha chain
publication title Variable MHC class I engagement by Ly49 natural killer cell receptors demonstrated by the crystal structure of Ly49C bound to H-2K(b).
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 52
structure length 255
sequence length 272
ec nomenclature
pdb deposition date 2003-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1p1zA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1p1zA01
4CADA 4YHIB 2AXJA 1XGTA 3QQ4B 4N0UA 1F6AB 3SY0B 3QUXB 4M48H 3N1GC 2X4SB 1GC1L 4M9PA 3QIUA 4LKXA 3JV0A 4U1MB 2C3GA 2ADJA 1QSED 4QRTB 4N0YL 4PRNB 2AJZB 4ZFZB 1HK6A 4LPYA 5IMLA 3CXHK 3RBGA 3I75A 4UUJB 5IHUH 1X5ZA 1YMHB 1DL7H 3IRPX 4X6BA 5EUKB 3QG6A 1Y6MR 1KJMA 1AQKL 4Q74A 5DR5H 1MI5D 4UQ3B 3V6BR 4IOFD 3BWUC 4Y5VA 3QUKA 4IS6B 4UTAL 3A0OA 3IDYC 1KPUA 4PRPD 3RZCA 4JKKA 5K33A 3WNPA 2C9AA 3KYOB 2AI0L 4YAQB 4R26H 4NFBA 4M61B 4KZDH 5GZND 4R8WH 4M7JH 1CTNA 1MVUA 1S7VA 2YD4A 4JFXB 5CINL 5D93C 4L4VA 3MRKB 4PP8C 1O0VA 4XC3H 2GAZB 1BFOA 3WHXA 3M8OH 2D0GA 5J4MA 3I3BA 5JHLL 2VKWA 4Y2DB 4HUKB 5MEPB 5DDHB 4MMZC 3TFKC 3MSPA 4OCXL 1CGSH 1NLBL 4U1GC 4X7TB 3C2SA 3WS3A 3KHQA 4Y19A 4LPWA 3BHBB 3B2UD 3IT8D 1FV1B 4RISL 3MRFA 1Q0YL 4YXKH 4UAOB 3MFFA 3EGSA 3W5NA 3RUGE 3KPMB 3MUHL 4QRQA 5DT1H 4DJMA 1C1EL 4XHJC 2DWEB 2DIBA 2BNQA 1SMOA 2GEEA 5INCA 1T0NA 2DLHA 4NN5C 3JUZA 3GUTA 2XQYK 3DMMA 4YDKH 3FT4A 3EYUL 2H26A 4LAQL 4WO4D 2HVKA 5D1QC 5HHVH 4GKSB 3V8OA 2X4UA 4J8RA 2HRPH 5FKAA 3FOLB 2DKUA 1KFAH 1AGDB 1LQSR 4NKOA 1A6AB 1VFMA 2I9TB 3P9LA 4LP5A 5J6HB 1F2QA 2YEZB 3INUL 2ID5A 4PJBB 5DFVC 1UYWH 4NBXB 5F71A 5ACLA 3EIFA 3E3QE 2J6EH 3CZFB 4AQOA 4CVWA 2Y07L 3DNKA 3MLZL 2M2DA 3RWHA 4TVPE 1JPSL 4GKZA 5F7MC 5F1IB 5CJBA 4YDVA 3STBA 2G9HA 4NKIH 4OFYA 4ZNEA 4XBPB 3WJJC 3OPZH 1WWAX 3MRBA 4KJPC 5IQ7L 7FABL 1UH4A 4H5SB 4OD1H 3MRCB 4UT7L 3LKQA 4ELKA 3BVNA 3SCMD 4HJ0D 1CFQA 4FQLH 4QCIA 3PNWB 3U4BH 4NQDA 3ZTJG 2QBWA 3HLAB 5IB1A 1KJ2H 4WTZA 4JFEE 4I3SL 2CO7B 2YPVH 2FSEA 1FYTD 5EU6D 3OKEB 3QCTH 1LO3L 2W0FB 4Z77A 4AEHL 2AXFA 2D4FA 3O6LL 4NP4H 4YBHA 4YDIL 3IDNA 1RK1A 2PF6A 3SKUD 2AJSH 3R8QA 1CDYA 1BGXL 5I66B 4LP4A 3ARRA 3C9NA 3RVXD 4Y8DC 3QEUA 5DD3H 1Y0LB 3QUYA 5FGSA 4I18A 2I07A 3GMOA 4QF1A 1QRNB 4RMTA 3SDCA 2DQCL 5C0BB 5GS0H 1KJVB 4AG4L 4U7MA 3PV6A 4QHNA 1YNKL 3ROLA 1UZ8A 5ILTL 1HHHB 1O7VA 2BFVL 2Q1EA 4PLKC 4P23D 1IBGL 3A6BL 4RMUA 1AD9B 2R4SL 3PG2A 3AY4A 4HC1H 3QQ9D 1I3RB 1KIQB 4PJAA 4WFED 4H1LH 5AWNL 2X42A 5TFSL 3RVUC 1BFSA 2Z35A 3C6SB 3QEHA 4BM7A 1S7TB 3O2DH 4GRMB 4P59H 5GS0C 1MJ8H 5DMGC 3I6LE 2JJUA 2X6MA 3V0AC 3KPPB 4HKBA 4O02H 3QFDA 4MS8D 4GBXA 1OPGL 3DGGB 3WKML 1LD9A 1RJYB 1QFWL 2BZDA 3TO4D 3W0WE 1J8HA 2ESVB 5E5MA 4JFZH 5C86A 5D7IA 2J4WL 2L7UA 1DQQA 4PS4L 1AKJD 5CFHA 2AEPL 4DAGH 2MCG1 4D0BA 4PRIB 4IBLT 5CZVL 4XI5D 2A0LC 1V7NL 5HI3C 5MEND 2BHUA 2ZWLT 4QWWD 2D7QA 3CFBA 3F8UB 1MHEB 4E5XB 5C0JA 2Y1VA 1G7QB 2R9HC 2BJMH 3SE9H 2DKMA 1XGUB 3L3GB 4JRWA 5FM4A 4PTTA 4OM0H 3E0GA 2JB6B 1RFDL 1KCVH 1CS6A 1X6NA 5EU5B 1KGCE 4IRJA 1TVHB 5FYLE 4ZMAT 1A0QL 5DJ8B 1TNNA 4NWUL 1CT8A 3U6RB 4FTVA 3P0YH 3VFTA 1CL7L 5H35A 1U2HA 2BDNH 2QSTA 3BP7A 3LKNB 4XAKD 5JLZB 3AC0A 3PHOB 3ALXA 4QRRE 3OB0K 2BK8A 1TNMA 4JFFB 5IB3B 1IC5L 2OL3B 1CGTA 1MCOH 1MPAH 5TH2A 2PO6B 5GRXG 4GRLB 5DMIL 4GXVH 1OARH 5ANMB 2V7NB 5E2WH 5CGYC 4WENB 2AV7A 4X6DF 4PJ5B 5C07E 1EMTL 3N1MC 3NIFF 3SKMA 2QHRH 4I0CC 5DD1H 3DV4B 4OZGE 4JJ5B 4XCCL 3F5WA 1XF2B 2GT9A 4UTBH 4POUB 3QQNA 2H6PA 1OWWA 3EYSH 3FT2B 3MRGA 5TGBB 3UTSB 4ELME 4N68A 1T0MB 3ZKXB 4MQSB 3EYFB 2H2PC 3P4NA 5E6IA 5DRXB 1BBJB 2CQVA 4EUPB 2ZUYA 3GJEB 4L8DB 4OV5B 1GGCL 1WTLA 4NQEE 2Q7YA 4ENED 2YMXH 3PDOB 4XVSH 3VH8B 4LSQL 2PW2B 3IDXH 5GGQL 4KMTH 4MMXC 1T89A 4TOYH 1C5BL 1HI6A 3MV8E 4QTHA 2X9WA 2NXYD 3D39E 4GJTB 3KPQA 1T1ZA 3DRTA 1H3GA 3MNWB 1C08A 3RAJH 3R1GH 3R8BB 1I8IA 2FEEL 2R2EA 1W72L 4OTXH 1QOKA 1MQKH 4K23L 4XBEH 1KPRB 1ZVHA 1BD2A 4OLWH 4JZJB 3D6GA 2D7MA 2ARJB 1AO7B 1FZJB 4F7TB 1PVHA 1ZHBA 2Q8BL 3DUUA 1WT5A 2FL5A 4JREB 5IESH 5IEHB 4LDOB 2IAMD 5L8LB 1R5VA 4XVUD 4PRHD 1CLZH 5H94B 4F80A 3B9EA 1XGQA 1F45A 3L6FA 3S96A 4E41D 1KOAA 1LEIA 4OLZH 4XNMB 3PWPE 3AREA 1ES0B 2J3SA 1I1FA 2EDHA 1JPGB 5E8PB 2PTTB 3HRZB 5FM8A 3T0VA 1CICD 3TV3H 1DN0A 2XWBA 3N9GH 3AROA 4YFLI 5I0DA 1DQLH 2MPAL 1WFNA 5DJXB 2XTJC 4FNLH 3QIWD 5I1HH 1SYVB 3PL6D 1EAPB 1BJ1H 1F4XH 3SDDA 2FB4H 4N8VB 4XB8A 4P5KA 5EU4B 2C1OA 5A2JH 1A7QH 4ODUB 5E8DL 3OR6B 4LKCA 1KEML 2PXYA 3AGVA 2EKSB 1YMMB 3ILQD 4FQ1L 1IRAY 4D0DB 4ZUWA 1KT2B 1ZK9A 3VMOA 1ONQA 2NX5A 4DOHB 5CJQH 3AVEA 1JF1B 4O58H 1CG9B 4QHMA 3FN0H 3OZ9H 4ZNCD 4HG4K 3JTSA 5T1KD 1CE6B 2MNUA 5MI0B 3KR3H 4PLJC 3TVMC 1OP3K 1EEQA 3UTQB 2WINA 4PJCE 5IBLD 4Z7UE 1D5MB 4KHXL 3U4AA 4BSWA 2VZUA 3EOTL 4RGOH 5ITFB 3WNNA 4P2RE 4HJJH 3LPGA 4GW1B 2XICA 1YEIL 2J1KA 3IXAA 3O4LE 1BJ8A 2I9LB 4JEGB 3TLRA 4ZTOL 3UTZA 5DRWB 1ZLUK 1ZGLB 1NKOA 4G7YL 4ONGL 3VFOB 1OCWH 4WCYH 1ZLSL 4KRPC 1FIGL 4PB0L 5I8CA 4KY1L 3BE1H 2ZG3A 2ITCB 3PP4H 4KMLB 5JHDA 5HHMB 5DI8B 1AR1D 2LAGB 3MQIA 3BD3A 4U1JB 3S7GA 4YWGL 1RULH 3D0LA 2NW3B 2VXSL 2ZUQC 3FMGH 3QZWG 4MA3B 4HH9A 3U2SA 1NCNA 2NY3C 2YKLH 3BOVA 1A7RL 5FUZH 1IM3A 4KKBC 3NGBB 1UKTA 3QQ3B 3PGDA 3RGVA 5EULV 1XF1A 2APWA 4OZIF 1UXSA 4EVNB 4NHCL 4XHQA 1I9IL 2EYSB 3RQ3A 3MLUH 4KZEL 3F6IA 4P5MA 3STLB 3RPKA 3H9SB 3O6FC 5IIEA 3GI9H 2XT1B 1MH5A 4ZQKA 4MNGB 2Q7NA 4NM4H 5B38B 1N5AB 4L4TD 1NEZA 5EOCL 3T77A 4PGZA 3SE3A 4AM0A 4R4BA 4ODBD 3X3GL 4HKJA 3BUTA 5C0AB 4PB9L 3G6DH 5H2BA 2DS4A 2KZWA 5EUOA 3O9WB 1BF2A 2GSIA 3S37H 2HJFA 1CFNB 1ZTXH 3N85H 1S5HB 3EYQC 1RUKH 3QWOA 4P2OC 4WI6A 4OM1L 3IF1A 4PJIE 5C8JA 5DJ2A 2OJZL 5EIIA 1HYSC 1INEH 1L0XA 5IOPB 3V5HA 1FO0B 4KVNH 1Z2KA 1KJ3H 3F7VA 5GGTL 2NLJA 3CGTA 1F5WA 2FBJL 2QADC 4X6DB 4EDXA 1NKRA 2Z4QA 1RJZB 4JQIL 2HT4D 3NZHH 1EBPA 1MWAA 3RHWF 4CNIA 1AJ7H 1BX2A 1AIFA 1AFVL 4Y4KD 1YYLH 4YQXH 1ZWIB 3G5YB 3QEGH 4HX1B 3KPNB 4LCCB 1YN7A 2IC2A 4F37K 1MIEH 4S1QL 2BVTA 3OKKA 4OQTA 3VFRA 4PG9B 1D9KC 32C2A 4PJEA 3QDJB 4JGMA 3UYRH 3FQTB 4JN2A 3R4DA 4MB4A 4P9HL 1NGWA 4H20H 3FONA 4Z7VA 3QDMD 3SGDH 3KDMB 2P5WE 3UROR 3BIKB 3ZO0A 4RMSA 1EEUA 5E03A 5E6ZA 1JNLH 1X5HA 1FL5A 2NTFB 2HWZH 1AE6L 5T3XE 2IPKA 5JO5B 4NNPH 3VXMD 5E6YA 4P4KA 2GJZB 1WZ1L 2P48B 5D2NB 2ICWB 5D7JC 1Y6KR 3T4YB 3D2UD 3H7BB 3WFCH 2F54D 1DBJL 1P6AB 4XCNB 2ZUVA 1ZLWK 4JZNB 1FFPB 4I48B 5JPNB 2P24B 1F4WH 1JZ7A 1UENA 4RGMC 5IJKC 3QIBB 1AGFB 1BQHB 3BP6A 2JTDA 3VXRB 3Q1SH 4KKAD 1OW0C 1IM9B 2DTML 1P6FA 4HZAA 1QLEH 5FOBA 3O2VL 4PJHA 1T83A 3V5KB 4H88H 3T2OA 4WV1A 1P7QD 5L2KE 1AY1H 3SGDI 1RIVL 1UEMA 3ZHLA 5ALCH 1RU9H 1MCQA 4DEPB 1FVEA 1A7NL 3QIUB 4ZUUA 1CD1A 1CK0H 1QBLH 4FFZL 4NN6C 1Q9LA 5FUCC 2ADJB 1RJLB 3FB5A 3BPNC 2IFFL 5E5RB 3VWJC 3IDJA 4RBPH 4APQA 4PV9A 4GMTH 1TJGH 4X6BB 5KG9A 3T3MF 1QFWM 1UVQA 1YY8B 2Z92B 1KJMB 3SO3C 4MSWA 4OSUL 4WFGE 3OKMA 4XHJD 1IVLA 1BM3L 2P8LB 1GVIA 2F8VA 4L3AA 5T3ZE 3VU2A 3ULVL 4RGNC 1K85A 5CJXC 5HJ3A 5DJ0B 4P46B 1MVUB 5I8KH 1NC4D 2R2BB 1JGVL 2APXA 3ARDC 4XVJL 4DK6A 1BFOB 2R1WB 4MXQA 4UNUA 2E7BA 2FLRT 5E95B 4OD2A 3O6ML 4UINH 4L8BA 2XZAH 3WS3B 2O61B 2ADGA 3FRPA 5ACZA 3WO4B 3RNQA 3NBNA 3LEYH 4YLQT 4WHTA 5DD6A 1QZ1A 4JO3L 1R0AH 1MLBB 5DYOA 5J6GB 1D5ZB 3MRFB 3H42H 5T1DH 4U7KA 4N8VG 5D96B 2FYYA 4E42B 4I2XB 4IDJL 1ACYL 5DK2B 1TMCA 1DQTA 4X9BA 4QRQB 1SJEB 4HCRA 4KJPD 2BNQB 4F7CB 3RP1A 1MNUH 3H7LA 4GG6A 3GUTB 3LPFA 1RD6A 4GG8A 4Z0BL 1E6JL 5AZ2L 3GSWB 4MQTB 4WTWA 4UV7L 2JJVA 2VSCA 4XPFL 4YFDB 4OZIB 3UJIL 3UPCA 2YWZA 1SMAA 5A16B 5I30H 3RDTA 3HC4H 5F1NA 2BVOB 3A67L 3S37X 3RWFB 2O5YH 4XPTL 1GGTA 5IEKA 4HAFA 5DMYA 3K1DA 3P9LB 5MEQB 2VJXA 1U3HC 3UTPD 4WI8A 4YFEA 3L5WA 4Y16B 1K5NB 4IEFB 3HMWL 3I84A 1NDMA 2AK4A 1NFDF 5F72S 1LO0H 4FQXC 2V2XB 4GKZB 5K9QI 5CLTA 4TNWK 4YDVB 1K8IB 1PBYA 2K7PA 4MD0B 1EJ6A 2EDEA 4ONHA 3KXFD 3ZTNL 3RL2A 3MRBB 4LRNL 5BJTA 2X4OA 1DBMH 3MROA 3QCVH 2HTKC 4ELKB 5D1ZA 4OZHF 1G9EA 3GSOA 4NCC2 1HWHB 1OAXL 3N50A 1CFQB 4PLKD 5E9DE 4QCIB 5L7XH 1TJHL 1JHKH 3RVUD 1TQCB 1D5IH 4P3DA 2YD6A 5AG8A 5SWQA 1K8DA 2OP4L 1BZ9B 5GS0D 4GQ9L 5FYLH 1PG7W 5BXFB 5DMGD 4JANA 1C12B 3KJ4C 3WN5A 4JG0H 2AXFB 4N5ED 5J0BA 1EO8H 1B6UA 2WBKA 4MJIA 4EI5D 2F53B 5F7NC 1PQZA 1RK1B 1U8HA 2YPKB 5EZLA 5D5MA 5HHPA 3QEQE 3KLAB 1AXTL 3VGEA 4LEXL 2XOTA 4ZYKB 2DYPB 3QUYB 4XB7A 4BSVA 3MUGA 1MREH 2I07B 3GMOB 4I18B 5BRZA 3SDCB 1NGXA 1VB9A 2VL5A 1IQWH 2XRAL 2IMMA 1R3KA 2A0LD 3CVIL 5DJAA 3PV6B 5HI3D 3UTTA 3KPRD 4PTUB 5E08H 4QHNB 2IADA 2PW1B 4JM2A 3TPUB 1IJ9A 2ZUUA 2FWOA 3GMRB 3FZUC 2R9HD 2HJKA 4FN0A 4TSBH 1CFSA 3L5HA 1X5AA 3Q6FA 4BKLA 5ALBL 1MF2L 2FD6H 5CKGA 3THMH 1RZIB 3D48R 5FUOL 4XMKL 4YH6A 3C5SA 3EO0B 3VFMA 3U4EB 1EGJL 4YDLC 1JHTA 4RA3A 5IHZA 1IKFH 5FGCE 5C09A 1RVFH 4K55A 1G7HB 4LDLB 3U9PL 4UU9A 1FNAA 3K2UL 1HKLH 2VDML 1AGEA 5I19H 4NRXB 2JELL 1A6VL 5E5MB 5GHWL 1OTSC 1IL1B 1JPTL 1JPFA 4D0BB 1HINL 1KYOK 5BZWB 2DQUH 1FNSH 3QUML 3D3VD 2A1WH 2J12B 4U3CA 5DSCA 2R8SL 5C08A 2P46B 1Q0XL 1RV6X 4ZXBA 3IJHB 1NBYB 5SWZA 4C56D 4HJGA 1ZOXA 5CZXC 4F7PA 3CLFH 2WZPD 3MJ7A 3HZYA 2DLEA 3EOBA 4H8WH 2FZ3B 2WUCH 4FZ8L 2GITA 5AZEH 4PTTB 1Z5LA 4LPCA 4BZYA 3V5DA 4HWEL 4L3ED 3B9KA 1MCNA 1SEBB 4PPTA 4CKVX 4EN3A 3NCFB 3CUPB 1HHKA 1MJJB 4G8GB 2FIRT 3GO1H 4N0FA 2Z0BA 3VFTB 5H35B 5EUOF 1HOCA 1T7XA 4NQCD 5JMRA 1LDPH 1P84K 1B90A 1BVKA 3WFBH 3FO2A 4M43L 3T4AB 3P40A 3GMQB 1JK8A 1YEHH 4YHKL 4S1RH 2NY2B 1N5YL 1RSFA 4ODSL 3RTQB 4HIEB 1M71A 1RMFH 4YX2H 2A6KB 1BQHG 4LSVH 3NFNB 3BUYA 5JDSA 4M7KH 3G6AB 5ISZA 3HMXA 3MV7B 1DE4A 5L0QB 4ETYA 3PQYD 5DEGA 5IM7B 5EU7C 1I1AC 3HAEA 4EDWL 5HPMA 2Z93B 5JOEA 1RIHH 1G7MA 1QSEA 1UB5A 5ETUB 1QACA 3WLBB 5JTWA 4G3YH 1JNJA 4P2QD 3S36H 5KVMC 3VFSB 3P4NB 4DGYL 1D6VH 5DA4A 4JPIB 5E4EC 1PKQE 3QUZB 3OKYA 5J12B 35C8H 4CN1A 5HGDA 4LSSH 4NJ9H 1U0QA 4IOIB 2EH7L 2JK5A 4H26B 4PRPA 5TQ2H 1U8OB 1TTFA 1HCVA 5ESVA 1GOGA 4N0CC 2VR4A 1A64A 1DLHB 2XN9D 1I8IB 2YD1A 1LGVA 1Y18B 4YBQC 1W0VB 4BK4A 3D69A 1N0LA 4Y5XA 4HK0A 3DWTA 1ZHBB 4I77L 4JGJA 4OLEA 5KS9A 4HEME 4IRZL 4DK3A 3KYKL 2J5LB 3MRDA 3OKNA 1NSNL 1NFDB 2L0DA 2P8MB 3MRLA 5IF0B 3O3DB 3S96B 5M94B 3U48A 2CRZA 1LEIB 3IAPA 4BFEA 3JTTA 5HYQA 2WWKO 4GUPA 5IGXL 1V3LA 3FQWA 4PLJD 5D70H 1M1SA 3TVMD 5CIPH 1QUNA 2WY3A 2VDLH 4OZHB 4Y4HB 4UMGA 4UQ2A 2BOCA 1UM5H 5J1SC 2VZ3A 3QWRD 5KANG 3S35H 1NLDH 4WO4A 5FCUL 5DMJB 1GCFA 4NRYA 4ONFL 3LKOA 1D5BB 2VXQH 5D4QA 1H8SA 4R90L 1QFOA 2C1OB 4N9GA 4Q9BA 4Y4FD 4QOKB 1S7RB 1I9EA 1ED3A 4WJ5A 4HUVA 1F3RB 3NPSB 5CEZL 4LIQL 3VXSB 3BPOB 3L3OA 2QQLL 1AXSB 4HUXA 2NY3D 2JCCE 4QHMB 5BVPH 1T7YA 5E24E 4QHUB 4LNRB 5E7FA 4UB0L 1JFQL 4HWBL 4KKBD 4MJ6A 3E3QA 5IB2B 2VLRB 3ARPA 5FYKD 4OZFH 2CIKB 3SCMA 2FATH 3S97C 3O6FD 3QP3A 3HG1E 4NQXB 3CLEL 1H15B 5HVHC 3HI6L 1FFQA 3FOMB 4GAJH 1CFBA 2GJ6D 3B6SA 3QNXA 5EFIB 4KHTH 2CLZA 2DD8L 4KH2A 3BKJL 5HDQH 2G2RB 4G9FB 4GKNB 1RPQA 4G43A 1FYTA 2CKBH 3HA0A 5C0CB 5I8CB 1S3KH 2BCKA 4WTZG 5JHDB 4PJ8C 5CD3B 3MLWL 2VC2L 4MD4B 5IW6A 3EYQD 5KW9L 2PYFB 3BQUA 3TJEL 5ADOL 3D0LB 4FQPA 3U2SB 2EH8H 4HH9B 4OUUA 3GRWL 4X4ZA 1HYSD 3QA3A 1KLFA 1IGYB 4XP5H 1FG2A 1MFCL 3BGFB 4G6KH 1QSFD 5DRZB 4POZC 4NQUA 2R0KL 2H9GA 5CSZA 4LCWD 3CCHA 2CLRA 4P23A 5IIEB 4JRYD 2AXGA 4ZQKB 2BVQB 1EO5A 4LVOC 4AM0B 1HKFA 3LEXB 4LPUA 3TYGL 2VABA 4PJFF 3ARYA 4HKJB 3MLXL 5DVMA 5EIQA 2EDNA 1CLOH 5H2BB 1S7QB 2YPLE 3PIQB 5EUOB 4U1NA 3Q6GH 3FCTB 4MS8A 1D9KD 5KAQF 1TTUA 2YBRB 5C3LD 3BT2H 5C8JB 3TO4A 4PV8A 3AM8C 2A77H 4JZOB 4JR9H 2WBJA 1AKJA 1I7ZB 3MX0A 1U36A 2V5TA 4DUWA 4I4WA 4WW2A 2Y25A 3F7VB 1C5CL 5IROC 2R29H 5MENA 5L88H 1WBZA 3S36X 4FABH 4Y2OA 4W81A 3F6LA 3DX8A 4PRAB 4R0LB 1Q9OA 3PWVB 1UFUA 1E6OL 4JQVA 1VFAA 5D7JD 3VGAC 2VZTA 4G5ZH 5ADPL 1MRDL 3BKML 1MCSA 4CNIB 2EE9A 4Q6IC 5GIRA 1E4KA 5C7XH 4WFHE 5D5MF 1Z6JT 5JW3L 1GGIH 5IW1A 4PD4J 3VFWB 4LSRL 3GBMH 3VWKB 1S9WB 1RAMA 5T3ZH 5INDA 4HLZH 4KK9C 4LVHC 5KN5A 3ARFC 4UI2A 4XNZB 1JZ2A 4FQIL 1QKZL 3IJYA 4LHJB 3TBWB 2WAHA 4AIZB 3FONB 4Y1AE 2DI7A 5IWLA 2LTQC 2PYEE 1A14H 1J05A 1I3GH 2VYRE 4NC1C 1VEPA 4ZFOL 4CN6A 5ICXA 2AGJH 4P4KB 3VG9B 4FG6C 4DZBA 2XWJA 3LSOB 1B2WL 3OX8A 4BUGA 3SGKC 1NAMH 2B39A 3Q3GA 4IMLA 3ARGC 3CH1B 3S35X 4MAYD 4TUOB 1WCBA 4XCYB 3D85A 1PYWA 3LRSA 1MFAH 4KTYA 3QULA 3DO7B 4RGND 4NOBA 5IKCA 4I3RH 4U1SA 1S7SA 3ULVF 1VA9A 3QBTB 4I1NB 1FZKA 1K2DA 3DX9A 1NPUA 4JFDD 5EN2A 3GHEL 1V3JA 3RU8L 4U49A 4HW6A 4AMKL 1NFKA 4ZUUB 1YZZA 2ADIA 4L29A 1QO3A 3GGWB 5HHXL 1FRGL 1Q9LB 3RI5F 4LGRB 5AUMA 1BIIB 3RX5A 4NYLA 3FB5B 1I85A 1OAYH 2YA0A 3WEXB 1V8HA 4FHBD 1FORH 3G9AB 3K3QA 1NL0H 2X4PB 4APQB 3REVB 4Q2ZA 5EO0A 5GGRB 5C0GB 5C2UB 2BVPA 4PRHA 3MRJA 2HG5B 2DQFA 1T20B 2ED9A 5DF0A 2N7AA 2ZOKA 3B4NA 5EOTB 1OB1B 3VXOA 1ZA6A 1A3RL 3OF6A 4D0CA 4DN4H 1JJUA 2NR6D 5C6TH 5BV7B 1QHPA 2HN7A 2VXUL 1CICA 4C57C 4JPKL 1KCRH 2MQ3A 4OD2B 2DIJA 1JNNL 3DUSA 3RZWA 2OI9B 3QIWA 4GAYA 3PL6A 3RNQB 5DD6B 2X44D 5EPMA 5MP6H 5L6YL 3HI1A 3MOAH 1A6PA 2ICWI 4MDIB 3B3IA 3MJ9H 3H0TB 2BY2A 4M48L 1RIUH 1U8NB 1OD7A 2DJ4A 3P77B 5I1JH 2VLKB 5FFLA 4NKMB 4MVBD 2D03H 5C0EA 2YUXA 3X3FH 5B8CC 3DX7A 5H37H 3OAUH 1I8MA 4ZUVA 3STZB 5IHUL 1A6WH 2NY6B 4WUUA 3L5XH 4MA1B 4K71B 4PG2A 4RMWA 4YHPA 1R3LA 5DR5L 3ULUE 3WYRA 1RZGA 1Q1JH 2P47B 4F7EB 1JZ4A 4S0UC 4RQQA 2PR4H 2IH3B 4L3CB 1NBZB 4C83A 3CXDH 4LHUD 4PJFB 5LGKA 4KZDL 2D7NA 4R8WL 4M7JL 4XC3L 3M8OL 1T21B 2AJYH 4ONHB 4JQXA 4PJBE 2X4OB 1EXUA 1GHFH 3UP1A 1CGSL 2W0KA 2WK2A 3GSOB 1A4KA 1OAUH 4OGAC 1MLCA 2E9WA 4V1DB 2DLFH 3SJVD 4PBWD 2C7UA 4YXKL 4QRRD 1IAKB 5SWQB 1GPOH 4FP8H 5IV2A 1H0DA 3CMGA 2X41A 4XAWL 1YEDB 1UADC 2MCPH 1RUQL 4JANB 1VGEH 2VIRB 4S10A 3VRIB 4CJ1A 4MJIB 4BQ8A 4L4TA 1EUUA 1PY9A 1U8HB 4YDKL 5EZLB 1G7IA 5D5MB 2LE9A 4JHWH 4OCRL 1IGFH 5HHVL 1NEZG 3G08A 4BSVB 5BRZB 4QRPB 1OTSD 5BO1H 4G8FB 1KFAL 1NGXB 2VL5B 5J11B 1A6TA 3UTTB 1LK3H 4NDMA 5I73B 2IADB 5F7KC 4DW2H 4QYOA 1WFOA 4PGEA 3PWNB 5CZXD 4BKLB 1TCRA 2J6EL 1B4JH 3ROOA 1QRNE 4MNQB 4NQED 5C0BE 3HB3C 4EI6A 1OQXA 3VFMB 1J0ZA 5D6DC 3RY6A 5F6IB 3PHQA 4IRSB 5FF6A 4JKPL 5J7CC 3FFCE 1TFHA 2VAAA 3OPZL 8CGTA 3UO1H 1J0IA 3GSQB 4OD1L 3L95A 5C09B 4Y4KA 3GMMA 2EKJA 4FQLL 2FECL 2OXGA 1BVZA 3MJGX 4W4OA 3LKPB 4LLDA 1J1XH 5DUBA 3U4BL 3EAKA 3SKOA 1KJ2L 4WVRA 1OHQA 5KZCB 3VE0A 4I5BB 1IQDB 2YPVL 2DTSA 4S0TD 3QCTL 5IFAH 1HILA 3W81A 4NP4L 4ZXBB 5SWZB 3QDMA 2AJSL 3V4PH 3VD7A 4X5LA 2D4DA 4CBPA 3WHE0 1XGYL 4OV6F 2BVUA 3ZYOA 4PJ7A 1ADQH 3IU3B 1GC1H 4MLSA 5DD3L 1Z5LB 3L3IB 3T0BA 1LNUB 2DKSA 3VXMA 4TVSa 2P5WA 5T5NG 1T80A 5GS0L 2ESVD 1OAKH 2MOVA 1N64H 4NCDA 5EB9A 5I75B 2DM7A 1UJ3C 4QNPE 1YY9C 1T66C 4EN3B 2L4OA 4R97B 4WDIA 4D9QE 3D2UA 4PRID 2F54A 5TPWH 5B39B 4MA8H 5GZOD 1CF8H 2IBZX 1WCQA 1F3JB 4HC1L 2H3NA 2YD3A 1ZT4A 3FAXA 5BMFH 5DZOA 3FO2B 3V0VA 1WQVT 4UDUA 2CKNA 1GC1C 3O2DL 4P59L 4N0CD 3P4OA 1M71B 1MJ8L 3OGCB 4MWFA 5FV1L 1U95A 3TN0C 3DARA 1P7QA 2ED7A 4YBQD 4O02L 1WFTA 2BOBB 2F58L 1NCDL 2QQKL 2XG4A 1S5IH 1DE4B 3GM8A 3QFJA 1RZKL 2LV4A 4JFOB 1OT1A 1U8JA 4JFPA 4JFZL 3DGCR 5ANME 4ZSOA 1QBMH 2G60H 4DAGL 4CL7A 1QSEB 1UB5B 2CXKA 4JFFD 4TN9A 5TDOA 2W1NA 3IYLW 2EIBA 1FZOA 5HY9A 1GGYA 1I8LA 1K3ZA 2QSVA 3P9WB 3C87A 2BJML 3SE9L 3HNTH 3JUYA 4O4YH 1Q0YH 1XGRA 1MI5B 2GY5A 4PJ5D 4HV8A 1LP9A 3IETA 2R2HB 5HI4C 2EDXA 1KCVL 5HGHB 1KLUA 2R0ZH 4HQQL 3EKCA 5LGHH 2HT2C 1EO7A 1OD9A 3UTSD 2J8UA 3P0YL 2ZUXA 1NC4A 1ZHKB 2BDNL 5DHVB 3BZFA 3G5XA 3GKZA 4I9WE 4TUJA 1MCOL 1IGTA 1CGXA 1MPAL 2F5BH 1BOYA 2EEDA 2GTZA 5DGQA 3K7UA 4GXVL 4C4KT 1OARL 4PRBA 3OKNB 3PWJB 2IALB 3C5ZA 4KK6D 1FP5A 2XKNA 1I3VA 3FRPG 3O41A 3RWGB 5GPRA 3MLZH 4OLXH 1YPZA 3H9HA 3CNKA 1HNGA 4U0RC 3O3AA 1L7TH 3AB0B 4UTBL 2DWDA 1B6DA 1A4JA 4HUUB 4OLVH 1YDPA 4WO4B 3ZTJH 4AEFA 3MODH 3VXUB 1AI1H 3NABL 3NCCB 4NNXA 2UZIH 1O5DT 3LQMA 5AEAA 4PD4K 2YMXL 3CX5J 4XVSL 1ED3B 3CFEB 3IDXL 4KMTL 4TOYL 4P5TA 5EBMB 1N6VA 3L3OB 3SN6N 1ZVSA 1UWXH 3RAJL 3R1GL 4OTXL 5IMKA 1MQKL 1BGXH 4XBEL 2XA8H 5DO2C 4OLWL 4L9LB 1FAIL 3F7YA 2E7LE 4POZD 4EQ3A 3AS1A 3QXAB 3V4UH 2HRLA 4NM8H 5IESL 2DQCH 3QUMB 4PJGA 4DOHE 1J10A 1B0GB 1HHIB 1H5BB 3K2MC 4YK4B 2EO9A 1UWXK 1CLZL 1YMMD 3CJJA 5KVDH 1DANT 3TBSA 4LCYB 4OQ1A 2CLVA 2EDYA 4OLZL 1S7UA 4X4XA 2WQ8A 1IEBA 4M6ML 3EW3B 2VN7A 4MAUH 5DMKA 4QHKI 4U6YA 1FYTB 4UIMB 5EU6B 5EBGA 5F93C 4HULB 2BCKB 3MBEC 4N5EA 4EI5A 5EWIH 1CDIA 2V17H 3FB6A 3C60B 2YA1A 4WEMB 3TV3L 1IAMA 2ATKB 4CW1B 5F9OH 1DQLL 1OPGH 4FNLL 5I1HL 4H1LA 3UZQA 1F4XL 2FB4L 3LN4B 2BX5A 2FR4B 1X7QA 4QLRA 5HHME 1A7QL 5IB5B 2Q76A 4QT5A 2XQBH 5CSZB 1UACH 1KIUA 2AEPH 4OIIH 4ZAKC 2R1XB 4LVNC 3Q5OA 3LN5B 5CUSH 4Z76A 3RX8A 4P23B 2Z31A 5CJQL 4O58L 2N1KA 4ZTPH 1VKXA 4ETQA 3LKRA 4XX1E 3LD8B 5IB4A 2VE6B 3OKOB 1QVOB 1K3IA 1RFDH 3OQ3B 4P99A 1FIEA 5KSVA 3QCUH 4I0KA 3ZKND 1CIUA 4XNXH 1NCBL 4RGOL 5K9KA 4LASL 4NWUH 4XCEA 3TZVB 2CK2A 4HJJL 4HKZA 4KI5C 3PF2A 4BQCA 1NFIA 1NAKH 2VDNH 3BIBX 4NUGH 3TO4B 1QFWI 1DTUA 1AKJB 2DQIH 3KPSA 1OCWL 3O0RL 4I4WB 4WCYL 5MENB 4WFGD 3BE1L 3DVGB 4YGVA 3BRFA 3D3VA 3PP4L 4ZDHB 1WZKA 1UGNA 4X7DC 5IR1A 5BS0E 2UWEA 5C0AD 2RR3A 5TDNB 4C56A 5I1IH 1Q38A 4B50A 4FG6D 3AXLA 3FMGL 3O9WD 1M7DA 2NPLX 5DLMH 5IFJA 5FUZL 3Q5TA 3ARGD 1QD0A 4L3EA 5EO9A 5I1DA 2A6JA 3EBAA 3TBVA 4ZPTB 5FYJE 3VXNB 4WTXA 2YN5A 4X6DE 4TNVF 2IQ9L 1BIHA 3BGFC 3N1PC 4WNQA 3NIFE 1LE5A 2ATPB 2VXTH 4FQCH 3C08L 3MLUL 3GBLA 1N7MH 4RIRA 2A2QT 1CL7I 2MKLC 2YHGA 3LN9A 4N90E 4NQCA 4PJXA 2A83A 1DFBL 3GI9L 1OGTA 4WGVB 1AHWB 4X7SL 2VB5A 4NM4L 4X80L 4M7LH 3WIIH 4Z95L 2OTWA 4J1UB 4V2BA 5CP3H 4BH7B 5HHOD 3IGAB 1PKOA 4PJDA 4QGTA 2ZKHL 3IVKA 1K4DA 5IJVB 2H32A 3BH8A 1ZHNB 3S37L 4MB3A 1ZTXL 1RUKL 1VSCA 3BAEL 3UZVB 1W72H 1SY6H 3EO9L 3TNNA 1XCQA 1T03H 1F42A 1H3WM 3FN9A 3PQYA 4EIGB 1LK2B 3OX8B 4NKDA 1INEL 2EICA 1TETH 2KZ1B 1P1ZA 4KVNL 3Q5YA 1BJMA 2V5MA 5GGVH 3HNSH 3SO5A 1G7JA 4ALAH 1U8IA 3HAEG 2AQ3A 1A7BA 3QULB 2ZUTA 1S7SB 3QXVA 4O2FB 2ZP0T 2OLDA 3HZVA 3NZHL 5EN2B 4YPGA 4OGYH 3QO1A 1AJ7L 1YYLL 4YQXL 2Y7QB 3QEGL 3LZFH 2PCPA 3O11B 2E7MA 1MIEL 4PJ7F 3TIDB 1QO3B 5B3JF 3TESA 3G5VA 2FEEI 4N0UE 3UYRL 3E2HC 4GW4B 5TF1H 2EEAA 3VXRD 1GL4B 5D9SB 4H20L 4UBDD 5I0ZA 1XCTB 3IAGC 2IAMB 4ORGB 5E8DH 5EO0B 3HR6A 1G6VK 1KEMH 2BVPB 1KN2H 1QQDA 1JNLL 4E41B 4WI2A 2HWZL 4XP4H 2OZ4A 4NNPL 3UMTA 5J1TC 3UPRA 4HDIA 4YNYA 2FO4A 5KVEH 3QEQD 1RUPH 3VXOB 3WFCL 2BNRD 3WBDA 4YEFA 5E8EA 1OM3H 3X12A 2NYYC 3QWRA 1M05A 1FNGA 4KFZC 1ZS8B 2H41A 4KHXH 1JTTA 4IM8A 1S7WA 2ICWJ 1MUJA 4GAYB 3BWAB 3PL6B 5C2BH 1UB6B 3Q1SL 5EPMB 1QLEL 4L4VE 5IVXA 4ZS7H 3HI1B 7CGTA 4Y4FA 3NTCL 4MCYB 4G7YH 2A6IB 1AY1L 3B3IB 2Y5EA 1P4LA 3ZE2F 4LLVA 4P46D 3IJSA 1WWCA 4X9GA 4XCFL 1RU9L 5ALCL 5IBUB 3T0EC 1MY7A 3UZEA 5LGJA 4ZPVB 1CK0L 3L7EB 4Y19E 1LP9F 4YHYB 1QBLL 4YC2B 2AKRB 2APBA 1BP3B 3X14A 5C71A 3DX7B 4G42B 3CFDA 5T1KB 4OGAD 3DRQB 3T8XA 4O5LL 4I13B 3ZE1F 4I2XE 5FAAA 4X99B 4GMTL 4TVPL 4YHPB 2F8OA 2BNQE 4LRIC 3FQRA 2ITDA 5I9QB 2YUWA 3O6FA 4NHCH 4U6HA 3W9EB 2FEDC 4R4FH 4WI4A 5CGTA 4BQ6A 2OSLB 5F7EH 1PG7H 4PGCB 2AEQH 1PD6A 1N6QH 4IIQA 5D72H 5E99H 4B41A 2B1AH 4GSDL 3ZKSD 3P9MB 3HG1A 5I8EA 4KUZH 2Q87A 1R3JB 5I8KL 3MTRA 2VWEC 1A2YA 1L8JA 4PB9H 4IOSD 4K3DH 1YPZF 4OUOA 4UINL 1FVCB 3HC0A 4F2MA 4OM1H 1A4KB 3HR5A 5T5FH 3LEYL 4JFYA 1R0AL 3BW9A 1QSFA 1U91B 4AZ8A 1QBAA 5DURB 3H42L 5T1DL 2HVJB 4LCWA 1HQ4A 4OCWH 4OKVA 1HN1A 4ZFOB 4NHUA 4NSKA 5IV2B 3IFOA 3HE7C 1FSKB 3D0VB 1T4KA 4JRYA 1IAOA 2P7TA 3ARVA 3QISA 1MNUL 4JQIH 5ENWA 3SQOH 4NQDE 3CFCH 1L4IA 2HJLB 5C0DB 3M07A 1KB5H 1DUZB 4U2ZA 3W11C 3QNZA 4XT1C 2BMKB 3G08B 1F6LL 3TA3C 5I30L 5HHQB 3CVHH 5J3HD 3RBSA 1D9KA 2O5YL 3K0WA 4M7LT 4YIQA 4F15C 2YPLA 5EZJA 2KKQA 3QJHB 1HZHH 1T3FA 3QH3B 2F53D 1LO0L 1FZMA 3CIQA 3BFOA 1U8KB 2W65B 4OLUH 4TULH 1FE8H 4TRPH 1T6WA 3PHQB 4U6XB 4V2CB 5B22A 1AP2B 3IXTB 2DYPD 1YY9D 1T66D 1OF2B 2R2CA 4X6FB 5D7JA 1DBML 3QCVL 1FNEB 2XYCA 1WIPA 1WZ1H 2BSTA 4KV5F 1G7LA 2MHAA 5E8NB 1Z9OA 4X6EB 3OJDA 4JJHA 1OOAA 1T22A 4LLWA 5DJCA 5F88B 1JHKL 2OXHA 3SKOB 1D5IL 5D2LA 2KDGA 1NCWH 3VE0B 4HUMB 5HYJD 1OW0A 1NDGB 5FYLL 2QSQA 3ILPB 1HILB 3H8NA 3TN0D 4JG0L 5DZLA 1EO8L 4LOUD 1UCBH 5GGVY 3QDMB 4HFWB 4J7RA 3GMLA 1J8HE 1FNHA 4R7DB 1P9MC 4JO1H 4MHHG 4X6CF 3LHPH 5D7IE 2UVEA 4PJ7B 3EJZD 1MREL 1A7NH 1SQ2N 3VXMB 1FN4A 1IQWL 1S78D 3V7AG 4MQ7A 4FFZH 5E08L 3BZ4A 3CDCA 4L8SC 4PP1C 3VFVA 2BNUB 5J11C 3MO1A 5SX5K 4Y5YC 1KTRL 1BZ7A 2F54B 4OD3H 1HEZB 4TSBL 5DQDL 5BZDB 2IFFH 2ZNXA 3O81A 4MAYA 1SYSA 2LVEA 2FD6L 1T1XB 1P53A 3DVIA 3V0VB 1CLCA 4UDUB 5HI4D 4HHAB 3IDYB 3KYNA 1BM3H 1GIGH 3JWOH 4FTVE 5JZ7C 2HT2D 3LQAL 4JFDA 5J57B 2M26A 4TTDC 1HH6B 5D93B 1RVFL 2KL6A 2UWEF 3OKDA 2DQGH 3EOYG 4MJ2A 4G8GD 4L9DA 5I19L 1JGVH 1XGPA 3O45A 4JFPB 1U8PB 1X5XA 1BPVA 4ZSOB 2BRQA 1NMAL 4JAMA 4NQSB 4U1GB 5JW4Q 3CSPA 3UJTH 2FHFA 1LO5A 5TDOB 4J3TA 2N7BA 1DEEA 2DQUL 3M17B 1FNSL 1WAAF 1JYWA 4YHIA 1JV5A 1OTUC 4YPJA 2IMNA 3GI8L 3DBXB 2Q20A 3CLFL 2Y23A 4OFPA 3SY0A 4H8WL 5ELIA 3KS0J 2X4SA 1LP9B 1NCUA 1PG7X 5FGBA 3ECBB 3I9GH 3MV7D 3DECA 4NN5B 1P4BH 2EIEA 2YC1A 4U1MA 5DJYB 1WSST 3CMOH 2B0SH 4PJDF 2WW8A 4QRTA 5D1QB 4PRNA 2AJZA 3GO1L 4DGIH 1NC4B 4ZO8A 4UUJA 1YMHA 4DKDC 3BZFB 5GGRY 2JJTA 5EUKA 4UOW0 2E7LC 1UH2A 4OKDA 4TUJB 4HS8L 4XPTH 1YEHL 4UQ3A 5FA3B 4S1RL 3F58H 4F9PA 1RMFL 4IS6A 4YX2L 4LSVL 1BD2E 1CD0A 1J1OH 4CVXA 3O41B 4ZD3L 4M61A 3B5TA 3VFUB 5DO2D 4OCMC 1YPZB 1WIOA 3MRKA 1HSAB 4LSPL 2FH8A 4MVBA 5HYSB 4Y2DA 3B8SA 1GGUA 2DBJA 3ZTNH 2FCBA 3SDAC 3BJLA 3ARWA 1YDPB 3SPVB 4WWID 4G3YL 4X7TA 1OAXH 4NNXB 2G75B 2A73B 1U8MB 1OGAD 3BHBA 1KXQE 1FV1A 5SWSB 4KGJA 3QG7H 1MFNA 5K9OB 2VO5A 4PREB 1MCLA 3MBED 2OP4H 8FABA 3SGJA 3KPMA 4LSSL 4NJ9L 1LE9B 1D5XB 2DWEA 1P2CA 5TQ2L 1ZVSB 3QB7C 1I4FB 1U42A 1Y6NR 1DVFC 1KJ2B 4TQEH 3JZ7A 1Q72L 4RMQA 4QOKE 2QQQA 2GJJA 3DROA 1T2QL 4WFHD 3KXFB 2WBWB 3FOLA 1EFXB 3VI4E 2XRAH 1AGDA 2D7PA 2NX5E 3B43A 4U2YA 5DVLA 1A6AA 2I9TA 1A22B 1AC6A 3UPAA 1A6ZB 5J6HA 3KGRA 2YEZA 4QHKJ 2W9EH 5D7LD 1JUFB 3SJVA 5DHYB 3VGFA 5E7BA 5DJDB 4KAQL 4LFHD 1XMWA 1YQVH 4LSUH 2CLVB 3CZFA 4Y1AD 4Z8FL 3CFJB 4U6YB 5D70L 1U3JA 1AD0B 5IVXF 5FYJH 2IANB 5F1IA 2VDLL 2FX8H 3BRDA 4XBPA 1UM5L 3H3BC 3S35L 2H8PB 1NLDL 2VLRD 3GSRA 3KAAA 4KI5D 1ZT7A 4M02A 4XZUA 4G9FE 4H1LB 3U9PH 5IT2H 3PNWA 1S9XB 4YDJB 3HI5H 5JHDE 2JELH 3UBXI 3WKNA 3U0PB 3G6JF 3KPRB 3DXAB 4A6YH 4JRXD 2FGZA 2OQJB 1CZ8H 3GSNH 1CFTA 1XT5A 1IC4H 1Z9MA 5C0CD 3OKEA 2CSPA 2XNAB 4Z76B 4RWYH 2ARWA 4YJZL 1H3UA 4X6CB 2X7LB 3TH4T 4O9HH 5BVPL 4ETQB 2QR0A 3CDYA 3LKRB 1ZANH 2P5ED 2QJDA 4HWEH 1K4CA 5KSVB 3LV3B 1KJVA 3P3YA 5CGMA 5K9KB 2FATL 4XCEB 3CPLB 3V5HB 3FQNB 3EFFB 4GAFB 3VFPB 1H5BC 1T5XB 3QAZC 5DEFA 3L1OL 1AD9A 3WV0A 3WIFA 4XNUL 5HDQL 1FFNB 2SEBA 1I3RA 1KIQA 1B3JA 1DR9A 2CKBL 2J2ZA 5EUOE 1S3KL 5ID0A 3D3VB 3HZKB 1S7TA 4GRMA 5E2TH 5I1GL 3U1SH 1HXMB 2UWEB 1TQBC 4C56B 1E27B 3KPPA 3PXJA 2NQCA 2EH8L 4E0RB 4FXGB 5CJ5A 3DGGA 2BRRH 1JHLH 1RJYA 4XP5L 5ICYB 4U7SA 1KCSH 4ZUSB 4L3EB 5I1DB 3REWB 1URLA 2C26A 2A6JB 4G6KL 4PJ9C 2ESVA 5IP4A 3C8HA 5KVGH 4OIAA 1TCMA 4S2SA 2C3VB 4WNQB 4PRIA 5T3XL 3BPLC 1LE5B 3I6GB 1FC1A 4RIRB 2UUDK 1CU4H 2YK1H 4NO0D 6CGTA 2A83B 1OY3B 4E5XA 1G7QA 1W2KT 2Y6SC 3AFLA 2V5SA 2OTWB 3L3GA 3OG4B 3P11L 4N0CA 3B2VH 4PJDB 1CLOL 5FA4B 5EU5A 4YHZH 1K4DB 4PJEE 1TVHA 5TE6H 5DJ8A 3Q6GL 3BH8B 3U6RA 4NO5B 3VWKD 3SDYH 1Z0NA 1NANI 4HBCH 3RFZC 3TNNB 4Z7VE 2M1KA 3BT2L 5E2UH 4GS7C 2A77L 4FS0A 4JR9L 3PHOA 4ODWB 3U36B 4YXHH 2OTUB 4XPGH 4JFFA 2WIMA 2OL3A 2W38A 2GI7A 1U8IB 2R29L 5EZOH 4CN4A 5L88L 4JM4H 4R2GB 4Y5VC 5DS8B 4P2QB 2PO6A 4GRLA 5JA8B 3RZCC 4FFYL 2V7NA 5I74C 3V9FA 4G5ZL 4PJ5A 4JFHE 3QO1B 3NMEA 4NO2A 3N1QC 2X9YA 3DV4A 3U83A 4JJ5A 5C7XL 1GGIL 1XF2A 3NAAH 1NC2B 3GBML 2XN9B 3FT2A 3UCRA 3UTSA 3MLVH 2XTJB 1LEGB 1O7SA 5T3ZL 4PJHE 1T0MA 3G5VB 4XVTL 1CLYL 4NQVB 5JPMA 3EYFA 5DRXA 1MAKA 1BBJA 1PEZA 1JZ3A 4EUPA 4R90H 2O5XH 1J86A 3GJEA 4L8DA 4OV5A 3BKCH 1A14L 3T0ED 3PDOA 3VH8A 2PW2A 1JRHH 1QQDB 3BI9X 3BZEB 2EC9T 3QDAA 4KGLA 4LIQH 5FHAH 5JR1H 3V6FA 5I71C 3DMMC 5DJ6B 2AGJL 5CMAB 3WNKA 4CJ0A 4Z78B 3ULSB 3TVMB 4HWBH 3O3UN 1KPRA 2AJ3B 1BHGA 4JZJA 1AO7A 1FZJA 1UXWB 4F7TA 1M05B 1FNGB 1A1MB 3RWJB 1DDHB 3TPKA 5IEHA 4N0RA 2FEDD 4RX4D 1S7WB 3WFHB 2GYSA 1MFAL 1MUJB 1J18A 5H94A 3PGFH 4HF5H 5TQ0H 1KIRB 5IVXB 4KRPB 1QA9B 4XNMA 1ES0A 1IC7H 4JB9L 1P4LB 4XTRC 4CVUA 2DICA 4NT6B 3IJSB 4P48A 3KLHD 3F65A 5LGJB 3S8WA 2ZUQB 5E8PA 3MLWH 2NY3B 1E28A 2DL9A 4LMQE 1OAYL 2KQMA 3G6JB 3T8XB 4KU1A 3T65A 4Q9QH 5ACMA 1EAPA 1NL0L 1MFCH 5EU4A 3BN9C 4ZFFB 2WV3A 2N56A 4ODUA 3RHWK 1U9KA 2R0KH 2VLKE 2VDQL 3HE7D 2ITDB 2EKSA 3O6FB 1YMMA 4GG6E 2XKSA 1KT2A 2FDBP 1Z9SA 3GB7A 2GJ6B 2EYTB 1X5KA 1JF1A 1MJUH 1CG9A 4JN1H 3W11D 4G9DA 2VLJD 3KNBB 1B88A 1CE6A 3NCBB 3TA3D 3MZGB 3WL9B 3LVEA 3MLXH 1A9BA 3UC0H 3UTQA 4P2OB 4W6XB 1D5MA 3MRHA 4K07A 1KCRL 4QTIH 1X5JA 5ITFA 5J13C 4HIIB 3AM8A 2J8HA 2AK4E 2E6JA 2FRGP 3IFNH 3HR5B 4JFYB 3BW9B 4LAJH 3KLSA 4Z7OF 5MP6L 1UWEH 5IVOA 3MMEB 5DRWA 3MA7A 3MOAL 5GRWA 4H1LG 1U92A 3QHTC 3VFOA 1HQ4B 2X70A 4M3JA 2QADB 1RIUL 1VERA 2ITCA 3MREB 5I1JL 5DI8A 5EOCJ 4LPTA 3EFDH 3MLSL 4U1JA 3BDXA 2D03L 1E6OH 1TZIA 4GBXC 1XF3B 5ENWB 3X3FL 3ZDZF 4Q6IA 4U1HB 3OAUL 4MA3A 4M6NH 2GKIA 1NGZA 1A6WL 3CU1A 3QQ3A 3L5XL 2QQNH 1NCAL 2PTVA 1L9MA 3ZYJA 2DQDH 4Z7NF 1D9KB 1SBSH 3P4LA 4EVNA 1JWMB 3VGDA 3X11A 4MJIE 2EYSA 1UJTA 1NUGA 2WWKT 2RIKA 1Q1JL 4HPOH 2C4FT 3STLA 5BVJA 5D5ME 2DBLH 3H9SA 3BD4A 5EZJB 1I75A 3IKCB 1QKZH 1JYNA 4X4MA 2PR4L 3CXDL 4MNGA 5B38A 3TCXA 4PGDB 5BRZE 1J0HA 4ODTL 3I02B 3MFGB 3UTTE 3WS6A 3QPXH 2GQHA 3HRPA 5C0AA 2AJYL 5D7JB 3O9WA 5B3NA 1YYMH 2VQTA 3PJSB 3MA9H 3SGKA 1A21A 1G7LB 1Z9LA 3ARGA 4ZG1A 4LQFL 4OLYH 3IDIB 2DLFL 1R24B 5IOPA 2EZ0C 1FO0A 1WIUA 4OZGF 4RGMB 4MQXC 1UM6L 1GPOL 3DIFB 4FP8L 4MNQD 1YNTB 1XIWC 5C09E 2MCPL 4ELMF 3VG0H 1ZV5A 1VGEL 4IRSD 1RJZA 3RVTD 1UCTA 3EHBC 1P4IH 1NAMA 3DSFH 3FL7A 3HTLX 4FFEX 4J6RH 4JHWL 4F3FB 1PX4A 1IGFL 1MHPH 4UOW1 1ZWIA 4HX1A 4NN6B 4WY7H 4LCCA 1CR9H 4OFKA 1FN4B 3P0VH 2H45A 3HPLB 4OJFH 4MQ7B 3GJFH 1EERB 1FRGH 1LK3L 3BPNB 5SWZE 4PG9A 4G6AC 4OCNC 2FGWH 5E6IC 3VWJB 4DW2L 3ULVD 1OTUD 1AGBB 3QDJA 4JHZA 3FQTA 4U3HA 4X7CC 3E6HA 3SO3B 3RL1B 3N0PB 1EZVY 3IS1X 3SGEI 1IGML 1EFQA 4Z7QE 5HYEA 1WEJH 4CU6A 3SDXA 4M03A 5JO5A 3UO1L 2GJZA 3ARDB 5DUMH 1FPTH 2ICWA 5D2NA 3MLTB 3TJHC 2DQJH 5AYQA 3NFPB 1A3RH 1J1XL 1WT5C 4KQ3H 1XGPB 5JUEH 1JYXA 1F3DJ 3HKFA 3IDGA 2CRIA 4QXUH 4JZNA 1J1PH 4JPKH 3NA4A 4AEEA 4MA7H 5JPNA 2P24A 1WWBX 2FJHA 1DEEB 3QIBA 1G84A 5IFAL 4ZS6C 3Q2CA 2UZYB 1ODAA 4LQ1A 4RAUB 3VXRA 5ISZE 1IM9A 1JV5B 4QHLB 4DFIA 4M6OL 3AREC 2Q8AH 3V5KA 4ESKA 5L6YH 3NCEB 2EIZB 3V4PL 2B5IC 1DEDA 1LO2H 4M8QB 1UH3A 5ICZB 1QSEE 3CDGB 1ADQL 3QPQD 1FL3B 3ZZ1A 4HXAH 3FRUA 3SDAD 2YC1B 3NH7H 1OAKL 1N64L 4QXTB 1RJLA 3C8KA 3SDDC 4EKXA 1WICA 2BNRA 3PABB 3MJ9A 5TPWL 1CGUA 3LH2H 4MA8L 5EOQL 1CF8L 3U79A 2ZCHL 2VLLB 2PXYC 5BMFL 1GSMA 4PRPE 1YY8A 2Z92A 4JDVB 1U3HB 1BQSA 4PJCF 3QXTA 2YD2A 1CDUA 2R15A 3SEPA 2IG2H 2P8LA 1X4XA 5I1EH 4P2CG 4D9RD 1X5FA 3DYOA 4FQXB 1DVFD 2IGFH 4CVXB 3R06A 3NZ8B 1AC0A 5DJ0A 4P46A 1C8PA 1MCFA 4JO4H 1S5IL 4FQJH 2R2BA 3PHSA 3S3JA 5KS9E 2QV2A 2R1WA 1B4RA 5A2IH 3QDGD 5EIVA 1QBML 4JPVH 3KPTA 1WJ3A 4DTGH 5E2VH 2G60L 2V9QA 3V8CA 2JB5H 5I6XC 2A9MH 2XWTA 1YEJH 1NJ9A 3ARTA 2O61A 4RNRB 3QYCA 5BOPA 5EU3B 2QKIA 1AGCA 4KJQD 1MLBA 3W0WB 5J6GA 4WHYH 1D5ZA 1U58B 3HNTL 4O4YL 5EORH 4EXKA 4E42A 3KJ4B 2GUOB 4I2XA 4KPHH 5DK2A 3V52H 3W2DH 1HIMH 8FABB 4XAWH 1HHJA 1SJEA 3NCJH 4IDLA 4BUHA 4WU5B 2F74A 4C58B 1RUQH 4F7CA 2R0ZL 1P2CB 4S1SL 4XMPH 4LHUB 3T1FB 5LGHL 1Q94B 1WZLA 5FM5M 3MUZ1 3UAJC 3GSWA 5KSBA 1PSKH 3VXUD 4OCRH 4OZIA 3DROB 2Z91A 3WIHL 2RFXB 5A16A 3ES6B 2XXCB 2BVOA 4G6FD 3RWFA 1EJOH 1DSFH 2F5BL 5BCAA 3LKSB 5MEQA 3DURB 2Y06H 1LHZA 4W4NA 1JN6B 3SJVB 3VCLA 4Y16A 1K5NA 1MCWW 5C0IB 4PJIF 3GDBA 4QRRB 5DWUH 3SE3C 3VW3H 4WW1B 1A1OB 2GK0B 2X1PA 5DJZA 2CGRH 2V2XA 2I26N 4OLXL 5FIEA 4YDLB 2JE8A 3C2AH 1K8IA 5HVWA 4MD0A 4JKPH 3AU1B 1L7TL 3ARBC 1TZGH 1YA5A 2AQ1A 2W07A 2FJGA 4XMLH 2NY4C 4RCAA 1MWAH 3GSRB 1ZT7B 4OLVL 4PY8I 2CJUH 3MODL 1AI1L 4XZUB 2UZIL 4OZGB 4I0PB 1FYTE 1ETZB 3HNVL 1JPST 2WLZA 4J3WA 4ELMB 4OQTH 1N8ZB 4EQ2A 1BZ9A 2DL2A 4XXCA 1CFTB 5J1AB 5BXFA 2B2XL 1C12A 1QLRA 2D31B 2F53A 3C60D 4NQEB 2YPKA 2AABL 2QR0B 3KLAA 1XGYH 2XA8L 4PJ9D 4ZYKA 2DYPA 1L6ZA 3V4UL 3MV8B 3D39B 1K4CB 4NM8L 1OP9A 3TO2B 1F11A 4PTUA 4RMVA 3U46B 4WFEE 2IJ0C 2PW1A 4NNYB 3MR9B 1ORQB 3TPUA 2CMRH 1RUMH 4PP2A 3GMRA 4J3UA 2Y6SD 5KVDL 2FECI 1XZ0B 5DEFB 1ZAGA 1ADQA 3WIFB 4MAUL 1DZBA 2SEBB 5HI5C 1RZIA 2NY0C 5ID0B 3EO0A 1YC7A 3U4EA 5EWIL 2J7LA 2V17L 5FEBA 2F5AH 4DUVA 5LWYL 3PWPB 3JV4A 5F9OL 1G7HA 3TZVD 4ZO6A 1I1AB 2E7HA 2F58H 1NCDH 5D7SH 2QQKH 5MENE 4NRXA 1RZKH 4OF6A 1F90H 3K4AA 4LF3B 2XQBL 1UACL 1IL1A 4OIIL 4S2SB 4Z18A 5BZWA 4Y8AA 5CUSL 5JQ6H 3LPWA 5E4EB 3GM0A 2I60L 4KDWA 2FLBT 4WV1C 1K9TA 1Z0MA 4L4VD 3IJHA 1NBYA 1G0XA 1JGDB 4X0KB 3KPLA 4TPRL 4ZTPL 1M6OB 2R0WL 3RPIA 1RZKC 2FZ3A 3OB0H 1FAKT 5DUPH 1OSPH 1R5IB 3QCUL 3P2TA 4HQQH 3H3PH 4XAKE 4XNXL 4LU5H 4Y19D 4K7PL 1SEBA 5BQ7A 5CLWA 3CUPA 1MJJA 4G8GA 1NAKL 2VDNL 5KOMC 4NUGL 3OG6B 1T1WB 3WXVL 4PJCB 3V7AE 2DQIL 1YUHB 3QHZH 3BMVA 2LU3A 3T4AA 2V9RA 4O2EB 1T5WB 4P2RB 4D94A 3GMQA 5CBEB 3BYYA 3O4LB 3NVQA 5HD8C 4OGXH 3DMMD 1HH9B 4FFWC 3RTQA 4OI9A 4HIEA 1FHGA 3UJJH 2A6KA 1CWVA 4PGBA 5I1IL 3NFNA 2AJVL 3G6AA 3WNMA 2K7QA 5DLML 3DV6A 4NO2B 3KWWA 3MV7A 4MXQC 4HCRH 4PRDA 5D1XC 5IM7A 2VN4A 2ZPKH 3LDBB 4RA0C 2Z93A 3EJYC 4G6MH 4MXWH 4WEUD 5CEZD 5ETUA 3WLBA 2VXTL 4FQCL 2X89D 1JMXA 5SX4H 3MRNB 1N7ML 3NABH 3VFSA 5JPMB 4OB5H 4RFNC 4KK8C 3B9DA 1YEGH 4JPIA 2XZQL 5CIPB 3QUZA 1SM3H 2ZG1A 4M7LL 4XTRD 3WIIL 3TBTB 4OFYD 5K9QG 2X09A 1EVUA 3N06B 1N6UA 4O51A 3TYFB 5F9JA 5CD5D 4IOIA 4MJ5B 2QTEA 4H26A 2V2WB 2VTFA 2ED8A 1KLGB 4BFIB 4BQBA 1U8OA 3V6FB 2VLMD 3SDXF 5TDPB 4GT7A 1DLHA 4NQDD 1SY6L 3V0WL 1T03L 1Y18A 1W0VA 2EDJA 5TE4L 1FAIH 4PRHE 1TETL 4RFOH 5DD0L 4GRWH 5GGVL 3HNSL 5DQ9B 4QXWA 4ALAL 1MSPA 3V6ZB 5HVHB 4GXUM 4PJIB 3DVNB 3VD9A 1OGAA 1R3IH 1NFDA 2P8MA 4R2GC 5IF0A 3O3DA 2DN7A 3EO1B 4OGYL 4D2NA 2WIIB 4M6MH 3MBEA 4PJ8B 2GTWA 5F7FA 3WDIA 3LZFL 2NY1C 4OZHA 3ULUL 4Y4HA 3WD5H 1BWWA 1E28B 5DGRA 2VNCA 3ABZA 1D5BA 4MD5A 5DXWA 3PXHA 1MCKA 3T65B 5TF1L 2CKBB 2YRZA 3GK8H 1GYAA 3TC9A 5I2IB 5LJYH 4KWUA 3FFDB 4QOKA 1S7RA 2B1HL 5DK3A 1H9VA 1OP3H 1KN2L 3WN5C 5D7LA 4CAGA 4K3EH 3VXSA 3GB7B 4XP4L 1AXSA 4LVOB 4WUUE 2GHWB 4QHUA 4LNRA 5KVEL 1RI8A 1ZT1B 4G9DB 1RUPL 1J8KA 4BELD 1ZLUH 4KXZH 5IB2A 5CP7A 1A9BB 1HDMA 1OM3L 2ZCKH 5DD5H 2VLRA 4LGPB 3MRHB 4JM2C 1NCBH 2CIKA 4JDTH 4LASH 3K80A 1XR8B 4Y7MA 1MJ7H 4YEEA 4RDQF 4NQXA 1H15A 5C2BL 4DCQA 2W60B 5L9DH 3FOMA 4ZS7L 3MA7B 5EFIA 1KTKE 2XFXB 1U92B 2G2RA 4JRXA 4G9FA 2X70B 3KYMB 3O0RH 4GKNA 2BHYA 2YOCA 5C0CA 3H6JA 1TZHB 4WI7A 3ELAT 3VGAB 4FTVD 5CD3A 4XP9H 4MD4A 4YE4H 4F58H 1TZIB 2PYFA 4Q6IB 5L2KB 4XWOC 5ID1B 2P5EA 1PGRB 1NGZB 1IGYA 3O4OC 2EZ0D 2JKXA 4KXZI 4MQXD 5KSBF 3QT2A 1MFBL 5DRZA 3PP3K 4N1HB 3F62A 4IJ3C 5DURD 2IQ9H 4LVHB 5E94A 3ARFB 1LEKA 3X11B 1XIWD 4L4TE 4R4FL 4KROC 5IVNA 3C08H 5F7EL 1PG7L 5BVJB 2AEQL 1JBJA 3EHBD 1N6QL 5D72L 1DFBH 2LTQB 5E99L 1JGUH 1OAQH 2B1AL 3RI5K 4X7SH 4KUZL 4X80H 2BVQA 4ZODA 2MJWA 3RWDB 4Z95H 3WLWC 2R69H 2ZSVB 2ENYA 4LSDA 3LMJH 1JE6A 3LEXA 5CJ8A 1G6RH 2YWYA 1GZQB 1KTDA 4N8PA 4XNQB 4HPYH 2ZKHH 4K3DL 3OKLB 4WIQA 5A2FA 3U0WH 1S7QA 2HH0H 3PIQA 5AD0B 5JXEC 3FCTA 1IGJA 1GGBL 1L7IH 5DC4B 4Q6YA 3BAEH 2YBRA 3HMXH 3EO9H 5T5FL 3ARGB 4UNVA 3O6KH 4HZLA 2PTUA 5CP3A 4JPWH 3HAEH 4JZOA 5DHXB 5M7QA 1EUTA 1I7ZA 4OBRA 3UX9B 1INDH 4OCWL 4S1DC 3SOBH 5LXGH 1F2XK 5GRUL 2V9TA 1WGOA 1W72A 4PRAA 4R0LA 3PWVA 3SQOL 3MOQA 1OAZH 1NAMB 3CFCL 3TJHD 2EC8A 1KB5L 3GMNA 5HGAB 5FXCH 1J9CT 4NUJB 5HHOB 1X6LA 4GAGH 3CVHL 3VFWA 5A43C 1YEKH 3U7WL 3VWKA 3ALPA 4RZCB 4JVUA 1S9WA 4RSVA 3OXSA 5C6PB 3QDME 4HFUH 1BREA 2X05A 1WBYB 2XACC 3TBWA 4K7FA 1HZHL 3E6HB 4PJ7E 4NO3B 4AIZA 1A47A 3VXME 2X1XR 3CDFA 3QDHA 4IOFC 4FQHB 3L3KB 3SDXB 4OLUL 4Q0XH 4TULL 1FE8L 3FO0H 4JCLA 4TRPL 5T1MB 1ZLWH 3EOAB 2FNBA 1Q9KB 5SV4A 2F54E 4OBSA 1VCAA 4IMKA 3SDDD 2OBGA 5JIKA 1I7RA 4Y5XC 1I1YB 2UYLB 3O3EA 3LSOA 4O2CB 3HS0B 4EBQH 5JXAH 4A2MA 3CH1A 3V95A 3L3DA 2EE6A 3EDKA 3IDGB 1UM4H 12E8H 1NCWL 2H1PH 4TUOA 1A02N 1JNHB 4XCYA 4NBZB 2FJHB 5C9JA 4PIRF 3DO7A 3U7YH 2DM3A 3RNKA 4L1DA 4F8QA 5GGSY 5I76A 1UCBL 2EDOA 3QFJE 1M7IA 3NTCH 1BECA 4ZSOE 4JO1L 4EUPG 3LHPL 4HIJA 1EPFA 1E4WH 4AEIH 4OI7A 4XCFH 1CXLA 3FRUB 5B8CB 3TFKD 3F12A 1IC1A 2E27L 3VH8G 25C8H 1QFPA 3MUY1 3GGWA 4X8JA 3ZE2E 3C8KB 1FQ9C 4JFQB 4M1DL 3QEQB 3FB8A 1BIIA 3H9YA 4XGZB 2BNRB 4ODXB 3WEXA 4O5LH 4OD3L 3J7HA 1LP9E 2X4PA 4LRIA 4DGVH 4E9LA 3REVA 4TVPH 5GGRA 5C0GA 3DI2B 4FZEH 4RX4A 3ZDXE 2RJMA 2PETA 3CXHJ 1GIGL 3ZE1E 2HG5A 5KSAC 5JOFB 2F9BT 3JWOL 2J8UE 4OZ4B 1T20A 4ZOCA 1KCGC 2VUOA 4AIXA 1INQB 3R06B 4GSDH 5EOTA 1OB1A 2MKWA 1GJIA 1ZEAL 2DQGL 3E3QC 5D1QD 4UIKH 3MCLH 1TIUA 3SCMC 3V4VL 2I25N 3U30C 1FJ1A 2XWTB 3UJTL 1NJ9B 4JVWA 5FGCB 1XH3B 2VITB 2BY0A 2OI9A 3P30L 1IILE 1T1YB 5DFVD 4HUWA 2QKIB 1AGCB 1YPZE 1A5FH 3TF7A 3WJLC 4XRCB 3VDAA 3HE7A 4MDIA 4ONOA 2ZUSA 4XWGH 5IBTH 1S8DB 1VEMA 3H0TA 1U8NA 1KBGH 1A7PH 3I9GL 3ARBD 1HHJB 3P77A 1P4BL 1QSVA 2F74B 2VLKA 3BQUC 4NKMA 2X4QB 5EO1B 5GRVL 1QSZA 3CMOL 1BVLB 2B0SL 4NZUH 2VLJA 1AQDB 3RVXC 2CUMA 4DGIL 5KSBB 3C5JA 4N1CA 3STZA 1JYVA 5GJTH 1WC7B 2Z91B 5GGTA 4K3GA 2EXYC 5SWSD 4U1KB 1OWRM 5EBLA 1KPVA 2VXVH 4QO1A 5E5UB 3F58L 4F7EA 3QQ9C 2NTSP 1EEYB 3ETBF 1U41A 3VCLB 1FGVH 1J1OL 4X9HA 2IH3A 4L3CA 1NBZA 4PJFA 3KXFE 4BFBD 5DJZB 3EYVB 4PJGE 4A2LA 4CRPA 4PY8J 3F7RA 5CKAA 5MERB 1KUMA 1D6EB 1CVRA 1ROWA 3EDEA 1T21A 3W82A 2FJGB 1EFXD 2H2SC 2NZIA 3TEUA 2PN5A 1CN4A 4OCLC 4YR6B 2WBJC 1F4AA 4V1DA 1NGQL 3QRGL 4WW2C 3QG7L 5IHBA 5HI5D 2C3XA 2JIXD 2NY0D 2IH1A 1IAKA 4KV5E 2VR9A 4LLQA 1YEDA 3MJ6A 3SBWA 2IAND 4XX1G 5CEXA 2VIRA 1QLRB 2GW5A 3VRIA 5KJRH 1P9MA 1PKQB 4K8RH 1G9MH 4UDTB 3WUWB 3TM6A 2CDGB 1EH9A 4TQEL 1E4KC 3KPRE 2HKHH 5FKPB 5B38G 5FOJA 1DBAH 2QSCL 5I1AB 1UJ3B 5MHSE 4QRPA 4G8FA 2GK2A 3NCYS 1NMCC 1F11B 4JY6A 1X5IA 3DXAD 4KI5F 2W9EL 1R3HB 3MV9D 4KC3B 2BVEA 4PP2B 5DQDH 3PWNA 2WWMC 4K8RC 1G9MC 5EZIL 5IWLC 2OR8A 2R39A 1UA6H 1YQVL 4LSUL 5FDYA 5FM5O 2DJUA 3FTGB 5HYJB 4MNQA 3WSQH 3X13B 1VGKA 4ZO7A 3VJ6B 5FYJL 3ZDYE 5HGBB 1MCIA 4JY4A 2FX8L 3TN0B 4IRSA 1EVTC 5F8RC 3HE6C 3LQAH 3D9AH 1GOHA 3GSQA 4KKLC 3RWEA 2MWCA 2AV1A 3JV4B 3PWLB 5A3IC 1WUNT 3KPSE 5IT2L 5HGGS 4K9EH 3LKPA 4EJ1C 1KV3A 3HI5L 3D3VE 1I7UB 2RAMA 4I0PC 5LQBH 2EDWA 1NMAH 2UWEE 2RCSH 3BEVB 4I5BA 4A6YL 4C56E 1IQDA 3VXQA 5F1KC 1CZ8L 3GSNL 5HD8D 1IC4L 5CGYD 5I1KL 4RWYL 3LQAC 3ZE0F 3BX7C 4L3EE 3WXWH 3GI8H 4O9HL 3KPLB 4ODHL 4BZ2H 4K9EC 2NXYC 1ZANL 3RPIB 1JF6A 1SJHA 4JLRB 5D1XD 4F7MB 3SE4A 1BOGA 3BXNB 3C6LC 3IU3A 1JWUB 3L3IA 4HAGA 1LNUA 1DANU 1YEEL 4KMQA 3IFPA 4ZUTB 3I6KB 4NQCE 4PJXE 5BQ7B 1QNZH 3LIZH 4F57L 4GH7B 4L5FH 1CE1H 2H2PD 5I17A 2ICEA 2EO1A 2Q6WB 5B39A 4Z9KB 3GKWH 3A6CL 1F3JA 1UC6A 3HPJA 4PJDE 2W9DH 1T0PB 4H8WC 3MCG1 4HS8H 2ZJSH 1DP0A 2A38A 1F4YH 5E2TL 3U1SL 5F9WC 4XBGA 5HHNA 3QNYB 5DTFB 3OGCA 5CHNB 3PQYE 1G7PB 4PGBB 5FO7B 3U0TB 2EIDA 4ZD3H 2YXMA 2ZOLA 2PNDA 2BOBA 1JHLL 2BRRL 3DV6B 4NZRH 4U0RB 3KWWB 1KCSL 5KTEH 4RWHA 3ESVF 4LSPH 1CICC 3SDAA 4PRDB 4P2QE 4JFOA 1U2CA 1JGLH 1BF8A 5KVGL 3DLQR 3QIWC 4JDZB 4Q7DA 1T6VN 4KRLB 1B0WA 2ERJC 4R2GD 2KPNA 3TGXA 3PUCA 3V7MA 1CU4L 3G5ZA 2YK1L 1JCKA 1MFDH 1B0RB 1KN4H 3VRJB 2MQCA 1MI5A 4W70A 1YQ2A 3VXPB 2XN9E 3GSUB 4AL8H 2NY1D 4O51B 2DQHL 5EC1A 2R2HA 1ERNA 3B2VL 5F9JB 2VZ1A 5HGHA 4YHZL 5TE6L 5H37G 1NC2D 4U1IB 2X1WL 43CAB 1REIA 3SDYL 1TPXC 1V5JA 2XTJD 1LWRA 1CDCA 4HBCL 4F33B 1JZ5A 5E2UL 1ZHKA 5D8JH 4I3GA 1ACZA 1Q72H 2YZ1A 4PG2C 5DHVA 4BH8B 1T2QH 1QLFB 3QDGA 4YXHL 4XPGL 4XPBL 5FDWB 2DLTA 4F9LA 2YR3A 4MXVE 5EZOL 4JM4L 2K1MA 4L1HA 4R7NB 2OK0H 1OGAB 1OP5K 2V7HB 3PWJA 2IALA 5CSBA 5FYKU 4KAQH 3T2PA 3ZT7A 4HEPG 3RWGA 5ITBH 3UBXA 4NZJA 3V6OA 2HFEB 4Z8FH 3MBEB 2VDRH 2GTWB 4P9MH 4JQXC 1CDHA 1W8NA 3OXRB 4WFFD 5F7YC 4JM2D 3UDWA 3NAAL 2EDQA 2NXZC 3BPCB 4W6YB 5IG7B 3MLVL 4HUUA 4M3KB 5IVXE 3LDBC 5ABDE 3VXUA 4MD5B 4DKAA 3MLRH 5FK9A 3GIZH 4ZAKB 4BA8A 2O5XL 3BKCL 4KRPD 4LVNB 1HXYB 1S9VA 1EGJA 1H3TA 1FBIL 3LS5H 3CFEA 1JRHL 3BEWB 5D7LB 2BXZA 1KCUH 5C3TA 2UY6A 3FKUS 5EBMA 5FHAL 4PR5B 5AYUL 5JR1L 4TNVK 4Y1AB 1J5OH 6FABL 2XY2A 1IKNA 5FYKE 1KENH 4L9LA 4GKOA 3ZHKA 3QXAA 5CP7B 1HDMB 3QUMA 3QO0B 4JVPA 1BJ1J 4NC2B 3MCKB 5EBWB 1B0GA 1HHIA 1H5BA 5C08D 5BW7A 4MZ2A 1F58H 3PGFL 1IT9H 3JXAA 4HF5L 4DCQB 5IMOB 5TQ0L 1AXIB 3L1OH 1J12A 1IFHL 5F9AC 4LCYA 4XNUH 3WLWD 1IZKA 4JRXB 3DHMA 1IC7L 3RY6C 2PUQT 4UIMA 5EU6A 3VMPA 2AJXH 1LO4H 5I1GH 4POYA 5JXED 1DQJB 1BBDL 3C60A 4Y4KC 4KUCD 4P2OD 1QSFE 2ATKA 4CW1A 1CDBA 1ZSDA 2P5EB 4LCWE 5LBSL 3P4MB 4PJ9A 4KJYB 4P57A 5GRJH 3CSYB 4Q9QL 4NHUE 3MLPA 3LN4A 3SQBA 2FR4A 3DUHA 5IB5A 4S1DD 4JRYE 2HFFA 5E94B 5K59E 1LEKB 4TSCH 1T7WA 2QADD 5T3XH 2R1XA 1UZ6F 3LN5A 3HFMH 4Q9RH 4QNPF 3MJ8B 4NOFA 5ISZD 2HKFH 1MJUL 4JN1L 3T0DA 1KNOB 2M8XA 5HBBA 4RRPA 4UV4H 3FT3B 3ET9F 2VE6A 3OKOA 1KTDB 4LLAA 3UC0L 1QVOA 3P11H 5FO8B 1ZXQA 2D0HA 1DJSA 1MCHA 1Z3GH 3JWNC 4QTIL 1IGJB 3TZVA 1FGNL 3K4ZA 4KRMB 3DHJA 3IFNL 4HZLB 1UWEL 1KACB 2GY7B 3IS0X 4KKNA 1NMBH 4KKAC 3DVGA 1QYGH 4ZDHA 4NO0B 2VQUA 1W72B 4FFYH 3EFDL 5TDNA 3L3HB 3S4SA 1TITA 4M6NL 2UY7A 4X4YA 3MACL 4RFEB 1ZGLM 5D2LE 3GMNB 2O93L 1U6AH 3MNZB 4ZPTA 3VXNA 2VZVA 2QQNL 4BQ9A 4IHOB 2DQDL 1SBSL 5T33L 3E2HB 3SKJH 3OXSB 2ATPA 1BQLH 1I8LC 1BQUA 5DVKA 4HPOL 4XVTH 1CLYH 1BFTA 2DBLL 1N3NA 3G04B 3QXUA 3RWCB 2VZOA 2ZZUT 4AQ1B 4K7FB 1RHFA 1AHWA 4Q97A 3GIVB 1D3CA 5FUCE 1WTGT 2A6DA 4J1UA 4N1EA 3QPXL 4BH7A 3IGAA 5TE7H 4P3CH 1OQOA 1MY5A 3T0AA 2COQA 3MOBH 5IJVA 1RUAH 4F8TA 5ERWB 1YYML 3S6CA 1ZHNA 2MFNA 3MA9L 4LARH 1I7RB 3BYTA 3R0MA 5GQBA 1CXFA 3O3EB 3VWJD 5CWSB 1ITBB 4L8CA 4OLYL 1LK2A 2WNGA 1GZPB 2RGSA 2A74B 4RGNE 4MZ3A 3L3DB 1H8NA 1P7HL 2X89A 3PV7A 4JFDE 2YD8A 5KSAD 5EC2B 3C5ZC 5C9JB 1FFOB 3VG0L 3RNKB 4HWBA 1F8TH 4O2FA 2J88H 5I76B 1P4IL 3DSFL 1M7IB 1JP5A 1ND0A 5F7UA 4JHAH 1XEDA 3T0EB 4J6RL 4JB9H 3ARDD 5IHLB 4DVRH 5GXBB 2DOCA 4HIJB 4TVPD 1MHPL 5FB8A 2Y7QA 1PZ5B 4OF8A 4WY7L 1S7XB 3F12B 1CR9L 2R23A 3P0VL 3OTTA 3O11A 3JSSA 4OJFL 3TIDA 4ZFGH 4X8JB 3O8XC 2FGWL 3FB8B 4P4RB 3W39A 5BOZG 1C16B 3VD3A 5L2JB 4GW4A 1X5YA 4AK1A 5D9SA 3CC5A 1IMHC 1XCTA 2LU7A 2IAMA 3QZWB 4ORGA 3FO9A 3H3KA 1WEJL 2VDQH 4JFED 4P5TC 4HGWB 4HWUA 3BQUD 4E41A 1R6VA 3GRWA 4JO2L 2VDOL 1LQVA 4JCMA 3CK0L 4HWZA 4RAVB 4XC1H 5DUML 1FPTL 4KDVA 5AG9A 2DQJL 3T2QA 4KQ3L 2EXYD 5JUEL 3FFCB 2I27N 1HQRB 4QXUL 1ZS8A 1FJ1B 1J1PL 4MA7L 1IEAB 3VGBA 1U3HD 1N2RB 3B5HA 3BWAA 2I24N 4HUWB 1UB6A 3LEVH 4XPHH 1W0WA 2Q8AL 3S3PA 4MCYA 2K9UA 1LO2L 3HE7B 2A6IA 4FQXD 1A1NB 4K2UH 3I2CH 5GSVB 2X40A 4N5EC 4EI5C 5C9KA 1RK0A 3CFKB 4D8PB 3OBAA 4Z7OE 4HXAL 1P7KB 1X4ZA 2CH8A 4ZPVA 4JKMA 3NH7L 3L7EA 2H2SD 4R3SB 3MLSH 1OTTC 2HTKD 2AKRA 3I6LD 2VLJB 3MXWH 4G42A 4LFHG 5T1KA 3ZT5A 3TA3B 2WBJD 3C5JB 3DRQA 1QFHA 2HA1A 2P44B 3LH2L 4X99A 1KG0B 1SHMA 3ZDZE 4M5YH 1R5WB 3W0WD 4FFVC 3T08A 5HDBF 1NCAH 4F15B 1EHAA 5EBLB 1U3ZA 1NCCH 1KPVB 3SKNA 3W9EA 4LL9A 3MRIA 2Z31C 4LLUB 1RURH 2IG2L 5I1EL 2OSLA 2MTPA 4PGCA 2VQ1A 1KB5B 1GAFH 1VFBB 4Z7NE 5I1LB 1S9KC 2IGFL 2AJUH 3GZKA 5FV2A 3P9MA 4AENA 4HS3B 3CVHB 1R3JA 4JO4L 3MV01 4ODTH 4FQJL 5JOPE 5CILH 3WDHA 1A9EA 3TT3L 3WMSA 5JA9A 4JPVL 4DTGL 5E2VL 1KGCD 4W6WB 2JB5L 5E1HB 2A9ML 5FYLD 1YEJL 1C5DA 3SJVE 1XF4B 1FVCA 1S9YB 5F7DB 1VPOH 3FZUD 5JW4M 1E4JA 2WWMD 4K8RD 2DM2A 4LQFH 1U91A 2HVJA 1MHHB 5A2LH 2VZSA 4OFDA 2IH1B 1XIWA 1UM6H 4DKEH 5EORL 1WISA 4ZFOA 4HXBL 4KPHL 3V52L 4RAHA 3W2DL 1HIML 3VI3F 4LLQB 3D0VA 3HE6D 3ZMRA 3NCJL 1GOFA 3D25B 5CEXB 4XMPL 4KKLD 5T1LB 1DLFH 1Q8MA 2R4RH 5DK0B 5A3ID 5E8OB 1A6UH 2HJLA 5C0DA 2YN3A 1DUZA 5C07D 4NFCA 1PSKL 3WFZA 1TENA 2BMKA 5IVZB 4I0PD 5I16B 2DI8A 3D85D 1QFUH 4L8SB 5HHQA 2H32H 4AH2B 2NNAB 1EJOL 3H2WA 3NCMA 1DSFL 5ESAA 4M7ZC 4Y5YB 4JY6B 4B0MM 1HNFA 2Y06L 5F3BB 3QJHA 5JMOC 3QH3A 5DWUL 4PY7B 3N1FC 3VW3L 1RZFH 3VMNA 2CGRL 1VGKB 1IGMH 3C6LD 5JIHA 1U8KA 2W65A 2LAAA 3KPOA 3GJFA 1EHLH 1CBVH 3C2AL 4JY4B 1VACB 4U6XA 1NGPL 1AP2A 1TZGL 3IXTA 3IFLH 3MV8D 5F6HI 3D39D 4X6FA 1OF2A 4MDJB 4XMLL 3C09C 3T1WA 3TJHA 1MWAL 1FNEA 3PGCB 3RWEB 1F13A 2CPCA 2CJUL 2AV1B 4S11A 4X6EA 4Z7WA 5E8NA 3MRRB 3UYOD 2Y4SA 3L9RB 4XP6H 5F88A 2XTLA 3LS4H 3GSVB 5DA0B 4OQTL 3Q0HA 1X5LA 1DQMH 3VXQB 3U9UB 4J2XA 1KELH 1NDGA 3MXVH 3ILPA 1CDJA 1FH5H 5EU7E 2XZZA 4M6OH 5LAXA 3OF6D 1MHCA 3TIEB 4HFWA 4O00A 1YN6B 1W0YT 2ESVE 2GCYB 2P45B 3PWPD 4R7DA 1KYOJ 4WWKC 4YHLL 2X4RA 1SJHB 1I1AD 1BOGB 4PRIE 3OV6A 4N9OB 4OCSL 2LABA 4OT1H 2YD7A 2OZ4H 3IFPB 5MEOB 2DLIA 4G8IA 3S98A 4LGSB 2CMRL 4HKXA 2IQAB 1RUML 2BNUA 5I17B 2ICEB 1T04B 1I7TB 2ZCLH 1HEZA 3I3DA 3WUZA 5BZDA 2E6PA 5EOQH 2ZCHH 1I1CA 1P5UA 3HPJB 3QXDB 1T1XA 2YXFA 4FMKA 5AAMA 4HHAA 3GEWB 4HGMA 3O2WH 3AAZB 3HC3L 5C0FA 1TXKA 4XBGB 3FJTA 3LRHA 2BXYA 1P84J 2F5AL 5HHNB 1V7MH 1CXKA 1HH6A 2MQ0A 5JNYA 4WUUD 5CBAB 2ZOLB 4HIXL 4JFFE 1H8OA 5D7SL 2NCMA 4NGHL 3TFKA 1F90L 2AAVA 3SDAB 1CGYA 3S88H 1U8PA 3W9DA 4M4PA 4NQSA 1ORSB 2R0LH 5E0QA 4HUNB 2C4XA 2Y5TA 5F89B 1RZ7H 4P2RD 5JQ6L 3BKYH 3M17A 3NA9L 4PJ5E 2DLGA 1H3PH 3O4LD 3G5ZB 4Y4FC 5FYKH 2IBZY 3DBXA 3UTSE 1IGIL 3FAWA 3ECBA 5EC1B 1G9NL