3QUZA

Structure of the mouse cd1d-nu-alpha-galcer-inkt tcr complex
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
273
structure length
266
Chain Sequence
NYTFRCLQMSSFANRSWSRTDSVVWLGDLQTHRWSNDSATISFTKPWSQGKLSNQQWEKLQHMFQVYRVSFTRDIQELVKMMSPKEDYPIEIQLSAGCEMYPGNASESFLHVAFQGKYVVRFWGTSWQTVPGAPSWLDLPIKVLNADQGTSATVQMLLNDTCPLFVRGLLEAGKSDLEKQEKPVAWLSSVPQLVCHVSGFYPKPVWVMWMRGDQEQQGTHRGDFLPNADETWYLQATLDVEAGEEAGLACRVKHSSLGGQDIILYW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Antigen-presenting glycoprotein CD1d1
publication title Galactose-modified iNKT cell agonists stabilized by an induced fit of CD1d prevent tumour metastasis.
pubmed doi rcsb
source organism Mus musculus
total genus 71
structure length 266
sequence length 273
ec nomenclature
pdb deposition date 2011-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3quzA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3quzA01
3NPZB 1INEL 3GHBL 4KZDL 2OCFD 3IKCB 5DI8B 4E42A 1S7SB 4Y4FA 5E99H 4TNWK 4X7FC 4L1DA 5C0BE 1L0YA 1VGKA 1AO7E 2DL9A 2Y25A 1K8IA 5L0QB 1MCCA 4Y19A 5FOBA 4IRJB 5A16B 3ARRA 5C7XH 1MAML 4JFQB 3TIDB 4YR6A 4UT7H 5E4EC 1I75A 1CFTA 4WTWA 1IGCL 1BQHG 1K6QH 4N0UA 3JTTB 4Z7VF 1T7VA 4ZXBC 4AG4L 1C5BH 5JIKA 4KQ3H 1XF4A 4MDIB 2VSDA 4NN5B 2YWZA 1BFTA 2ZWLT 3U46B 4TUKL 1ACYH 5EUKB 5FKAA 3ZTNH 2VWEE 1XF5B 1CR9L 3BPLB 4NWTL 2DJ4A 2Z92A 4KKLD 4YWGL 4JEGB 4LLDA 1JMXA 4IRSB 4I0KA 4KUCD 4HIHA 4JO3H 3TNMB 4LVNB 1NC2D 3PQYE 5DD0L 3KNBA 2IBBA 3SDDC 1MQKH 4ERSH 4WJ5A 4L8SC 3RZCA 3JZ7A 4JQXC 5JW4N 1QRNA 3J8F7 4L3EA 3LMJH 3BDXA 2G2RA 5ITBL 1LO0L 2GY7B 1XGUA 5DQDL 3OR7B 5CD3A 4POZD 3IXAA 2VZTA 3MRJB 3GKWH 3UYRH 4GMTL 4AIOA 3R06B 3QIBB 4RBPK 2EIZB 1AXSB 1GGUA 3WE6A 3WL9B 1UZ6E 1FSKC 4XNUH 4M61A 5HYJE 2AXFA 2X4PB 3OB0H 1ES0B 4ZS7L 5BOZG 5JPMB 4X7CC 3C60D 3VXSD 4MJ4A 1YY9C 4OIBA 2GYSA 5DUMH 3WIHA 4PTTA 4QRTA 2XZCH 4HS8L 1DQQA 5I0DA 1MCKA 1WZ1H 5BS0E 2XTJD 2R0KL 4OF6A 4R7DA 1KYOK 5IMKA 4EI6A 2AS5M 2H3NB 3WNMA 1N6QL 2EDLA 3T0EE 3UTQB 4EI5D 5I6XB 3RAJH 3QG7L 1JUFB 4XCNB 2X6MA 3MNVA 2WINA 2JIXD 3IDXL 2P8PB 3BFOA 5IB2A 4MQXD 4ZODA 4JPIA 1AE6H 5IB5B 1J8HD 4F7CB 1QYGL 4UBDC 2G5RA 2IGFH 1I3RA 1Y6KR 1MUJB 3BKYL 4WHTA 1MCWM 4ODTH 3P9WB 4PJDA 3X13B 1TPXB 1DANT 4HAFA 5IV2A 1M7XA 3D69A 1IQWH 1PJ9A 2WW8A 4JRXA 2J6EH 3JWOH 3W82A 3MZTA 3TBSA 1E6OH 2FD6H 2Z31B 4NO2B 4RISL 4PJ7B 4AEHH 5J57B 3CZJA 1LQVA 4H8WH 5IQ7H 2VZSA 1OPGH 1ZAGA 2WBJA 3FQXA 4I13B 4OM0H 4JHWH 4JRYA 4XTRC 3TPUA 4KHXH 4W6WB 3ZDZF 1L7IH 1PKOA 3VFUA 4D3CL 5IJVB 2GSGA 4XH2B 3TYFA 3B5HA 3BP6B 3F7YB 3REVB 1LP9A 5FF6A 3NGBB 4K71C 5D7SH 2DN7A 3QUMA 5FYLD 4KJPC 2YBRB 4PGEB 1NCTA 1N5AA 1I9JH 4LU5L 4LLVB 5I1DA 2BNUB 1AGDA 2VZVA 2ENSA 3HB3C 3O3DA 3GHEH 3AY4C 1WIUA 3SBWC 5E9DE 1TVBB 2VQ1B 4APQB 4JFFD 4WHYG 2BX5A 2X4OA 3AU1B 1IGYB 5TFSL 2ARJB 3NFPA 2XI9A 1CLYL 1NDMB 1NJ9A 3MV8A 5EN2A 1BQHB 4YHIA 4RQQA 5IVXF 5L2KA 1AC0A 5GGSY 4R4ND 2Q6WB 3ZKND 1C16A 5C86A 5DK2B 3MOAL 3ARVA 4CU8A 1MCBA 4J3WA 3QCUL 4TVPE 3I6LD 5KJRL 3DXAA 5DTFA 1OF2B 3INUL 4U33A 1AGCA 1D5MA 4YHOH 5DJ6B 4V1DA 3OKNA 3F6IA 1QSFA 4PLJC 5DD6A 2C7UA 3QUXD 1K8IB 5HDBF 1G7IA 1U8QB 1JIBA 4EN3C 5C1MB 3QXVA 4TNWF 4Q6IB 4IOFD 2E9WA 4YR6B 4ONFH 2E9BA 3U2SA 3IXTA 3P11H 4DJMA 1KIQA 2ADGA 3D0LA 3SKMB 5TQ2H 1AC6A 3LB6C 4J1UA 5IFHL 1JTPA 2MPAH 3UJIL 3LN4B 1OAXH 3SE9H 6CGTA 5IW6A 3TZVA 2OZ4H 1RZ7L 1CFSB 3L3IB 4F57H 3KGRA 2GUOA 1WGOA 3V52H 5JZ7C 5L6YH 5LGJB 1PZ5B 1JFMA 3H3PL 3DHJA 3GMOA 5FKAB 4ZMAT 3VXNA 1TXKA 5GRXG 2P5WE 2EH7H 3NFSL 4JN1L 2Y06L 2PW2B 4IM8A 4FQCL 1B0GB 3CUPA 2NQCA 4LEXH 1YMHB 4CAGA 4PJFE 3QFJB 3UTTB 2LVEA 4ZTPL 4L5FH 2BVUA 3SE3A 2O26U 3LEYH 3FHQA 5DC4B 1ZE3C 4XCEA 5I30L 4LGSB 5DEGB 3MRDB 4DQOH 3L7FB 1HCFX 1OW0A 4IEFB 1HKLL 5K9KB 3QNYA 4YIQB 3TH4T 1QA9A 1NCAH 2QKIA 4HC1A 2H2SD 5T3XL 1S5IL 2G2RB 3MV7D 3SDAD 3QT2A 1OAYL 5CD3B 4XNQA 3RTQC 5IBTH 4Z8FH 4MWFA 3QUZC 4S1SH 43C9B 1MFAL 4ORZC 2DLEA 1ZV5A 4HG4J 4M6ML 4QCIB 5HYEA 5KVGL 3WD5L 3I9GL 3HUJE 3DVIA 1J88A 2J8UE 2W9DL 5T5NG 1MLBA 2H8PB 1MFNA 1EV2E 1MI5E 3DHMA 2VITA 5EIIA 3RPIA 1QFOA 1DQQB 1I1RA 1FZMB 4H88L 1X5IA 3NCCB 4PP1C 1WF5A 3DGGA 2EYRA 5IMKB 5JMRA 5FECA 2YEZA 4LSPL 3L1OH 4OCYL 3GNML 5EBGA 4LSRL 1RUAH 5ACMA 3KPMB 4NQCB 3GSWA 3MRGA 1HE7A 5E0QA 5DK0B 4GS7C 2EH8L 4JREC 3G04B 2YK1L 4UINH 3S35X 2DLGA 4F7TA 4M7KL 4P23A 3CDGB 1EXUB 4JHAH 3QJFA 3GMQA 1RI8A 4OB5L 1JHTA 5HHVL 3H9SE 3ETBF 3D69B 4LNRB 4P46A 4JRXB 3GBNH 1N4XH 5F6HI 1NKRA 4AEFA 1PZUB 4Y0GA 1SMAA 3AXLB 2B20A 4OZGF 1MFCH 8CGTA 4JZNA 1HHJA 4I0PC 1M05B 1CL7H 2X1PA 1LK3H 5GRJH 1R3KB 4JM2B 4PJXF 4B41A 3QIUB 2YD1A 4RMUA 3TYFB 4LRNL 5F89A 2Q8AH 3QXTA 2R29H 3PP4L 1M1SA 5HPMA 1U95A 4IS6B 4XC1L 5JTWA 2R2EA 3KPRE 1YQVL 4M7LH 3RBSA 1KENL 5FB8A 5I1DB 2XRAL 1U8KB 4G9FE 4M1DL 3VG9C 1MIEH 1QR1B 4XNYH 4HUUA 4LVEA 4QRQB 3F7VA 5CS7A 5C07B 1IGIH 4PRPA 1IVLA 1QSEB 4ODWA 4FQ2L 2RFXA 2XN9E 1D7FA 4H20H 1ETZA 5EN2B 2JLLA 5K33A 2JCCE 3LY6A 3V6ZB 4LPYA 5IR1A 5I76A 3ZKMD 1AJ7L 2JELH 2VOTA 3OAUH 5HYFA 4HLZH 3OGCB 3QIWD 4LFHD 4N8PA 3NPSC 2NW3A 1AGCB 1ZA3A 2ESVB 3D39D 4RFOH 1YEJL 2X1XR 1DL7H 3MRKA 1TJHH 5T1MB 1WWCA 3OKNB 3LEVH 2VDMH 5MI0B 5D9SA 4ODXA 2C7UB 1OCWL 1IEHA 4LSSH 2ED9A 2E8YA 4JVPA 3VE0B 5IMLB 2O5YH 5T1KA 1JGUL 5EU3B 3WFCL 3ARWA 1K4DA 4XBEL 3O3AB 4OGXH 3VFSA 5IW1B 4MNQD 4ZPTB 1KIQB 4KJWD 4AQOA 1CGSH 2SEBA 5DHVA 2R4RL 1QBMH 1VACB 4H25A 5EOCJ 3P77B 5FGBA 1IEBB 4U6TA 1UH2A 2R1WB 2HJKA 1AXTL 1XH3A 4U0QB 3D18B 1JRHH 3B5TA 1T4KB 5E8OA 3RHWF 3I50L 4PJ8B 1XGPB 4RX4A 4X4XB 2V7HB 3P73A 3HR6A 2OR9H 1P4IH 5HGHA 1AIFA 1G7HA 3QO0B 5DFVC 3I3DA 2OQJB 1CZ8L 3UDWA 1CLOH 1KPRA 1FFPB 1KJ3H 3CH8A 3S37L 5ALBL 1G9NL 2P24A 1A3QA 4ENEC 4ODHH 4KV5E 3MBXH 5ISZA 3TBYB 1A6AA 3TJHC 3GSUA 2AXJA 4N5ED 3QNYB 4GQ9L 3TBWB 1WWBX 4NKIH 1A47A 1JTOA 1OSZB 1RHHA 3BH9A 4DTGH 1M6OA 3EYUH 4XVTL 3FHAA 2FB4H 4HMDA 1T2XA 3WJJA 1YZZA 1HNGA 2D4DA 4TULL 5D1XA 3LKSA 4KU1A 3VXUE 4X9FA 4OZFA 3RVXC 3VFOA 4HWEH 3QRGL 4PJBF 4EVNA 1MJJB 5JHLL 1NQBA 2PN5A 4NC0B 3MRFA 4ZNCD 3MA9L 5SX5K 3VRIB 2QADC 2C4XA 2PF6A 1MCPL 3OKDA 4FQJL 5EIIB 1CLZL 1OAKL 1P7QD 2APXA 4XXDB 1OVZA 4PJAF 1E4KA 3X3FH 2HP4A 2OM5A 3LKRB 3OAYH 2CKBH 3IAGC 5KW9H 4L29A 3MRCA 4EXPX 5EU5A 4GW1B 2HT2D 1PW3A 2CK2A 2VLKE 1U58A 4HIIA 1TQBC 4H0HB 3CLEH 4PY8I 4I77L 3V4PL 2WQ8A 3S35H 4BSVB 5J3HC 3VFVA 1CFBA 5IW3A 3X3GH 4RMWA 4IMKC 2XWBA 5C0EB 4LSQL 2VLJD 2F19L 2AKRA 4XWOD 1IJ9A 4JG0L 1NUFA 4QYOA 3DVGA 1FG2A 1JHTB 2ITDA 1E4WH 1DDHA 4FQLL 2HG5A 2BNRB 1XGYH 2D0GA 2Y6SD 4L4TD 2PTTA 4FFYL 3L3OA 1LE5A 3PIQB 5BW7A 5JMOC 5FM8A 5IB3B 3FOMB 5I1HL 4JZNB 3QEQA 3AREA 2ADJB 2DQHH 5EZJB 1JHKH 5DJZB 1CI5A 3OJDB 4ZFOL 1R24B 2FNBA 5F3HA 4ZQKB 1F13A 1YEGL 1YY9D 1PG7L 4LMQI 2X9WA 4AMKL 2HJLB 4JCMA 4P2RD 4HGKC 4MZ2A 4N0CA 4AL8L 1MIMH 1KTLB 1XGRA 2UZIH 4OLVL 4QNPE 3UPRB 4QHKI 3L5XL 2YPKA 4ODSL 5I73C 2ZUUA 4QTHB 5E8EB 4PLKD 2ZPKL 1KC5L 1WICA 3BHBA 5JUEL 3GB7A 1IAOA 5FYKL 5IB1A 1HDMB 1R0AL 4N8CL 2RFXB 3BMVA 1WEJL 3W2DL 4LCCA 1S7XA 4U1GC 4WFFD 4WTZG 4MQTB 5IVZA 5K9QI 1DQJA 4XCYB 3PWNA 4KUZL 1NSNH 1KPVA 3KPOA 1IGJB 3OR6A 4X98B 4OUUB 4W4NA 1I8MA 1RFDL 3KYNB 2BHZA 3DECA 3VXSE 4L8CA 1X5ZA 1ZA3B 4KMTL 1U3HD 5C71A 1KFAL 1F3JA 1LHZA 4B5EA 1SEQH 4MD5B 5D9SB 2XTJE 3HG1A 3U9PL 2VDNL 3BWAB 4XVUC 4PJ9A 3PDGA 4XMPH 5F21B 4PJHE 4A6YL 2OJEB 5CIPH 3VXRD 3JWOC 3NTCH 1ZLWK 4WV1C 3HAEA 5DO2C 4Z77B 4M3JA 4ZUUB 4XPTL 1TDQA 1A1NA 4H8WC 4M48L 2A1WH 5DJ0A 4LBEB 2BERA 3PQYA 4QHLB 4WI4A 4PP8C 1JJUA 5AYQA 3FQRA 1MCQA 2V5SA 5GGTH 5ID0A 4D9LH 3BT2H 2ZSVA 1AKJB 3L3DB 3WFBL 1N8ZA 3B9KA 4LEOA 1YEKL 2JB6B 3MRPB 5DFWH 1EMTH 3V6OE 3BGAA 4PRHA 5J9PA 3X14A 1MF2H 3JV6B 3KPSB 4TQEL 1T1ZA 5I8EA 3MUGA 4P59L 1KPRB 2NXYC 3O9WC 3ZKXC 3FN3A 3HI1A 5KZCD 1T22A 3RDTA 1A3LL 4LLUB 2HVKB 1YJDL 5DVKA 1F4YH 1Z5LA 4N8VA 1EHAA 3GSUB 2GAZB 5I1JL 2DD8H 5L88L 2UY6A 5MEPB 1YEDA 5F93C 5I19H 1RHHB 3R4DA 3T8XA 3WLBB 3EYVA 1OP3K 4YDIL 3IF1A 1MAJA 3FQWA 4UUJB 3EDEA 2O5XL 1VFUA 3SDCA 2UYLA 2XZAL 3HNVL 1EVUA 3QJHA 3GSOB 1ED3A 4KK9D 3HC3L 4KI1A 5E00B 5D5MB 5I18L 3PL6B 4JFFE 1EBPA 4P2QE 5GRVK 3KXFB 2QSTA 3OKDB 1CE1H 3O6MH 3NZ8B 5DJXA 1CYGA 1AR1C 3AB0C 1F11B 2AXGA 3ARGC 4PJGE 5EOQH 1ZGLB 1YNTA 1MHCB 1DBJH 4YX2H 3RUGF 3RU8H 3V6FB 3Q6GL 3GRWH 4L29B 4EUPH 1ZHLB 4YHNA 3D9AL 1RZFL 3D85D 1U8JB 4MAYD 5E94A 4OCWH 1ACZA 3T2OA 4Z6AT 1LEGB 2NY6D 5I1LB 4LDLB 1J1OL 4R2GC 3UTZA 25C8H 2HKHH 5SWZA 4S1DC 3R8QA 2FL5B 4RGMC 1DBMH 2EXYD 5SWSA 4GBXB 1WAAF 5C0DA 3V6OC 4F7PB 1TZHB 1R3IL 1U36A 2DKMA 1LQSR 5DR5L 4NRXA 4Q6YA 4BQ9A 3QDJB 1FO0L 3MBEC 5B8CC 4WNQB 1FGNH 2A9ML 1QZ1A 3QDME 2B4CH 1HYSC 1FG2B 3LN5B 5EB9A 1OY3B 2V7NB 4JZJC 1H3PL 1EO5A 4LQFL 3MO1B 4MXWH 1U91B 3D48R 3WXVH 3G6JE 4NQDB 3BZ4B 3QDAA 4JB9L 3W11D 2AJXL 1V7MH 1A7OL 1TNNA 3V2AR 1EUTA 2ADIB 2YMXH 5F44A 5CHNB 3RBGA 3D2UA 5GZOC 1EUUA 3OKLA 3TNNB 4X6EB 3RGVC 2JK5B 1JF6A 2VDLL 4ETQB 5B4MC 4RSVA 2NY0C 4K7PL 5L8KB 3MJGX 3OWEA 4BUHA 2ADFH 4F33B 3PXJA 4YGAB 4LCUB 3RNKA 4KRLB 1VKXA 1EO8H 1LEKB 5DGQA 1EFXB 3PG2A 1CDJA 1A7RL 3V4VL 4IJ3C 3TVMB 4NYLA 4LSUH 5LGHH 1A14L 1FZOA 1PKQE 1ODAA 1BVLA 1HILA 1UENA 1GHFH 1XCTB 3SDYH 2FR4B 5C09D 5IVZB 3TA3A 1RJYB 3PWNB 4MD0B 2BMKA 1KJ2B 1BHGA 1HXYA 4PYGA 3PHQA 4LDOB 2ICCA 1A7NL 4AT6A 2W9EH 3RZWA 1JYWA 4LF3B 3JV5A 1I8MB 3V8CA 1JGVL 1DP0A 3KPPB 5GGRA 1LO3H 1NAMH 2R8SH 2DTSA 2PXYA 4OZ4A 1P84K 4X9HA 1G9MH 1F3JB 5E03A 2CDGA 3ARDB 1CDYA 2HT3D 3E8UL 32C2B 4DGVH 3B9VA 1XCQA 3F7PC 3ZE1F 4Z5RA 2D7QA 4OCRH 2H6PB 3FRUA 4LCYB 5D7IB 5FHBL 3JTCA 1TCMA 3PP3H 1EK3A 5JHDB 3ZE2F 2APWA 2VB5A 5E2VH 1A1NB 3CX5K 3KR3L 5DJ0B 2X4SA 4PJFA 3ROLA 4BQ8A 4EBQH 3UXFA 4P9ML 5F9AC 1HQRB 5TF0A 4RCAA 2FWOB 1UEYA 4KDTC 3GSXB 3IDJB 3K7UA 2YZ1A 4LSDA 3U1SL 3WBDA 5FYLL 2NY2B 1HZHL 1FYHB 1CD8A 5E8PA 4MJ2A 5JPNB 3V7AG 3HC0B 3QB7C 5I8EB 1G84A 5JW4Q 4TPRL 3KYMA 3LAFA 3RDTB 3MV01 2A9NL 4X99B 1J0JA 4RFNB 5A2FA 1CU4L 2J8UA 3QI9C 5E7FA 5DUPH 1HNFA 3BN9C 1CFVH 2N7AA 1RIUL 4JFEB 5CP3H 1O5DT 3H9HA 1S7TA 3FQWB 3ULVH 2RHEA 1ZT4B 3MTRA 3QEUB 1H3TA 4HGWB 2Y4SA 5LBSH 3F7QA 4JQVA 4PJCA 1FJ1B 3Q5YA 1JNHA 4G3YH 4XP4H 3ZMRA 4TSCL 5LQBH 4YHPA 2CLVB 5H94B 2YRLA 1KB5L 2NXZB 3FFCD 1H3WM 3EOAB 1CXHA 3VGAB 4ZFZA 4DFHA 4YHNB 2CRYA 1CTOA 4OZIF 3TYGH 3K8MA 5HBBA 5GSRB 3TO2A 2DI9A 3HMWH 4P48A 3D39E 1LNUA 1TMCA 2BRQA 4OLYL 3UTZB 5SWZB 1HHKA 3IFOA 1UM6L 4WFHD 4XB8A 5SWSB 4JDZB 5F9JB 3MXVH 5DVOA 3DV4B 3RFZC 5GGVL 2WNGA 3O8XA 1AQKL 5E08H 3GMLB 1P9MA 3QSKB 1CICC 1UXWA 2EC9T 3K8LA 2J4WL 5E6IC 4B0MM 5E1AA 4HJGA 5IGXL 5HHXL 2F5BH 4HH9A 2PO6B 3UZQA 2AQ3A 5E2UL 4P9HH 2APTA 1Q0XH 3ZDZE 4POUB 4MNHA 5DHXB 4AK1A 4JFHE 5HVHB 3DO7B 3HN3A 1T5XB 4I4WB 1NCBH 2MQ0A 4CVXB 3A6BL 1FYTD 1OAZH 4RGNB 1VADB 3C8HA 1CFNB 1HH6B 1MPAH 4OF3A 3LKPA 2ZCLL 4ZFOA 4JHBA 4M6NL 3W9DB 4XNMA 4KKBC 3LQZB 1F3DJ 3RL1A 5E8NB 3GMMA 1SYSA 3LQAL 4MA1B 5C9KA 4NP4H 2VH5H 3FO2B 1Q9LA 4HPOH 2HFGH 2NY5H 3L3JA 1PVHA 1UCBH 4YGVA 5IVXE 5GRYA 4JZOA 5HYSG 4NM4H 2B0SH 4DZ8A 3BDBA 1ZHBB 3GDBA 5BVJB 4S1QH 1V3KA 2EDNA 3MLVH 1NFDB 1AGFA 4LCWE 4EOWH 4ZUSB 1HK6A 3MJ8B 3SPVB 1YN6A 5BOPA 2B5IC 4HXAL 4K07A 1J7VR 5F8RC 1HKFA 1HXYB 3BEWB 3MNZB 4KY1L 1J1PH 5HDBE 4AT6B 2L7JA 5F1NA 4NFBA 4UILL 1BVKA 3MLWL 1RVFL 5I71B 1G0XA 5FGRA 4EDWL 5F3BB 2IPKA 2BVTA 1FVEA 1AD0B 3V4UL 3IU4L 2EDRA 1FFOB 1MJ8H 2BP3A 3PHOB 4ZFGL 1A4JA 3FJTA 3T1WA 4PRNB 2ZUQC 5KSUB 1I1AC 3GMPA 4QHUB 5J1TC 3ROLB 5IT2L 1WBXA 2JJSA 3NCBB 4LPVA 1MWAB 4YHLH 1CQKA 1XR9B 2VLJE 3GJEB 3S4SG 4WW2F 5CLTA 1WQVT 1F2XK 2HT4C 3PABB 2R0LH 4YO0A 5C0FB 3ILQD 4X7SL 3FTGB 5D70L 1FLRH 4Y1AE 2ZNWA 4RGOL 4UTAL 1BFVL 5CBAB 2CKNA 1S7QB 4WWKA 3GMRA 1WIPA 3S97C 3SEPA 3C2AH 4G5ZL 3MV9B 2R23A 1RJCA 3HE7C 3V9FA 3OXSA 4G8IB 1IAMA 3K80A 4Y16D 3CVIH 1VDGA 3MLXH 5CZXD 1I8LA 3BQUB 1OT2A 4L8DB 3LKNB 4NCDA 4ZDHA 2Z93A 3F58L 2OSLB 3MPCA 5DSCB 5F1OB 4C83B 3VD4A 4FXGB 1IRAY 4IOIA 1I1FA 4QRSA 2F54E 2EZ0C 4G6KL 3H9HB 1BJMA 4FABH 2HFFA 1KIRA 3B3IA 5LWYH 1JYXA 4GRLA 1EO7A 3ARFB 4RWYH 2CLZA 2IAND 3RX8A 3TJEH 3MLZL 1ZEAH 4QOKA 3MLRL 4R96A 1KEGH 4LHUD 3PJSA 3CSGA 4PR5B 1JNHB 1INDL 1K8DB 1DJSA 4WDIA 5HGAA 2QQKH 3ZDYF 3D0VB 1A9EA 2WP3T 4BZYA 2VABB 5HHOB 1MVFA 4WFFE 4BKLB 2AABL 5FM5M 3QH3B 4X5WB 5F6IC 4YXLH 4PPTA 4NQED 3QAZC 4NGHL 4MS8C 2ILLA 3GFUA 1YMME 3IB4A 5H2BA 1RUML 4HEPG 3TO2B 3VG0L 1XIWC 3KJ6L 3O6LL 1TMCB 5T33H 5BJTB 3ZL4L 3GSNL 5GGUA 1LVEA 2IF7A 1ZXQA 1IFHL 5D2LA 5BXFB 5TJWK 4ELMB 3VXRE 4OZGE 4MXVF 5C0CE 4ZS6C 2NLJB 1FO0A 5E1AB 5KBNC 1Q9KA 5HYSB 5EC2A 3V0VA 2IAMD 1S9WA 4KDWA 1HCVA 2HKFH 3EFFA 3SKNB 4D0DA 1NC2A 3TO4D 4PJXE 4MNHB 1BLNA 4N0FA 1NFKA 5KSAB 4UOW0 1HXMA 2E7MA 2PYFB 2M26A 4OLZL 3JV4A 2RQ8A 3DUUB 4I3SL 3C5ZC 2B1AH 4XP1L 4HWBL 4Y2DD 3SY0B 3UTSD 4OQ1A 2VXQH 3DRQB 1YNLH 5FO7A 2YPLD 1KXTB 1MRFL 3S34H 2DJUA 5BQ7B 1BECA 4HJJL 1DLHB 4E0RA 3GJFB 2FEEL 3PGDA 4QHMA 3WIIH 3CFEA 3VFGL 1RK1A 4OAWA 4U1IA 4UT6L 4FZ8H 4J3UA 5D6DA 1CXIA 5EO1A 4JFDE 3VXSA 3A0OA 5K9OB 1E27A 4PBXA 4U7SA 1XGTB 5I1AA 1NMAL 3PWJB 2I24N 1YEIH 3DVNA 3WS6A 1S9XA 5IEKA 1KTRL 3WKMH 3VWJD 5FV1L 5ITFA 3REWA 4EI5A 1X6LA 1EDQA 1HWHB 1KTKE 2IQAA 3WUZA 3S4SB 1NGWA 2BNQD 2JIXA 5I66A 1QFPA 5D7LE 4UZGA 3EYQD 1YEFL 3U7WH 1LEIB 4LKXB 2B39A 4M1GL 4RMQA 4NZRL 4HIEA 4ALAH 1J8HA 5J6HA 3EYFA 3HKFA 2DMCA 2VXTL 5TE6L 3STZA 5CD5C 4IRZH 3RKDC 3FONB 2ZSWA 2B4CC 3KLAA 2OJZH 1ZLWH 4R3SB 1FVEB 1QFUH 2CUIA 4GG6A 4BM7A 3LD8B 1SVCP 5DA0B 3BP4B 4A6YB 1A7PL 2DQTH 3I2CL 5JW4M 2X42A 4GRWB 4EQ2A 4I18C 3RGVD 2FATH 4P2OB 3EOTH 5DUBB 3AMLA 1IAII 4YC2C 5JO5B 3H0TA 3RWFA 3VXQB 1WBXB 4F7MA 1JRHI 2BK8A 1OWRM 3NMEA 5DYOB 4MMXC 3BPCA 4NO3A 4ZUVA 5AWNL 1UFUA 4ZTOL 4ZO9A 1L9MA 1NCDL 2D31A 3FT3A 1Q9OA 4NO0D 5EFIB 5ERWA 3QUKB 2HTKC 1X5KA 4U6YB 3BP5B 1Y6MR 4O2FA 3WNOA 1H5BC 2G75A 5J06A 4JKWA 4Y5VA 4JFFA 1RV6X 4NJ9L 3EZJB 4PJ7F 3LKOB 2Z93B 3OG4B 4PJBE 5C6TL 2QQLL 1INQB 1JTTA 4XZUA 1I1FB 1OP3H 3WLWC 4WEMB 2EEBA 1T3FB 5CEZL 2VDOH 4O4YL 1S5HB 1P5VA 3ULVE 4DKAA 2VLLB 3CFDB 1OHQA 2F5AH 4CJ1A 1H3VA 4YUEL 4PJAE 1X4ZA 1TJIL 4XNZC 5D7JD 4FQHB 2DWDA 4QOKB 1FH5L 1G9MC 5DC9B 4XMLH 2PCPB 2OR8A 3VWKC 4HZLB 3IFLH 2OI9C 1QPPA 2XG5A 1GZQB 3QUXA 4DN4L 4J6RH 5HGAB 1A8JH 2HFEA 1NMCC 4GLRH 4F3FB 2AK4D 1KEML 4Q74A 5IQ9A 3N9GL 2H32B 3BYTA 3NCMA 1BFOA 1KB5A 2ZUSA 3TWCH 3KPQB 2F58H 4PJEB 4CMHB 1WC7A 1U8IA 4WUUD 4HXBH 3G6JA 2CGRL 4HKZA 1GGIH 3U7YH 3MNWB 4PV9B 4NNYB 1OAUH 2HRLA 5F7EH 5D8JH 1DFBL 5GGUB 4M8QA 4JKKA 1M71A 5C0RH 2DM3A 4R97B 4Y4KD 3S96B 4XCCL 1OQOA 4TSAH 5CBEB 2ZUXA 3V0VB 1MLCA 3WFZA 3O4OC 1FL3A 1NC2B 5EZOL 1D5BB 3BMWA 5EU6E 1YN7A 4I9WD 3T2NH 4QXUL 3WO3B 4G8FA 1MJUL 1YEHL 4BSWB 5ICXA 4XPHL 3BP7A 1HXMB 5T1LB 2NY4B 2R0ZH 3JV4B 4Y4HC 2PYED 4LNVA 1WZKA 4BZ1H 4F80A 3Q5TA 3ARBD 3ULVC 3O41B 3JTSB 3DYPA 5BVPL 2H2PD 3HE6C 3QQ4B 3MV7A 3VFNA 5TF1L 3SDAA 3ESVF 3UZVB 4MA3B 3KG5A 3QXUA 1YY8A 3LPGA 4R0LC 3UAJC 1MRDL 5MENE 4ZD3H 3UC0H 4H5SB 2LE9A 3RWHB 2IPTH 2HMIC 4IOSD 1K4CA 3DMMB 1J0KA 5IUSA 3FO9B 5KSBA 3QWRD 4GW4B 4Z7VA 2GK0B 3CSYB 5ALCL 5MP6H 4F9LA 4MNGE 3CCHA 1T0NB 4K3GA 5KAQG 1RMFL 1GC1L 4LHJB 3BRGC 5IROA 3T77B 4JR9L 3ARSA 1CQYA 3QYCA 1CICD 3HNSH 4HKJA 3RVWC 2NNAB 2E7BA 5D1QB 1TVHA 1UACH 3WHE0 1YNKL 2ZJSH 2DQCL 4PGCB 1NCNA 3CGTA 1EAPA 1SJHB 1WCQA 5J6HB 3FRPG 2G9HA 2A83A 2FX9L 5KG9B 5HVGB 2IH3A 4IRJD 4L3AA 3FFCE 4OLWH 2KKQA 1GIGL 1U3JA 4P9HC 1ZVSA 4E5XA 2CLRA 2BRRH 3I75A 3BKCL 5F6HJ 3EBAA 4H1LA 3ZHLA 1QKZL 4P5TB 1JHLH 1RULL 1H8OA 5FGCE 2CQVA 2WV3A 4MCZB 5DFTA 1J05B 3JVGA 4P5KB 4PD4J 4QT5A 3VA6A 4WFHE 4NCC2 3H0TB 1OB1A 4RAHA 4HGMA 3TN0C 2UVEA 4L9LA 3TESA 3NA9H 3U48A 3KS0H 1BQLL 5CMAA 4ZUVB 2EYSB 4AZ8A 4MVBD 1AY1H 3O2WL 1Q9WB 3CK0H 2NY5C 4XGZB 4IRSD 1S9YB 5KS9B 2BSSA 5SWQB 1DBAL 1CT8B 3FT3B 5FM4A 3BZFA 4K2UL 4AIZB 1TETL 4OCXL 1FYTE 3G6DL 4JY6A 1NLBL 3I85A 1R5VA 5IESL 2G75B 4NRYB 4QHNA 1PSKL 1G7PB 1ULVA 1DR9A 1FVCB 3LPFA 5T1DL 4OQTH 3OKKB 1JN6A 5ESVB 1FPTH 1ZWIB 4XZUB 5KOMC 1HINH 1RUKH 3C6LB 1PBYA 4ZOAA 3VFWB 4OV5A 4M93C 2LAGB 2FEDC 3QIBD 5D96B 4LVOB 3ELAT 5J1SC 3QIWA 3O0RL 1LP9F 3O3BB 1T21A 3D39A 5TDOB 1NUGA 35C8H 5I16A 3RUGE 3B9DA 1U92B 3MACL 2VYRE 3CPLA 4HBCH 3L3GA 1QNZL 3GMNA 2A6IA 5CGYC 3DROA 4XMKH 4LKCA 2OL3H 4JDVB 4MNQA 1UADC 1WAAE 4WWID 4R4BB 4KKCD 3QEHB 4O2EA 3FN0H 3U30B 1EA9C 1E4JA 1GGYA 3QO1A 1KLUA 1MY7A 2VIRA 2VO5A 3TV3L 3AM8A 3Q6FA 1ZS8A 5K9JL 3TFKC 1CBVL 3GSNA 1M71B 2I9TA 4HPYH 1FNSH 1V05A 4Z78A 1UJ3A 4D94A 5GJSH 4FQ1H 1UXSA 4X9GA 1HHGB 1BZ7A 3QEGH 2XNAA 1OTUD 5F7KC 1GOGA 2HFTA 1EJ6A 1RZIB 1NGPL 1JNNL 5IVXA 4GKZA 1FP5A 3BP7B 5SX4H 1RU9H 3THML 3S5LA 1BD2E 2DWEB 4X4YA 5MEOA 4N5EA 1FRGL 2I5YL 1XZ0A 1KJMB 3QQ3B 4PV8A 1JZ3A 4HWBA 4TTDD 3L9RB 3JUZA 5ID1A 1FL5A 1QPXA 2I60H 4P57A 4FMKA 5GSVA 2E7LA 3VFNB 4KI5C 1OAQL 5I15L 3NCFB 2GTWA 4JJ5A 2CR6A 4S2SB 2HA1A 3Q1SL 4HIJB 4HK0B 5GIRA 1UWGH 2Y5EA 2VC2L 5T5NF 3KYAA 4MS8D 4APQD 3VXMB 3KHQA 4PB9L 5ELIA 5IHUH 1ADQL 4JPKL 4EIZC 4PGBA 3RGHA 1XIWD 3GSQA 5F96H 4U1LA 4HIXH 4UV4L 4DK3A 3DTXB 4N90E 4OFYD 1V7NL 2FGWH 4GMSH 4NHUE 4FFWC 2IANE 1F6FB 4PY8J 3UJTH 5DS8A 1ZHNB 1YPZB 2HVJA 4L8BA 3RWCA 3HRZB 3IJSB 3ZE1E 2FX8H 2GJZA 3ULUF 1GVIA 4U0RC 3LRSA 1L7TL 3FQNA 3ZE0F 5HY9A 3ZE2E 2VLJA 4L8SA 3VXOA 1BGXL 4NQEE 2H1PH 5ACZA 3T2QA 1S9VB 1AI1H 1MCRA 4L4TA 4NRZB 4UAOC 5LAXB 3JWDC 4LPTA 3IFNL 5CUSH 4UTBL 4E41B 3E6HA 2H26A 2AK1H 1HYRC 2V6HA 3BD3A 1S7RB 3M45A 1N5YL 2VLRD 4QRPE 4U1KB 1G7QB 2DOCA 4XBGB 2B2XH 4JDTH 1OB1B 3QDHA 3L95B 1QG3A 4XPBH 3RKPA 4L9LB 1BAFH 4FQPA 1VESA 4XNXH 1KTDB 2WBKA 1I1YB 2AXHA 5CGMA 4LK4A 5EBMB 3HI5H 2A2QT 4P2RA 5JDSA 3WFEL 1Z6JT 2VXVL 5FYJU 4Y5XA 2BSTB 2BSSB 4QWWC 4QHKJ 2CRZA 3QFJD 3UTTD 4C56B 1IAKB 1S7WB 1R6VA 1HHHB 5INDA 5C8JA 1WBYA 3QUYB 3UTSE 3MGTA 1DBBH 3ZTNL 1CVRA 1EIBA 4YDVA 3FT4B 2E3VA 4JFYA 4NHCH 3FQUA 4G8GE 3QBTB 1F4WH 4B7LA 4KK8C 4L3CB 4Z7OE 5ETUB 3SGKC 3AGVA 1FNLA 4G42B 5FYJH 2XWJB 3EO9H 3IETA 4FFZH 2ORBH 5AZEL 4MJIB 5EORH 4NQUA 5GGRY 5DEFB 4IIQA 1P7KA 3UPAA 3KYKH 2FBJH 2FO4A 2JJVA 4S10A 3H3BC 3O2VH 5F7FA 4OZIE 3TM6A 4OGAD 4P3WA 5F9OH 4X6BA 4J8RB 3X11B 3VXRA 3L3GB 1YECL 4OZGA 3DROB 4LKCB 2KQMA 5I17A 4I3RH 3B6SA 4K3EL 4OSUL 1FAIH 5I2IA 2X7LB 4PJXA 4ZAKB 1OTTD 1A5FH 1G6RL 4NQCD 3U0WH 4Q9CA 5IK3A 3CU1A 3F65A 5ABDE 5DUML 2WAHA 2D7TH 1MJ7H 3C09B 1OGAE 3WS3B 4HDIA 3IS1X 4XPFH 2EIEA 4DGYL 2BC4B 1R5IA 1LWRA 4J4PC 3E2HA 3LV3A 4Z7NE 2EKSB 2VE6A 4TRPL 4K3DL 4XC3H 3LEXB 5E8DH 3OZ9H 1AFVH 1T2JA 1BJ1H 3NACL 3MRHA 4YH6A 4OJFL 5ESAA 4NNPL 4JM2D 3GK8H 4YE4H 2X4UB 4X80L 1LD9B 4PV8B 3QIUD 4KGJA 1JGLH 3VCLB 3FT2A 4OKVA 2G60L 3DIFB 5GS0H 3VGEA 4PG9B 1D6VL 1H3GA 1LK2B 1FBIL 5HDOA 4UIMA 1HIML 1VHPA 1SBSL 5E4EB 43CAA 5IQ7L 4DGIL 3B2VL 5EA0L 2XACC 4R8WH 5C07D 4KHXL 1QSED 5I74C 5I1GH 4PGBB 4ZPVA 2FX7H 2P45B 4ZXBB 1SQ2N 2KBGA 5IG7A 5DVMA 3TEUA 4JQIL 2R1XA 1B4JL 2O93L 5HHPB 5E95B 1NBZA 1WIOA 4XAKE 1I7ZB 2CR3A 3WDHA 4KZEH 1I9JL 3D85A 4MAYA 4MHHI 3STLA 5E6ZA 2Y7QA 3KPTA 4L8BB 2ESVD 3IDGA 3WIHH 4AEIH 4PG2C 3CLFH 4PRIE 1QEWA 3EGSA 4M3KB 1MNUH 3SDDB 5D5MF 4XX1E 3K2UL 3MCG1 4BQBA 3ECBA 4OZHE 1ZLVK 1N3NB 5C08B 3WUWG 3CFBA 4K7FA 4D0BA 3CVHL 3L3HB 1NBVH 1Q1JL 3EO0B 5TH2A 3E6HB 3MCLH 2WUCL 3KPNB 1AP2A 5LCVH 2PW1A 5GS1C 1E0OB 2QQNH 1D5XA 4DWHA 1LE9B 3NABH 3U4EA 1FV1A 1BIIB 3MRRA 4UIKH 1FSKB 5C0BB 2VRAA 3DETD 1KELH 3VGAC 2V2WB 4PJ8D 5E2WH 3FQTA 5ANME 5J12C 1AO7B 2BDNL 3K4ZA 3RWIB 3PWUB 2E5EA 5DD1L 1RHFA 4CNIB 1KBGL 1XR8B 2BOBB 2C1PA 5BV7H 2IJ0C 4JO2H 4PJAA 4M62H 2OZ4L 1GOFA 1N2RA 1KCSH 1PX3A 5DD5L 4HKBA 4F57L 5K9QG 4F2MA 2PYEE 1L6XA 3OX8A 5E7BA 5F7WC 1A21A 3QPXL 2VN4A 5JR1L 1JYVA 2BHUA 2EYTA 5CJ5A 3QUMH 1ONQB 3TT3L 4RIRB 3TP4A 1FNAA 1HH9A 3B2UD 5C09A 4XP9H 3RWEB 1ZSDB 4IDJL 4M7JH 3IDNB 4Q97A 4Q0XL 5CJQL 1VB9A 4F8QA 1QR4A 2ZUWA 1EGJL 4QF1A 3ZDYE 4TVSa 4GSDH 1UQSA 5DEZA 2R56L 1PQZB 3ARTA 5EDXA 3BDYH 4M7LT 4YXHL 1II4E 1S7VA 4HF5H 4X6BB 4EDXA 2ZKHL 1VFAB 1W8OA 2HH0L 2P5EE 3QFDB 4NN6C 3R1GH 2EDHA 3PWPB 2YPVH 3B6SB 3A67H 4RFEA 4K71B 2DQFA 3H6JA 1RZ8B 4MXVE 5JIIA 2HLFD 1ZLSH 1XF2B 1HSBA 3SOBH 2X9XA 3LIZH 1KIPA 5KANI 3FO1B 1ZKAA 1T7WA 5KVEL 3T0BA 1AHWC 5BS0B 3M1BA 4X4ZA 4JY5L 2NY3C 1GGTA 1Y0LB 4LRIC 3BKMH 3LPWA 1H0DA 2QJDA 2ITCB 4O58H 2BNRD 6FABH 4GXVH 5GS2H 5EULV 1T03L 2ZG1A 5DJDB 2ZOLA 1UKQA 5M7QA 4RZCA 5D7IF 4RAVB 2RCSH 5HGDA 3MRHB 1NBYB 5EBLB 1JWUA 4X6DA 5EPMA 2R2BB 4OIAA 5F7MC 4JHAL 5F9DC 1P53A 4O51A 3VFPA 2E8ZA 1E28A 4KC3B 3GI8H 1UB5A 5DRNB 4MAUL 1IBGL 4XWGL 4MNGA 1ORSA 4I3GA 1RIVL 2KDGA 3KLHC 1MCEA 4EN3B 1RK0B 1EZVY 2DQDH 3HS0B 4HJ0C 4CVZA 1MY5A 2GCYB 3FMGH 4G7VL 3FB7B 2E27H 4OI8A 2OYPA 5EZLB 4W6XB 3RVVD 2A6DA 3C8KB 3MLSL 2XWTA 4M5ZH 4QTIL 1WJ3A 4BFBD 4HC1H 3WUWB 4Z0BL 2EE3A 1NLDL 1RURL 1ADQA 5A3ID 1KGCE 2IFFH 5JA9A 1H8SA 3KJ4C 5GGQH 3ULUH 4TSBH 4HK3J 3MRMA 1X9QA 1WCBB 1KCKA 2Y7QB 4OLUL 4KAQL 3LSOA 3MRBB 3P4OA 5CWSA 5E9DB 5ESQA 1IGIL 1RZJH 4NBZB 1QEWB 1ZANH 2V9QA 2VQTA 5ENWA 1G7MA 1ROWA 1AGBA 3ARZA 3EYSH 3T0AA 3TJHA 4FNLL 5CGTA 1NUNB 1I8IB 5JOFB 4PB0H 3EKCA 3B43A 4NQVB 4ZUTA 1Z0MA 4LLQA 2AV7B 4M6OH 4X6CA 1X5AA 3IGAA 5BRZA 3V5DB 3RTQB 1GJIA 3QUZB 1LO5A 2DTMH 1FYTA 2BY2A 1EHNA 2X70B 4MA7L 2ZUVA 5IBLC 1AKJD 2AI0H 1JCKA 5IWLA 5TE4H 1JWMA 1Q94B 1FNGA 2QHRL 3S3JA 2C4FU 4OGXL 4NKDA 1ZA6B 1SEBB 2C9AA 5JLZB 2W9LA 5C2BL 4EIGB 1DEEA 3KPSD 1CGSL 4K7PY 4PJ7E 2O5ZH 1NFIB 3T09A 4ZFFB 3IFPA 3O2DL 1IAIL 5T3ZD 3ERYA 3P4MB 4M7ZC 1M4KA 3O45B 4CW1B 5GHWH 3BVNB 1BPVA 2AEQH 1TZGH 2UWEA 3W0WB 2ATKA 4NUJA 2CJUL 3QZWA 4UNUA 1F58H 1KJVB 4EZMA 3TF7C 3TT1H 4GKSA 4WEUD 4P4KC 4D9QD 3N85H 1MHEB 1QSZA 1RIHH 4GS7B 4JREB 4KGLA 5TPWH 3QNZA 5HDQL 1NCCH 2V5YA 1UVQA 3L5JA 4ZNEA 4DVBB 2FHFA 3GO1L 5I9QC 1WAAA 5FYJE 1A1MB 1F6AB 2FIKA 5HGGS 4JPWL 3RWGA 3UMTA 3V0WH 3HI6H 15C8H 1DQDH 4ODHL 3MBXL 3PL6D 1UQSB 3WFHB 4ONHB 4LOUC 3KXFD 2P49B 4G9DB 3GM8A 4LHQB 1UM5H 4AH2A 4F9PA 1IKFH 2I27N 4I0PB 4GLRI 2FDBP 4Q9RL 1NFDF 1C08A 2GK2A 2V5TA 3NCYS 5B39A 4Y5YA 3MOBL 1INEH 3GHBH 4KZDH 4X5XA 2MHAB 2CD0A 3RWDA 1RZGA 4FZEL 4HX1B 1DVFC 2G5BB 3CZFA 3HUJB 1G6RA 1WFUA 4GBXD 4FG6D 1KIPB 3VG9B 4Y19E 4NN7C 2R9HD 1D9KC 5TE7L 3QDJD 4NDMA 5HI4D 1FDLH 4KJYB 4G6ML 1MAMH 2H9GA 3LN9A 1J9CT 4MJ6A 3TBVA 1H3UA 2C3VB 2YC1A 1H0DB 5DHVH 1B4RA 4N0UE 1HOCB 1ND0B 4NQDD 1IGCH 5AYUH 1JPFB 4KTEH 5LXGL 2CIIB 2EC8A 1JZ7A 4AG4H 4NSKA 2LU4A 5BZDB 4BUGA 4H26B 2R4SL 1KN2L 4QXTB 3TGXA 4BFGA 4Y16A 3WN5C 4D0CA 5EOTB 4QGYA 5IIEB 4XVSL 2XTLA 3T1FA 3NPSB 3A6CH 4TUKH 5F7DA 3C9NB 2M1KA 3SKOB 1I7UB 1E28B 2BY3A 1UB5B 1CR9H 5FOJA 4NWTH 3CFJB 4N0CD 4UV7L 4WI8A 2FJGA 3MJ7A 4YWGH 3HZMB 3H9SB 2IMMA 1QLFB 5TGBA 3L3KA 2A74B 4WO4C 3UTTE 4ZSOB 2IANA 1L0QA 1DUYB 2VDRH 5DD0H 1CN4A 3HCVB 1EFXD 1ERNA 2WWMC 3KYOB 4Z18A 4LHUA 2MJWA 3TVMD 2Q7YB 2A6DB 3AMKA 3IU3A 3PGCA 5D1ZC 5J4MA 1BFSA 2J88L 4RDQG 2XQBH 4PRDA 1U93A 1TTGA 3OL2A 4Q2ZA 3V8OA 5ITBH 1LO0H 4D8PA 5DQDH 4G6AD 4HUMB 5TDPB 4Y4FC 4NQEA 4OZFH 3HZKB 4L4VB 4GMTH 1S9KC 1S8DA 3KPRB 3G5VA 4LASL 4PY7B 4G9FB 4ZS7H 2NY7L 4BZ2H 4A2MA 1FQ9C 1YYMH 4I5BA 4M8VA 3ARDD 4HS8H 8FABA 5ENWB 3ET9F 5GGVY 1C5DA 2R0KH 1AGBB 2NR6D 2XN9B 1X5YA 5D71L 1N6QH 2JCCB 1RZKL 2IAMA 1RY7B 3IDYC 5JHDD 2FYYA 4LLQB 4J2XA 1S7UB 4FFVD 4ZOBA 3OPZL 2EDJA 3IGAB 5BRZB 4KROC 1LO2L 3CVHA 3IDXH 4JM4L 1KSRA 4NQXB 1QBLL 4YDLC 2KH2B 3GUTA 3RIAK 3RWJA 1QYGH 2BCKB 4R4FH 4Y2DA 1DEDA 4Y89A 3BKYH 2DLFH 5GS0C 4XMPL 2YPLA 2NY2D 2QADB 4JRXE 2X4NB 2XPGA 1C12A 2P8LA 5CJOL 3BIKA 4ELMF 3RZCC 4KJQC 3MGAA 4HHAA 3IFPB 5L7XL 5HI5D 3MRQA 1I85A 1I7TA 4HCRL 1T1YA 2V2XA 2OZ4A 2XA8L 4JRYE 3BZEB 1TQBB 3BT2L 2EICA 2UWEB 1A3RL 3CFKB 1NAKL 5L2JA 1CXFA 2FJFB 4D3CH 4DKEL 1LP9E 2Z35B 3MRIA 2AJ3A 4JFED 2KQNA 2Y72A 3N0PB 1KLFA 2CO6B 1JK8B 3IAQA 3VWJA 1CLCA 1MF2L 2P8MA 1RUQL 5EC1B 2F8VA 4LU5H 4YNYB 2BNQA 1D6EB 1IM3B 3BO8A 5EUOA 1CFQA 2R2HA 4XRCB 5EO9B 2X4QA 1EGJA 3GBML 2UV3A 3VW3L 4IHOB 1HI6A 4I48A 5C0GB 1KXQE 5D6CB 1KXVC 3MV8E 5TFSH 1CE6B 2GTZA 1QO3A 4KPHH 4WUKL 4ELKA 2IH1A 2NXZD 2YA1A 2R69L 1T6VN 3MOAH 3RGVA 1F45A 3QCUH 5B39B 3DMMC 3HFMH 3VXUB 5KJRH 2ESVE 4OKDA 1DANU 1U41A 4X5XB 1C5CL 5JOPD 1EEZB 4V1DE 4M1CC 3RVUD 1NEZG 3CZFB 4WU5B 5I73B 4YHKH 5C6WH 1WITA 3SN6N 1CWVA 5EOQL 3HAEH 3RX5A 3T4AA 3PWLB 3TBVB 4ODUB 4MJ6B 3SE8L 2PO6D 3GRWL 3DGCR 2X2YA 1WTLA 2YHGA 3FB5B 5BV7C 4BFIA 4NO0A 2GSIA 3BW9A 4HUNB 2D9QB 2WBJC 1KN4L 1PFCA 2VLKB 4U1GB 5IFHH 3UJIH 1GH7A 1LGVA 3DUSA 1WBZA 1G9EA 1RZ7H 5SX4I 4OCLC 4GRWF 5DZOA 5D72L 4RGND 4D0CB 5JW5A 5C9JA 2XKNA 3HR5A 3T1FB 3H3PH 3T04D 4F58L 2P4AB 3UBXA 4WI7A 2VL5B 3NFSH 4OIIL 4JN1H 4WIQA 4Z7WB 2B4CL 1EBAA 3S6CA 4LL9A 2Y06H 3MJ7B 4FQCH 1I9RL 2VAJA 3QULB 1JPGA 4G80A 4WV1B 5B38A 4P49A 4ZTPH 3QXDA 3N06B 5I30H 4PDCE 4X7TB 1TNMA 4JFXB 4UDTA 3C5SA 3VJ6B 1FZKB 1YDPB 5FO8B 1I9EA 3RI5K 2AK4A 4PRDB 5T3XH 1A6ZA 3HZYB 1S5IH 1P5UA 4KDTA 3ULUE 3IJHB 5IB4A 4ZYKB 1OAYH 5EO0A 3EJYD 4Q9QH 1OD9A 3RA7L 1KCVL 3ZE0E 4WW2A 1B3JA 1KOAA 1S8DB 3L7EB 4M6MH 4WUUA 2HAZA 5KVGH 4FXKB 1EO8L 1UB6B 3WD5H 3I9GH 3OKEA 1Z9LA 1T7YA 2W9DH 4LSUL 2Y36L 2NXYB 2VDPL 3FB8B 2ENYA 3O9WB 3S88L 3ZKXB 3MLUH 4RWHA 1ZT1A 4H88H 1MCLA 5B38G 4Y4KA 1ZLVH 5DJ2A 3SDYL 1J10A 4U6XA 4YBQD 4YHZL 3TZVC 1KPUB 4C4KT 4LSPH 1VPOH 3K46A 1FVDB 1S78D 3GNMH 4OCYH 4LLMB 3CH1B 4RMSA 2FSEB 4AENA 2R8SL 2DM7A 1BOGA 5DDHA 4PJEF 4XBPB 3GUTB 2EH8H 2VDQL 2AJZA 2YK1H 3PV6B 2PYEA 3U36A 4V2CB 1NGZA 3A6OA 4DGVL 4K94H 1QLRB 5DJAA 3ARBA 3OKOA 4OB5H 2WWKO 1LDPL 4PJHB 2BNRE 3RIAF 1U8PA 3SE3C 3AB0B 3JSSA 3BIKB 3ARGB 5DJ8A 2DKUA 5CEYB 3MV9D 1JPSL 3T0XA 4LPWA 3MCKA 3O2DA 3OMZA 2V2XB 1IM9B 3MLTB 3BQUD 2FJHA 1IMHC 3QWRA 3D6GA 4R2GB 4HLZG 3ULUC 3RVTC 1YQ2A 4RGMB 4LRNH 1VFMA 1E4XI 3BH8A 5JA8B 3PP4H 1KCLA 3GIZH 4XC1H 2COQA 4U1SA 2F74B 1NEZB 4CN6A 3ARFD 4TVPH 1CICA 3UO1L 3MBEB 5B8CB 1KENH 1PG7X 3DRTB 3IKCA 5DI8A 2BNQB 2XRAH 3BI9X 4M1DH 1S7SA 5EUOB 1RZJC 4JZJB 3D5OF 2DL2A 3O3EB 5JXED 4GAJL 4LSTL 4OGYH 4KK6D 4DW2H 4FQ2H 5BZWB 3K1KC 4IRJA 2GTZB 5HHOD 5A16A 4JFQA 3TIDA 3VXTB 4QY8B 5FA4B 2N4IA 4ELKB 2R39A 4WY7L 1FE8L 2IH1B 1P2CA 3BJ91 5CILH 2DMBA 5D2NC 1NC4B 1OD7A 1F8TH 4ODBD 3RGVB 5IHBA 3JTTA 5H8DA 2EDQA 4WRLA 2NY0B 4P23C 1S3KL 2K3TA 4WTXA 1P4LB 4N9GA 1U6AL 4MDIA 1YEJH 3QRFM 3U46A 2CXGA 1OCWH 4P2QB 5EUKA 4P46C 4DK6A 2A0LC 3D3VB 4XPAL 1XF5A 1JGUH 2GITB 3WFCH 4IJ3B 3L6FB 4X8JB 1MFBL 2O61B 4PJGB 4XBEH 5IMMA 3TNMA 2YOCA 1FNFA 2VZ3A 3RL2B 1U2CA 1U8OB 1MQ8A 2GSIB 4LARL 2R4RH 3BW9B 1I3VA 4GG6F 2V9TA 5KSAD 3MODL 4HKXB 1AXTH 1FNHA 1WBZB 4TUJB 3P4NB 4RA3A 3ILPB 1E6JL 2P47B 4FFEX 3I50H 2P46B 5AD0B 1F90L 4OLEA 2B7DT 1NUDA 3HC4L 4R7NB 3KPSE 2ICWI 2XOTA 3SCMC 3MRJA 1MHHB 1CGYA 2V5MA 3QDMB 3R06A 2QHLA 3NIFF 3QIBA 4DKFH 5MHSD 2EIZA 1CZ8H 3WL9A 2AJYH 1TIUA 5T3ZE 1JYNA 4YK4C 2X4PA 3S37H 5ALBH 1FNEB 1ES0A 1G9NH 5ISZE 3SGJA 5B38B 5JPMA 5ADPL 3LHPL 1GRWA 2RB8A 4XP5L 2VDKL 3S36L 5I1IL 5FYKD 1KYOJ 1Z9MA 5IHZB 2I07B 2X4TB 3B8YA 3ZDXF 2H3NA 4WU7A 4XVTH 3UTQA 3S9DB 5KTEL 5FK9B 4TULH 1JUFA 4XCNA 2HFGL 2NMSA 1T66C 2OK0L 3WNPA 1BWWA 1T0MB 3QRGH 2P8PA 4O5LL 5JHLH 3OKEB 4NM4L 1EZVX 4PS4L 5IB5A 3KXFE 5SV4A 2OP4L 2JJWA 3MA9H 5IEHB 1MCPH 1HWGB 4MD4B 4PREB 4FQJH 4U1HB 1CLZH 1OAKH 4O9HL 3GZKA 4K8RD 3HPJA 3X13A 2Q76B 4EOWL 1PKQB 3VD9A 4FQXC 3SDXB 1C1EH 5J6GB 3QI9B 4NT6B 2YD4A 2W59A 5C0ND 4NO2A 3QQNA 1MCOL 4P2OD 4I77H 3V4PH 1OSPL 3ZTJH 4F15C 2ED8A 2EXWC 1GXEA 5IJVA 4LSQH 1NDGA 4PFEA 1NGZB 4XH2A 2WWMD 2F19H 4K55A 3CDYA 3F7YA 3REVA 3VFRB 4GAFB 4JG0H 3CXHK 5TQ0L 1F4HA 5H35B 1FN4A 2YBRA 3WJLA 4FQLH 4PUBL 1D5ZB 4J12A 3WSQL 4LLVA 4FFYH 2D7NA 4BH7B 3QEQE 1B2WL 1TVBA 5I1HH 2VQ1A 4MS8A 1OOAA 4APQA 3MCKB 3WEXA 1HSAB 2VTFA 5FYKU 3ZHDA 1T5WB 4HCRA 2FJHB 1IGYA 2C3GA 1XIWA 3WJJC 1NDMA 4W6YB 1BQHA 4HWZB 5D1XC 3ROOB 1YEGH 2XG4A 2Q6WA 1PG7H 1U8HB 3BH8B 2OXHA 5KAQF 4OFYA 5DK2A 3S7GA 4AL8H 4OLVH 4U1SB 3SJVB 3ABZA 1DQLH 3C2AL 3L5XH 5E6IB 4ODSH 3ZSTA 1OF2A 1HHIB 5I1CL 4K7PX 4QOKD 4QXWA 4XCFH 2DLTA 5JNYA 2ZPKH 1KC5H 5DJ6A 1E4KC 5HI3C 3CVIL 5JUEH 1R0AH 5A2IH 1U8QA 4IDLA 4OD1L 4N8CH 1XF3B 1MVUB 4DAGL 1Z0NA 3SO3C 4Q6IA 1WEJH 3W2DH 7FABH 4KRNA 1J0IA 1P2CB 4HEME 3OHXB 4KUZH 5KSBF 3SKMA 3BEVB 4JN2B 1QP1A 4NZJA 3EYOB 2FLBT 3LN4A 2QSVA 5KSVB 2XZQL 1RFDH 4UQ3A 4U6HB 1CFSA 3L3IA 1PDKA 2VLRA 4U7MA 4N9GB 4KMTH 4R90L 5LGJA 1KFAH 1PZ5A 3HG1E 4O2CB 3U9PH 2VDNH 4UB0L 5IM7B 5BW7C 2PTVA 3GM0A 2PW2A 3IDMB 3EFDL 2DYPB 2CKBB 4R26L 1B0GA 4D2NA 5KVDL 5EWIH 5IMMB 1T04B 4JANB 3AREC 1YMHA 5T3ZL 4EUPA 3GRWA 5C92A 4M48H 1U3YA 3QFJA 3UTTA 2KPNA 2YA2A 2B5IB 2ICEB 2I9LA 4S11A 5DEGA 3MRDA 5T1LD 2NY4D 4FQIL 3L7FA 5K9KA 4EEEA 1J8KA 3QXAB 4YIQA 4DOHB 3WFBH 3VRJB 1YEKH 4L4JA 4N0YL 4PRHE 2DICA 1NEUA 3FKUS 2QSCL 2X1OA 43C9A 4TQEH 4P59H 5GS3A 4QCIA 3JWDL 3HRPA 1QQDB 4I18A 3KWWB 2H8PA 5J13C 1A3LH 3K81A 4LCCC 1YJDH 3DMMD 5I1JH 4EUPG 5L88H 2ZUQB 4Z9KB 5CAYB 1FZMA 1I1AB 2VXQL 4JFEE 1ORQB 3MYJA 4R9HA 5T3XE 3RP1A 3U82B 2A6KB 5DZNA 4WU7B 4YDIH 2O5XH 4QEGA 2XZAH 5D1QD 3HNVH 1VCAA 3KPMA 4NQCA 3HC3H 3MLYH 5DK0A 2VWEC 3G04A 4MDJA 3VD5A 1ZVHA 3TIEB 3CDGA 1EXUA 3HE7B 2BSRB 3HPJB 5DMIL 1IT9L 2V17H 1MCNA 3MJ6A 4LCWB 2A77H 1HN1A 2LTQC 4LNRA 1V3LA 2Z9TA 3HA0A 5J1AA 2J2ZA 3D9AH 1RZFH 2PNDA 4P5TD 3AXLA 5JOPE 5L9DL 4JPVL 4NPYB 5SWZE 1J1OH 3B9KC 1M05A 1UZ8B 5SWSE 4K9EL 2Z4QA 4ZUWB 3RJDA 3OTTA 4JFOB 2EDKA 1R3KA 5FKPB 3JV0A 3OF6D 4JM2A 2YD8A 1NDGB 1R3IH 1UM4L 1PLGH 3QIUA 1UEMA 5DR5H 3NN8B 1FO0H 4OFVA 1MSPA 3U4BH 2A9MH 4IS6A 1FN4B 5CIPB 3DI3B 1H3PH 1U2HA 1MFDL 4LQFH 1GGCL 1U8KA 2N7BA 5EOCL 3QCTL 1QR1A 2ERJC 1AQDB 4JB9H 5F6IB 3EZ8A 1A7OH 1QFWL 4XXCA 4AYFA 4QRQA 3QAZB 2D3VA 1F2QA 5C07A 3WEXB 3IYLW 1OTSD 1QSEA 3UYPA 5IJKA 3QCVL 4TOYL 1XIWB 3G5YA 3O6KL 3T0EC 1GGBL 3SDCC 3V6ZA 1KJ2L 2VDLH 1I3GL 3C6LD 3DX6B 3WHXB 2DBLL 3STBA 4KTDH 4Y1AB 3EW3B 3F12B 1JGDB 4YAQB 3OGCA 3VGFA 4FN0A 1OGTA 2ESVA 4DVRL 4WVRA 5JNYB 4LSVL 1A7RH 4XAWL 5T1MA 3V4VH 5IFJB 3VE0A 5IMLA 1MH5B 1A14H 1DZBA 3C08L 5EU3A 4UU9A 3O3AA 3C5ZB 5IW1A 1U0QA 2EIDA 4YJZL 4ZPTA 2F54B 1VACA 3HE6A 1A7NH 3OKYA 2X41A 3P77A 1IEBA 5AUMB 3RHWK 2R1WA 3FO0L 4UQ3B 1AGEB 1JGVH 5CZVL 2HRPL 4M43L 4XMLL 4Z7UB 2VLRB 3D18A 4LDEB 4K94C 1T4KA 3VI4F 4RRPG 3DURA 2XA3A 4OBSA 4FS0A 4PJ8A 3E8UH 1XGPA 3EO1B 4RAUB 4X4XA 3K3QA 2V7HA 1PYWB 1FFQA 2B8OT 3QO0A 4ODVL 1DE4B 2OQJA 3QWQB 1FFPA 4EUPB 1F00I 3RPKA 2QSQA 3ZSSA 1YMMB 2VISB 3KR3H 4HUVB 2P7TB 3ULSB 4MB3A 3TBYA 5F7EL 4P9MH 2I9LB 3RQ3A 1U8NB 1J0ZA 2CDFA 4QKXB 2ZCHL 3TBWA 4G8EB 3V7MA 1OSZA 2D2OA 1TQCC 2BXZA 1A9BB 4OF5A 3U1SH 3UCRA 5FYLH 2LFGA 2Y9RT 4KDVA 1HZHH 5LKNA 2VKWA 1W72L 2D0FA 2EE9A 1BZ9B 3T65B 3PNWB 1MJJA 5DQJB 3NCJL 4TPRH 3VXMD 4I18B 3VRIA 3LS4L 1CU4H 1ZMYA 2VXUL 3CSPA 4XXDA 3TA3C 5DA4A 4YC2B 2PR4L 2WUBL 3LKRA 3MYJB 1NGQL 4J23A 3FFDB 4GW1A 5F8QC 5FUZL 3MFFB 2YN5A 1CDCA 2PXYC 1A0QL 4UDUB 1IEAB 2DIBA 3OXRB 4ZD3L 5GZNC 4PJCE 4BSVA 5HD8C 3C87A 2MKWA 1A7BA 3MXWL 4MDJB 5C0EA 2UUDK 2DQIL 4KKAC 4CADB 4TSCH 1H5BB 3WMSA 4X8XA 2WBWB 1IARB 2BJML 3H42L 1KB5H 3EJZC 3EHBD 4LLWA 4N9OB 2BNRA 5J1AB 3MR9B 3O81A 3PIQA 4E41D 1UACL 1M7IB 4N1EA 1R5WB 5IB3A 3FOMA 3SCMD 1OARH 3O6FC 4U1MB 4H0IA 4RNRB 5DWUL 4C54A 2ADJA 4OLYH 4Y8AA 5D7LB 5EZJA 2Z4QB 4MCYB 5DJZA 1UM6H 1G6VK 1NAMB 1LO4L 3NH7L 3OJDA 1R24A 3X12B 4ELME 4XNZB 1CIUA 5GGVH 4ZQKA 1AQKH 1QBAA 2WIIB 1F02I 3VWKB 2HJLA 2J4WH 3WNKA 2OI9B 5IGXH 5FM5O 3RY6A 5HHXH 1KTLA 4Z0XB 2ICES 5E2UH 4U05A 3UPRA 1JF1A 3F8UB 3Q2CA 1NMCB 1G9NC 4CDHA 2W92A 1YEEL 4C56D 1A4KB 3MA7B 4PTUB 4QTHA 3RY5A 5E8EA 1CGVA 3PV7A 4HBQA 1OP5K 3A6BH 3QUYD 1HDMA 3V5KB 4MMZC 3G5YB 4MHHG 2B1HL 2ZCLH 3IDIB 4M6NH 3T0WA 3IRZA 1NPUA 1XGQB 4XCYA 3CC5B 1U8MB 1IGJA 4X98A 1KF9B 3LQAH 5MHSE 5IBUG 3C8DA 3P30L 4OUUA 4OCMC 1CD1A 3BXNB 4MJID 3KYNA 1OGTB 1J0YA 4JO4L 5IKCB 4W68A 3B83A 3O4OB 4MD5A 5FYKE 3QPQD 1WISA 1GSMA 2W0KA 3BWAA 3FCTB 4P3CL 2OJEA 2EXWD 4UU9B 3EDKA 3IAPA 4Z77A 4Y4HB 1BF2A 1DTUA 2KUTA 3QQ9C 4ZUUA 2VAAB 2FECL 3M07A 4HXAH 2C3WA 4WI9A 4LBEA 1ITCA 4QHLA 4KY1H 3HE6B 3GKZA 4U1NB 2EC9U 2GI7A 2LABA 4ZAKD 1XF1A 1MWAL 3CXDL 3O8XC 1Z2KA 2NY1C 4UILH 3MLWH 1RVFH 4R0LB 1AKJA 3NVQA 4CMMB 3L3DA 2QV2A 3DURB 4EDWH 2F8OA 2JB6A 3MRPA 2NZ9D 3QHFL 4EKXA 5I1EL 3V4UH 3IU4H 4GRWE 2NYYD 5DT1H 4H1LH 3WIFB 1X3DA 2J8HA 1BBDL 3JV6A 1H15B 3KPSA 4DEPC 3VDBA 4ZFGH 12E8L 4HV8A 3NIGF 1IZKA 1JV5B 4TUOB 2D9CA 4LLUA 2HVKA 4NKOA 5DD3L 5IT2H 4Y88A 2GAZA 4DUVA 2CDFB 5MEPA 4OI9A 3WLBA 4X7SH 5D70H 5FCUL 4UUJA 4RGOH 3BX7C 4UTAH 1X5LA 5KVFL 3DJ9A 1BFVH 1P4BL 5EU4A 3WFDL 5DLML 3GSOA 2R0WL 5E00A 4OD3H 2NW2B 5D5MA 5EU6B 3UPCA 1FIGH 1H3XA 3IJYB 3PL6A 2DMKA 3KXFA 1IZJA 1ZHKB 3NZ8A 1KV3A 4ZXBD 3IT8D 1F11A 3TH2T 3F58H 3MRLB 3VMOA 1ZGLA 1MHCA 3TN0B 5IF0B 3V6FA 1JP5A 4G6KH 1MRCL 1ZHLA 2AJUL 4FQQB 1IC5L 1U8JA 2F53B 2PKDA 5KANG 4QOKE 1LEGA 3Q48A 5I1LA 3MLZH 3OBAA 4OM1L 3SGDI 1ZTXL 3RNQB 3MLRH 4P3DA 5MENB 2FL5A 4NM8L 4GBXA 4DCQB 4F7PA 1TZHA 4MB4A 1INDH 4O02H 3SDDD 3MX0A 4GAGL 3QDJA 3ESUF 4WNQA 1U3ZA 4BQ6A 3WO4C 5HHQB 2AABH 3LN5A 5C08D 2V7NA 4PJEE 3MO1A 4LLWB 1U91A 4NGHH 3OG6B 2P43B 4NUGL 3ALWA 4NQDA 3BZ4A 3UJTL 1RUMH 2XQYK 3VG0H 1CG9B 3KJ6H 4M93B 3O6LH 3OB0K 2ADIA 4WTZA 4JKPL 3ZL4H 3GSNH 1Q38A 1UKTA 5CHNA 1UC6A 5C0BD 1N59B 5D2LE 2H41A 1PD6A 5IBUB 3TNNA 1IFHH 4X6EA 3RX7A 2JK5A 4Y7MA 3O4LB 1AO7D 3SQBA 4WWKC 5E2TL 4ETQA 3FZUC 1EEYB 4OTXL 5EH1A 5GGSB 1JF1B 4F33A 5LVEA 2XY2A 1I8LC 4LCUA 2AK1L 1HQ4B 5GISL 1YJDC 1LEKA 1EFXA 5FGCB 1CK0L 5IOPB 3TVMA 2HLAB 1J86A 4OLZH 1AD9B 4I3SH 4N1CA 3AAZB 4PJ5B 4XP1H 4HWBH 3H2WA 4URTB 5E5MB 4Z95L 4UQ2B 1DSFL 2VMFA 4GRLC 1XCTA 1MRFH 4UBDD 3HI5L 2FR4A 1RJYA 5JIHA 4MD0A 4X6DF 4IMLB 1KJ2A 4YHML 4HJJH 5CEZD 3QP3A 5JORB 3LCYA 1CD1B 1I4FA 4LF3A 3VFGH 4MZ3A 3KPPA 4UT6H 4DN3L 4QRRB 4KHTL 3W5MA 4K8RL 4NWUL 4PRAB 4M6AA 3G5ZB 1DBBL 3ARDA 1NMAH 32C2A 2AV1A 4G7YL 3U9UA 4PJIB 1D5IL 1UT9A 1E4XL 5HYQA 5CZKA 2H6PA 4XTRD 3K74B 4LCYA 5D7IA 4GXUN 5JHDA 4M02A 3GGWB 3PWPD 3CX5J 1EFQA 4H0GA 4KJPD 2C3XA 1J8HE 1YEFH 2Y07L 4YBLC 5B3NA 2FBJL 4M1GH 3QNXB 1F6LL 3E1F1 4NZRH 1HQRA 3HB3D 2FWOA 5CJXA 3O2VL 2VXTH 3GSXA 4KKLC 2WM0A 3IDJA 5TE6H 3GI9L 3I84A 3KS0J 4GG6E 2C26A 5BS0D 5TDNB 4YEEA 3HZVB 4ONGL 4LCIL 1A7PH 1U42A 3I2CH 5F9WC 5JPNA 3HC0A 4I3RL 1EHLL 2C1OB 4HV8B 4JY4A 4MB5A 1RJZB 4X99A 4NKOB 5ICZB 3UP1A 4X6CF 2OLDA 2D7TL 1N64L 3NIFE 2BSED 4POZC 1WFNA 5AWNH 3G5XB 4JFEA 4OFKA 4ZTOH 4WI6A 4U0RB 4PLJD 5FYLE 3DX7B 1MOEA 1NCDH 3DSFL 5IFAL 5D6DC 1ZT4A 3QEUA 3QG6B 4RBPH 4HGWA 4EN3D 3C60C 5D7KD 5EU4B 1W72A 1B6UA 3OZ9L 4YFLI 2XTJC 4UAOB 1FJ1A 1EEQA 4NKMB 3LB6D 4NJ9H 1BD2B 1RD6A 1MCWW 2CLVA 1PY9A 5H94A 5C6TH 2QQLH 5JZ7D 2VN7A 1BIHA 3EOAA 2UWEF 3BPNC 4MQXC 3I6LE 3V95A 5GSRA 5C0JB 1UA6L 4JG1L 1WFTA 1TJIH 4CDGC 4GAYA 1FH5H 4P3DB 5E9DD 5F9JA 4JDZA 2VJXA 3KDMB 3NFNB 3DV4A 1JZ4A 3P0VL 1TJGL 2ATPB 3GMLA 4DN4H 3NAAL 1KG0B 1N7ML 1FORL 3W9EA 5KN5B 1KEMH 2WY3A 1QLEL 3N9GH 1WUNT 2PO6A 1MHPL 3NBNA 4LVHC 1CXLA 5EBWB 1FGVL 4NHUB 4XHQA 3DO7A 4F7EB 1T5XA 2CGRH 4I4WA 4MYWB 3RTQD 3QUZD 1KLGB 2AJVL 4CVXA 1X6NA 3W81A 1VADA 1DFBH 5EIVA 1CFNA 2MMXA 3SKJL 3PDOB 2VUYA 1HH6A 3W9DA 2CK0L 3LQZA 1KB9J 5E8NA 4XCCH 4NC1E 3QWOB 4A2LA 3FO2A 5DK3A 4PP1D 4Y5VC 5EZOH 4HS6A 3MCLL 4KXZI 1MJUH 1YEHH 1EAJA 2E6PA 4XPHH 3W0WD 1A6TB 3VGGA 1ZHBA 1MCFA 4QRPB 4R4NC 5BVJA 4RDQF 2Q8BL 5FHAL 1NFDA 1N0XL 4I2XB 3MV7E 3FOLB 3DLQR 4ZUSA 1Q0YL 2P5WD 3MJ8A 5BVPH 3LOWA 2YUXA 3SPVA 4X6FA 2DI7A 2D03L 1T89C 3BEWA 3CMGA 3CMOL 1W0YT 3MNZA 3L5HA 5MERB 3LQMA 4LRIA 1MRDH 1I4FB 1T83A 4Z7WF 3QUXC 3F5WB 1SYVB 5M95B 4IOFC 5KSBE 5F3BA 3O6FD 1GYAA 4I0PD 4BH8A 2AV1B 4Z7VE 3ARYA 3JWNC 5HJ3B 3U9UB 1AD0A 1FL6B 3V0AC 1FFOA 1MCHA 5ALCH 5HYQB 5CEXB 4G8GB 1RMFH 1GC1H 2GW5A 3PHOA 4UI2A 3BSZL 3DVFA 3U0PB 4PRNA 4W81A 4DUWA 5DMGC 5KSUA 1X5JA 1YNKH 3TCLB 3LDBC 4QHUA 3GEWB 1J1XL 1RJLB 4GSDL 2ZG3A 2DQCH 1VSCA 4S0TD 1T1XB 3IVKA 1MWAA 1XR9A 3GJEA 4OFDA 4HK3N 1KUMA 1T2QL 4QNPF 1MI5D 2FX9H 2IADB 3PABA 4OZIB 5C0FA 5E4IA 3FTGA 4DUXA 1NANH 4NNXB 1FCGA 1GIGH 4LIQL 4HULB 2DQGL 2EECA 4ZO7A 5FA3B 5I74B 2FHCA 3CFIC 3NZHH 5CBAA 1S7QA 4BK4A 4E41E 3BKCH 2ZOKB 1H9VA 3UJJL 1XFPA 1QKZH 1RULH 3MV9A 4JY4B 4F8TA 5JQHC 2H2SC 4G8IA 4JAMB 4LGRB 3BQUA 1WV7T 4L8DA 3LKQB 3LKNA 5FUCE 3SDAC 2NTFA 2OSLA 5DSCA 1N6UA 4C83A 4FXGA 4CN1A 1BQLH 4NZUL 3LQAC 1J12A 2J8OA 4ISVB 4AM0B 4JFZL 3N50A 5HXMA 3O2WH 2CMRH 3BRDA 3H9SD 4HZAA 4LLYB 1DBAH 3ARFA 4C56E 1GZPB 3AVEA 1W72B 3QA3B 3Q3GB 4PJHF 4K2UH 1I9IL 5C2UB 1TETH 2NPLX 3G6DH 1NLBH 5IESH 5JXEA 4PR5A 4F9LC 1PSKH 1K8DA 2GJ6B 3D0VA 2VABA 4WGVB 5HHOA 5IROC 5T1DH 5GS1B 1F97A 4Q58C 3GI8L 5DRXB 4BKLA 5ICYB 3DUHA 3QH3A 4X5WA 1ZLUK 5FFLA 1XT5A 4L4VD 5J12B 4MJIE 2Z8VC 3KPRD 4FTVB 2XXMB 3TBTB 3FMGL 2E27L 2MWCA 4G9FD 5BJTA 2C4FT 5DFVD 4GAYB 3J7HA 2CRMA 3QHZL 4PBVC 4YDKL 2OTWB 2UUDH 5I0ZA 3AS2A 2J12B 2IMNA 5DQ9A 3MACH 5EUOF 4ENED 5BXFA 4ELMA 3TLRA 3AUVA 5DURB 2XN9D 3W9EB 3TJHD 4MNQE 1QNZH 2NLJA 1K5NA 4B7IA 5K59F 4B53A 4P99A 5HYSA 2Q3AA 5F97E 2YN3A 3JVGC 5FCSH 3SKNA 4YEFA 1GPOL 3BKJL 2YKLL 5BRZD 3ZKQD 3HPLB 4FP8L 5KSAA 2OTUB 2PYFA 1W2KT 5FUCC 4CN4A 1BJ1J 3DUUA 3RVXD 2Y23A 3SY0A 5K9JH 5F7LB 1CBVH 4PRIB 2BOCA 1X5HA 3SQOL 3DRQA 4TNVF 2QADD 4QRUB 4JLRA 5BQ7A 3U7AA 2ICWJ 5FUOL 3E3QE 1DLHA 4OZHB 2J5LC 3GJFA 4AJ0A 1A1OB 4PGDB 1WTGT 1R3JB 4HS6B 3MOQA 4XB7A 5DRZB 2LAAA 1OP5H 4NN6B 1P1ZB 1NGPH 3THMH 5K9OA 1A6VL 1XGTA 2X9YA 2I5YH 4DZBB 3WKNA 1GAFL 4C4KO 3PWJA 4HD9A 3ZKMC 5J3HD 3P0YL 2E7LE 3QIWC 5ANMB 1DN0B 3P3YA 1OAQH 4X6FB 5I15H 2HJFA 5BO1L 3S4SA 2C3HA 1AHWB 4GT7A 3Q1SH 1W0VB 3OSKA 4OFPA 2NY3B 5K93A 1LEIA 4JFPB 4LKXA 3VH8G 5A1AA 4NOFA 4PB9H 1X7QB 1ADQH 1TZIB 3FONA 4GW5B 1JZ6A 2XKSA 4YXKH 4R3SA 4BH8B 2MQ3A 4S1RL 2LVCA 3WNLA 5TPWL 3BP4A 4UV4H 4A6YA 2X4RB 4WW1B 1GCFA 1V7NH 3VI4E 2JE8A 1NGXB 4P2OA 4NQSB 3VXUD 5DUBA 1AXIB 1A6UH 3AM8C 1NH6A 1SM3H 15C8L 1CCZA 5AAWA 3CIQA 5JO5A 3VXQA 5CCKL 3IVKB 4Z76B 2QBWA 2W60B 1IE5A 1UJ3C 5DYOA 5HGBA 4BELD 5F7YC 4GG8B 1KCUL 2IG2L 3OJ2C 4ZG1A 1BGXH 2F15A 4L4TE 5IMOB 2P5EB 2OL3B 5EFIA 2ZNXA 1R3LB 1MEXL 3QUKA 2EEAA 4YQXL 3SDXF 2VLKD 4N5EC 4UTBH 4MX7B 3KJ4B 4U6YA 3BP5A 1N5YH 3P9MB 1MFEL 5F1IA 3LKOA 3PWVB 2E7LC 2NTFB 4QXGL 1INQA 4NIKB 1FDLL 4P2RE 2AQ1A 4HT1H 1T3FA 1S5HA 2XFXB 2YRZA 3WFEH 2VLLA 2VXVH 1FFNB 3BN3B 4XVUD 3CFCL 3CFDA 5I8OL 2NX5B 1SVZA 3M8OL 5AYUL 1IGFL 4KTEL 2EIBA 4FQHA 5DO2D 3HLAB 5CSGA 1NBQA 3BUYB 2JB5H 5SX5H 4NJAL 2PCPA 4HZLA 5AZ2L 1QFHA 1UH4A 5T5FL 3MGOA 1GZQA 4GH7B 2CIKB 4P2CG 3A6CL 4M5YL 2FGZA 2HT2C 2DS4A 3EIFA 4F3FA 3GSRB 3VI3F 2Y5TB 3DX8B 4J3OC 2H32A 4P5MB 5CEZE 3KPQA 3DV6A 4PIRF 4F37K 4PJEA 2ICWA 4X5LA 5DMKA 2VDRL 5AZEH 5HSFA 3MNWA 4PV9A 4NNYA 1EJOL 4U3XA 4UT9L 4XWOC 4MQ7A 2A73A 4NZTL 3S8WA 1QBBA 3QISA 2NXYD 3O9WD 1IC7L 1U8LB 5DQ9B 4M7ZB 2XQBL 5CJBA 1DBKL 2Y6SC 4MSWA 3S96A 1YECH 1K5NB 4GKNB 5CBEA 1JGEA 3PWPE 3LH2L 4P4KB 1D5BA 4X7EC 3V5HB 3I6KA 4K3EH 2E7CA 4OSUH 4BSWA 1G6RH 1A2YB 1CL7I 4BZ2L 5T1LA 1G7JB 1I8KB 5I9QB 1YYML 3WXWL 5HHMB 5ILTL 2BVPA 4GKOA 2L0DA 3MZGB 2DM4A 1W0WB 2BOCB 4Y5XC 1SJEB 1PGRB 4G6FB 5I1KH 3G08B 2FH6A 3JTSA 3O41A 4WI3A 4KVCL 3QQ4A 1CD0A 1J5OL 2KL6A 4JLRB 3VH8B 4DGYH 4HFUL 1AR1D 4MA3A 4PLKC 5EG6C 2J3SA 2FZ3B 4HWNA 3ARGD 3QDGB 3LZFL 3OKMB 4TRPH 4K3DH 4H5SA 3RWHA 1Q72H 3NACH 1IM9D 3U0TB 1FLTX 3DMMA 1B88A 4OJFH 4R4FL 4NNPH 3PXHA 3FO9A 2DLFL 1BBJB 4R2GD 4X80H 3VFTB 4GW4A 4S1DD 2GK0A 3CSYA 1DVFB 2G60H 1CD9B 1ZT7B 3UTPD 1T0NA 5J11C 3M17B 5GRUL 4NN7B 1D6VH 5D7KE 2V2TB 1T1WB 4IIQC 2WANA 1D9KB 4GRMA 3T77A 2HJFB 3MBED 1MREL 2NNAA 4LPXA 1YYLL 2HWZL 1U3HC 5D1QA 1FBIH 1JWSA 4RA0C 4U3CA 1HIMH 4G6JL 1HYSD 2WWKT 1SBSH 4PGCA 4DGIH 1ZGLP 3B2VH 4PRBA 5EA0H 1SJHA 4NZDA 5KG9A 4NO5A 2DQEH 5I8CB 4AEEA 4QGTA 4JQIH 1B4JH 3WN5B 1NC4D 4LMQE 5HYIA 1O7SA 4G59A 4OCNC 5JQ6L 4BQCA 3VDCA 5GZOD 4JGJA 3DBXA 4P5TA 2AJSL 3OV6A 5DJCA 5B4MD 4MCZA 1J05A 2NY0D 4P5KA 2GT9A 2GEEA 5A2JH 4HFWB 3UTOA 4GUPB 5JXAL 4WO4B 3OF6A 1JI1A 1EEUA 4P2QD 3BE1H 5HGBB 1MELA 3D3VD 3NIGE 3E2HC 4KPHL 1IC4L 2BVOB 5INCB 2EYSA 1TCRB 3K2UH 4LAQH 2UVFA 5D1ZB 2MCPL 1DQML 3HNTL 1NMBL 1Q9WA 4XGZA 2YD2A 1S9YA 5KS9A 5SWQA 4BK5A 1CT8A 3G9VA 3U4AA 3CVHH 3HFML 1Q1JH 4E42B 4J3TA 4AIZA 2WUCH 4Y4FB 2FH8A 5JIPA 4NRYA 1A6WL 5F1IB 1G7PA 4HS3A 1FVCA 4XPGL 4YHKL 1CGUA 1VGKB 3OKKA 1L9NA 4Y19B 5FOBB 5ESVA 1ZWIA 1KCRL 2BDNH 2FBOJ 4KK5C 3C6LA 5DD1H 3S3SA 3VFWA 1KBGH 3QDMD 1VGEL 4KK9C 5ECJE 1CFTB 3S3PA 3PP3K 3MYZA 4N0UB 3O3BA 2FIRT 3HMXL 5B3JF 5TDOA 2W91A 5DD5H 3W0WE 3IDYB 1U92A 4MA8L 5I8KH 1XF4B 3MGOB 4JKLA 5DMGD 4KROB 4WEBL 3QPXH 5JR1H 3SE4A 1UWEL 1T7ZA 1BEYL 4YDLB 4MAYC 1GC1C 5C09E 3TT3H 3CSBA 3ZKSD 4JDVA 2Z92B 2NY6C 4K3JL 1OWWA 4IDJH 3DV6B 3B9AA 4LLDB 4Q0XH 4R4BA 2AEPH 2ICWB 4HIHB 5CJQH 2EXYC 4OCSL 1EX0A 1EGJH 2EDXA 3SKUD 5DMKB 3QEHA 3KHOA 3KNBB 2IWGA 2HYMA 4B50A 2R56H 4WJ5B 4YZFF 4F37F 3RZCB 4MQ7B 2A73B 4YXHH 1QRNB 4OLXL 4L3EB 1JZ8A 1J18A 5DXWA 4JO1L 4MSWB 2ZKHH 3QI9D 3N1QC 1XGUB 1NKOA 3BD5A 1DQTA 2HH0H 3W11C 1RUPL 5JW4R 3IXAB 1JGEB 3BN9D 4Q9QL 1HHGA 5CKAA 5GJTL 4CVUA 4OBRA 2LU7A 3WE6B 3I6KB 2GHWB 1RZIA 4M61B 3EOBA 2AXFB 5H37H 4CVWA 3EAKA 4V2BA 2DWEA 2YUZA 2QLVB 1UWXK 1KJMA 2BVPB 3QQ3A 4PTTB 2JJTA 4QRTB 3MLUL 1JL8A 1TFHA 4RMVA 4YFEA 3L9RA 4Z7UF 4R7DB 2W0PA 5KVEH 4EI6B 3BIAX 4JY5H 1F4XL 1FFRA 1VPOL 3FRPA 4S2SA 1JNLL 4CUCA 1T03H 3MNVB 2DQJL 5D2NA 2K7QA 2WINB 4HIJA 4HK0A 4EXKA 4JJHA 2OMNA 4YPGA 1VENA 3VXMA 5IB2B 1IKNC 4D9RD 4JPIB 4X6DE 5DF0A 1W8NA 1I3RB 4K94L 3QHTC 2N1KA 4WHTB 4X9IA 1OM3L 3VD7A 4PJDB 1PG7W 5IV2B 4MAUH 3DTXA 3I3EA 2QR0A 1Z9OA 1IBGH 4XWGH 1RIVH 2OBGA 3SJVD 4ZSOE 4GRMB 2FEEI 5E6ID 3TBSB 4S0SD 1JWSB 1ZHNA 3P40A 1YPZA 4G7VH 3HRZA 3IJSA 1BP3B 2HT3C 3I3BA 5BV7B 4PRBB 3MLSH 4QTIH 2WBJB 3FQXB 4JRYB 5D93C 4Z0BH 3TPUB 1NLDH 1RURH 4NO5B 1WLHA 2GSGB 3VFUB 5FF6B 1LP9B 3QUMB 4XP6L 3GIZL 4L4VE 4MXQC 1S9VA 2ZCKL 3FN9A 4NRZA 5LAXA 3DBXB 4TVPL 1N5AB