3QUZA

Structure of the mouse cd1d-nu-alpha-galcer-inkt tcr complex
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
273
structure length
266
Chain Sequence
NYTFRCLQMSSFANRSWSRTDSVVWLGDLQTHRWSNDSATISFTKPWSQGKLSNQQWEKLQHMFQVYRVSFTRDIQELVKMMSPKEDYPIEIQLSAGCEMYPGNASESFLHVAFQGKYVVRFWGTSWQTVPGAPSWLDLPIKVLNADQGTSATVQMLLNDTCPLFVRGLLEAGKSDLEKQEKPVAWLSSVPQLVCHVSGFYPKPVWVMWMRGDQEQQGTHRGDFLPNADETWYLQATLDVEAGEEAGLACRVKHSSLGGQDIILYW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antigen-presenting glycoprotein CD1d1
publication title Galactose-modified iNKT cell agonists stabilized by an induced fit of CD1d prevent tumour metastasis.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 71
structure length 266
sequence length 273
ec nomenclature
pdb deposition date 2011-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3quzA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3quzA01
1ES0B 1T83C 1XFPA 1GGIH 3MV7B 4PJ5A 1RJYA 5B3JE 6FABH 2FX9L 4H1LH 1SJHB 2EYSB 3U1SH 4RWYL 2VOTA 4OLVL 2F5BL 1OSZA 4ZFOA 4ZODA 4WI9A 5T1KA 4MQXD 1AD0B 1I7UA 3M8OH 1NGWB 3HAEB 3BWAB 4EN3C 5F21B 4W4NA 5D72H 3NIGF 3TH4T 1KACB 3CFDA 2AK1L 4ODVH 4C83B 3QEUB 2JF1A 3P77A 5IQ7H 2JB5H 5FKPB 1D9KC 3QNYA 5JW4N 4X80H 2OJZH 1BBDL 1DE4B 2PCPB 1CGSH 3GKWL 1ETZA 3QUYA 3UZEA 3EYOB 3PHOA 3VXTB 1CFBA 1NUGA 3CDGB 5JMOC 3VE0B 4OD3L 1X5FA 2H6PB 3BPOB 1TJGL 4BQ8A 1PLGH 3EGSB 2FGZA 2EKSB 5EIVA 1K4DB 4HHAB 1DFBL 3SKNB 3FONA 5E4EC 1CS6A 1F90L 3D0VA 1NCAL 1KJVA 1LP9A 5DJCA 4TOYL 5IBTL 5I15H 1FVDA 1FNSL 1HH9B 4DK3A 4GW5B 1NUFA 3C8DA 4N8CL 4I0PA 1WWWX 2FYYA 4G6AD 3VJ6B 5D7LB 1PKQB 4DGIH 1TJHH 2QQKH 2OCFD 5HGAB 1FZJA 2NLJA 4OLYH 4TRPH 3TNMB 5MI0B 4CMHC 3VD9A 4ENED 4O02L 4OTXH 2CIIA 2GJZA 3K81A 2VWEE 4I3GA 4KTEL 1OP9A 3H7LA 5C6WH 1XGRB 1FRGL 4RNRA 4FMKA 4HULB 5HBBA 1EO7A 1DBBL 4PGCB 4QKXB 1KJ2B 3GSXB 4Y5YA 5ICZB 1KCUL 5E2VH 1BZ7A 5I16B 3QQNA 4FS0A 3BRDA 4FABH 2N7AA 4HGMA 4WW2B 4WHTB 1AE6L 1R5WB 2R23A 5EBLA 3QCVL 3SE8L 4NRZA 3NN8A 4PREB 4QY8A 2NY7H 5I6XB 1FE8H 1T5WA 1TVHB 1LDSA 4PY7A 1RUQL 2VLKB 4XBGA 5FHAH 4FQLL 1RZFH 3WIFA 2N1KA 2N7BA 4F57H 1YJDL 4AH2A 3TN0C 3GMMB 3IS0X 4GKSA 4K9EL 4KK6C 4OZHF 1KELH 4KHXL 2X41A 3B2UC 5FK9A 4JM2C 1OLZA 4Z5RA 3HLAA 5IWLA 1AGFB 3RA7L 3MRJA 5D6CA 4XTRC 5C08B 1CYGA 1AH1A 4H0GA 1M1SA 3A6OA 1E4KA 5A43C 5A2LH 2NY4C 4QGYA 1LE9B 4R26L 4UQ2B 4QRTA 3ULSA 3QFJE 4JKLA 5I9QB 4CW1A 3VU2A 2IGFL 2BY0A 4LCWB 4ZSOA 4RFNB 5E6YA 4NZRL 1JTOA 4N0CA 1U3HB 4Y1AB 1S9VB 2J7LA 4G6MH 5FYKL 2HRLA 4J3UA 5GRZA 4OIIL 4NQTA 3QEHA 5LCVH 3MBED 1ZOXA 2QQNH 3KWWB 1YPZE 4AM0A 3RDTB 2GJ6D 4NT6B 3RQ3A 1DVFC 4PJGB 3QJFA 1U41A 4LSTL 5D7SL 2J4WL 1BFTA 4HKXB 2DQGL 3OKKA 5J0BA 2HJLB 1I85C 3VXPB 4XXCA 3SGJC 4U3XA 3IAQA 5KSAA 3ZKND 2AQ1A 2C3VA 2JKXA 2P1YA 3FCTA 4LCUA 4BJLA 3WJLC 5EU6B 5ICXA 1T22B 2AJ3A 5MP6H 2YN3A 3GJEB 3KYOA 1SEBB 3RNKB 2E9IA 4KKBD 2GJ6E 4C56B 1G0YR 4Q0XL 2DJSA 3DUHA 5D1ZB 5F1IB 3GMNB 2E7HA 1L7IH 4PRPB 5C0BB 5JW5A 3KXFB 1TNMA 4RISL 2J5LB 1FLRL 4NC2B 4WHCA 4RWYH 5L0QB 4OLVH 3SKJL 2F5BH 5IESL 3D9AL 3GJFB 4YGVB 5EU5B 2FJFB 5GS0D 1FL5A 2Q76B 7CGTA 4GMTL 3RL2A 5B22A 2IF7A 3WS6A 2X4QB 4Y2DD 4OKVB 4NHUE 3NCBB 4NBXB 1BVLB 4WUUB 4HAGA 4UZGA 5E8DL 1XCQA 1AKJB 3CJJA 4Y7MA 4PR5A 1F5WA 3PDDA 4ZOEA 4XXDA 2AK1H 1ZT1B 3SDDD 4P2RB 5SWSA 3L3KB 3ES6B 3N1GC 4NN7C 4BQ6A 4HIIB 3WFZA 3P4OA 4GS7C 1BBDH 2I07A 5I8EB 1ZLSL 3ARBA 5ERWB 2I9TA 3T2OA 3GKWH 4OD3H 5EOTA 1E27A 4R3SB 3UXFA 3MJ6A 4WHYH 3VD3A 3X14B 3DLQR 4JFOB 4JFYA 2D7QA 2AXFA 4Y16B 2HJKB 1F90H 5IK3A 3MCKA 3WNLA 5EIIB 1NAML 3VDBA 4TOYH 5IBTH 3DGCR 1FNSH 1RHHA 1VKXB 4AJ0A 3ZE1E 3MJ9L 4N8CH 4UDUB 5DJYB 5H2BA 3GI8L 1P6FA 1BX2A 1RAMA 3LKPB 3VFMA 2BP3A 1LILA 4NGHL 4EQ2A 3PXHA 2Z31B 3L95A 2FZ3B 1P4IL 4NP4L 3L9RB 5EO9B 1DUYA 4PP1C 2UZIL 4OI7A 1WITA 1NCCL 3U36B 1ZGLA 4O02H 4QYOB 1IFHL 4KTEH 4QXWA 3MUZ1 1FRGH 2IPUK 1A6VL 2D4DA 2RGSA 1IGJB 3PABB 5TQ0L 1C12A 5EU7C 4P2OB 4BFEA 1KCUH 1IAOB 4HUNB 3BH9B 3VH8A 2F53A 4OIBA 5DLML 4F8TA 3IDMA 5L8LB 4R2GD 1JHLL 5IMLA 1ORQB 3VFOB 1AE6H 1NMBL 3QCVH 5H37G 3SE8H 1CDUA 4R4NC 1IE5A 3AS0A 3BJ91 4J3OC 2GSGA 3WNPA 1JHKL 3C08L 1RUQH 4HPYL 1NFDB 3MNVA 3U6RA 5JZ7C 3LS4L 3TZVD 4FQLH 4H1LB 2VNCA 3GHEL 3B3IB 4HUKB 3MRCA 4LSSL 4E41D 1R3IL 1YJDH 5CBEA 1UH3A 1CD0A 2XQYG 3FB8B 4ODSL 3ARFA 4K9EH 5DVNA 3U30C 4LRIA 3WIIL 1CG9A 4KHXH 2A73B 3QA3A 1UFUA 1EJOL 3C6LA 1ZHNA 3SDCC 1TCMA 3T04D 5C9JA 1MOEA 1QBBA 4PJFE 4NN6C 4ZAKA 3UPCA 1N5YL 3RA7H 3PGCA 1IJ9A 4E41E 5KW9L 2GK2A 4PRNA 5JHDE 1NMCB 1OF2A 3RGVD 1WF5A 4R26H 1UEYA 3REVB 3U48A 1S7QA 4PG2C 4EI5D 2IGFH 3SCMA 1UEMA 4KK8D 5CCKL 5DJDA 4X83A 4NZRH 1I7TA 4WI6A 2EIDA 1PGRB 2GTZB 5FYKH 3D2UD 3PP4L 1DBKL 1YMHA 1A6AA 1IGTA 4L4VA 4OIIH 4OKDA 3ZKXC 4PJBB 4Z7VF 3BW9B 1H3VA 1MCSA 4NQEB 5TF1L 4O51B 5IR1B 2FIKB 3NCJL 4U6XA 3NIFE 2ORBL 3U7AA 2D0GA 4LCCC 5KN5A 2YPLB 1G9ML 1XGPB 3KHOA 8CGTA 5L2KA 4LSTH 2H26A 5D7SH 2VDLL 2J4WH 5EIQA 2DQGH 5DS8B 3DROB 3CUPA 3GMOB 2H41A 3KJ4B 4XWOC 3RIFF 3O9WD 2CKBA 3O41B 2Y72A 3PWPD 3RVXD 3RX5A 5E2TH 5KZCB 4QGTA 4UB0L 1QBML 2R2EB 3FO2A 2VLRE 4GFTB 1KCLA 4XCYB 4Q0XH 3VMPA 4GBXC 3QIWB 3UYOD 1KEGH 1JF5A 5CFHA 3U9PL 4ISVB 1MLBA 4RISH 2J8UB 3PWPE 3WN5A 4J3TA 1FLRH 2VLJA 2CKNA 1UQSA 1LO5A 3AS1A 3SKJH 4L9LC 4LDEB 3B9KD 5IESH 3VMOA 3R4DA 4OFIA 2VZUA 1RV6X 2AQ2A 4GMTH 2ZUUA 5IJKA 1AY1L 3FQNA 4MNQB 5TH2B 5E8DH 3UMTA 2FO1A 5DK0B 5K9KB 4EVNA 2YD8A 2HYMA 1NL0L 3RWIB 4HSQA 1CXLA 4A6YL 4G8EA 3IJSA 5DFWH 2R9HC 4LHJB 1DQJB 3INUL 1DQLL 4K94L 4K3EL 1ZLSH 3CFKA 5E94B 1KGCD 1MIMH 3F6LA 1KPRB 3E2HC 3RY5A 5HHMD 3UTTB 4WJ5B 5ISZD 1CFTA 5F71A 3DTXB 4RGOL 3OR7B 4MCZA 2AXJA 4DOHB 1NAMH 3SQOL 4LGSB 3QDMD 3VXMB 1OLLA 4Q9BA 4Y4FB 4TPRL 1KGCE 1WFOA 1G6VK 5B38G 2W9EL 5HHME 3GI8H 4ZTOH 3L6FB 4YZFE 3UPRA 3EYQC 4OCLC 4XMLL 1UVQB 3VA2C 3VGBA 4BFBD 1P4IH 4NP4H 4MAUL 2UZIH 1W8NA 2I27N 1YNLL 1NCCH 4WEBL 5HSFA 1KN2H 4LK4A 3IFOA 2MOVA 1HWGB 1BLNB 1HDMB 3D0LB 3QDME 2XZAL 3B9VA 1B90A 1FIGL 1IFHH 4XH2B 2Q6WB 4OFYA 4N0UB 2DQDL 4W81A 5T3XL 1G7LB 4OSUL 1CT8A 1A6VH 5CWSB 4IIQA 3RP1A 3V6OC 3HRZA 5TQ0H 5LGJA 3MRHB 4P59L 1KG0B 1BFOB 3B9AA 1CU4L 4FNLH 2DQIL 4ERSH 2NY3C 3KLSA 4M61A 1KCRL 2HT4C 4P46D 5DLMH 2DYPD 3E3QC 5E6IA 1TJIL 1JHLH 4ZPTB 1NCNA 3QHTC 2ZOLB 3D18A 4RMRA 1NSNL 1NMBH 4OF7A 5BOZG 2CLRA 1XH3A 2BZDA 5FYJD 5I76B 1REIA 4OM1L 3KPRB 3C08H 4DKEL 1JF1A 4HPYH 4KROC 4O2CB 4NCC1 3Q5TA 2X4TA 3FB7B 3LS4H 3GHEH 1EXUA 1R3HB 3WDHA 3BQUB 4X6CE 3EJYC 4LSSH 5K9OA 3ARPA 1H3XA 3JV0A 1HHHA 4Z0XA 4M1CD 5FYJE 5HY9B 2ESVA 3EO9L 2H32H 1EJOH 1H8NA 1ZA6A 5J6GB 2AEQL 1FV1A 5HI5D 1UCTA 1N5YH 3KYMB 4PJEB 5FGCE 4MJ6A 4Y4KA 2KUTA 4PJHB 2Q7YB 3C87A 3WJJA 4QRPE 3QQ4A 3T77B 5JIPA 4LBEA 1F6AA 1CLOL 4F37K 5CCKH 4HXAL 4JRXB 4L8DA 3O6FB 1KTLB 3DXAA 4Y5XC 1Q38A 1Z0NA 2GHWB 3UDWA 2F54B 3ULUD 1DBKH 5IB4A 4X9FA 3ZE0E 1DEDA 3GBML 2J88L 5JTWA 3OTTA 4ZUWB 3QXAA 2ED7A 4RAVB 3L5WA 5DJZB 3NCJH 3ZYJA 1MEXL 2ORBH 2YK1L 4LPYA 5DHYB 3U4BL 2YSSA 4YHOL 4RDQF 1G9MH 1GH7A 2C7UB 2X10A 2EDBA 2BMKB 1CDCA 2VDLH 3VD7A 1JPSL 3NIFF 1WZKA 4AK1A 1JZ4A 3WHE0 1F3DJ 4JVWA 4GSDL 4M6ML 3SE4C 1HH6B 1KCVL 3FB5B 3PQYB 4YHNB 1PAMA 4UB0H 1GSMA 1QBMH 1JK8A 2RFXA 1MCHA 2VXQH 5JNYA 1F4AA 2EKJA 5JW3H 3ARXA 2JCCB 1EHNA 1MCWW 1EZVY 3U9PH 2OK0L 1OP5K 5D5MB 1NFIB 4FFWC 4HKZB 1NDMA 4OGAC 3DI3B 3O3EA 2BCKA 2DBJA 3TVMD 4D0BA 2BSRA 3WLBB 4AEHL 5KSUA 1JJUA 5CEXB 1IARB 1I8MB 4WWKC 5IB2B 1UM6L 3OGOE 3MGTA 4IDJL 2X9WA 1G7MA 3VWKC 4I4WB 2AV7A 2GK0A 1A7NL 2F5AL 4QWWD 1NL0H 5HHQB 4A6YH 5FM4A 1S5HB 3CFEA 3IJYA 2NXYC 3INUH 4LSVL 1DQLH 3DURB 4K94H 3ARWA 4K3EH 3JBG7 3U0TA 1DBAH 5GGTL 1N26A 2QSCL 4X0KA 2VZ3A 4ZNEE 1I3VA 4PJ8C 1KIRB 3ZLQC 2O5YL 3BH8A 4NKMA 4RGOH 4QRRA 1CGWA 3ARDC 1A6TB 5DQJA 5EU3B 5J12C 1E28A 5D1XB 3WYRA 2VN4A 4QCIA 1A4JB 2Y06L 3SQOH 1XT5A 2OM5A 3ME0A 3MC0A 5E03A 3V4VL 4M8VA 2OYPA 3FFCD 2BC4B 3O2VL 4BSVA 1ZXQA 4CMMB 3SO3C 1BD2B 4XMLH 4H88L 5MENA 2E6PA 4TTDC 1BGXH 4MAUH 1MCNA 4JFFD 5DK3A 2BXZA 3MV7D 1X6NA 4YO0B 5EPMA 2DMCA 4JY5L 5E0QA 4WEBH 4O2EB 4OFPA 4YZFF 3ARSA 3WV0A 4GKNB 2FX8L 4GLRH 2XZAH 1FIGH 1QLEH 2ERJB 2DQDH 3SDXE 1I8KB 3JZ7A 2L0DA 3FFCE 5T3XH 4S2SA 3RVVD 4OSUH 3O3AA 3F5WB 5DFTA 1QLFB 5IQ9A 1WC7A 4O00A 4JFFE 1OP3K 4P59H 2DWEA 3MV7E 4L1HA 2DQIH 3IDYC 1HHGB 1T3FA 1KCRH 3CVHL 4F7CB 1MCFA 1TJIH 1RZJC 4LCYB 4RX4D 1MFEL 5IB5B 1U8QB 1NSNH 2AXGA 5I1IL 4ZO9A 3N50A 5KG9A 1B6UA 4DKEH 2HG5B 3RWGB 3RI5F 4PJXB 3RTQA 2XZZA 1JWMA 5JPMA 1KPUB 3QUYC 5DK2A 3P0YL 1YYML 1D7FA 3GGWB 4U1KB 2Z4QB 2E8YA 4BZ2H 4ZXBA 3I9GL 1EO5A 4X6CF 3EO9H 3VXUA 5DDHB 4MA1C 2OL3H 4PTUB 4N5UA 4ZQKA 2NR6D 5GSVA 5TE6H 2AEQH 5J3HC 4IHOA 3TV3L 5CHNA 4I0PC 5D7LD 2R1WA 1IGFL 5DYOA 1KYOK 5F9JA 1I7ZA 2APXA 4OCNC 1JV5B 2AJZA 2F15A 4IS6B 2LTQC 4S1SL 3OKEA 1CLOH 1CDGA 4MD0B 2OP4L 1JPTL 1W0VA 2RJMA 2IADB 1SEQH 1PKQE 2GY7B 5D7LE 3T0EB 2X4SB 5I17B 1UJ3B 2LQRA 2H3NA 3GBMH 3UYPA 4Z7QF 4M7LT 4Y5YC 1HCFX 4X4ZA 4Z7VA 4LLDB 1NAMB 4LLWA 2YK1H 3LMJL 1PFCA 4EUPA 1UZ6E 3U4BH 1M05A 3ZE0F 1GXEA 3ETBF 3LQMA 1RK1B 3MTRA 5F1OB 1Z5LA 2X42A 5TDPA 3V6BR 4IRSA 3DECA 2XYCA 4M1DL 4XC3L 1FZMB 2R69L 1JPSH 2VR9A 1AXSA 4ODUA 4RGND 3VRLE 2VLKD 4GSDH 4M6MH 5IM7A 1MCDA 3G08B 4H5SA 1EK3A 3E6FB 1KCVH 3ULUF 1G0XA 2IALB 4U0RB 4M6NL 1KC5H 4XNZB 1ZS8A 4HH9A 4X7TB 2EECA 2EXYD 1IKFL 4U49A 3P4NB 5DI8B 5SV4A 2CDFA 4RGNE 1TVDA 5HYSA 2J8OA 1GGYA 2A6JB 2VLKE 4BH7B 5F9AC 5E00A 1AHWB 5IWLC 2BVPA 5C08D 1OTUD 1A9EB 2R2HB 2GJ6A 3M1BB 2B2XL 4I48A 1QSFA 1Y6KR 4KKCD 3P4MA 1E4KC 4FQQB 4JHWL 3I3BA 3RKDD 3N1FC 1M7IB 4RGMB 4NJAL 1BEYL 4IMLB 4IDJH 1N6VA 4LCWD 4PJCE 3TA3A 3CU1A 2ZPKL 4GLRI 3CFIC 1U3HD 4KJWD 4Y1AD 3VFNA 4N0CC 5C08E 4M03A 4LEXL 1CD8A 2F5AH 4R97C 4FQ2L 1T66C 1A3LL 3BZEB 5ENWA 1QTYT 4LSVH 1G7JB 2F58L 2ITCB 2H32B 3CZJA 3EO1A 3KS0J 3VI3F 3VXOA 3OJ2C 4LCWE 3VGAB 1MAJA 2WWKO 5CMAA 4HUVB 4P2QB 4JFDD 5GGTH 3RDTD 3BP6B 5KJRH 2QSCH 4HMDA 4NQVA 3WHE1 1T0NA 3BKCL 4QO1A 3GBLA 1VACA 4HV8A 4B7LA 1S9YB 2V5TA 4PP2B 3BIKB 4XXCC 4FQJL 4CVWA 5KSAC 5I1HL 2XTLA 3M07A 3O6LL 5EU6D 5E8EA 3HPJA 2Y06H 1Q9KB 4WFFD 2NY1C 2V6HA 2D7OA 1CFSA 1AXIB 4JFDE 4FFYL 4C56D 3O2VH 1J7VR 4WO4B 3CSYB 3BOVA 2GTWA 5CGTA 1C16B 5BRZB 4ZYKA 4MHHG 4L8SB 2NTFA 4PRPD 5C0BD 1OAQL 4ONGL 4IRJB 4V1DB 1QA9B 2Z92A 3KXFD 4JY5H 3K3QA 3GB7B 5EU6E 4XHJD 4U1NB 4CVUA 4WFFE 4L3ED 4ZOBA 3Q2CA 5BZDB 5HPMA 3LIZH 4YDJA 3C60B 4LVHB 4C56E 4PY8J 4ELMA 5HHOA 4ELKB 1CN4A 4EDXB 3WS6C 3WFHB 4PRPE 5C0BE 3SDXF 2AJUL 4WUUD 4IMKA 3KXFE 1J8HA 3CVHH 5DJAB 1AKJD 5F7FA 4OCYH 3WUWA 1MFEH 1L4IA 3ROOB 3LD8B 3L3JA 4L3EE 3PWNA 4OAWA 1VHPA 2A77L 4P2RD 2BOBA 5I1IH 1WTLA 1RSFA 3UPAA 4HGWB 1T1ZA 1A1MB 1FYTB 3LB6D 4HXBL 1A5FL 4WUUE 3ARBC 3QO0A 2V2XB 3P0YH 1CXHA 4K07A 1XIWB 1YYMH 2FR4B 1U3YA 1MNUL 4HWNA 1BQHB 3I9GH 2VDOL 3BEWA 4Y16D 2G5BB 1J86A 2FRGP 4OF8A 1J8KA 3FO9B 1LVEA 5F88A 2FJGB 3MA9L 5JXAL 2ZCKH 2BNUA 3QIUB 3TV3H 1AI1L 2XWJA 4GXUN 1FLTX 3ZDXF 1IGFH 1S7RA 5TDOA 2P7TA 2Z31D 4A6YB 3C5JB 4K8RD 1AGEB 5FCUL 4CVZA 5IBUB 3AS2A 4S1SH 4H8WC 4Q9RL 2OP4H 3QEGL 1JPTH 4Q6IA 1JWUA 3K1DA 4E41A 4QTHB 1J05B 3PJSA 3BRGC 2OSLA 3G5YA 3VCLA 3UJIL 1FZKB 1WAAE 4P2OD 5D9SA 2F74A 1HQRA 5I18L 5F7NC 1WISA 4NYLB 2V2TA 3HC0B 4IJ3B 1OWRM 3LMJH 1JNHA 3OJDA 4X7EC 3P30L 4XVUC 2BNQB 5JOPD 1BJ1J 2LU3A 1MWAA 4X6BA 4XC3H 3PL6B 1F3RB 1QFWL 2A9ML 2R69H 4JHAL 4XCEA 4MLSA 5B8CB 3OKOB 4XNMA 2IPKB 2DTSA 4XNQB 2YD7A 1FH5L 1YEFL 5D7KD 4HIJB 4M6NH 2NW3A 5KSBB 4S0UC 5IEKA 3VRLF 3BP7A 4PRIB 4PBWD 5I8OL 4NRXB 1IKFH 2JB6B 3T4AA 2HKFL 4Z7UA 3ARFC 5J11C 3X11A 2Y7QB 2ICWJ 4LRIC 2H1PL 4WW2F 5TGBA 3FOLA 3C6LC 1T6VN 1HSAB 3HR5B 5D2LA 2P8PB 5C07A 2VZVA 2BSED 1X5GA 2I24N 3BUTA 4ZAKC 4NO0B 4KKAC 3GMQA 3S4SB 4XPTL 1S7SB 2B2XH 4PD4K 5K33A 1L7TL 4ZUTB 4GRWH 2D31A 5C0GA 4JHWH 2HFFA 5BZWA 3ZZ1A 2K1MA 1JUFA 3O9WA 2AEWA 2HTLC 1S7VA 5FECA 1BEYH 1VEOA 5K9JH 3SCMC 2ZPKH 1IGIL 3GSWB 1PD6A 5K59E 3CK0L 3RX7A 4HK3J 5F6HJ 1KJ3H 3IDIB 2X4UA 4LEXH 1G7PA 4JFEA 4GRLB 4FQ2H 1A3LH 3W11C 3BGMA 1U8HB 2DKMA 4B50A 1QRKA 2HT3C 2F58H 4NQED 5J13C 1TDQA 1UB5A 5FAAA 5CEZL 1I1AB 4M4PA 1OAZL 1MHCB 3C5ZA 2OR9L 2YPLD 4ZFZB 5TF0A 5DA0B 3B9KA 1NC2B 5CLWA 1P4BL 3RWDB 1UACL 4PJBE 3WE6A 4FQJH 2EICA 5I1HH 4NQEE 5FA4A 5KZCD 1NPUA 3TEUA 3AMKA 1QQDB 4UQ3A 4UAOB 5EZLA 1F42A 4X8JB 2YPLE 4FFYH 5IV2A 5E5MB 3B83A 1MFNA 3QIWD 2ZZUT 1I1YB 3P9WB 3QZWB 4RAUA 1OAQH 4ONGH 2V7HB 3IDGB 3UTSA 1YQ2A 4L1DA 4PJGF 4FFZL 4I18A 1GJIA 4CNIB 5AUMB 3FMGL 4G9FA 4U3HA 3WN5C 2FHBA 3FQTB 2Q8AL 2V5YA 4LKXB 1KXVC 3G5VA 5HGDB 5D2NA 2I60L 4FQHA 3LKOA 2E7LC 1QPPA 2F8OA 4N0YL 5ISZA 3LN4B 3OKLA 5J9PB 1CGVA 3BISA 5I8CB 5IMKB 1HEZA 5D7JA 3NFSH 3BXNB 2AJUH 5IJKC 5DVLA 4JAMA 3QDMA 4V2BA 1I1RA 4OLXL 1RK0B 4KMLB 3GIVB 1N5AA 2CMRL 2V9QA 2A77H 2X1QA 2WWMC 3KPNA 1RZ7L 4HXBH 2VJXA 1A5FH 2HLAA 4JDZB 1PVHA 1PDKA 1UYWL 3QI9A 4P23A 3UTTD 1XZ0B 2EZ0D 1JRHL 3HUJB 4QXGL 4OZFH 2P44B 1MNUH 2N4IA 4HIEA 2VDOH 4FXKB 4N9GB 2BVOB 3SKOA 1ZT7B 5L2JA 3G5ZB 3VXMD 3QUZA 4Y4FD 2DYPA 2Q86B 4X6CA 3MA9H 5JXAH 5ID0A 3FQWA 3UTTE 4MXWL 1AI1H 1WIUA 3O4OC 4O4YL 1AD9A 3UZQA 1YN6B 1VSCA 2NX5B 3FTGB 2PO6A 3W39B 3REWA 4K7FA 3W81A 4OGYL 2R56H 3TBWA 5FCUH 5GXBB 5DEGB 4DOHE 3H9ZA 3VXME 4Q9RH 3QEGH 4UDTB 4NUGL 3MRRA 3VFPA 2BVEA 4PJ7B 1IQWL 2G9HB 4X7DC 5F3HA 3MRKA 3O3DB 5CGYC 3BPNC 3MOQA 4D0DB 1JP5A 2R1YA 5D96C 3STZA 4IIQC 4RA3A 3UJIH 4E0RB 4JN1L 3CMOL 5I18H 3ZO0A 1DN2A 3GSVB 3T0VA 3WD5L 5GZOD 2XRAH 5KS9E 3UBXG 2ICWA 4TVSa 5E6IC 5JORA 4IBLT 5DQ9A 4N0UE 2IPUG 4U1MA 1YQVL 1QFWH 4JLRA 5HJ3A 4JHAH 2FH6A 2X44D 3KPRD 4KKLC 4R7NA 4LSUH 2ZJSL 2PKDA 2DD8L 1HSBA 1YEJL 2IPTL 2CRYA 1FFNB 1FH5H 1YEFH 1KLUA 1LD9B 3BHBA 3IXTA 5GRYA 2PN5A 3BQUD 4LEOB 5AYQA 4JDTL 4MA8L 5HVHB 2DLEA 5I8OH 2J8HA 5C2UB 1IAIH 2HKFH 1LEKA 3KPRE 3WO4B 2NY6B 4JHZA 5LG1A 4F7MB 4KZDL 3WUZA 1M6OB 2A2QT 3NAAL 2FEEL 2HFEA 1I3RA 2OQJB 3CVHB 2XA8L 4OUUB 3TF7A 3VFUB 4XPTH 1NFDF 4MZ2A 2ZSVB 3SBWA 1L7TH 4RMUA 4Y4KC 3QO1A 5F9WB 1R3LA 4OCRH 3WJJC 3PWJB 5EFIA 1CZ8L 1P7QB 3H9SA 5HHNB 3ECBB 4D8PA 3T2QA 3EDFA 4S11A 2XN9D 4LLQB 4KXZI 4JRXD 1IGIH 4UOJA 5E95B 4J12A 3LPWA 2BVQB 5FUCE 1FL3A 1G7HB 2F54D 5AEAA 4OFKA 3UDWC 4PJHE 4AIZA 4G6KH 1G9NL 4JY4A 5EUOA 5DJ6A 1R5VA 4KMTL 3HKFA 2H2SD 5K59F 1TMCB 2PXYB 1E6JL 3MGAA 3PWUA 3OJMB 4P4KA 2J6EL 3O2DA 5CEZH 5ALBL 4D94A 1OAZH 5DC4B 1MCIA 1NDGB 2XN9E 5MEOB 4TUKL 1U58B 2OR9H 4JRXE 3QSKB 1P4BH 4YBHA 5E7FA 3UBXB 5IKCB 1IGML 3MRQA 5E08H 3E6HB 2CJUL 4HZLA 1UACH 5CJXA 4FTVB 2DLTA 3VD4A 4YIQB 5JO5B 5DTFA 4ODXB 3OGCA 2DQCL 2EXWC 4M8QA 3QXDA 1OP5H 3V0VA 1G6RA 5GPRA 4PJBF 2GIYA 4S10A 2I5YL 4L29B 1AGDB 5HGGS 3TFKD 1JHTA 1ZANL 5CILL 4BH8B 4BKLB 2ZKHL 1DEEA 2X4NA 3BEVA 4WENB 4JANA 3S36L 1WV7T 4FFZH 1JGVL 4LVNC 4PRBA 5E1AB 2Q8AH 4GG6B 4MB5A 2FECL 2V17H 1SJEB 2FSEA 3LHPL 2E9JA 2I60H 5DFVC 3WDJA 1PSKL 4N0YH 1D6EA 4P48A 2JCCE 2QR0B 3LKSA 2BNRB 4AL8L 5TE7L 3DIFB 5D5ME 1WZ1L 4ZUUB 5TPWL 3KDMA 1X4ZA 4PV9B 4OLXH 1EO8H 4NM8H 4R90L 3AU1A 2CMRH 2BY1A 1H5BB 3UAJD 2J8UF 2R1XA 3QDJA 3DX8A 1B3JA 5GGVH 1ES0A 1RZ7H 4N0FB 4LLVB 2AK4B 1BREA 2EYSA 2P8LA 4XGZB 1UYWH 2VQ1B 4K3DL 1BM3L 1V3KA 1JRHH 1U8NB 4QXGH 4LPWA 5E2JA 3JWDL 3OAYK 4J4PD 1QFWI 4GRWB 4X98B 5EOCJ 5D1XD 1AD0A 3DSFL 1NGWA 3B9EA 4QOKD 3BWAA 2CR3A 2UVFA 1FG2B 1GGTA 5JOFB 4HWZB 1YEGL 2VL5A 4RX4A 1F4XL 1F58L 4MXWH 3OKMB 5FYKD 5IMMB 3BP5A 4ZUSB 4O4YH 4C83A 4WWID 1BD2D 3QEUA 5IHLB 2Y5EA 2ZG3A 5FKPA 2V9RA 4U1GC 3HI1A 4MWFB 4OGYH 5BO1H 2B0SL 1EX0A 2PCPA 1OP3H 4LQ1A 4JREC 3EYOA 1KLFA 4QOKE 4NUGH 2IBGA 3VE0A 1T7ZA 4PJDB 4LAQL 2H6PA 1IQWH 2O5XL 5DC9B 5FYKE 2EKSA 1D9KB 5ESQB 1K4DA 1BD2E 4HHAA 4K23L 3SKNA 5H35B 4JN1H 3CMOH 2Z93B 4ZO7A 3WD5H 5IGXL 1HH9A 4R0LB 4MD4B 4GW5A 4Z8FH 2VWEC 3HMXL 3VJ6A 1PKQA 4G6AC 4OCXH 5J1AB 1YQVH 4XX1E 3BSZL 1K4CA 2LV4A 5HGAA 3TNMA 1S9WB 2ZJSH 4GAFB 4NNXA 5ACMA 1MCOH 2DD8H 3RTQC 2AI0L 4KK5D 1YEJH 3RVUC 3FB6B 4FQ1L 2EYRB 5DUBB 4KVNL 5ETUA 4TNWF 3Q6GH 4JDTH 3MLVL 1FCCA 2WZPD 3RUGA 3LRSB 1T04B 2VR4A 5GGQL 3GSRA 4JKKA 1Q0YL 1J0HA 4PGCA 4ZXBC 4CMHB 1FFPB 3LSOA 3LKNB 1QFUL 5ICZA 4PJXE 4KZDH 5I16A 1DP0A 3NAAH 1RZIB 4M5ZL 2XA8H 4WW2A 4WHTA 5D93C 3MRLA 3HG1E 3JV4B 4K3HA 5ACZA 4I9WD 4PREA 3F12A 2OJEB 4FOMA 1TVHA 1W72L 1CZ8H 3ILPB 3WXVL 2VLKA 1RUML 1AFVH 2A6DB 1EGJA 1LMKA 3GSQA 1Q94A 3RVWC 2DMKA 4D3CL 5DT1L 3GMMA 3T0ED 3I02B 3I6GB 4OZFB 1MHPL 4I9WE 1G9NH 3GDBA 4KMTH 3V7AE 1E6JH 2W65B 4PJEF 2J6EH 4UT7H 3D1MC 1SJVA 2ADIB 5ALBH 4PJHF 4MCYB 4PG9B 1E4XL 4TUKH 2COQA 5FOBB 1BOGA 1F3JB 3TN0B 3LKRB 5C0FB 4IRSC 2WM0A 4XWGL 1IGMH 2CJUH 2X89A 2LAGB 1EH9A 3F7VB 4L5FL 4UQ2A 4JM2B 4IRZL 4R6UA 1IT9H 5DF0A 5EUKB 2P5EA 1SQ2N 5JOEA 3BRFA 1U3HA 4Y1AA 1S9VA 4U1IB 1MJUL 1MFBL 2CR6A 1JRHI 1ZANH 4PB9L 5CILH 5FYJU 3C2AL 2ZKHH 1NUNB 4PDCE 1U0QA 1KV3A 4KPHL 4BSWA 3BKJL 3RWFB 4WNQA 1W0WA 2UWEA 2OZ4A 1LK2B 2H2PD 4AYFA 3P4LA 3S6CA 3LHPH 4PJGA 1U8KB 1PSKH 3JV5A 5ALCL 1TTGA 1QSVA 7FABH 2L7UA 5C0IB 4KWUA 4WEMB 2Z8WC 3O3BB 3H2WA 2L4OA 4AL8H 3KPMA 1P5UA 3A67L 3OV6A 3ZKNC 3DJ9A 3Q5YA 5TE7H 1NFKA 1KJMB 1T22A 3EDEA 1WZ1H 5TPWH 3TA3C 2F9BT 2JCCF 4ZFOL 1DVFB 3VXSB 2ZP0T 1N6QL 5B39B 1X7QB 1FNEB 1L6ZA 1RD6A 4R90H 3RNKA 3TBSA 4C56A 1FGVL 3MV9B 1CE6B 1YEIH 3EHBD 4LLMA 1UADC 2DQUL 5D5MF 5D1ZA 3UCRA 5I1AB 3GMNA 2GAZB 2VO5A 3D6GA 1KIQB 1MJJB 1JN6B 1PYWA 3KXFA 4AIOA 4PP8C 4P2QD 3I6LD 4PGDA 2J12B 3GJFA 1BM3H 5CBAA 3L3GB 5C92A 3OF6D 5GS0C 3PF2A 1NGZA 1RIVL 3JWDH 5ANMB 5AWNL 4OKVA 1S7TA 4YLQT 3UJTL 3MGOB 2G75B 3DSFH 1BVLA 1DSFL 4WUUA 5IVOA 1QO3A 3NBNA 1AKJA 2HN7A 1YEGH 4P2QE 1F4XH 1F58H 1M7XA 3I6LE 2FB4L 4E9LA 4WO4D 4JG0L 4NSKB 4WU7A 4P2RA 1CE1L 5BS0B 5DD0L 1KULA 4HIIA 4IRJD 4V1DD 2B0SH 2W0PA 1QKZL 5ERWA 4NQCB 5HVGB 3PV6B 1UKQA 4HFWA 3GRWA 1HE7A 5EO0A 2VXUL 3OXSB 2FEEI 1OTSC 5FUOL 4KDVA 2XKNB 4JDVB 4JKMA 3AUVA 3ORJA 4XRCB 2O5XH 3C60D 1HXYB 2XICA 4KRMB 3DGGB 3X14A 4GS7B 4K23H 3CXHK 4FN0A 4ODTL 4Y16A 2HJKA 1GRWA 4WI5A 3QG6B 4V1DE 1KPVB 4PRAB 4IMKC 1WUNT 5HGBA 5IGXH 1EA9C 3F8UB 3LEXA 5DRNA 32C2B 5DJYA 4UDUA 4MJIA 4LKCB 3LKPA 5I1KH 2H45A 1ZHBA 4U7KA 3BSZH 2Z31A 1OTTD 1K2DB 3L9RA 1FYTD 2XWBB 4U6YA 3E1F1 4YR6B 3N9GL 2AI0H 3U36A 3VFRB 4FQ1H 2W0KA 4YE4L 5DD6B 4S1DC 4KVNH 1U95B 2IFFH 3MLVH 1XIWD 1U91B 1JGDB 3R06B 3FT4B 5GS2D 4JO1L 5BVJB 1N2RA 4F7EB 3JTSA 1IGJA 3PABA 4LLYB 3DARA 3PIQB 1FYTE 1QFUH 1MUJB 3D25A 1IAOA 3BH9A 5IROA 3IU4L 4KGLA 1ORQA 3QIUD 3EW3B 4HCRA 3VFOA 2XFXB 1S9KC 1WCQA 4PJXF 4ZFFB 5C0DB 4O2FB 3SEPA 2GJJA 1ZLWH 3H7BA 1IM9B 1W72H 1NFDA 3WXVH 2X40A 1YA5A 4HG4J 2NQCA 2QADD 1RUMH 4K2UL 4P3DA 1MJ8L 3C09C 1EEQA 1LGVA 4F80A 2HVJB 4U3CA 3D39B 1BAFL 4Q6IC 2FECI 3SHSA 4D3CH 5DT1H 3MRMB 5HYJB 5AZ2H 1MHPH 4LPUA 3O45B 1XR8A 3SPVB 2YD2A 3NA9L 3BKML 2A73A 1ZE3C 3UP1A 3CMGA 1NJ9B 3RWJB 3TLRA 4AMKL 1ZT4B 1UENA 3X17A 3DUSB 2A83B 2B1AL 2BNQD 2DLHA 3P9MB 4U6VL 1SM3L 3PL6D 3U30B 4XWGH 5F96H 4PPTA 3NOIA 4Z95L 2YXMA 4IRZH 5B4MD 4YBQC 5I73C 1A3RL 1G0DA 3VFWA 35C8L 3T65B 4FXGB 4KK8C 1H8OA 2GTZA 1MJUH 4NRYA 4PRID 3ZTNL 1B4RA 1MFBH 2BNQE 5BV7C 5T3XD 4PB9H 3JSSA 5CKGA 4N90D 1K9TA 4F9LC 3BW9A 4DN4L 3C2AH 4LNRB 5F6IB 5HDBE 4KPHH 2VE6A 4UBDD 3BKJH 3UTPE 2NYYD 5IR1A 2FIKA 2B8OT 4NO0D 1YNKL 5IVXB 5KSBE 1QHPA 2DI9A 2YPLA 3UTZB 2EDLA 3O6KH 1INQA 1G9EA 4U7MA 1EFQA 4J2XA 3L3HB 5GSRA 4JPIB 5ALCH 5T3XE 2R15A 3ARYA 1KB9K 1GC1L 5DS8A 3GMOA 2X70A 4N90E 3A67H 3O9WC 3RVXC 2X1OA 4PJ9A 2ZUQB 1A3QA 3CVIL 3VRIB 1MI5E 2WANA 4IM8A 1RZKC 4XCYA 1FGVH 4GRLD 3QIWA 4LHQB 2DQUH 2WP3O 4FHBD 1L9NA 1MIEH 1A4KB 1H8SA 5IVZB 4WTZA 2CLVB 2VYRE 4ISVA 3NZ8B 4M93C 1I1AD 2J8UA 4YPJA 1X5HA 1HKFA 3C5ZC 3BZDA 2AGJL 3HZKB 1INDL 1NC2D 2DIJA 3B9KC 2WUCL 4PB0L 1RIVH 3TT3L 3BDYL 5AWNH 4LMQI 4PLKC 4X4MA 5JUEL 4OV5B 3OR6A 3UJTH 3I75B 1DSFH 4MNQA 5TH2A 4L9LB 3HFML 1MHHA 3D85B 5DK0A 4QT5A 2FB4H 4JG0H 1EAJA 1CE1H 5T1MA 5DD0H 5E4IA 4EI6B 1DQJA 1EDQA 5IIEB 5JXED 1I9EA 1QKZH 5E94A 4I18C 1SY6L 1I4FB 1KPRA 2YN5A 4Y19E 4L8BA 5FUOH 3UTTA 1RMFL 4JY6B 5D2NC 3ILQC 4WJ5A 4RA0C 3HC3L 3DTXA 3OR7A 2QTEA 4ODTH 12E8L 1B0RB 4H8WL 5D7JC 4Y8DC 3D3VA 3E2HB 1HYSD 1YMMB 5T1LD 1NBQA 1A6WL 4Y4FA 4DVRL 2APWA 4LHUG 1E4WL 3MNZB 1Q0XL 1J0YA 1MVFA 2ADJB 3CDYA 3L6FA 3C9NA 3V5HA 3T0DA 4ALAL 4DEPC 3N9GH 3S88L 4X6EA 2X4OB 4QEGA 4KRLB 2OS7A 4KI1A 1HDMA 1T2XA 4YE4H 3QI9C 3VGHA 1E4XI 4P23C 2Q6WA 1KTKE 2NY0B 3BN3B 5GGVY 2VKWA 5GS1B 1G7LA 1FORL 4JO1H 5FA3A 3MJ7B 1P7KA 3HE7D 1SVZA 2HKHL 3O11A 1VFAA 4DAGL 1JF6A 2Z8SA 4LSQL 1BFOA 4R96B 5AYUH 5TJWK 2W0LA 3QUZC 1ZA3B 2XQYK 3IU4H 1BVKB 3LN5A 5KVEL 4ZPTA 4ACPA 2RQ8A 3HUJE 2X09A 1F02I 1FDLL 1XGTB 2PO6C 3OWEA 3KPRA 1FP5A 4XP6L 3IF1B 3FB7A 3MV8A 4K2UH 1W2KT 3EZ8A 3EYFB 1R3HA 4PYGA 3BQUA 3JUYA 1BAFH 3QFJB 5IMOA 4Q58C 3QWOB 2YZ1A 1S9XB 4M1CC 5CSZB 5C8JB 3NPSB 5HY9A 1FG9C 4KROB 4WIQA 3NA9H 4Z18A 3BKMH 1Z9MA 1A7QL 3ABZA 3FHAA 5J6GA 1Y0LA 4AMKH 3MRFB 4W70A 1CFNA 5JIKA 3KYMA 5HI5C 4PJEA 2B1AH 1ROWA 4U6VH 2XZQL 4DN3L 1WQVT 2Z35B 2X4PB 5IW6A 5DVMA 2IAMB 4OGXL 4FQPA 4Z95H 1YPZB 1HOCA 2J3SA 3FN9A 5HHVL 5FDYA 3T77A 4XT1C 3QEQA 3O6FA 1IEBB 4LPTA 2F54A 4L4TA 3HMWL 3ULUC 1QFWM 2C1PB 4F58L 4DN4H 2VITB 3N85H 4ZUWA 2NY6D 1TQCB 1V8HA 4RAVA 2IH1B 3O4LB 5DJZA 3GSOB 2VQUA 3TF7C 1YNKH 2PETA 5HDBF 3MROB 3QUXB 3CFCL 3U79A 3WFBL 3CCHA 3MLYH 3SBWC 4WFGD 5DO2D 2ZUSA 1IAIM 5TDNB 1FSKB 1GC1H 2PW2B 5C0EA 1P7QD 1RIHL 1UXWB 4G43B 5IOPB 4BYHA 5KSBF 2HT2D 2BRQA 3G6DL 2DLFL 4F2MB 1HH6A 1HQ4A 5GJTL 4JZNA 1QLRB 5FYJH 5D7IE 5AAWA 3RVTC 3FB5A 2ZNXA 3PQYA 3IXAB 4JQXA 4YHNA 3CVIH 1V3MA 4HX1B 3G6AA 1EBPA 5ESAB 5ILTL 1K5NB 3TFKA 3O2WL 4YNYB 3TPUA 4TUOB 4WFGE 3QXUA 1H15B 2PXYD 3KPLA 3GMPB 3TNNB 3BN9C 5HI3D 1LEGB 4P4KC 4P3WA 5D5MA 5ACLA 3ZDZE 4HKZA 1XF3A 4V3EB 1ZTXH 2AGJH 1INDH 3MCLL 4Y2DB 1UZ8A 3WLBA 1P2CB 1S3KH 3MCG1 1JPFB 5EZJA 5KVMC 1EUTA 2WUCH 3TYFB 4PB0H 5CEXA 2ZCLL 3TT3H 1I8MA 3BDYH 3W9DB 4UOW0 5JUEH 4FTVD 5CJXC 1W72B 5BJTB 3ZHKA 2VISB 5DJ8B 5F1KC 3S8WA 3SDDB 5EU4B 1S7XB 3HFMH 2D0FA 2NNAA 3AB0B 3MLSL 4QHNA 1YDPB 3T2PA 4P5TD 3V2AR 1S5HA 3W0WD 3KAAA 3Q3GB 1JZ3A 4NKIL 1VCAA 4FTVE 3BVNB 4LPVA 3DRTB 1NLBL 3DURA 4I1NB 3ZL4L 5K9QG 3WEXB 2QLVB 3HHRB 1SY6H 2C3WA 2JK5B 2ZG2A 1UGNA 4HC1L 1RMFH 1AR1D 4ZD3H 3G5XA 3HC3H 1BZQK 1TPXB 5CJ8A 4YDVB 4GRMA 4G6FB 2ZOKB 2VC2L 2BNRD 3W0WE 1MJ7L 1A6TA 5EU3A 3L3IB 12E8H 5D1XA 1JMZA 2NY2B 4H8WH 5CKAA 3BUYA 1UWEH 1A4JA 3KPSB 1EAPB 1A6WH 3RHWK 4DVRH 4PJIB 4GG6E 1E4WH 4U1HA 1KXTB 2VRAA 1Q0XH 3IDNB 1AP2B 4MXQA 1FIEA 1ZK9A 4PLJD 3ARDB 4ALAH 3FRUB 2HTKD 3NVQA 4MDIB 5J12B 3AS3A 3OAYH 4YQXL 2BNRE 4HKBB 3S88H 2AK4D 1DL7L 4O2EA 3FN3A 1MVUB 1X6LA 4GKNA 4PV8A 2GSIB 3K2MC 3ZE2E 1U8JB 1I8KA 4CADB 2EDYA 3QDGB 4ODHL 2NW2B 5IF0B 2Y6SD 5HHPB 1HXMB 5FA4B 1QLFA 5EZLB 1RJYB 2HKHH 3DO3A 4OD2B 4DAGH 4LSQH 2AK4E 3MACH 5KVEH 4ZFOB 5IB5A 4HW6A 3T0XA 2QQLL 4PJFB 5T1KB 3TZVB 2QHRL 1NKOA 4GRWE 1MRCL 4KJQC 2HG5A 2SEBB 3RWGA 3ROLB 4XP6H 3IDYB 3MLXL 5E9DD 3HUJF 3SJVA 5JHDB 3MXWL 5HDLA 1XF4A 1R5IB 4IOSD 3FKUS 5CAYB 4NFDA 1JWSB 4XAWL 3GGWA 1F4YL 4U1KA 1D9KD 2WBJA 4NQSA 4MD5B 3QNYB 3IFLL 4HEPG 4R4FL 2E27L 1A7QH 1ETZB 5F89A 3VWJB 1EHAA 4PTUA 5E5UB 3PHOB 5E9DE 3BYTA 3B5GA 1WWAX 2V9TA 3RGVB 4PJDE 4QRSB 2XZQH 5E2UL 4DN3H 1YC8A 4ORGB 3DYMA 4OGXH 5KANG 3VA6A 1T20A 1F4HA 1WFTA 4MA1B 1CGYA 1KJVB 5MHSE 4M7KL 4PJ7F 4YWGL 5MI0C 3D2UB 5HHVH 3CXDL 1FVDB 4IS6A 2XNAA 3GBNL 4HWBL 1T7XA 1FPTL 4MD0A 3V4PH 4Z7NF 2CRMA 1JPGA 5ELIA 1CFQA 5F97E 3LKQA 1ZVSA 3HMWH 3T0EA 2AXHA 5EZOL 1WBZB 5I17A 1UJ3A 2NLJB 1CDIA 2VLRB 5EH1A 2LTQB 4WW1A 4UMGA 1NCDH 3QXVA 1WTGT 4F7TB 4OF5A 1KN4L 1NAMA 3AC0A 5DMIL 3K80A 1C8PA 3TC9A 4WW2C 3NABL 2VDNL 4RNRB 3CFCH 3HAEH 3WFBH 2VDQL 2KBGA 3PWVB 5I6XC 1BWMA 1X4XA 4Y5YB 3IS1X 3NFPA 1C5CH 1IVLA 1BZ7B 4G80A 5GJTH 3S3JA 2PYEB 3WFDL 4NN5B 5GGRY 4YFLI 1J88A 1FFRA 1J1XL 1TLKA 2R23B 4OQTA 3UX9B 3O8XA 4X7TA 4JGJA 1X3DA 5ILTH 2ZUXA 2CDGA 1T5WB 3P4NA 4A2MA 1HIML 1XR9B 1S7WA 3IDJA 4XBGB 5E8OB 4BH7A 5F7WC 3AREB 3LPFA 4CDHA 3TN0D 5LJYH 3MCLH 1A9EA 4V2CB 5BVPL 1OTUC 3M1BA 4MDJB 4GKSB 1VENA 2X1XR 4XP1L 2CDEA 4KKCC 2C1OA 2ZCLH 3ZDZF 4YBLB 3B2UD 4NIKB 1NEUA 4JM2D 5FK9B 2LAAA 1M7IA 3MO1B 3QJHA 3RKDC 1ITCA 3HLAB 4IMLA 4XTRD 5D6CB 4UT9H 1RULL 5DMKA 1U3HC 4KJWC 1CICA 1RPQA 1SHMA 2O61A 4KC3B 5C6PB 3ULVC 4P9HH 3BZEA 4NKIH 5C6TL 1G7JA 1OD9A 3IVKB 1NLBH 2H32A 4F15B 3ZL4H 4YJZL 4U0QB 4Y5VB 3VFGL 1CQYA 1RVFL 3EO0B 5I75B 4HC1H 2C4FT 1QEWB 3BP6A 3TO4A 3K1KC 4HMCA 3OF6A 3EOBA 2JIXB 1T1YA 2WAHA 2XY1A 2Z0BA 1S9YA 5I74B 2VC2H 4G8FA 1NC4B 1MJ7H 1HI6A 4RAHA 3I84A 3OMZA 1LO2L 2R2BA 4P5KA 1IAKB 3WBDA 3PGFH 4MA3B 1Q9KA 2FH8A 1DVFD 1EEYA 3RWCB 3VXSD 4YHML 2UZXB 4OD1L 3MV9D 3RU8L 1J12A 4P3CL 3F7RA 4WO4A 3CSYA 3OKKB 5BRZA 3EYVA 1DN0B 5D1ZC 4YQXH 4C54A 4GG6F 4IRJA 2C3VB 2EDTA 1MF2H 3SY0A 2NY1B 4TNVK 3S35X 3LQAC 3JWOC 4U1NA 4CL7A 4C58B 3AVEA 1DBML 3VXSE 5FV1L 1DDHB 1MRFL 4ODHH 4UOW1 3NPZB 4HD9A 3MV9E 4P46B 4IOIA 4ELKA 4EDXA 3MLWL 3WFHA 3ZE2F 1T0MB 2IG2L 1GGBL 3MJ8B 3ROOA 1RIUL 4TSAL 4CU6A 3RL2B 3VH8G 5BS0D 3FQUA 2QQLH 3E0GA 2DJ4A 3GSNL 5ANME 4FFEX 2QHRH 1A1MA 1MRCH 4CBPA 2PTTB 1K3ZA 3MLXH 3LB6C 1OVZA 4NQCD 3JUZA 3MXWH 5A2FA 5AG8A 4QRPB 4PR5B 4MXVE 4LHUA 4GRWF 2MJWA 4CAGA 1XIWA 4XAWH 5SWSB 2FR4A 1F4YH 3HZMA 3S35L 1F4WL 3MBXL 5BS0E 4J8RB 4OQ1A 5GZNC 1BQHA 3HS0B 2VSDA 3IFLH 2C26A 1I9RL 4R4FH 2E27H 4Y16C 2I9TB 3FO9A 4LDLB 4NQCE 1ERNA 3GK8L 5EOTB 2W0FA 4NKDA 2Z31C 4JFYB 4A6YA 2AXFB 1AGEA 4K8RC 4PJDF 3N1MC 4HMEA 4M7KH 4YWGH 3CXDH 2DQJL 4ORZC 3GBNH 4HWBH 1MRDL 5DMGD 5H2BB 1FNHA 3T3PE 1BX2B 2JELL 2QSQA 1QNZL 3GI9L 4OF6A 2M26A 3K2UL 1J05A 1T21A 3GUTB 4TVPL 4H0IA 2VMFA 1UH4A 4KVCL 3TCLB 1FZKA 1NMAL 1ZGLB 3T09A 4NYLA 25C8L 2ICCA 3HC0A 1KN4H 5DMIH 5IROC 2EYTA 3NABH 2VDNH 3MOAL 3PL6A 3HZYA 3KPTA 1IM9D 2IPKA 4P57B 3DI2B 3WKNA 5FUZL 3IDMB 5C0AA 1J0KA 4HIJA 1YY9C 2FHCA 1MCJA 3HB3C 1J1XH 4Y0GA 4R4ND 2KDGA 4PRIA 1A2YB 4MQ7A 5HYJD 4NRXA 2B4CL 5FYKU 2JB6A 2P48B 3JWNC 1TCRB 5EU7E 2ZCHL 1QACA 1HSAA 4A2LA 2P8PA 2YPKB 3MYZA 5L6YH 4NO3B 1YEEL 4QTIL 5CBEB 5C0NC 3S4SA 5BVPH 1S7SA 4XP1H 3ARFB 4ZUTA 5HYJE 1CG9B 1NMCC 3X13B 3QA3B 3UC0L 4EEEA 1HWHB 5C9JB 1YYLL 4ZAKB 5F7HA 2YUZA 5T33L 3GSWA 4M1GL 1RULH 43C9B 1VEPA 1WGOA 4PRNB 3PHQA 4BZ1L 3MOBL 3B6SA 3OAZK 1TITA 3JV6A 4RMTA 2O26U 3BGFB 5L7XL 3TIDB 2X05A 2IANA 3QUKB 1EFXB 5C6TH 4NWUL 2OL3A 1AQDB 4AQ1B 1VFUA 3VFGH 3MNWB 1I7TB 1RVFH 2AW2A 2NTSP 3GFUA 3EYSL 4ZFZA 4HZAA 1YMHB 1GIGL 3RWDA 1WT5A 2QHLA 3BIBX 4JM2F 4MNHA 5TFSL 1JNNL 5J13B 1SMAA 1QD0A 5HD8C 3KJ4C 3FFCB 4EZMA 1X5XA 2YA0A 3V8OA 1LO2H 3KYKL 4PJ9C 1QQDA 5C7XL 4MQSB 1N4XL 4YHMH 2EDFA 5IVXE 4OD1H 4X8JA 2H26B 4HDIA 5E5MA 4JFPA 4P3CH 4BK4A 1EEZB 4J1UB 4XWOD 3QIWC 1I1YA 3QZWA 2A9NL 5DVKA 5EZIH 2V7HA 2MQ3A 4CNIA 1BZ9B 5AUMA 1MELA 3RZWA 4XPFL 1MFDL 5HGDA 1DBMH 1MRFH 1RJCA 3G04A 1NUDA 4AT6B 2YWZA 5J9PA 1H0DA 3MLWH 4NBYB 3BXNA 4HJ0D 4E42B 3WN5B 1QRND 2VLJB 1UQSB 2X5PA 4G7YL 2IG2H 3D85D 1GGBH 1RK0A 5F93C 5ADOL 1G1YA 1KF9B 5JQHC 1RIUH 1H3WM 1KB5L 4TSAH 3JTCA 4OF0A 4NQDB 1A02N 3QIBA 3GSNH 4DJMA 3BKYH 1U8MA 3FQNB 4F37F 1FZOB 2VIRB 4JDZA 4JRYD 5INCB 3RAJL 3WMSA 1QRNE 2Z8VC 1XZ0A 1MSPA 4BQBA 4EVNB 3ARRA 3OX8B 1P84K 2EZ0C 4PYHA 1MH5A 5F72S 3CLFL 4G8EB 1ZWIB 4YDKL 3S35H 1F4WH 3MBXH 3WS3A 4NCDA 4MXVF 4JCLA 1I9RH 4N9GA 4CRPA 3BZ4A 3GEWB 2Y4SA 1ZT7A 1YMMD 3GIZL 1C7TA 3G5ZA 3CH1A 3V4UL 4JRYE 3RNQB 2Q86A 4Y4FC 5D1QA 3GK8H 5H37H 4M7JL 4XPAL 3HZVA 2O5ZL 3T0WA 5I19L 1RURL 2NX5A 4IDLA 4MCZB 3W39A 1ZSDA 4FZEL 1AGBB 1OGAE 3K4ZA 4XMPL 2GEEA 4NJ9H 4AG4L 1FL6B 2QV2A 1KT2A 3V6ZA 1UG9A 4P5MA 3STBA 1D5BB 2DQJH 1YMME 1AC6A 3IYLW 4UDTA 2JELH 1QNZH 2NY0D 3GI9H 4PJ7A 5GGTA 2G9HA 3BAEH 2DQEL 3O3DA 3K2UH 4D0DA 1GOGA 4XPBL 4TVPH 5I2IA 1P4LA 3T3PF 4E0RA 2CPCA 4KVCH 1XF2B 3IFOB 1NMAH 4GOSA 1RU9L 3HPLA 2HWZH 5GZOC 25C8H 3T8XB 4XB8A 4RGNB 1CVRA 5BV7L 2QBWA 3MFFB 4OCMC 5HI4D 5T3ZE 3MOAH 1TZGL 5D96B 1WJ3A 1DTUA 1K8DA 4KUCD 2XXCB 4HUUB 3HRZB 1IILE 5LGJB 2IQ9L 2HT4D 4M61B 3ARVA 5FUZH 4GQ9L 5E6IB 4DW2L 1N59B 2DMBA 4GG8B 2EE6A 3D18B 2ARWA 4JGMA 1TZHB 3QFJD 3BQUC 4NCC2 1CIDA 2UV3A 1PBYA 4PJCB 1AJ7L 2B4CH 2ZUVA 4KROD 3V6OE 4UTBH 3WLWC 1MREL 2ZCHH 1S78C 4F7MA 3BPLB 2QSTA 1M6OA 5KOVC 1H9VA 3E3QE 3EJYD 3P40A 1EXUB 2OQJA 1RZKL 3CVHA 3KNBA 4OUUA 3TJEL 5ICYB 1YEEH 4QTIH 1IM3A 2BSSB 3VFUA 4KKNA 1OL0A 5ESVB 2ZSVA 2LU7A 1J10A 2IAMD 3O81A 1GZQB 2ESVB 3PWJA 1P7QA 3UC0H 3ARZA 1XCTA 3ECBA 2XV6B 3MLZH 5F7YC 2FD6L 4LAJH 1YYLH 1FV1B 4LL9A 4ETQB 5T33H 3O6FC 2I9LA 4KQ4L 4Y8AA 4MJ6B 2BVQA 5F3BB 4UILL 4Y4KB 1G7HA 3HCVB 4BZ1H 3MOBH 4N8VG 2Y5TA 5L7XH 2XKSA 3GMRA 3QQ4B 1TMCA 4JFDB 2H2SC 2X7LA 2XG4A 3AM8A 3Q6FB 4NWUH 3O4LD 3H0TB 4XP5L 1NDGA 3PGDB 3DXAB 5MEOA 1PZUB 5JW4M 5IBLD 3EYSH 3QUXD 4MNGA 3ZYIA 5IKCA 5TFSH 2C3HA 1JNNH 2EDKA 4KTDL 3HE6B 3QXAB 1A21A 2PNDA 3L5WB 4YIQA 4I77H 3KR3L 1CD1B 1CF8H 1KNOB 2NZ9C 2YSSB 3O4LE 3KYKH 4ZPVB 5C7XH 4JQXC 1JPST 1N4XH 5C09D 4YXKL 4XCNA 4L29A 1AGDA 2FX9H 3TFKC 4BH8A 4APQB 4BKLA 4MB3A 4LMQE 2BFVL 2A9NH 4L3EB 5IVXF 5B3JF 4CVXB 1JK8B 5GGSB 2RFXB 5E1AA 4M43L 4RSVA 1DBJL 4XPFH 1FO0L 5C09E 5DA4A 3EDJA 1BQUA 2QR0A 2XQBL 3U0WL 4YK4C 1AIFB 4J23A 2Q7NA 4OGAD 3QAZC 4Z7WA 1NDMB 3LQZB 1NANH 1Q9LB 1DQTA 4ZUUA 4G7YH 4TQEL 1DCLA 2DB8A 3O3EB 3OPZL 4PV9A 1UA6L 4NO5A 4CKVX 2BSRB 2EDEA 5ADOH 3MYJA 2DQTL 1KB5H 1H5BA 5D8JL 4Z78B 3FQXB 4K9EC 4HFUL 3VG0L 2P5WA 2DICA 1TJGH 4HS6B 3RAJH 2EDNA 4XGZA 3BGAA 1BIHA 4HIXL 4KJPC 1DFBH 4LLAA 1ZMYA 1PZ5A 3EZJB 3VI4E 3QXWA 1NCAH 3CFBB 3CLFH 4YDKH 4I2XA 4G6FD 5IHZB 2DM4A 2YA1A 3I6KB 3IJYB 4X98A 5DZNA 4YHYB 1SBBA 1UM5L 2CRZA 4LFHD 3L3OB 2NY2D 5EC2A 4RFOL 1TFHA 3RZCB 5D1XC 3GIZH 1JIBA 3CU7A 3KPSD 1A8JH 3U0TB 2MKLC 3L5JA 3V4UH 3NCFB 3T3ME 1FG2A 1Q8MA 4HPOL 1I8LA 4M7JH 4X0KB 3TBYB 4HWZA 5T5NF 4YX2L 3OKMA 5I19H 5IMMA 4ZUSA 4MXQC 1RURH 3ARDD 3DVGB 3BH8B 4QRRB 2WQRA 4FZEH 5DWUL 5DQJB 3FN0L 4XMPH 5CD3B 4AG4H 4QCIB 3OHXB 1G7QA 1T80A 5FXCH 4F33B 3QCUL 3KPSE 3DETC 2BDNL 4C59B 1DBBH 2IBZY 4AEIL 4PJIE 3CPLB 3QDGD 4Z6AT 2DQEH 4KUZL 5MENB 2C5DC 4JM4L 4TTDD 1P69B 3WSQL 3MR9B 5GGUA 2GFBA 5HYEA 5H35A 1A0QL 3QPQC 2IH3A 1HHJB 2JJTA 3DO7A 4JREB 1RU9H 1J1PL 4U1LB 4GAYB 4R0LA 3MUY1 2P8MA 1LO0L 5BV7H 1J0IA 3DX6B 3GSUB 3NFNA 1MFAL 3RWEA 4Z9KB 3FFDB 3QRFM 3QDGE 5T1KD 5M95B 1D5ZB 4EUPG 5IQ9B 1MQ8A 3LV3A 1UJTA 4X6DA 2IQ9H 1S9WA 4UNUA 2DL2A 4PJ5E 4PJAA 4FFVD 3RBSA 1T3FB 5JHDD 4GQ9H 4DW2H 2EYRA 5DUBA 3WKML 3G6JB 4OZIA 3T1FA 4Y4HA 4PGEA 3DVFA 4XZUB 5KG9B 1N6UA 3LRSA 3MODL 2WBJC 3EDDA 2MFNA 1IC7L 1MREH 1FFPA 3RTQB 3QT2A 5CZXC 2E3VA 3WFCL 5GQBA 3VWJD 4DZ8A 2EDHA 5DK2B 2VDKL 1RZKH 3TJEH 3O0RL 4GO6B 3TCXA 1Z9LA 5HYSG 2I25N 4KUCF 1OB1B 3TBVB 1WICA 3JV4A 5BMFL 4ZXBB 2GITA 2OJEA 5EO1B 1TZIA 1KIPB 3VXUB 3GSNB 4S1QL 3O2DL 3ILPA 5FKAB 2YC1A 4NKOB 5FO7A 2FD6H 4ZQKB 4Y2OA 4QHMB 5HTSA 2A6DA 1HNGA 3V0WL 1MFCL 2R1WB 1GAFL 4UILH 1ED3A 3IGAB 5F9JB 3QQ9C 2ED8A 3I02A 3I6GA 4OZFA 4CN4A 2EDJA 3MA7B 3T0EC 1VDGA 4G8GB 4AQOA 2VLRD 1UJ3C 2AJZB 2QQQA 4JJ5B 5KSVB 3VGGA 3OKEB 3HC4L 4X7SL 2NXZB 5IG7B 2ADIA 1FGNL 1W0VB 4XP5H 1NANI 1DUZA 4PG9A 1QR4A 3LRGA 1YPZF 3PWLB 1AGCB 4KGJA 1H3UA 2X9XA 3LKRA 5C0FA 1WFUA 5HDOA 1RUKL 2CIKA 4KTDH 4J3SA 1GGUA 3CNKA 3KR3H 4UTAL 4LLWB 2PYED 1WIPA 4XP9L 5C0JB 4IRSB 3BFOA 3CSBA 4U1IA 4XNZC 3O8XC 4ODUB 5T1DL 4X8XA 1HILA 3LZFL 4WUKL 3S37X 4Z76A 3D9AH 2BFVH 4H5SB 3RWFA 3ARED 5FB8B 2YOCA 2PYEE 3EYUL 4M43H 5FYLL 1DBJH 4HH9B 1FO0H 4E5XB 3IDUA 3V5DA 1LK3L 1U6AL 3IJHB 3D5OF 4MS8D 2AV1B 3EOTL 2XQBH 5C0IA 3U0WH 1BF2A 3O3BA 4ZS6C 4JPWL 2CO6B 4CN6A 4RGMC 1GZPB 1N8ZB 2Y1VA 5E00B 1KJMA 4TQEH 3OPZH 4YHLL 1UA6H 4WRLA 2DIAA 4I48B 2KZWA 5B39A 1FNEA 5E2WL 2ENSA 1A9BB 4OFVA 4BQCA 3U82B 5C71A 3MV9A 1CICC 1CE6A 4GUPB 5D8JH 4OUOA 3SGEH 1MY5A 2ILLA 5DHXB 4JFQB 4HFUH 1KIQA 1MJJA 3WUWG 1JN6A 1KTDA 4X5WB 3TA3B 3UYRL 4KQ3L 1T89A 4G42B 4HIXH 3VGAC 3S37L 3T1WA 3VFNB 4EDWL 4MJ4A 1OAUL 3BD5A 3TO4C 5KVGL 5E8NB 3ZT5A 1T66D 2JIXD 4JB9L 5ANMA 1HHKB 1NC4D 4FA8A 4QHUA 3MJ9H 1RZ8A 4KK9C 2Y23A 3VXOB 3VI4F 3MGOA 2G75A 5CEYA 4JFXB 4NGHH 4RIRB 4D9QD 1XMWA 5BXFB 2XZCL 4HPOH 4NQVB 3ZE1F 4RZCB 4YX2H 3C5SB 1KYOJ 2V2WB 4NPYB 4MZ3A 5KS9B 3U0PB 4WO4C 5BS0A 2KKQA 3T3MF 3FN0H 3TWCL 2PYFB 2XPGA 4KZEL 4IRJC 5AD0B 1U9KA 3HTLX 3HPJB 5E8EB 4D9LL 1EBAA 3L5HA 2NY1D 3PV6A 5FO9A 3BZFB 1VADA 3QCUH 4D9QE 2BDNH 5J7CC 4JFZL 4AEIH 4M02A 1M71B 2XKNA 4JDVA 1TNNA 1G9MC 3OAUL 4MAYB 4KUZH 1AO7B 4ZYKB 4UNTA 4ONHB 1O5DT 4KJYA 4LVHC 3WSQH 2NTFB 1HXYA 3DGGA 5IJVA 2HVKA 3JVGA 1A0QH 4PJIF 3OSKA 1KPVA 2DS4A 4N1EA 3FRPG 5F1SA 3W82A 1FHGA 1J1PH 2MCG1 1JHKH 1LO0H 1MFAH 4LKCA 3JTTA 2EDXA 3LD8C 2XTJB 4ELMB 5HHOB 2JJUA 4I5BB 3TIEA 1OTTC 3VXQB 4O58L 4YR6A 1OGTB 1R3IH 1J8HB 3BO8A 1F2XK 3VFRA 4ODSH 4QRPD 3SGDH 3WKMH 5GRJL 3WIHL 3WIIH 4RDQG 2CLZB 1U95A 1WLHA 4XCCL 3PWNB 2ZSWA 3B2VL 2P49B 2BOBB 1U91A 5SWSD 4FRWA 1JGDA 1XIWC 3R06A 3FT4A 3MODH 5IT2L 5BVJA 2J1KA 4OZHA 4F7EA 1IC7H 3PG2A 4LLYA 3PIQA 5KW9H 3VDCA 3QWQB 3WFCH 2MQCA 3H6JA 2VDKH 3D69B 4PJFF 5DXWA 5B38B 5J89A 5CIPH 5F7DB 1INEL 1KB5B 5SWSE 2A0LD 4O2FA 4RWHA 5BMFH 2XN9B 5SWZA 3BEWB 4QHLB 3MMEB 5CP7A 1IM9A 4S1QH 1F8TL 5FFLA 4P4RB 3PP4H 4IOFD 1K8IB 4NC0B 3RL1A 4K94C 5F88B 2BHZA 3D39A 2XWJB 3V0WH 1MFCH 1GAFH 3F6IA 5EBMB 1S7RB 1U8IA 3OKDB 4XP4L 1GHFL 1EUUA 5TF1H 5JPNB 4XBPB 3O45A 4CVZB 1FNGB 5E8PB 5M7QA 3U7WL 3HC4H 4X7SH 3CC5A 3C09B 2B20A 2G2RA 3NGBC 4IJ3C 2PW1B 4KRPC 3ULVL 4CDGC 1MAML 1RUKH 5IEHA 3PL6C 2OSLB 3VCLB 2P46B 1FC2D 1EERB 1EVUA 3SGEI 1MLCA 5D9SB 1A7OL 1HQRB 4NNYB 3VRJA 1YEDB 5CGMA 1QSEA 2CH8A 1NBYA 5B4MC 4UTAH 1JYWA 4XVUD 4FXGA 4OI8A 4JO3L 5FGRA 4XP9H 2YRZA 1C5DA 4OCWL 4ZDHA 4UIMA 4XCEB 5DRXB 5T1DH 4WUKH 1ONQB 3LZFH 4XNMB 4LNRA 4TTGA 5A3ID 5I73B 3J8F7 4FQXC 2ITDA 3L7EA 5HHXL 4UBDC 5GS2H 2NYYC 5J56B 3EYUH 5IEKB 3KLAB 5FYLH 5IVXA 3UTZA 5BV7B 1NGYA 1AY1H 3ARFD 4N8VA 4Z7UB 1U6AH 3L3HA 2AEPL 4JPIA 3EOTH 3OAZH 2Q1EA 5DJ2B 2HH0L 3C6LD 1TVBA 3FOLB 4QHKJ 4JPWH 1GPOL 1VGEL 5D2LB 1QR1B 5E1HB 4D0CA 2LFGA 5C07B 4ZAKD 4W6WB 4KKAD 1OT1A 3GMQB 3QUML 4YHLH 3VRIA 4KMQA 1URLA 4GW4A 5JMRA 3PHSA 4J7RA 4XC1L 2D31B 3RPIB 4MYWB 2XI9A 2FO4B 2HTLD 1A4KA 1EFXD 1Z6JT 2GCYA 4LOUC 2CLVA 4PRHB 1GCFA 1P1ZA 1XGUB 4O9HL 3UYRH 4KQ3H 5F7EL 2HJFB 3S37H 3RWHA 2I26N 1HHIB 4EDWH 2X4UB 1OAUH 4NC1C 1OSPL 5KVGH 4JFEB 2NY5L 1WT5C 3W11D 4JB9H 1KCGC 4QOKB 5CZKA 3U7YL 3UTQA 4TPRH 2HT3D 4X4XA 4M93B 2W9EH 1UB5B 5FM5O 3P0VL 3C5ZB 4HIHB 1B88A 3D85A 2XZCH 3SGDI 5L2KD 4U31A 4LARL 4UAOC 1PEWA 3MRNA 1YNLH 2ZUWA 4XVJL 3LOWA 3WE6B 3H8NA 4MVBD 4XI5C 3TWCH 5J57B 4KZEH 4D9LH 1OAXL 2J6EA 4P0DA 4POZD 4JFZH 4JY6A 3QRGL 5L2KE 2GYSA 4MMZC 3BYYA 1CU4H 3OAUH 3MFGB 5DJ0B 4RAUB 1BFSA 5LGHL 3UTSB 1IGYA 1B0RA 2OBGA 2YXFA 4I18B 1I3UA 1YNTA 2VLJD 5B21A 4G9FB 4RRPG 3G5VB 2AP2A 4OM1H 3AAZB 3MNZA 3QNZB 3QB7C 3PV7A 2V7NB 4NWTL 3OKLB 4PBXA 4NQDD 4JN2B 2EDQA 2OXGA 3DMMB 2ID5A 3QIBC 2YZ8A 2FLBT 2EDWA 3K8LA 1MQKL 1QOKA 3HG1B 1MHEB 3GM8A 2X4OA 2VLJE 5CSGA 5GRJH 3WIHH 5FOJA 1N5AB 3B43A 4WY7L 4XCCH 1QFHA 1FO0B 3B2VH 2E7LE 1A7RL 4DEPB 1DQML 5GS1A 4R7DB 2FJHA 3U46B 2WWMD 5IT2H 4NQDE 4GW1A 3KPNB 4XBEL 1X5ZA 2UUDK 4WV1B 2QJDA 2P24B 2HLAB 1FC1A 4R96A 1XGQB 3QI9B 1TTFA 4NOBA 5FM8A 1ZA3A 4QNPE 4PD4J 5D1QC 5DRWB 1P53A 2CGRL 5CJBA 4K55A 2YBRB 1INEH 3LS5L 4HIEB 3NIGE 3W9EA 4HXAH 2B5IC 2WIMA 3SKOB 1F8TH 5L2JB 4X4YB 3QUZB 1Z2KA 3EYFA 2J88H 3QFJA 3DYPA 1AD9B 1WBXA 3VG9B 1I1FB 3S5LG 5K93A 1GHFH 2PO6B 3REWB 5E24E 1S9XA 1MEXH 5CSZA 2KQNA 5C8JA 1VA9A 1I9JL 3TBWB 4YHOH 2JJWA 3U7WH 2K7QA 4HT1L 4RFEB 1R0AL 3MRGB 3MRRB 4OFYD 3ULVH 4X9BA 1JGLL 2Z35A 4G9DB 3RY4A 2X4PA 2OMBA 4MHHI 2IAMA 1L0QA 2N56A 2BOCB 1YPZA 4YFLF 1A7OH 1NGPL 2BVYA 4X7CC 5E6ID 3TYGL 5LAXA 5JORB 3N1PC 4JO3H 1J18A 2XY2A 1IRAY 2ATKA 1IEBA 4U1MB 3MBEA 2OK0H 3QDHA 4OCWH 4JLRB 5HJ3B 4KKLD 4G6JL 5I1DB 3A0OA 1ORSB 1LE5A 4UI2A 4AEHH 4MX7A 1KLUB 2FL5A 3GSOA 4C4KT 5B3NA 1J5OL 1UM6H 2EDRA 2OTWB 3QUXA 3DX7B 1I9IL 1KEML 2BVUA 3DPBA 5TDNA 4OV6F 2ESVD 5F9WC 1LEKB 2HH0H 5IOPA 3C8HA 2NPLX 3ALPA 3OXRA 1GPOH 1VGEH 1A7NH 2HFEB 4WI3A 1I3RB 4LU5L 4FABL 3IXAA 4L3CB 3QUMH 4NHUA 4HX1A 4Y4KD 3EOYG 5ESAA 1R3LB 4XC1H 5FV2A 4YNYA 1C7SA 1RJLA 1WFNA 1O0VA 3H9SB 4EXKA 3N06B 2ESVE 5GS3A 3GMPA 5FGBA 4G5ZL 1CLYL 3T2NL 1LEGA 3AM8C 4O9HH 3QBTB 2BY2A 2CQVA 1H3PL 3DXAD 5F7EH 4QRUA 2O5YH 2EEAA 4Y2DA 5CP3H 4NQXA 5CIPB 1P2CA 1OSPH 3TH3T 2NY5H 1JPFA 4XNYL 4JY4B 5EUOB 5GGRA 3TYFA 2MMXA 3U7YH 3HE6D 3PWUB 3QFDB 4P4KB 3V4VH 1UB6B 1JNLL 43CAB 3DV6B 2FCBA 4NZJA 4KY1L 1MPAL 3U9UA 4KHTL 5BJTA 2VISA 5DJ8A 3EJZC 3P0VH 3SDDA 5EU4A 4H88H 4X5XB 3DXAE 4LARH 5E7BA 2LABA 4YC2B 3MRQB 3CDCA 4XVJH 4K3GA 1BIIA 2CXGA 4APQD 5J1SC 2FX8H 1KFAL 4KI5C 1KOAA 2EXWD 1V7NL 3OGCB 4RQQB 1Q9OA 3V0VB 5I71C 2MKWA 3WEXA 3RIAK 2JK5A 1D5IL 1CK0L 2DWDB 1QBLL 1JFQL 3QRGH 3SDAB 1A6ZA 5MEQA 1AR1C 5C0CB 3NMEA 4YDVA 1RJZB 2ZOKA 1DEEB 3BEVB 5LGHH 2JE8A 3Q5OA 4JANB 3L3IA 2EIEA 3BDBA 1VFMA 1JTTA 4PRBB 3KPSA 3GO1L 5HYQB 3ZMRA 4I0CC 2EDDA 1F45A 2VQTA 2YD5A 4U4BA 3IDNA 4NWTH 1AP2A 1D6EB 3B9DA 2YD6A 3FRUA 1H5BC 2DRUA 3LEYL 4AZ8A 2FEDD 1F13A 4HKBA 1ZHLB 1MQKH 1FNAA 1TQBC 2HMID 1XF5A 4K71B 1MVUA 3ARUA 2VAAA 3ARGB 1YUHA 3HA0A 3AU1B 2RR3A 5C3TA 4M3KB 1U8JA 4WY7H 4BUHA 4MJ5B 4CADA 3QDGA 2NW2A 1LDPL 3KG5A 1DQMH 5IF0A 2R1XB 3QDJB 3DX8B 3I2CL 5HHPA 4DTGL 3OKNA 4XBEH 4BM7A 1YN7A 4OD2A 3RZCD 1IQDA 2D03L 4LPCA 1Y18A 3MLUL 2P8LB 2D7PA 3FO1A 1I8LC 2CGRH 4UINL 5LKNA 2QADB 1R3JB 3LS5H 1X5KA 2EO1A 4PJFA 4QRRD 3TZVA 1EMTL 3QP3A 4QNPF 4EJ1C 3MRDA 2SEBA 1U8OA 3ROLA 1L0XA 1FNFA 3FRPA 5JHDA 2AEIT 4AEEA 5KBNC 3CSGA 2VL5B 2V5MA 1R5IA 4JR9L 3BP5B 1JWSA 5MEND 4MD5A 5JDSA 4QRRE 4Z7OE 1CR9L 3HI1B 1I9JH 3DRQB 3PNWB 2VDML 5T5FL 5SV3A 1WVZA 2JJTC 4M1DH 3VWJA 4HT1H 1R0AH 1UZ6F 4R0LC 5A2IH 3RGVA 1T7YA 4WVRA 4QRSA 3L1OL 1JGLH 2ATPB 3MRIA 3UROR 4EI5A 1WCBB 5MENE 4ORGA 2WIIA 1VGKA 2DDQL 1P6AB 2VZTA 2VABB 4H26B 2HLFD 1NGPH 2H9GA 4HQQL 3D2UA 4PGBB 2XACC 5C70A 4PTTB 3LDBC 4XPHL 4ZOAA 3TYGH 3X3FL 1S8DA 1NGQL 4YHPB 2JLLA 4HWEL 4Y4HC 1I8IA 1K4CB 4M5YL 1WBZA 4G6JH 1MI5B 4XAKD 2VLRA 3RTQD 4NNXB 3RVUD 4F7PB 1U8PA 4F7TA 4GAGL 3IT8D 1XEDA 1NGXB 2WINB 3NCYS 1J5OH 1UWXK 4OF3A 5ETUB 4QRQB 4PBVC 3G6JE 1U93A 5EC1A 3RUGB 4NJAH 1JZ2A 3PWPA 1I9IH 3AROA 3I3DA 3HNVL 3GSRB 3MLTB 4ZXBD 1KEMH 1HNFA 3PWVA 3VXUD 3LSOB 2OI9B 1U92A 1N0XL 4DVBA 4XAKE 1GVIA 1CCZA 1T0PB 4LU5H 3QNXA 2PYEA 4PJCF 4XNUL 3FAXA 3MJGX 3FZUC 3MRLB 1I7RB 3ELAT 5ACZB 2GT9B 3F12B 1ADQL 1QP1A 3CDFA 2VUYA 4G8GD 1XR9A 3U2SB 5JLZB 3VXUE 4WU5A 5EDXA 1TIUA 5E8OA 4G5ZH 1CLYH 3T2NH 2NXZD 3ZTJH 3BKCH 3QQ3B 3GSQB 3RVWD 3AREA 1Q94B 1H3PH 2VXTL 4MDJA 4UT6L 4LP5A 3O6LH 3QG7L 4XNYH 5CJQL 3R8BB 5IFJB 4MS8A 4Y19B 4HK3N 4JZJA 4G8GE 3FAWA 4XVTL 2CO7B 1JNLH 3MO1A 4KY1H 1MPAH 4KHTH 1F11B 5IB3A 2IMMA 3DX9B 1BOGB 3C8KA 4X6FA 3MRPA 4IRSD 4EOWL 1T1WB 2VDPL 4KXZH 2J2ZA 3BP4B 1AXTL 4TVPD 5HHMA 1KFAH 4JZOB 1V7NH 1A1NB 3IVKA 4GXUM 3UBXI 3CGTA 3LH2L 2P5EB 4Z7VE 4OZGB 4Y5VA 2FBOJ 3EO0A 3NACL 1D5IH 1CK0H 1X4YA 1QEWA 1QBLH 1JFQH 1QSZA 4LVOC 1VFBB 2YEZA 2ZUYA 2JIXA 3V0AC 1AQKL 5T1LB 4YFEA 3NCYP 3QULA 1NC4A 1MCLA 4BSWB 1N64L 3F7YA 4W6YB 4TVPE 5GHWL 4WNQB 1W0WB 2UWEB 1D5MB 4NNPL 3VFVA 1ND0B 1IAKA 3GO1H 4MA3A 1Z9OA 3RWCA 1QSFD 4HK0B 5I1LA 3HI6L 4H25B 3AXLA 1SYVB 1DN0A 3KLHC 5ADPL 3KPMB 4YEFA 4ZS7L 4JE4B 3LEYH 3TA3D 2D9CA 5FDWA 5E2TL 1T89C 1BJMA 4U6HA 5SWQB 2EIZB 3PXJA 3HE7B 4H0HB 3TBSB 3DOSA 1DDHA 5IFAL 1QSFE 3QPXL 1LDPH 4LLMB 3CLEL 1KEGL 1JVKA 3I2CH 4P46A 4CN1A 5IW1B 3HNTL 4DTGH 3T0BA 2GQHA 4GT7A 1PYWB 2D03H 5ITFB 3MLUH 5F1NB 1T0MA 3P9LA 4PGDB 1MCQA 3T0AA 3QUMB 3MJ8A 5CBAB 1B4JL 1ULVA 4H20L 1NGZB 4UINH 3OJVC 2IMNA 2Z8RA 1DLHB 3ET9F 5CZVL 1EMTH 1NBZA 1S7TB 4NO2B 5I1EL 2PTTA 2NCMA 1JGEB 1CFVL 1BVZA 1QO3B 4QRPA 4RRPA 2HN7B 1CGXA 2L7JA 5DJXB 1D5XA 4JR9H 4WU7B 3ARQA 4MAYD 1AO7D 4U6TA 3B5HA 4H1LG 4J8RA 2AKRA 1CR9H 3HS0A 3P30H 5ID1A 5T5FH 2D2OA 2VDMH 3JVGC 1WAAF 1MIML 4HFWB 1OTSD 3Q0HA 5DVOA 2Z91B 5EO0B 2A9MH 2KH2B 4Z7OF 2AJSL 1C08B 1BBJA 3L1OH 2XTJD 2WLZA 5HHOD 3BI9X 1AO7E 5FF6A 3BESR 2DDQH 4M62L 1E6OL 1J8HD 4OB5L 4HQQH 5HGBB 3IFPB 3LEXB 5DRNB 4XPHH 3V6FA 1SY6A 3X3FH 5GRWA 1X5IA 4MJIB 3SKMB 4HS3B 5DMGC 4ZTOL 2H1PH 1NGQH 3DUUB 4DZBA 1N3NA 4HWEH 1ZHBB 1K3IA 3CZFB 1HINL 4PRDB 5D7IB 3MZTA 2XTJE 4ELME 5HHOE 4M5YH 1IKNA 3GUTA 4X5LA 4U6YB 3DVNA 3I3EA 3TCLA 4DCQA 1KN2L 1I1CA 2CRIA 3C6SB 2H8PB 4S1RL 1J8HE 4GAGH 3S97C 4S1DD 4OQTL 5KVDL 1DQQA 2IJ0C 1KIUA 3S5LA 3HNVH 1N2RB 5D6DA 3L7FB 3JTSB 1IL1B 4FG6D 3BPCA 3CK0H 1N0XH 3BD4A 4FNLL 5KTEL 3D25B 4ERSL 4P57A 1NEZA 3G6JF 2FLRT 3S36X 5ECJE 1T4KB 1FFOB 5IB1B 4XNUH 2MHAA 1QVOB 1A2YA 1ADQH 3VW3L 3I85A 2EEBA 3H7BB 4HJGB 4HUWA 1RHFA 1A6UL 1TCRA 3FQRB 1MCEA 4UIKL 1B0GB 3TVMA 1X44A 4P3DB 4P9ML 2YPKA 4NO3A 4MJ2A 4FMFA 2VXTH 4WTZG 4KAQL 4UT6H 1LWRA 1YC7A 5CJQH 1FN4A 3QG7H 4LLUB 5DUPL 4B41A 1XR8B 1GL4B 4XVTH 3X13A 2P4AB 2Y25A 3RFZC 4ZNEA 5M94B 4ODBD 1L9MA 3LY6A 2G5RA 4P5TB 3W0WB 4C4KO 2R39A 4X99A 3P11L 43C9A 4EOWH 2FBJL 5F44A 2VDPH 4BFIB 2APVA 1AXTH 3FMGH 3OG6B 3TIDA 4YBQD 4NZTL 5F6IC 5T3ZL 3MUGB 3QUKA 1EFXA 1WBYB 5BQ7A 3ZKMD 3CX2A 3VFWB 3LH2H 5CINL 1AQDA 5HGHA 2AJYL 3MNWA 4YDLB 1IEHA 3NACH 5DEFA 1X9QA 4NRYB 2DM7A 3CXHJ 3PUCA 1AQKH 4J6RL 5DD3L 1HZHL 2VE6B 1N64H 3SDXA 5GHWH 3FFCA 5C07D 1CLCA 2ZNWA 4NNPH 3AGVA 2ZUQC 2BHUA 1INQB 4DKAA 4JFFA 3HI6H 3MV7A 4HUXB 5GSRB 4PLNC 4W6XB 2Q3ZA 1EEZA 4J1UA 1SJHA 4Z7UE 3V8CA 1IC5L 2X70B 1G1CA 1SYSB 4MVBA 5ADPH 4PRHD 4ZS7H 4Y89A 1T7WA 3MREB 2V5SA 5D2LE 4PJ9B 2WWKT 5GRUL 5C07E 2R2CA 4DGVL 1BZ9A 1BJ8A 4JPKL 2VXQL 4NZUL 1JBJA 5IFAH 5JW3L 3QPXH 4JFED 4MQXC 3EFFB 3CLEH 1H3TA 3HAEA 4AT6A 3HNTH 5J6HB 3OL2A 4PRHE 3HRPA 4E42A 3C5ZD 4HJ0C 1CXEA 4JCMA 1B4JH 4H20H 2E7LA 1JYXA 1DE4A 2B7DT 4EN3B 4JFEE 4PLKD 5E9DB 3VFSB 4NQDA 1WWBX 5CZVH 3OB0K