3QUZA

Structure of the mouse cd1d-nu-alpha-galcer-inkt tcr complex
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
273
structure length
266
Chain Sequence
b'NYTFRCLQMSSFANRSWSRTDSVVWLGDLQTHRWSNDSATISFTKPWSQGKLSNQQWEKLQHMFQVYRVSFTRDIQELVKMMSPKEDYPIEIQLSAGCEMYPGNASESFLHVAFQGKYVVRFWGTSWQTVPGAPSWLDLPIKVLNADQGTSATVQMLLNDTCPLFVRGLLEAGKSDLEKQEKPVAWLSSVPQLVCHVSGFYPKPVWVMWMRGDQEQQGTHRGDFLPNADETWYLQATLDVEAGEEAGLACRVKHSSLGGQDIILYW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antigen-presenting glycoprotein CD1d1
publication title Galactose-modified iNKT cell agonists stabilized by an induced fit of CD1d prevent tumour metastasis.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 71
structure length 266
sequence length 273
ec nomenclature
pdb deposition date 2011-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3quzA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3quzA01
1BGXL 4NJ9H 2DTMH 3KNBB 3RDTC 1CTNA 4WV1B 4AMKH 4HQQL 2FX8L 3U9PL 3LN5A 4MA1C 3O2VH 5C6TL 1NAKH 3JWNC 2A0LD 5J89A 5ENWA 4A2LA 1MJJA 4G8EA 4WHYH 1XGUA 1BEYH 2AW2A 4LAJH 3KPQA 3KPLB 1T1YB 2FZ3A 3V7AE 1RSFA 1T83C 1TNNA 3WIIL 4EUPH 5JZ7C 4P46A 3AREA 5MEND 4UUJB 3ULSB 5IBUB 1BBJA 5C0IA 1RZJL 5ALBH 5F9WB 1KIPA 4M9OA 2X9WA 4KMTH 5B8CA 1IT9L 4U1JA 2D3VA 4G7VH 3RQ3A 1KULA 5HDOA 2BRRH 2KPNA 1GH7A 1S7SB 3B6SA 5C0BB 2DQHH 2NY7H 3V5KA 3G5XB 2VUYA 5A2KH 5I1AA 5L2JB 2GK0A 2VXVL 3WIFB 4JCMA 3LRGA 4JKMA 2DTSA 1TZIA 1J5OH 4U6TA 4LLDB 3FO1B 1T3FB 2NY2D 3BZFA 1F3DJ 3D2UA 4HC1A 3EJJX 1VACB 1T1WA 4P2YA 1ZGLP 4TTDD 5K59F 2DDQH 2HWZH 3QIBA 5D2LB 4NWTH 5INCB 4XNXL 3K8MA 3OR6B 1ZLSL 5C08A 1IRAY 5DHYB 2OZ4L 1U9KA 5FM8A 3VRJA 1CLCA 4XNZB 5D72L 2D7QA 3RP1A 4OB5L 3KAAA 4H20H 3CVIL 4Y5YC 3SOBH 2KQMA 1IGTA 5C0RL 3NACL 4K9EL 4UT9H 4AYFA 2ATKA 3V4UL 1A7QL 5D1QB 2Q6WA 2WBJC 4FQ1H 3MV9E 3K3QA 4KXZH 1R3LA 4PJFA 4V1DA 4B41A 1OTSC 2Q7NA 3MRQB 3TPUE 2H32B 3S34L 1QNZH 1A1NB 2OLDA 5IVXF 3VGDA 4D9QD 4R4NC 3BP4B 4LLYA 1T7WA 2ZUYA 1K6QL 5T33H 3BN9D 3VE0B 3QUYC 1ADQL 3UDWC 1BLNA 2A77L 5EIVA 4FQXD 2BJML 3CMGA 4JFEE 2W60B 1WF5A 4OCSL 2DI7A 4PBWD 4TYUA 4U1LA 2PO6A 5E7BA 3VFOA 3VCLA 1FGNL 1YMMB 4X6DA 3DYPA 2AGJL 5DEGA 4LRIA 4IOFC 2X05A 3BMWA 2AEPL 5BW7A 5D1XD 2CUHA 4NM4L 4RZCA 1RFDH 1MCJA 1XAUA 4AG4L 2FJFB 1TCRB 1AO7B 1OTTD 3HFMH 4G8GB 3BZEA 4R0LA 5IP4A 2E6QA 2IF7A 2CMRH 4XWOD 3VRIA 1CE1H 2R39A 2Z4QA 4L9LC 1WC7B 3H3BC 4PJ5E 4U7KA 3V6BR 5HYSA 1QA9A 3HE7D 1DSFL 2C3GA 4Q0XL 3UO1H 3O3BA 5D6CB 5KW9L 1MAMH 3CD4A 2DICA 3RBSA 3TA3C 4HW6A 3MRKB 3OKMA 4PJIF 3P4LA 3V6FB 2IPUK 4HIHB 4KDTA 2R2BB 1FL5B 3VFMA 1B0RA 2J6EA 5EO9A 2X1QA 5LAXA 3QJFA 1OM3L 1T66D 4HBQA 4G59A 1QPPA 1FRGH 4ZFFA 4XZUA 2VDOH 5DRNB 3PWLB 5EC2A 1E4JA 3RWCB 1NLBL 4MJIA 1GXEA 4IHOA 1U8HB 4CW1A 2PYEA 4O2FA 3M07A 3MRGB 4W6WB 1FGVL 3DVNB 1SEBA 5JMOC 4LHUG 1LHZA 4IRSB 3HPJA 2DQUL 4Q58C 4YHKH 4WWKA 3OKOA 4Q2ZA 5IBTH 5T3ZE 4HBCL 3VXPA 1UH3A 4HKZA 2AJSL 2JF1A 4M1GL 5KS9A 4MAYA 3FRUB 1NBQA 1P7QA 3ZDYE 4PG9A 3SGKC 4QWWD 5L8KB 4RMWA 1A3QA 1NC4A 4JRYE 4P3DB 5I1GH 3KYMB 4NUGH 4XMPL 1I4FB 3M45A 3C2AL 2MMXA 4L3ED 5C0JA 2QHLA 3AGVA 4NRZB 4GBXC 5F7LB 4WCYH 3SE3A 3L7FA 1AFVL 4AEHH 4S1DC 3HR6A 4LMQI 3HLAB 3PQYE 1GHFH 4FQHA 2VLKB 4W4NA 3BVNA 2HT2C 5FUOL 1HI6B 1MPAH 4N0RA 3MBEC 4LSPH 4PD4K 4JAMA 5D71L 2DKUA 5IV2A 4NO0D 1MF2H 3MMEB 5KVDH 2GEEA 2P46B 3GMLB 4M6NH 1CFQA 2OX5A 3BEVA 3U36A 4PP1C 4ZOAA 5J7CC 3PWVB 4M3JA 3WSQL 5FCUL 1FORL 3VMOA 1CFNA 2WUBL 2E7LA 4ONOA 5B38G 2OP4H 3GSXB 5FYJD 4NFDA 3RX8A 1Y6NR 3STLA 1JGVH 1R3HA 5E5UB 5JW4M 1DLHB 5L6YL 3O6FB 1KTLA 3QIWC 4ZPVA 1CR9H 4NQVB 4OLWL 3UTPE 4OCRL 4P9HC 1R0AL 3DV4B 4OBSA 4YBQC 3IB4A 4GW5B 1YMHA 4M00A 1JPFB 1DN0B 3TVMB 4W70A 1S7WB 3G6JB 2ITDB 1T20A 1KNOB 1G9NL 3GMNB 3MRRA 3QO0A 1E4XL 5BS0E 4RMSA 2P49B 4PRIE 2J8OA 4ZO8A 2VUOA 4WENB 4X4YB 5I1DB 3LPGA 4FS0A 3TO2A 2Z92B 4MLSA 3UTSD 1L0QA 3VWJA 3UPCA 3RPIB 3ZDZF 5EOQL 2YPVL 4J4PC 4EN3B 2VAAB 5E8NB 4YPGB 4PRDB 4OGAD 2PCPA 1JWUA 5A1AA 5J8OA 1OCWH 2YKLH 3LS5H 4V3DB 3VMNA 4HWUA 1Q9WA 3NA4A 3SGDH 2P8PB 1JYWA 2YD9A 4WEBL 4QXGH 1OAXH 3LEVH 1HHKA 1OGAA 1A6AA 3D0VA 4O2EB 2VH5L 3PWPD 4BZ2L 1BZ9B 4H25A 4AZ8A 1RUQH 1QACA 3MRIB 4UQ2A 1J05A 5DMGD 1HHHA 4HUVB 2IPTL 3CFCL 2IH1B 3O0RL 4Q9BA 4GKOA 3KPSD 3B9KB 4AIXA 3ZYOA 1DBMH 1XF1A 3E2HB 4QXUL 5E7FA 4G43B 4LVNB 4BM7A 1UCBL 1UYWH 1SVZA 4OBRA 1SM3L 2FJGA 3HZYB 5EU6B 5FKPB 3NBNA 2XA8H 2D31B 4WNQA 5EUOA 4P2QB 1DBKL 3JWOL 4N1EA 5DA0B 4JFFA 3WDJA 4I18B 5KVFH 2NX5B 4NKDA 3IDUA 1UENA 3QCVH 2ZP0T 1PYWB 1HIMH 5T3ZH 4FFYL 4B7IA 4Z78B 3GI8L 3I50H 4ZFZA 1L9NA 4KPHH 1QTYT 1MHPL 1JJUA 4LEOB 4YPJA 3WUZA 1Z0NA 4E0RB 1MVUA 4CADA 2WSKA 3RVXD 4LL9A 2Q87A 1K9TA 4XB8A 1MCOL 3EJZD 4G80B 3RZWA 3G6AB 2XKNB 1IC4L 2EDTA 1FFPA 3GSUB 4XVSH 2NQCA 3C8KA 1GC1C 3QXWA 4P3CH 1AGDB 3QEGL 2F19H 2RJMA 5DYOA 4JFXA 4KQ4H 2ADJB 1YC7A 2IQ9L 1AIFB 3X12A 2GJ6D 1N2RA 1NCWH 1JHLL 3T4AA 2X4NB 3DMMC 2NTSP 2FL5B 1HCFX 4OSUH 1SEQL 4UV7L 2YD7A 3IKCB 4ZD3H 5HYJD 4OD3L 4OTXL 1TDQA 4M7LL 5GGVY 3WXVH 4FABL 2AJZB 2IC2A 4PJXF 4IIQA 1BVKA 4KUZL 3QWRD 4TUKL 4KI5E 4QRPE 2PW1B 3KHOA 5DK0A 5TQ0H 5LXGL 1FL6A 1DBAH 3BH9B 3ULVD 3QZWG 2AXGB 4K55A 4LMQE 1D9KD 4R7DA 3X13A 3HI1A 1EO8H 5JW5B 3RVUC 2W1NA 5J3HC 3UROR 2HTLC 5AZEH 3CZFA 1M7IA 4O2CA 5DJXB 1Y0LA 2NYYD 1DBBL 1HYRC 1D3CA 2V7HB 43CAB 4X99B 2R1YA 1IZJA 4JY6B 3BD3A 2LTQB 2W65A 5C0GA 3V0WH 4XAKE 5MENE 1GYAA 2VN4A 1NDMB 1I9EA 4OGXH 5GISL 1AC0A 1MWAL 4L4JA 5C0AE 4KJQD 3HZKA 4KKLD 4WW1A 2R0WH 4X8JB 3U0WH 2Y5TB 2HFFB 2R2CA 1S5IH 2EYSA 1B0WA 5C2UB 1H0DB 5LG1A 3HMWL 1FVCA 2OK0H 5A43C 1OAYL 1SYSA 4MNGB 5F7KC 4RWYH 4O58L 4LPTA 3WO4B 1F2QA 3AROA 1XZ0A 4BSJA 3WN5A 5CEYA 4GRWH 1CF8H 1ES0A 3LQZB 3VFVA 2VLLB 3VMPA 4LKXA 1OW0A 5JR1H 4PLKC 1FO0A 2I26N 1ZE3C 4U1MB 4DCQA 4UOJA 3O2DA 5IQ9B 1GCFA 4MS8A 2XI9A 3MJ7A 1U8MB 3NCCB 4U6YA 2HKHH 5MP6L 1AKJD 1LP9F 2DBJA 2Z8SA 4Z6AT 2DLGA 1GGBL 3ILQC 4Z0XB 4KK9D 4J12A 1A9BA 1FYTD 4DUXA 4EKXA 5B4MC 4HS8L 4MCZA 4HK3J 1C12A 1KB5L 5CJQH 1FZOB 2R2HA 1KN4L 1RMFH 4WHTA 5I8EA 1W8OA 2QKIB 1I7TB 5GGUA 5DQJB 3OKEA 4IRJC 3RWJB 2JJTC 5F9AC 1ZHNB 4X4ME 4C58B 3B8SA 1EMTL 4NRXB 1INQB 5CJXA 1QFWM 2XZCH 4TSCL 1N4XL 2XN9D 4NKMB 4Q9RH 3PG2A 3O8XB 3RZCA 4XP5H 2FB4H 1C8PA 1I3RA 4ERSH 2XWJA 5IVZA 3OL2A 3HC3H 3O6LH 3BKYH 4NQCE 3ARDA 3TT3L 1RZKL 1JN6B 1G84A 5C0EA 5EUKB 1JGUL 3VI4E 3T3MF 1MFBH 5HHOA 1WBZB 3M17A 3WHXB 2EDHA 1A3LL 2UZXB 3D85D 4MDIB 1H3TA 4M7ZC 4F37K 1BX2B 4HK0A 4FZEH 4FXGB 1OP3H 2EDLA 3IDXH 4OD2A 4CRPA 4QHUB 1I7UB 4Z7UF 1YZZA 3QQ9C 3BGFC 3SDDC 3X3FH 1LO4H 1WISA 3QNYB 4ZPTA 1C08B 2VDML 4X9IA 2BY3A 3WKNA 5HHNB 2Q76B 4GQ9H 4I0PA 4Y8AA 5HVWA 2V2WB 4KJYB 3QIBC 4WTZG 3DVFA 4JDZB 1CT8B 2NY4D 3PDGA 3OBAA 5H37G 4GLRI 3HI6L 5DJYA 1NBVL 3EZ8A 4U1NA 3MV9A 2FATH 3E6HA 5DD3L 1DBJH 1YY8A 4EDXB 5CLWA 1ZHBB 4Y4HD 3TPUA 1T0PB 4N0CC 1GGYA 5L88H 1B0GA 4F7CB 1NMCB 1ACYL 3NAAL 4OUUA 5ITBH 2CIKB 4Z76A 3EYQD 5C2BL 1F8TL 4TSBH 4YHNA 3FN0H 4ZODA 3DSNA 1C16A 5T1LA 5HPMA 1Z5LB 4KRPB 4CVXA 2DL2A 2H1PL 4AM0A 1A7PL 4N90E 1U8IB 4YHYB 2NXZC 1CGTA 1JHKH 4U6VL 5KSUB 1UXSB 2WWKT 4YIQA 4XX1E 2YSSB 5ICYB 2FEEI 4HQQH 2FX8H 2VLRD 3U9PH 5C7XH 5AZ2H 5C6TH 1RUKH 3LOWA 4M62L 4LSUL 5EO0B 5F3HB 2DI9A 4DW2L 2CUMA 3WIIH 1A6ZA 4PJ8C 3OXRB 3O4LB 1LO0H 1B88A 1IEAB 1RZJH 5AYQA 4OM1L 3OGOE 3W39B 4PJ5A 1NFDA 3U30B 1YUHB 4ZNCD 1MRDL 1HQRA 5HHXL 2IMMA 4HKXB 3CFBA 2VABA 1NC2B 1L7TL 4GOSA 4U0QB 1IZKA 1XF3B 1JV5B 1U93B 1UEYA 5CSGA 3UJTL 1TCMA 1F3DH 1NEUA 4QOKB 2P24A 3OF6A 1CIUA 5DEZA 5B22A 4IEFB 1KJ2L 3RHWF 4GMSL 4WEMB 2X44D 4XPFL 4XNXH 5JHDD 3T65B 4K94L 3GSOA 1ZLSH 4EUPB 3RWGA 4HWZB 4DQOL 1N8ZA 2CLRA 4HT1L 4WW2C 1UACL 4WU7A 2OZ4H 2WINA 2QR0A 4LASH 4Y1AD 5D72H 5IF0A 3LHPL 2UY6A 4MCYA 3QG6A 4KDTC 2XZQH 3L5IA 5C0RH 3NACH 1A3RL 2P5EE 4K9EH 4UU9B 3ZE1E 5SWSB 5IESH 5C9KA 2DJUA 1BZQK 2ARJA 1A7QH 3DUUB 4WRLA 3GI9L 4R26H 4Z7QF 3ESUF 5TDNA 5J13B 4U1IA 3RWEB 3LKOA 1ZK9A 3R06A 2PN5A 1VFAA 1T1ZA 4JRYA 4LPUA 3S34H 3C5JB 4KQ3L 2XXCB 4HV8B 3HG1E 4LLWB 5J1TC 2LVEA 3TO4D 1K6QH 2EKJA 1MHHA 2Q3ZA 4D9LL 1F11B 4RIRA 5ERWB 1ADQH 1UB5A 3QSKB 4J1UA 3PQYA 1BVZA 2A77H 2NY0D 5EZJB 4P5KB 5EIIA 4MA8L 4OCSH 2OI9B 5LQBH 5C07B 3DO7A 3P2TA 3JWOC 3SE3C 5FK9B 1U0QA 4R2GD 3NMEA 1YPZE 2AEPH 2P5WD 3RI5F 3WE6A 1WEJH 5E6IB 1XGRA 5BVJB 3O3DA 4LSSL 4R97B 1YEGH 3OWEA 5KN5B 5IW6A 1WQVT 4N0FA 2R1XA 4L4TB 1KCKA 2O93L 3MGOA 5F9JB 4P5MA 2AK1H 3CSBA 1RK0B 2GJZB 2FH8A 5D7JD 1A6TB 1C5DA 1S7XA 2EXWD 3DHMA 2WIMA 1NGZB 4Q0XH 1NJ9B 5IBUG 3T0XA 2E7LC 1CVRA 3GSRB 4J8RB 1ZSDB 4X9HA 5F6HI 2GTZB 5C6PB 5HJ3A 5EBMA 1X44A 5BS0A 4PRIA 3U9UB 3VFTB 2NLJB 1L8JA 4YDIL 4NKIL 3NN8B 1Y18A 3PWJA 4Q9QH 1PKQE 4NZTL 5KOVC 3QHZL 1OM3H 1F58L 5JIIA 1UJ3A 4KK8C 2F54B 1FG2A 4GT7A 1L9MA 3E3QE 5T3XE 3NCYP 4PRPB 3HE6B 4KVNL 3WFCH 2GITA 3QG7L 1WITA 3IDGB 1U92B 1JPSL 1G0DA 3SBWA 5I8CA 1G1YA 2FGWH 4X7SH 3BI9X 1GPOL 4HBCH 2HLFD 3SEPA 4C57C 3NCMA 4R7NA 2AJSH 4L8CA 2GJ6E 4M1GH 5IKCB 2JIXA 3REWA 3CFEA 1EJ6A 3H9YA 5D7LE 4P9ML 4TRPH 4PV8A 3C2AH 3RVWD 3KJ6L 1MCEA 3EDJA 5FAAA 3BQUC 2IG2L 4E42B 3R1GH 1AFVH 4MDJA 4XP1L 3QDMD 2E5EA 2GUOA 4ODWA 4U6HB 3G5YB 3NGBB 5DSCA 2VKWA 4NYLA 3MV8B 3GM0A 4BSVA 1S9YA 4P4KC 3BMVA 4U2YA 5HDBF 5KSAD 3BSZL 5J06A 4IOIA 4YFLI 1HXMA 5JOFA 4S2SB 5EFIB 3OKNA 5C8JA 4WFGE 4HWEL 1ZVSB 2FCBA 4MD0A 4QXWA 4YBLC 1O0VA 4HX1B 1NLDL 5DURB 3KLAB 1OPGH 2WUBH 3QQ3B 4AH2A 4PJAE 1CN4A 4OLYL 4NQDB 3EYVA 3OZ9L 4S1QL 2W9LA 1IQDA 2X4RA 2ESVE 5L6YH 5DMYA 3U4EA 1JGLL 3ZYIA 3HPLB 4JREC 2LQRA 4OCRH 4XCEA 1R0AH 4XNUH 2IPKB 3L5XL 4LIQL 1F2XK 4LLUA 3L3DB 4YDJA 3RDTB 4W6YB 4LVOB 5GS2H 4XHJD 3W0WE 3PIQB 5EBLA 1F4WH 3VXUA 1G9NH 4MA1B 3F12B 3D18B 1E4XH 5DK3A 4NQED 2GSGB 3VGGA 5T5NF 5MEPB 3RWFA 3BX7C 3UBXI 4OIIL 3MRDA 5FGCE 3GO1H 5IJVA 2XQYG 1JNHA 1Q38A 4HGKC 4TTGA 5IB1B 1RU9H 4JZOA 4AIZB 2ZCLL 3QFJE 4QRPA 5EOQH 3VXMD 5IMMB 2YPVH 4C56B 3CCHB 2BHYA 4MQTB 1UA6L 1ZGLA 2XTJB 3TBWB 3NIDF 1AHWC 1NDGA 2LVCA 3QHFH 4WFFD 5EPMA 5D9SA 3RKDC 3S36H 2ZZUT 3JUZA 3VWKD 4WO4A 4I2XE 4WEBH 4IIQC 5GS0L 1XCTA 1M71B 2NY3D 4POZD 5D2NC 5EWIH 4K7PH 3D1MC 4M1CD 1C5BH 3K8KA 5MENA 1UWEL 3C09C 3P0YL 43C9B 2QSCL 4ZS7L 1KCVH 1M7DA 3ILPA 2UVFA 5J9PB 5C0AA 5C0CB 2NCMA 3O0RH 4LBEB 12E8L 4G3YL 1XH3B 4MNQB 2Y06L 1CD8A 2P44B 4X4XA 3ZE2E 2HN7B 1UCBH 4EI5A 1YY9D 2HH0H 4NQXA 3QQ4A 4Y5YB 1IKFH 2W9DH 3VFWB 5T3XH 4CN4A 4Z8FL 2PR4H 1DVFC 1DBKH 4V2CB 1HILB 3U0PB 4YR6B 4Y2OA 1F6AA 1JRHI 2AK4B 2PUQT 2W9EL 2WBJB 2VQ1B 3C5ZB 1IAII 1VFUA 3BYTA 3CFDA 3EUUA 1ETZB 1T6WA 1NGPH 4FFYH 4NOFA 3CU7A 5I66B 4RGMB 3L5WA 2R2EA 5ANMB 5F8QC 5AWNL 2DQGL 4NZDA 1IEBB 1U58B 3PHOB 4J6RL 2IADA 4JQVC 1RY7B 4KTDH 1A1MB 3QXUA 1BIIA 5C86A 4ZOBA 4KKBD 5L2KD 1OWWA 3WFEL 5T1KB 2UVEA 5BOPA 1LDPL 4EXPX 1MCOH 4NN5C 5ESVB 1U8LB 4QNPE 4Y16A 5JPMA 1WWCA 5LVEA 4YX2L 4V3EB 1FCGA 2EIDA 5I8OL 4HFUL 2F5BH 2HG5B 2Z0BA 1Q94A 3OAUL 2OZ4A 3RGVA 2IQ9H 3IFOB 3D9AL 1JHLH 3IJSB 1YYML 2VXUL 3INUH 1SEQH 4UV7H 4X4MA 1GL4B 2A6JB 2OR9H 4X6BA 4XTRD 5I16A 1A6WL 3MBXH 3L1OL 5JTWA 5KSVB 3HMXL 5HBBA 1CFTA 4L5FL 3IFPB 3I9GL 2IAMA 4NN7C 1KG0B 2LAGB 5D4QA 3V9FA 1LE5A 3WHE1 1QSVA 5LXGH 4NQCA 4CJ0A 4OQTL 2IH3A 4FXKA 2W92A 5EU3B 1P2CA 2M26A 2VLRE 3AAZA 4UNVA 2NY6D 2V7NA 1E28A 2FH6A 5CJXC 3WJLA 4GAYB 3OXSA 2CIIA 1FAIL 1VFOA 1DBBH 2C7UA 3T77B 2Y6SC 1Z9MA 4GRMA 3TA3B 1ADQA 4ZFOB 3G9AB 4K94C 5C92A 1R24B 4JJHA 5GISH 4HEPG 3ZHLA 3K80A 3ARGA 4LCWE 2WLYA 4RBPK 3WCYA 1NFIA 1FSKC 5F7MC 1KIRA 4OCMC 3LKNB 5ICXB 5GSVB 2I07A 4PJDB 2OXGA 1KEMH 3TWCL 4XVUC 4LAQL 2D0GA 3BJLA 4C4KT 5I75C 3ULUF 1OD7A 1X5YA 1QBLL 1I3VA 3VFPB 5D7SL 1X9QA 1ZT4A 3SDXE 1TVDA 3CDGB 4POYA 3G6JF 4ZUVB 5BQ7B 3KLHC 3WXWL 2HVKB 3GSQA 4WUUB 3JWDC 4TUOA 4X9FA 4WFEE 4N8VA 1G7JA 1HXYB 3QQNA 1RK1B 3LSOA 5DD1L 3QI9C 5I17B 4PRAB 4JFDB 3ZE0F 4WFHD 2X70A 2KQNA 4XCNB 1JPGA 3EGSA 2EDBA 4JEGB 4KH2A 3MLRH 1WBYB 4WI2A 3MBEB 1BPVA 3QCTL 5EB9A 3IDJA 1XGYH 3MZGB 1KN4H 1A2YB 2VR9A 5J1AB 2R0KH 4GRWB 3NA9H 5CD3A 1WFNA 5IB4B 5KANG 3CC5A 1EMTH 4IM8A 4NQUA 1IARB 4UNUA 2BOBA 5F21B 1U91B 2O61B 4QRSB 4G7YL 4S1RL 3NFPA 2H9GA 1A0QH 1ONQB 3U7WL 3TT3H 4BELD 1RZKH 2J8UB 3QUMB 2FHFA 3D3VB 2VIRB 5CZVH 3OKDB 4JDVA 2P5WE 2W38A 4BQBA 1FYHB 1U3HA 2EDJA 3EYOB 4I77L 4Z77B 4JZJC 3STZA 5K59E 3T4YB 2A6KB 4MB3A 2IANE 5CP3H 2H6PB 1WVZA 4MWFB 3SKOB 2ZUVA 3F58H 3N0PB 5I1LB 1I1AD 2XG4A 3F5WB 4QXTB 4YHPA 5DDHA 3KVQA 2CUIA 2ZUQC 3CVHB 1G7IB 2VDMH 1I8KB 2XWTA 1ZV5A 3P4MA 2XRAL 5EU7C 2P5EA 4HXAH 2MNUA 3JV4A 3WFBL 3PABB 3CSYB 2VNCA 4LQFL 1M4KA 4LCIL 5E00A 5C09D 4I3RL 3HI6H 3MOBH 5ESQA 4PGEB 1AD9B 4U33A 5IMLA 5DD3H 5FECB 1Q72H 3VXSE 5C0NC 3H9SB 1QHOA 1I8LC 5C3LD 1J0ZA 3HG1A 3NAAH 3IXTB 5DF0A 5C2BH 4HS3B 2VSDA 3QEHB 3DXAD 4D0BA 4KY1L 1OSZB 5SV3A 1HHGA 4BQ6A 3TN0C 5K9QG 5EZIL 5IIEB 4U6VH 1KUMA 4PJFF 4AL8H 3FOMB 2F74A 4QHMA 4DKAA 3SDCC 1JF1B 2EE2A 4G9FB 3W5MA 1YPZA 1OP9A 2R4SL 4XBEL 1A4KA 4P2OA 4LSUH 5BZDA 4PIRF 3DV6B 5T1MB 4KJWD 2ICWB 2VSCA 4DW2H 5FV1L 1FNSL 2B1HL 4F8QA 2CQVA 3B4NA 3FFDB 4UT7H 4OM1H 2AJUL 4OF8A 5J6HB 3L3OB 3QXDA 4NIKB 2PW2A 4JJ5A 1G7HA 1MFAH 3O6KL 2O5YL 4NO2A 5ISZE 1KPRA 1JGDB 3PWNA 1DANU 1T2QH 4WJ5B 5GGQL 5HHXH 3WL9A 4AEEA 1K8IB 5A16A 1S9WA 3SGEH 3IVKB 4F7PB 1NGXB 3IDYB 3B9AA 4TVSa 3UJTH 1DFBH 2ENSA 4WGVB 4P23B 4N0UE 3V6ZB 2OTUB 3OJMB 2OTPA 1KJ2H 2HP4A 5E9DD 1PKQA 3Q6FB 4RX4D 3DROA 1CLYL 3GNML 4RQQA 2BSED 3E3QA 4X8XA 5IROA 5TH2A 3FQTA 5DGQA 3I6KB 1CXLA 3LHPH 3SPVB 2QQNL 4XP4L 3FTGB 5FYJL 1A3RH 3HB3C 3LN9A 1X4ZA 4DUWA 2A74B 1X5GA 4Y19E 2ZKHH 1DEEA 2BX5A 3DRQA 5KTEH 1S5HB 2DD8H 3EFFA 1PD6A 4GUPA 4N1HB 4FFWC 4G6JL 4LSTH 4R4FL 5D7LA 3F6IA 1T1XA 3DX8B 3SBWC 3FQNB 5GGVL 3F7YA 3BIAX 2V5SA 1EX0A 4PTTA 3VXME 3VG0L 4ZQKB 1JRHH 1RJZA 4YFDB 4NNXA 5BOZG 4KROC 1T22B 4RMUA 4GKZB 1T0NA 3S35X 2EZ0C 3GSNL 1G6RH 4FTVE 3CLFH 2DJ4A 2MHAB 2BSRB 1WGOA 1HKFA 1TETL 1CD0A 3IU3B 1I1FB 1A7OL 1RUML 3L95A 4RGNE 3SKNA 5BVPH 4WI5A 4XH2B 1CXEA 5SWZB 3FZUC 5DWUL 3HUJB 4PJAA 1QD0A 2BNRB 3KLSA 1UM6H 1NAML 2ESVA 1ZGLM 3V95A 1KCGC 4ZNEE 3MRMA 2M1KA 3QIUD 1YA5A 3BPOC 1LEKB 1BM3H 4K3GA 3BKML 1AXSA 5DC0A 3MV7B 4OCWL 1TVHA 4O5LL 5BV7L 1WT5A 3W0WA 2H8PA 3ZKXC 5EULV 2WWMC 1KOAA 2DLFL 1XGQB 1BZ7B 5EOCL 3MTRA 4KJPC 2BNQB 1MJ7L 4TOYL 4YDIH 2X6MA 2APFA 4NKIH 3SO3C 4KZDH 3QDJE 2HRLA 1OTSD 1OAKL 4NZTH 4IRJB 4MA3A 1IVLA 4OKVA 4ETQA 5AUMB 5EOTA 3RUGB 4APQA 1BVLB 3QFJA 4R4ND 3ROLA 1AI1L 3FFCB 4TUJA 2ZCHL 4UILL 5HGDA 4KVNH 1U8QB 4G8EB 1MRCL 3QG7H 3ESVF 4EUPG 4F15C 2HYMA 1JPSH 4Y4FA 1G9EA 3PWUB 1U2HA 4XNYL 1DLFH 1KLGB 4I2XA 2O5XL 3U4BL 1UZ6F 2FECI 3TIDA 1QQDA 4KI5C 5DFTA 4HK3N 2CLVB 3FHQA 5HHMD 4JPIA 4CMHC 4PGJA 2AJ3B 3GHEL 3N85L 4LCCA 2PXYA 1MHEA 3HAEB 2A0LC 1MJUL 3BW9A 2Y4SA 1UEMA 3KJ6H 2AQ3A 4W81A 4DTGL 5IB3B 3K74B 4WO4C 5IFJB 3BGMA 3SDDB 5I1AB 2H41A 4X80H 3RY6A 3B3IB 4ZUSA 4HJ0D 3KXFB 3T09A 1A7RH 3MLTA 3PV7A 4XCCH 4QY8B 3GBML 3H9ZA 1PY9A 1DN2A 5K9OB 4J3WA 2ADIB 1LMKA 1UZ8B 4IMLA 3ULVL 3CX2A 2YBRA 3O11B 1J7VR 2UY7A 4OGZA 1SMOA 1U8JA 4XBPA 3B83A 3OHXB 3ZTJG 1JTTA 1BJMA 4ZOCA 3QXAB 5H35A 4Y2DA 4ZDHB 5BO1H 4S1QH 3GMQA 4TTDC 1IM9B 5FHBL 4AT6A 1DUZA 2P7TB 3PV6B 4PP8C 5J12C 1CZ8H 3FB6B 3T0EB 5DUPL 2NXZB 1H9VA 5CP3A 2GKIA 1L7IL 5MHSE 3P9WB 3QEQA 4Y4HA 1ZMYA 4WI6A 3TZVA 1J0YA 3QUZA 5GJSL 3BPCB 1CDBA 3VFUB 3SKJL 2D9CA 3P40A 3WD5L 1PEZA 1XR9A 4UIKL 1PZ5A 4PGCB 3MRPA 1GAFL 4YHML 3MCKA 2XY2A 4QRRB 4Y5VC 2BHZA 1DQLL 2AQ2A 4PJXE 1FL3B 4PJ8B 1QSFE 4G9DB 4RFOH 4LDLB 3UAJC 5DJDB 4JFPB 1W72H 2OR7A 4DZ8B 1CICA 3L3IA 4HH9A 1YECL 5DEGB 4GBXD 4MXQA 1MCSA 1K4DA 3BN9C 3BZEB 2X4UB 2VLJB 3L3GB 3B5HA 1MCBA 2GTWB 2HT2D 2DWDA 4XP9H 4ODVL 4LVHC 5IR1A 5KVEL 5GS0H 1RAMA 3IFLL 1I7ZA 2KDGA 1NCAH 2IJ0C 2JK5A 1EHLH 3C6SB 4ZUWA 3C2SA 3Q5TA 1FE8L 1UWEH 3IDIB 5EZOH 5GRWA 1FZMA 3P0YH 4PP1D 4ZS7H 3T0DA 3MROA 4XC1L 12E8H 4LCWA 4PJHB 1OB1B 1GJIA 1D5MA 1OTTC 2Y06H 4WW2B 2FBJL 2F9BT 5E4EB 1NGYA 2H3NA 1TTFA 3GGWB 3LZFL 4YHOL 3QDHA 3VFRB 4XWOC 5HY9B 3VFSB 3QIWD 4L8BA 5I1IL 4Z8FH 3QJHA 1MUJA 5EIQA 1EEZB 3HE7C 1J1XL 2UV3A 3SDXA 2W9EH 2BXZA 3BZ4A 3O45A 2GFBB 2YA1A 4JM2A 5BCAA 1KPUA 1EFXA 2AXHA 1K2DB 2WP3T 4BKLB 2LAAA 4JO2L 4E5XA 1YYLL 3UBXA 1EHAA 1U8NA 4J6RH 4Q2ZB 1KCRH 1I1YA 2X1OA 2YPLD 1Q0XL 4L3CA 1LP9E 3LRSB 3Q1SL 3UTTB 1RIUL 1T66C 1LDPH 1H3VA 4NWUL 3NFNA 5GIRB 5C09E 5KZCB 3V8OA 1KJ2A 2GAZB 1RJCA 1I1RA 5E99L 2W0FA 5GGSB 5IMOB 2X89A 1MCWM 3HS0B 5ESAA 5DZLA 1HCVA 1CXFA 2YC1A 4OZIE 3NH7L 5I8OH 4HFUH 1Z3GH 5FA3B 3IDMA 3OAUH 2QQQA 1YMMD 3D9AH 1ZVYA 4UIMA 1N59A 1E4KA 1QRNB 4OQ1A 1LO2L 1I9IL 3DX7B 1OVZA 1GZPB 1A6WH 3L1OH 4WI4A 1UGNA 4QWWC 5C0FB 3I9GH 1GVIA 3K8LA 3PGCB 1Q9OB 4LCYB 4LF3B 3TYFA 3WFHB 1KLUB 4ODXB 2ERJC 1AY1L 4HGWA 4E9LA 4HIIB 3SJVE 3T3ME 2N7BA 5DD5L 1NSNH 2BY2A 4N0YH 5JOEA 5SWQB 3EO9L 2IANA 4HPYL 1YN7A 3P9LB 5CJOH 4Z7UE 2VO5A 2Z35B 5DA4A 1EAJA 4MQ7B 4IS6B 5CCKL 5H2BA 3T2OA 2YPKB 2KH2B 4JFHD 1MCCA 4PR5B 2F15A 1OSPL 4KMQA 1P69B 1G6RA 2Z31A 5DC9B 3QULB 1I75A 5DHVH 2J4WL 3J8F7 3ZYZA 3V4VH 3QA3A 3TPKA 5DJ0A 2AS5M 3MJ8A 1IAOA 2ZOLA 3FB8A 5L7XL 4JY4A 4YGVB 1J8HD 2VKXA 3NCBB 3RWDB 3TWCH 1D5XA 4P5TD 3WJJA 4KUCD 2YUVA 3WNKA 4ZXBD 1U8KB 4PJ9B 5D7SH 3VXSA 4QRUA 3GBNH 3OKLA 2ATPA 4WI7A 3D25B 3FONB 4Q97A 2FHCA 5FYLE 1HEZA 3GMPB 2YUXA 5I15L 4LU5H 4I9WD 5FCSH 5E0QA 4HG4K 2C1OA 3DMMD 2Q86B 5LGHL 3LIZH 1MWAB 4FA8A 3MUJA 3U0TA 2GCYA 4KHXH 3FT2B 4NKOB 3BQUB 3WS6A 1HE7A 3FAWA 3X14B 1RZ8A 3G08A 1P84K 1LQSR 4F9PC 4PRHE 2I9LA 4U7SA 3VXOA 1HZHH 4QTHA 2CPCA 3FO2B 2VYRE 2DYPA 1S7QB 4Y5XA 1ZA3B 2DM4A 1PQZA 3C87A 4LKCB 4P4KB 5I1HL 1F3JB 1WZLA 4ZYKA 4OGAC 5E5MB 5E8EB 1D6EB 3I3BA 5KSBA 5MEQB 4ZMAT 5L9DL 1DQJB 2VISA 2ZG3A 1I3GH 2Y7QA 1YEEL 5DD0L 5DJAB 2HA1A 3EOAB 2XWBA 2OL3A 5HTSA 5FF6B 3MOAL 5LKNA 1PJ9A 2FO4A 5JW3L 1JWMA 3RNQB 5GRXG 2AEQL 4RBPH 4G7YH 4OLEA 4S1RH 5DEFB 5DMGC 1MVFA 5ISZA 3DVIA 3E1F1 4W4OC 3RL1A 1MI5A 3DPBA 1HWGB 3RTQA 3IJHA 3U7WH 5BV7C 2PKDA 3DX6B 5EA0L 3ULUD 4N0UA 1MFCL 1KB5B 1CFBA 4ONHB 4NC0B 5E8PA 3MRBA 1NFDF 3DUSB 4OZGE 4U6XB 4HG4J 3ARTA 4I5BB 5KOMC 3MLXL 5BZWB 5CILL 2E9WA 2P1YA 1RZGA 4BH8B 1LGVA 1SJXA 2WUCL 4LSVL 2EC8A 3UYRH 4KZEL 1ZXQA 2FNBA 1P84J 4XXCA 4QYOA 2XRAH 5GZOD 3PGDB 3X12B 4FG6D 3GMRB 1RURH 2FDBP 4Y19A 1X5KA 4L8SA 5F71A 4LCIH 5HGHA 4Z7QE 1N6QL 1AHWB 1WSST 3X17A 4C54A 3GB7B 4HUWA 4F33B 3DGGA 2KZ1B 3IJYB 3EJZC 5DRXA 5B4MD 2EIBA 5IHZB 2B2XL 5JIPA 5DD6B 3C08L 2I5YL 3O9WA 4ISVA 4JQIH 1P4IL 4LARL 4WTWA 2Z9TA 5D2NB 2ADGA 5HHVH 1R5IA 1AXIB 2HFEA 3WS3A 1L6ZA 1QSEB 5JQ6L 4KY1H 4XNMA 4PB9L 5E95B 3T0AA 4L1HA 4UAOC 2CRYA 4G6AD 5ACZA 1F5WA 4FTVA 3QP3A 4XPHL 4FFZL 2YEZB 5HHPB 4TPRL 3U6RA 3AS3A 1IC5L 2R1WA 3CPLA 3ARED 4P46D 1DVFB 2R4SH 4JO3L 1DQDH 4MQXD 3GIVB 1U8PA 1D9KC 1OAQL 3TNMB 3AXLA 5CINL 1W72A 3L9RA 1IKNA 5FV2A 4M43H 1FNSH 1BD2E 1DUYA 4PG2C 2B1HH 1M7XA 1E27B 1NEZB 2ICES 2R15A 1VHPA 2NXYB 2NYYC 5F9OL 4LHUA 5D7IE 2F5AH 4NHUB 4P2RE 3U46B 2AJUH 2JCCB 4ZNEA 1M6OA 2WMPA 4X5WB 1DP0A 1KENH 4NNYB 3IYLW 3O6KH 1FV1B 4JN2B 3DTXB 3H42L 5ILTL 4DFHA 1T5XB 25C8H 4KJQC 5GGQH 3D2UD 5ID0A 4JRXE 5EU5A 1QPXA 2B4CL 1JPST 3FL7A 3Q6GH 3QIBD 1T0MB 4PJDF 5IM7A 2G9HB 4HULB 1YEKL 3LS4H 4KTEH 5C08D 5K9JL 5DK2B 3MJ7B 1N0XL 2YMXL 4KMLB 3QDJA 1FQ9C 5CBEA 3DECA 4WHCA 4Z7VB 4FFEX 2PTUA 3AMKA 3GNMH 5JORA 2HJFB 4MVBA 1O7SA 1FFRA 1YEDB 4NN7B 5ALCL 3TCLB 4XP4H 4V1DD 5I0ZA 4NQSB 5CD5C 1FVEB 3CH1B 3CFJB 4GG8B 3OG6B 5H37H 3D6GA 4APQC 5I1EH 1U95B 2VL4A 2CDGA 4JKKA 4K3EH 4KK9C 5TDPB 5B38A 2ED7A 3LH2L 3CZJA 4G6JH 4XVJL 1W2KT 5CEZE 1EAPA 1S9XB 5HXMA 4K7FA 4Y4FC 5GGVH 2VDRH 3W11D 2SEBB 4GRWF 2VDKH 1CE6A 1LDSA 5FYKD 1B90A 2PO6D 4ONGL 1AE6L 3VG0H 1JHTA 5DI8B 1JZ4A 2BVQB 2E7HA 3UEZA 1EEYA 2PXYC 3KR3H 1FSKB 5HDBE 4OD2B 5TF1H 5C0BE 4FQCL 3LKSA 4HDIA 4NUJA 3DLQR 1TETH 4DN3L 5I75B 2J8UF 1HSBA 1SY6L 1B4JL 1RUMH 5TGBB 4ODSL 2F58H 3BP6B 3L3KB 4DVBB 1MLBA 2NY5C 2QEJA 5D70H 1K5NB 1IMHC 4HH8A 2JKXA 2CLZA 1NBYA 1QLFA 5HSFA 1EJOL 4MD4A 3QAZC 5D2LE 5FO9B 3SE9L 1U41A 4Z7OF 4HCRL 4MX7A 3C8HA 3TH3T 1NAMH 3QWOB 4UNTA 2LABA 5I1CL 3QI9B 4O4YL 2ZSWB 5IUSA 1MREL 3ALXA 4OCWH 3FKUS 4XCYB 1EXUB 4EDWH 2AV7A 4XC3L 1DQQB 2P45B 5GS1A 2DLFH 4KRNA 2XQBH 4ODTL 1YC8A 3QH3A 5EOCH 5DHVA 2NY4C 3PE9A 1FZJA 1X6NA 1MFNA 4JFEB 1OTUD 2F53B 3SDYH 2APWA 4MJID 3W9DA 2PYED 2B0SH 1LD9B 3MX0A 1PFCA 4PJXA 1KBGL 4X7EC 1QSFA 4Y4HC 2CR3A 1LK3H 3GHBL 5DJ8A 2FSEA 4WWKD 1BJ1J 3VD3A 3MRHA 3QUZC 2I9TB 1AI1H 4LPWA 4N1CA 4UILH 3VW3L 1F4HA 2GT9B 3EYQC 3HC0A 2FEDD 1MRCH 4MAYD 2X4SB 1OAUH 1P7QD 5BRZA 2NZIA 2Q7YA 1SJEB 4X6FA 1JFQL 1NC4D 4XNYH 3TC9A 2CDEB 2YUWA 4PGZA 4WTXA 5C70A 3U4BH 1RJLB 5I2IA 2CO6B 1YMME 3C9NB 1T21B 1TITA 5DVOA 4S1SL 2EIZA 4A6YA 2GW5A 4M6OL 2JJSA 1N64L 1BQHB 3F7VB 4HWBA 3GHEH 3N85H 4JZJB 4NT6A 4PLJC 3UJIL 4R4BA 2HVJB 5FKAB 1V8HA 4G8GE 3D39A 3MV11 1ZS8A 1MJUH 1QR1A 3UZVB 1NGQL 2E6PA 1XT5A 5GRUL 3CU1A 1G7PA 1U36A 3PGFH 4MXVF 2BSTB 3LQAH 4NZRL 2UYLA 3C6LA 3MUGB 4YHIA 2AVGA 3OG4B 3GBMH 4HUUA 3MACL 1S7TB 3OQ3B 1HHIB 2H26B 3ULVH 4L4VA 3UYOD 3QNXA 3MOQA 1TIUA 4KHTH 3MRFB 1G7QA 2WM0A 1CD1A 5DQ9B 1JL8A 1OT2A 1EGJH 1P5UA 3DHJA 3QZWA 1H3UA 2NR6D 3HNSH 4OIAA 1UB6B 4NSKB 2BFVL 2QHRL 2VZ3A 5CEZH 5FHBH 1LP9A 4JM2C 4OFYA 4PJEB 5D6DC 4KK8D 4MJ5A 5TDNB 1YEIH 3R06B 1CTOA 3RWIB 3TN0B 5DUPH 1J8HE 4ORGB 5C09A 2WAHA 3H0TB 3ZT6A 1HHJB 2X5PA 3ARFD 3EYFA 5KANI 3N06B 3CK0L 3SDCB 3QO1B 4XWGL 4MHHI 2VE6B 4NCC2 3RIFF 4OZIA 4WI9A 1IL1A 4NPYB 1MHHB 5IK3B 2DKMA 1IM3A 1IAIM 4IMKA 3VWJD 4K3JL 1FCCA 3VD7A 4UIKH 2XNAA 4TNVF 1MCFA 3MXWH 1VSCA 2MPAL 2XA3A 4XCFH 4WHDA 1DQLH 3O81A 3DURA 4GKNB 5CIPB 1LE9A 1T5WB 5F1NB 3W9EB 4YNYB 4U1SA 5FDWA 4CVZA 1F90L 2MOVA 3UTQB 3DVGA 4BFIA 5KG9A 1BFSA 1EA9C 3CDFA 3TO4C 1JF6A 1OGAD 2VLKE 3AS1A 3SJVA 4P99A 4NNPH 4G5ZL 3MGTB 3V8CA 3G5ZB 3S96B 1W0YT 3EZJB 2FR4B 2NY0C 4ODVH 1VGKA 5KVEH 5IW6B 3L5JA 2R1XB 1HDMB 2XPGB 4XRCA 4GW4B 4X5XB 5CMAA 4Z7UA 3E8UL 4CVWA 1TJIL 1UADC 2R23A 3NPZB 5D1ZB 1ND0B 3BWUC 1WIOA 1H3GA 1BBDL 4XC1H 2HTKD 5GGSY 3QUXA 1N5YL 1ZA6A 4H5SB 5EBMB 2H32H 1QFHA 3HAEG 3LZFH 4G6FD 3V52H 4QRTB 5C0DB 4JFFD 1G7MA 1CXIA 2WQRA 3N1PC 5H94B 5D5MB 5DRWB 3BRFA 5SX5K 3ULUE 2Z31C 5K9KA 5I1IH 5ACMA 1H3PL 2VR5A 5D7JC 1REIA 4JY5H 1JK8B 1DE4B 3ALPA 1BHGA 2CDFA 4LP5A 2C5DC 2ZUWA 2EXWC 3MV01 4FQJL 4JLRB 3G6JE 4JFQB 4J2XA 4Y4KA 1MNUL 4LNRB 4MXWL 5K9QI 3MUY1 2GSIB 2BHUA 2JB6B 5JW4Q 4JO2H 3ARWA 3WJJC 3CXDH 1SYVA 1J1PL 3B2UD 3MLZL 5AD0B 1TJHH 4PP2A 1HSAA 2JB5H 3ZE0E 3VFGL 4MB4A 4E41B 4PRHA 5IEKB 1JP5A 1RIUH 4F7TB 4NJAL 5EDXA 5F3BB 4D3CL 1W0WB 2VQUA 4NWUH 1ZWIB 3C60B 3NABH 1CL7I 2D4FA 5E1AA 4WDIA 4QHLB 1YEFL 4XHQA 3TFKA 2EKSA 2DMCA 3IXAB 3JTSA 4KTYA 4D94A 4ODWB 1PX3A 5DSCB 3ARBA 1LO2H 5TE4L 1JTOA 1I9IH 1KT2B 3H7BB 1A6VL 4WTZA 2V5MA 4YAQB 4D2NA 1U2CA 3RVWC 3CMOL 4G8FB 2UZIL 3BPOB 1AY1H 4EVNB 3TF7A 4PY8J 3GSWB 3FAXA 4AQOA 3ZL4L 2J8HA 3MLYL 5E8OB 3IDNB 5EU6E 1TMCA 1IBGL 1CCZA 1UC6A 2EDFA 1YJDH 1RHHB 1MHCA 3ZKXB 3MREA 2HLAA 3B2VL 3EO9H 3G04B 2IBBA 5FUCC 4OD1L 3V2AR 4OZGA 1KIQA 4ZFGL 35C8L 2BSSB 3AVEA 5HGBB 3DBXB 1S8DB 4F57H 2NY1B 3SDAA 3VA2C 5J4MA 4M48L 4BQ9A 4NN6C 3R8BB 4QTIL 2VZSA 1BFVL 4O02H 3REVB 2VDQH 4BH7A 5J56B 3KHQA 4L29B 3MRCB 3CUPA 1IQWL 4Q74A 4NBZB 1ZLWK 5C08E 4L3AA 2EH7L 3ZTNL 2G5BB 4DWHA 4OAWA 4H1LH 3ARZA 4YUEL 4XNQB 1T6VN 4XXCC 1PSKL 4MS8D 4U1KA 1D5BA 5HYQB 1CGVA 3SCMD 2DWEB 4CMHB 5I15H 2AJYL 2FHBA 4NHCH 5FXCH 5LGHH 4LRNH 4DFIA 5FB8B 1NGWA 3NCJH 3L7EA 5D9SB 5HI4C 2A6IB 1YDPB 1AGEB 5DMJB 4X6CB 3PL6A 1WCBA 3O9WC 3AM8A 1MQKL 1FBIH 5IFAL 1WV7T 1UQSB 5MENB 3BIBX 2D7MA 1G9MH 1IGCL 1KJMB 1BJ8A 5DJZB 1URLA 3M1BA 1RVFH 5E2VL 1MLCB 1AJ7L 1KLFA 1R3KA 2VDLL 1I8MA 4IRZL 1D5IH 3RZCD 3LKQA 3MFGB 1BD2A 3VWKC 5DD0H 5C9JB 4HS6A 4NQXB 5E2TL 2DQJL 4GO6B 3MOAH 2EYTA 4POZC 5D7IA 3ARDD 4P2RA 5JW3H 4M1CC 2NY2B 4HXBH 4NRYA 2WLZA 1MRFL 5HHOD 1HH9A 3HZMA 4N8CH 3CFDB 4JRXA 4U05A 5LBSL 1FFOA 2WIIB 4OZFB 3WDIA 3T8XB 5EO1B 3UYPA 5EA0H 1MY5A 2FIRT 4MNGE 1CIDA 1FFNA 5E4IA 1YY9C 4XVUD 1MFCH 1P9MA 3TIEA 3L3JA 1YN6A 5CP7A 3QFDA 1A7BA 3ZT5A 3TH4T 4F9LA 2ENYA 4H8WC 2BVUA 3MNVA 3B43A 4OZ4A 4I0PD 1PLGH 3MFFB 4LPVA 5GQBA 5CILH 4UDTA 4PS4H 1A9EB 4Y5VB 4RFNB 4LSVH 4CNIB 2J3SA 1QBBA 4ONFL 3MV9D 3HR5A 2YOCA 3MNWB 2CJUL 5GGRB 1Q9KB 3MCLL 3KNBA 4D9RE 5JA9A 3OSKA 4R3SB 4WV1A 4KKBC 7FABL 1N6QH 2RFXA 3W2DH 1EGJA 5CGYD 2OQJB 2A73B 1FPTL 3VG9C 3AY4A 4FQXB 2B2XH 5H8DA 4FZ8L 3GMMB 3C08H 5T1LD 2I5YH 1FNFA 1P4IH 3KPLA 1KPVB 1T1YA 3OJDB 5LCVH 2BY1A 4ODBD 1XGPB 3TYGH 3BKCL 4UUJA 2AKRB 3ULSA 3RFZC 4PY7B 2DKSA 3WIHH 4K8RH 5D1XB 2ZSVB 4LSRL 4XTRC 5A2JH 4S10A 2LV4A 2OM5A 4JR9L 1VGEL 1S7SA 5C0BA 4XPHH 4FFZH 2OSLB 4M02A 2X2YA 3VI3F 3G5XA 2AQ1A 5JXEA 1IC5H 5L2JA 2EE9A 3WIFA 5JIHA 4AIOA 4JO3H 3GRWL 3U2SB 1OAQH 3HE7B 4LLDA 3EDDA 1T3FA 3FO1A 5CINH 3EYUL 2PETA 1VACA 4PJ5D 2DM3A 4K2UL 2H2SC 5D2LA 5INCA 1BP3B 3OR6A 4MA7L 3BPLB 1EVUA 1GOFA 3HKFA 2IGFH 5IG7B 2EECA 5DHYA 4HUXB 4ZUUB 2VXQL 4MQSB 2P8LB 1QO3B 3V6OC 5ILTH 3H42H 4ESKA 3BDYH 3O6ML 3ZKQD 3TESA 1GGIL 3P0VL 2VQTA 3LPWA 2YWYA 1ZT7B 4YHLL 2B4CH 2N56A 1A14H 2VL5B 2Z93B 1WZ1L 1CFSB 2QQKL 5D1QA 5GGTA 2WWKO 4S0SD 3VU2A 4DGYH 2XT1B 5I6XC 3DYOA 3MRQA 2Y23A 9CGTA 1JPGB 3I3EA 5C0ND 5F1IB 1A1NA 2DLIA 2MCPL 2AEIT 2DJSA 3BP4A 5HI3C 3FJTA 1KC5L 5T3ZD 1FJ1B 3JVGC 5GS1C 3VE0A 5IHLB 2P43B 2RCSH 5JW4N 3LDBC 5JHLL 1QKZL 1YNLH 4L3EB 2ERJB 2W60A 4JRYD 1UZ6E 4RAUA 4M5YL 1MCDA 4JDTH 1EVTC 3F7PC 3DRTB 1YMMA 5TQ2H 1V7MH 4MNHB 3CFKB 1KXTB 1J87A 3T04D 5HYEA 2L7JA 3PQYD 2FJFA 1OQXA 4G8GA 1PAMA 3HZVB 3JSSA 3PXJA 2AABL 4NO0B 4LFHG 1NKRA 3O4LE 4U0RC 5GXBB 4ONGH 1WC7A 2K3TA 2PYFB 1OWRM 4XB7A 3ARUA 5DUBB 5JUEH 4FQCH 2ZOKA 4DN3H 1AGBB 1CDJA 5D6CA 2Y07H 1SY6H 15C8L 4JO1L 2XY1A 1CXHA 3MRKA 3MA9L 3U48A 1D6VH 3ARXA 4QOKE 4UV4H 2VDPL 3V6FA 3C6LC 4HIHA 2R2BA 1FL5A 5EC1B 3UTPD 2DQIL 1XF4B 1CL7H 3PNWB 3HCVB 3H8NA 3SE9H 1I7RB 5MEOB 5ADOL 1CBVH 4HCRH 3GBLA 3MYJB 4FMFA 3P73B 5DRNA 2D4DA 3CJJA 3PWLA 4JFFE 3L6FB 5I1CH 1YNTB 1TTUA 3RX5A 3RWCA 4F2MB 1I1AC 1QVOB 1U8HA 2N1KA 1NEZG 3RA7L 1MREH 3UXFA 3VXNB 3MRGA 5BS0D 4N5EA 3DVNA 3GSNB 4PRID 1P7HL 4IRSA 3UTSB 3MODL 2R4RL 5SWSE 1CI5A 3FB7B 4XC3H 4JGJA 3B8YA 5GZND 1IGYB 3FRUA 1VEPA 2E7MA 1BQLL 3BWAB 1UM4L 2XKUA 4P3DA 4P9HL 1LK2A 2MTPA 2IALB 2JELL 4JM4L 1I4FA 4QNPF 2G2RB 4UT6H 3AS0A 5FM5O 5KJRH 4LCUB 2CK0L 1BJ1H 4NRZA 4PB0L 2HT4D 3K4AA 4IMKC 4HKBB 1NAMB 5BMFH 1I9RL 3PWPB 5AYUH 3VW3H 5HHQB 3HLAA 5BZDB 4UDUB 2VLKA 2JIXD 3GJFB 1J1OL 1RHFA 4KROD 1HI6A 3KPSB 5C07E 5BV7B 5TPWL 4OI9A 1VFMA 4DN4H 3MMEA 3GMLA 4CDHA 4S1SH 3HNVH 1EHXA 2AP2A 2OXHA 4C59B 1OGTB 1CXKA 1AD0B 3PWVA 4M8QB 3UJIH 2ADFL 1QBAA 1TTGA 4XAWH 3A6OA 5K93A 2DQDH 4JPVH 4KAQH 5GRUH 3KYNB 3GSXA 3STBA 2ZUUA 4FQ2L 3QBTB 4KJWC 1P4LB 3V5DB 4JPKL 4OFKA 4CVUA 3O3EB 1R3IL 1DLHA 3O6FA 5CWSB 3LEYL 4YXHL 2JCCF 4NQVA 4IDJL 3DV4A 3MACH 2FGZA 4GW5A 4RQQB 1JPFA 1KTKE 3SGDI 1DN0A 3TVMA 5CZXD 4X6EB 1S7WA 3G6JA 2ITDA 5FHAH 1KNOA 3GMNA 1H5BC 4NO3A 3QPQD 5IB2B 3H3KA 4X4YA 2BNUB 2JE8A 3Q5YA 1Z9SA 2BDNL 2C1PA 1UT9A 5I1DA 1BF8A 3GM8A 3K4ZA 4Z7VF 2QHRH 2YD8A 3PDOB 2F54E 1XF2B 1ZLUH 2GJ6B 1SBSH 4Y4KC 3RPIA 3EFFB 3IS0X 4ZSOB 3ZKND 4EN3A 2ICWJ 3VXUD 4PRPE 4Z7NF 2VAAA 5E8NA 4YPGA 3KJ4C 4PRDA 4Q6IB 5HYJB 3EO1B 4UAOB 5IHBA 4UOW1 3CK0H 4GW1B 3F7YB 4J3UA 1VENA 3GFUA 3HI5L 2P8PA 1RJYB 1R6VA 4NZUH 2AJVH 4K3JH 4KI5D 4O2EA 4QRPD 5F7DB 1D9KB 1BZ9A 2FX9H 1AP2B 1ITCA 3MRIA 1HKLH 1GC1L 5DJ6B 4EI6B 4HUVA 2OTWB 5I0DA 1U42A 2IH1A 3B9KA 1BAFL 1RZIB 3QDGD 5BJTB 2A6DB 1HINL 3E2HA 4WO4D 2I60L 3V0AC 4G43A 3GIZL 3RIAK 3WFDL 4XAKD 3HZYA 3MV8E 5EU6A 5FKPA 1WK0A 2HRPH 3D0LB 5INDB 2AXJA 2D31A 4P2QA 5GRJL 5C0AD 2ICEB 4I18A 3KG5A 1ZTXL 2EC9U 3WIHA 2BVYA 2AERT 1PYWA 2XXMB 1TJIH 4P23D 2RAMA 4Z78A 4EI5D 1H15B 1INDH 3S6CA 4HIXH 4LEOA 4PJGB 1BBDH 5HHOE 1BQHG 4E0RA 1N5YH 4NQDE 5FGBA 2I25N 3SO5A 1KELL 4RAVB 5CAYB 1YEHL 1D5ZB 4G80A 3G6AA 2XKNA 3DARA 3GSUA 1CG9B 3MNZB 1H3PH 3QIUC 3MRJB 1AGDA 4MA3B 5FM4A 4PFEA 1UCTA 3I6LE 4YZFF 1AKJB 3MJ9H 4X0KB 4CMMB 2ADJA 4MXWH 1OLZA 1AIFA 1FYTB 2X4NA 2FL5A 2BVOB 3GSVB 3IKCA 4FQQB 2ZJSL 4OJFL 1JYXA 3BPNC 3ZTJH 3MLZH 4Y16D 4R90H 5GHWL 2AJZA 2FWOB 4LNVA 4YH6A 3MLPA 3T1FB 2DM7A 4UBDD 2PW1A 4C56E 3IU4L 3UAJD 3VFNB 3BH9A 3RGVD 2QTEA 1T04B 1CLOL 2XTJE 1MHEB 1LVEA 2XN9B 4LVEA 5JW5A 4YDLC 3I75B 1FNGB 2ZUXA 1V7NH 4TULH 5B39B 2VDNL 3WEXB 2NW2B 1YEFH 2B7DT 3RU8L 5DJXA 2HMID 2IAMD 2V7HA 43CAA 4IOSD 4X99A 4JY6A 3A6BL 1D7FA 3S4SB 2A2QT 1NDMA 1C7SA 5DJCB 4NQCD 3D85B 5C0CE 4RAHA 1EERB 4OCXH 5CHNB 2R8SH 4MNQE 4X8JA 2Y5TA 2HFFA 3MA7B 5KSBF 3CMOH 2DI8A 3MXVH 3BP7B 3OAZK 5SX5H 3ZL4H 1B2WH 4HJ0C 4MNGA 4ODUB 3U79A 5F7NC 1QYGH 3E6FA 4JFOB 4LLAA 1G6VK 5J11C 4RNRB 1QLEL 1NFDE 3B2VH 4XXDB 1R5WB 4U3HA 3ARGD 4IJ3C 2NY4B 3LQZA 1UH4A 2VLLA 1NMBL 3MR9B 5I18L 4ZFGH 35C8H 5I8KL 1X5AA 1F6LL 5ANME 4K71C 3LD8C 4U1MA 5LWYL 1IGFL 3PHQB 2VZVA 5T5FL 5F7YC 5CLTA 1P9MC 4Y4HB 5IQ9A 1U8MA 1VCAA 3QDAA 1SY6A 2PF6A 3U7YL 1BFVH 3KYKL 4PJEF 4Z0XA 1XMWA 3MRPB 2COQA 3CH8A 3RVVD 3ZTNH 2AEWA 1QR4A 2XFXB 1FZOA 1OARL 4EQ2A 4OLVL 4YUEH 4HC1L 5DMIH 4LOUD 2QKIA 1I7TA 4N90D 5GJTL 5DQJA 4DKFL 3RWJA 3VGBA 3UTZB 2VLRB 4HJGB 3EDKA 1VPOL 1MCIA 1WJ3A 1ZHNA 2AJYH 4LLMB 4QCIB 4NRXA 2WANA 4HF5L 1MAKA 4Z0BH 2W0LA 4NKMA 3O8XA 1QFWL 3IETB 1Z9OA 4YQXL 3I85A 2B20A 2HKFL 2Z8VC 2ORBL 3RPKA 5TE6L 1FZMB 1IGCH 1JN6A 5EUKA 1S3KL 5F6IB 2ITCB 1V5JA 4J3TA 4I3SL 1RIVL 1WBZA 1DQML 1GZQB 3WHXA 4H1LB 4MDIA 3SE8H 1BX2A 4FXGA 1XF5B 4KGJA 1A5FL 4QHUA 1I7UA 3JZ7A 5E2TH 5EBWA 5GGRY 2DQJH 1N3NB 1QFUL 1QBML 2EEDA 3QJHB 2VZTA 3QNYA 5E6ZA 1MRFH 3WFZA 4YEFA 3U82B 3QHTC 1C08A 4YDKH 1U3HD 5HHNA 2Q76A 3TJHD 5JHDB 5LBSH 2V2WA 4KJYA 5FYKL 4OUOA 4JDZA 1CT8A 4PJDE 3JTTB 1ZLWH 5EORL 3MO1B 1ZHKB 5D5MF 2Y1VA 5E1HB 4Y1AB 4JQXA 3EOBB 4NP4L 4XNZC 1I1YB 3EKCA 4EDXA 1ZHBA 3BRGC 4LGSB 1DDHB 3TV3L 2OJEB 1AQKL 3GJEB 1MIMH 3MLSH 4F7CA 5FOBB 3NFNB 5L0QC 4WUUE 2CIKA 2P5ED 2B39A 2GHWB 2DQTH 5IT2H 2MCG1 1DR9A 1WZKA 5DVKA 2YC1B 4JFZL 3FOLB 5D93C 3ARFA 4JFDE 1U8IA 4PJBB 3BDXA 5I76B 1CS6A 3LB6D 5TE7H 5KSUA 2Y36L 1UXSA 5IJKA 4I4WB 4UIMB 3MCLH 3TO4B 1F97A 2YSSA 2PTTB 5ICYA 1ULVA 1JMXA 3HG1D 1T7YA 2HFGL 4GAFB 4WI8A 3CDCA 3MSPA 1FPTH 2NY0B 4LHJB 1Q0YH 1DEDA 5F89B 4FZ8H 5KVMC 3HRZB 5EO0A 5F3HA 1UWXK 3H9HB 4GRWE 3BHBB 2J6EL 3S37X 5DS8B 1JNJA 4PD4J 4OF3A 3KLDA 3OXRA 3O4LA 4R2GB 1IEAA 2P5WB 5JXAH 1MCPH 1U3ZA 1T03L 3W39A 1NQBA 4LSRH 4OCYH 4TVPE 1YUHA 5F7EL 3JTCA 2F8OA 4YK4C 4P2OD 1OHQA 4HKXA 1AQDB 2R69H 3BAEH 5DR5L 1R3JB 1K8DB 2J8UE 1NC2A 3D3VE 1MFDL 3OTTA 4GKSB 1XF3A 5D7JB 1JV5A 1U93A 1ZEAL 1J9CT 4QOKA 3EYUH 3N1GC 1HWHB 5F44A 2YK1L 4YWGL 3FB8B 3T65A 3HHRB 4MA7H 4Z7OE 4U1HB 4OGYL 4EUPA 4HWZA 3MRLB 3FCTB 2ARJQ 3SKMB 4JG1L 1JNNL 4MD5B 2VXQH 4LP4A 3K4DA 2VOTA 3O6MH 5IVXB 1GGIH 1IFHL 3P0VH 2OJZL 4XT1C 4C83B 4UU9A 3KPRB 4LPXA 5SWSA 1O7VA 4I0KA 1SQ2N 2Z8WC 4CUCA 4JN1L 2C3VB 1Q9LB 2A9NL 3F7QA 1QLRB 1WZ1H 2QQKH 3DUUA 5GS3A 2GCYB 3RWEA 4OZFG 5T3XD 4P5TC 3G08B 4N5EC 3NIGF 3H9SE 3C5JA 4ZXBC 2MCPH 4HV8A 4Y89A 4LLWA 5F9DC 5E5RB 2IEPA 1KC5H 1F11A 3VXUE 5ERWA 3PP4H 4N9GB 2YA0A 3VA6A 5EZJA 4P5KA 3MJ9A 1TFHA 3PDDA 3OPZL 1QKZH 4X6CF 2R56L 5D7LD 2OI9A 4JPWH 4KK6D 5C07A 2Q8AL 4OI8A 1ORQB 1A4JB 2DQFB 1QOKA 2GIYA 3FQWB 4QEGA 4G9FE 3QDMB 5FK9A 4OCNC 3LKPB 1QFOA 1ZHLB 4P4RB 5E6IA 4GSDL 2XZAH 5KSAB 2VXTL 5ITFB 3TBTB 1K4CB 2AABH 1Y6MR 3B5GA 3QDGE 5KN5A 1BFOB 1AGCB 4MXVE 4PJIB 5F9JA 1FLRH 2YHGA 1ITBB 4WFGD 3WHE0 1RK0A 2GJZA 1PEWA 3P4OB 3RAJL 3MRBB 1A6TA 4NN6B 1F13A 1NGZA 3NVQA 1NJ9A 4HIEB 1EZVX 1BIHA 3GSRA 4J8RA 1ZSDA 1UVQB 2R9HC 3BIKB 3QCUH 4NCDA 15C8H 5DQDH 4JO1H 1F4YL 3TNNB 3MA9H 2ESVD 1AH1A 3VFTA 3U9UA 2NLJA 4QYOB 4LSQH 2EH8L 1A7NL 2VDPH 3NN8A 3ULUC 1R5VA 2A1WH 3ELAT 4MZ2A 3WYRA 1EIBA 1JYVA 4AMKL 2C3XA 2RB8A 5ADOH 2F54A 3L3HB 4HMDA 4NQEB 1QUNA 3W0WD 2L0DA 4LLQB 3O2VL 1EK3A 1NAKL 5CSBA 4PRPA 3HE6A 4BZYA 5F72S 1BEYL 3IDGA 4NO5B 3RA7H 1U92A 4AEIL 3MODH 2EDRA 3QPXL 1VFBB 4TVPH 4K7PY 2BZDA 2YS4A 5CD5D 3VXMB 4AEFA 5GZOC 4FG6C 3SCMA 4M03A 5ALBL 5IKCA 3HN3A 4APQD 4UQ3B 3QFJD 3TBYB 4YHZH 1BQLH 3QUMH 4G7VL 4P9HH 4UI2A 4JM4H 4QHNB 4BZ1H 3VWKB 2NY7L 4Y4FD 2NY3B 1MJ8H 5J6GB 4E42A 4PB0H 5LGJB 4OZIF 1I9RH 4R9HA 3QNZB 4PJ7B 1XIWD 5E56A 3G5YA 2DS4A 2L7UA 4ELMB 4TSAL 3MV8A 3N1QC 1AC6A 4KU1A 2UWEB 4NWTL 2PXYD 3EFDH 4XPGH 5TPWH 3CVHH 3B9KC 4JHWL 4S2SA 5EFIA 4M1DH 4G6AC 1KACB 2HFTA 1ZVSA 3E2HC 2E27H 4TQEL 1E4XI 1RUAL 4OM0H 4FQLL 4PTUB 4HX1A 4H20L 3TBSB 3KLAA 3GK8L 2UUDK 3AREC 4P46C 5SWZE 3SOBL 1UJTA 2VR4A 4UT9L 3QQ3A 4MQXC 5E8DH 1CDIA 3HUJE 4BA8A 2X4TB 4NQDA 3VJ6B 3ARPA 1JNLH 4F7EB 5B8CC 1Q8MA 1R3IH 4FQ1L 1OP5K 2P4AB 5KVGL 3LEYH 4YXHH 2ZUSA 1B3JA 3HPLA 1TQBC 3CIQA 3BE1H 4IDJH 5JNYB 4OFPA 3L3DA 4YXLH 5JORB 4ZTPH 5L2KB 4QT5B 1JFMA 3PIQA 4PREB 4Y2DD 1WLHA 2Q1EA 3F12A 1RV6X 5I1KH 2IFFH 5CUSH 3VG9B 1CLZL 2GSGA 2BNQE 5MEPA 3VGHA 2BDNH 2VRAA 2A9MH 3EDEA 1T83A 3DUHA 2CKBB 1KIUA 1KJVB 4ZG1A 4YFEA 3HTLX 5IB1A 4AIZA 5D96B 3RUGE 3QEQD 4XMKH 5IMMA 2WQ8A 4C56A 3CCHA 3FFCE 3TZVD 3QUZD 4JB9L 3QEUB 3TBWA 1RFDL 1TZHB 2AV1B 2ZNXA 3DI2B 4BK5A 5I19H 1H3XA 3BD4A 2DQEH 2CMRL 4ELKB 1M71A 3UC0L 1BGXH 5JW4R 1CICD 1G7LA 2NY6B 2B5IC 43C9A 4MXQD 1FO0L 1GC1H 3QXVA 4PLJD 5J9PA 2V9RA 5CSZB 3UO1L 5C0CA 2EDXA 5GRYA 3O2DL 4LBEA 1BAFH 4AENB 1XH3A 1ZKAA 4MNQA 5DZNA 5JOPE 4JRWA 3W11C 3S35L 4N5UA 2HN7A 3KXFE 2PO6C 2C3WA 3WFDH 4Y5YA 5K33A 5JPNB 4JFYB 5HYIA 1JGEB 4LRIC 4PRNB 1HILA 5BW7C 3U0PA 4KK5C 1IT9H 4YR6A 4LCWD 2AK4A 2WBJA 2VQ1A 3C5ZA 4R0LC 1ETZA 5I6XB 5IMKB 1X7QB 2G75B 3FB5B 4WWID 5I66A 1VKXB 1P6AB 5ANMA 3R4DA 1U3YA 3J7HA 2VXVH 4YHKL 1U58A 3EO0B 3PHOA 1JZ6A 5IBTL 1A1MA 4XMLL 5DVLA 4C55A 3V5HB 5T1KA 5DFWH 3UDWA 1WIUA 5JA8B 4JM2D 3T0EE 1J88A 5ESVA 1U8LA 1EFXD 4OZGF 4WU5A 2EEAA 2BVPB 3P0GB 2K7QA 4WFED 1SJHB 3UZEA 4XGZB 4X7CC 4NQTA 4OB5H 2HG5A 4WCYL 3CVIH 2OMBA 3IFOA 3AU1B 3IJSA 1JPTL 2HJLB 1LEGB 1RZFL 4H0GA 2A6JA 1KF9B 4PJCB 2ZJSH 5JLZB 3V4UH 1B6DA 1MPAL 4QRRE 2DMKA 5GHWH 5KSVA 2E9JA 3IFPA 1OTUC 4U0RB 1MF2L 2BCKA 2X89D 1KG0A 1ZT1B 4Z7WB 1OF2B 1CDUA 4ZUTB 3LV3B 3BP5B 5EU3A 4WWKC 3JWDL 3V0VB 1WTLA 2VLJE 2FEDC 2MQCA 4GAYA 4WIQA 4MAYC 1QP1A 3O8XC 1G7PB 2VDNH 3C8DA 1JGVL 2NTFB 4NDMB 4RA3A 3RU8H 4MGXA 3T77A 5MI0C 2BJMH 3TA3A 3A6BH 2QL1A 4ZFOA 3LN4B 2V5TA 1FGNH 4KKCD 2AXFB 2C4FU 5EU4B 2AGJH 5AG9A 1NCNA 3D69B 3FQUA 5ICZB 1B4RA 4X98B 1ZLVK 4PJHE 3UCRA 1KJ3L 2WP3O 1LEIB 1M05B 4NM4H 8FABB 3RX7A 3WLBB 1NH6A 1BREA 4AG4H 1QEWB 2IAND 3LKNA 3T3PF 1I1AB 5ICXA 4PJDA 3FQXB 2MSPA 3N50A 5DC4B 5FO8B 5D7IF 2Z31D 5DRZB 2Y72A 3VFPA 3CDGA 3ETBF 2WW8A 4ZUVA 5BQ7A 1DSFH 1NMBH 2HVKA 2X7LB 4WUUA 3SGKA 1PG7X 5C09B 4D0CB 4NGHL 2YKLL 3OAYK 3LS5L 5KW9H 1JWSB 4R96B 1HXYA 5T5FH 1RK1A 3OJ2C 4PRBB 3LPFA 1RZ7L 5I17A 4PRAA 4QXGL 1OAXL 1ZVHA 4JFDA 5KAQG 3VXSD 3HAEH 3U7YH 2GY5A 3NPSC 2NR6C 3UTTE 1KGCE 3OX8B 1UH2A 3DXAB 3ISWA 3MBEA 4DKEL 1IAKB 1QFPA 4OLVH 1A2YA 1NLBH 2KKQA 3ORJA 1BWMA 4MJ2A 3ARFC 5J1AA 4CVZB 4YHYC 3S3JA 2VZUA 1FGVH 5JO5B 1UYWL 4DKFH 5IB4A 3ULVF 1X5JA 2DQUH 1FNAA 1BQUA 1QRNE 5TF0A 3VWJC 1NCDL 2DYPD 1S7VB 1U91A 2O61A 4QRSA 3P77B 4H0HB 4Q6YA 2HJKB 3UTOA 4YQXH 4BUHA 1XGTB 3QCVL 3OAZH 4DZBB 5ID1B 1KCUL 4XMPH 5TE6H 3ARYA 1ONQA 3KYAA 2E9IA 4OZHB 5T3ZL 2J8UA 3VI3E 3QUMA 1S3KH 2CRZA 3D3VA 4KPHL 2VIRA 5FA4B 4I3SH 1RIVH 2O26U 3OKDA 1DQMH 4F3FB 3U30C 4HHAB 5J57B 3T4YA 4LK4A 2A6KA 1H5BB 2DL9A 2XOTA 5FUOH 2VERN 2H6PA 1A5FH 3D48R 5ISZD 4MWFA 3SKOA 5D71H 5I1LA 1MI5D 4XVSL 3RTQD 5B39G 2WV3A 3F5WA 1VADB 2NW3B 3K1DA 1T7ZA 5KAQF 1NCBL 3CVHA 1G7IA 3S4SG 5E9DB 1I8KA 4PJGF 2F19L 3WSQH 4PUBL 4F7MB 5FCUH 1FORH 4J4PA 1NCWL 2HTKC 1WZMA 3PABA 3CSYA 5EORH 3S5LB 5TDOB 5D2LF 4ZD3L 4EQ3A 1WICA 3O3AB 3MLVL 3SE4A 1AD9A 4PGEA 3VGFA 4BYHA 3WXVL 4DGIL 4JKLA 5FECA 5I74B 1U8OB 2GK2A 3H9SA 4OLWH 5TQ0L 2ED9A 1LNUB 3IXTA 5AEAA 1XEDA 1YQVL 4ORZC 4HS3A 3CGTA 3QEHA 1EO8L 4Y19D 1AGFB 1TENA 1OSZA 3K46A 5J13C 1EO5A 1P7KB 5HI4D 4MLIA 5AZEL 1J12A 1IGIL 2YZ8A 5IIEA 4KDWA 3B2UC 3FOMA 2X4PB 3O9WD 3V0WL 3FQRB 1JF1A 3SGEI 1I8IB 4G9FA 5F97E 2BERA 5FFLA 5CEXB 2JTDA 2XACC 3U0WL 3CSPA 5A2LH 3CFIC 3SY0B 2RBLA 3DV6A 5T1MA 2ICWA 1S5IL 3MYZA 5IW1B 2OI9C 3JV6B 4UINL 3F7RA 2YD6A 4FTVD 1P1ZB 3ZLQC 3QDGA 4D0DB 2OK0L 3LEXB 3FFDA 2OCFD 3DIFB 1NCCL 4RWYL 1N5AB 5J6HA 1T03H 1NBZB 3L3OA 4XVTL 2NNAB 1MHCB 4RGND 5F7EH 2VH5H 1A22B 4BZ2H 5E6IC 2IQAB 2QQLL 1CF8L 1JGDA 4WJ5A 4NFBA 1X3DA 4R97C 2IPTH 2KL6A 3KPNB 3CFCH 1K8IA 5FO7A 3BUYB 4PV9B 2X4QB 5JR1L 4Z9KB 4JVPA 3IVKA 4F7PA 1NGXA 2OYPA 3QIUB 1NCTA 5F88B 4P23A 4QXUH 4LHUD 3VXTB 1CDCA 3V6ZA 1IAMA 1SM3H 2OTUA 3VRLE 2HKHL 3Q6FA 5A2IH 2EXYD 4H1LG 2V9TA 1MSPA 3JWOH 3BPNB 4M7JL 4L8DB 3I6KA 5CJQL 3G5VB 1RMFL 1ORSB 3GI8H 5EZLB 3SPVA 4JHBA 3FTGA 1MHPH 4HLZH 2JJUA 2OMNA 3QDJD 1FLTX 3KPMB 4JN1H 1KCLA 2A74A 1MIEL 2B8OT 3WN5C 1S5HA 3V79C 3K2MC 4YE4L 4M6AA 4MVBD 4YDLB 4Q9RL 3QUYB 3CSGA 1UWXH 4ERSL 5HD8C 1IC4H 5FYJU 1OW0C 3RL2B 3DX8A 3HC3L 2V2TB 3FQNA 3UJJL 3RY5A 5CJ8A 2EDOA 2E8YA 3QEGH 4MS8C 3U1SL 3QEQE 5HHMB 4O51B 1QSEE 1S7RB 3SCMC 1MFBL 1MCWW 4ZQKA 4B53A 1S78D 1R3KB 1T22A 4GKZA 1YNKL 2YD5A 3OPZH 2XYCA 3IDXL 4OD3H 4OTXH 1BMGA 2MHAA 3KWWB 1H8NA 3P9MA 4M7LH 2Q8AH 4U7MA 4FABH 3IU3A 1I1FA 4KUZH 4TUKH 4L9LB 3VD9A 1BECA 3OGCB 4YDVB 4XH2A 2MJWA 3A67L 4GQ9L 1LO5B 2VXTH 4LEXL 5SWZA 4BJLA 4IJ3B 2H45A 2EEBA 4X7TB 3T08A 3HUJA 2BNRA 5IEHB 4RFEB 2H2SD 3RZCC 4K71B 5E70A 1FFNB 5DHXB 5HGAB 2FIKB 4NHUE 2JCCE 1HH6B 5CP7B 1HK6A 3RAJH 1LEKA 4XBGB 3ARDC 5DTFB 3ET9F 3ZYJA 3MV7A 1WBXA 1MWAH 2BOCB 5ITBL 2V6HA 3KPPB 3LKRB 4NC2B 3FN0L 5A3ID 1XGQA 1BZ7A 3DOSA 2BNQA 5D7KE 2EH8H 2A83B 3HMWH 2RGSA 1OAYH 5IQ7L 2BMKB 4Z7VE 1F6FB 4O58H 4RCAA 4IRJA 3OR7B 2JJTA 3X11B 4LVOC 5AUMA 5MHSD 4MJ6B 3KDMB 2RFXB 3DGCR 3BEWB 3RUGA 1BVLA 1PX4A 4I1NB 5C7XL 4I0PC 5HI3D 4Z7NE 3FFCA 3P4NB 5AZ2L 1RUKL 1U8QA 4AEIH 1T2JA 3HC4L 3PWUA 2FJHB 4UTAL 3QPXH 4PJBF 1S9VB 1KLGA 1LO0L 3FO9A 5IB5B 4I8DA 3ERYA 4JG0L 4M61A 1QSFD 4GBXB 5DO2D 2CLVA 5MP6H 2CD0A 4K23L 1GGBH 2AJ3A 2XTJC 1UWGL 3HAEA 5CGYC 4HS8H 2DF3A 5JDSB 1W0VB 4K07A 5BRZD 5IB3A 4G8IB 1KB5H 2EYRB 4R6UA 4P57B 1XR8B 5IFJA 3FT4B 3SDDA 4HFWB 1XCQB 3B3IA 3KXFA 1J0HA 3F65A 4HZLB 4TSAH 4S0UC 4QY8A 4S11A 4TSCH 1N4XH 3D39D 4JHWH 2N7AA 5K9OA 2ADIA 1UZ8A 4TQEH 1RUAH 4LASL 5CZKA 3O11A 1CGUA 5F93C 3TBVB 4FQLH 4OV6F 1S7UB 3QIWB 1IGJB 5DJ2B 3GK8H 1BQSA 5MERA 1JGUH 4N0CA 2XZQL 2W0KA 3OHXA 3C6LD 5IESL 5L0QB 2X9YA 3QXAA 1LWRA 3MUZ1 1A3LH 4ZDHA 3TJHA 1IM9A 4MSWB 4R26L 2P7TA 4WUKL 3PV6A 3C5ZC 5KVGH 3FB6A 3T0EA 3B9VA 4I48B 1HQ4A 5D93B 3R0NA 3ROOB 4L4VD 4RGMC 4M6ML 1WWWX 4OF5A 3KPOB 2FYYB 1A47A 5EG6C 2YPLB 4YZFE 3IFNL 5E94B 3MRNB 2VLME 3BPCA 4J3VA 2MWCA 3VFUA 1CLZH 1KXVC 2CSPA 5M95B 4OFYD 1G0YR 1RUPL 4JZNA 4PGCA 3BH8B 2F53E 4GG6B 4QRRA 1NBVH 5LQBL 4RAUB 1FL3A 4PJ8A 5DZOA 3T1WA 4G9DA 3BXNB 3ARVA 1MCLA 5DJDA 4JFPA 3BJ91 4DZ8A 1J0KA 2DAVA 4JB9H 3WLWD 2VC2L 1ACYH 2QADD 1WEJL 5BXFB 3Q3GB 3RKPA 4YK4B 1FNEB 1F8TH 2X4UA 1PKOA 2VLJA 4F8TA 4OV5B 2OR8A 3L3GA 2GTWA 1X5HA 1YEGL 1V3LA 3FRPG 2H1PH 1JIBA 3IF1B 1A7PH 4K3HA 3UC0H 3GMOB 2AK1L 3I02B 4KV5F 3C6SA 3WUWB 2VTFA 3IDIA 4X7DC 2UUDH 1FVDB 1FO0H 4NKQB 3SJVD 3IGAB 2ZOKB 2LFGA 5TFSL 3O2DH 4NCC1 3VXQB 6CGTA 4PJHA 1OB1A 2FD6L 3FHAA 3VGEA 4M62H 1OP5H 5KSBE 4WW2A 5HYFA 3S35H 1ED3B 32C2B 3GGWA 3T2NL 4AJ0A 4G42B 3VFRA 5HY9A 4YO0B 1JUFB 4Q9QL 3VFSA 5EU7E 3H6JA 2E3VA 3QUKA 1N0LA 1CU4L 1EEZA 3ES6B 1MRDH 3QUXD 1TJGL 2GFBA 4OFVA 1J8HB 3WFCL 1MI5E 1K2DA 4P5TB 4BKLA 3NZ8B 4GQPH 1A1OB 3C5SB 4JANB 1MEXL 2Z91B 1L7TH 4ZXBB 4H26B 2FGWL 3DX9B 4X7SL 2YR3A 5ETUB 2APBA 1T4KB 4XMLH 1B6UA 5F7UA 5J1SC 3LRSA 4J3SA 4PJEE 4GMSH 3UTTA 4GRLD 4GAGL 4XPFH 2D0HA 1DQTA 4Y4KD 5GIRA 3DMMB 4K94H 5FYLD 1DL7L 5DMKB 2GAZA 1LK2B 4TRPL 4DQOH 4U3XA 5EN2B 4HT1H 1KB9K 1UACH 5GGSA 5IMOA 2H2PD 3HS0A 3G6DL 3I6GB 4KKAD 4RISL 5FA3A 3R1GL 4G6KL 3UPRB 4Y0GA 3GJFK 1EO7A 1JPTH 4PRHD 1RZFH 1QRNA 2X40A 3ECBB 1UJ3C 3DX7A 5GZNC 4G6ML 5HDLA 1GZPA 3GI9H 3TLRA 1N7ML 5C0FA 2APXA 3GEWB 3PGCA 1Q9OA 4J23A 4LF3A 4LCYA 3WFHA 1KLUA 1WFUA 4ODXA 4KQ3H 1JVKA 3TFKD 4HIIA 3JWDH 4PJ7F 2HT4C 4DK3A 1OPGL 3PF2A 4MMXC 2M2DA 3ARBD 4LLVB 4D9LH 4CU7A 4ELMF 2BXYA 4LIQE 2UWEF 3DO3A 2V17L 5I9QC 5SWQA 3RWHB 4M9PA 4BSWB 3KYOB 3P9LA 4MA8H 2Z35A 4MQ7A 4IS6A 2YPKA 3OKKB 4PR5A 3GUTB 1QG3A 1JE6A 4XNUL 3QULA 3B9EA 3O4OC 1BOGB 4QF1B 1FZKB 1KJ3H 2V2XB 1F4WL 4QRQA 1HYSD 2X4OB 2CGRL 4ZO6A 2X1WL 3K0WA 3B9DA 4NO3B 2APTA 4LSSH 5D5ME 2CK2A 4YGVA 3RWDA 2C1PB 1KB9J 3GO1L 1UXWB 1U8KA 4PJ9A 5IOPB 1RU9L 2VB5A 3SDAD 3D25A 4LPYA 3FONA 3VH8B 4J7RA 3O41B 3GMPA 5CZXC 1F4XL 1GSMA 1MH5B 4NGHH 2XKSA 4J3XA 4D8PB 3BO8B 2Q86A 3I3DA 3QHFL 1NANI 1MWAA 1HOCB 1ZANL 3QPQC 3SE4C 3S36L 3FT2A 4NKOA 3PJSB 1RZ7H 3BQUA 5EOCJ 4PGBB 4HIJB 3X14A 4E41E 5EWIL 1J86A 4MB5A 4K7PL 4ZAKD 1C5BL 3QHZH 3FO2A 1F58H 1S7QA 1ZA3A 1KCVL 3ZKNC 3WMSA 4LKCA 4P4KA 3LN5B 1F3JA 4OF0A 4DKEH 5E5MA 5E8EA 1D6EA 3RJQB 1E0OB 5ENWB 5MEQA 1MJJB 5HI5C 1DQJA 1XGUB 2EC9T 1I9JL 3VXRD 3KPQB 5IVNA 1CVSC 4OKDA 2FZ3B 3DSFL 3PL6D 3MLWL 5DJAA 3EOAA 2HH0L 1GPOH 1IKFL 4K3DL 5FF6A 2W9DL 3AREB 4P46B 3BFOA 1NCDH 3DWTA 5T3XL 1BBJB 2PR4L 5C0IB 1ZLVH 1XIWA 3RNQA 1KIPB 2QSTA 3DJ9A 1NUDA 5B8CB 4M7ZB 5DEFA 4U1JB 4P9MH 4QKXB 1KCUH 3B6SB 1NGPL 3V5KB 1BD2D 2FEEL 4Z5RA 3WNPA 2ZCKL 1TQBB 4YEEA 1SVCP 3DX6A 2IG2H 3BGFB 2GK0B 4XP1H 4KTDL 4P2RD 1KB5A 1WFOA 1TZIB 3S9DB 4ONHA 4P59L 3BZFB 3D2UB 1T1WB 3DUSA 2IBZY 3QIBB 3BSZH 3OAYH 4U6XA 4JRXD 4Y8DC 5E24E 4I5BA 5C08B 5BZWA 3ALWA 3IDYC 4HWEH 4BH8A 1NCBH 3VRJB 4P23C 4EI5C 3P3YA 2F5BL 1NLDH 4PUBH 3PGDA 3B5TA 1IGTB 5CIPH 3GMRA 3INUL 3I84A 4OLYH 2OR9L 3OZ9H 2ATKB 1AHWA 4IDLA 4JVWA 4BFGA 3GB7A 4M7LT 4DOHE 3MBXL 3MLVH 2Q6WB 1RZJC 4F33A 3IJYA 3X3GL 5E2WL