4PJFA

Structure of human mr1-ac-6-fp in complex with human mait b-c10 tcr
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
269
structure length
263
Chain Sequence
RTHSLRYFRLGVSDPIHGVPEFISVGYVDSHPITTYDSVTRQKEPRAPWMAENLAPDHWERYTQLLRGWQQMFKVELKRLQRHYNHSGSHTYQRMIGCELLEDGSTTGFLQYAYDGQDFLIFNKDTLSWLAVDNVAHTIKQAWEANQHELLYQKNWLEEECIAWLKRFLEYGKDTLQRTEPPLVRVNRKETFPGVTALFCKAHGFYPPEIYMTWMKNGEEIVQEIDYGDILPSGDGTYQAWASIELLYSCHVEHSGVHMVLQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A molecular basis underpinning the T cell receptor heterogeneity of mucosal-associated invariant T cells.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Major histocompatibility complex class I-related gene protei
total genus 73
structure length 263
sequence length 269
chains with identical sequence C
ec nomenclature
pdb deposition date 2014-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4pjfA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4pjfA01
4BZ1H 5KSUB 3D2UB 4PJBA 3RL2A 1A3QA 4KKCD 4MD0B 1C7TA 5D93C 5EBMB 2FR4B 4MZ3A 1IJ9A 1W0WA 3EYUH 3QFDA 2ORBL 3MUGA 4U6YA 4LARL 1HNGA 5JO5B 3VW3H 2QV2A 1OTTD 4G9FA 5LCVL 3H2WA 3ZL4H 1BBJB 5IMLA 4GKNA 1C12A 1XGYH 4IRZL 2XWBB 1FORL 4LLUB 3ZKMD 2B2XH 3RTQC 4R4BA 2NX5D 3P0VH 4N0UA 5EZLB 1RK1A 2VXTL 3NIFF 3MX0A 2VLRA 3G5YA 4L8CA 5JDSA 4YHYB 5LG1A 3MJ7A 5JHDE 3R0MA 2CLVB 3RUGB 4APQC 4OZGA 1INQA 1R3KA 2OP4L 2EKSB 1FYTD 5E2UH 2F8XC 4Z7VB 5F7WC 4J3UA 3C8HA 2O61B 2AJXH 3LS4L 1MCRA 2K7QA 1FBIH 3M07A 3QQ4B 1QQDA 5GS2H 4AZ8A 1FAIH 2Z8WC 3G6JF 1S7UB 3FN3A 4Q9BA 5F6HJ 1BIIB 3NCMA 5C09A 4EUPB 5ENWA 4DGYH 1XZ0A 2XWTB 2P24A 3MRLA 4L4VA 1RZ8A 3NIDE 4G8IB 2WLYA 3CFDB 2XWJA 4PJDA 4XP9H 1TXKA 2Z31A 4QRUB 3LHPL 4JM4H 3HG1D 3RI5F 1EDQA 4H8WH 5HYJA 1X5KA 3ET9F 3NIGF 3B9AA 1CDCA 1MHCA 4PPTA 3VCLA 4PJEA 4JRYE 2QTEA 1VACA 2AEIT 4PJDE 5F1IA 5C8JB 3VG9B 1VPOH 1MAMH 4WHCA 1WIUA 2FBOJ 2HVJA 5ISZD 3T0BA 4JDTL 4LLDB 3RIFF 4KK9C 4S0SD 2ZNWA 3HUJF 3S98A 3WFDL 1K4CB 4HBCL 1ONQA 2P42B 3SE4C 5DLML 5ISZB 5HVFB 4HUMB 3IB4A 3I6GA 4ZFZA 2BRRL 3AREA 3SDYL 4QOKA 3E6HB 2ENYA 3VXPA 1JNJA 3BMWA 3LRSA 3T3MF 3GMMA 4OLYL 4Z95L 4ZFFA 1U3HB 2YUXA 4QOKD 4E41E 2PO6A 4LLYA 1G7JB 3TN0C 4WHDA 2IADB 2CGRL 4PREA 4KXZH 1UT9A 3S6CA 3LY6A 1AH1A 5IB4B 2HT2C 4LSPH 3ARUA 3FT3B 4KKAC 4D0CA 5C0RH 3TBYA 4B41A 3NIFE 4HAFA 2FB4H 2DIBA 4BZ2L 3WJLC 5BO1H 4JO2H 5DQDH 3RPIB 3TZVC 4JFZL 1NBVL 1DN0B 1CDUA 3TA3A 2FO4A 4UAOB 4OCXH 4D3CH 4J1UA 3VFNB 1FFOB 2VWEC 4QHUA 5C0GB 4POYA 4JFOB 2V9RA 1KIPA 3B9KA 1WZ1L 4PR5B 4X6EA 4G42A 1KIQA 5FHAH 4KROB 1PY4A 1YEGL 5JHDB 4A6YH 3S5LB 2A6JA 4HKXA 4UINH 2DBLL 3SO3C 2LTQB 4PBWD 3WFEL 5JHDD 3ERYA 4QRRD 4NC1E 1T3FB 3V4VH 3O0RL 4HIEB 4Y5XB 2R2HA 3B9VA 5C92A 4Y2DB 4PRBA 1NGZA 3UDWC 5B8CC 3K2UH 5I1CL 3GBNL 4Z7VE 4JG1L 3K0WA 1D9KD 4KV5F 2FWOB 2XRAL 4ZFZB 1D5ZB 3T2NH 3OR6A 5C09D 2CD0A 3LEXB 4NM8L 3JWOH 5IMKB 1UJ3A 3OSKA 3IU3A 3LRSB 5FO7A 4M6NL 1CDJA 1U3ZA 4HIXH 1HH9B 2ITDB 1OSPL 3SGDH 3PL6D 1LO3L 1EFQA 1H3GA 2CH8A 4JJ5A 4Y88A 4YR6A 4XHJC 5IMMA 5EU6D 3DURB 2EYTA 4L5FL 4PJHB 1Z0NA 1J1PL 1AY1H 4H26A 2BSTB 4LNVA 4WNQB 3PQYD 2DQJL 3GSVB 1KC5L 1A21A 2F53B 2H3NB 1CQYA 4HKZB 3QRGH 3JTTB 4P23B 3O8XD 5EB9A 3U9PL 1I3GH 2J7LA 3QNZA 2Z35B 1KB5A 3OKEA 2DIAA 3BQUB 2BSSA 5D7KD 1T3FA 4MDIB 4DGVL 3O9WD 2E7CA 2ID5A 4YPJA 1JRHI 2HWZL 4L29A 1HE7A 1C16B 1KT2B 4M9PA 2OTWB 1ZLWK 4OFKA 3ME0A 2Z4QB 4G80B 1U95B 4DCQA 3S36X 1J8HB 3D0VB 2FEEL 5J11C 1YEJL 4AK1A 1WZ1H 2IQAB 1G0YR 5ANME 2KL6A 4K7FB 3ZHDA 5E2JA 5MERB 4UV4L 1NEZA 3VD7A 3ARBB 2ZUQB 4UDUA 3H3PL 1NLBL 3TVMD 4GSDH 4OFDA 3ALWA 3QWRD 3H3PH 1WISA 1JMXA 2D7PA 4YX2L 3QJFB 4PFEA 1MFEL 4ODTH 1CN4A 1IM3A 3V7MA 4JAMB 1YEDB 1GSMA 3FOLB 3DMMD 5T3ZL 2H2SC 4PV9B 1A9BA 5C0JB 5J57B 3GRWH 3MRDB 1I1FB 4QRRE 4P2OC 1BAFL 4GQ9H 2CGRH 3BQUA 3UTTE 5M7QA 1KCGC 1HEZB 1Z5LB 2Y9RT 5D1QC 3SDDB 4KI5D 4JFDE 4P5TB 3QO1B 1SHMA 2FRGP 4YHZH 3A67L 4YDLC 4Q97A 2IAMA 4J3WA 3QWQB 3L3HB 2FX8H 4JB9H 3S5LG 4HH8A 1KTKE 1FNAA 1ERNA 1N59A 4HPYL 4X4XA 4KWUA 3K4DA 4LRNH 5DMYA 1FNGB 1E4JA 4NBXB 1WBXB 5KSVB 4RRPA 4JRXB 5CBAA 1NMBL 4RAVB 2D9QB 4XNXL 2R69H 2W07A 5F1OB 3C6LD 1KLUA 5JLZB 1PZ5B 3KPLA 3N85H 3I02A 1ORQA 1BOGB 4LGSB 3V0WH 1NMAH 1FZJA 2YSSB 1TETH 2VXUL 4ENED 4TSCL 2AI0H 3RGVB 4G7VH 3MRPB 2H3NA 4GXVH 3EDDA 3U30C 2BCKB 1PX3A 3SO3B 1G1CA 4LPCA 4ODSL 4AMKH 3SCMA 1RZJL 3O6ML 1OTUD 3C5JA 2AV1B 3JV5A 4NQEE 4JFFB 2K3TA 1I1AB 2BVTA 1LVEA 2P1YA 3FCTB 4LSUH 4QGYA 4YLQT 5ABDE 1WUNT 1TDQA 1JPTL 4JVWA 4K3EH 3I6LD 4JZJC 2QEJA 2JELL 2R8SL 4MS8C 2GJ6A 5DSCB 3QUKB 1Q38A 2OTWA 3F7VA 5HHNA 2R2EB 2E6PA 3VXSE 3BEVA 5I8KL 3DGGB 4YDIL 3T1FA 4WWKD 1F45A 5KSVA 3MLZL 3FQUB 5HPOA 3WL9B 5IT2H 1ZHKB 5LQBH 4R8WL 1EA9C 3C09B 3LKQB 1RFDL 1BD2A 1ZGLP 4OZHE 1I7ZB 2BOBA 2O5XH 1RZIB 1KJ2L 3QG6A 1BZQK 4UILL 3B5GA 3EIFA 3P9MB 2BNRB 1H3UA 1QEWB 3NFNB 5CILH 3AREB 4QHNB 1TZIB 1WTGT 4MNHA 4R4FH 3V6FA 5I1HH 1JPSH 5C09B 3PDOB 3V0VB 1RZ8B 1MJUH 4O51B 4HCRH 3IKCA 2PO6D 4KUZH 3GI9L 2IH1B 3ALPA 4JFQA 5F88B 4MD0A 4EDWL 3LD8B 3DYOA 1KCKA 4JY5L 5D1ZC 5I8OH 4NJAH 5HI3D 4F15C 5MEPA 3BZFB 4ZFOL 1C5BL 4Q6YA 1QKZL 2V7HB 3DGGA 3T1FB 3RBSA 5IMLB 3HRZB 3MRGB 4HEME 4JRXE 3Q2CA 1KLFA 1KG0A 1A6VH 3OZ9H 3GMOA 3P4MA 2Z92A 1UWEL 4AEFA 4GG8A 4G8FB 4LMQI 2DQCL 5BXFA 5DYOB 1FRGH 1VA9A 3HMWH 3DMMC 4XVSL 1BLNA 1UKSA 5DUMH 3ARDB 1DQJB 2R29L 4JANB 4XP4L 4DTGH 1IM3B 3HMXA 5DI8B 2HVKA 4I18A 1D6EA 5E4EB 4UUJA 4R2GB 4FFWC 3T2OA 1WBYB 1M7IB 4BZYA 4CVXA 4QHKJ 1GL4B 1CLOH 1CICB 1VESA 3U7YH 1DBMH 3T0VA 1I1YA 3WXWH 5JMRA 4G9FE 5KS9A 1N6VA 4G8GA 3BPOB 2NY5H 1S78C 4R0LB 1E27A 3FTGA 4KMTH 1VHPA 4QRSB 4KVCL 4PYGA 5E8NB 5IB2B 2OZ4L 4L3EA 1YN6B 2CIKA 3CVHL 1I8IB 3O6FB 1VACB 4OM0H 3IRZA 3ZYOA 4ODUB 4LVNC 3QEGL 3BPLB 1KJVB 1WGOA 4J3XA 1H8SA 4EN3D 1G7IA 5GS0L 1T0MB 1XT5A 4F9LA 4AEIL 2FWOA 3LKOB 2A6DA 2Y7QA 4ZS7H 4EVNB 1JZ4A 5E2TL 4XNZB 4ZUVA 3Q1SH 3MV9A 2I26N 4QCIB 5IEHA 3E6FA 3IJSA 3VFSA 5CSZB 1JK8A 1M7IA 4CVXB 1NUGA 1P84J 1HHJB 3OJVC 4LSRH 3WJJC 15C8H 2VR4A 4IIQB 1KNOA 2OI9B 3M1BB 3GSNL 3S34L 1HYSC 5KVFH 3FCTA 2VXSL 1QSED 3MLXH 1UWEH 3C87A 1RZ7L 2X4SB 3NOIA 4JKMA 5E8NA 3O6KL 5DQ9B 4NCDA 2FHFA 4UAOC 3WD5H 1KPRB 4GKZA 4BFBD 1W2KT 1I9EA 5K59F 2W1NA 3QP3A 4M1DH 4LPWA 4YIQA 2EO9A 2WINA 3ULSB 5IHBA 3GSXA 2J8OA 5EUOB 1PG7W 4KKBD 4MA1B 5GGRA 2AXGB 2G60L 2WIIB 5HHMA 5HDQH 3F65A 4FNLL 4LHJB 1T0MA 4S0TD 5FK9B 2XKSA 5M95B 2YC1B 2I9LA 1OPGH 4APQA 4IHOB 1WF5A 5ITFA 5A2JH 4NNPH 4NC2B 1INEH 2D0GA 2GSIB 4U1LB 1A1OA 1LP9E 2KPNA 4TN9A 4P5KB 1MJUL 2R29H 3WFBL 1FNGA 3W11C 1JBJA 1A0QH 1UJTA 4GRWB 3I3EA 1CT8B 3UPRA 5HHME 4FNLH 1H5BA 1R24A 2A9MH 3RWHB 4U1SA 4XC3H 3V52L 4J3TA 2O5YL 2NLJB 3OZ9L 1I7UB 1MHHA 2UY7A 4W68A 4GH7B 3RVTD 1D3CA 1GOHA 2YR3A 1LE5A 3OXSA 4HS6B 3WD5L 4IDLA 4EUPG 4YHPA 3TVMA 3JVGC 4UQ3B 1SJEA 3SPVA 2ZUWA 4WWKB 1KFAH 3P40A 4ZXBB 1A9BB 3MGTB 5T3XH 5HYJD 4KKNA 2CK0H 1XF2A 1HQ4A 3QQ9C 1UACL 3TT3L 3MCKA 1P84K 3SJVD 4MD5A 5F9WC 1BQHA 4OCRL 4J8RB 5DWUH 3SJVB 2JB6A 5KVDH 3EO1A 1NGYB 1PYWA 3HNTH 2IAND 3PWNA 1FYTA 1HKFA 3L5XL 1LNUA 4IDJH 4DW2L 3KLDA 1TNNA 3DIFA 2OR9H 1B0GB 3LMJH 1DP0A 3FFDA 4O2CB 3V79C 4GMTH 1JPGA 1MCSA 2OS7A 2HVKB 5D5MA 3BE1L 1PEWA 2PO6B 1KB9J 1D5MB 1U8PA 5C0CB 5KN5B 4JFXA 4H1LA 4PRIB 4Z7UF 4NGHH 4HUXB 1Q8MA 1G9NH 1HHJA 3VI4F 5DHYB 1MRCH 2YXMA 5GS1B 3ARQA 4D94A 4MS8D 3P30L 3HC0B 4UB0H 3I3DA 1NL0H 2OLDA 2VERN 5DRXB 3L9RB 4HXAH 1UENA 1DSFH 4UQ2A 1HSBA 4MNHB 3V6FB 2X42A 1WQVT 1QYGL 3MZGB 5KVGL 3O6FC 1PW3A 1SBSL 4OF5A 5KG9B 4PJEB 4N0FA 3U0PA 1AIFA 2AV1A 2EXYD 3CC5A 4S1RL 5EC1B 5DJ6A 3F5WB 2RJMA 2DKSA 5GGRB 4XNYH 32C2A 2MWCA 1YEIH 4G3YH 4M93B 1JGDA 3RWCA 1GPOL 5GZOC 3BUTA 5TGBA 4KUCD 1O7SA 1LP9B 3WDHA 4R2GD 5ERWB 5CZXD 5DMIL 3IDNB 2GI7A 4MA8H 5FM8A 5C2BH 5IEHB 1TCRA 1AQKH 5INCB 3HMXL 1N8ZA 5ALCH 3EO0B 5JXED 1KTRL 4YE4L 3HRZA 2BC4B 1SYVA 1WWCA 4FMFA 5CS7A 2VUOA 2F74B 4YX2H 4MJ2A 1U8KA 4XVTH 4X7DC 3V4UL 3GIVA 5AUMA 3FB7B 1RZIA 5E6YA 5T3XD 5DS8B 2Z8VC 2ZOLB 1AGBA 3CFJA 4X4YB 3T2QA 3QXAA 3DWTA 3O6FD 3MRHB 1MHEB 3DRTA 3WNOA 3KYOB 2Q3AA 1SBBA 3FMGH 3QXTA 3TF7A 3GKZA 2XQBH 3VWKA 1XR8A 4MD5B 4NZDA 4OCLC 1G7QA 1OT1A 1CGTA 4Y4KC 3GMQB 2FR4A 1XCQA 4UMGA 1B3JA 2H1PH 3MXVL 2CO7B 4ZQKB 3RHWK 3VFPA 5KJRL 3G6JE 2MCG1 3HZKB 1HSAB 4UTBH 2X10A 5DRNB 3UTSE 4PG2A 3ES6B 1FSKB 3MODL 3FO2A 4K7PY 2WUBH 8CGTA 3EJZD 4OF7A 3LKNB 3WXVL 2D7OA 1RHHA 5CJQL 1CD0A 2MMXA 2QJDA 5K9JH 1CFTB 1J1XL 5J1SC 4WJ5A 4BFIA 4RMUA 4G8FA 3X3FL 1YY8B 1AQDB 4M6ML 5IMMB 5GS1A 3BX7C 3TFKA 1BQHG 4LDOB 1LEIB 2YPVL 3SOBL 1F02I 1GC1L 1SJEB 4JHBA 1L7TL 3GJFK 3RUGE 3QYCA 4CN6A 2VL5B 2EE9A 5E95B 1J9CT 1SJVA 2DLTA 4PJIF 1W0YT 2GITA 4G7YL 4PY7B 3V95A 1IGFL 2AXJA 2H45A 4NO2B 4XMPL 2ZG1A 5FCUH 5DZLA 3PHQB 5HI4D 1OD7A 1XCTB 1IGIL 1QPXA 3QO1A 4I0KA 2Z31B 3IYLW 4QRUA 2ARWA 1I9RH 3RZWA 2Z31D 4F2MA 5HI4C 2BY0A 4ZOEA 4Q6IA 3V4VL 5HXMA 4RQQA 3VFVA 1EHAA 4P3CL 4AEHH 5FYJE 3RDTD 3RIFK 5ICYB 4UT6L 4P2RE 2HG5B 2R0WH 1IM9A 5AYQA 1U95A 4XBGA 2BMKB 2KZ1B 1TZHA 3F12A 3W39A 5I8CB 4LHQB 4X7TB 4DZBB 4TSBH 4KHXL 2EDEA 5D7LB 1LD9B 4LKCB 1TJHL 2C1PB 3LKSB 4RA3A 4MNQB 5I73C 3GMOB 3PGCA 5GGQH 4GJTB 3RZCD 5IV2A 4RDQF 4P2RA 4ZOCA 3U46A 4MJ6A 4X4YA 4OLZL 1T89C 2VISB 3ULUH 3TIEA 3ULVF 2J5LC 4HIIB 4JREB 4LLYB 1NSNL 2CIIB 2DB8A 1F4HA 3VFUA 4LCWA 1RJYB 2MOVA 2PW2A 3NN8A 5C0NC 2HRLA 3O0RH 3MOBL 3PJSB 5FKAB 2O5ZL 5I1HL 1RUKL 2EEBA 2FLRT 4I8DA 2J4WL 3GM0A 3N1GC 5F21B 5C0ND 3TBSB 4OD3H 4JDTH 3UTSB 1F4YH 2FLBT 3BVNB 1Y18A 2IPKB 3B3IA 2WBJA 3VGBA 4JDZA 4X4XB 5LGHH 4MCZA 5D2NE 4OF0A 4LPUA 1L9NA 2NYYC 2VKWA 5EG6C 1N64H 4GKNB 4NM4L 3BN9C 4O02H 2R4SL 1MFEH 4ODTL 1X5XA 3SKMA 1T6VN 2R4SH 1KJVA 1MF2H 4CDHA 1OAKH 5I66A 3PGCB 4H8WL 2R2BB 3AVEA 2FL5A 5AUMB 1A9EA 1QBLH 3RKDD 4JZOA 3B8SA 3T0DA 4QF1B 4L9LA 4MA8L 1MUJA 4BFGA 3PF2A 4V1DE 1SEQL 5E0QA 4I2XB 5D72L 4Y1AB 2VB5A 3BHBB 4XXDB 5EU6E 4ZSOE 2A6IA 1ZTXH 5GRVK 4M6OH 2VDOL 1UH4A 1ADQL 1S7UA 4XPAL 1D5MA 1U8PB 5KN5A 1CICD 3V0VA 2CIIA 2L4OA 3EYFA 3OJMB 4MXWL 4DVRL 1A7RL 1FVEA 3C5SB 5AZEL 1IBGH 1RHFA 2WW8A 3NGBC 4L4JA 4BKLB 2YRZA 3J7HA 1WZMA 5EU6A 2YPVH 1EEYA 3BZFA 1RUAL 4HQQH 3D0LA 4PG9A 4KQ4L 4P57B 5B3JF 3QR2A 4TNWF 3BDYH 3GB7B 2PYFA 3O8XA 2E7MA 3F12B 3W39B 1I8LC 3BDYL 1G7MB 5DEZA 1GGYA 1S7XA 2NXZC 3QUZD 4JFEB 2WIIA 4LARH 3V6BR 2Z92B 4HC1L 4X6BA 3U1SH 3CSYB 3O2WL 1A6AA 3G6DH 1T7WA 1PG7X 2HFFB 1JGDB 4OZ4B 1EH9A 4CJ0A 2VZVA 5F7HA 3JWOL 3TC9A 4UNTA 2YPLE 1OAXH 1QEWA 1A1MA 4MJ5B 1D5XA 5AAWA 4FQHB 4GRWH 1IAIM 2FD6L 3MLWL 3GI8H 2BC4A 4ZAKD 3IETB 1EBPA 5E4IA 1KPUB 4M7LL 1ZV5A 3IKCB 4JG1H 4FQ2H 5I1CH 2ICEA 5SX4H 3PGFL 4Y5VC 1S9YA 2NTSP 4XNQA 5TDPA 1NCDH 1YYMH 1KENL 1EEZB 2BVPA 3OF6D 1HKLL 4QT5A 1AE6L 3C6LC 4XH2B 2NY6C 1V3LA 4OZIE 1YEDA 1AJ7H 1T1YA 2EXWD 4PJBE 3CXDH 3CX2A 4WCYH 1Q0YH 1UXWB 1NDGB 1XIWB 5KVEH 4FQ1L 3N9GL 3MRNA 4R4ND 5J1AB 1PAMA 1UCBL 5I73B 4L8CB 4ZYKB 2CPCA 3Q5OA 5E8EB 1T22A 3ARFB 5C0RL 3IFLL 1P2CA 1J05A 3INUH 1RULH 4DOHB 5HYEA 4OD3L 3NA9H 5DJAB 4UTBL 3BJLA 3BESR 3LDBC 3QUYC 3T65A 2Z91A 3WE6B 1I1RA 5FO7B 4CMHC 3MCG1 2PNDA 1CS6A 2P47B 4RX4D 2DLFH 2ZSWB 2HFEA 4NWUL 2E27H 4NKDA 1R5IA 4YHOL 1H3PH 1W0VA 3DETD 2W60B 2G75B 5FKAA 4YXKL 3WCYA 5JUEL 5E9DB 5DS8A 4OLZH 5D7LD 3QNXB 1JGUH 3RY6C 3LPFA 3ARVA 4OUOA 4WENB 1NC4D 4K7PX 3KHQA 1U8LB 3W9DB 4JM2D 1WFNA 4XCEA 1NFKA 4EOWH 1VGEH 4PRAA 3OAUH 3I2CL 4HJGA 4F7PA 3O41B 2W38A 1CIUA 5D70L 4XP9L 3RNKB 1CF8H 3OKLB 1AXTL 2DF3A 1A1NB 1KCRL 4HIXL 2H32B 1MI5D 4OZHF 2CXGA 2WSKA 5L7XL 4LLDA 4OGAD 5DK2B 3LEYL 4JKPH 5IK3B 4GMTL 3RHWF 5DGRA 2ZWLT 5CZVH 4P2RD 1WSST 4URTB 3BUYA 4EQ3A 4LFHD 2HRPL 1MLCA 4X6FB 3UYOD 1JYVA 4NO5B 4PV8B 3GBNH 4LCCB 1OWWA 2P7TB 2YK1H 1FAKT 4QHLB 2RQ8A 2GCYA 1J5OH 4IRSB 4BJLA 1YQVL 5D1ZD 3SKNA 3WS3A 5IVXB 4MVBD 2G5RA 2FDBP 5C7XL 2XG5A 3OKNB 5C09E 5JOFA 3HI6H 5DC0A 3QHZH 9CGTA 4M5YH 1E4KA 4KVNH 3L95A 2E7HA 4MHHI 5J3HC 4OCWL 1MQ8A 5GSRB 1JHKL 5JR1L 2E7LE 3IJYB 4TTGA 1S7SA 2DYPD 1QSEA 3KJ4C 4MNQE 1MCOL 43CAA 3TA3D 4KMTL 3H9HB 3U30B 4KVNL 1U58A 3I50L 3VFUB 3HI6L 2VO5A 2X44D 4X4ZA 4WV1B 2WWKT 1RAMA 1J8HE 1MI5A 3JTCA 1QBML 1JWUB 1TTGA 5F9OL 1CG9B 4ZQKA 3IDGB 4PJFB 2GKIA 4W4OC 4G8GD 2Q1EA 2OR9L 4PLNC 1U9KA 1HOCB 5DHVA 1GAFH 3ES6A 3OMZA 4R7DA 1D5IL 1RK0A 1UJ3C 3G6AA 3ILQC 4YH6A 3DVFA 4KK5C 3T09A 1VFBA 2P8LA 4OT1L 5D7LA 1BX2A 3C60B 1LDPL 2VLMD 4XPBH 4QXGL 2C3XA 2A83B 4UIMA 1DUYB 2HFEB 4YR6B 1OGAB 1IFHL 4M7KL 5GS3A 2R2BA 5C2UB 2ZG2A 3BZ4B 5GSRA 5FYLH 5H35B 2HT4D 2W9DH 5C71A 1FG2A 4HS6A 3OXSB 5GRJL 4LU5H 5HD8C 2P8MA 3DROA 4P23D 2X70A 1KIRA 4JY5H 1HNFA 4KHTH 1DBJH 1LDPH 3RI5K 3CSBA 5TH2B 4HUVA 4PJGE 3DJ9A 4RGNE 3FQWA 1AIFB 3CC5B 2OR7A 4U1NB 3GI9H 2GITB 1CLYL 4KPHH 3W82A 1IEBB 3GNML 2IH3A 4MA1C 4YZFE 2MKLC 3LQZA 4NQDD 2BX5A 3QIUC 3BDBA 3BKYH 3O9WA 1NKOA 4P46C 3V8OA 3PHOA 3RWGB 3O4LD 4YQXH 1CD1A 4NKMA 4G9FB 3I6LE 2MNUA 1ADQA 4YHLH 3OR6B 4GMSL 4HLJA 5I71C 3TJEH 4XCNA 5IHUL 2I07A 3QCVH 4R7NA 1BHGA 5FDWB 5T1KD 4PJHF 3UYRL 2DQGL 4NYLA 1KJ2A 2M26A 4GS7C 4YXLL 3FB7A 4HWEL 1SYSB 3RVWD 2XNAB 1NMCB 3PP3K 3RAJH 2OCFD 4EXKA 3DX7A 5KSBA 1UA6H 2ZCLH 3DMMB 4K3EL 1MEXL 4JAMA 4JDVA 3RY4A 5EORL 1IAKB 3REWB 4P9HC 5GISL 1EO8L 4XHQA 1YQVH 4XNUH 3L1OL 3WS6C 3BRGC 1Q94A 4XZUB 2NXZD 3QUZC 5E08H 1VFOA 4KDWA 4JPIB 3JWOC 4ZODA 5D5ME 3V2AR 1K6QH 3MLSH 3OKEB 3BQUC 5DK0B 3MRJB 2IMNA 2MHAA 3LN5B 4Y4KA 1D9KC 5C0DB 3D25A 5DJZA 2APBA 1CK0H 2DQIL 2H6PA 4X80H 3MLYL 1EO8H 4PJ7A 3QIWC 2PETA 5IEKB 5CEZL 3M17B 5H8DA 4G6ML 3U1SL 2XQYK 4OCRH 5BMFL 4RFEA 2CKBH 3IDMB 25C8H 2PR4H 5B39A 4TNWK 2FO1A 4GW1A 5FXCH 3MJ8B 2DL9A 5IW1A 3OTTA 2PF6A 4GKSB 1QUNA 4HV8B 1N0LA 2ITCA 4LRNL 4NQXA 5GS1C 4L8SB 5SWSA 2EC9U 1X9QA 2L7JA 3C9NB 1L0XA 3V4PH 4KFZC 4Y7MA 4FQHA 3G08A 4I4WB 4ZFFB 3ZYZA 4BQ8A 3EYVA 1WBYA 4Y4HC 4IRSD 4LEXL 2VLLA 4TVPD 2CRIA 1A0QL 5FIEA 4M8VA 7FABH 1I7UA 4IIQC 1LE9A 5GGVL 1MWAL 5ACMA 5C0DA 3OF6A 4P2CG 2XWJB 3PL6C 2VDLL 2CDEB 3LVEA 1MELA 1AI1L 4Z5RB 2UY6A 3NFSL 3IVKB 3DUUB 1ZHLA 3ILQD 5J56B 3T0AA 1CFSA 1MY5A 2GJ6B 1BM3L 3QPQD 3N9GH 4LPVA 1MIEL 5IB3B 1DBJL 1QFOA 2P5EB 1XF2B 4P57A 3O41A 1HXMA 1QBLL 4PLJD 1TZHB 2H2PD 3VRJB 2B7DT 3MCKB 3L5JA 3GMNB 1FDLL 4OKDA 4N0YH 3V5DA 3FO9A 1AE6H 3D39B 2X40A 1RK1B 5F7FA 2GAZB 5FA3B 5JDSB 4B0MM 4P4KB 5B4MD 4B5EA 5H94A 1RZ7H 3UPAA 5IFJB 1B9ZA 5SWSB 4QXUH 4PB0L 1SY6A 4Z77B 2Y06L 3ZHLA 3RGVC 4JJHA 5DJCB 4F57L 5CEXA 5KOMC 1LWRA 3X17A 3JTSA 2FIRT 3IXTA 5IKCA 1CD8A 3VFSB 5C3LD 5J6GB 4YHZL 2EDQA 3SBWC 3G04A 1PDKA 5JZ7C 4OIIH 1XCTA 2AS5M 3DTXB 3CUPB 4FRWA 4Y5YA 3HE6B 2GY7B 3X3GL 1JGEA 3VWJA 4U6XA 3W9DA 4FQXB 2YD5A 1QSVA 3HZVA 1ZGLB 3CX5K 1JP5A 3N50A 1F3DJ 1UM5H 4F7PB 4QRPA 3FQNB 4HC1H 3C2AH 5I1DA 3FQXA 1MHCB 3BGFB 5IG7B 1NFDF 2V5SA 2VKXA 3EW3B 1OF2B 1REIA 2E6QA 3GMRA 2FJHA 3RIAF 3EOBA 3H9SD 1RUAH 3JV4B 4Y19B 1KTDB 4RFOL 1YEKH 4K3GA 2C3WA 4GW1B 2GFBA 1UYWL 2DTML 4OIAA 4L29B 5CGTA 4L9LC 1KB5H 1IEHA 3MCLH 5HSFA 2A38A 4CDGC 5C08B 3EYSL 1N4XH 3BGMB 2AJVL 1ZSDA 3T65B 4I18C 3U7YL 1T83C 3IS0X 3T0EE 4MDJA 1U3HA 4ZUTB 5IBTH 2DQFA 1M6OA 4X7EC 3IFPA 4OQTH 2PN5A 5CEYB 5I1AA 1FVEB 4ALAL 3T2NL 2GTWA 5TDOB 4S11A 5DJ0B 1YECH 1K4DB 4YUEL 4PJ5B 1WAAA 2B2XL 4OFYA 2ADIA 1DDHA 4I3SL 2N4IA 3RFZC 3BW9A 4GAFB 3MREB 5D7IF 2DQEH 1U2HA 1F2XK 5F6IC 5IB1A 4LEOA 1N6QL 3LQMA 4PJHA 4Y4FB 1L8JA 1MCKA 2RAMA 4R96B 6FABH 3EYQC 4OI9A 1HQRA 2NX5B 2AEWA 3G5VB 1I8IA 3SDAC 5I2IB 4MAYB 4NQCD 4R90L 1MRCL 5IIEA 1CBVL 4KK6D 4PJAA 2FECL 4WU7A 3ARFD 2NW2B 1U93A 4YDVB 4L8SC 3O3AB 3BQUD 4XVJH 2CRYA 2ARJB 2VN7A 5IFAL 2RIKA 4LEXH 2P7TA 5KJRH 4Y16C 3IT8D 4AIZB 1GGIL 2GSGA 2GCYB 4WWID 2ED9A 2OQJA 5DI8A 5EH1A 3BP5A 4CVZA 4YHKL 2VIRA 5DUBA 4MMZC 1PG7L 4HUXA 3CFDA 2KQNA 3GJFH 2R23B 1KPUA 4L3AA 3T4AB 4D9QE 1LDSA 1GH7A 1MCCA 4EQ2A 2W91A 3QPXL 4UDUB 4KKAD 3VMNA 2LE9A 2E7LA 1S9VA 2X2YA 4RMQA 3BRDA 4L3CA 3NTCH 3MRPA 4PJXB 4MQTB 4UV4H 2ERJB 4C56D 4RGND 5CP3A 1NEUA 4FG6C 3H42L 2VDLH 4RGNB 5J1AA 5EC1A 3BWUC 5MP6H 3RPKA 1BD2D 4UT9L 4OCSL 4PJ8C 3ULVC 4ORZC 4N8VG 2KKQA 3KGRA 1JFQL 3TM6A 3STLA 2VQ1B 5JIKA 3PWPB 4PJ8D 3ULVD 4R3SB 4OZHB 5ICYA 5DHVB 2NY4D 2WBKA 2C7UB 2GJ6D 3QG7L 4ZTPL 4NO0D 4J4PA 4Y19E 1VB9A 2C3HA 4M5ZL 1ED3A 4HUUB 1BFOB 4K8RL 2AW2A 1MCLA 2IQAA 5JORA 3REVB 4LCIH 3QEHB 4YWGH 4HK3N 3GIVB 3GIZH 2GUOB 2X7LB 4NHUE 3CX5J 3CUPA 1P69B 5I1IL 4JO2L 5I1GH 5HYJB 5BOPA 1QLFB 3HG1A 5AZ2H 4UB0L 1FL3A 4QY8B 4WGWB 3MGTA 2R69L 2RCSH 2RGSA 4YO0A 1ROWA 3FN9A 1ODAA 5DVKA 2YA0A 5E2WL 1J1XH 3WMSA 2Y72A 3Q5TA 4HEPG 3MRDA 1RJYA 2A9NH 5EBLB 5B21A 1S7VA 2HLAA 4CW1A 1MPAL 4DFHA 5IVXF 3IDYC 1MRFH 1X7QA 3MRKB 3FZUC 5DUPL 5EA0H 5FK9A 4P46B 3KPQA 5DUPH 4PJ7B 2V7NB 2J4WH 4P2YA 3TV3L 4RDQG 1J88A 2JIXB 4OZGE 4L8BB 4QRQA 3UTSD 2AV7A 4QHLA 4XGZA 3BGMA 4YFEA 3K7UA 3V5HA 4O5LH 2GJZB 1IGYA 3A6OA 5D6DA 1EVTC 1FGVH 1FYTE 4QNPE 3CDGA 4U0QB 3EYQD 3GSWA 4WO4C 4F7MB 4U1SB 2VSCA 2P5EE 4IEFB 2UZIH 4HXBL 1KJMB 5EU3B 4HC1A 4H1LH 5I76B 3QAZC 1KLUB 3VXUB 5JLZA 3TFKD 2X09A 1FZJB 1RIVL 4LSDA 2ZJSH 3S88H 4KK8D 4OV6F 3KYKL 5I1LA 1FL5B 2A77H 2ZZUT 4HLZG 3JTTA 1YY9C 4GBXB 3B9KC 4EDXA 1LO4H 5CD3A 4Y16D 4HBQA 3NFSH 3L7EB 4YE4H 4MAYA 3IJHB 4OLUL 5LBSH 4PY7A 4I0PB 2CSPA 4JFPA 1ZLSL 4CU8A 2OL3H 4OZFA 4LSUL 2CDFA 3PWNB 2FX9H 2OJZH 3BUYB 1N6UA 4PRPE 2CUIA 2BSRB 4LSVH 4LAQL 4HWUA 3T3ME 2W9LA 5DFTA 1QPPA 4R3SA 2VDMH 5DJ8B 4JPWL 4N5EA 4MNGA 2FEDC 3IU3B 1OF2A 3P0VL 4P3DB 2DQCH 3DHJA 5B3JE 4RFEB 3CAFA 5DUBB 4JFXB 4NZRL 4E41A 1NFDB 4M7KH 4EI5A 5DD1H 3CGTA 2WV3A 4IM8A 3U46B 5EBGA 2VMFA 4JE4B 4RISL 5CINH 5EWIL 3SGEH 1NCBL 5DO2C 4I48B 1Q9KB 3UBXG 3BE1H 3GBLA 4MA3B 5I75B 2CJUL 2IPTH 3TF7C 1BIIA 4E5XA 4Z0BH 3WIFB 1AD9B 3NPSB 4HUKB 4ODXA 3OGCA 5IBLD 3WHXA 1I1AC 1MCNA 4OLXL 4NFBA 3ARGC 1OAUH 1N5YL 2IFGA 4X9BA 4IOIB 5KSUA 3QXUA 3NAAH 3B9EA 3W5NA 4Y5XC 3CH1A 3DUHA 4EI5D 4ZFGL 4JKPL 4UZGA 4X8JB 5AEAA 2V7NA 1M7DB 2VLJA 2JIXA 3HE7A 3ELAT 5F97E 5I19L 3WN5A 2I07B 1KXVC 4TUJB 1Q1JL 4JRXD 5E7FA 5GGSA 4M43L 2FIKA 5CWSB 1BBJA 3UTTA 4D8PA 3GIZL 2DQGH 1NANI 1EIBA 3X3FH 5IJKC 1YDPB 1FORH 3UZVB 2EZ0D 4KRPB 5AG9A 1BOGA 2BVUA 4QXWA 4EN3A 1NLBH 1JI1A 1OQOA 1U91A 3L5IA 3MLZH 1X6NA 1CE6B 2YEZB 3I6GB 4QRTB 4DZ8B 3UP1A 2M8XA 5DURD 4BM7A 3ZT6A 5EIVA 4M8QA 1X5IA 4N0CA 1KEML 2IAMD 3PP4L 4PJAF 2VXVL 1RIUH 4P2OA 3IJSB 1RJZA 1URLA 1ZWIA 4N68A 5D2LE 5HPMA 4PB9H 2QSQA 1E4XL 5LBSL 2MHAB 3LN5A 1HIMH 1LK3H 3P9WB 4BELD 5C86A 5HJ3A 1MFDH 3PWPD 1Z5LA 3ARXA 5E99H 4NJ9H 3EO9L 3C5ZD 1IKFH 1YUHA 3FOMA 4HFUH 2AQ2A 1G9MH 3H3BC 4TUKL 5IVNA 1WAAF 1BD2E 3FKUS 4JM2B 3E0GA 4XPFL 5D4QA 5FYLL 4BSJA 4N8VA 3OAZK 5GRJH 4MJIE 3QPQC 4E42B 2J8UB 1WBXA 1RZGA 1MJ8L 3NH7H 1YDPA 5JA9A 2ESVA 4HXAL 5TE4H 5L2KB 2VQUA 4OT1H 2HVJB 1GGCL 1J1PH 5D96C 3U48A 1ZA3A 4BFIB 4QXTB 1LNUB 1ACYH 2F9BT 3HMXH 2BNRA 4TQEH 2VH5H 3UTZA 3F62A 2YPLD 3S34H 4P9ML 1T89A 1OW0C 1S7WB 4JB9L 4XMKL 5BZDB 3FT2A 3DUSB 3DXAA 3THML 4IOFD 4MAUH 2ESVE 4WFFE 5SX5H 1LK3L 2R23A 2UWEA 5KVMC 3RX8A 3EGSB 3CFBB 2IPTL 1R5WB 4HZAA 1WTLA 3TCXA 4JFFE 5J6HA 1SY6L 4X7CC 1TQBC 1TVHB 2V5YA 2ZCHH 3HE6D 1MNUH 3IFOB 3ROLB 4JQXA 3U0WL 1IC4H 3DVNB 5TDPB 4AEEA 4LHUD 1BWWA 2W9EL 5IMOB 3VFVB 1O5DT 2NYYD 2DLEA 3U0TB 5DJYB 5IVOA 4KTEH 3MNWA 2WZPD 3MV8E 3WYRA 1AGFA 2MPAL 3KYMA 4LVNB 4X0KB 4ZDHB 5EBLA 1MCPH 3MNVB 4OAWB 3QCTH 3K4AA 5DQDL 3BKMH 1OTSD 2W9EH 5IBTL 5HDLA 5IGXH 2IBZY 5I9QC 4X7SH 5J7CC 3B6SB 4DUVA 3HB3D 4QRTA 4DZ8A 5ERWA 4DVRH 5BJTA 4NZUH 3C8DA 2VQTA 5IMKA 2HJFB 1FFPA 4HX1B 1HHGB 4NC0B 1FZOA 1WAAE 4NZTL 2YS4A 3LEYH 3FFCB 4YDJA 5ACLA 4WHYH 3D2UA 3Q5YA 2C9AA 2VDPH 3NCEB 1RV6X 4MB5A 5MI0B 2B4CC 5HDBE 3VI4E 4UU9A 2EDXA 4G6JL 2XN9E 3ARBA 3QNXA 3DO3A 1F2QA 4U6XB 4MQSB 3QEUA 4U0RB 4EOWL 3DURA 1ACYL 4XBEL 1KSRA 3FQRB 1VFAB 3EDJA 1UM5L 3CCHA 3KXFA 1S9VB 4FZ8L 1KFAL 2DQJH 1BP3B 2DL2A 4ETQA 4NN7C 3TO2B 1Y0LB 4NN6C 2QQNH 2P5EA 1N5AA 5IESL 3JSSA 3ROOA 2YD6A 4D8PB 5KZCB 2YKLH 4XP1H 3QNZB 1TCMA 1E4XI 5BV7L 1D6VH 3I3BA 1NGPL 4WHYG 4NQVA 3QNYB 4OCYL 4XCYB 3FHQA 1VKXA 4PGEA 2Y7QB 4GUPB 4RMTA 1KIUA 3L3JA 2EIEA 3GSNH 1W72B 2AV7B 4XGZB 4V3DB 4JO1H 4LASH 4Z7QF 3BIAX 3IDIB 1CQKA 1B0GA 5E9DE 4OGXL 4WTZG 1D5XB 3VXRD 4OI7A 4IRSA 4JPKL 4G80A 1U8OB 3WFHB 1A47A 4HIJB 3KXFD 1A6TA 4P4RA 1WIOA 1BZ9B 2ADGB 2XTLA 3EYFB 1JPSL 1NGWA 3ZKND 1FBIL 1FFQA 1FIEA 4K3HA 3W0WD 3GBML 1AR1C 1FNSL 1F3RB 2O5XL 4ZS7L 1T03L 1I8MB 2E6JA 2B1AL 5DD6A 4G59A 4R0LA 4BSWA 1FC1A 3KDMA 5EO9B 3VFRA 4R96A 1NAKH 1H0DB 4F7CB 4HKZA 5HHQB 5LGJB 2V5TA 3SDAA 4FQ2L 1BQLH 3MBXH 5LQBL 1R3JB 1U58B 3P11L 1P7QA 4D0BB 1QFWI 5DJZB 2ZUTA 5GHWH 1MNUL 2B5IC 4PRPD 5MENE 1Q72H 3BKYL 1T2JA 4JKLA 2Y6SD 4P5TD 5FOBB 4NRZA 3ULUE 5B39G 1EX0A 1E4WH 2YN5A 4F7EA 1A7OH 1A7QL 5L7XH 4ONGL 1YC7A 4X7TA 4ELKB 3BKJH 2FIKB 5DD3H 5DLMH 3CK0L 5I17B 3SDCA 3LKNA 4MMXC 4P99A 4LHUG 3KPRD 4JY4A 2F5AH 3UMTA 4RGOL 4QOKE 4E41D 3KLAB 4OGZA 25C8L 1FRGL 1QA9B 4M03A 1CGXA 1LE5B 4ZD3L 4POZC 2D31A 3FB5A 3NIDF 3VH8B 4XCFH 1I75A 1TZGL 2X70B 1GGUA 5DEGB 5GZNC 4MYWB 5HGBB 5I1IH 1XF1A 1MH5B 2NZ9D 1OB1A 1I9RL 1RZFL 2F5AL 2X4TA 1EUTA 3ZT7A 4FQIH 5D1QB 4PUBH 1MCHA 1UM4H 3QG7H 4ZTPH 2CDGA 4S1DD 4K94C 4JQVC 1K4CA 4AENA 4WEUD 4XPHL 5F9OH 1YUHB 3FOMB 5FOBA 2YOCA 4IOFC 4PGJA 1AXIB 5GISH 5CJXA 1RZKH 4YBLC 2NQCA 3JUZA 3LRGA 2C4FT 2V5MA 4I2XE 5GGSB 4PJBF 5JXAH 4L4VE 3MBEC 1YEFL 4RBPK 2ZJSL 5LVEA 3VG9C 1VEMA 3SO5A 3WKMH 1EZVX 2A77L 4OCMC 2A1WH 4NSKB 4Y5VB 5EIIA 2B0SH 1IAOB 4P4KD 1NFIA 1ZANL 4N0CD 3TA3C 4C57C 2NXYD 3P9MA 1JV5A 4HXBH 2NY1C 3QEQA 2IG2L 1F00I 4FZEH 3G5ZB 3OB0H 2OZ4A 4M00A 3VGFA 1F8TL 3QUYD 2DM7A 2X4TB 4JO3L 3RWJA 1KB5B 5I1JH 4DK3A 3SDAB 3FN0L 1UC6A 5SV3A 4F37F 1MFBL 5I30L 3GKWH 1I1YB 3FZUD 5HGHB 4YHKH 4G6FD 1ZK9A 4G8GB 1JPTH 1PSKL 1AO7A 1DLHB 4HIEA 5IR1B 3ZYIA 3OWEA 3KVQA 4PTUA 4XNYL 1YYLH 3JBG7 4DCQB 4PRHB 3O3EA 2VAAA 1P4LA 4PLKD 3DPBA 1FIGH 1S7TB 4HBCH 4ZAKA 4E42A 1NGPH 3EO0A 1B2WH 2VLME 3D9AL 3JWDH 4JZNB 4DZBA 1JJUA 2C1OA 5JW5B 2EYRB 4OBSA 5CINL 4J4PD 2I9TB 1TJIH 2EDNA 3QEHA 4M7JH 5I66B 2FGZA 2H9GB 5HHMD 1AKJB 4DN4H 3ZE2F 2OMNA 1BF2A 5DVMA 1XF4A 3DROB 4EZMA 3QXAB 1CK0L 3TGXA 3CVIH 5EOCL 1E4WL 1GXEA 4AH2A 3CU7A 1QNZH 4NPYA 1D6EB 5DJ2B 5GGTA 5F3HB 1ZVSB 1IL1B 3NCCB 4YPGA 3VD5A 3OAYK 1MCIA 2Q20A 4L9DA 1N0XL 3QEUB 4ONHA 3LV3B 3S9DB 2BSRA 4HF5H 4IMLA 2GHWB 3VMPA 1E27B 4LHUA 3RWCB 3VXTA 3T3PE 5JO5A 5IQ9A 1FC2D 2EDKA 2P5WA 5C9JA 1NLDH 1UB6A 4Z76B 3RVUD 5FYKE 4HMCA 3BI9X 5IBUG 5TDNB 2GJZA 4XP6L 3MNVA 4O02L 1TETL 2D9CA 4OCXL 5IIEB 3BT2H 3RTQA 1NBVH 2E9JA 3WXVH 4GRLC 3SCMD 3KLAA 3B5HA 5K9JL 4NQDA 3H0TA 1TPXC 1U41A 1ZT4A 1ITBB 4M61B 4XI5D 4PD4J 5DFVD 4YUEH 3TH4T 2UZIL 3P4LA 1JUFA 1QFWL 1VADA 2DQUL 2HJFA 4U2ZA 5DA0B 2IBBA 3SKJL 1K3IA 2XZQL 4R2GC 2Y6SC 4QCIA 1XGTA 2EEDA 3HC3H 5EBWA 3VWKC 1F11A 2PXYD 2BOCA 4P9HH 3UTQA 4KKCC 4KTDH 4TOYH 3LQAL 4JFFA 3T0WA 1DANU 5D2NC 3K1KC 5C6WH 2WMPA 1RZKL 5IJVA 4K94L 5CSGA 1D9KA 5HHVH 4U6VL 3V4PL 4P59L 2D03H 4X8JA 5CP7B 2XV6B 4N9OB 5HY9A 1ES0B 1XH3A 2FHBA 3TCLB 2AJZB 1M7XA 2EE2A 1T66C 3CPLA 5HHQA 1NCUA 3PWLA 3QUXD 1HQ4B 3OKDB 3VGAC 2MQ0A 3GMPB 1QLEH 4RGMB 1RJLA 4KHXH 2H32A 1QP1A 4Z7VF 2JB6B 3S37X 1KTDA 3OB8A 4PJXE 4JRXA 5CBAB 5EIQA 3SEPA 4Z6AT 4HWNA 43C9A 1OP5H 2EIBA 2J8UF 5JW3L 3LHPH 2OX5A 2ZUXA 1NANH 1L7IH 2EDBA 2P44B 2Y5EA 1IGJB 5C2BL 3V7AE 2DBJA 1LHZA 5FO8A 1HILA 4TVPL 3G5ZA 1SM3L 5CBEA 4ALAH 4ZTOH 4X4ME 2JJTA 1JNHB 2IALB 2VL5A 4GRWE 2FEEI 3MROA 3IKKA 4NRXA 3AXLB 4LPXA 2EO1A 2ZUVA 3W0WE 3KNBA 2DDQL 3E8UL 2G60H 4NKDB 1DEEA 3WIHH 4D9LH 4F58H 3MRJA 1YEKL 3TYFA 2P5WD 4Z5RA 2ATKB 3S7GA 4YEFA 3BW9B 1CXHA 3KYAA 2YHGA 5E7BA 4F2MB 3QQ3B 5E5MA 2NY7H 4XMLH 4PJ7E 3NPZB 1GCFA 4JM2A 3PWLB 3UAJC 2GEEA 2BY3A 3FRUB 4PRAB 4FP8H 3MYJB 3M17A 2OSLB 3PWJA 5KSAC 2R1YB 1TJIL 1LQSR 2VXSH 1FVCB 3GSXB 2WUBL 1B4JH 1AFVH 3DVGA 4LF3B 3MNZB 1FCCA 1X7QB 3MRKA 3QNYA 4JHZA 4HFWB 5MEND 3K74B 3VA2C 1E6OH 4LSPL 4ONGH 1WVZA 3MLYH 3ULUC 4JFDA 3HAEG 4PJ5E 3RL1B 3JTSB 1UKTA 2HRPH 3LMJL 3MV7A 4M8QB 1IT9L 3KPNA 2AJSH 3EFDL 5J12C 1Q72L 3O2DH 3GHEH 5J6HB 3KPRE 4N8CL 1AR2A 4PJBB 5FA4A 5I16B 4U4BA 1YMHB 3AB0B 2J8HA 2G2RA 4PRID 5D70H 3UBXB 2EZ0C 4YC2C 3SGKA 4A6YL 4FQXA 3QULB 2BXZA 3VWJC 1QRNB 2Q7YA 2V17L 5D7JA 5DEGA 3MUY1 4XPGH 3UAJD 4QRPB 3GSVA 5DJYA 1UB6B 1S5HB 3LIZH 5EU5B 1DBAL 4JFZH 5BS0B 3MLVL 3HR5A 5FUCE 3RWJB 4LDLB 4OD2B 2R0WL 4J8RA 2D4FA 4XPFH 2CDGB 5EO1B 4A6YB 3TBWB 4TYUA 5GGVH 5B22A 2DQEL 2HJKA 3G9VA 4I3RL 4AL8L 3Q6GH 4WFHE 5D7SL 4NQDB 2VOTA 4JN1H 2X4QA 1S9XB 4QF1A 2GK0A 3ZTNH 3MA9L 2YMXL 2QBWA 2OJZL 2OTUB 3OKKB 3UTZB 1QBMH 1SEBA 1CL7H 5GGVY 3B83A 1F6LL 1F11B 1BFOA 3SDCB 2GTWB 5TDOA 4FA8A 5IQ7L 4NO3B 5CILL 1EV2E 1BWMA 1BJ1J 1ACZA 5F96L 4IRJB 3ZZ1A 4JRYA 1Q0YL 3BH8B 4OUUB 5CAYB 1DQLL 4ODHH 1A7PH 4YEEA 1JHKH 1EEUA 2D7QA 1VFAA 2EXWC 1JV5B 3LIZL 3QUXC 3IJYA 3A0OA 1WEJL 1JWMA 3VGDA 1KENH 4EXPX 2X89D 4L3EB 3TWCL 5I1DB 4ZPVA 1MQKH 3CDCA 3EAKA 2DWDB 1J18A 1A4KA 4X9HA 4H0IA 5TH2A 5ETUB 3SCMB 2FJHB 3MLXL 2YD2A 3AFLA 4FFZL 3JV4A 4Y19A 4RNRA 4X5WA 1PQZA 4G8EB 4HSQA 4D2NA 4K07A 3O3AA 5K9QI 4D9RE 1NGXB 2LVCA 2H1PL 4IMLB 2IAMC 3LKPA 5CJBA 2A73A 1CFQA 3HLAA 4K3DL 3HI1A 4YNYB 3IDXH 3HZKA 3I9GH 4F9PC 5BJTB 5EWIH 2CK2A 3TO4D 3FB6B 4PJ9A 1I4FB 3QUMH 3EOTH 2NW3B 5GGQL 1NJ9B 5ID1A 4W4NA 1X5ZA 4PS4L 3MJ8A 5IW1B 4MJ4A 3U4BL 4ACPA 2H41A 5A2LH 5EORH 1FHGA 4GQPH 3E2HB 4NSKA 4Y5VA 3F7YA 5EIIB 1BQLL 3MBXL 4O4YL 1K4DA 4CMMB 3G9AB 5GZND 1AGDB 3UYRH 4H88H 4XRCB 2ADIB 2OBGA 2WANA 2Y5TA 3C6LA 2IWGA 3UO1H 4P23C 3BGFC 3B9DA 2ICWB 4LP4A 3VA6A 4GKZB 4NCC2 1J1OL 3ULUF 1R3JA 2K7PA 2OSLA 3PWJB 4Y2OA 2DKMA 3G5VA 1BQHB 1KGCE 5DJDA 1FVCA 1UXWA 3RWFA 3ROOB 4OD1H 4ZUUA 5C0IA 2J8UE 1DR9A 3BO8B 3K46A 2F53E 3LQZB 5DD0H 5EO1A 3EZ8A 5ISZA 4CAGA 4ELMB 3DUUA 1B0WA 5E2VH 4I3GA 1CFSB 3C5ZB 2C3VA 3BPNC 3CMOH 1WT5A 3MRIB 4OV5A 3WIHA 3VXSD 3TYGL 1PEZA 2EDFA 1EGJH 3TIDA 4AG4L 1C08B 2R1XB 2VDKL 4OZFH 3S3JA 5EUOE 1TMCB 1MF2L 3RDTB 1BVLA 5FKPB 4ODVH 4MA7L 1WK0A 1GGTA 1P5UA 4NYLB 4NUGL 5I16A 5HDOA 2C1PA 4PJXF 3LH2H 4U2YA 5L9DH 2HN7B 3S4SA 4Y4FC 5EUOF 1BLNB 2CUMA 4S1QH 1U8NA 3EYOA 3W5MA 2FJGB 1XGTB 4TRPL 3V7AG 3L6FA 5HHVL 1ZHNA 1JVKA 1K5NB 4P59H 4HJJH 1UZ8B 2W65A 1IL1A 1JL8A 2NY2C 1WBZA 3QH3A 1K8IA 1SMAA 1DQDL 2XZQH 1GGIH 3IAQA 3EUUA 5CP7A 2CMRL 1ETZB 2W0FA 4PRHD 4NO5A 3QUMA 3G6JA 2WBJC 1IZKA 3U2SB 1I3GL 5LGKA 2G5BB 4U31A 3V0AC 4HS3B 3KYNA 1TJHH 1CVRA 4WO4A 2X4OB 3QJHB 4R8WH 5AYUL 3CD4A 1XGPA 3VXUA 1QD0A 1U6AL 5J13B 3P4MB 4DQOH 3HZYA 5H94B 5JUEH 1KYOK 4GBXD 4TULL 3N06B 2EH8L 4LLQB 1A8JH 4I1NB 3L3GA 5K9QG 4GBXA 3E6FB 2WWKO 1IQDA 4JREC 4PRIE 4LIQL 3K4ZA 3BP7A 2VZOA 1X5LA 5TQ2L 4DAGH 1P9MC 5JIPA 4Q74A 2HT3D 2P43B 4XXCC 4K2UH 4DGVH 1G7QB 4PJDB 5GS2D 2JLLA 4QTIH 1XCQB 2IFFH 4OLXH 2VTFA 2P5WE 2EDOA 1RULL 4MD4A 2OYPA 3EHBC 3MREA 5ISZE 4J3VA 3QHFL 2Y23A 2IQ9L 1PKQA 1JNNL 4FFEX 3O6LL 5F7EH 2HKHH 4ETQB 4CADA 1S5HA 4FQ1H 3CZFA 1UYWH 3FQXB 1KCRH 2XZCH 4IRJD 4FQJH 2KQMA 4LF3A 4Z18A 1OGAE 1ZE3C 3H3KA 2VABB 3CNKA 4RFNC 4WJ5B 3PABB 2BK8A 5EC2A 2F74A 5FGBC 1E6JH 4G9DA 4ERSH 5D2LB 5F70A 3SE9H 4HJ0D 3D5OF 1RMFH 2EC9T 3RZCC 2OTUA 3OKKA 3OGOE 4K94H 2YD4A 3T0XA 4G5ZH 3VXRA 2VDNH 1R3IH 5C08D 2JE8A 5H37G 1ZVSA 4I0PC 3CFBA 3DYMA 1H3XA 4YPGB 1C1EL 5DQJA 4HCRA 1I1AA 4MJIA 3TO4C 4CU6A 4XCCH 1F90H 5KBNC 4Y4HD 4WHTB 1DTUA 4PJCF 3MR9B 1TVBA 4MD4B 1ZHBB 4UI2A 1ZTXL 4WDIB 3KJ6L 2HTKD 2H6PB 3BGAA 1QTYT 4K7PH 2ZG3A 4JRYD 3HS0A 3Q6FA 2A9NL 4RWYL 4OQ1A 1DBBL 2B0SL 4FMKA 4PJXA 4UOW1 2GIYA 4NKOA 1AHWB 4MVBC 3WN5C 4M7ZC 4NUGH 1J0ZA 1BBDL 1CXLA 5E6ZA 4XCNB 1G6RB 5E03A 4XP6H 3U6RA 2P49B 2VABA 4IS6B 5I8KH 3PGFH 5FYLD 4WU5B 4P2OD 1PFCA 1YPZE 3CIQA 2DQDH 4W6WB 6FABL 4UT6H 5D5MF 5INDA 1U8HB 3H0TB 2X4QB 1A7NL 4MJID 1IKNA 1QSFA 5HVGB 4FXGA 4K9EL 2XZZA 1FFRA 3X14B 3ILPB 3KJ4B 1IGIH 1FNHA 4M7LH 4FG6D 1E28A 1BEYL 3WS6A 3DV4B 4QWWC 4TVSa 4NKIL 5ADPH 2IANA 1J0YA 4LIQH 3NPSC 4RAHA 3NACH 2HKFH 4PREB 2NLJA 1Q9WB 3TN0D 3PHQA 5C0CE 4GW5A 1QA9A 4TULH 4C83B 5L8JB 3TBSA 3IVKA 3LCYA 4LRIA 3ZTJG 4U1KA 2AK4D 3VXQB 4HK3J 3BEWA 4HAGA 4HPOH 1DJSA 1JWMB 3HG1B 3AM8C 3CCHB 4X99A 5I8EB 5KS9F 2KH2B 4QHUB 3H7BB 5C0GA 1KEGL 3R06A 4NQCE 4ZFOA 5EUKA 1IAII 2E8ZA 4JM4L 4RMRA 4OD2A 1KCSL 5DJ6B 1Q9LB 8FABA 5DJXB 3GSNB 2B4CL 2BNUB 5EZOL 4D9RD 5T33L 3IDGA 1GZPB 4PJFA 4Y2DA 4ORGA 4PGEB 4F33B 4M5ZH 1ZEAH 5HD8D 3O11B 3A67H 5MEQA 3EZJB 2Z4QA 5FO8B 4NWUH 4PY8I 4LK4A 3D0VA 1YMMD 4U1HA 3OHXB 3K2MC 3IAPA 2AJ3A 2R1XA 4WI2A 1IE5A 5HYFA 2P8LB 1YMMB 5CKAA 2AKRA 3RP1A 2C7UA 4PGZA 3HAEH 2VIRB 4MXQD 3S35X 5EU3A 1CCZA 4UILH 3TYFB 5C0AA 5F7MC 3OAZH 4C83A 4JM2F 1G0DA 2ATKA 5F7UA 3WSQL 5BV7B 3RVTC 5BVPH 5E56A 2ZUYA 4JPVH 3TNMB 1X4XA 3KPTA 4UBDD 3CVHB 3FQNA 1MLBA 1G9EA 1JZ7A 1ZANH 1OAKL 4MCYB 1ES0A 1XH3B 4JM2C 4M6MH 1KCUL 3WO4C 5TJWK 1KGCD 1KCUH 4KJYA 1A4KB 4PJEE 1YEFH 5KG9A 5CHNB 3RU8H 2YZ8A 3S3SA 2VLRB 1B4RA 3SDAD 1DEDA 4XCCL 5E24E 1T0NA 2GFBB 2QQLL 3GDBA 1MWAA 5DFVC 2UVEA 4JCMA 4G6FB 2YA1A 2ZKHL 1R0AH 2GW5A 4HUNB 3BH9B 1YECL 2C3VB 4ELME 2A73B 4ZSOB 4JFDB 1MJJB 3ARTA 4OFIA 5EU7C 5GRUL 5TGBB 1CGUA 3S36L 2X4PA 1KCVH 3P4OB 4ODSH 4AMKL 1GRWA 3UJJL 1TNMA 5BVJA 1I9IL 4R7NB 5E8PA 1CFVL 1UM4L 4M62H 4WTWA 5C0CD 1OAXL 4OF6A 1KCSH 1EGJA 1MY7A 1OCWH 2HTKC 2RB8A 1AC0A 4Y5YC 1QR1A 1VGKB 4F3FB 3MR9A 3ARBC 4HK0B 4KJWC 3BZ4A 1BQUA 5EZOH 3QZWG 4U7MA 5E5UB 4NQED 2DYPA 2GYSA 2CLRA 3VXUD 4KMLB 4PJIE 1S7SB 5EZJA 2YPKA 4KXZI 1ZHNB 3AS2A 2OJEB 3UTTD 3D0LB 3VRLF 1N6QH 2UZYB 4NPYB 3DX8B 1KEGH 3GB7A 3O8XB 4LL9A 4LOUD 5CJ5A 5FFLA 3IRPX 4KV5E 2SEBB 5JIHA 4QTIL 1MWAB 2HFGL 1ORSA 4HS8H 5K93A 1U93B 1P5VA 3O9WC 1J05B 4N1EA 4EUPH 1CFNA 2VZTA 4KJQD 1S9WB 4P5MA 4E0RA 3O81A 3P9LB 3E6HA 3ILPA 1KYOJ 3QO0A 4ZUVB 3ARDC 1V3JA 3FN0H 1MEXH 4JO3H 3GSUA 4C59B 1G7LA 2ZPKH 4KRNA 3L1OH 4GLRH 4U3XA 3ZE0E 1W8NA 4BFEA 1OARH 4LKCA 4XWOD 1U2CA 1ZT7B 4KDTC 1NGQH 4XPTH 1P4BL 1S9YB 5C08E 1NUNB 1S7RB 2Q3ZA 2QQKH 1R3HB 4UQ3A 4C56B 3NZHH 4QHNA 3KS0H 2DJSA 3G08B 2UVFA 4C55A 4LVHC 2ZCHL 4P2OB 3DYPA 2CUHA 3FQWB 4LQFL 4KKLC 4YIQB 4MJIB 4ZS6C 2XXMB 3HPJB 5IFHH 2L7UA 3FAXA 4JHWL 5HGHA 1CFBA 1ZKAA 1FYTB 2QLVB 1MCDA 4TPRL 3TH3T 1J5OL 4YGVA 3LOWA 5FYJU 1ZHLB 4QHMB 5FO9B 1T0PB 3RWDA 3VJ6A 1AO7D 2XA8L 5D7KE 4GRWF 5BQ7B 1AD0A 3LEVL 3CPLB 2EH7H 2APFA 3GNMH 3TBVB 4N8VB 4CJ1A 2G5BA 3VXME 4H1LB 4PJ9C 5GSVA 1KTLB 4TUJA 4FFYL 3TBTA 5I1EL 3KPMA 2BERA 1DBAH 5D7LE 5ESQA 4JR9L 3HPLB 1H3WM 3C09C 1TZGH 4R4NC 5HI5D 4JR9H 4MNQA 4UIKL 1C5BH 4LSTH 4PRNA 1ZGLM 2Y5TB 3C6LB 4XP5L 1RUMH 4PJIB 3TJHC 1FE8H 4X98A 1B88A 43CAB 3DBXA 2D03L 2IMMA 3MTRA 5D6CA 2P45B 5ANMB 4J1UB 3VFNA 1IAKA 1EMTL 5IKCB 1OB1B 2YUVA 1MI5E 3UPCA 2NXYC 4Y4HA 1R5WA 3AXLA 4WFGE 4TPRH 1AQKL 3OGCB 4NM8H 2VLLB 4X80L 3AAZB 5EBMA 1RIUL 5FB8A 5KTEH 1KEMH 3ARYA 4IDJL 1XF3B 3PUCA 1FL6B 1JTPA 1FNEB 3HZVB 1YEIL 1S9KC 4ZUSA 4JHAH 1AHWA 4PJCA 4L4VD 4G8GE 1OL0A 1EJOL 4Z7NF 2LAGB 3NCYS 1GIGL 3D87B 4NNXA 3O4OC 2PW1B 4GG6F 2J8UA 5B39B 1G7IB 2FJFB 4XTRC 5F9AC 2HYMA 3UC0H 3W81A 1L0YA 5CMAB 5ID0B 3D39D 4V1DD 3VW3L 4Z7VA 5EZIH 1Z0MA 4OLWL 4RRPG 4V1DB 4D9QD 3FT4A 5HYQA 4PJEF 1V8HA 2BNRD 3OX8B 4YAQB 1DQQA 4WUKL 3MGAA 5CEYA 4L4TD 4KJPC 1CICA 4YFDB 5HYSA 1FO0A 5TPWL 4XX1G 1WWWX 4MX7A 4NQUA 1XF3A 3PWUB 5HGAB 5AWNH 4Z0BL 5HI3C 1EHLL 1CF8L 2X4SA 4WFEE 1AR1D 1DLFL 4NQDE 2A0LD 4X99B 4L1HA 5I8EA 1FE8L 1CLYH 4KPHL 1NBYA 4DVBA 3NCJH 1T1YB 3UX9B 3TO2A 1GGBL 3DI3B 2VLKE 1AD0B 3G5XA 2AEQH 4RISH 3GSUB 4ZAKC 1B6DA 3PQYB 1OAQL 3VXMA 3S96B 3KPSE 1DE4B 5I0DA 4NZRH 3MRQA 3SGJC 3ZDYE 2AXGA 5HHMB 4QEGA 5I1EH 4NDMA 3QFJE 5EN2A 3BXNA 3ARFA 4ZS6D 3C08L 2I24N 4ETYA 4GUPA 1XR9B 2ILLA 4GFTB 3KPOB 1G7PA 2HFFA 4J3OC 2EKSA 1JPST 4EVNA 1Z3GL 4LFHG 3HA0A 3U4EB 4LLQA 5HYQB 3GHBH 1IGJA 3OX8A 4YAQA 4ZXBC 1HCVA 4MXQA 2YMXH 5CCKH 4JGJA 4YQXL 4PTTA 5CJOL 1ZLSH 2UWEE 4JFHE 1X3DA 4JQIL 5DK0A 4Y4HB 4GAJL 1E6OL 5GRUH 3S36H 4RX4A 1I8MA 1CD9B 1K9TA 2FGWL 3JUYA 3LD8C 4XNQB 1M1SA 4PLOB 3QCTL 3Q6GL 4OQTA 3QEGH 1QSZA 3D48R 4Z76A 3ZE0F 4WUUD 3U0TA 1NBQA 5C6PB 2CRMA 1Z9OA 3VFMB 1P1ZA 2W59A 3N1PC 3ZL4L 1DE4A 2JCCA 2ATPA 2UV3A 3RTQB 3U4BH 5KSAD 3KPMB 2C1OB 3CXDL 1Q9OA 3RTQD 1PX4A 5DD5H 4G8EA 1ORSB 4EJ1C 3UEZA 5KZCD 4L8SA 2OTPA 4APQB 3PGDA 3PV6A 3QHZL 1IT9H 4K71C 4K55A 1WZLA 1M4KA 2YD9A 5JNYB 5D5MB 4X7FC 5FHBH 4X6DB 1T1ZB 1AP2A 1KLGA 1RI8A 4N1HB 3MJGX 3IGAB 3MRRA 1XGRA 4R6UA 1MPAH 3GI8L 1M6OB 1TQCB 2AP2A 1F97A 3EJZC 5I1AB 4WVRA 4NO2A 5D2NA 3CFEA 1VGKA 4F3FA 3CLEH 3OKMA 1TVBB 3Q1SL 4OLVH 5T1LD 3UBXA 3RKPA 2NY2B 3D6GA 2AEPL 1ZVYA 4I9WD 3RWEB 1EZVY 5T1LA 1GGCH 1JWSB 3QUXB 1NQBA 2PTVA 1QSEB 5E2WH 5KSBE 2E7LC 3CVHA 4KQ4H 2H2PC 2NNAA 1WCQA 4MCZB 5IQ9B 4XBPA 2JB5H 3RUGF 1HZHL 3HR5B 2NCMA 4NFCA 1V3MA 1A14H 3HPJA 4NFDA 1HXYA 1FZKA 2DI9A 4WW2A 2CKBA 4PBXA 5IHUH 1FLTX 4H1LG 4LAQH 1IC5H 4U6HA 3HNSH 1MOEA 4ZTOL 2KUTA 1H3PL 4YXKH 1SM3H 3EOAA 1FH5L 4LSVL 2O5YH 2VSDA 2XN9B 3LEXA 5GHWL 4OZFG 3EBAA 2V2WB 4ISVB 4EI6B 2XY1A 4HWBL 5LKNA 2JJTC 4PJ7F 5E8PB 3FRPG 1P7KA 1X5HA 3MXWL 2NY4B 4HD9A 4HUWA 3VFOB 4G7YH 3Q48A 1FNLA 4MQ7B 5GGRY 5I15L 4IJ3B 4OCSH 4TTDC 1L7IL 3INUL 5F1SA 3DRQA 2QL1A 3DVNA 1UWXK 1G9MC 5D1XA 4QRSA 4K23H 2YUZA 4MNQD 2WQ8A 3QJFA 4ZNCD 2WP3T 3SOBH 2NNAB 5LGHL 2V17H 3MOAL 4NN6B 5GRWA 3TCLA 3S35L 5CD3B 2P8PB 3KYMB 2NMSA 3L7EA 3VFMA 4R4BB 5I74B 1B0RA 1BVKA 2ZSVA 3BZEA 3V5DB 1IEAA 3K8MA 1HXYB 4WRLA 2SEBA 3AAZA 2XG4A 1MI5B 3UDWA 3H9SE 4ZFGH 3UROR 4OZ4A 1Q0XH 1CL7I 1U8HA 4Y2DC 5BRZA 3JXAA 2MQ3A 4DN3H 1PD6A 3QDMB 5FGSA 1DQMH 1DVFD 1UZ6E 4AQOA 5H2BB 1KT2A 1S8DA 3BPNB 1DQJA 2Q6WB 4PD4K 4LNRB 2JJSA 3GHEL 4CMHB 2C26A 4L4TB 2A6IB 1UEYA 4HS3A 5MHSE 5BW7C 1OQXA 4BQ6A 1VFBB 3BOVA 1XGUA 2CRZA 4KUCF 3TN0A 4Q7DA 4L3EE 5IESH 3I50H 2E8YA 1UCBH 2AABL 4H0HB 1QG3A 3T0EA 2AJUH 2B39A 3DETC 3OG4B 1AKJD 4OLWH 1MAJA 3WJLA 2EDYA 1FG2B 4Q9QH 1ZGLA 1KPRA 4OTXH 5HHOE 5CKGA 3VG0L 4LCIL 1CYGA 1YNLH 4PJAE 3C8KB 2UYLA 5J06A 5GIRB 3B2VL 4P2QE 4PV9A 4TSBL 4X5LA 3SKOB 4A2MA 2X05A 4ZFOB 4I3SH 3FONA 4NT6B 1A6PA 1I1FA 5CEZE 2JKXA 5E6ID 1X6LA 4NKIH 5ADPL 2YC1A 1QBBA 3SY0A 3T8XB 4X9FA 1OP9A 4IHOA 1JZ5A 4M1GL 3EDFA 4TVPH 4YGVB 3CFCL 5B8CA 1FG9C 4RAUB 1MFCH 4M1GH 4UOJA 1MFCL 4JKKA 4MLIA 5HYIA 1E0OB 5SX5K 5L8LB 2XY2A 2VDOH 1UG9A 3CDYA 4HHAB 4I13B 4XB8A 3O2WH 3QA3A 5MP6L 3PABA 1W8OA 1EERB 3LKSA 3BP4A 3HAEB 3KYKH 2NR6C 5BZWB 2R15A 4H8WC 3M1BA 1T20A 4AM0A 1HWGB 2XT1B 3VDBA 1NFIB 4WUUA 3SPVB 1TTUA 1YC8A 2VRAA 1I3VA 2BY2A 2IGFH 1BBDH 2BNQA 3AS1A 4L8DA 1AGEB 4U1MB 5AYUH 4I48A 1CR9H 3EYVB 2EC8A 4AH2B 3MSPA 1T80A 3OKLA 4LLWA 5EU5A 4AIXA 1Z9LA 4FTVE 2RFXA 2BCKA 1G0XA 4YHOH 2WINB 4QO1A 1XIWA 3IU4L 5BRZD 3MV8A 5D8JH 3WUWB 4JFQB 1NGZB 1UXSB 3K1DA 4WUUE 1ZHBA 4GQ9L 4LKXA 1CFNB 3DI2B 3SE8H 4YDLB 3KPPA 4BUGA 1ADQH 1U3YA 1UVQB 4CU7A 3QIWA 1BJ1H 4M4RA 5LAXB 1R0AL 4CUCA 3JWNC 5DMGD 4ELKA 1I4FA 5KANG 2R2EA 4XBGB 3BP5B 4CVZB 2X4OA 1U0QA 2QQNL 3PWVA 2AGJH 5IJKA 5J8OA 5J3HD 2GUOA 1UACH 2X7LA 2IPUK 4N0RA 3SE9L 1XIWD 5CP3H 4KDTA 5T3XL 3LKQA 4Z0XA 4OJFH 4UBDC 2ZUQC 4HK0A 4DKAA 2HKHL 1XF4B 5MEOA 2NY0D 1FLRL 1JHTA 1HILB 1ZLVK 35C8L 4P2QD 5IM7A 4ODVL 4F7CA 4OIBA 5DURB 2VITA 2FGWH 3WO4B 3B9KB 1LMKA 2AAVA 2ZUUA 3SKOA 2BOCB 3ETBF 2E9IA 2WBWB 2XIDA 2NXZB 2DS4A 1C1EH 1ND0A 5C3TA 3AGVA 3A6CL 4D0DA 4NUJA 4NBZB 2EIZA 4FQIL 5DRZB 1JF1A 4H20H 3KPPB 3MV9D 1K85A 5JHLL 1LP9A 2LVEA 3CFCH 3CZJA 4G5ZL 4MS8A 5HGDB 2J6EH 1IGFH 2Q87A 2DBLH 4JZJB 3MBED 1KC5H 1C08A 3MPCA 1S7QA 1MCPL 3OJDA 2DKUA 4KDVA 5JQHC 3D3VE 5CJ8A 2HAZA 3MRQB 5E9DD 3F7QA 3QEQE 5BMFH 5LCVH 4JY4B 1M71B 3JWDL 3C6SA 4YBQC 2BHUA 3VFGH 1HHHA 1KBGL 2PR4L 1NC4B 5E6IC 3BRFA 1XGQB 3EFFB 5ELIA 1CGSH 4BQBA 5AD0B 4L5FH 5FV2A 3RRQA 1U8QA 3WLBB 4Q2ZB 4U3HA 4NP4L 5F3BA 1JPFB 1II4E 2F5BL 2FECI 2FSEA 4YFLF 3DBXB 5CEZH 2DICA 2J88H 3RL1A 3I9GL 4JFYA 5IM7B 3PP3H 5GGTH 3ARRA 2HP4A 1SJHB 2ICWA 4S1SL 1V5JA 1EHLH 5T5NG 1QLRA 4I77H 2IBZX 2HKFL 1DL7H 1K8DB 4MSWB 1A7QH 3CFIC 5DJDB 3GKWL 4U6TA 1MVUB 3TNNA 5DGQA 4LLMB 1C7SA 4Y89A 4FABL 4UU9B 2VH5L 1EFXD 1ETZA 3L3HA 5B8CB 3LQAC 1F4XH 1BFTA 1N59B 5T1DL 4JZJA 2Y36L 4QXUL 3WV0A 1FZMB 2PYEE 3K8LA 3IDNA 3MBEA 4DWHA 2EDHA 5DVOA 3DSFL 3QIBA 1A7PL 2F54B 2P5ED 1RJLB 2EYRA 3WKML 5FUOL 2XI9A 3NABL 4F7MA 4P49A 1J0IA 4EBQL 4GW4B 4DEPB 5DT1L 3QAZB 1HHHB 2MCPH 4X5XA 4HGKC 4H5SA 5ICXB 2RR3A 1RIHH 4OZGB 3DMMA 4GRLD 5BVPL 1T5XA 1NDMA 4K7PL 3ZDYF 5E00B 4WGVB 4ZUWB 1YNKH 2XICA 1ZSDB 4KAQL 1TTFA 2NTFA 4M48H 3W9EB 2UZXB 2ZSWA 4Z8FH 1TQCC 1RVFH 2FYYA 4ODXB 5EPMA 4ZUTA 5SWZD 1J8KA 4JCLA 5DHVH 1VFUA 3PL6B 3BH8A 5A3ID 1IQWH 3O3DB 1QZ1A 3ROLA 3SDXF 2ICEB 1JZ8A 3MJ9A 4XP4H 4OCNC 1UWGL 3GO1L 4RSVA 4F7TB 1LO0H 2YPKB 4XCFL 1IM9B 2CKNA 5DR5H 1KPVA 1QFUH 3U2SA 3C8KA 3D3VD 1YZZA 5KSAB 3U4AA 3OJDB 3R8QA 1J86A 4XPBL 3HI5H 5BS0D 4HDIA 3GSNA 4WW2B 1IGMH 2ITCB 3MZTA 4LSRL 4RWHA 2X1XR 4KI5C 1MLCB 4NQVB 3MOQA 4XCYA 2DQIH 5C70A 4YDVA 3VRIA 3PHSA 4M7LT 1JNLH 1U92A 4BQ9A 1S9XA 2X9WA 4V1DA 3WLWC 3R1GL 1T7VA 1N5YH 3CLEL 5DD3L 1GHFL 2VZUA 4UNVA 3FB6A 3MLSL 1MIMH 2D7MA 2DLIA 4U05A 3S4SG 5ILTL 4S1SH 4Z7WE 3ARGA 5GRXG 2E9WA 1F3DH 5CGYD 5GRZA 3RWIA 4U1JA 2WUCL 1VSCA 3MRFA 4KJQC 4HIHA 4X6DF 1JHLH 2F5BH 3UJTH 3TBYB 4G9FD 3HCVB 1J8HD 1CDIA 3GSQA 5M94B 4QNPF 3JZ7A 3ZKQD 4UQ2B 3B8YA 1HXMB 3V8CA 1CDHA 4NQEA 1Y6MR 4MVBA 5HHNB 5J11B 3L3IA 4LLWB 1N5AB 5DZNA 1MRDL 1GIGH 3S37L 5GJSL 4HH9A 1JHLL 3VXMB 3IDMA 1GVIA 3S5LA 4XT1C 3ECBB 1G9ML 1FQ9C 4YHMH 1AI1H 4L9LB 5IFJA 3GUTB 3EOTL 3GGWB 1RY7B 2QSCL 2ORBH 3I6KA 5F96H 2F58L 1E4XH 3IDIA 3B9KD 1TZIA 5IUSA 3MJ9H 4HG4J 2CLZA 3KG5A 2NTFB 4MXVE 3SDCC 2VLKA 5ESQB 2HFGH 4GOSA 3E3QA 2D3VA 4ELMF 5I76A 4CVWA 4HIHB 3DTXA 3RY6A 2VDRL 5DWUL 1D5BB 3VWJB 2W0KA 4WFGD 2AK4E 2EE6A 3JVGA 2CLRB 3VXUE 1T2XA 5EFIA 4XP5H 1HINH 3IFNH 1IFHH 4HUVB 2VZ1A 5IOPA 4G6MH 4U1NA 3QIBB 4P2QA 4RGNC 1JGUL 5DO2D 4HG4K 1WWBX 5F1KC 4N0FB 3U0PB 4WW1B 4FFYH 3O2DL 1INDL 1BIHA 1ZVHA 2I27N 4TOYL 1FPTH 2GAZA 3J8F7 3LKOA 3QDMD 4JN2B 4NJAL 5FA3A 1W72H 4XVUD 1FNEA 4TNVF 1DLFH 3SE4A 1L0QA 2W0FB 4P5MB 4LCCC 5DRNA 3LS5H 4NKMB 4AT6A 1OAUL 2DD8H 4ODWA 1AXSA 4UV7H 3X14A 3AREC 1QFWH 4KUZL 1BFVL 2HMIC 4PGDB 1YMMA 4P3DA 4PJ9B 1T1ZA 1XZ0B 2XWTA 3MRLB 4GKOA 1UM6L 1MVFA 2PW1A 1A6UH 5J6GA 1NCBH 2ICWI 4TTDD 5GJSH 1UA6L 2ZCLL 1MREL 2LAAA 2QADB 5FUCC 5EOQL 5GS0C 3KLHC 1DDHB 3DECA 4H25B 4JQXC 5I18L 5HVHC 2X4NB 2WP3O 4L4TE 4TSAH 12E8H 4KZDH 3DX7B 4M43H 3RWEA 3MUZ1 4XMLL 3BDXA 4YGAB 4JG0H 3CH8A 3L3GB 3P30H 4KRMB 4OM0L 3PNWA 3T04D 3SHSA 2JJUA 5F7KC 2X1PA 2DI8A 2YN3A 5L6YH 4DJMA 1EJOH 1ZA6B 3LN4A 3TBWA 4HH9B 5T5NF 5IVXE 2YK1L 2PXYC 2QQQA 3K80A 2AJYH 5CIPA 1GHFH 3LV3A 5KTEL 1IAIH 4F58L 1NBZA 5DJAA 3VRIB 4AT6B 3M8OL 3PHOB 3RWGA 3RWDB 3VJ6B 1T2QL 4PTUB 1I3RB 2GY5A 3O11A 1CLOL 1QQDB 4YFLI 2ENSA 1FZMA 3QUMB 5JOPD 3MLTA 4HIJA 3P77A 4ZNEA 1FV1A 1CGSL 4ISVA 2AI0L 5A2FA 2X4RB 4JO4L 1V7MH 3HE7D 2WAHA 1TQBB 4RMVA 3D3VB 5EC2B 2CXKA 2VLKB 4ZG1A 5E9DA 4EI5C 1LK2A 1NFDA 4X5XB 5J9PB 1B4JL 3QDGB 1RPQA 1CI5A 4TVPE 4H5SB 5ICXA 1NMCC 3DRQB 2J2ZA 2QSTA 3U7AA 5F1NB 3VFRB 4LVEA 5FGRA 4XH2A 2ICES 3HFMH 2RBLA 1J0HA 4ZPVB 5AG8A 3L3OA 1T5WA 1HQRB 2B1HH 1XF5A 5BS0A 3U7WL 3DO7B 1O0VA 4ZOBA 3ULSA 3QIUD 4Y8DC 4C4KO 4JPWH 5CHNA 5I8OL 5F7DA 3A6BH 5C6TL 3QIUB 5FYKL 4WV1C 1OTUC 4X9IA 1IQWL 4PJDF 1TVDA 4NJ9L 4WDIA 1NGXA 1PJ9A 5JA8B 5F6HI 4F37K 2LFGA 3GRWL 1NCWH 1CFQB 3HLAB 4ZO7A 2FATL 1F8TH 3FO0L 3L3JB 1I7RA 2OL3L 1W72A 2Q86B 1TIUA 1JYWA 2LU3A 2HH0L 3IFLH 1SEQH 1HH9A 4OLUH 2MCPL 4QGTA 1LEKA 2BMKA 3TPUE 3DLQR 4NBYB 4QLRA 3BSZH 3Q3GB 4MHHG 3VGGA 5JW5A 3QJHA 5BCAA 1NC2A 3C60C 4PJ5D 1J1OH 3BP4B 3HAEA 3WEXB 3FQTB 4S2SB 1IGTA 4R97B 4NQCA 4GRLA 4PJGB 3IS1X 5D7JD 3VXMD 4KY1L 5FCSH 3NZHL 5DYOA 2XQYG 5LXGH 4K23L 2DWEB 1NLDL 5DMKA 1JIBA 1ZT4B 4M61A 5E00A 1CU4H 5K9OA 2F53A 1AGCA 4APQD 5E8OB 4XNZC 2OM5A 1V7NH 1LO2L 5GRVL 1FYHB 3DNKA 1X5FA 5SX4I 2QHRH 4QYOB 1VCAA 4O2FA 5C0BA 5F7NC 1UWXH 3G04B 3I85A 3B43A 1A4JB 2K9UA 3ZMRA 4HF5L 1SJXA 1OLLA 3QRFM 2PXYB 1RUQL 5JPNA 3QCUH 4Q6IC 4QHMA 5FO9A 4K3DH 1KB5L 4OB5H 4X6FA 5EA0L 4FQQB 5E8DL 3V6ZA 3VD3A 3G6DL 3CSGA 1PKQE 5BQ7A 4Z9KB 1YN6A 2CIKB 2DQUH 3KS0J 3H42H 5AZ2L 4RFOH 3QO0B 4WI7A 5TQ0L 2HA1A 3VXOB 1AY1L 5JMOC 3SKNB 3ZO0A 4X0KA 1FVDB 2QR0B 4ZDHA 2VR5A 1YJDC 4WY7H 3WKNA 2X4RA 3T0ED 3D39A 1JI2A 5EDXA 1BQSA 5H37H 3VE0B 3CVHH 1XEDA 2B5IB 1XR9A 1ZA3B 1SMOA 4ODHL 3EYOB 3QEQB 3QQNA 4KI5F 2Z8RA 1OCWL 1HSBB 2OL3B 1MH5A 4RMSA 2AKRB 3BP6B 4I0CC 4MXWH 5IB5B 2WIMA 4NHUA 5FCUL 4PTTB 2BHYA 2FYYB 2IALA 5EPMB 2BP3A 1CE1L 4IIQA 4JQVA 3EJYD 2VWEE 5IFAH 1KCVL 3LSOB 5JPNB 2I5YL 2MKWA 4PJ8B 5TQ2H 4DAGL 3U82B 3TZVB 3P73B 1S78D 2QSVA 1HHKB 4Z7UB 1JRHH 2AK4B 5FYJD 5A1AA 3GSOB 5IOPB 1XMWA 2V6HA 4XWGH 5KSAA 3MOAH 2QADD 2WWMC 1TJGH 4TUOA 1KTLA 3QPXH 2BNQE 5FM5M 3SKUD 3VFTA 4KMQA 4J7RA 2HJKB 4NM4H 3S88L 3JV6B 1NC4A 1YYML 1P2CB 4GRLB 4PJGA 1LEIA 1F3JB 1JZ6A 1F4YL 4ZXBD 5ICZA 1RD6A 3STZA 1U92B 5DDHB 1M05B 1IAMA 1FO0H 4AIZA 2NY1B 4DK6A 4MJ5A 3DX6A 4QRRB 4EDWH 1CE1H 3DV4A 1FCGA 1XGRB 5J89A 1W72L 1K8DA 3CLFL 4MSWA 3JV0A 2IANB 3FFCA 3MXVH 3IJHA 1EEQA 4OLYH 2W65B 3CLFH 7CGTA 3RWIB 4G8IA 5CSBA 3LSOA 1Z3GH 1WBZB 2EICA 3CH1B 3QH3B 4CNIA 1ND0B 4OF8A 2V2TA 1HYSD 3RNQA 3X11B 3KDMB 4NN5B 5F6IB 2ADJB 1IM9D 2WK2A 4ERSL 5DK3A 5E5MB 2ADFH 5I1GL 5JXEC 3F7VB 2CO6B 3MRMB 1DCLA 1EJ6A 4K3JH 3DX8A 2UYLB 4M02A 5JW4N 1BOYA 2F54A 3UTTB 4BUHA 1A1NA 3Q3GA 2BVOB 4LDEB 5FDWA 3QDHA 5EUOA 4WI5A 4XI5C 4Y19D 4PRBB 5D2LA 1U8IA 4J12A 1C5DB 1MCWM 5HBBA 1HN1A 3MMEA 2H9GA 4OLVL 2VN4A 1ZAGA 4E0RB 1HWHB 1CTOA 1T5XB 1CIDA 3P9LA 4G6JH 3MGOB 4GLRI 4ZUWA 1AGCB 1IARB 4NZUL 2GSIA 4U1LA 2W92A 3C2SA 3MLTB 3O3BA 1QVOA 5EBWB 5C0FB 1P9MA 2E7BA 4KK5D 1XFPA 2IH1A 1AD9A 1R6VA 2XTJC 1BEYH 1ZT7A 5A3IC 4J2XA 2ZP0T 4JRYB 5GZOD 3RJQB 4G43A 1SQ2N 3O45B 1MRDH 1WIPA 3UZQA 2BXYA 5F1NA 4OTXL