1P1ZA

X-ray crystal structure of the lectin-like natural killer cell receptor ly-49c bound to its mhc class i ligand h-2kb
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
272
structure length
255
Chain Sequence
b'HSLRYFVTAVSRPGLGEPRYMEVGYVDDTEFVYEPRARWMEQEGPEYWERETQKAKGNEQSFRVDLRTLLGYYNQSKGGSHTIQVISGCEVRGYQQYAYDGCDYIALNEDLKTWTAADMAALITKHKWEQAGEAERLRAYLEGTCVEWLRRYLKNGNATLLRTDSPKAHVTHHSRPEDKVTLRCWALGFYPADITLTWQLNGEELIQDMELVETRPAGDGTFQKWASVVVPLGKEQYYTCHVYHQGLPEPLTLRW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, K-B alpha chain
publication title Variable MHC class I engagement by Ly49 natural killer cell receptors demonstrated by the crystal structure of Ly49C bound to H-2K(b).
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 52
structure length 255
sequence length 272
ec nomenclature
pdb deposition date 2003-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1p1zA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1p1zA01
5F1OB 2DQIH 4O02L 5IEKB 1ZHBB 2HP4A 4NDMB 2RFXA 3BIKB 5F8QC 1LK2A 5D7IF 2MOVA 5EOTB 5HDBF 2C3VB 3OWEA 4JG1H 4LEXH 5JHLL 3HS0B 2NXZC 1MRDL 1NBQA 2Y5EA 3JZ7A 4JM4L 4V3EB 1S9VB 3STZB 4OLEA 1ZHBA 2D3VA 2J4WH 3DX6B 2LU7A 5EOTA 3RZCB 4P2YA 3QQNA 2C3VA 1RK0B 4YBHA 5T5FH 1M7DA 4YFLF 4EUPG 1T83C 4PJ7A 5F7KC 4GW5A 3A67L 3LKRB 5I1GL 1D5XB 5T1MB 3QI9B 1PG7L 1S9VA 3KPQB 5E2TH 4YHZH 3DX6A 5C0FB 3IS0X 4ETQB 3QAZB 3BXNA 1RUML 4I18C 1RK0A 3TH3T 3EFDL 1KTLB 4KK9C 1OTUC 3AAZB 4UNUA 1DBJH 3QI9A 1XCTB 3LN4B 4HFWA 4FFYH 1TPXB 2VXUH 1MRFH 3U6RA 1IZKA 1A3LH 1KTLA 3CZJA 1JPTL 4D0BB 4LASH 1K4DB 2NY3D 3OPZH 1XCTA 3GSVA 3RWGA 5BS0B 3PDGA 4XP4L 2BSTB 3RGVD 4R4ND 5AAWA 2Q3ZA 4F8TA 2EIBA 4JPIB 5E70A 4HH9A 1JFQH 4M1DH 5C7XL 4D0BA 3VMNA 2OJZH 1K4DA 2AV1B 5FM5O 3SE4C 4HG4J 5BS0A 5KS9E 2BSTA 5ACZB 4TSBH 1FYTD 3QWOB 1GZQB 3IDGA 3JBG7 4JPIA 1GC1C 2AXJA 4MD4B 4ZS7L 4BELD 3HTLX 4K55A 5A40E 5J11B 1DVFB 2AV1A 3HRZB 3KAAA 3RX5A 2NXYD 3QWOA 4R26H 5GRVL 5KSAD 2DQUL 4LLWA 4UB0L 1FCGA 4Z7VE 3CGTA 2NW2B 4X4YB 5F7HA 3CSBA 3MGAA 3OV6A 3KJ6H 3NABL 1FZMB 1IGYA 3ARQA 2YRPA 4MB5A 5D7LD 5SWZE 1YN7A 4PJ9A 5I74B 1NCBL 3MRPB 2EE6A 3T2QA 5DRXA 4PRPE 5L2JB 5E9DD 4BFIB 2NW2A 2Z8SA 4X4YA 4E0RB 5JXED 1MLCA 2AK4B 1QLRB 1FZMA 4PY8J 3CMOH 4PJBA 3I6LE 2BNRE 4LSTH 2J8UB 3RJDA 1OGAE 1R24B 2DF3A 3ULUF 2CIIB 4BFIA 2VL4A 3Q6GH 2VMFA 5HDOA 2GKIA 1WIUA 2AK4A 1M1SA 4JRXD 4LK4A 5HYJB 1WWAX 1YEGH 4RDQF 4YDIH 3BN3B 1KC5H 1ULVA 4U1MB 2W0PA 4J3UA 3IT8D 4I3GA 1R24A 5IMLB 3EO0B 2AEQH 2CIIA 4KXZI 1QBMH 1NAMA 2KDGA 4PJAA 3TF7C 4XVUD 5A43C 2C3XA 4M6MH 5HYJA 2DQCL 4ODSL 4LFHG 2AVGA 2FJGB 2X7LB 3MRKB 3QIWA 1FFRA 4YPGB 1AH1A 1G6RB 4IMLB 4JG1L 1W0YT 5KVMC 1OP3K 1S7XB 1T7ZA 5IMLA 3EO0A 1MFBL 5DJXA 4UILL 3S3PA 4JY5H 3TBYB 4OLYL 2FJGA 5KOMC 5JTWA 2KH2B 4YPGA 5EOQL 4HIEB 1G6RA 4IMLA 2IAMD 1S7XA 4Z76B 4N0UE 2EH7L 2KPNA 1T20A 3RIAF 4X0KA 1U6AL 1XF2B 2AXHA 3TBYA 5E5UB 4XNYH 3QNXA 4LP5A 1RVFH 5EBWB 3JUYA 4Z76A 2B8OT 2ESVE 1KN2H 4PLKC 3QQ3B 3JSSA 4KMLB 1VFBB 5EORH 1RUAH 3B2UD 3CMGA 1XF2A 5DHVB 1E28B 3LEYL 4NN7C 5E8NB 1L0YA 5EBWA 3O6FD 1A3LL 2A6JB 1IGCL 2OYPA 5H8DA 5ACLA 2APXA 1VFBA 2XKNB 2NY6C 1LO2L 3WL9B 2DLEA 4UDUB 4YZFF 5DHVA 1E28A 4HBQA 1P7QB 3RI5K 4NO3B 2H2PD 3VXRD 2B1AH 2A6JA 3NFSL 4XHJD 5J9PB 2BVTA 2V9QA 1GPOL 5E5MA 2OJZL 2ZUUA 4PRIE 2X4OB 2XKNA 1K6QH 4LCCB 5C86A 1N3NA 4JVPA 4UDUA 5DEFA 1P7QA 1X5LA 2ZKHH 4NO3A 4GFTB 3MOBL 3KGRA 5J9PA 3I3EA 3QCTL 12E8L 1RULH 4NHUA 1YDPB 1BFVL 3UROR 3NTCL 2X4OA 4OM1H 1FO0H 5FGSA 4HWEL 4PJ8D 5TGBA 1I7TB 3IFNH 3BAEL 1UYWH 3TYGL 5AEAA 1LQVA 1GVIA 1TNMA 4LQ1A 4HULB 4LLMB 4HKZB 3UZQA 1ZLUH 4B53A 1YDPA 1QR1B 1U8KB 3ULVE 4DN4L 1NDGA 1I7TA 5FYKD 4WJ5B 1HHKB 1JPFB 2AEIT 1L4IA 4HKZA 3VWKD 1WZ1H 1RK1B 1RIHH 4Y4FC 4ALAH 1QR1A 1U8KA 1U95B 3T4YA 5KS9B 1L7IH 2H32B 3L5JA 1BIHA 1VGKB 1W72A 5DUMH 3S37L 3PDOB 3WN5C 2FHCA 5J3HC 2VLMD 3VFPA 4KGLA 1NSNL 4UIKH 4GKZA 4WJ5A 1HHKA 1F4XL 4M3KB 1RK1A 4YQXL 4KMQA 3C2SA 3V9FA 1QSEE 1U95A 4EBQL 5KS9A 2H32A 1VGKA 1E0OB 5J13C 3TBSA 4HK0B 3O3DA 1KC5L 2HH0H 2R23B 1N0XH 4LSVL 4Z7VB 3GBNH 3QEUB 1LP9F 4BQ6A 3BDXA 3FO2B 5JORB 5SWZB 3T0DA 4G80A 1UACL 2R23A 4X98A 4PRPB 4N0YH 4Z7VA 4PG2A 3RY6C 1NGYB 5AG8A 1PZUB 5I6XC 3QEUA 3V4UL 3DX9A 3FO2A 5JORA 4GXVL 4JY5L 4M7ZB 4P57A 2BNRB 3TT3L 1E4XI 1OGAB 4PRPA 3NIGF 1NGYA 1J0HA 4NNYA 3MRGB 5I9QC 4HFUH 3IRZA 4K23H 2XWJB 5D1ZD 1MHEB 2R8SH 2BNRA 4XNYL 5H35B 3N1FC 1RVFL 4NFDA 1CGVA 1UKQA 2E9WA 4P3CH 1FAIL 3MRGA 3PDDA 4GUPA 3M1BA 3QEQA 1ZHLA 4PRHA 2ZUQC 2BRQA 1RZJL 1MHEA 2XWJA 2BVUA 3NAAH 3SN6N 3CCHA 2YUVA 8FABB 4G3YH 3P4OB 1AR2A 3I50H 1PEWA 5INDA 3ZE2F 2CXGA 3VDCA 4ONFL 3D85D 4QXTB 5IJVB 4JFFB 1IMHC 1AGFB 4DKAA 43C9B 4ZO7A 1P84J 1QLEH 4N0UB 4LCWA 2CDEA 4OV6F 8FABA 2C3HA 4PS4H 1Q1JH 4J3VA 4P59L 1CDYA 3SKMB 1CLOL 4CMMA 4JFFA 2WK2A 4IOSD 1FIGH 5JR1L 3FTGA 3PWNB 4GSDH 5EN2B 2UZIH 4Z7UE 4N0UA 1DZBA 4ZUUA 3MLUH 1UM6L 2ESVB 1EMTH 2XRAH 1RULL 3FB5B 2YD9A 3GHBH 3VXQB 1YYLH 4DVRH 4TNVK 1S78D 2AJYH 2VDPH 3PWNA 2XI9A 4S0SD 3D39D 5EN2A 1NEZB 3DETD 3TV3L 4NZRH 3E8UL 2VDRH 1S7VA 1JZ6A 3B9KA 2V2WB 3AREB 1UENA 5E2JA 2Z31A 4WW2C 1T66C 4LQFL 2BSED 4XT1C 3FQXB 4KRPC 5FHBH 3AM8C 1NEZA 3ARDC 35C8L 5ICZB 5F70A 2UUDK 4JM2B 1UA6L 5CEXB 3TZVD 4PRIB 1RIHL 2V2WA 3AREA 4TVSa 1PYWA 4YBLC 5A2KH 1L7IL 4D9QD 1MEXH 4LGPB 1H9VA 3FQXA 5FB8B 5I1JH 5JQ6H 4X99A 3ILQC 3I75A 3UAJD 2E7BA 4DFIA 4JM2A 4G6FD 1R3JB 4F3FA 1J0JA 5B8CB 4J3OC 5I19H 3NGBC 1AJ7H 1KFAL 3UJIH 1O5DT 4Y5VB 4GAJH 3EOTH 2HH0L 3AVEA 1WAAF 5IMOB 1GCFA 4APQC 1Y18B 2EZ0C 3EIFA 3VDBA 3GGWA 2ZJSL 1JPGB 3BGFB 1BX2A 1CVSC 2BJMH 4XI5C 1EHNA 5E94B 1TFHA 3W2DL 4Y5VA 3WFCH 1XGUB 1FNEA 4RMWA 4YBQC 1REIA 1WWBX 1VCAA 4Q2ZB 4ZPVB 4K3JL 2OI9A 2X89A 5IMOA 1A02N 1DEDA 1S3KH 3THMH 1S8DB 5KSBE 2P42B 1JPGA 5SWSB 3T4AB 5GZND 2WBJC 2EIDA 5M95B 1XGUA 3NCEB 1QFPA 3L3DB 2QSQA 4ZPVA 3V6FB 1S8DA 4O2EA 4P23B 3TBVA 1QSEB 4WFEE 5SWSA 3IDNB 5IB4A 3DVNA 4D3CH 2UYLA 5GGVL 2DBLH 4DKEL 4KROD 4WEBL 5GZOC 3L3DA 4YE4L 1RFDH 4W4OA 3CLFL 3WFEH 1CDGA 3V6FA 4P23A 4YFEA 5EUOF 3O45B 4YDKL 3IDNA 1MCHA 3LY6A 3HB3D 4UTBL 3O6KL 4RWYH 2HWZH 4M1CD 5EC1B 5HYEA 3L3IB 3E1F1 3WS6A 1N0LA 1RU9H 2I9TA 3QRFM 3TIDB 4EIZC 4Y1AB 3K2UH 4OUOA 4FQPA 1A7NL 3PQYA 4DN3H 4QRUB 5EC1A 4IS6B 1MAML 1EVTC 4TOYL 3QUXB 1CXIA 3QIUC 4JREB 3NZ8B 3BH9B 3TIDA 4Y1AA 5D5MF 3ARPA 4GBXD 2Y25A 4E41A 4I77L 3BISA 1A7QH 1RZIB 4QRUA 5F7EH 3H0TA 4IS6A 5TH2A 3MLUL 1KCRH 5DLMH 5A16A 1NBZB 1CGXA 5TQ2H 3NZ8A 4P46B 1AGDB 3OR7B 1X7QB 3UX9B 4OAWB 2NY2D 1RZIA 3GRWA 4JGJA 3F8UB 4LSUH 1LO5B 5AD0A 2XG4A 1MCPH 4JKKA 3WXWL 1TJHH 4KK8C 1EZVX 1NBZA 3CH8A 1IQWL 3U7YH 3FKUS 3UC0L 4JHAH 4RMUA 3MRFB 5EBMB 1XIWD 3G5VB 3OR7A 1CD9B 4RAVB 4TTDC 1X7QA 5KANI 2Y23A 5L8LB 1BLNB 1A1NB 1MCIA 1T7WA 1X5JA 4N9GB 1ETZA 4MA7L 1IGIH 1I1FB 5DD1H 5E4EB 2EE2A 3BDYH 4M62L 4NP4L 4J1UB 3RDTB 5EBMA 3Q1SL 1MEXL 1NPUA 3G5VA 3WKML 1BD2B 1HIMH 4RAVA 4IDJL 4XXCA 1BLNA 3EFFB 1A1NA 2EC9T 5I1JL 4WTZG 4N9GA 4Z7UB 5KJRL 3FO1B 2FD6L 2RQ8A 3N9GH 1MQ8A 1INDH 1QD0A 4J1UA 3RDTA 3HNVH 4FOMA 1CDIA 5I19L 3BKMH 4IRJB 1DBBH 4RBPK 4XBGB 1BD2A 5J0BA 4JJHA 4GAJL 2BY1A 1QSZA 3EFFA 4KQ3L 3FJTA 2Q6WB 5BVJA 2CR6A 1D5BB 3FO1A 2H26B 2YKLL 3L6FB 5JDJA 3B3IB 5HI4D 4NJ9H 5JIPA 2BJML 1JGUH 4LHUD 2UVFA 4QRPD 3FL7A 4XBGA 1DBAH 1MLBB 2Q6WA 3Q3GB 4WO4C 4MXQC 4NQEB 3S96B 1MCJA 3ZYOA 4QEGA 1D5BA 1CVRA 4OTXH 2H26A 4JFHE 4PP2B 3UYRH 3B3IA 3THML 3WNPA 2VLRD 2FO4B 5FV2A 1INQB 3FB6A 2IBZY 3WE6B 2WBWB 2PO6D 5GGTA 3Q3GA 1J7VR 4Z78B 5AYUH 4NQEA 5DD5H 4RFOH 3HZKB 4OZFB 2F5AL 2MNUA 4PP2A 3WIHA 4RGND 4PJGF 3RBSA 1QEWB 1KN4H 2WUBL 4R2GB 4N5EA 2FO4A 4AT6B 3LZFL 4H1LG 3WE6A 2VXTL 1NFDF 2I24N 1KIPA 3OGCA 4P9HH 3HLAA 4Z78A 4OZFA 2AJUH 2HFEB 3OKMB 4H5SB 4GRWE 1QEWA 3T0EE 4YGAB 1JE6A 32C2A 3BPCB 2R0WL 4OLWL 4TUJB 3TBTB 2F8XC 3QEGL 2HFEA 3OKMA 5KSBB 4YHML 1IQDB 1F97A 4KGJA 2MCPH 3MCG1 3ULUL 2D03H 4I0CC 4KJPD 2W0FB 3S36H 3B8YA 3BPCA 1NC2D 2YUWA 3TBTA 2Y4SA 5GGRB 2A73A 5B39B 3LB6C 4LVNB 5KSBA 2HT3D 1KCUL 2RR3A 4HT1H 3U1SH 4HWZB 1JHKL 4JO2H 4H0IA 2W0FA 3SDCD 1I7UB 1NJ9B 1A4JB 3TVMD 2F5BH 5A2JH 5GGRA 2X1XR 5B39A 1N5YL 4K94C 1UCBL 3O4LB 3TJEL 2XIDA 2DIAA 4H0GA 5IROC 1KCSH 2L0DA 2JCCF 1L8JA 1MCRA 2Q3AA 1A3QA 4JE4B 4ESKA 4HKBB 5HVHB 2NW3B 3OZ9L 1I7UA 1NJ9A 3B9VA 2ICWJ 4PLJC 5E24E 4LSUL 4UOW1 1NUDA 1O0VA 3T0AA 1NMBH 1UWEL 1EDQA 2RCSH 1TJHL 3O4LA 1ZGLP 5KN5A 2EKJA 5JDSA 3L3JB 1J5OH 4I3RH 5B22A 5HPOA 5J6HB 1PX3A 3BO8B 4HKBA 5HHXH 2NW3A 4MQXD 5FYJU 2B4CL 4MXWH 1IARB 4D2NA 4NSKB 3TA3C 1F6FB 4LNRB 5DD1L 4WHYH 4N1HB 4W70A 3L3JA 3BDYL 5C0NC 1U3HC 4ELME 3BE1H 1HHHB 3BO8A 4PTTB 3HZMA 1KB5H 5EIIB 4N8PA 3U9PL 4NSKA 4ZOEA 4LNRA 4DJMA 4XC1L 4M8QB 1T7YA 3CZFB 3SDDC 1HHHA 3QO1B 5F9JB 5IESH 5EIIA 4TSAH 4OLXH 5KSUA 5ID0B 1D6EB 4U1LB 2WWKT 2FCBA 4DGVH 4M8QA 4RGOH 1N6VA 2DMCA 1FYTE 1VGEH 1ZMYA 4IRSC 3L95B 3LEVH 4BQBA 3PL6D 1P6FA 2WW8A 1H3VA 2D7OA 2DYPD 2R29H 2I27N 5ID0A 1D6EA 4KDTA 4OTXL 1T1WA 1LO3L 4I3SH 4BH8B 3HAEH 3OKLB 1MRCH 1YQVL 4HUNB 3L95A 4F7CB 2BDNL 1DFBH 1NMCB 5ACMA 3CK0L 4P2OC 3D5OF 3RIFF 3QRGH 1KPUB 3BJLA 4Z7QE 4PB9L 4RMRA 3GI9L 4BH8A 5IW6A 4TVPL 2HAZA 5D7LE 3NIFE 2DI7A 7FABH 1JRHI 4F7CA 1KCVL 4DQOH 3K4DA 2HKFL 4A6YL 5E9DE 2F19L 1KPUA 1M6OB 3O2VH 4U1KB 1ES0B 2F9BT 4RGMC 4F9PA 4LSQL 1FVEA 4HAFA 5JO5B 1ODAA 1MPAL 3TFKC 2BC4A 5CSZB 4U1KA 5DJAB 5CILL 1ES0A 1KLGA 4JRXE 4QTHB 4ZOCA 3T2NH 2FJHB 4U6XB 1RZFL 4HZAA 1PFCA 1KB5B 4MGXA 4U7MA 4F33B 3L5IA 1VADA 1RUQL 5DMGD 1U8QA 2H1PL 4OFPA 4W81A 4AMKH 5KSVB 5DJAA 5LGHL 4QTHA 1J05B 5CZXD 1IC7L 3B43A 2FJHA 3ARSA 3P9LB 4TVPD 4WWKC 1MIMH 4GAFB 1J1OH 1KB5A 2QQLL 5ETUB 4H88H 1A6ZB 4KK6D 3VFOB 5CZVL 5KSVA 2QHRL 2GITB 4GRWB 4FG6C 5BO1H 5ANMA 1KCSL 3QQ9C 1J05A 1YYML 1CQKA 3P9LA 1GGBH 3T0EB 3QJHB 1IAOB 1QBLL 4OLZH 4M6OL 2B5IC 4MSWB 1OP5H 5ETUA 1A6ZA 2JJSA 3VFOA 2RCSL 2F15A 3AGVA 3JWNC 3HC4H 4GQ9H 3T0EA 1UWGL 3QJHA 4Z0BL 1H0DB 1S5HB 3QR2A 3HI5L 1XEDA 1CYGA 4WRLA 3NH7L 1OCWL 2EDXA 3U2SB 5HBBA 1OARH 4JFQB 4XMLH 1FG9C 2OMNA 4BZ1L 4F58H 5ADOL 3GSNH 4PRNB 4D9LH 2GHWB 1H0DA 1S5HA 2MQ3A 1RJZB 4HIXL 3O9WD 2NX5D 3C8KB 2VR4A 3U2SA 1T1ZB 1FZJA 5C0IB 1HKLH 4JFQA 2OTWB 4OFYD 3TCXA 3GMRB 1EBPA 3QUYC 4PRNA 4MHHI 4WDIA 2OP4H 1RJZA 4NFBA 3VXRE 3KPRD 4QRRB 4TSAL 1KG0B 3C8KA 4LLDA 3NFNB 1T1ZA 5C0IA 4KI1A 5E03A 3QFDA 3GMRA 3ZKSD 1FRGL 4NUJB 4PB0L 1M7IB 4D0DA 5K9QI 5ICYB 4WFGD 4KJYB 4QRRA 3N1MC 4JQVC 1KG0A 2JE8A 4MJ5B 4FFVC 2PYEA 4YK4B 5LCVH 4XAKD 3ORJA 3WKNA 4L4VD 4OGXL 1ZEAH 4ELMB 2ADFH 3QDGD 3QH3B 4AM0A 4LAJH 3U0PB 4B5EA 1M7IA 4JDTH 5ICYA 5C6TH 3MLZL 4BSJA 3CFBB 3DGGA 4KJYA 4MA3B 3P9MA 2FO1A 3MRQB 1UJ3A 2QADD 4MJ5A 1XGQB 2NY3B 5GS1C 3OHXB 1A5FH 1FN4B 4HS6B 3RGVB 1BJ8A 4ELMA 4WTXA 4LDEB 3T65A 4GG6E 5SX5K 3U0PA 4DQOL 4W6WB 1RV6X 3CFBA 5FYKE 4JFYB 4MA3A 4AEFA 3MRQA 3EO9L 1F5WA 1XGQA 2EDDA 3MLVH 4GKOA 2OBGA 3OHXA 3LIZL 5DK3A 5GRWA 1MQKL 1FN4A 4ZFZB 1FYTB 3DTXA 2NY4C 4PJIE 2VLME 4YLQT 5C07A 4JFYA 4XP9L 1TJGH 1WZLA 1AFVL 1X5FA 4GS7C 1AY1H 2GUOB 1DP0A 1VKXB 1FFQA 1BF8A 4RAHA 4K7PH 4X6DF 1OW0C 1OAQH 3E0GA 4ZFZA 3ROOA 2NXYB 3GSNB 3D0LB 1FYTA 4U4BA 3T3PF 5KSAB 1NCWL 1JHLH 2K7PA 4OB5L 1NMAL 1MCDA 5IBLD 1S9WA 2BOBB 4MJ4A 3R0MA 3IU4L 4N1EA 2BFVL 3RX7A 1IAIL 4X6EB 2E7MA 2Q1EA 3RAJH 4HUKB 4NPYB 5F1SA 5D7LB 1FPTH 3PV7A 1P4IL 4JO3L 3TPUA 2YD7A 5CUSH 5E9DB 1I7ZA 4PJCF 43CAA 4X6EA 4ODXA 1NFKA 4XTRC 2JIXD 2LAAA 3QXAA 2VR5A 4ZYKB 4NPYA 4OZIE 5D7LA 3ARUA 1MJ7L 1U8PB 2NXZD 4N9OB 4G8EA 4LSSL 4OM0H 3KWWB 5E2WH 1MY7A 2ZCKH 5E9DA 3GSOB 3ARGC 3FHAA 1B88A 4G9FA 4JRXB 4KKLD 5IQ7H 2CGRH 5TDPA 4ZYKA 4P5TC 1MSPA 2W9EL 2D7MA 4XCYB 4Z7NF 1QHOA 1YEHL 5CZKA 2P5WE 2APWA 2QV2A 3KWWA 3MOAH 3MRLB 4R9HA 3REWB 1QFHA 3RRQA 3AS0A 2APTA 3GSOA 3F6LA 2P8LB 5D1XD 4XPTL 4EQ2A 4U1JA 4XMLL 3WV0A 4JRXA 2VAAA 4EI5C 1GC1L 5GRUH 3ZKQD 5IWLA 3QUZC 4XCYA 4UV4H 4XP6H 1GGIL 4G8FB 4NT6A 1KXQE 1FNSL 2P8LA 3RUGB 1N5AB 2GAZB 5ENWB 2AJSH 3V95A 5L88L 3ECBB 3MX0A 1BZ9B 1TVDA 4NQSB 3ALWA 1NGPL 2IAMB 3CUPA 1CFNB 4NQXB 4BK4A 4K3DH 1G7PB 4G8FA 3HC3H 3RUGA 1N5AA 3VI3E 4EUPH 4EEEA 1ZKAA 3ECBA 4HXBL 5L7XL 1N6QH 4M4RA 1JYVA 1AE6L 2ITDB 2VTFA 5GISL 2IAMA 1CFNA 5CJQH 1G7PA 3DVGB 4R3SB 3SGEI 1A14L 3LV3B 3MXVL 2ITDA 3MR9B 1NCTA 1J10A 3D39E 2PR4L 4JGMA 4LVOB 4LPTA 3O6FB 4OF7A 4R3SA 4J4PC 4N5UA 4HG4K 4UOW0 5BRZD 3D2UD 1KNOB 1A5FL 2EDWA 3LV3A 2V2XB 5JQHC 3WCYA 1MWAB 2NY5H 4DZ8A 3MR9A 4L9LC 5IKCB 4XWGL 2FL5A 3VXRB 4LCUB 3O6FA 5C09D 4G9DA 5IFAH 1TZGH 1IGFH 1K9TA 4KTYA 1UEMA 3IETB 1KNOA 4D9QE 1FIEA 4JFOA 1HSAB 4ONOA 1BM3L 3VFSA 1MWAA 1KJ2B 4Z18A 4U6YB 3VXME 5IKCA 3WFDH 3F7PC 3QHZH 1YJDC 1DDHA 2EDHA 4QHUB 3O8XD 5D7SL 2Q8BH 4JQIH 1ITCA 3K4ZA 5EZJB 4MA8L 3IETA 3HN3A 1ITBB 1HSAA 3FRUB 4P4RB 4PV8B 4U6HB 4XCEB 3BD3A 4PJ8B 1A4KB 3UO1H 1KJ2A 3WLWD 5DMYA 4U6YA 1CS6A 3BKCL 1HINH 2DJUA 3AMKA 1NEUA 4QO1A 5E8OB 1T2QL 1VERA 3ZHDA 1T6VN 1WITA 4PV8A 3FRUA 4P4RA 4U6HA 2H6PB 4XCEA 3WFBL 3VFTA 2KL6A 4PJ8A 5LBSH 1A4KA 2XFXB 5CJOH 4JZJA 3L5XH 3ARVA 1TZHA 5TE6L 1KJVB 2N7AA 2FX7H 5CCKL 1GH7A 1N26A 2IADB 4OCXL 3VWKB 5E8OA 3W11C 1YECL 4N8VB 3TIEB 2GYSA 4UDTA 3S34L 1KULA 4OUUB 3DOSA 4PJIB 4R7DA 2XFXA 1F3JB 4HMEA 1R6VA 3Q0HA 4TQEH 1KJVA 3EZ8A 1WCQA 3GK8L 2BRRL 4NRXA 2PN5A 3VWKA 3TIEA 1TVBB 4OCSL 4GRMB 2IPTL 2WUCH 2FEDC 4OUUA 4PJIA 1CXKA 1FZKA 1F3JA 4LEOB 5IP4A 3FFDA 3MOAL 3RBGA 5I15H 1A7OL 2J1KA 1GOGA 1JF6A 2ADGB 3ROLB 1TVBA 4ZSOE 2I60H 2HLFD 4GRMA 3GMPB 2VDNL 3RL2B 1UXSB 2LVEA 4NQCA 3ZTNH 1HK6A 1JMXA 4LEOA 1ORSB 4ZDHB 1M05B 2UY7A 1J88A 2ADGA 5GJTL 3ROLA 3BDBA 4GKNB 4IMKC 1UKTA 4OZIB 3GMPA 4Y4HC 5T1LD 3ARBC 1N7MH 1UXSA 3RL2A 2IALA 4ETYA 1AXTH 5IVOA 1RUKH 1M05A 4ZDHA 3GMQA 1HDMA 1U2HA 1GGYA 2HG5A 4GKNA 4G6KL 4OZIA 5D8JH 4NNXA 1FH5L 1FGNL 5D1ZB 3V52H 5IJKA 2VO5A 4MNHB 2NY1C 5A2IH 3DYPA 5L0QB 1J18A 3CFDB 4Q6YA 2QHLA 1CD1B 3TN0A 1T3FB 3NBNA 2AEPL 1BBJB 2E9JA 3U7AA 3PHQB 5D1ZA 3ARFC 3K8MA 1UH2A 3ZE0F 2OJEB 3T0XA 3CFDA 1KBGL 4PJ5D 5I1EL 5SX4H 1NANH 3MRRA 3OJDA 1T3FA 1Y6NR 1BBJA 5DJCB 2VAJA 1IKFL 4J3TA 5L6YL 3PHQA 1JV5A 2MMXA 3DBXB 3BP5A 3FN0H 3TLRA 3QDMA 4Y4KA 2OJEA 4U6VH 1JGVH 1IC4L 3OMZA 1I7RA 2E5EA 1ZT7B 3FB7A 5D7JD 4KKAC 4B50A 1BBDL 1CGWA 1I9RH 3MQIA 3DV4B 3IGAB 3OG4B 3RWHA 3DBXA 1G7MB 3BVNB 4Y4FD 3WFDL 3QHZL 3BGMB 2VISA 2VIRB 1HHGA 2VYRE 2WLZA 4CVUA 2PW2B 5HDBE 2JJUA 4CMHB 4FP8H 2JB6B 1XGTB 1RUPH 1U3YA 4OCWL 1LE5B 3L7EB 3IGAA 3BW9B 3D39B 1G7MA 3BVNA 2BVOB 3BGMA 1JNLL 4GKSB 2VIRA 2X4RB 4BH7B 3DMMC 2FX9H 3N06B 4R4BA 3LKNA 5F6HJ 4S0TD 1I1RA 2JB6A 1XGTA 1I9JH 4OGYL 1IL1B 3GBMH 4MB4A 2G5BA 4QRPE 2F54D 5CP3A 2PTUA 1PKOA 2DDQH 1IZJA 4YHIB 4EDXB 2BVOA 4IBLT 4GKSA 4N0CA 1MI5D 3GB7A 2X4RA 3B9EA 4YHKH 4BH7A 1E6OL 4Y5XB 1U41A 5GJSH 3TZVB 4BJLA 1BJ1H 4XPAL 5E56A 3V0WH 1IL1A 2AV7A 4Q6IB 2WLYA 1QFOA 2XA8H 1K4CA 4YHIA 3LH2H 4EDXA 2R2HB 1OTTC 4M48H 5F8RC 3RP1A 1I85A 1H5BC 4G6FB 4Y5XA 3P0YL 3LHPL 1FFNB 4RGNE 1IEAB 1RMFL 3SCMD 4I2XE 2AJXH 4HCRA 1EIBA 1MJJB 2R2BA 4DZBB 1ZXQA 2XZCH 4HSQA 2HTLC 2R2HA 4Y8DC 1FFNA 1B4JH 1C5BH 3FT4B 4M7LT 2KQMA 2N1KA 2YA0A 2C3GA 3CDYA 5EFIB 4DZBA 1A1MB 3ZTNL 3DRTB 1IAKB 1MFCL 4LOUD 5DZLA 5E8PB 2NY7H 4G7VH 1GOHA 2OL3L 3V5DA 1RZKH 5C2BH 3FT4A 1OHQA 5K9JL 2YPLD 1F3DH 5HGGS 1JGEB 2ICES 3MLRH 3KVQA 1P69B 5DJ0B 5EFIA 1MHPH 1RZ7L 1IAKA 1UZ8A 1NGWB 5E8PA 1X9QA 1NCAH 4PY8I 3TJHC 2A74B 3S97C 2YD4A 4UUJB 1A21A 4F7EB 1JGEA 1OAKL 3D9AH 4KROB 5DC9B 5BW7C 1FLRL 3RVTD 1B0RB 1MHHB 1NGWA 2NZ9D 2ARWA 3GBLA 5FHAH 1DTUA 4NBYB 5HVFB 3INUL 1H3WM 4OLUL 5IQ9B 4ZSOB 1VFAB 4JFZH 3RVUC 4UUJA 4F7EA 4X9BA 3GKWL 1C7SA 4OD3H 2FYYB 2CSPA 5GRJH 1K3IA 4KRNA 5HD8C 2VLLB 2CXKA 5FM8A 1YEIH 5F96L 1YY8B 1G0XA 4XZUA 5IQ9A 4ZSOA 1BJ1J 3NIDF 1VFAA 4KHTH 5J12C 1C5DB 2VXVL 4O58L 1PLGH 5I1IH 3RWDA 4GRLC 5C0RH 1KSRA 1K8DB 2A6KB 5EPMB 2B0SH 3JV0A 2VLLA 1YQ2A 1AHWC 3UTQB 1FORH 2PCPB 3BJ91 1YY8A 3EZJB 4OJFL 5GS0D 4TNVF 5KVGL 4GBXB 3P77B 4WI4A 1QSVA 2DQJL 4J3XA 4QNPF 1C5DA 4OKDA 1HNGA 1S7RA 2A6KA 5EPMA 3H3PH 1MREH 3QUMH 3CC5B 5BZDB 1FGVH 1R3LB 5IHUL 1QKZH 2ZSVB 3IDYB 4RA0C 5DJ2A 4GBXA 4XWOC 4OGAC 1U8LB 3H42L 4EZMA 4FQXD 1MIEL 2NY2B 1ZANH 4KUCF 5IMMB 2BNUB 4L9DA 1MCLA 5HHNB 3MCKB 4LARH 3I3DA 4FNLH 5BZDA 3DUSA 1AD0A 3HI6H 1I9JL 3ZYIA 1JMZA 1N59A 1XIWB 3GBML 1CICA 4ZPTB 5TF1H 5FK9B 5IMMA 2BNUA 3CVIL 4P9ML 5E0QA 1JPSL 3BWAB 5D2LE 4XI5D 2E27L 1KCLA 3C6LA 4NM8H 5HHNA 3IXTB 3MCKA 3VG0H 1KENH 1XIWA 2WM0A 1S7QB 3C09C 5FK9A 2FWOB 2A1WL 3BWAA 3V0AC 6FABL 2HFGH 4MDJB 1WIPA 3IXTA 3H9YA 25C8H 3KPTA 3IAQA 4FN0A 3C60A 1JTOA 1S7QA 2CPCA 1KJ3H 3N0PB 5D7IA 1Q72L 4JB9H 5IT2H 5HJ3B 2ATPB 1VPOL 3CDFA 4LHUB 2HJLA 1IFHH 1XT5A 4QRPB 4TSCL 1MCEA 4ZUTA 2VWEC 4KMTL 3K80A 2VZ3A 2CK0L 4K8RD 5INCB 4FQJH 2UWEE 1Z9LA 1HNFA 1J1XL 4PREB 1ZT1B 2IQ9L 2ATPA 5HJ3A 2VLRB 4KZDL 4LHUA 4M3JA 4NC0B 4QRPA 4RX4D 4QGYA 5I30L 1MHPL 3V4VH 4NQDD 2PO6B 4HPYL 4NZTH 5INCA 2R4SL 3H7LA 2Z92A 3QUMB 1G9MH 4PREA 4RGNB 1ZA3A 4W4NA 2QQKL 4TVPE 3NPZB 1A3RH 1L7TL 2VLRA 5F44A 2DQEL 3D9AL 2BXYA 4XB7A 1GSMA 3LRGA 4WCYH 1OTSC 2Q8AH 2P48B 2Y72A 1DQLL 5ITBH 2ID5A 4QY8B 3SOBH 4F57L 1AI1L 2VNCA 4BUHA 2I9LA 4JRYD 4L8SC 3FONB 4MZ2A 1CLYH 4WUKH 1CE6B 2EDJA 2R56L 3IU3B 5IGXL 4JKWA 4KDWA 4QY8A 5I71C 5I17B 5BV7C 4YHOH 3AU1B 3SE8L 3EYSL 3DVIA 4XX1G 5I1HH 3VMPA 1HHIB 4KHTL 2FH8A 1NLDH 3ILPB 4LIQE 1NC2B 3F7QA 1G7JB 4MAYC 4XNUH 4FZEH 2K7QA 3P4LA 4HEPG 3V6OC 4TTDD 5I17A 5EC2B 4XMKL 3AU1A 5T3ZL 3C87A 4JCLA 4AQOA 3MO1B 2XZQH 3SDCB 3ILPA 2KKQA 1NC2A 3IDUA 4S1SL 4XAWL 1LP9E 1RY7B 3DRQA 2NX5E 2APBA 4G7YH 3MYJB 1D5MB 5GGVY 1MCSA 5AZEL 4QYOB 1AP2B 3MO1A 1X6NA 3SDCA 3UZVB 2XQBH 3KPRE 1N4XL 5JA8B 3B5HA 4WU5B 1ROWA 1BZQK 4Q9QL 3HMXL 1GHFH 3C5ZC 3JV5A 3WO4B 3MYJA 4JR9L 2HJKB 5JOEA 5K9OA 1V7NH 4QYOA 1AP2A 4RRPA 1D9KC 4HUMB 2VQUA 3QA3A 4WFGE 1MFDL 2X09A 2D7PA 1OD9A 4WU5A 3KPMA 2OQJA 4M43H 4XAKE 3EDKA 5F7MC 2HJKA 3QYCA 4L4VE 5DGRA 3QDGE 2B2XL 2X5PA 3EYOB 1MCQA 1V7ML 1YNKH 1MJ8H 4BSWB 2DM3A 5D96B 2YSSB 1WFUA 4LKCB 4OF6A 3DJ9A 1P6AB 4ZNCD 2NR6C 2G2RA 3P73B 3H2WA 2VOTA 1A6WL 2LTQB 4X8JB 4CDGC 3GUTB 2AI0H 4I13B 1EXUB 3OQ3B 2IQAA 1T21B 5DWUL 3EYOA 1BOGB 4BSWA 4UT6H 4O4YL 2YSSA 4LKCA 3ARXA 1KJ3L 1IGMH 2BX5A 3LRSB 5LQBH 3MUJA 3AS2A 1NAKH 2OXGA 5EO1B 3RZCC 2H45A 3GUTA 1EXUA 3BQUC 1T21A 4K3EH 4K94L 2VZUA 1YEEH 3E6HB 3PL6B 1EGJH 3QI9C 3RFZC 1RZ8A 2DYPB 2R4RL 2Q76B 4BQ9A 1JTPA 5D2LB 4LPXA 2RB8A 1DJSA 4Y2DD 5IIEB 3LRSA 3MV01 3QJFB 3QAZC 5EO1A 3O81A 3D3VB 5F7WC 2D4DA 4LIQH 4MVBC 3OR6B 2Q76A 1DL7H 5IIEA 4OT1L 1TPXC 3D3VA 5F7NC 3PP3H 2NY0D 3FZUC 5HI5D 2BSSB 3SJVD 4NBXB 3LB6D 2DIJA 3OR6A 1QFWH 2HT4D 4H1LH 5C0EB 4JFDA 4J2XA 5IF0B 4BA8A 1JWMB 3LRHA 4FXGB 4CJ1A 3T0WA 1ACZA 1WC7B 3U4BH 5GRXG 3RWCA 4EN3D 1WBYB 1MFEL 5C0EA 3PHOB 5IF0A 4CN6A 5L8KB 2G60H 1JWMA 3CFJB 2X4SB 5C0AD 3K7UA 5H37G 3V4PH 1Q0YL 1WC7A 2PYFB 1WBYA 1EFXA 4XVSH 3UPRB 2NNAB 4XNUL 1DVFC 3IFLL 3KYOA 3FO0L 3PHOA 4XCCH 4WWID 3IFOB 4RA3A 5HVGB 1CFVL 1WAAE 1DQDL 3CFJA 2X4SA 3MZGB 1I3RA 2PYFA 1F90L 2XZQL 1C1EH 5LWYH 4PJ9D 4FQIH 1CD8A 4PJHE 3UPRA 3HNSL 4NKIL 4PGDA 1PG7W 1KB9J 4PGEB 1TMCB 3PXJA 3EGSB 3VD9A 3IJHB 2HVKB 1E6JL 5CP7B 4A6YA 1YY9C 1CFQB 2HFTA 2MTPA 3B5TA 4LP4A 4QHLA 4U1HB 4HHAB 3GJFH 2E7LA 1MY5A 5HGBB 1TMCA 5M94B 5KTEH 3CFIC 3ZDYE 1I8MB 1SY6H 2HVKA 2MKLC 1K3ZA 5C0CD 5CP7A 1S7TB 5EU4B 2YEZB 1OPGH 3KHOA 3VE0B 1JGLH 1LVEA 3OF6A 3X3FL 4IOIB 4X6CE 5GGSY 4U1HA 1CF8L 1F13A 3BOVA 4IRSD 5ISZD 5I8CA 2DQTL 5CJ5A 4NUGH 5T1KA 2M8XA 5MP6L 4Z95H 3QQ4B 5HYJD 4J12A 4E5XA 1S7TA 3WLBB 1YNKL 1MJ8L 5EU4A 3QIWD 2YEZA 5EUOE 2HJFB 4NHCL 1LP9B 2HRPL 3O9WB 5IR1B 4IOIA 2NX5B 1P4BH 1JZ3A 3X3GL 5BRZE 2W91A 5KVDH 4U1GB 3LS4H 2AI0L 3ZKNC 1BFSA 3QQ4A 3MRCB 4MYWB 2PW1B 4IIQB 1A6TB 4TUKL 3O41B 3WLBA 4ENEC 3KPRB 1NEZG 3Q6FA 5C09E 1LP9A 4PBVC 5IR1A 2NX5A 5JHDD 2B20A 1NAKL 4OFYA 4EVNA 3BT2H 4M7JH 2EXWC 2MHAB 2ZUSA 1BAFL 3NZHH 2WWKO 3MNZB 2YXMA 4K3EL 2PW1A 1ERNA 4IIQA 1A6TA 3O41A 3KPRA 2HYMA 4MQ7B 1XFPA 3PWJB 3QPQD 1JI1A 3T08A 2D0FA 5IBTH 5D5ME 3SKJH 1U3JA 5HHOD 3EYFB 3KLHD 3Q48A 5TDNB 5A1AA 3GIZH 4L4VB 5DMIH 1KXTB 2MHAA 3D18B 3MNZA 4YGVB 5FYJD 4LU5H 4MQ7A 5DJ6A 2QADB 2IPKA 3F7YB 2YA2A 3CFKA 1HZHH 5DI8A 4LF3B 1HCFX 1Z2KA 5H94B 4DAGH 4OGZA 3PGFH 1LHZA 4F80A 1YN6B 3EBAA 2DTMH 2HT2C 4YGVA 3HA0A 1BEYL 1FLTX 1QG3A 5JUEL 3BN9D 5ESVB 1YC8A 4OIIL 4LF3A 4N68A 4FRWA 3AXLB 5H94A 4PRDB 3ZT6A 1T5XB 1YN6A 3RTQA 2FHFA 3KLAB 5ADPL 5ID1B 4FG6D 4FQ2H 3TP4A 1T1YB 1MFNA 1SBSL 3BP7A 5ESVA 5E00B 1J87A 4JN1L 4LCCC 4R90H 4ONGH 4LSDA 3K46A 3U7WH 2G60L 5D6DC 3AXLA 3MA9L 3BZ4A 5CIPH 1ONQB 1T5XA 1I3GH 3MMEB 1H15A 5DRWB 4HUWB 1QZ1A 4FMFA 4QHNA 5ID1A 1A7PH 1T1YA 5BZWA 5E00A 1CGSL 3W39B 1IC5H 1XCQB 1D5IH 1NBYB 1U58B 2DN7A 4KVNH 1ONQA 1EUUA 3MMEA 3OKEB 3CLEH 4AIZA 4UTAL 4X5WB 3LSOB 4HUWA 3I85A 5LWYL 4FQIL 2BMKB 2PXYC 3SBWC 4KKBD 4MNGA 3W39A 5SV4A 1XCQA 4Z6AT 1MCOH 4DUWA 2ZSWB 1U58A 2JIXB 3OKEA 4DKFH 2NXZB 4YHNB 4X5WA 4QKXB 3LSOA 1GXEA 4NNPH 4QHMA 3WNKA 5CBAB 5JLZB 4JFXB 1ZVSB 4X7EC 2HLAB 2IH3B 2N56A 5CEYB 4JKPH 3VGBA 2JIXA 2W1NA 4ZO9A 2GK0A 4YHNA 1OT2A 1ZK9A 5JZ7D 3T8XB 5CBAA 5JLZA 1DSFL 3ZDXE 4ZNEE 4JFXA 4PGBB 1ZVSA 5D1XB 4YXKL 2HLAA 5DFWH 5CEYA 4E9LA 4AG4L 1T83A 1CL7L 4Y89A 2EDTA 2R2EB 4IOFD 1EO8H 3T8XA 3WD5L 1BFTA 2O26U 4K71B 2EDBA 2EH8H 2OZ4A 5D1XA 3VWJD 1P4BL 1CI5A 4I18A 1EUTA 1J86A 2CO7B 5EZOL 3DYOA 1WAAA 3JUZA 3ARRA 4RFNB 1G6VK 4EKXA 2QQNH 5AG9A 2R2EA 4I0PD 3O2DH 4TTGA 4RAUB 3D69B 5IFJB 3DO7B 4M7ZC 5I1KH 3VRJA 3M45A 1ADQL 2BVQB 3IDXH 3PGDB 5F93C 4YO0B 3VFNA 1CDCA 3NOIA 1J1PL 1WF5A 3D48R 5D9SB 4RAUA 5EOCH 3D69A 5IFJA 1NGXB 5FYLD 1XR8A 3DO7A 2K9UA 4G6MH 5SV3A 1ZSDB 1RPQA 5GIRA 3ZL4H 5HYQB 5DMIL 3MACH 1OP5K 3QEQD 3EYQC 4PRHD 2BVQA 5EUOB 3SE4A 3PGDA 4LU5L 4D9RD 1SVZA 3OAUL 5D9SA 4I5BB 4JHWH 1HYSC 1NGXA 5BRZB 1UEYA 4L29B 4KY1L 1JHTB 3D2UB 1ZSDA 4WI6A 2GY7B 2F54E 1DBKL 2DTML 4KUZL 3HC0B 3O3AB 4ODHH 5EUOA 5C09B 1MI5E 3BP6A 1OLZA 3NA4A 4ZD3L 3OB8A 3C5JB 4LCWD 5BRZA 4L29A 1SQ2N 3D2UA 2PNDA 2XWTB 4DW2L 4JO4H 4BZYA 3HC0A 4JFFD 1KTDA 1NCDH 4NC1E 2YK1H 5C09A 5JW3H 4XTRD 1BZ7B 3GHEL 5D5MB 3O8XB 4ONGL 4RMSA 1CG9B 2P7TB 3MXWL 5DQJB 4XNZB 1HI6B 3WEXA 3UBXA 1IM3A 1AR1D 3ARGD 3B2VL 4FFWC 5E2VH 2JKXA 1WT5C 2A0LD 3ZMRA 2D9CA 1XF4B 4OZFG 5D5MA 1H3PL 3O8XA 2JF1A 2VE6B 4LSRH 4PLOB 3FO9B 3ALPA 5EWIH 2P7TA 5HVWA 5DQJA 3HCVA 3O4OB 4JKLA 3OGOE 1HI6A 4KVNL 3B9KD 2F58H 4HIJA 3QG7L 3KPLB 2Z31D 4MHHG 4M6NL 4F7TB 2FGWH 1XF4A 3AREC 1FG2A 3KPPB 5I8KH 3QUZD 2MQCA 15C8L 3FO9A 3IRPX 2YPLE 5HYSA 3L7FB 4U7SA 4X7SH 4DKFL 1MFAH 3GKZA 3KPLA 2QKIB 2GJJA 4LCIH 4MD0B 4AH2B 3TF7A 4F7TA 5K9QG 3KYMB 4NC2B 3KPPA 3NCJL 3KR3H 5EOCJ 2YBRA 4R0LB 1O7VA 3L7FA 3CDGB 3MUGB 4PJDA 4QRQB 2QKIA 2R9HC 5F7DB 2CRMA 2K1MA 3OKOB 5B39G 5B8CC 4KAQH 3KHQA 3TCLB 1LO4H 3RKDD 4R0LA 4Y5VC 3GO1H 3BZFB 1XF1A 4FFZL 3X14B 3MUGA 1YJDL 3SHSA 4QRQA 1KGCD 2FIKB 4MJIA 5F7DA 2QSTA 3CXHJ 4HIIB 3EOAA 3EDFA 3OKOA 3CXDH 3I2CL 3BGFC 2O5ZH 3WUWB 2DD8L 1ZVHA 3ULVC 3QB7C 1EEYB 1P4LB 3TCLA 4AYFA 4ELKA 2X89D 5FUOH 3BZFA 5T1LB 5HY9B 3X14A 1EAJA 5C3LD 3CU1A 2FIKA 4QF1A 4NWUH 5C6PB 2DKMA 1BQSA 1I1YA 2ATKB 1U3ZA 1A6VL 3WUWA 4CADB 5I76B 1EEYA 1P4LA 1RJLB 1KIUA 3WXVL 5FDWB 2RJMA 5SWSD 5I73B 2QEJA 4OSUL 3VXSA 1IKNC 2F53A 1UG9A 2AQ3A 2VDOH 3FHQA 5LXGL 4P23C 2ATKA 2VDQL 4CADA 5I76A 2VR9A 3CPLB 4OCYL 4NKMB 3SY0B 1RJLA 4B0MM 3A6BH 3QFJA 4IHOB 5FDWA 1R5WB 5EO0B 2J88H 1QRND 3RZWA 3EHBC 2Z93A 5C71A 4H25A 1SEQL 1DR9A 3LVEA 3WS6C 4PJGA 4PTUB 3BEWB 3PF2A 4DTGH 3RL1B 4OQ1A 4PJ5B 2GSGA 3EJZC 4G5ZL 2FB4H 4M93C 4MLIA 4PJFF 4NKMA 3VFWB 1NFDA 4DK6A 1R5WA 3MBXL 1NGQH 2F8VA 5HSFA 5D2NE 3RVXC 4Z77B 2JK5B 2XT1B 4P3DA 4PTUA 3BEWA 3OJVC 1DQMH 1WEJH 4PJ5A 3PQYD 4HPOL 5DGQA 3X12B 4N90D 1OAUH 3PP4H 5D7JB 3GJEB 4PIRF 2W0LA 1FNAA 1Q0XL 4NJAH 3W11D 4Z77A 2JK5A 4KJQC 5DFTA 1EX0A 3QUXC 1J8KA 4Y4FB 2DBJA 4FZ8L 4E41D 2UZXB 5JW3L 3T3MF 1KPVB 3BI9X 3WDIA 5D71H 2J8UF 5D7JA 5FM4A 3GJEA 5DK2A 2ZPKH 4DFHA 4DGYL 4Y4FA 1T4KA 4JO1H 4KTDL 1IAII 3NVQA 1KPVA 4P46C 2VUYA 4KJWD 1L9MA 4G6AC 1NL0H 1R0AL 5CS7A 1MHCA 4ZODA 1GGCL 2FGZA 1WBZB 2F54B 3GFUA 1GZPB 5F7FA 3ZYJA 1CFSB 2BY0A 3P3YA 4I9WD 2VC2H 3QCVL 2JCCA 1MI5B 3HR5B 3NPSB 1BQHB 2EKSB 4G6JL 5AZ2L 2DTSA 4ZTOH 1GZPA 1CFSA 5F89B 4LCIL 5DD3H 3LDBB 4NQDE 4WI8A 5E4EC 4NIKB 4NKOB 3ARWA 1MI5A 3RDTC 3ARBD 3AS1A 3GSUB 3HR5A 1G9EA 5GS0H 2I5YH 4MJ6B 4NM4L 4HH8A 2R39A 5DC4B 3S3SA 3SCMB 4OBSA 5HHQB 1KYOJ 5F89A 1A6UH 1CR9L 2DQGH 2LU3A 4OCRL 4UV7H 1BD2D 2Q7YB 3JWOH 4NKOA 3MJGX 3CIQA 2WINA 2A6DB 3VXTB 2DQHH 4IRJC 3VXOB 1LO4L 4X7FC 3JWDH 3SCMA 1CIDA 4JRYE 5EG6C 5E7BA 4L8CA 2C1OA 5FCUH 1A1OB 3P0VH 4HZLB 5GS2D 2Q7YA 5EDXA 2VZ1A 4FABH 1B2WL 1WTGT 1G1YA 1JNNH 4YUEH 1DUZB 3VXOA 3WFHA 2B1HL 5B3NA 3ARFD 2YWZA 4HGMA 1RQ5A 2YPLB 2BP3A 1A1OA 4HJ0D 4HZLA 4X6DE 1GJIA 1U93B 4XMPL 3MJ9L 2IG2H 3FMGH 2B7DT 1DUZA 4YWGL 4LVEA 3UBXI 2YPLA 5EUKB 2JTDA 1D6VH 4FTVB 1CK0H 1U93A 3MLWH 4S1RH 1MH5B 3S4SB 3QIBD 2E9BA 5MEQB 1RHHB 1XGPB 1DLFH 3V0VA 4XCFH 3N85H 2FX8H 4PJCE 5DVKA 4YX2L 5CHNB 4FTVA 4RZCB 1G0YR 3S8WA 4XVTH 3BZEB 1WJ3A 4XPFL 1RHHA 1XGPA 2XZAL 1OF2B 2CKBH 4JDVB 4M7KH 1BVKA 4RZCA 1INEL 1HILB 4K8RH 1JK8B 3OJMB 1G7LB 1TJIL 2OL3A 1NLBH 4Z7NE 3BZEA 1OF2A 3IDMB 4HWBH 4XC3H 5CJBA 3S88L 4HGKC 5F7UA 1HILA 1G7LA 3HZYA 1ZS8B 5FKPB 3PWVA 4M5ZH 3LMJH 3AM8A 4KXZH 1HH9B 1WGOA 1UB6A 4L1DA 2DLFL 2EYRA 2ZPKL 4FQXB 4N0FB 4XNXH 1U8NA 1F6AB 3L1OL 1ZS8A 4PJ7E 2OR8A 4NKDA 5FKPA 1YEDB 3I9GL 5LGJB 4NFCA 5I1LB 5HVHC 3TNNA 4ZFFB 1OM3L 5D2NB 1I8IB 2VERN 3LS5H 1I9IL 4N0FA 4ODTH 1S9YB 5DJYB 2VC2L 1F6AA 1Q8MA 2X4PA 4RMVA 5C08A 1JIBA 5LGJA 1YEDA 2YPVL 2E8YA 3MYZA 4HF5H 2IJ0C 3HR6A 3V7MA 2EIZB 3LQZB 1FE8L 1I8KB 5IHZA 5DUPL 3PWPA 5D2NA 1I8IA 1T7VA 1RIVH 1S9YA 5DJYA 4F9LA 2C4FU 3IB4A 5GHWL 1AQKH 4HS8L 1VFUA 3KPSA 1XGRB 2I5YL 1X5ZA 3PJSA 2EIZA 1XF3A 4P9HC 5CEZH 3SJVE 3MLYL 3BKYH 1N2RB 1UM5H 3MUHL 1OLLA 4MZ3A 3QO0A 3S3JA 5F7LB 1XGRA 2YPKA 3HNTH 2FR4B 3JVGC 1UWXH 1A0QH 4XBEL 1LILA 3WSQL 4FQ1H 5DFVD 5ILTH 5IHLB 4Y16D 5FCUL 3P0VL 5HHPB 4JFPA 1N2RA 1ED3B 4WEMB 5ERWB 5CD3B 3C08L 2WP3T 5B4MD 2PTTB 2P4AB 3MRIB 5CBEA 4KPHH 5C0AE 3GI8H 3CSGA 1SYVA 5HD8D 4ZFOB 5HHPA 2WIIB 3MRJB 4NQDB 1DQTA 3K1DA 4X83A 4FXLA 5JPNB 3OX8B 4QXUL 5GGQH 3BHBB 5ERWA 3WNOA 3BKJH 5CD3A 3MRIA 2HKHL 3SO5A 1EZVY 2A2QT 3VD5A 1NMCC 2FZ3B 4LLYB 4N8CH 4RX4A 3CAFA 4AL8L 2WIIA 3MRJA 1DN2A 1TETL 5JPNA 3OX8A 3OAYH 4S1RL 1E4WL 3DX7B 4YXHH 5HDQL 5KVFH 2G75B 2PTVA 1JZ4A 2QJDA 2FZ3A 3N85L 4LLYA 4JRYB 1CLZL 2FX8L 4XCNB 4PJBE 3SDAC 4G8IB 5L9DH 3DX7A 4OQTH 4ZOBA 3MC0A 1KXVC 3DLQR 4XCNA 5C0CE 3N1GC 1YPZF 5IMKB 4X6DB 2Z91B 1NCCH 1FYHB 3BMWA 4G8IA 4TPRL 4BK5A 2XV6B 1QNZL 5ISZE 4MB3A 4PJAE 1H3TA 1FAKT 5MI0B 4PY7B 5HYJE 1JL8A 4X6DA 3O2WH 1MNUH 2VQ1B 2Z91A 3R06B 4J6RH 3FOMB 1UM4H 3PIQB 2J8OA 2ZCLL 4PY7A 4PJCB 3KPOB 2UZYB 3GSRB 1LDSA 1UVQB 3WNLA 1S7SB 3FT3A 5JHDE 2AABL 4UIMB 3WIIH 3PIQA 1MCKA 3ZO0A 2O5YH 3WS3B 3OKNA 5J7CC 1T80A 3MGOB 4PJCA 4NZDA 3KPOA 2ZOKA 3BPNB 1AO7D 1U92B 3GSRA 5TE4H 3X17A 3DUHA 3SQBA 5DA0B 5HHOE 3MTRA 2OTPA 4NRZA 3WS3A 1WICA 3HMWH 4LRNL 2RFXB 3MGOA 4BFBD 5FYJE 5BV7L 5DHYB 5HTSA 1AQKL 5AYQA 4KZEH 3N1QC 3ZE0E 3CVHL 1CZ8L 1T22B 4WO4A 5FUCE 4KTEH 4L3EA 3C8DA 5CEZL 4EJ1C 3CJJA 2VJXA 1ACYH 3I6GB 3BKYL 2PETA 1K2DB 5DHYA 1M7DB 4Q9BA 4PJ7B 4GW5B 4ZFGH 4IRZH 2AQ2A 1NGZB 1WUNT 1T22A 5FA4A 4EQ3A 2FATH 4HLZG 5ILTL 5DVLA 1ZTXH 2YXFA 4X5LA 3BXNB 3G9AB 4YHLH 3I6GA 1J12A 1K2DA 4Y2DB 1B3JA 3RPIB 3HMXA 1CD0A 5KW9H 1WV7T 4QRRD 4N8VG 3AFLA 4OQTA 1NGZA 4KQ4H 4NHUE 1BGXH 2PYED 5D1QC 3HG1D 1MAKA 4HFWB 1WTLA 3EAKA 5T1DH 2AK1H 4YK4C 3U6RB 5GGQL 4UNVA 1VFOA 4Y2DA 1MJUH 5EBGA 3RPIA 5CSBA 5I8EA 4W6YB 2CDFB 2A38A 3OSKA 1NAMH 2DI8A 2NY0B 1MCCA 3GSVB 2WNGA 3RWGB 3K74B 5E7FA 3RWJB 3SJVB 1LO0H 4HH9B 4YXHL 3L3HB 3RGVC 4R4NC 2W9DL 2CDFA 4CW1A 4OI8A 2V17H 5MEPA 8CGTA 3RWJA 4EN3B 1P9MA 3SJVA 1Q9OB 3IDGB 1G6RH 5DJDB 3AMLA 2EC8A 5C07D 3L3HA 1EHLL 1EAPB 4JPVL 4U3HA 4F7PB 5C0AB 1SJHB 5JOFB 4M1GH 4C55A 3LPFA 4EN3A 1UGNA 3S36X 1CDHA 3FFCA 4UT9L 3VFGH 4ZMAT 1Q9OA 5IROA 3MCLH 1JYWA 4LLWB 5DJDA 3NCYS 4HJJH 2R0LH 1JJUA 4K2UL 1JZ7A 1OAYL 4GQPH 4JFEA 5KSAC 2XQYK 1EAPA 5D72H 1S7WA 4F7PA 1MAJA 5C0AA 1SJHA 1DBML 5JOFA 3BUYB 1IGYB 1YN7B 4PJ9B 4YXLH 5FYJH 3UTTA 5HI3D 5FA3B 5DRXB 1IAIM 1NFIB 1W8OA 2IH1B 1UQSB 4WNQB 1MLCB 3MFFA 3CFEA 3QP3A 3TA3A 4Z7UF 1QYGH 3BUYA 4YHYB 3L3OB 4JPWH 1CU4L 4PJBB 5DHVH 5JXEC 4KC3B 1U3HA 5FA3A 3U4EA 4ORGB 3WIIL 1F58L 1NFIA 4M5YL 1IM9D 2IH1A 1UQSA 4WNQA 4G9FD 1K85A 1Z5LB 4GMSL 2EXYD 5C0CB 3F62A 3L3OA 2DJ4A 4KRLB 5TE4L 4CBPA 3D0VB 3SDDA 4PUBH 4S1QL 5ISZB 4IRSB 4ORGA 4UMGA 4XB8A 3BQUD 5FYLE 5IWLC 4HC1L 1NAMB 4GLRI 4PJAB 2OR9L 1Z5LA 5TPWL 1DE4B 3D1MC 3QEQE 5C0CA 4PRHE 1HKFA 3QIWB 3GZKA 3OXRA 2Z4QA 3STLB 4D9RE 2DQDL 3D0VA 4ZUVB 3K8KA 5DRZB 5ISZA 4IRSA 5KAQF 2DQIL 5DJXB 3RVVD 3RWFB 4L4JA 3A6CH 2H9GA 2E7CA 4OF3A 1RIUH 1DE4A 1J8HA 5I8OH 5I75B 3STLA 3RU8H 1BWWA 4LEXL 4ZUVA 3ZKMD 5DRZA 5I1CH 5JHDB 4LCWE 5E99H 1G9NH 2HTKD 1NUFA 1T20B 3F7VA 2MPAH 3RWFA 4P2OA 2J4WL 3MV9A 4X0KB 4IEFB 4XPGH 1W72H 4JFFE 5ICXB 3DNKA 1Q9LB 3S98A 3QNXB 5T5FL 5HHOB 4RGMB 5JHDA 4QNPE 5CGYD 3AY4C 1AGCA 5E2TL 4JG0H 4YHZL 2H32H 2AJVH 4JHBA 3AROA 5ICXA 1Q9LA 4Y88A 4KFZC 3B2UC 5HHOA 4NO5A 5ESQB 2JJWA 1BREA 1AQDB 1DBJL 3TT1H 4LVOC 4U1IA 3O6FC 3TFKA 4FFYL 2VXUL 3BFOA 1MRFL 3B6SA 5FECB 4FQCH 5FM5M 4AK1A 3R8QA 1FVCB 5ESQA 5CJ8A 1EJOH 3BPLB 2VB5A 1AQDA 4QOKA 2NTSP 4LASL 2XTJC 1AXIB 1T0PB 5E5MB 3OPZL 1XGYH 2H2PC 3U9UB 3KNBA 1N3NB 4AEIH 4XHJC 5FECA 5DEFB 1UZ6F 1G6RL 3W82A 1JFQL 1FVCA 1EPFA 4M1DL 4WWKA 2C7UB 1F11A 2B5IB 4NHUB 5T3XE 4Q74A 3U9UA 4JPKH 3SQOH 4QTIH 4M1GL 4TSBL 1C08B 3VFGL 5TGBB 2GJ6D 5H37H 1KB9K 1OSPH 4JY6B 3BSZH 4I8DA 3UJTH 2YRZA 5FYLH 3SGJC 2AQ1A 2A83B 4PJ8C 1GIGH 2C7UA 4FHBD 3VFUB 4OD1H 5I1AB 3UJJH 4A2MA 4Z5RA 1KGCE 4WI9A 2WWMD 4GAGH 1C08A 4YXLL 4R26L 1YEFH 1C5CH 4UT7H 1NDGB 5T33H 4JY6A 3BRFA 2W9LA 2A83A 4UNTA 3V8OA 2CH8A 3VFUA 1R3IH 5I1AA 1L0QA 1RD6A 3T4YB 3KJ6L 4L1HA 1W72B 4HXAH 5I2IB 2LAGB 3VWKC 4Q9RH 2LVCA 1FDLH 3D87B 4KDVA 3VFMB 3VFPB 4UOJA 1NBVH 4GKZB 4ZTPH 1PG7X 2C26A 3PP3K 5KVEH 4ENED 2X9XA 5B38B 1OB1B 5SWSE 3CMOL 3TBSB 5I2IA 1KIRA 4NZJA 3VFMA 2GTWA 3O3DB 3QDAA 4LSTL 1HHJA 2D4FA 3LQAH 5FUZH 4NGHH 5BOZG 3Q6GL 5CINH 5B38A 1OB1A 1QRNE 4FQQA 1YEGL 2X4TA 4YDIL 4G80B 4RIRA 3U30B 4NQCD 4KI5D 3QUKB 3VWJB 4X98B 2AEQL 4LRIA 4LL9A 1QOKA 1QBML 2NY5C 4JQVA 3ZKXB 3DX9B 1W8NA 4M6ML 5F3BA 4I0PB 1FFOA 4P57B 5I8OL 2P8MB 4Z9KB 1OQOA 4FQLH 3QUKA 3PQYE 5LAXB 3VWJA 1JWUA 4XHQA 4Y19D 4N90E 5ESAA 1EA9C 2Z8RA 4NNYB 2MPAL 3BPOB 3VRIB 3IXAB 4Y1AE 4NWTH 1RHFA 4I0PA 4E41E 5I1DA 1CE1H 1EEQA 3J7HA 2P8MA 3ZE1F 4ODBD 4O2FB 5LAXA 5C9KA 3L3KA 5K59E 5JXAH 5D1ZC 3TN0D 4OCMC 2P1YA 5T3XH 4GS7B 3RPKA 1CDJA 5EBLA 3VRIA 3IXAA 3EJYD 4GUPB 3B83A 5L0QC 3M1BB 3QEQB 1ZHLB 4PRHB 4MS8D 1JVKA 2ORBH 4O2FA 3GJFK 3O6LH 3JV6B 3CCHB 5TQ0H 1KN2L 3P40A 5INDB 5IB2A 2XWBB 1YNLH 5EORL 5JOPD 1RUAL 4ERSH 4X4XB 3WDHA 1OW0A 2ERJB 3BH8B 4GOSA 4FQCL 4PJEF 3JV6A 3QDMD 4LCWB 4Y4KD 2CDEB 5AWNH 4L4TA 2R0KH 5HYIA 4LHUG 4JN2B 2KZ1B 2XWBA 1P5VA 4CMMB 3ULVH 4P2CG 5HPMA 4X4XA 1FFPB 4AEIL 4C57C 3LQMA 3BH8A 3FTGB 3VGGA 1OOAA 4ZUWA 3LKSB 3MREA 2H8PA 4ZUUB 2B1AL 2ICEA 4HQQH 4K7PX 3IKCB 4Z0XB 3OB0H 4JN2A 1K6QL 3ARGB 1FFPA 1AC6A 1ADQA 1BD2E 3DO3A 1V3KA 2ZKHL 1JPST 1JP5A 3VRLF 3LKSA 1S78C 4WFHD 3IKCA 4Z0XA 4YDJB 1S7VB 3ZTJH 3B9KB 3UJJL 1FL3B 3ARGA 3DETC 2FH6A 2Z31B 4OM1L 1FO0L 4UBDC 1V5JA 1V3MA 1C5CL 5T33L 3IFNL 3QUZB 1UYWL 2G5RA 1NC4D 4N0CD 1GGUA 3F7RA 4YDJA 1R3IL 1FL3A 1PYWB 1F4WH 3SGDI 4HUUA 2J5LB 4PG9B 4WI7A 2CLRB 1VEPA 4LNVA 4Y5XC 3TZVC 1RURH 4KVCH 1QPPA 3BYTA 3QUZA 3DX8B 4X99B 3I75B 4J7RA 4NQEE 4Q6IC 4K9EH 2W59A 4F3FB 1WZ1L 4F7MA 5MEND 4LGSB 4ALAL 4V3DB 4JJ5B 5F9OH 3UAJC 5DUML 4L3CB 4PG9A 4XVJH 2CLRA 1WWWX 4KK5C 3S6CA 1TENA 3DX8A 4UIKL 5D6CB 2ZNWA 2W0KA 4CNIB 1CGYA 2Y36H 1H8OA 3GGWB 1BX2B 4JJ5A 3IDIA 4L3CA 1M71B 5IM7A 4GW1B 1FNEB 5J4MA 1JRHH 3GRWH 5E08H 1N0XL 5F71A 2OI9B 3RY5A 5D6CA 3GBNL 4CNIA 2XQYG 1QR4A 1CQYA 4R8WH 3K0WA 3MZTA 1ZAGA 4XPBH 3QDHA 5DVNA 1M71A 1CLCA 1ZHNB 2VLJD 3FB8A 4GW1A 3G6JF 3R8BB 4HBCH 3L5HA 2CMRH 4N0YL 5GZNC 4KWUA 3RVWD 2P5EA 4O2EB 3TBVB 4Y8AA 4KHXH 5IB4B 3DVNB 4J4PA 5AAMA 3T2PA 2UYLB 4NWTL 2V5TA 1ZHNA 2V9TA 3NMEA 2X1WL 4L9LA 4KROC 2JJVA 3JTCA 4NOFA 1QRNB 4MMZC 3VA6A 4HFUL 4XP1H 4K3GA 4K23L 2R8SL 1KEGH 4HEME 3O6LL 2D2OA 1ZLSH 2BVEA 3HB3C 2AXGA 5DDHA 4ZAKD 3O4LE 4RNRB 4P3CL 2KBGA 4U1NB 2I9TB 1QRNA 4M1CC 1UJTA 4GMTH 4XPHH 2Z35B 1J0ZA 5GS2H 3PQYB 3NAAL 3NIFF 4BZ2H 5E6ID 4G3YL 3I50L 4RNRA 2VDKH 3QPXH 4U1NA 1S7UB 2Z35A 2VLKA 5EU7E 4JZNB 4E41B 1HEZB 5EA0H 2JJTC 5GGTH 3H0TB 1QLEL 4GBXC 5TH2B 3L9RB 4PS4L 1FP5A 1Q1JL 5A16B 2DM7A 3WIHH 4ZXBC 1S7UA 4ACPA 2Y06H 1A7RH 2AKRB 3BD4A 4JZNA 3NA9H 1FIGL 1HEZA 4OCNC 2R2CA 4S1DC 3IDYC 4GSDL 2O5XH 2UZIL 5DD0H 3MLTB 4OZFH 3A0OA 3L9RA 5AD0B 1EMTL 1JF5A 2XRAL 1OVZA 1FVDB 2NY2C 3GHBL 2FBJH 4JANB 1YYLL 4DVRL 2AKRA 1CICD 1RZKC 3C9NB 2AJYL 2VDPL 4OKVB 5IB3B 3BRDA 4P4KD 4PRAB 1XIWC 3MLTA 4JY4B 1ETZB 3C6LD 2AW2A 5A3ID 1JBJA 4NZRL 1FVDA 2VDRL 4LLUB 5ALBH 4HLJA 1L6XA 4J8RA 4JANA 5L2KA 3C9NA 4OKVA 5IB3A 1BQLH 3ARBB 5FHBL 1C12B 4PRAA 4JY4A 4PJDF 3VXNA 2XPGA 5EZIH 3CXHK 2A9NH 4LLUA 4NO0D 5F9OL 4H0HB 3C60D 3H9ZA 5HYFA 3VW3H 1QA9B 4XNMA 3DARA 5BVJB 5JQ6L 4LVHB 3ARBA 1C12A 5MEOB 4CVXB 4PJXF 5IFHH 1CL7I 5FFLA 4U0QB 2IMMA 2OLDA 4CUCA 2BCKB 1AJ7L 1RZGA 3UJIL 4MNQA 1KJMB 5HI4C 1QA9A 3ISWA 3EOTL 5FEBA 1JRHL 1SJEA 3TBWA 5MEOA 4CVXA 3EHBD 3BP4A 1I8LC 2VUOA 4LLVA 3K1KC 3ARFB 4U1SA 4ODVH 3F12B 2BCKA 1BF2A 3FB6B 4DUVA 3K4AA 1IT9H 1KJMA 3WFCL 5ALCH 2A9MH 1Z9SA 2JLLA 1X5XA 2ED9A 3RVXD 1X5KA 4C4KT 3ARFA 4UINH 2V2TB 1S3KL 2VDMH 3QULB 1YEKH 2PO6C 4PRBB 3FQWB 3F12A 3GMOA 4JZOB 4ODWA 5J56B 2YD5A 4HW6A 4RGNC 2E6QA 5D4QA 1KIPB 3OGCB 1QFUH 3HLAB 3QIBB 3ME0A 2GEEA 5BMFH 2V2TA 4X9FA 2IEPA 1PW3A 2VITB 3QULA 4PRBA 5ANME 1RJCA 1T03H 3FQWA 3S35H 3AUVA 4D3CL 4JZOA 3UZEA 1X4ZA 2DBLL 3O6MH 32C2B 4LSPH 1KEGL 4HJGA 3PG2A 1RFDL 3QIBA 1OT1A 4W68A 1J0KA 3WFEL 2VITA 3RKPA 1YC7A 4ZOAA 5DEGA 1BVLA 3HFMH 1WFNA 4H20H 4XPHL 3U0TB 1CDBA 2N7BA 4BSVA 2LABA 5F3HB 3IKKA 4WGVB 3RJQB 4RWYL 4EXKA 2HWZL 1E4KC 4PLNC 2P24B 2A73B 1IEHA 1ZVYA 1JGDB 4GG6F 4KJPC 2XXCB 2VDKL 5FCSH 1RU9L 2YS4A 2W60B 1FL6B 3U0TA 3DMMA 3K2UL 1FSKB 5IB1A 3ABZA 2Q87A 5F3HA 2HT3C 3MJ9A 3R4DA 4DN3L 4QGTA 2P24A 5F7YC 2DOCA 4R97B 3DXAA 1JGDA 5BJTA 3TVMC 2CRIA 5E8DH 5EU6D 5JW4N 2W60A 1FL6A 1P2CB 2IANA 4ZS6D 3NA9L 3QXVA 2ZUXA 1A7QL 2IGFH 2RHEA 2R1WB 2VXQH 5F7EL 1A47A 1KCRL 4WV1B 5DLML 5KN5B 1M4KA 5JDSB 4NQVB 5TQ2L 5JMRA 4IJ3B 1H5BA 3HPJB 1P2CA 3S5LB 3C8HA 2WSKA 3WO4C 5C0DB 4QRRE 2R1WA 2VH5H 1MCPL 2PYEE 1KYOK 4WV1A 3K3QA 3HG1E 3U7YL 5GGUB 4NQVA 4JHAL 3E3QE 3HPJA 3Q5TA 1VENA 2Y1VA 3S5LA 3ULUD 3HZMB 1G9MC 5C0DA 3WJJA 1F4YH 1BQLL 1OQXA 1IGIL 5EZIL 2A77H 1JF1B 3V6ZB 5D96C 5GGUA 3SGEH 4Z8FH 4M7LH 2A9NL 1YUHB 4WHCA 4WHDA 1HIML 4OV5B 2LTQC 2X05A 4D8PA 3OL2A 5KSUB 3LKOB 1JF1A 3N9GL 3V6ZA 4NN5B 1INDL 3KYKH 3HNVL 4Y16B 1PSKH 1YUHA 3BKML 3QHFH 4RISH 1DBBL 3MUY1 3MJ6A 3CFCH 4OV5A 2YZ8A 1KELH 5C07E 2HA1A 5BW7A 1T1WB 3LKOA 3GM8A 3V5KB 3PL6C 1MVUB 4GRWH 4NJ9L 5J89A 4Y16A 1JGUL 2NQCA 2YR3A 4K7FB 4R4FH 4HV8B 3P30H 5HHVH 1DBAL 1W0VB 5ELIA 5J1AB 5E1AB 1IRAY 3UYRL 3V5KA 4F8QA 1MVUA 4JRWA 3D3VD 5IW6B 3VG9C 2L4OA 4K7FA 1IILE 4HV8A 3IF1B 3TPUE 2ZNXA 1G1CA 1QFUL 1W0VA 5AYUL 1OD7A 5DD5L 3MJ8B 1SEBB 4IDLA 4RFOL 5J1AA 3SE3C 5E1AA 4JFDD 5BVPH 2AS5M 1KN4L 4O9HH 3TO2B 3IF1A 3ZDZE 1EO5A 5D93B 1FVEB 3FQUA 5C1MB 4P9HL 3MJ8A 1SEBA 2AJUL 4X8XA 1IGTA 2BC4B 4G9FE 2FHBA 4YFDB 1KLGB 4X80H 3KJ4B 4ZG1A 3F58H 3TO2A 1RI8A 3SDYH 1EFXD 1UXWB 1SM3H 2VABB 1VADB 5E6YA 1U8QB 4HX1A 4ZO8A 4MCYA 4WY7H 5IBUB 2AJZB 1V3LA 2J6EA 2EYTA 5DMGC 2W07A 2MCPL 4WW2F 4HUVB 3NCFB 1ZA6B 2FSEB 2D03L 4RQQB 2EDQA 2E8ZA 3S36L 1J0YA 3LKQA 1UXWA 3H9SD 4DOHE 2VABA 2EDRA 2AJZA 5ANMB 4HT1L 3U1SL 4KK6C 3F5WA 4HUVA 1ZA6A 4X5XB 4JO2L 2FSEA 1ZHKB 4RQQA 3V5HB 4DVBA 2AEWA 1HXMA 5JHLH 2F5BL 1MOEA 1MRDH 3RUGE 2XICA 4JM4H 4X4MA 1FJ1A 1AO7B 4X5XA 2DLGA 2EYSB 1ZHKA 3V5HA 1EBAA 1OWWA 3OF6D 5DJZA 3A67H 5I1GH 1NMBL 2DIBA 1PG7H 5CLTA 1J5OL 2D7NA 4I3RL 2BSRB 5T1KD 3UTSD 1AO7A 5FGBA 2EYSA 1RUMH 5HHXL 3WYRA 4MXWL 1F2QA 3EFDH 4F15B 5EH1A 1FZJB 3Q2CA 4NO2B 2BSRA 3O9WC 5K9KB 3G6DH 3BE1L 4PJFE 3KXFD 3DSNA 1KB5L 4WDIB 4BQ8A 3HE7D 1JPTH 4B7LA 4LLDB 4EXPX 4IIQC 5GRYA 3QFDB 4NO2A 5K9KA 1PSKL 1Z9OA 3K2MC 2X42A 4D0DB 5IESL 1R3KB 2PUQT 4OLXL 5C7XH 3AC0A 2P46B 4L8SB 3HUJF 5F1IA 2PYEB 4YNYB 4DGVL 3HG1B 2WP3O 2ZG1A 4RGOL 4OBRA 4W6XB 4AM0B 1OL0A 1VGEL 5I71B 3LEVL 5BV7B 2GJ6E 3OTTA 4ONHA 3MBED 1R3KA 3OKKB 3DGGB 4ZS7H 3P9MB 4PD4J 3MOQA 5IB5B 2R29L 1UJ3B 4L8SA 2CRZA 3VJ6B 4YNYA 1QHPA 3CVHB 3CD4A 3QNYA 3HG1A 3QDJA 4I3SL 2QADC 3E3QA 1MRCL 5DVOA 1ZE3C 3T65B 3U83A 1DFBL 5CMAB 3OKKA 3LD8B 4UB0H 4EOWH 5IB5A 3QBTB 3VJ6A 4X6FB 3QRGL 1FNLA 3CVHA 4MAYA 2NYYD 4WI5A 3NABH 3V6OA 2V7HB 1X44A 3DTXB 3RTQD 7FABL 4NBZB 1NCBH 4RFEB 3WFZA 3WUWG 5CMAA 5C07B 3GM0A 4X6FA 2OTUA 5C2UB 3O2VL 3EO1B 3ROOB 1L0XA 2V7HA 1Y6MR 2XTLA 4RFEA 1YEJH 1S9WB 2ARJQ 1X5YA 1D9KB 4OFIA 1UWXK 2EEBA 3EO1A 4PDCE 3T2NL 1I1AC 4Q0XH 4NQCE 4KI5E 3TPUB 3C6SB 1I7ZB 5FF6B 1D9KA 4JEGB 43CAB 4AMKL 4JVWA 4ODXB 2X1OA 1VEOA 3QXAB 2DQCH 4ODSH 1NKRA 4G8EB 1MIML 1J1OL 1B6UA 4G43B 2HRLA 4H88L 3C6SA 3L3GB 5FF6A 1IM9B 5IEKA 1MFBH 4Y19E 5EB9A 4G9FB 3VCLB 4NDMA 5BO1L 1FC1A 1KT2B 1FNHA 4UILH 3BIKA 4P2QD 5TDPB 2EDOA 5DO2C 1GGBL 3OAYK 4OLYH 3AB0B 1MWAH 5EOQH 4OLZL 5HGAB 5T5NG 4G43A 4KKLC 3RNQB 4I4WB 3HS0A 1LGVA 3L3GA 1KPRB 3BQUB 5EU5B 2EH7H 1IM9A 3STZA 3VCLA 4U1JB 1KT2A 2VAAB 1U6AH 3HC4L 4GQ9L 5D1XC 3RZCA 1KJ2H 5HGAA 3RNQA 5D1QD 4I4WA 4DOHB 1KPRA 3BQUA 5EU5A 4NT6B 2QR0B 3LKRA 3HE6C 1D5XA 5T1MA 2H3NB 1OARL 3U0WH 3KPQA 1IVLA 1EEUA 2VL5B 5JOPE 4F58L 3GSNL 4K71C 5C0FA 4KK9D 3G6DL 1OTUD 4D9LL 4ETQA 3LEYH 1NUNB 3DVFA 3CUPB 5CD5C 3QDME 1KTRL 1SJXA 4RFNC 2QR0A 3AAZA 1IGCH 2H3NA 1QQDB 4MVBA 1HKLL 1KTKE 4WUUD 2VL5A 3LN4A 4HWUA 1LO2H 3NFPB 4HS3B 4HLZH 1JWSB 3BGAA 2OP4L 4UAOB 5FYKH 4YC2B 3NFSH 2YN5A 3TEUA 5J06A 1BQHG 1GPOH 1QQDA 2RIKA 2VSDA 4PYHA 4J3WA 3NFPA 4HS3A 3MV7D 1JWSA 3T09A 4BQCA 3MOBH 1T89A 4WFHE 1W2KT 1FV1B 4HC1A 3QCTH 12E8H 1BFVH 5LCVL 3NTCH 1TZIB 3T1WA 1ZEAL 2DWDB 5ACZA 1G0DA 2ADFL 4PJFB 4HWEH 1GZQA 4DZ8B 3BAEH 2FL5B 4JDTL 4MD4A 5F9AC 2YD2A 5C6TL 3TYGH 4G9DB 4EOWL 5IVNA 1FV1A 1DVFA 3HRZA 4D0CB 4RMQA 1TZIA 4JFOB 2DWDA 4DEPB 4PJFA 4DN4H 3VFSB 5F1NB 3PE9A 3HPLB 5IVXF 1URLA 3ZLQC 1F6LL 1DDHB 5DJ8B 3MLVL 5MENE 4D0CA 2BERA 3TC9A 3O8XC 4P5KB 2GJ6B 5F1NA 3S37H 3MRPA 3HPLA 1YEJL 1NSNH 4XNZC 1TJGL 5L2JA 1AY1L 1F4XH 2VQTA 1F42A 5DJ8A 3WLWC 4E0RA 4K7PL 4YQXH 1QLRA 1OAQL 1CGTA 1AGEB 4EBQH 4QHKJ 4Q0XL 3VFTB 4P5KA 2GJ6A 3GIVB 1JHLL 3S4SG 2J8UA 4JZJB 2B39A 4ZUSB 1AIFB 1TZHB 3O4OC 4LSVH 3VI4F 2AAVA 1ZV5A 3BD5A 4L5FH 1EERB 1BFOB 1XF5B 3RAJL 3GSXB 1AGEA 4PP1C 4UDTB 1FPTL 3H3BC 1F45A 4QRSB 1UACH 2VLJE 4R7DB 3GIVA 2IBBA 3DSFH 4U1MA 4ZUSA 1AIFA 4NN6B 3ZHKA 5CUSL 4BFEA 4NRXB 4OCLC 1BFOA 1XF5A 3GSXA 3V4UH 3TNMB 4N0RA 4EIGB 1BQUA 1F8TH 4GXVH 3QSKB 2W38A 4QRSA 2X7LA 2GSIB 3MRKA 1MWAL 1FZKB 4R0LC 4K07A 4OM0L 3FFDB 4XRCB 5DHXB 3TT3H 5E2WL 3FRPA 2ZCKL 4OFKA 4AZ8A 2DRUA 4WW1B 3JXAA 5IQ7L 5D2LF 3TNMA 2CGRL 3VD7A 1TQBB 3DURB 4UZGA 2QTEA 4NQCB 2GSIA 4MJID 1JNHB 1KJ2L 4HIEA 4XRCA 2HLFC 3RWIB 4JLRB 3BYYA 3DHMA 5E5RB 3SGKA 3U0WL 1LEIB 1FAIH 4WW1A 3M07A 5GRUL 2MKWA 5DQ9B 3DURA 2GIYA 4UV4L 5CP3H 1RZJH 4PLKD 1OAZH 2IALB 1JNHA 4KH2A 3RWIA 4XP6L 2VZVA 3GMQB 5GSRB 1HDMB 3CSPA 4JLRA 1YPZE 4Y19B 3P9WB 2HG5B 2DJSA 3E6FB 3QQ3A 2AJSL 4ONFH 4HDIB 1LEIA 1T6WA 1L9NA 5DQ9A 3F6IA 4NNXB 3VXSD 2F53D 4DWHA 2XTJD 1HOCB 5E8NA 4HAGA 2NY6D 4K3DL 5DT1H 5FYKL 5GSRA 5I73C 3HC3L 4Y19A 3TN0B 1WIOA 3E6FA 4P59H 1A6AB 4HDIA 4P99A 1N6QL 1CLOH 5C9JB 3QFJD 2UWEF 3WL9A 4HCRH 1Q9KB 5JR1H 1HOCA 5CJQL 2FBOJ 2GW5A 1UM6H 3MRRB 3OJDB 4EI6B 5C0GB 1A6AA 3RHWK 3V7AG 5C9JA 4LCCA 4MS8A 2V7NB 3RI5F 1Q9KA 5D6DA 1JV5B 4OZGF 3BP5B 3QDMB 4Y4KB 3MJ7B 3TV3H 3E8UH 4EI6A 5C0GA 1I7RB 2PXYB 2MJWA 3FB7B 3ARZA 5ITFB 2V7NA 4LQFH 2NY5L 3RWHB 4F37K 2DL2A 5D7JC 3MJ7A 2VISB 35C8H 1HHGB 5IFAL 1TZGL 1IGFL 1UA6H 4LLMA 5F6IB 2PXYA 3SBWA 1EEZB 5ITFA 5E95B 3P11H 1CFTB 5TJWK 5D7IE 1JPFA 3WHE1 3PV6B 3IS1X 3R0NA 2Q8BL 4R4BB 3LKNB 4JQIL 5DUBB 1J0IA 1HYRC 1I4FB 5J3HD 3TGXA 1EEZA 2N4IA 1KFAH 2G5BB 3PDOA 3UO1L 1CFTA 2XN9D 1XAUA 3VGAB 1X4YA 1AKJD 1HINL 1NC4B 4G8GD 3GB7B 3PV6A 4L5FL 5DUBA 2ZJSH 4O2CB 1I4FA 4PR5B 2NCMA 2DL9A 2AV7B 3W2DH 5LBSL 4HK0A 1FNFA 2ZG2A 1U91B 1K4CB 3NPSC 3DSFL 5CJOL 3L5XL 4K3JH 1BP3B 1NC4A 2FX7L 1CTNA 3SO3B 5MENB 4LPWA 3LDBC 4NC1C 4AEEA 1C8PA 4O2CA 3QZWB 4PR5A 2VLRE 1F8TL 1EJ6A 5SWZA 1B0WA 3MA7B 2R0ZH 2R2BB 2DKSA 1U91A 1T04B 4TQEL 2C9AA 3SCMC 4P2RD 5MENA 3QZWA 4CU6A 4OZ4B 1FO0B 2WUCL 5GGVH 2P43B 3MA7A 4DKEH 3VH8B 4WEBH 2P5WD 4YE4H 4FXKB 1T04A 3ES6B 5I15L 1OGAA 1T5WB 3CLFH 3V5DB 3H7BB 4Y5YC 4LOUC 1PX4A 4YDKH 2I60L 1HWGB 4YEEA 4OZ4A 1FO0A 1R5IB 4UTBH 2VLJB 3VH8A 3O6KH 1OAZL 5H35A 1UZ8B 4FXKA 3ES6A 1T5WA 3CX5J 3H7BA 3IAGC 1MCFA 3G08B 4ISVB 1F4HA 1R5IA 1N7ML 2VLJA 1A7NH 2EDYA 4MD5B 1AXTL 1RUKL 2GT9B 5DT1L 1UB5B 1MAMH 1ZLUK 1VSCA 4TOYH 1QRKA 3P4OA 4MWFB 2VXSH 3RVTC 5LKNA 5EU6E 1Z9MA 2NZ9C 2ZWLT 2X10A 3HZVB 3G08A 4ISVA 4QXTA 5IJVA 5D8JL 3VA2C 1AGFA 3V52L 1H8NA 4FTVD 4HCRL 4I77H 43C9A 4A2LA 3UYOD 4MD5A 2GT9A 1UB5A 1CWVA 2IFGA 4ZAKB 1T2JA 4YPJA 4Z7OF 3MLPA 4MWFA 4XZUB 3SKMA 4LHJB 3HZVA 5GXBB 4FQHB 2YC1B 3RWDB 1TXKA 4LFHD 3NCCB 5E6IB 1YPZB 2ESVA 4ZAKA 4UBDD 3WXWH 1WT5A 1EFQA 3FB5A 1IQWH 1D3CA 3UC0H 3QNZB 4NCDA 3DPBA 3VXQA 3ULUE 4FQHA 2QQQA 2YC1A 4PP8C 5GS0C 2ZUYA 4FFEX 1S7RB 3FN0L 5CJXC