4PJFA

Structure of human mr1-ac-6-fp in complex with human mait b-c10 tcr
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
269
structure length
263
Chain Sequence
RTHSLRYFRLGVSDPIHGVPEFISVGYVDSHPITTYDSVTRQKEPRAPWMAENLAPDHWERYTQLLRGWQQMFKVELKRLQRHYNHSGSHTYQRMIGCELLEDGSTTGFLQYAYDGQDFLIFNKDTLSWLAVDNVAHTIKQAWEANQHELLYQKNWLEEECIAWLKRFLEYGKDTLQRTEPPLVRVNRKETFPGVTALFCKAHGFYPPEIYMTWMKNGEEIVQEIDYGDILPSGDGTYQAWASIELLYSCHVEHSGVHMVLQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Major histocompatibility complex class I-related gene protei
publication title A molecular basis underpinning the T cell receptor heterogeneity of mucosal-associated invariant T cells.
pubmed doi rcsb
source organism Homo sapiens
total genus 73
structure length 263
sequence length 269
chains with identical sequence C
ec nomenclature
pdb deposition date 2014-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4pjfA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4pjfA01
5I73C 2GJ6A 1R5IA 4HKXA 4OZFA 3TLRA 1LE5B 4K9EH 1FL5B 4Y4FB 1AFVH 2X70B 4D8PB 1YNLL 2ZUQC 4AG4L 5IMOA 3RZWA 2FWOA 3QEQD 3JVGC 3UBXI 5LJYH 1FVDB 2C4XA 2VIRA 3VXUA 4LP5A 1MY7A 3DV4B 4MLSA 4J8RB 2VN4A 5MERB 3UPAA 4ORGA 4JPIA 4Z7VA 5IBUG 2EYSA 2VN7A 3NA9L 2J8OA 1I8IA 5ESQA 2W0PA 3FT2A 5E94A 2HVJB 3MNVB 5IBLD 4Z7QE 1MRDL 4LOUD 5C0FA 1YPZB 4L1HA 5GS2D 1ZA3A 1JPGA 4BM7A 2F15A 2E9JA 2O61B 2EE6A 2PN5A 1P7QB 5EU6A 1TCMA 1OW0A 4P4KA 1KLUB 2P43B 3RX5A 1ZK9A 4G6MH 1H8OA 1F11B 2HAZA 2DIBA 4Q58C 4Y4FC 3SO3B 3VFNB 1I3VA 4O2CA 3HZVB 1U8OA 1VFUA 1CR9L 1A7NH 4JDTL 5HYSA 3BKJL 2Q86B 4EI6A 1EBPA 3FQRA 4WUUE 5FUZL 4X6DF 2R1YA 5HVWA 1AY1H 2D0GA 3E1F1 1SQ2N 3R06B 3PHSA 1C7SA 4P5TB 5C6TH 1YYLH 4FQXD 3ZDXF 3U46B 2P8MA 2E7LA 4KDTA 3FQNB 5FO8B 4LGPB 2HJFB 1J1OL 2XPGA 3OKOA 4PJIB 5KOMC 5LGJB 4HHAB 4TVPE 5FGCE 4ZS7H 2Q3AA 1CBVH 2AXFA 2OJEA 5SX4I 1EZVY 3EFDL 2R15A 1G7QA 4MA7H 5IB1A 4NCC1 5E5MB 1KPUB 4XNXH 2DLTA 5EO9A 3IAQA 5DWUH 3IS1X 5T5NF 3H0TA 3VD7A 1HHHA 3HR5A 4XXDA 2PTTB 4LHUA 1QSEA 3PDOB 1ZHBA 1S9VB 1O0VA 1L7TH 4QY8A 4PG9B 2Y5EA 2PNDA 4H26B 5EPMB 4OF5A 1DQJB 2ORBH 3BP6B 2XKUA 2FZ3B 4Y5YC 4P9HH 3TA3C 5IB2B 5F9OL 3FFDB 1FNGB 4M62L 3V7MA 5L2KE 4PB0L 2WIIA 2AXGB 1I7UA 4PP1D 4PJCA 3CX5K 4DKFL 4F8TA 4TPRL 1GJIA 1OQOA 4YR6A 5KN5B 4NP4L 1UM4H 1HH6A 2ZNWA 1P7HL 3RL2A 1NGXA 1LDPH 3EDEA 4ZFGL 1YDPB 4ODTH 2IAMD 5GZOD 5C07B 2B4CC 4I77H 4YNYB 4GG8A 4ISVB 3QPQD 2XZCH 1VDGA 4MSWB 5D7JB 3UZQA 3IU4L 3QIBA 5CJQL 5D1ZA 5D1QB 1XIWA 4HIHA 1A6ZB 4PRID 4Y8AA 5F7EH 1S9XA 5GJTL 1EDQA 4PJXA 2DQTH 1I1AA 4OLVL 5FB8B 1S7XB 4PJAA 1MI5A 5IMLB 4PLJC 1YMMA 1ZHKA 3E6FA 4Z7NE 1CE6A 5ESAB 3HC3H 1MCEA 3GGWA 4OCSH 4NKMA 5FGRA 3OSKA 2R1XB 3GMLA 3HZYA 1ZEAH 3HKFA 4YK4B 4I18B 1XAUA 3ZHKA 4XXCC 5D5MA 3SGEI 4CMMB 1YECH 2BSTA 4U3XA 4ZXBD 1IT9L 1U8KB 3PIQA 5GRWA 3RAJL 2XTLA 1EAPA 5I66A 4C4KO 1S7TA 4OCRH 1DE4A 4BFIA 5CUSH 3VW3L 4DGVH 3SDDB 4RGNB 2WUBL 1MHHB 1NGYA 3GO1L 1MAJA 3SE4C 2JB6B 1S7UA 2NXYD 3IDJB 4WW2A 4PRNB 4HBCL 5EU4A 3RDTD 5CGTA 4YDKH 3NBNA 4HWUA 3TEUA 4WJ5A 5A2IH 1WFNA 1PYWA 1WEJH 2W0KA 2WINA 3D2UB 4MXQA 3DRTB 3V6ZA 2YD5A 4YDLB 1PY4A 5T3XD 2Z9TA 4TN9A 3U4EA 1X5LA 2W9EH 4LSRH 2MFNA 4Z7WE 1OGTA 3CFEB 1SYSA 4XNUH 3UJJH 5A2KH 1D9KA 3SQBA 2M26A 3TPUE 2YXMA 1IEBA 2NY4C 4F9LC 3BHBA 4WY7L 2VUYA 1RUAH 4IDJL 1QLRB 2RR3A 3PWLA 4WU7B 2JCCE 3HG1A 2NY3D 4QCIB 1HNGA 2P8LB 3SDDC 4RGNC 1GYAA 1JL8A 2VZVA 4ETQA 5IW3A 3MRGA 3TC9A 4K7FB 4YDIH 3U9PL 4ZUVB 1MFAL 2DL9A 2B4CH 2GITB 1KJ2A 1MCPH 4MQXC 4XPTL 4KZDL 1FNSH 3R8BB 1XGRA 3SCMC 3U2SB 4Y4KD 2C3VA 4YDLC 5LCVH 4S1SH 1FNFA 2VDQH 3DSFH 1KFAH 4HUUB 2OM5A 3A6CH 2DQUL 2R56L 2GQHA 3NAAH 4KKAC 4N8CH 4N0FB 4HJGB 4NZTL 4YZFF 5HGBB 1I8MA 4FN0A 4GSDL 5TPWH 2BRRL 5JTWA 4ZUUB 4BKLA 3KLAA 1A6UL 5CD5D 1J0ZA 3C09C 3GK8L 4JJ5A 5T33H 1A9EB 1TJGL 4TRPL 4NNPL 4Z78B 3U6RA 3PWPA 4LCIL 4R4BB 4XAKD 2FR4B 2GUOB 4PLKD 4GMTL 3EAKA 3PABB 4JRYD 4PJBE 1QBAA 5JR1H 2BSED 4QGTA 4Y89A 3QEQB 4QHUB 5JORB 3QDAA 2WWKO 2AXHA 4D9RE 2X1XR 1RVFL 3V5DB 5KAQF 1N4XL 3OR7A 2R0KL 2CRMA 3TBTA 3WE6B 5DMKA 1RHFA 5L0QB 4X6FB 3FB7A 1QRNA 1BPVA 2ZKHL 1XZ0A 1KUMA 3NCJH 1QR1A 5EA0H 1NANI 4H1LA 3DX9A 4U05A 1V5JA 4MB4A 3N0PB 3QJFA 3MZTA 2HLAB 3BAEH 3ILQD 4I48A 2IG2L 3KLDA 3MREB 1RZ8A 4TUOB 1CXIA 5B8CB 4XWGH 4FQIL 1SEBA 3QB7C 5F7FA 1Z9LA 4JHWH 3SDCC 2GTZB 3OHXA 4KVCH 3LPWA 2H2SD 3L95A 1V05A 1AO7A 1OWRM 3CCHA 4KV5E 1MCBA 3LZFH 5FFLA 3ULVL 2DD8H 3QUMH 4FQXB 1IEAB 2OZ4L 2PO6C 3IDNB 2BVQA 3T0EE 4MQSB 1AXTL 5E8NB 3E0GA 5DEFA 2P8PB 2VDKH 4OFIA 5A40E 2XN9A 3FZUD 4P2OA 1V7NL 3B9KA 5JLZB 3PWUB 4LKXA 4WI7A 3IFNL 1JF6A 1A02N 4XP4H 3T09A 2WW8A 4PTTB 4KK8C 3RL1B 2MCPH 3SJVA 3MYJB 3LRSB 2OTWB 3HCVB 4OLYH 4ZNEE 3PF2A 2IWGA 5B4MD 4OCMC 3QQ3A 4ONOA 5IGXH 4OFKA 2NNAA 4FQXC 1QFWH 3O3BB 1A21A 1F8TH 3RZCA 1T1ZA 1DN2A 2VZSA 4HPYL 4P5TA 2C1OB 1G7PA 4R4NC 1NCAL 3JWNC 3P11H 1HEZA 3W5MA 3LRHA 1JVKA 1F00I 2OMNA 4CU8A 2F54A 1EO5A 5F44A 3OZ9L 5FO7B 4UBDD 1NUNB 1YY9C 4ZS6D 4WI4A 2R0ZH 4FTVB 1BOGB 4AQ1B 1FLRH 1AQDB 2DYPD 1QLFA 2VXUL 2IAMB 5BZDA 3HAEA 2CD0A 2PXYA 4NQDA 2ERJB 4Z7UB 3EHBC 5GGQH 4P9MH 2OQJA 25C8L 4OAWB 3G9AB 4PRIB 4Y7MA 4YDJB 4R0LB 5I17A 2XV6B 5E7FA 5IEKB 2X4UA 4ELKA 3SEPA 3VH8A 4PGZA 4YBQC 5JMOC 3IVKB 2R4RH 2MCG1 1Q9KB 4MJ4A 4RISL 4JPVH 4KHTL 3QFDB 2IPTH 3WO4C 1MFEH 2C1PB 5SWSA 5F7HA 3D5OF 3AY4A 3K80A 1N59B 3SDAC 2XZAL 3EBAA 4FFVD 5DD1L 4PLOB 4ZXBB 3BSZH 3CGTA 3V79C 4PGEA 3QEGH 3PGFH 4OZIA 1GH7A 3ZKND 1MIML 3FRPA 1KN4H 2NXYB 4R0LC 3QFJD 3QNXB 4NFDA 1CDBA 3HUJF 2YN5A 3IT8D 1DJSA 3VCLB 2EDFA 2ATPA 2EE9A 3JV5A 2BSRA 3ARXA 1HK6A 1T3FB 1E6JH 3T08A 2ADJB 1NPUA 2IBBA 2ZCHH 4OGYH 1J18A 2HFTA 5CSBA 1U92B 1AFVL 2XRAL 4DZBB 3AGVA 3BX7C 5EOTA 2X4OB 1Q38A 4LSQH 1Z5LA 2E9BA 3V4VL 1F97A 2RQ8A 4WHDA 1U0QA 2FGWH 1FZOA 3LN4B 3PNWB 4POUB 2W0FB 4HUXA 2VRAA 2NY3B 5CWSA 3V5HB 1D5ZA 5C08A 1NAMA 3HN3A 5SX5K 3U4BH 4QKXB 1EPFA 1IQDB 3GDBA 3UTTA 3V9FA 4Q9QH 5CD3B 1Y0LB 3DVGB 4FMKA 5I1LA 4OZFG 4I3SL 4G6ML 3GMMA 4Y4KB 5ITFB 2Y9RT 5A16A 1DLFH 4L29B 4GLRI 3PQYD 3RGHA 4ENED 4YXHH 1HWHB 3UTSD 1HSBB 4MJ5B 2Y23A 4NRXA 4HWBA 4WW1B 3OG4B 1OARH 4Z5RA 5JIKA 4D0CA 3D39E 3L5XH 3IDYC 2R2HB 4RAUB 4QRSA 1MHPH 2RFXA 3X12A 4AIXA 3VDAA 2D2OA 3FRUB 5HHQB 5HYJD 5E00B 4FXKA 4JRYB 4UDUA 3VFGH 5ILTH 4ZS7L 4YHNA 2HRLA 1ZT4A 2MOVA 4K7PH 4D2NA 1F4XH 4KGLA 1QFOA 1U93A 2A9MH 3H42L 2BOBA 5BV7L 5EBLA 3TJEH 3P4LA 4MA7L 1S5HB 3QPXH 4N8VG 3RWEA 3TBYB 4ONGH 1LO4H 3PQYE 4XNXL 4NHUB 5DWUL 5HYSG 4PJDF 4XVJH 4FFZH 2X42A 5M95B 1OGAE 4L8DB 4MJ2A 5F88B 1YN6A 4X7FC 4OZHF 3VFMA 3HC4H 5IMKB 4B7LA 1KXQE 2GJZB 1L7TL 1F2XK 4R3SA 2KH2B 2IH3B 1KC5L 3DX8A 3CVHA 1I3UA 4DKDC 5BJTA 2ORBL 3EYSH 3ULVE 4O9HH 1D5IH 3UZVB 1MFDH 5C86A 5F3BA 2X4RA 4U31A 2I27N 3F8UB 4PJ5D 4L4VE 1A5FH 3V6OA 1KF9B 4RNRA 2C3HA 2EIZB 3ESUF 2ZUXA 3SOBH 1L9MA 3GIVA 3LPGA 1D5MB 3P4NB 4ZFFA 4WUUA 3IJHB 5FOJA 3EW3B 3IJYB 1UM4L 3QUZD 3B9DA 4NQXA 5K9OB 4RWHA 1LDPL 4HQQH 3V0AC 4M7LH 3F7YB 4XBPB 4ODTL 3D48R 1N64H 4X7TB 4I77L 2DLGA 5E2WH 3V5KB 1REIA 3VXSE 3KVQA 4LHUG 1EJOH 1KLGB 2NLJB 1HHIA 5E99L 4C56E 1W72B 2H1PH 2R23B 3RBSA 1UB5B 4IM8A 1IKNA 1NBZA 2DQTL 3DTXA 1VERA 2OTUB 3VD4A 3O3EB 4GXVL 1T1YB 2R29H 4MVBA 1H9VA 1DUYA 1XGPA 1KGCD 3HC3L 3QWOB 4NKIH 5KS9B 3P9LA 4OCSL 2LFGA 1AD0B 5ICXB 1ERNA 3U48A 3L7EA 1ZEAL 4NWTH 4XCNB 2OCFD 1EVUA 4WFHE 5CP3H 5TF0A 1ZVSA 5D96C 4NQUA 1YECL 2HJLB 3LVEA 1HSAA 3LKOA 3T2QA 4OZGE 1DEEB 1KCVH 1YNTB 1WC7B 4TNWK 3JV0A 3K1DA 4OF8A 4QEGA 2XG5A 3HE6A 3EYFA 1NSNH 1QNZL 3MRIB 4OCRL 3VXRB 2HTKD 3I50L 5CUSL 5DJCB 5GGVY 1YC7A 5B22A 4KI5E 4HT1H 1VKXA 2X4TB 3PWUA 4NC1C 5BZWB 2B1HH 1G7MA 4RAHA 4HX1A 2DYPB 4V1DD 5D6DA 3BVNB 3ME0A 5DD0L 3OKNB 3VJ6A 4X9BA 1KCLA 5FEBA 1WEJL 3AM8C 5GRZA 1DUZB 2VXSH 2E8YA 1CXLA 4KJPD 2W9EL 1T5XA 4LSRL 3U7AA 4F7CB 2APBA 3OJDB 4XNUL 3UJJL 3U82B 1OSPH 3NOIA 3FN0L 3OKYA 1KG0B 2NY1C 1CICC 3CXHK 5F7DB 5ICYA 4RMUA 3HE7A 2OI9B 1RUAL 5HSFA 1IGTA 1X7QA 4TQEH 1AGCB 1FAIH 2B1AL 2JKXA 4JZOA 4M02A 4JFEE 4UBDC 4O2EB 3OR6B 4HUWA 1MIEH 1RIVH 4MD0B 5FCUH 2ADFH 2BOCB 4LBEA 4YDIL 2YWYA 2B4CL 4HG4J 1KXTB 2DMCA 1YEDA 1MCPL 1QFHA 1FNSL 4XMKH 5IROA 5LCVL 3TJHD 1BLNB 4S1SL 2VDQL 5CHNB 1KFAL 4BFGA 1I3GH 4XMPL 5EO1A 4G9DA 2VDLH 3QFJB 3UMTA 3RWIB 3ZYZA 1SM3H 4QRRB 1FNEA 5F70A 4M6ML 5KVGH 1B6UA 1HXYA 3DROA 5FYJH 5T33L 4GQPH 2PYEB 5C92A 4G6JL 2WV3A 3IFLH 1VCAA 5JPNB 1X5FA 3IVKA 5JR1L 3MJ6A 1I1YB 1JFQH 5TE7H 1T7ZA 2GIYA 1M6OA 4P46D 1TZIA 4HIEB 1DSFH 3MPCA 4KVNH 4Z77B 4NGHH 5HHOE 3MROB 2EZ0C 4U6XB 3F6IA 5E2TH 4Z7WA 2HRPL 4NN7C 3WLBB 3TPUA 1KB5H 2I9TB 2FCBA 3NCJL 3MA7B 5EA0L 1KYOK 4WDIB 5C0BE 3TP4A 2JCCA 2NY7H 4B41A 4HUMB 1ADQH 4NQCE 1J11A 3BAEL 4X4XB 3KPRD 3MMEA 2K7PA 2IC2A 2VAJA 1YMHB 4OBSA 4U1SA 3JXAA 5D2LF 5I1GH 3RDTA 4UMGA 3UTSB 2W38A 1B0RB 4Y16B 2W59A 1HQ4A 5DI8B 5KSBE 5H2BB 3BI9X 4JHWL 4KVCL 3QDGD 4UV4H 3BIBX 5IB5B 2EKSA 2G2RA 3VXOA 3U30C 4BSWB 3LZFL 3FB6B 3QUML 2VKWA 4HJJH 4LCUA 3EJYD 5JHLH 1JWMB 4GKOA 2XTJE 1ORQA 5HYJB 5F9JA 1IFHL 2VDKL 4H1LG 1WUNT 2A6KA 1ZHNA 1AI1L 4XH2A 2A77H 1TXKA 3KPRE 4MJID 3RWCB 4PJBA 3THML 4DFHA 1Z0NA 1GIGH 4X9IA 4XP4L 1V3LA 1QA9B 4UZGA 1A9BB 3V0WH 2EDWA 2MCPL 1KN2L 4Y16C 4N8PA 5I74C 1ED3B 1CG9A 1ZGLB 3O2VH 2DLHA 4YHOH 3IYLW 2Y7QA 4GG6B 5IGXL 2QLVB 5DK2A 1QFWL 2DIAA 3LKQB 4P23D 1KJMB 1F8TL 1GGIH 4IIQA 3MV01 3IDGA 5KSUB 3NVQA 2W92A 4H0IA 4MA8H 5FV1L 2PYFB 4CVZA 5KJRH 5HGAA 1TQCC 5CLTA 4PJ5B 3DNKA 3HNVH 3UC0H 5GS0C 2GAZA 3HMXH 3PWNA 4JRYA 4OUUA 3TBVB 2SEBA 4E0RA 2QBWA 2A6DA 1BD2E 3HPJB 4OSUH 1FZJB 2R0ZL 3O2WH 1FIEA 3EZJB 4DOHB 1F2QA 1FLRL 2J6EH 4NFCA 2Z93A 3T0EA 4F7PB 1F3JA 1BJ1H 5BO1H 2VABB 4WV1B 1MCHA 4BA8A 3E3QE 4P9ML 4JANB 5HHMD 4U6YA 5AZEL 4XRCB 2V2XA 4N0YH 4KPHH 2ENSA 4PJ7E 4UIKL 1RJZA 5HGHA 4NNYA 2R4RL 5FK9A 3T4AB 4Q7DA 3B8SA 3MNWA 2VWEC 2IPTL 4ZNEA 1XF2A 1MFEL 2G5BB 3GKZA 1FO0H 4WO4D 3VWKC 4WI2A 4OF0A 1FFQA 4JO3H 3FONB 3PWJA 2AP2A 3GJFA 1TVBB 3BSZL 4MAUH 4OIAA 2XY2A 2LE9A 5DO2D 4WV1C 3FQTB 4I2XB 4MA1B 2EEDA 3RA7H 3QUYA 5E08L 1C12B 3KPOA 3S98A 4UT7L 1PG7W 3S4SA 1E6JL 2ADGA 3TH3T 4R9HA 3ZSSA 2ZCHL 4OD3H 4OGYL 3CFKB 5EU7C 4XNQA 3U0WL 2P5ED 2IALB 4LLMB 4HH8A 3D85B 2DQJH 1FYTE 2A1WH 3WXVH 5IKCA 3TESA 5GS0H 2ICWB 5DFWH 1GGBH 3WKNA 1U8HA 2E27H 2W07A 1NMAL 4P57B 1JNHB 1PJ9A 1XMWA 2PW1B 4MA1C 1ND0A 1QBLH 1WC7A 5CJOH 1MCSA 3FRPG 3U4BL 3CFBA 1QKZH 1KENH 5DXWA 5EG6C 1FHGA 3LB6C 5C0IA 5IB3A 1JMXA 3B6SB 5JIHA 4Q9QL 4NWUL 2IF7A 3LRGA 5HPMB 3L7FB 2WM0A 2ARJA 1IGJA 4P5KA 3TH2T 1DLFL 4FOMA 5FA4A 5DZNA 3RWFA 1B6DA 4WFEE 2X5PA 1CD9B 5IJVB 5J6GB 2CK0L 2UUDK 3REWA 5CINH 4P5MB 2XWBB 4LVEA 4K3DH 4PJGE 2FLRT 3RNKA 5ALCH 3L5XL 5JOEA 3WO3B 1FG9C 2Q20A 1RIHH 3NIDE 3LPFA 4P3DA 1MHPL 3T77B 1EEYA 3V7AE 3QEUA 3DV6A 1JK8B 5I8OH 4C83B 5A43C 3KPSE 3SKNB 5ILTL 4N0CD 3VGEA 4K7PL 5SV3A 4KRPC 4P46B 5D9SA 4P3CL 1FYHB 3CSPA 1JNNL 3VU2A 3BGMB 1D3CA 2EDYA 3L5WA 3LDBB 5E1HB 3IU3B 4ZFZB 3TJEL 1LO5A 3JSSA 4NO0D 2BCKB 3QPXL 4ONGL 1AXSA 1LO4L 3WFCH 3L3DA 3RBGA 2BDNH 3P4OA 4FQCL 4Y2DA 5F7LB 1XGYH 3W9EB 1G7HB 4GJTB 3WKMH 1R24A 5F3HB 5EORH 2FO4A 3TZVD 4JREB 5H94A 1KCRH 4LPWA 3DUSA 3ARUA 3QAZC 1K4CB 5IHZA 5T1DH 5FUCE 1D5IL 1MFDL 4OI9A 5KSAC 4TTDD 3VG9C 1XF3B 1TITA 5DLMH 3SN6N 3QO1A 3HR6A 3SE9H 1Q9WA 3QDGB 3C2SA 3N9GL 4JFFD 2ED9A 2ICWI 3LKSB 1U3HD 4RFOH 2H26B 1BVKA 1BQUA 4F33B 3DUHA 3SOBL 4ZUSA 1YYMH 4M8QB 1A0QH 3ZSTA 4O5LH 1INQB 2XXCB 3D39A 4R26H 2Y1VA 2LABA 1F6AB 1WBXB 1CDHA 3W39B 4HQQL 3L3JB 3RTQA 4M93C 1N64L 1AHWB 5E2WL 4JREC 4MJIB 4RAVB 1EJOL 1FG2B 3MA9H 1M05A 2H1PL 2HFFB 3L1OH 3BN9D 3QIWA 5CBAB 1RY7B 3DHJA 3H9SE 5DJ8A 1MOEA 1WTGT 2RJMA 5K9QG 1UZ6E 1U8MA 4L3AA 3PQYA 5LBSL 1ZE3C 5ANME 5IQ7H 1WSST 4NKIL 5DI8A 5DGQA 4G9FB 2VAAA 4X6DB 2FIRT 4P23B 5MP6H 5CBEB 4QLRA 3T0XA 3TBSA 3K8KA 3W9DA 1C1EH 1WZKA 3WUWB 1PKQE 5EC2B 5GGRY 1KCVL 1NDMB 5I6XB 1A6AA 1ZSDB 1YZZA 5GRVL 2OZ4A 4TYUA 2X9YA 2A38A 2MQ3A 4L4VA 2L7UA 4HT1L 5CS7A 4XBGA 4X5XB 5D7IF 2B1HL 4R7DB 4YGVB 1KBGH 5MEND 1IAKA 3DVIA 3V6FA 2VE6B 1G7IA 5ERWA 1I3RB 4CMHC 4WWKD 3QDJD 5C0ND 1M7XA 3WD5H 1CS6A 4HUNB 2VXSL 2FSEA 5HHMB 3VXSA 4WI6A 2FL5A 4QRUA 4C56A 2Z8SA 3HNTH 1OSPL 3PL6A 1KJMA 3OAYK 3RVVD 5I6XC 2Z0BA 3VFWB 4MDJA 5EIIB 2QQNH 3VFUA 5HI5C 3QNYB 3VXTA 4TQEL 1FAIL 5DS8A 1GOGA 3NCMA 4WO4B 4IS6A 1MIEL 4EKXA 2CDFB 1RIVL 3WDJA 5IFJA 3FQWB 4XPFL 3KLHC 5F9WB 4IDLA 2CUMA 3MLUH 5DQDH 3QUZA 3QULA 3QDJE 3IKCA 2HVKA 1QP1A 4L9LA 4OZGA 3ARPA 2RCSH 1I3GL 3QO0A 4X83A 1FNLA 5A3IC 5I76B 1I7TA 5C0RH 1SM3L 2MWCA 4GRLA 1YEJH 1A14L 1HXMA 3C2AL 2EEBA 5FYJL 3L9RA 2C4FU 4NO2A 5EU3B 4OKVB 3CU7A 3F12B 4X7CC 1NCWH 3C5SB 4HUKB 1YJDC 2P5EB 5JOFA 2IH1A 5DRZA 1JFQL 5TE7L 4ZUWA 4LGRB 2FATH 3E2HC 4GKZB 4NPYA 3QWRD 1DSFL 1GOHA 1QR4A 3AS1A 3GHBH 4Y5VA 3MUGA 3I6GB 4PRDA 4NGHL 5E2TL 1K5NB 4KJQD 4PTUA 3RY6C 3FCTB 1ZWIB 5D7LB 4K8RC 4EOWH 1BOYA 5DHYA 4LLYA 3BH9B 4MD5B 3WHE1 1HCVA 2NY7L 1JGUH 1ADQL 5CMAA 3MLXH 1EFXA 4JFEA 5CIPH 1JGVH 1VA9A 4JQIH 4M7JL 4DZ8B 5I1GL 1P84K 1UB6B 3L6FB 2XWJB 3OKKA 3VFOA 5E5RB 3BDYH 4V1DA 4FG6C 5DJYB 4C54A 2CLVA 2OXGA 4G8GD 4Z9KB 1KCSH 4P4RB 4FTVE 5GGRB 3MLPA 5C0CB 1LK2A 5E9DD 3H6JA 1NCUA 4U4BA 5HYFA 3LSOA 3UYPA 3SE3A 1JYXA 1U8QA 1DLHA 1CWVA 4ELMF 1MHEB 1MQKH 3LMJL 2V9RA 5JHLL 3FQXA 4QOKD 2AK1L 4F3FB 5JXED 3UX9B 3BPNC 4GBXD 1KPVA 2VXTL 5IW1B 1LO0H 3BPLB 2BNQD 2CIIA 5C3LD 2P5WD 2A77L 2Q7YA 3U36B 5KTEL 1AP2A 1T89C 2XA3A 1MCOL 3M1BB 1GIGL 3GI8L 5EBWA 1YEEH 5HVFB 4NO0B 2IQ9H 2FJFB 3V0WL 1NC4D 5HHOA 3ZLQC 1H3WM 3L7FA 4G8GE 4BUGA 2MJWA 4KROC 4J3SA 3O2VL 3BP4B 1BHGA 4JHBA 3SQOL 3TZVB 8FABA 1QYGH 2JK5A 4YQXL 3Q3GA 3CH1A 3O6FA 5C0BA 2WNGA 1DCLA 4N5UA 4NQCA 4GUPA 4JY4A 1RU9H 1GGIL 1PX4A 2WIMA 4JN1H 2NTFA 4L9DA 4MA8L 4LF3A 2VSCA 2PTUA 1YNKH 5KJRL 4U1KA 5IIEB 1GCFA 2BNQE 3HNVL 3UC0L 4GRMA 3HMXL 3UCRA 4JFFB 1C16B 1T21B 4X6EB 4MAYD 1TTUA 5KSBA 1S7QB 4OSUL 3MRQB 3GMRB 3UTPD 1JRHL 5EO0A 4QHMB 5F9DC 3P77A 3HNSH 4OJFH 4MD4B 1XEDA 5BO1L 3GB7A 4JLRA 3S35H 4NJAH 1XGUA 1S7RB 5J1AA 2VLLB 3ARRA 4N0YL 1OTTC 1LDSA 2NY0B 1G9MH 3KPRA 4KPHL 1P69B 3JTTB 4Z0XA 3S3JA 1MLBA 4JKLA 3NN8B 1ITBB 3C5JA 3O6LH 1FBIH 5H35B 4POZD 1FH5L 4RMWA 4K2UH 1ZLUH 3GMPB 2D7MA 4AENB 4R2GC 4TUJA 1FO0L 3UTPE 1OVZA 4GAYB 3ILPB 4CJ0A 5GZNC 1AH1A 1IM9D 3NIFE 2BNRE 2EC8A 3QUXC 4FQ1H 4JO3L 1QACA 5TE4H 5IHUH 2EC9T 1QO3B 4MAUL 1KELL 5HI3C 3CNKA 3SKOB 5AAWA 3C9NA 3HTLX 4M1DH 3VFVA 4LCCA 3GRWL 3ECBB 2CMRH 4HFWB 2ZOLA 1LEGB 3LEXA 2NY0C 1PEWA 3IF1A 3G6JB 2VOTA 4CAGA 1OP5K 5MENB 3QXAA 4FQHA 3QEHA 1BD2A 2XWTA 3DRQB 4WWKB 1VENA 5I1JH 2QSTA 1P1ZA 2H2PD 3NIGE 3HZMA 3MV7D 4OD3L 5GGVL 2J8UB 2EDQA 3BKML 3FO1A 4N5ED 1D6EA 1H3PH 1UWGH 4Z7VF 2DQJL 2A1WL 3B2VL 4ZYKB 1VEMA 3WXVL 3E3QA 3WN5B 1VACB 2P24A 5GS0L 3C8KB 1T83C 4CNIA 2NY2B 4JHAL 1RI8A 4OLZH 4PJ7A 1QBLL 2GI7A 2ATKB 3BKYH 4LARH 1W0WB 1KENL 3MGTA 4QT5B 3S4SG 5DD5H 4OQ1A 3BE1H 4BQCA 5ID0B 1J9CT 1K8IB 1U8NB 3KXFD 3DUUA 3S34H 3KYMB 5JXAH 3WFEH 5FYJE 4UIMA 1LP9E 2DICA 3CFCL 4F8QA 4V3DB 3X3GH 5K59F 3SKMA 3JV4B 3MCG1 4KKCD 1PQZA 5CINL 4M43L 4K3DL 3V52L 3WN5C 4K3JL 5FF6B 3OAUL 4RZCB 4QXTB 3ET9F 1RIHL 2NY2C 2XZQL 1KB9K 3LKPB 3RI5F 5BS0E 4XMLH 3MGOA 4Y5YA 3TA3A 1RUMH 1UM6H 1II4E 2Z92A 1J0IA 2O5YL 5B39A 1KIPB 3UAJC 2V2TB 5MI0B 5IF0A 2OLDA 5I71B 1FYTA 2Z35A 2EXYC 4Q97A 3SGJC 5FV2A 3T2PA 3WFCL 3G04B 1BGXH 1OY3B 2FDBP 4AYFA 5JZ7D 4KZEL 1XGYL 3BO8A 1XR8B 4JAMA 5EORL 3W82A 5IW6A 1CTNA 3HRPA 4ZSOE 1WFOA 3HUJB 1MVFA 4LSVH 3HZKB 4NQVB 4YHYB 2B20A 1RZJC 3LCYA 4QXUH 5DJDB 1T04A 5T1DL 4PJCF 2BVOB 3VXRE 1J12A 1M1SA 2DTML 1MWAL 4P2RE 5EU5A 3SE9L 3CLFL 3U1SH 3DMMC 3MCLH 1NCDH 3S3PA 5E9DB 4UB0H 4RFOL 5I71C 1D5XA 3VXPB 1J8KA 1YYML 1A0QL 4JM4H 1FRGL 1IGCH 4JY6A 4QOKB 4TNVF 3WIIH 5L6YH 2WWMC 2JJTA 2R1WA 4XP5H 3QA3A 5CSGA 4QTHB 5IHLB 1K5NA 1LE9A 3QDHA 1T20A 1MCIA 4GBXB 3IDMA 2GK0B 3DXAE 3HHRB 2P5WB 4FNLL 2HFEB 5CILH 3L3GB 4PJXF 2Q8AH 3KPSA 5HI4C 5CEXA 5FGBA 1U8PA 3IETA 2AKRA 4PJAF 4WHYH 4YHYC 1DQMH 2CR6A 3L1OL 5HDBF 2PW2A 3MSPA 3L5JA 4QRTA 1NC4B 3S36X 3O3AB 2DWEA 3MGAA 2ZUWA 4J6RL 3BPCA 5J9PB 2WP3O 3I6LD 3MRMB 1I8KA 4GS7B 3Q6FB 5EB9A 1FJ1A 5D5MF 5IQ7L 3BWAB 2HTLD 1UKSA 1I7ZB 1HHKA 1QG3A 1R3JA 2IQAB 4MCYB 1X5GA 5MP6L 3P0VH 4F7TA 3OMZA 2EDOA 4L8CA 3GSRB 4OZ4B 4P2YA 3C08L 2P45B 4QXWA 4UTBH 3VI3E 1C1EL 1BVLA 3MJ8B 1CGUA 2YRLA 3D3VB 2Y72A 1DQQB 3DURB 4JFQA 3MRJB 1IAII 3RY4A 3G5ZB 3QUMA 4NN6C 3QQ4A 3ZHDA 1V3JA 5J8OA 4WW2F 1F3RB 4MAYB 4N0CA 5IOPB 1HH9B 5E8PA 2EYRB 15C8H 5F1KC 2PCPA 5DVOA 3GHEH 4NZUL 1UWXK 4JVWA 1A6PA 1NFKA 3KDMB 5D2LE 1KBGL 1CLYH 2KZ1B 1L7IH 5JHDD 4L3CB 3SDXE 1BQHB 4P3WA 4W70A 2BMKA 3SCMA 1MELA 3AREC 3KYOB 2EYTB 2VMFA 2YK1H 4G43A 3UTQA 3JTCA 4HLZG 4OZHB 1H5BB 3EKCA 3RWJA 3VFTB 1H0DB 4Y19E 1CFNB 3HNTL 3GSNB 4WCYL 3VFSA 2E6QA 1JNLH 2PF6A 3CFDA 3VD9A 4JFDB 1T1WB 2W1NA 3QIUD 4U3HA 4JPKH 2NXZD 2QQNL 3H9SA 1UXSB 4NJ9H 2K9UA 3KR3H 4JGMA 3CSYA 3ARFD 3EUUA 2IGFL 1CDCA 1Z9OA 1BFVH 3LKNA 4P48A 5ANMA 2NZIA 1U3HA 3FOLA 4NOBA 1IM9B 4ODWA 1P4IH 5JHDE 4J3TA 3MRQA 5LXGH 3MLUL 5T1KD 5DQDL 4XGZA 1T22B 1XCTB 3RNQB 3TNNB 4Z0BL 1PKQA 1L6XA 2RCSL 4J1UB 3T0VA 2DBLL 2XY1A 3ARZA 1CFSB 4U1JA 5DA0B 2V5SA 2VR4A 5C0RL 1UA6L 4JGJA 3ZYJA 1YEJL 4CGTA 1GL4B 5ITBH 2W65B 4KQ3L 1P2CA 32C2B 3MV7B 3U7YH 4XHQA 2D3VA 4JN2B 2B2XH 3EJZD 3KHQA 4BH7B 3SDCA 5J0BA 4HZAA 3STZB 4IHOA 2X4QA 1RSFA 3NFSH 4XCEB 1FSKB 1ZLWH 2ADIA 2PO6A 1IZKA 4OFYA 1EO7A 1G0DA 3KPQA 3WNKA 1HE7A 4O00A 3LN5B 5CGMA 1A3RH 3DARA 1KB5B 3MLXL 2D9QB 1OAUH 1UADC 4B50A 1M7IA 2C7UB 2HT4D 4U1GC 5J4MA 1JGVL 1FDLL 2Y4SA 3GUTB 3GMQB 4JQIL 5AD0A 3KXFB 1ZTXL 1TJIH 4NC0B 1AE6H 4BZ1H 3DGCR 2DQFB 3OTTA 3QDJA 4YJZL 2VWEE 4R96A 1KCSL 5D4QA 4DAGH 1BAFH 1MLCA 4RBPH 4DOHE 1N8ZB 3OXRA 2XIDA 5DSCB 2DB8A 3KS0H 1F6FB 3LD8B 1Q72H 3O3DA 3X14A 1MQKL 1VACA 1KCUH 3W11C 1RMFH 1HOCB 4E41E 5IVXE 1FGNH 4HXAL 4UQ2A 4IRJD 5C0DA 3RWGA 1UENA 2VQ1B 5HYQB 2EDKA 5IMMB 1YEEL 4IMKC 3GSWA 3ALPA 2ICEA 5D2NC 5E1AA 2IQ9L 1LO3L 2J4WH 4IRZH 4QHKJ 2DQDL 4XWOC 5C8JB 3IDXH 4U3CA 5EU7E 3MRCA 3P0GB 2UZXB 4ZO7A 4PV9B 3T4YA 1R5WA 1QYGL 4Z18A 1L9NA 4JB9H 4PJEE 4LSTH 4PP2A 4NUJB 3V6BR 3U9UB 4O58H 1MJJA 1J05A 1WWBX 4RRPA 1YJDL 4JN1L 1NMCC 1MCCA 2XKSA 1YNKL 2CRZA 5CEYB 5I1DA 2C3XA 1HINH 4LEXH 5ALBH 3T65B 1NDGA 3M07A 3ARGD 3VRJB 4G7VH 4X6CE 3QWRA 4WU5A 1Q9LB 3QCVL 3SDAA 1UH2A 4X8JA 2R2EB 5CGYD 1LEIA 4JZNB 4UOJA 2HP4A 5LG1A 1A1MA 3HNSL 3D9AL 4OJFL 1A2YA 3LS4H 2JJVA 3SKUD 4GOSA 3S35L 2ESVE 4NJAL 2FBOJ 3BZEB 4I9WD 2A73A 5I1KL 3PUCA 4HK3J 1OLLA 2O5XH 4JRXE 4S1DC 1G9ML 5MEQA 4LLQB 4MS8A 3WFHB 1DTUA 5CJBA 5C71A 1LEKB 1SVZA 3O6LL 1FBIL 2H8PB 1CVSC 5A1AA 2BVOA 4K3EL 3BXNB 4G8GA 3HLAA 2V17H 3IFPA 4AIOA 1BFOA 1YN7A 3SPVA 4QGYA 4MHHI 2CUHA 4KGJA 1N0XH 2RBLA 4EQ3A 5TE4L 5IHUL 1P4LB 3AAZB 4NM8H 4PRPD 3IAPA 4M6OL 4MXVF 1JFMA 5FKPB 5DJ0A 4Y88A 2R0LH 3KNBA 5E2VH 4XAWH 1ZS8B 3T8XB 2BNQA 5CZVH 2G5RA 4MNQD 3MRPA 4LFHD 5D8JH 3PHOA 2JIXD 3H2WA 5KVDH 1IC1A 4S11A 5I1JL 3O3AA 1EHLH 4I4WA 3TBWA 2AJUH 2X1WL 1GGCH 3RKDD 3EOAB 2UV3A 3MFFB 2LAGB 1KIRA 2MNUA 3OKEB 1EUTA 4XB7A 2F74A 2IFGA 4N9GA 4ZDHB 3O2DH 3ULSB 1IC5H 3L3IA 3TVMB 2VSDA 3QIUB 2KQMA 2FECL 1N3NB 4TUKH 2NXZB 4OLZL 4CADA 3LQAH 5MEOA 5CP3A 4PV8A 3ARFB 4AJ0A 4CU7A 4Q6YA 1CN4A 3HAEH 4PGDA 4OLUL 3BKYL 2M8XA 1KCKA 2E9WA 1HH9A 1IARB 2WBJD 3P73B 1EHXA 1RFDL 1OQXA 3OGOE 2W60A 3S34L 1HCFX 2BNRA 5JXAL 2DLFH 3O0RL 3WFEL 4MMXC 4LNRB 3X3GL 4NO3B 4PJDA 2FJGB 5FYLD 4HKBB 4TSBH 3MLZH 4D0BA 4HZLA 2H45A 3TVMC 1U6AH 3W0WD 1AGFA 2P7TA 4PBVC 4OV5B 2QSCH 3AS3A 3MCKA 4XMLL 5DRXB 3K0WA 3OF6D 3QXUA 1Y18A 2YHGA 3BQUD 5T1LA 1OD7A 1UXSA 2DF3A 3TIEA 5FYKU 1C5DB 3RPIA 4NBZB 3GIZH 3OB0H 1VPOH 4Q6IB 2A6JA 4J4PC 3JTSB 5IBUB 3HS0B 4NN5C 5C0JB 4URTB 5LAXB 3TFKA 1FVEB 3KPLB 5ECJE 1ES0B 2A6IA 1BGXL 1EXUA 4Z7QF 3V4UH 5D6CB 1P7KB 4YC2B 4APQD 2Z31A 4XZUA 1TMCB 4BYHA 1OAKH 3KPNB 2DQGH 4AM0B 3EYQC 4XPBH 2OL3B 4IRSA 2R8SH 5J06A 5BOZG 3IFOB 3ESVF 4LSVL 3RVUC 1K8DB 2L0DA 3VE0B 3EO9L 4JDVA 1CFBA 4PJ8C 2HMIC 2QQQA 4GW5B 1A4KB 5E4EB 4JO1H 1WIUA 1LP9A 1OTUD 3QH3A 4HK0B 2OP4H 1YEKL 3BIKA 3MCLL 1CGTA 4Q6IC 5H37H 5B39G 4UB0L 1A7OH 1MPAH 5EDXA 1IGFH 1ONQB 5CCKH 1UXWA 3B9AA 4OB5L 2XNAB 4JM4L 5F72S 1IGCL 1BJ8A 3EOBB 4C58B 3WIIL 5L6YL 4XP5L 5F6HJ 5HHNB 1T1XB 5DRWB 4YC2C 4BFEA 2QQLH 5BS0A 4BELD 1BEYH 2I26N 2F53D 2VDRH 1H15A 3IJSA 5CILL 1GZQA 4LVHC 2NPLX 3X13A 4NC2B 3R1GH 1DQML 3OKLA 5DJZB 4F2MB 2AJSH 1BX2A 4HUVB 3EYVB 4RDQF 1ADQA 2FYYB 1U8JA 2IADA 4XB8A 4Q2ZA 4ZODA 3C6LD 2ZUVA 3AM8A 5I9QB 3UO1L 4ZAKC 4YDVA 3LH2L 1R6VA 2FHBA 5DQJA 1XCQB 4CW1B 3P0VL 4JFHD 4NSKB 4OF7A 4M1CD 4MJ6A 4ZSOA 4AIZA 2Z91B 4UTBL 1BBJA 1MREH 1CICA 3N1GC 3V7AG 2F53E 2E8ZA 3O4LD 1JWUB 3ARGB 3QXDB 3RUGB 1T5WA 4P2RA 15C8L 3GHEL 4Y2OA 1NEUA 1S9WA 1I8LA 1CLYL 2OJZH 4LKCA 5F21B 4H25B 1AGBA 2CGRH 4I0PC 1JV5B 4RX4D 4OGZA 2ITCB 4G80A 1SY6H 2Y36H 1UC6A 4O2FB 1L6ZA 3DXAA 3TN0D 4EVNB 5GRXG 4A6YH 2VH5H 2DM7A 4R7NB 4UNVA 5B38A 3KPPB 3F7VA 5HVHB 1EJ6A 5D7LE 5CKAA 1JUFA 1MAMH 1JNLL 2Q8BL 4HIIB 1CGWA 4Z7NF 4YIQB 4JPKL 1MVUB 1CI5A 3KR3L 4PY7A 1K4DA 4M8VA 1DVFC 1OAZH 5INDA 3EDDA 1LWRA 2UWEE 1BFVL 5FKAA 2NW2B 1HZHH 3QWQB 5F1OB 5E8DH 4XX1E 4LAJH 1P4IL 4QRPE 4Z95L 3HMXA 5LXGL 3DX7B 4PRPB 4PIRF 3T2OA 1ZAGA 4JZNA 4Q9RH 3GBNH 5GSVB 1IM3B 3KWWB 1SMOA 3S96A 2Y5TB 3VFPB 3LHPH 4MNQB 3U0PA 1QSFD 1U36A 5HVHC 4HDIA 2CDEA 3RJDA 2JIXB 1RURH 4PR5A 1EEZA 3RGVC 1KTLB 4GMSH 2AGJL 5D2LA 2Y25A 5HD8C 3PP3K 1JHKL 3O45B 3U7YL 3SDXA 4PRHD 3QT2A 2AS5M 2B2XL 1LD9B 5SWZD 4Z7WF 3ZE1E 4PRBB 4PUBH 1H8SA 3NFSL 1AIFB 2FX7H 4GO6B 5KAQG 4E42A 3BRFA 4Y19A 2VXQH 2JCCF 2Z4QB 1FO0A 1T80A 2YPLE 3MBED 1MRCH 1G7LB 1A3RL 2VL4A 1G9NC 1TFHA 3CUPA 5IFAH 1KTDA 4M6NL 1KIQB 1OAUL 3OJMB 3BT2L 2AEPH 2GJ6D 3QZWA 2N7AA 3GRWA 1T4KB 4S1QH 5D7IB 5F1NB 4Y1AE 4XBEH 1TJIL 5DJ2B 5JHDA 3BP7A 4XVTH 4PRHE 1G6RH 2VYRE 3V95A 4YBLC 4DAGL 1BAFL 1KLFA 4DW2H 4UINH 3W0WB 3VRLE 3TV3L 1Q72L 1YEIH 2CKBB 4GH7B 2X4NB 1FFPB 1KCUL 1RMFL 1UVQA 1TLKA 3BQUB 4PJBF 5JO5A 4KKNA 4KRMB 3B3IA 3NACH 1FV1A 1FGNL 4KQ4L 5EU6D 5IWLA 3C8DA 4P4KD 4MNHA 5BQ7A 4UV7H 4E9LA 1Y6KR 3MRRB 2LTQC 1NGWA 1CFQB 4JQXA 4HKJA 1TCRA 1KT2A 5T1KA 4KK6D 3IDXL 4XHJC 2DOCA 5A2FA 2EH8L 1RZFH 2RB8A 4APQB 1DL7H 2GSIB 5I18H 3W5NA 4QF1A 3QI9C 5GGSA 4JB9L 4LSTL 1ZHLB 2VUOA 3VXMB 4M00A 3MR9A 4O58L 2I9LA 3OWEA 3WHXA 1GPOH 3CDGA 4U6HA 5F96H 4WFFE 4EDXA 3QHZH 1PEZA 2VLJB 3I6KB 5EUOE 1T7VA 2R9HD 1T7WA 5DUBB 4JJHA 1HINL 4KV5F 4LEXL 4YO0B 4EUPA 5ALBL 1XF1A 4X9GA 5A2LH 5HBBA 3VWKA 4G7VL 4FABH 5C3TA 1CVRA 1T2XA 4PG2C 3MNZB 5C0JA 1T03H 3GSOB 3LS4L 2DWDB 4E41A 4GRWB 5IVXA 4X5WB 1B0GA 3I9GH 4AMKH 4HH9A 3V0VA 4ZUTA 5DHXB 2O5XL 2J88H 3TO4D 2FEEL 4RRPG 3I02B 4X99B 1A7PH 3TNMB 3MO1B 2ZSWA 4OLXL 5KG9B 5GIRB 3GSVB 3WBDA 1JPFB 4HEME 4PJ9D 1NKRA 4YAQB 3KJ6H 1MWAA 2OSLB 1RZIB 3PGCB 4HGWB 1N0XL 8CGTA 4ELMB 2QKIA 4M61B 3EO0A 5ICZA 3OKMA 4N0UE 3NABL 3FOMA 4FQPA 4NM8L 2VISB 5GSRB 3ARBC 4UAOB 2B0SH 4WHCA 5I30H 5EC1B 4PREA 4JFYB 5EN2B 3QIBD 3O4LB 2R0LL 5E2VL 3O9WD 4XAWL 5JDSB 4IRJA 5ADPH 3GSUA 4XNMB 2FHCA 5CZVL 4ZQKB 3KPMB 2Z8VC 1I1AD 4XCYA 1UACH 2YD4A 5KBNC 1EVTC 2DDQH 1MI5D 3EYOA 5D8JL 4M4RA 4F58L 1YMMD 2CK2A 4JDZA 4X6CA 2GW5A 4F2MA 3BKJH 5DUMH 5C2UB 3FTGB 1FCGA 3F7RA 1F3DH 2AJUL 3DIFB 5LQBH 2QSQA 1GGCL 3RX8A 3CJJA 5EZLA 3REVA 4JM2B 1OHQA 3F6LA 4L8SC 3TN0B 4AT6B 4CN6A 3D0VA 2ESVA 3WL9B 5HJ3A 1U58B 2G9HB 2YBRB 3O2DL 1IC5L 2NYYD 4JRXA 4LLUB 4NNXA 4Y5XC 1J5OL 1KACB 4FFWC 1IGYA 4TUKL 1CZ8H 1CD8A 5L2JA 3BH8B 3LQAL 5DVMA 3PV6B 4NOFA 2VL5A 3BYTA 2E3VA 2MHAA 3EFDH 3BUYA 4X0KB 5BVJA 1MH5A 1SYVB 1HQRA 1DQDH 2A74B 5CZKA 4I8DA 5EOCL 1HDMA 1V7MH 3CC5A 1GOFA 1K2DB 3K8LA 1UJ3A 1NCCH 4JM2C 5C9JA 1IAIM 4Y0GA 4DKAA 5HY9B 4LPTA 1MNUH 1GXEA 1QSFB 3MLZL 5K33A 3MV8B 2NY5H 2NY6D 3MACH 5JOPE 1U6AL 3VD5A 4J3XA 4WFGE 2QSCL 2CLRB 1BZ9A 3KYNB 1RJLB 1ZA6A 4PB0H 2V2WA 2ZUSA 4G8FB 1ZT7B 4POYA 5ACZA 5DZLA 3ARWA 1I4FA 5SWZB 1JGEA 3QJHA 3GIZL 4HWZB 1INDH 4JFXA 3P9MA 2J3SA 3NFPB 4AH2A 4TOYH 4HS6A 4Y4HC 4LU5H 3RI5K 2OR7A 4ZNCD 1BQHG 3MBEB 5DHVA 1IAOA 3V4UL 3VXQB 4EI5B 5CJQH 3ZT6A 3ROOA 1LO2H 1OAKL 2DQGL 3OX8A 3RHWK 4LLVA 2R8SL 2GJ6B 1R5IB 4HKXB 4OZFB 2ZSVA 3BPOB 4MCZA 4ACPA 3PWPD 3BUTA 4BSJA 3C60D 3RVXD 4NT6A 2DJSA 1FC1A 1T66D 4V2BA 5IMOB 2FWOB 4IMLA 1IE5A 5DJ6A 3DSNA 4JO1L 2VIRB 3VXUB 4JE4B 3B83A 3HMWH 3G5XA 4HV8A 2OP4L 2FLBT 4ORGB 1A7OL 4JPIB 4Z7VB 5E6YA 4ESKA 1IGFL 5CCKL 2EYSB 3PGDA 2BY2A 1I8IB 5ESQB 5E94B 3FT2B 3RAJH 1QRND 4BJLA 3FO0H 3ETBF 5C0FB 3NFNA 5ID1A 4EI5C 1ZA3B 1JPGB 2Y06H 3FFCE 2XFXA 1BEYL 5FXCH 5EU6B 2VDRL 1UZ8A 1KJVA 4P4KB 4UT6L 3M45A 4HBCH 4JFDE 3R1GL 4O2CB 1N7MH 1U8OB 2WBJA 5BOPA 4TNVK 5HYSB 4U0RC 4ZTOL 2P49B 4EI6B 3FQRB 3CK0H 5CIPA 4HJ0D 3TF7A 2R1YB 1PKOA 2LVCA 2VITA 4GW1A 1AO7D 1ACYL 5KVMC 2APXA 2P8MB 4LASH 3RIFF 5IB4A 1KXVC 3ULVF 2EDTA 2XPGB 3OKOB 3W0WA 1M7DA 1BF8A 3CXDH 1MREL 2OBGA 2XN9D 3G9VA 4CJ1A 4HIJA 3GJEA 4P2OD 5C0EA 3B9KD 2AXFB 2OJEB 1X4ZA 5TJWK 4Q74A 3C8HA 1G7QB 4OCNC 5IB1B 4XPTH 5EO9B 5DYOA 3H0TB 2APWA 4KJYA 2CGRL 1JPSH 1HHHB 3HR5B 4LSPH 4JZJC 2R56H 4NZTH 4TSCH 4XXDB 4LHUB 1ZLWK 1QSEB 4GAFB 1ZHBB 2HLFD 4G59A 1WFTA 4GSDH 1SY6L 3DX6A 1JHTA 1DDHA 1CF8L 1GGUA 2Y36L 4QY8B 3RZCD 2GSIA 3Q5TA 5DEZA 3GK8H 3TO4B 2VH5L 2DS4A 1X3DA 2VDMH 4NNPH 2EO1A 1MFBL 5DR5H 3MRNA 4LCIH 3RVTD 2R9HC 2WIIB 1I7UB 4EBQH 2XYCA 2F54D 4PJCB 1BECA 1GGYA 2BY3A 5HYEA 3EOTH 2AJZA 1OAZL 3VMNA 4YR6B 4PJ9B 1CT8A 3E2HA 1HH6B 4UOW1 5E8DL 3RL2B 4HG4K 4PLNC 1NGXB 1MFCH 1A4JA 2R0KH 5D2NE 4RBPK 2A83B 3DETC 2PXYD 1UH3A 4NQDD 1OSZA 3QQ9C 3C6SA 4GG8B 1Z3GH 2QJDA 3CVIH 3GBNL 2EC9U 3QIBB 5D1ZB 4F37F 1XIWB 4HIHB 4YPGA 4KI5F 1CXFA 1S9XB 2F53A 4PJXB 2Q3ZA 1I1AB 3MTRA 4DKEH 4S0SD 5B38G 4PJAB 5GGUA 1T0MA 3O4OB 4I3GA 1MI5B 1RURL 1YMMB 1ZHKB 3E6FB 2DQIL 1CE6B 4GMSL 1KEMH 3GGWB 4NKMB 3IXAA 3GMLB 3HZYB 3C6LA 5SWSD 3ZKXC 2ZPKH 1R3LA 5D5MB 1BJ1J 2XI9A 3L3KA 2BSTB 4B53A 2F9BT 1WF5A 3PIQB 3W2DH 2IANE 3D87B 1QEWA 5MEPA 4PUBL 4DUXA 1AXTH 2EO9A 1UWEL 1EAPB 2FX7L 5I66B 1E4XH 1S7TB 4KKLD 5IV2A 5D1ZC 1DE4B 4BFIB 5KSVA 1XIWC 5EFIA 1KTRL 1MRCL 1NGYB 1V7NH 2QADC 1S7UB 2H6PA 4L8BA 4PBWD 1F45A 5E8EA 1OP3K 4WW2B 5EU4B 1I1RA 4O51A 1P5UA 1TNNA 1JPTH 4GT7A 4WRLA 4F57H 4LMQE 1T89A 2AEPL 4CRPA 5IFHH 2UWEA 5JW4Q 4WJ5B 1MJUH 1PYWB 2A0LC 2NZ9C 2WINB 5DD6A 3V6ZB 3UDWC 4QRPA 4XBEL 3G5YA 1F4WL 3U4EB 3MRFA 4XVTL 5DMGC 1G6RL 4X4YA 4ODUA 1SJHA 1OGTB 5DURB 1SYSB 1D9KB 4L3EE 4AT6A 4DW2L 1IEBB 2NY6B 3BHBB 4EN3A 4UINL 3Q48A 3G6AA 1NCAH 4KMLB 3PWLB 5EIQA 1YEIL 3HG1B 3A0OA 1VGEH 2PETA 3NGBB 1OF2A 5CFHA 5C08D 3FT3A 4MXVE 5E8OB 3MRGB 1IRAY 2QV2A 3Q5YA 2C5DC 2VC2L 3OZ9H 5ADOH 3AUVA 5FDWA 2NCMA 3O81A 2R39A 3S5LA 1WZMA 1KJ2B 4V3EB 1CTOA 3QZWG 4LCWD 4U1NA 1XGRB 4MXQC 4UV7L 4OUOA 3FHQA 1NFDE 1CL7I 4X7EC 2B5IB 1I8MB 1CLOL 3TO2A 3C5ZA 4X8XA 4BKLB 3KLAB 3HPLA 1RZFL 4MZ3A 1D9KC 2YPLA 1DL7L 1ZLVH 3O8XC 4JJ5B 3NA4A 1J7VR 2LVEA 3PWPB 3U6RB 2WBKA 2VQUA 1ZXQA 3C60B 1GPOL 2CXKA 4Y1AA 1R3KA 3QHZL 3K46A 3TT1H 4RISH 1IC4H 1UG9A 2BVPA 3D18A 3MLSH 2KPNA 4PRHA 3AMKA 2FJHA 4LCWE 3EGSA 3OR7B 3TBTB 5DD1H 4BSVA 5TE6L 4M9PA 5DMKB 1MUJA 3FB7B 1VSCA 2B5IC 1QRNB 4FABL 3VD3A 1XZ0B 3QUXA 1QR1B 4XI5C 2KL6A 1WBYA 4LSUL 4H1LB 2X09A 3DX9B 4HF5H 3NZHH 4XT1C 4KJWD 3QJFB 3OJ2C 1ZKAA 1T03L 2AK4E 5FCSH 4KC3B 5F89A 3GSXA 5EBMA 4I48B 3I9GL 4AMKL 1RZ8B 2J88L 4QWWC 3B5GA 1SEBB 1A7PL 1HYRC 3ZTJH 5TF1L 3OHXB 2XRAH 3L95B 2FIKA 1AO7B 4CVXA 2WANA 3CCHB 4HS8L 7CGTA 1WVZA 4XP1H 4GQ9H 2XICA 3JWDC 4OD2A 4WUUD 1QBBA 4HGMA 2BVQB 3P2TA 3V4VH 3MUY1 5B21A 3P40A 3KJ6L 1I7RA 5DEFB 2YA2A 3QHTC 3HI5L 1CDUA 1I9EA 2XN9B 5DVNA 4S2SA 4P2OB 4LGSB 2B0SL 3B9KB 2BHYA 3X11A 4LKXB 5I30L 1IVLA 2NR6D 4TVPD 4BZYA 4UUJA 5D1XC 4BQ8A 1NAKH 2W9LA 5EUOA 4HMDA 5ADPL 5CEZH 2GYSA 3SJVB 4I3SH 1U2HA 1UACL 2DDQL 4PBXA 3BD3A 1SJXA 2V7HA 4MVBD 1BWMA 3QQ3B 2H32H 5DUML 2NNAB 3BZFA 1FGVH 1U8IA 1VGKA 5LQBL 2HT3D 3RZCB 2EXWC 1T1ZB 1NH6A 3ZT5A 5M7QA 1G7PB 4GXUN 1E4WH 2CRIA 4PJ7F 1MJ7H 1HEZB 2FBJH 2RIKA 4P2OC 3HE6D 1XGQA 2F54B 2CJUL 1CZ8L 2GKIA 5L2KD 2AJYL 1GHFL 3FB5A 5J6HA 3H7LA 4NQED 4DUVA 3H42H 2D7QA 1O5DT 1WAAE 4W4NA 5BV7H 1EERB 1E4KC 5J89A 3STBA 3AS2A 2ZOKA 1QLFB 1DQDL 3SO3C 5BZDB 3HAEB 2PXYB 1NLBL 2E9IA 2L7JA 4NQDB 5KVFH 2IFFL 1V7ML 2HLFC 3MV9E 3SGJA 2OQJB 4N0UA 2G60L 1R5VA 4OGAC 1UEYA 1NCCL 1B3JA 2Y6SC 5I17B 4P5TC 1MNUL 3K1KC 4DCQA 2X4UB 2IBZX 1U95A 3BZDA 3RVTC 1KC5H 2NY5L 4ELKB 3VH8B 3BMWA 2BJMH 3MACL 3TO4A 2X9XA 3HE7D 2XKNA 3WS6C 2CLZA 3D0LA 3JWDH 1G9EA 1A1OA 4JKPH 3ES6A 4NQEE 5SWSB 5SX4H 4HWNA 5IVZA 3QP3A 4JKKA 3DMMA 1NEZA 5FECA 1Z0MA 1QBMH 1INDL 4PJ9A 4PGEB 5MHSE 3TWCH 4OZIB 2MSPA 4TOYL 2Z8RA 2ITDA 2A83A 4L5FH 4LU5L 3TYGH 1BIIA 4OCYL 1FFOA 3LOWA 1K85A 1U3YA 5E99H 4AEHH 4G3YL 4JHZA 2ATPB 5JW3H 3O9WA 3NZ8A 2BSRB 3VGGA 3T1FA 1LO2L 5BRZE 4M3JA 1HILA 4CU6A 4DK3A 5DFVD 1RV6X 1OPGL 1TTFA 4HEPG 4GXVH 5I16A 3DBXA 3FAXA 3QR2A 3WXWH 3AY4C 5EOTB 3OAZK 4RQQA 1X9QA 2YN3A 3HMWL 5CSZA 4PJGF 1Z5LB 5JQ6H 2LAAA 5I8EA 5J7CC 4WTXA 1XR9A 3NIDF 1FZOB 3ZMRA 1FNAA 4HUXB 5CWSB 1D5ZB 4G7YH 2QR0A 1NAMB 3FO0L 5EULV 5C08B 3LY6A 5D7JC 2PR4L 2VLME 1QNZH 2Y06L 5F7YC 4NRYA 5D1QC 3I50H 3UTTB 3ZDZE 5I1LB 1WK0A 3O11A 4JPWH 3SY0A 3GMMB 5A16B 1U3ZA 3RWHA 4H88H 4HFUH 3MRLA 1N7ML 4LFHG 5DD0H 1X44A 4NRXB 1H8NA 2GCYA 5I1HH 5I0ZA 4Z5RB 1OD9A 1P53A 3CK0L 4RIRA 3OGCA 4UTAH 1ZT1A 4D0CB 3AREA 3CD4A 3SGEH 3FN9A 4FXGA 4QXGH 3CMGA 4I18C 2CIKB 4KKBD 4YK4C 2NW3A 5ISZD 3GFUA 1XH3A 3ULUC 4QRSB 2RFXB 3X12B 4LASL 2H3NA 1YEFH 3AC0A 3FN0H 2VLRE 4GFTB 4FXKB 4UDUB 1ZGLP 3D1MC 4YHNB 1ZT4B 3CXDL 2B1AH 1U93B 1YQVH 4HIXH 2BOBB 5E8OA 5L9DH 1T6VN 1G84A 3ORJA 5EBLB 3TIDA 2ZUTA 1JF1A 5TH2A 1I1FA 3L3HA 3RWEB 4D9RD 3CDCA 2FEDC 2BSSB 1TQBB 3CIQA 4YX2H 3IS0X 4YXLH 5CJXA 1YN6B 2IPKA 5DMYA 1JPSL 4P49A 4LSPL 4TSCL 3VFMB 4XMPH 1DBBL 2FNBA 5ISZE 1GRWA 1MF2H 3ZKMC 3FFCA 4LDOB 4R3SB 3E6HA 4M6MH 4HULB 3DX8B 3CVHB 4XVSH 1OTSD 5BJTB 3ZTNH 2VDML 3SGKA 5F3BB 1C8PA 2QTEA 1BMGA 4G6JH 1NCNA 5DR5L 1QFUH 2X4RB 1UFUA 1UZ6F 3CPLA 2DQHH 3AMLA 3C60A 2C3WA 4EBQL 4RNRB 4RCAA 1AR1D 1A7RH 4NQSA 3EOTL 3GIVB 4ZFFB 4WUUB 4LP4A 4WTZA 1MFNA 3MJ7A 4PYGA 3D25A 1CDIA 4NQXB 1MFCL 2HRPH 2WUCL 4RFEA 3HC0A 1WITA 5FOBA 4NYLA 4KJWC 3Q6GH 3T0ED 3GZKA 1Z3GL 4I5BA 3CVIL 1HHIB 4I0KA 5FGCB 1GZPA 1V3MA 5TQ2L 2A9NL 1PG7L 4PJHE 1A1NA 1I9JH 1NBZB 1JZ7A 1BZ7A 3DTXB 4DKEL 2CPCA 3FB8A 4HD9A 5D71H 3V6OC 1RJYA 1DUYB 1XGPB 5C0AE 2AJ3A 1KEML 3P9LB 1NL0H 3ARSA 1JYWA 3L7EB 1CFVH 2UYLA 2ZPKL 3WNOA 1ZVSB 3QYCA 2X1PA 4P2QD 3QNZA 1HSAB 3LKOB 1VB9A 5L0QC 3W2DL 5IBLC 4MDIA 4LOUC 2DRUA 4FZ8H 3HE6B 3EYFB 1MY5A 1E4XL 4K7PX 1IFHH 1VFBA 5KANI 5L2KB 3H7BA 3QUYD 1AI1H 1J10A 4ERSL 1VKXB 3THMH 2EDRA 1BIHA 4ZFOA 1CQKA 1G7MB 4HX1B 3UPRA 5K93A 1JPTL 3B4NA 4F57L 5HHPA 5B8CC 4MVBC 3VJ6B 5IFHL 1KN2H 5L8JB 1MJUL 4IMKA 4HK3N 1ACZA 1RULL 5D2NA 5DJXA 2AJXH 2Y07L 1T5XB 4NUGH 4MLIA 5TDOA 1O7VA 2WWKT 4P2QE 5K9QI 5IHBA 2VDPH 4HS3A 2AV1A 1JNJA 3B2UD 5ICYB 3HE7B 4XTRD 5E2JA 5T3ZL 4NKOA 1IGTB 1X7QB 2EDBA 1VGEL 4JZOB 4NHCH 5B3JE 3BEWA 1PFCA 1RPQA 3RVWD 1OCWH 4HUWB 3BKCH 4KHXH 1T6WA 2EDHA 1T0PB 2XZZA 3O2DA 4KAQH 5DD3H 4LBEB 5ADOL 4OM1H 5IR1A 4MNGE 5D6DC 1H3UA 1YEDB 2D31A 7FABH 4AEEA 1T2JA 4QHLA 4UOW0 1CGVA 4XX1G 2HG5A 3QCTH 4J12A 2IANA 3KJ4B 2FB4H 4FQJH 1Z6JT 5EO1B 4G9DB 3EIFA 1FNEB 3U0TA 1P4BH 4XPGL 2YA1A 2I07A 1N2RA 5AZEH 4BQBA 1HXYB 3ARVA 3DROB 4H8WC 4M3KB 5TGBA 4UIKH 1U2CA 6FABH 4I0CC 4ZPVA 1S78D 4PP1C 3WEXA 1M6OB 3OPZH 1TZIB 3TT1L 1IC4L 3MLSL 1PZUB 4Z7WB 5GS2H 2IAMC 3H9HA 5GZOC 4L3EA 3KJ4C 3LQZA 3TPUB 2ERJC 1JTPA 3AU1A 4Y2DD 5ESVA 4FHBD 3QPQC 2C26A 4HF5L 3NZHL 2CRYA 2JCCB 12E8H 5E08H 5DEGA 3MMEB 4U1SB 4UT7H 2GJJA 1YY8A 1TVDA 3RDTB 4E5XA 1PY9A 1VADA 2BC4A 1NGZA 4R4FH 1MCFA 1HQ4B 5F7WC 1FZMA 3EZ8A 4ODVH 1NFDA 3U0WH 5E6ZA 1W8OA 2P1YA 2EKSB 2G2RB 4YHMH 3VXOB 4YEFA 4HKZA 4LCUB 4XP1L 4GQ9L 4ZXBC 4JQVC 2WBWB 3X17A 1J1XL 3D39D 2ZNXA 1ORQB 4NRZA 3RY5A 5F9JB 1NMAH 3RTQD 2A6KB 1ZHNB 2R2BA 4JFPA 4XH2B 1D5BA 4PJBB 2NXYC 1AGEA 4XNYL 5J3HD 2JB5L 4U0QB 3RDTC 1NAKL 3GJFK 1XF5A 5CEZL 2H9GA 3GNMH 3QIWD 4NWUH 4LCWA 3VGAB 1UKTA 1WZLA 1CG9B 2JELL 3FO9A 2Y7QB 3UYOD 2CK0H 3MLWH 1OGAD 1HHJA 2X40A 1KOAA 5DK2B 1FGVL 3M8OH 2AQ2A 4Z76A 1JZ4A 2HWZL 3MFGB 4V2CB 5F7UA 2AK4A 3ELAT 4IIQB 2CIKA 4ZOAA 3IDGB 3K2MC 3MRDA 1J0YA 3PXHA 1JN6A 3MC0A 3KYKL 4KK5D 1E4WL 5FYKL 4WI8A 4CVZB 2NY3C 1MJ7L 5HGAB 5EZOH 4OV6F 5IT2H 2FBJL 2KQNA 3ULVD 2GAZB 4JO4H 3PWNB 3RU8H 3T0BA 4OUUB 4X4ME 1QLEH 2SEBB 4E0RB 4KY1L 1TVHA 1VESA 2A6DB 4L4VD 4P3CH 4LCYA 1JNNH 3DYOA 5CP7A 1KPRA 3VGAC 3NIFF 4Y4KC 2Q76A 4EIGB 1LILA 2Z93B 4J4PA 5JW5A 3T0EB 5KVFL 1F3JB 2YKLH 2BSSA 1WBZA 4FQCH 4LPCA 2GSGA 4NO5A 4WHYG 2EDJA 1F5WA 4U6YB 4G8EA 4LVNB 5CD5C 3IGAA 2V2XB 4IIQC 3VXSD 3D6GA 4C56D 3A6OA 3RKPA 3K81A 2EIDA 3WFBH 3VFRA 3PL6D 5J11B 5IQ9A 3PHQA 4F7EA 1GGTA 1RJZB 2BJML 1SY6A 4PLKC 5HGHB 4NNYB 3GMOA 1SVCP 3WNLA 5FK9B 1RUPH 3NIGF 3MNWB 3JWDL 4A6YA 4PJ8A 4JKPL 1XF2B 4HW6A 3N9GH 5E6ID 1R3IH 4ZOBA 5I1IH 3PWJB 3Q2CA 3GJFB 1NFIA 1QBML 4YFEA 3MLTA 4WFHD 2J7LA 3FMGL 1YEHH 3TWCL 3BFOA 2HT2D 4L5FL 3BWUC 3TYGL 3QDME 3QUYB 1FFNB 3KPOB 2NX5E 1JF5A 1IBGH 1QVOA 2N7BA 5TDNA 1S9YA 4AEHL 3S8WA 1C7TA 3ILQC 3S4SB 3VXNA 5JW3L 3RFZC 4KI5D 4GRLD 3MRHA 1Q94A 2ADGB 1WAAA 3DO7A 1JGDA 2EH7L 5TQ0H 4IJ3B 5AUMA 3LIZH 1MHCA 4ZO8A 4J7RA 1LP9F 4XNQB 5LBSH 2H2SC 3WXWL 4YHIA 3CZFA 5T3ZE 3B43A 3MV9A 5CZXD 2BVEA 4QRQA 3JBG7 5IKCB 2ZCKH 4UILL 5JQ6L 5I0DA 4ZAKA 1B4JH 1U8HB 2MMXA 1UCBH 1KNOA 1F4YH 4Z8FH 1ND0B 1JTOA 3FZUC 4G7YL 4PY8J 3QXVA 4LEOA 1MEXH 1WIPA 3CFBB 1HKFA 5C09D 2I25N 4DVRH 3OJVC 5C0IB 5L2KA 1EFXD 5IB3B 4JFED 2DM3A 4NQEA 3I2CH 3IXTA 3AXLA 4JPWL 4IJ3C 2ARJB 1IGJB 4P5KB 4H88L 4HFUL 5FA4B 3RWFB 3CZJA 1MRFH 5B4MC 2KUTA 3REWB 4LIQH 5I1HL 4TULH 4DWHA 4I0PA 1AGDB 4PDCE 4HAGA 2VERN 3P4MA 1CE1H 4UTAL 2JLLA 3RNKB 2G75A 1LHZA 4OM0L 4QXGL 4W81A 3MODH 4P3DB 4GAJH 4OF6A 4XTRC 1EEYB 2BFVL 3QEUB 1YEFL 3BD4A 1G6RA 2R2CA 5BRZA 3DV6B 2X9WA 3PG2A 4IOIA 5C09E 2X7LB 3VI4F 4ZS6C 5D9SB 4ZD3H 1YQVL 4PJFE 2I24N 4HIXL 1YEGL 2WK2A 5L9DL 1RUKH 3L5WB 4XPFH 1DVFA 2VLKD 3ARYA 4UDTB 1LO5B 1UM5H 4QYOA 1AXSB 1QFPA 3L3DB 3EO1A 5HHOD 3P4OB 4Y2DB 4YX2L 3DI3B 5CEZD 4YXLL 3KS0J 1R24B 4YHLH 2FO4B 3F7QA 4WGVB 4G8IA 5H94B 2IBGA 5I19L 1MF2L 3O6FD 4KH2A 1CQYA 3DUSB 5C0BD 4KXZI 4NQCD 4NBXB 1XGTA 5IHZB 1OAYH 1A14H 2O5ZL 3C2AH 4XVSL 3I75A 5SX5H 3ZTNL 4EIZC 2OI9C 3VWJD 1QFUL 3QO1B 4RMVA 1EX0A 3RGVA 2DQCH 2DQHL 2UVFA 1Q9WB 2EE3A 4L4TD 4WHTA 2VNCA 1J8HE 1BVKB 1A7RL 1FZKA 4FFVC 3QXTA 2VLKE 4ZUSB 5FM8A 5FO9A 5FA3A 4KRLB 3D39B 5K9KA 1IMHC 1G7JA 3LEYH 1A64A 1W72H 2EDXA 3QCUH 5CEZE 3VI3F 3ZKNC 1HKLL 3RTQB 1R3HA 3Q6GL 2XTJD 5LWYH 2VLRA 3WIHH 3EDJA 1DANU 4KK9D 5DC4B 2HH0L 1M05B 1S8DA 4YHZH 1ROWA 4GKNA 4X6BA 1I9JL 3QIWB 3R4DA 4M7JH 1W0VA 1E27A 3MOBL 5DJ8B 3ZDYE 1EEUA 1U8MB 3M17A 5D71L 3SDXF 3PQYB 4L4TE 1S7SA 5FYKE 3MBXH 1NL0L 2ZCLH 3ERYA 4FQLH 2VAAB 1CFVL 3AB0B 5EUKA 5C6WH 4WTZG 3WIFA 3TBSB 3S3SA 5ISZA 1M71A 1YUHA 3W9DB 4NKDA 3LMJH 2E7BA 5JPMA 1NQBA 1O7SA 1A6AB 2AK1H 4FZ8L 3IAGC 3BIAX 5J1TC 4WWID 5J3HC 2M2DA 2VXTH 4L4VB 3B5TA 1TTGA 4XBGB 5KTEH 5HGDA 1RUQH 4HXBH 1MCOH 2AERT 3GI8H 4EDWL 43C9A 4F7MA 1IAKB 3V6FB 4K23H 1BD2D 5TFSH 1G7IB 3DJ9A 5ERWB 2N1KA 4FQQA 4LLWA 1ETZA 4ENEC 2LU3A 4Y4FD 5TDPA 3ZYIA 1RZKC 3WNMA 3QQNA 4D9QD 1A6VH 2MPAL 2FSEB 2AJXL 3AB0C 3SQOH 3VXSB 4NUGL 4YQXH 2FL5B 4MQ7A 4QRUB 4C56B 1G0YR 5JW4N 3MUHL 3PL6B 4PJHA 1RK1A 3QI9A 2VDPL 4MDJB 4O4YH 3NH7H 5CLWA 4YE4H 3VFUB 4JY5L 3VXTB 4NHCL 1PAMA 1OCWL 5DS8B 3BKCL 4IS6B 5IFJB 4KHXL 1N0LA 5C0AA 1PBYA 5BCAA 4MWFA 4KAQL 1P7QD 5DD3L 2DMKA 4BFBD 4OM1L 3QXWA 4S0TD 1OT2A 3QUZB 3QULB 7FABL 2MKLC 1JRHH 3IKCB 1PZ5A 4GW4A 2HVKB 4L9LB 1AD9A 4D9QE 4OZGB 1WLHA 3QCTL 4YH6A 4H20H 2CR3A 4UQ3A 1FL3A 2FB4L 3QO0B 4FQJL 4PG2A 3F5WA 3WS3A 1VFAA 1UQSA 4PGCA 1I7TB 1SJVA 1X6LA 1P4BL 5L88L 3BP5A 4XC1H 2YS4A 4JFOA 4GRLB 4LRIC 1HXMB 1T2QL 4ZPTA 3L9RB 4NO2B 2YMXH 1FC2D 1NBVL 4G42A 6FABL 2CSPA 1YPZE 3TA3D 2X4SA 1FH5H 3QISA 4OCXL 2E7HA 5JOFB 3GKWH 2IH1B 1CFTA 1YC8A 5DRZB 5EOCJ 4ZUWB 4FQ2L 3OPZL 4LPYA 4NPYB 1F13A 4Y5VB 3MUGB 5D7KE 4PRDB 3QUZC 1FYTD 1A3LL 4P2QA 5GGTH 4PTUB 4OBRA 1KELH 3HAEG 5HVGB 5DK0A 3FJTA 5IVXF 5DHYB 4LLYB 3TCLA 1A7QH 3ARBA 3GRWH 12E8L 5CMAB 1EFXB 2X4PA 1CU4H 1FFNA 4JFEB 4EJ1C 3H9YA 1QZ1A 5DDHA 2CDGA 3TYFA 5F9AC 4PS4H 4BZ2H 5GRUL 3OKKB 3VFOB 4MNGA 1XF4A 4V1DB 4PJIE 4R4FL 3VH8G 1N5YH 1KV3A 2CLVB 4PLJD 5C0GA 3BW9A 4ODVL 5GGVH 4S0UC 4WFED 3BKMH 1LK2B 2ZWLT 4YHML 3LSOB 4PJEF 1U8QB 1DLHB 3B2VH 4L8SA 3HI1A 3FT4A 5BXFA 3FQXB 5DZOA 2LV4A 3K4DA 3CFJA 3S7GA 1B0WA 4JHAH 4AZ8A 3OKDA 4FA8A 4LAQL 5C07D 3BGFB 4C57C 1KPVB 1L0XA 4Y5XA 2HTKC 2CIIB 5IM7A 1S7VA 2VR9A 1FNHA 2Q7YB 3P3YA 2DM4A 4OCLC 3KPSD 1AP2B 5I8KH 5EBWB 4DGIL 4X6CF 3GNML 3IDUA 1AKJA 5HHOB 5FHBH 4LLDA 4I1NB 3WYRA 1NBYA 3CFCH 1MCNA 3K7UA 4KJPC 8FABB 5L8LB 2JK5B 3A6BH 3MLWL 4RMSA 4K9EC 3Q3GB 3CH1B 3SE3C 5JW4R 1AGDA 3O6FB 2F19L 4H8WL 4M43H 4ONHA 2Q6WA 5C0BB 3V52H 3M8OL 4K3JH 4NQCB 3LN9A 5DRNB 4GUPB 4JY4B 3OAUH 4JKWA 2Z8WC 3L3OA 2NTFB 2XZQH 4LF3B 4M5ZH 5C07E 4EUPH 3Q1SH 4CUCA 2NY4D 4U1KB 1LNUA 5EZOL 1E6OL 5IT2L 5H37G 3MOQA 3S37H 4JO4L 4GRMB 3RU8L 1QLEL 3QUKA 3SDDD 4RGND 5KSBB 2O5YH 2X7LA 5JMRA 5EH1A 3HRZA 4LLAA 5EO0B 4OI8A 3P77B 4MQXD 1RHHA 4UDTA 3TJHC 2QQKH 5BV7B 2XTJB 3D2UD 4RGOH 3SCMD 5IEHA 2YKLL 3GB7B 4JLRB 4Y4HA 4KZEH 1XGUB 4RGMB 3GM8A 4OIIL 5DJAA 4KKAD 3ZE2F 5I75B 5FM5M 4JEGB 1EA9C 2F5AH 3KPRB 4Z0XB 1JP5A 3WFBL 1MLBB 3MUJA 3C5JB 5I73B 4PD4J 3VMOA 1URLA 2X10A 2YC1B 2E5EA 2DN7A 3H9SD 3UTTE 2YD6A 1Q0YL 1RUPL 1WV7T 2DTMH 4RGNE 3U79A 1MWAH 4WI5A 4P46C 4I13B 4TUJB 5HDLA 3CLFH 3T1WA 4QTIH 5C7XH 2APTA 5KANG 3LDBC 1R3IL 5I1IL 4U2ZA 3MJ9H 5KVEL 1FRGH 4QHKI 35C8H 5AEAA 1YEHL 3C9NB 1FN4A 3PP4H 1QQDA 3PWVA 3VFVB 4LCCB 2R0WH 2HN7A 3MRKA 3T3ME 2ZOLB 3LEXB 3NMEA 4Q0XH 2C4FT 4FNLH 1IBGL 1WCBA 3IF1B 4X4MA 2PUQT 4KI1A 3GSQA 2ED8A 3QXAB 4XPHL 4FQHB 3QEHB 5DQ9A 5T3XL 1BD2B 2XWTB 3F62A 3NCCB 5E24E 4EZMA 4J6RH 5TQ0L 1P1ZB 3LIZL 2EICA 3HZMB 3WJLC 3BZ4A 3SBWC 4P9HC 4YPJA 3FO1B 1D6EB 3SDCD 1OGAA 5ENWA 2AV7A 4N1HB 3BEVA 3OXSA 1FCCA 1G6VK 4HMCA 3EJYC 2V5TA 2P24B 2ZCKL 5I8CA 2BNUA 3VRIA 2YD7A 4RA0C 1B4JL 4CNIB 1CDGA 4KWUA 2PO6D 1UCBL 3C08H 3Q0HA 1K3ZA 4OFYD 4LCCC 1F4YL 2IBZY 4PJ7B 4Z8FL 3TH4T 2YEZA 1AHWC 4LVOB 4M7ZB 4PGBA 4TSAL 1FE8H 1MEXL 4JKMA 1NJ9A 3FO2A 3UTZA 2I60L 4ODXA 3MGTB 4DVRL 4U1LA 2DJ4A 4WTWA 4D3CH 4PPTA 3I2CL 4NZUH 2AEQH 3DUUB 4N8VA 1S7WA 3SDYH 5SWQA 3LKRA 4H5SA 4KK8D 3V6OE 1Z9MA 5IBTL 1BWWA 4UIMB 3IRPX 1MRFL 3QEQE 3S35X 3SKMB 3DVFA 4LIQL 1PQZB 4TULL 4RDQG 4U1MA 3E3QC 4JZJA 3MLYH 5GS1A 1CE1L 3ARDA 4P23C 3QDMA 5IVOA 2NX5A 3VGBA 3MODL 4GAJL 5EZJA 1JHLH 5LVEA 3VA2C 5E70A 4WCYH 3MGOB 4LVOC 4M7ZC 4Y5YB 3TA3B 4R4ND 4LSSH 4W6WB 5EBGA 2Z92B 2R69H 2IGFH 5D7SL 4ZD3L 2FX9H 1Q9OA 5B39B 3BYYA 5E6IA 1IC7H 1A6TA 5IF0B 1E4JA 1RUKL 1YY9D 5DHVH 4J3VA 4ZMAT 1U91A 1JI2A 2YD3A 1FYTB 1X5AA 2Z35B 1J88A 4UU9A 1UM5L 3K4ZA 4X9HA 1IL1A 2HKHH 3BO8B 4JAMB 3IDIA 4YHLL 4Z0BH 3EHBD 5IW6B 1CGYA 5T1MA 2DBLH 2V7NA 1EMTL 3P0YH 3EFFA 1HYSD 4FS0A 5E0QA 1BM3H 5I1EH 1UA6H 1OAYL 1W0YT 1T04B 4KQ3H 2GTWA 4YBQD 1RZGA 2DQCL 5EU5B 3R0MA 4WO4C 1OOAA 5IJKC 3DVNA 1D5XB 3G08A 3PJSA 3S9DB 2KDGA 4FTVD 4D0DA 5GXBB 5F9WC 2YPKA 4PJGB 6CGTA 3SDAD 1SBSH 4JY6B 1DN0A 2UUDH 3LEYL 2R1WB 5DO2C 3QA3B 1LE9B 1W72L 3QCUL 2GFBA 2APVA 1T20B 3U7WL 3IDMB 5F8QC 4MX7A 4XC3H 5LWYL 2QEJA 4NDMA 3WIHL 4OQTH 3MRBA 3KPSB 5CEXB 2AXJA 1IQWH 5C09A 5F1IA 1U8PB 3IETB 2AKRB 1Z2KA 2GT9A 4YHZL 2PW2B 5I15L 1W2KT 4PJFA 1FDLH 4QRTB 1EGJH 5ETUA 2DWEB 1TDQA 4MS8D 3BPCB 1ZTXH 4TVSa 1FIGH 1I8KB 3DOSA 3TPKA 1FJ1B 5IG7A 2UZYB 3UDWA 3LEVH 43CAA 1EUUA 3MBXL 2ZCLL 4WNQA 1HHKB 3LV3B 1R3JB 4FQLL 4F7TB 1DBKL 3JV6A 2O26U 5HPOA 4L8CB 2JJTC 1BVLB 2UZIH 2NY4B 2EIBA 4Z7UE 1C08A 4JFQB 3QUMB 3QQ4B 1IAMA 1T0NB 5FGBC 4PRIE 3QRGH 1U8LA 4HXAH 5E8PB 4IEFB 5SV4A 2PCPB 2UWEF 5J1SC 1RUQL 1J8HA 4HXBL 4R90L 2VLKA 4K23L 2DQEH 3ZT7A 5DFTA 3MXVL 2D7OA 5TFSL 5E7BA 2EIEA 1LO3H 2BMKB 3I85A 3SCMB 2DQDH 3W81A 4G43B 1A6VL 3UTQB 2DLEA 1OB1A 3RWJB 4MA3A 1RK0A 1BZQK 4HGKC 1NLDH 3C09B 3UBXA 4S10A 3VFSB 5DRNA 3O8XA 2H32A 3CFDB 4BK4A 1YJDH 4O4YL 1HI6A 5DTFA 5F6HI 1NC2A 5FUCC 3NH7L 4YE4L 3H9SB 5JNYA 3VWJA 4FP8H 5GRJH 4WVRA 4N0CC 1JWSA 1Y6MR 3G6DL 3BPLC 3CSYB 5E03A 4BH8A 4L4TA 3LKNB 1E28A 5ANMB 1ORSA 3FOLB 1U3HB 2D7TL 4ODWB 3ZE1F 1F3DJ 2C3GA 1SJEA 1OAXH 3QCVH 4K8RH 4NZDA 4XGZB 1FVCA 2BNRD 5T3XE 3STLA 3ROLA 1NGQH 1PKQB 1TZGH 3D9AH 4H20L 3TZVC 3KPTA 1V3KA 4K7PY 4U1JB 3MJGX 5DC0A 1HHGA 5I1KH 4XC1L 3KGRA 4P59H 4QHNA 3RPKA 1CDYA 4HSQA 3SE8H 1P2CB 4BK5A 2YMXL 2ZZUT 4DVBA 1Q1JH 4TTDC 1TZHA 3GKWL 1MCLA 2YC1A 5T1LD 4K3EH 1U3HC 3SDCB 4B0MM 4GKSA 1FPTH 3PE9A 4IHOB 2X4QB 3JVGA 2YWZA 3GMNA 2ADIB 2PO6B 5DC9B 3VRLF 3TFKD 5GGTL 4JR9H 3FQUA 3KPQB 1J0JA 4M6OH 3ZE0E 1I75A 2E7CA 2BK8A 2BVTA 4ZTPH 2YSSA 1A7QL 2Z31D 3DO3A 4X98A 3OAYH 1CU4L 1HN1A 1IGIL 1M7IB 3BN9C 4LIQE 4IRSD 5I2IA 5D1XA 3D69A 5AD0B 1RZKL 4PS4L 1LVEA 4CKVX 1UJTA 4BZ2L 4XAKE 4JRYE 4LQFH 4LPVA 2MTPA 4YHKH 1N5YL 1LE5A 3QDJB 1FL5A 4Y4FA 4R96B 2X70A 4D8PA 1MCKA 5FYJD 3X3FH 1MLCB 5D72L 1FVDA 1B88A 3OXRB 1NBQA 5GISH 4ORZC 3O3DB 3DV4A 3X14B 1QFWI 4NHUE 4J8RA 5MERA 4LHQB 4NZRH 4XCCH 5GPRA 2D7NA 2HVJA 2JTDA 3MNVA 1JGLH 5BS0D 4UQ2B 5EUOF 1YPZA 3RWGB 5C0DB 3G6JF 3T04D 1H3XA 1D6VH 4OLUH 1CGSL 4WEMB 5I8KL 2O61A 3FN3A 1P7QA 3GSWB 1BQLL 3UP1A 4X7SH 2ICEB 5E1AB 1RFDH 1KLUA 1E4KA 5DVLA 4ODHH 4WWKC 1F11A 5C0NC 3VFNA 5FHBL 3HZVA 3MRCB 2J8UF 3O0RH 2J1KA 4FFYL 2Q86A 5AG9A 3T4YB 1R5WB 1E0OB 3A6BL 4PP2B 2V5RA 1Q0XH 3R06A 1MJJB 1J05B 3RVVC 4MZ2A 3U46A 2XACC 3H3PH 1BREA 4M5ZL 5IK3B 3FQNA 4G5ZH 5FO8