3H9HA

Human class i mhc hla-a2(a150p) in complex with the tel1p peptide
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
275
structure length
275
Chain Sequence
GSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDGETRKVKAHSQTHRVDLGTLRGYYNQSEAGSHTVQRMYGCDVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQTTKHKWEAPHVAEQLRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHEATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRYTCHVQHEGLPKPLTLRWE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
publication title T cell receptor cross-reactivity directed by antigen-dependent tuning of peptide-MHC molecular flexibility.
pubmed doi rcsb
source organism Homo sapiens
total genus 80
structure length 275
sequence length 275
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3h9hA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3h9hA01
1HHGA 2G9HA 3ARTA 5E94A 3QNXA 5DDHA 5EORL 1G7LB 5ECJE 4PRDB 3QWOB 3GJFH 3NVQA 1A5FL 1YJDH 1VFAB 3ORJA 3ULVL 2PW1B 3THML 1VACA 3S34H 4MQ7A 3BZ4A 3TPKA 1X44A 5D1XC 2EICA 1S7VB 5IVXA 1UQSA 1IC7L 1CE6A 3LQZB 2FYYA 3VXMA 4YHMH 4U1SA 2XTJD 5BQ7B 2I9TA 1MQKL 2FIRT 4R4NC 4HAFA 1VEOA 3SKOB 1U58A 2AP2A 3QEGH 2MOVA 4KRMB 4DFIA 1FE8L 4BZ1H 1EJOH 4UUJB 2AEPL 3MJ9L 3IDYC 5FYKH 4LCIH 3O8XA 2VLJE 1CS6A 2AJUL 2EDOA 3FJTA 4GXUM 4Z7UB 5DJZB 5GHWL 2F5BH 5SWZD 3K4ZA 3R4DA 2Y36H 4FTVD 2QADD 4KXZH 2FATL 4XMKL 2DQHL 1JWSB 1T3FA 1S78D 3FO1B 4GQ9L 4IHOB 4EIGB 5EULV 3MMEB 5AD0A 3GSNL 4U1HA 3NACH 4HJGA 4F7CB 4C57C 3U1SL 2VLMD 5FGCE 4B5EA 4QF1A 4X7TA 5C0EA 3VXUD 4L9DA 2F54A 1AY1L 1MLBB 5JPMB 4NNXA 1D5BB 4MD4A 4M9OA 4Y4FD 3IDMA 1U0QA 4OCSL 1CXKA 1FFNB 5EOTA 1DVFD 2IH1A 2B4CC 2O5YL 4DQOL 1B88A 2IGFH 3V6FB 1P5VA 5CZXC 4FFYL 5CMAA 1V3LA 4F37F 2EDDA 4M62H 4L4TB 4GAGH 3ARUA 1XIWB 5T1KA 4Z7WF 1M71B 4WWKD 4NJAL 1TZGH 1M6OA 4PREA 4PB9H 3VGDA 3X13B 3OKOA 1DFBL 3QIBC 3V6OA 4PJXF 1FZKB 1F5WA 1J8HE 2O5XH 4YHNB 3FQUB 4MQXD 3LZFL 3GB7A 4QY8B 4WO4D 4M03A 3C6LA 5IMKA 1GYAA 4MCYB 4X6DB 1G9ML 1I7UB 1CICB 4TYUA 3IVKB 3QXAB 4OLWL 1JPGA 2YPLD 3BVNB 5ILTL 1UXWA 2UUDK 4OZFG 4LQFL 2VOTA 3QXVA 4LEOA 3MREA 5F72S 3PP3H 4PJGA 1YNTB 1J1XL 3MNWA 2DL2A 5BXFB 4H8WH 4V2CB 2EXYD 1I8KB 3MLZL 2DWDB 1LE5B 1AJ7H 5GIRB 4XB8A 3M17B 1MFCH 1OGAB 4HX1A 1Q9KB 3VFOB 2BSTA 4FN0A 4KK5D 4Z77B 1MRCH 1HXMA 2P44B 1BFOA 1I1AB 3TO4D 3GSVB 2CLVB 3QP3A 1A6UL 3OAUL 3HI5L 2Z0BA 4P4KA 1D5MA 4MS8D 2HA1A 3CMGA 4KZDL 3G08B 4BELD 2VISB 4G8GB 4HW6A 1NJ9B 1Z9MA 4PJDA 1CR9H 4S2SB 4ZODA 3MV01 4M9PA 1BFVL 1HNFA 1IM3A 5I1CH 3ZTNL 3I6LE 1NC4A 4Y16A 2BRRL 2UWEA 3AREB 4GAJL 3QUYB 2R1YB 2IFGA 4LVNB 1IEBB 2I5YL 3MXWH 2A83A 4C56A 1CD1B 4F8QA 4FXGA 1MCPL 5HHME 1MCEA 1JWUA 5MP6H 4PB0H 5CP7A 1MRDL 4JM2B 4OZ4A 2OMNA 4WHTB 4ELME 3KNBB 3LEXA 2W1NA 4DAGH 4XBPB 4QXTA 5FXCH 5HHOB 3LMJH 1FNEB 1QLEL 3ARQA 3MCG1 4OFKA 1O7SA 4X8XA 2GSGA 2NQCA 2W9EL 1A7OH 1BFTA 1XF5A 3SCMD 4ZOAA 4JB9H 1S5HA 3F7YA 3GJFB 3O6KH 2EDBA 2PO6D 1RHHB 5KVFL 2LU7A 1CN4A 3FB5B 4ZXBB 4URTB 1INQA 1N64H 1PFCA 3LRSA 1HSAB 4RMVA 4KDTA 1W0WB 5J1AA 5LCVH 1EBAA 1I9EA 3K1DA 3GSRB 3EYUH 3SKJH 4XXDA 1KLGB 2ICES 4OZHB 2VXUH 5IHUH 1B90A 4KRPB 1OAKH 2ARWA 2YA0A 3AB0C 4N68A 3EDJA 4ZQKA 5IESH 1HKLL 4YDJB 5K9JH 5DUBB 1PSKL 2CIIB 1IGFL 4P23B 4OZIF 5FDWA 1MHEA 1A6WL 5DZNA 3OR7B 2ZCKL 4FQXA 1P1ZA 2R1XA 4HF5H 2CGRH 3UX9B 5ISZE 3LH2H 2UYLA 2GFBA 3BJLA 1RZKL 3GO1L 2OR9H 2OR7A 3DURA 4POZC 1LQSR 4CU6A 1BJ1H 3TA3A 3WFHA 3EOBB 2VQTA 4PP1C 3UJIL 3IU4H 1KENL 3CUPA 5DHVA 2ESVA 2XWBB 3HAEG 3O3BB 4HUWB 4YEEA 1WBZA 1U8HA 3R0MA 2I60L 4WUUE 5D5MB 5D72L 1H8OA 1XGRA 4X6CB 4P2CG 1TMCA 5BS0D 3QUZA 1UACH 2VLLB 3QYCA 3RTQB 3U0WL 1J0JA 1KN2H 4Z7QF 4FZEH 3A6BH 4JO4H 3D69A 3CVIH 3EYVA 1T66C 4FXKA 4D0DB 3TZVC 3FHAA 4M6NL 4WNQB 4L8CA 3SE3C 1AGFB 4UT7L 1BQHA 4L8BA 1FFQA 4R8WL 3K2UH 5A3ID 1YA5A 4Q58C 4KKBC 1BVKB 3VXTB 1NGWB 1S7SA 4JVPA 4L29A 1EERB 1XCQA 5GGQL 5J7CC 2C7UB 4DOHE 1H3VA 2XPGA 1IGTB 3IJHA 4JDTL 3ZT7A 5I16A 2CKBL 2XQBL 1M7DB 1OGTA 1WGOA 4OF3A 2F8XC 5AZEL 3EYSL 5JO5A 5C0RH 1I9RL 4PJAA 3GI8H 2LFGA 1Z5LA 2KQMA 3MLUH 2FX8H 2GSIB 3G6AB 1QO3B 1KIRB 3SDCC 1HQRB 5DC0A 4O58L 4XVTL 1QR1B 2EIZA 3OGCB 4PRPB 2HT3D 4RFNB 1H3WM 1TCMA 4PBVC 1LD9B 4UOW1 1UG9A 43CAB 4FA8A 3MRNB 4JN1H 2NXZC 1GVIA 5J89A 4C54A 5SWZA 3TVMD 4XAWH 4Z7WA 3OB0K 4FTVA 5K9QG 5C08E 1ZT7B 3DX8A 4MGXA 5F9WB 4PJXA 1MQ8A 4PRNB 3T0XA 1ONQB 2NX5E 4KK6C 1IC4L 3B9KC 3T04D 4YBQD 3TO2A 1RZJH 1OVZA 1HQ4A 1RIVH 2A74B 2OL3A 4Y4FA 3RVUD 5D7SH 5CJOH 4K3GA 2B7DT 3BUYB 4M6OL 1DVFA 1UJTA 3O45B 4HV8B 2Q86B 1NCBL 3W9EB 5C0CE 4QHLB 5J6GA 4CMMA 2C3HA 3T0EC 4RCAA 3NZHH 3TWCL 2OZ4H 1LO2L 2BVEA 2F19H 4D8PA 5C0DB 3S88L 3HC0A 3KLAB 1HZHL 2J7LA 4WWKA 2H45A 2DTML 5J6HA 5KVDH 4PRIE 1OT2A 3CU7A 1TCRA 1C08A 2HWZH 3CC5B 1QSED 3KYAA 3HI1A 4G8IB 4G8FA 4GKZA 2OM5A 2YSSA 2HMIC 4U1LA 3FFCE 2Z92A 1B0WA 3ARBB 3MRHB 3P9LB 4E42A 1KJ3H 1CICC 2YPLA 4XVSH 3MNVA 2VLRB 5HHNA 5B3JE 3WFDH 3VDBA 4YDVB 3LKRB 1JUFB 4JREB 2V9TA 4TQEH 3LN9A 1TQBB 4X6FA 3GBML 1BFSA 4LDLB 2COQA 1HCVA 4JFFB 2FX7L 2XOTA 4CVUA 3UBXG 5D7KE 3RBSA 1T1ZA 2YRPA 1P2CA 4YHYC 4RFEB 5IG7B 3C5ZA 4CKVX 2IQAA 1F4AA 3MRBB 4DGIH 1YUHB 3P73B 3VFPA 5L88H 3PDGA 5L7XH 4I3RH 1IFHH 2EKJA 1XCTA 3O11B 5GRUH 1K2DA 3O4OC 4HCRH 4J4PA 1UB5A 2A0LD 5MEOB 2X70A 3TC9A 5HI5C 4PJEB 3TO4A 3BDXA 1HDMB 3HUJE 1I1AC 3RDTD 4I18B 1E4WH 4E5XA 1EHNA 4XCYA 4KJWD 3QUKB 4NC1E 5HI3D 4RWHA 1FP5A 4JM4H 3VRLE 5EC2B 1SEQL 3F58L 5F44A 2BNRB 5GZOD 4PFEA 1OAUH 4GRMA 3LKOB 3N85L 5CD3A 1CGVA 2H6PA 1B4RA 3D39E 4K71B 4LLWA 3W0WB 5MHSD 1ND0A 3AREC 3NIGF 3QUYC 4WY7H 5D7LD 4NO0D 1G7JA 1JF6A 1MCJA 1NLDH 2XFXA 3FONA 1NAML 2FB4L 4UDTB 3IS0X 1RUPH 4APQB 2E9JA 1R5WA 1ERNA 1PGRB 1WT5A 4XBGA 4JM2C 5DC9B 1A14H 4MJIB 4KK9C 1G7HA 3RAJH 1TJHH 2DQJH 4OZIA 1XF2A 4P9MH 3ET9F 1EH9A 1QSFB 2Y7QA 4D94A 5GS3A 1J05B 2EH8L 5I76B 2QR0B 2PO6A 3RWJB 3MJ7A 2YHGA 2VAAB 2X4PB 4L5FH 4JPIA 4R7DB 1YJDC 2P8MB 3RVWC 3EO9H 3VI4E 9CGTA 2AK4E 2GT9A 5HGAB 1WV7T 3QQ9D 4ZNEA 1IC1A 1ZHBB 2ZG3A 4HWEH 3FB7B 4S0SD 1J87A 3IDNA 3DYOA 3LY6A 5DD3H 1RUKH 5GGSY 4CGTA 3KG5A 5IGXH 4KMQA 1UC6A 1PAMA 3OKDA 1Z9LA 3SEPA 4ZFOB 2C3WA 5KJRL 1D9KB 5C86A 4OF6A 3QNZB 5DS8B 2PR4H 3TYFB 5I8EA 2V7NA 3CSPA 2H9GB 2Y06H 3RPIA 3BP6B 1XR8B 1FGNL 1VENA 4DKFL 1BVLA 4HK3N 4XGZA 5FO9B 1NBVH 3NZ8A 4HDIA 3MLTA 3V7AE 3VGHA 4FABL 1OP9A 3QO1A 5TF1H 1RK1A 4NUJA 1X5KA 1AP2B 4G8GE 4U6XA 4LIQH 2EDHA 2Y9RT 5BS0A 1BD2B 1F6FB 3S36X 2VXSH 2MWCA 4XAKE 5FYKU 4JO3L 1BIIB 4HUNB 4N0FB 3RTQC 1KN4H 1NMCB 3V8CA 4J6RL 2OXHA 3LRGA 4EI5D 4YPGB 2B0SL 5IBLC 3MV9E 3S37X 3IT8D 1CT8A 3TBWB 2BXYA 4IJ3C 1EV2E 3MJ8A 4GG8A 2XZQL 3RL2A 3H7BA 3EYOB 4LSQH 2FDBP 3CDFA 3LKSA 1OTSC 3P4OA 5I74B 4H88L 1FGVH 1AR1C 1MF2H 1U8OB 3BQUD 2HH0H 2NY3D 3MRFA 3SY0A 5JPNB 3UC0L 4HG4K 4D2NA 3BGMA 4HS6B 4LSTH 3D18A 4MD0A 2P5EB 3KPOA 3GSOB 3OR6B 2R69L 4LPCA 2DBJA 4LKXA 3MLXL 3FN3A 3W9DB 3OZ9L 3BH9B 1OTUC 1U6AH 3X17A 1DQDH 4PLOB 4YUEH 4H8WC 4NKQB 5LGJB 3VXOA 3MCLH 4M4RA 1SJHB 1Q9OA 2NW2B 1FAKT 5E9DE 5F9OH 1MAJA 5E2TH 1X5FA 1AHWA 1TETH 3MGOB 3QCUH 5C2BL 3IKCA 5I17B 4G8EA 1H3GA 4XTRD 2FHCA 3O6LH 1IEAA 4AEHL 1CK0L 4N8CH 5MI0C 2CRIA 2EE9A 4IM8A 4N0CD 3ULVE 2B5IC 4NQDD 5SX5H 1IAOB 2VXVL 5BRZD 4MNHB 3HC4H 3NTCH 5D5ME 4LARH 1ZAGA 3O3DB 2R0ZL 4UIMB 3QDMB 1G6RA 4H1LH 3S4SG 3GIZH 3OKLB 3UPRA 1T5XA 2ZNWA 5CILH 5IVZA 5CCKH 2GUOB 4F3FB 3ZDXF 4QOKB 3RWFB 3ROOA 1DBJL 1KXTB 1DBKH 1NCCL 5HSFA 3TPUB 2WLZA 1WBXB 1FLRL 2FO4A 2JK5B 1NGZB 3DMMD 1L6XA 3DXAB 3U82B 1QSEA 4ZD3L 4XMLH 3QIUB 3BN9D 2WNGA 4FNLH 3SJVB 4CVZA 2E7LA 4LCUB 3NIDE 3CMOH 4F33B 1G7PB 3DVNB 5B21A 5C07B 4EDXB 3MBED 1A6ZB 3ARBC 5DJYB 2ZSWB 4M7JH 2DWEA 3B5GA 3S97C 2PETA 5CJBA 4IMKC 1R6VA 3HE7C 4JREC 1HILA 1R3HA 2E8YA 3TP4A 2K3TA 4U1KA 1F4XL 4AL8H 1WWAX 5C0BB 4GBXA 4JQVC 1IAKA 4KZEL 4R90H 2AJYL 3H42H 4U6VH 4KK8D 4X5XA 1P4LA 4QCIA 4F57H 3AC0A 5EN2B 1RSFA 4TULH 4H0GA 4W6XB 5HHXH 3QPQD 1ZLWH 1YY9C 5I1GL 4LLAA 3MZGB 4XPGH 5T1LD 4OCWH 4JPVH 3AROA 5D7IB 1BOYA 3FQXA 1KTLA 4I18C 3TJEL 4XP6L 3UYRH 3HZMA 2GIYA 1JNJA 5DTFB 2X4TA 5ALCL 1OWRM 3RWIB 1FIEA 1NL0L 4C4KO 2E9WA 3GRWA 2DAVA 5GS1A 4OLUL 1I4FA 4YIQB 1KTKE 2KH2B 3MRRB 4RRPA 4Y7MA 3CLEH 5SWSB 4K71C 5D7LA 2XTLA 3ARGD 3MR9B 3AMKA 2EE2A 3HKFA 3VFMB 4CJ0A 3U4EB 4Y1AB 1E4KC 1U8QB 2NY2D 1AXSB 1SVCP 5DQ9B 1EO7A 4APQC 1U8MB 4CL7A 4LOUD 1OAXH 1ADQA 1GGBL 1MCRA 5D1ZD 4YO0B 2DLEA 1KJVA 3VH8G 1DN2A 2AABL 1MY5A 3FQTB 4JR9L 3KXFA 3FO9A 4DK3A 2F58L 4Y8AA 1YMMA 5C71A 5IKCA 4S1SH 4JHWL 2DF3A 4ZUVA 1HHJA 3H0TA 2YWYA 1ZVSA 1JI2A 1A7PL 4UNVA 5IMOA 3LKNA 5F3BA 1CE1L 2IMNA 1RZFH 4U33A 3KYNB 2FNBA 1ZLVK 1NBQA 2DS4A 2W0KA 1MCIA 4X99B 3SBWA 4IOIB 3MRDB 4BH7A 1CU4H 2AXFB 5T3ZH 4PJFA 4TNWK 1RZ8A 2OQJB 4Y19D 4S1QL 4G9DB 3P0VH 4NKOB 1QLFB 1AKJD 1A3RH 2PTVA 1RI8A 5FO8B 3RIFF 1D9KC 2B1HL 1JZ3A 4JEGB 3A6OA 4QHMB 1P7QB 4Z95H 1V3MA 4Y4HB 4JG1H 5FKAA 3S5LG 4PGBB 3SDDB 5IW6A 1K5NB 2EYTB 1QFWH 1YEHL 4KV5E 1XGUA 4C58B 3WKNA 5DD1H 4XP4L 3WXWL 1J0ZA 4PJGE 3ESVF 2NLJA 2V5YA 5JTWA 1DQMH 4MJ6A 4Z7OF 2HJFB 4P3WA 3W5NA 3QAZB 4TSBL 2DQEL 4J8RA 1AR2A 5I19H 5L6YL 1CQKA 15C8H 3L6FB 3VRJB 1UB6A 2CK2A 5E5MA 3JTTB 5DRWA 5H35A 5L2KD 3PV6A 1OAYL 3MFFA 2OLDA 5KSUB 1ORQB 2ADIB 2FBJL 4H1LB 5F89B 4JHZA 4Y88A 1DEDA 1NMCC 3RNKB 2DLHA 1F58H 2BXZA 3PWJB 4EI5A 5JOEA 1NUFA 5BJTA 4ONHB 4DKAA 3RZWA 5C09B 5D9SB 4PJDE 1RMFH 2P7TA 4LLQA 5CINL 2YMXL 3NPZB 3DLQR 5D96B 5KSAD 1T6VN 5I8OL 1MI5E 4ELKB 2UWEE 4AG4L 2HRLA 2NY5L 3NIFE 3N50A 1KCSL 1AO7B 4M5YL 3SDYL 4OT1H 1NEZG 1FG9C 4EN3D 3WBDA 4ZOEA 5JORA 1KULA 2VTFA 2OTUB 1XGYH 3TCXA 3F5WB 1OSZB 4JVUA 2YK1H 3V5KA 4YDLB 1I85A 2IMMA 3RWDB 4YLQT 2GEEA 3V6ZA 1JV5B 1L0QA 2ITCA 4NO2A 2M2DA 2X9WA 4XNMA 3KJ6L 3VXRD 3T2OA 2R2CA 3TN0B 2IANA 4YHOL 5TGBA 1P4BH 2VIRB 4JO1H 5IB3B 2BHUA 2X6MA 1FAIL 5ITBL 4PGCB 2ZG1A 1OCWL 5KSBB 3OXSB 4S1RL 1YYMH 1NFDF 3EIFA 5I1DA 1K85A 2ENSA 4YH6A 2QV2A 4X4XB 1H0DA 4JFQA 3FN9A 1A9EA 4Q0XH 3QI9B 5J13B 3EFDL 1SM3L 3QUMH 1FPTH 2HLAB 3CFBB 4NQDA 1PG7L 3IAQA 3DTXA 4P2QB 5BRZA 4CRPA 1PZ5B 3BWAB 3IDGA 4G9FB 3V4PL 5IW1A 3KVQA 4X6EA 3N1FC 1I9JH 1UVQB 1S7XB 3HC3L 1X5LA 4YBLB 3IETB 3PWNB 5C0AD 5J9PB 1AD9B 2FGZA 4FZ8H 4K7PL 5D6CB 4C55A 4OLXL 2W9DL 3R06B 4MJ4A 3WUWG 2Q7NA 4ZOBA 3DUSB 4PD4K 3RI5K 2MPAH 3MCKA 5EUKA 3DMMA 3VE0B 2FECI 4RGNE 3VXNA 3ZYIA 5B39A 4HEPG 3QIUC 5H37G 4U1JB 4WHYH 4LF3A 5M95B 2ZZUT 3NCYP 4OFYD 3B6SB 4U31A 2J3SA 1RUQL 1NH6A 3C9NA 1QHOA 4ODSL 1CGSH 4QHUB 4M8QA 1DL7L 5ESQB 3C5JA 5IT2H 3OJ2C 3JWOH 4L4VD 4XNYL 1OP5H 1X6NA 4OQ1A 5I18L 1YPZB 2H2PD 1MNUL 5ICZB 1DDHA 3MODL 1RD6A 2IBBA 1TITA 2R29H 1PQZA 5C0JA 5T1LA 4HWZA 1JIBA 2XTJE 4X7SH 5F7NC 1F4YL 1FORH 3P30H 4PJ5D 1MCHA 4KU1A 5JQHC 1CLOH 2VZ1A 1BZ7A 3IS1X 1DQQA 3I9GL 3JWDC 1WFOA 1DLHB 2PYEE 4P59L 1CFTB 1KCUH 1TVHB 5DWUL 1VADA 4HWBA 3QQ3B 4YFEA 3ARVA 4X5WA 1P6AB 3U6RA 2IPUG 3V0VA 1E27A 2DQUL 3VXPA 1RZ7H 1BLNA 1F97A 2KKQA 4EXPX 1EK3A 1YMHB 3ARFB 1TENA 4FTVE 4F7MA 4NM8H 1I3GL 3GBLA 3SE4A 2NY1D 3GSWB 1XZ0A 5KTEH 4PJXE 3VWJC 2UY7A 3EYQC 4IIQB 5IBUG 3GK8H 5FYLL 3KPPB 4CU7A 1UCBH 4L3CA 3ARDC 3WIIL 2VLME 5D1ZA 5GGRB 4JG0H 2V9QA 5F88B 1IAIH 1LHZA 1WCBB 5FK9A 3VXUE 4D9LH 2VKWA 4HGWB 5K9QI 1JNNL 4S0UC 4GKSA 2Y5EA 4PJ7B 4U7SA 4UBDC 5HPMA 3E3QA 1RK0A 1JYXA 3DSFH 3IDIA 3SJVE 3SOBL 4RMQA 4GUPB 1AQDA 1S9WB 5HYJB 4L3EB 5JR1L 4WVRA 1H5BA 3RWHA 3WS6C 3E6FA 3KPRD 4EUPA 3L5WA 3QWRA 4J7RA 5T5FL 1R3IL 3BXNA 4HIXL 3VU2A 5CD5D 3GNML 2VL5A 1BEYH 1MVUA 4Y19A 1JFQL 2D7OA 3BPNB 4X80L 3BZEA 1AKJA 1JJUA 3MA9H 3MV8D 2HTLD 3L95B 3AS1A 5DK2B 4NHUB 2YPLE 4DKEL 4P2OB 2ZUTA 2HVKB 2QKIB 5ID1A 4HWBL 1FRGL 5E8OB 4U6TA 1NLBH 2BVOB 2VQ1B 4Y4HC 4QTIH 4KFZC 3SDDC 3H3KA 4XPAH 4XP9L 3VWKD 2X9YA 1MAMH 3CFCH 5CBAA 4M61A 4HXBL 3QUMB 1T0PB 2QQNL 4NZJA 4X0KB 1K8DB 1MEXH 4S11A 2BDNH 2VLKD 3B9EA 4PY7A 4MAUH 5ADPH 3HPJA 1L7TL 1S7RA 2ORBL 5L2KA 4JRXB 1UA6H 5DJCB 4OZGB 5EC1A 1TJGL 3PDOA 1LEKA 2MHAB 3LIZL 3TF7A 1MREL 3P11L 5C92A 5B38G 3UTQB 2IALA 4FFZL 4RIRA 3UBXI 3UO1H 1T21B 4JQIH 2GJ6B 3ABZA 2J8UA 5F7LB 5FO7B 1UCTA 2WANA 5HGBA 1MUJA 1T7ZA 3F7QA 4F2MB 2Q8BH 4Y5YB 2D03L 1T04B 5KSAA 1MCCA 2MQCA 1XGQA 2YXMA 1HN1A 2H2SD 4YC2B 4WJ5A 2VDML 2VN4A 4H5SB 2ZOLA 1LVEA 35C8L 4NQED 3RZCB 5DEZA 4QO1A 4UAOC 4W68A 1FL6A 1XF3A 2X5PA 5DJ2A 4LCYB 3CDGA 1JK8B 5EU6E 1FVCA 1EJ6A 1YEGL 4Z8FH 4OZIE 2DIBA 3QISA 5DJ8A 4DW2H 3EOAA 1L9NA 3OGOE 3VXRA 4OCRH 4Q2ZB 2PNDA 2CPCA 3N06B 3K8LA 1LEGA 2DQCL 4LL9A 1I1RA 1RIUH 2WWKO 3WFZA 3TN0C 1C1EL 1UEYA 1J88A 1BBJB 1FFPA 4UB0L 2D7QA 5F3HB 5DA4A 5C0FA 2BHZA 1FVEB 2V7HB 1N3NB 2EIEA 2APTA 5L2JB 3SDAD 4ZFFA 3QI9C 1I1YB 2Z4QA 5J13C 1T6WA 4GKNB 1P5UA 4Z7QE 3DGGA 5F9JB 4BH8B 5HD8D 5L9DH 2VKXA 1SJEB 4JRYB 1KYOK 4MA7H 3BDYL 5DJXA 2DTSA 3GUTA 3VG0L 3E6HA 5JW4R 2EDRA 4BKLB 1UWGL 4MVBC 1FO0H 3KDMA 4KDVA 3X14A 3MGTA 5C0AA 5JW4M 4K2UH 4DZ8B 3FB6A 4QRSA 3UYPA 4YWGL 2N56A 4G42A 4WDIB 4CDHA 4D3CH 4KMLB 4FQJL 1KB5H 3WDIA 4AJ0A 1F4WL 3V52H 4TUJA 4NPYA 3G5XA 1JGDB 2WUBL 4YX2L 4WU7B 3RKPA 3VFNA 2HG5B 3QIWC 4XP5H 3FO2B 2JCCB 4GW1A 1URLA 4JGJA 3BRDA 4ZS6C 3ROLA 3I84A 3DVGA 4LRNL 4OFYA 1Z6JT 3GI9H 4G5ZL 3GHBL 5I8CA 4UINH 2GYSA 5I1IL 1ZMYA 5T1MA 4LPWA 1KTDB 4MA8L 3MUGA 1LWRA 4BFIA 2NY7L 2BOBB 2HFEA 3WDJA 5IWLA 3H9SD 3P4NB 5FA4A 5I1KH 4L4VA 4JO2H 2KBGA 3VGAC 4ODUB 4PR5A 5D7JB 3OPZL 5ITFB 5BVJB 3L3DA 1AC6A 2RFXB 3CFJB 3VXSD 5AWNH 3W11D 4ODXA 1WC7A 2IWGA 4JCMA 4WU5B 2J12B 5ENWA 5LQBL 5EUOF 3FB8B 3TBYB 2AJSH 3KPQB 4GAYB 5DD6A 4HD9A 3NFPB 3WS3B 4PJ5A 2BNQE 2HJLB 2YD2A 2IAMB 2EDWA 1JGUL 2SEBB 4NWTL 5FHAH 2Q8AL 1TZIA 3FT3A 1KJ2A 4TVSa 3L1OH 3FOMA 3O2VL 3KYOB 4GRWH 3FT2B 3B4NA 4ZS7H 2VE6A 1E4JA 2JTDA 2NY0D 2CDEB 2OCFD 3H9HB 1RUML 3ZTJG 4HS8L 4X8JA 2P46B 3GBNL 3HPLA 1T0NA 3PWUA 4KKLC 1P4IL 3PL6B 1EEZB 4U6HA 4X7FC 4MAYB 4M02A 4PDCE 3O0RH 1S9XB 3U4AA 3PJSB 4OLZH 3DBXA 2NW3B 4NM4H 1G7MB 5E8EA 4DUVA 4OZFA 2QBWA 1GGCL 5TQ0L 2MCPL 2CDFA 1IC5L 3MJGX 4IIQC 2C4FU 3KPNB 1EO5A 3S96B 2VITB 1A1OA 2XWJB 5FGRA 1CI5A 2ARJB 4R97B 4WCYL 5BW7C 4LNRB 3BKCH 3QEQA 3QXUA 5GRWA 5DUMH 2EDKA 2X42A 5F96H 1D6EA 4RAUB 3FOLB 1FYTD 1JHLH 1R3JB 3NN8B 3SDXB 1HHGB 2G9HB 2HFFB 3Q5YA 4WUKL 2FGWL 5E94B 3QNXB 5CBEA 3DV4B 4OLYL 2NMSA 3U7WH 5I1EH 3OQ3B 4YHLL 4HUMB 4OJFL 4R3SA 1QSEE 3D9AL 3L3IA 3QUXC 3O4LD 1PZUB 5L8LB 3HZKA 4JFXB 1VACB 2C1PB 4GW5B 3MV8A 4XNZB 2XN9D 4Z76B 1GL4B 3VG9B 5H94A 1II4E 1YPZE 5IVXB 1HHIA 5DD0H 1UQSB 1JZ6A 1CE6B 1JPTH 2QQKL 3VXMB 1MFBL 4M7ZC 4P2OC 5DK0B 3UXFA 4GKOA 2EECA 2NY4B 4JFOB 4NN7B 4YAQA 1UWXK 4NRZB 2AGJH 1U58B 1GC1L 5KANI 3O9WD 2VLKA 2R9HD 43C9A 5BVPH 5IBTH 5T5NG 3O8XB 1GGIL 2QJDA 2RBLA 4NWUL 2O5ZL 4HWUA 2JIXA 4Y5VB 4FXLA 3HI6H 4GT7A 1U3HB 1A6AB 3MV7D 4LLVB 4MMXC 1XFPA 5CSGA 1FNAA 1FO0B 1T3FB 1CFSA 4PLKC 1XGTA 1XH3B 4JJ5A 3WNPA 1FNGB 3MROB 1JTOA 3GMMA 4ZFZA 5DMIH 4X7TB 2LE9A 5C0EB 4NT6B 2F54B 5TE7L 1KB5B 1WIUA 2YC1A 3EGSA 4N5UA 4NNXB 3OMZA 2UVFA 4EDWL 5MHSE 5CEXA 2GTZA 5HYSB 4HSQA 4WRLA 3LQAH 4KVCL 2FWOA 1D5IL 5EOTB 4UDUA 2IH1B 1BOGB 4XI5C 3WFCH 2PXYD 4YC2C 5JW5A 3DROA 5GGVL 4NQEA 1P6FA 5ABDE 2V2TA 2CDGB 1BX2A 2VDOL 3RZCC 5ESVA 4EBQL 4TUKH 2ZCHL 4I4WB 3T8XB 4CN4A 4MXVF 2FL5A 4PREB 1M6OB 2X89D 1X5AA 4PLJD 4QHNA 1JN6B 4UZGA 1MCWM 3HAEA 1OSPL 5FUZH 4IRSC 4M00A 4ALAL 2AJ3A 1HIMH 1VA9A 2J88L 1EAPA 3FO0H 1Q72L 4NGHH 5FHBH 1BQSA 3ZSTA 3L5XH 4G6JH 4UV4L 3C6LB 3GMLA 5CJQL 4Z0BL 2CMRL 5T33L 1BP3B 3VGBA 2R4SH 3BYYA 1MRFH 2WIIA 5TDNA 2A9NL 5CLTA 3HFML 3V5HA 1QLRB 4KMTH 1GIGH 4LEOB 3MREB 1IGCH 4JFDE 3V4VH 4HG4J 4JFED 4YDKL 1ZLUK 4FS0A 4OFDA 4F7EB 4N90D 2DD8H 4MHHG 3NCMA 1IGJA 4GRWB 3S3JA 2BSTB 2X09A 1S8DA 2ZNXA 3DO7B 1QVOA 3KPMA 4K55A 4OUUB 2AJZB 1HXMB 5E6ZA 1EO8L 2J4WH 1ZXQA 4HBCL 1D5MB 5TE4H 3BT2L 2NYYD 3DETD 1CFNA 5INCA 4MCZA 4CVXA 3IB4A 1T0MA 1ZS8A 2BX5A 1QSZA 2IC2A 1KCVH 4Q9QL 2ATKA 4YQXL 1NCAH 3QFJD 3QT2A 4NQVA 5B8CA 3PGFH 4R7NB 3L7FA 1IT9H 1NC4B 2Y5TA 2CUMA 1PDKA 5I15L 5CJ8A 1N7MH 4M3KB 2FECL 4AIZA 2YA1A 2UZIH 2OL3H 4HZLB 2A83B 2AQ1A 4I0PB 4C56B 1RJLB 2A77L 5EUOA 2V2XA 1JWUB 4LHUB 5CP7B 2NXYB 3WL9A 4KJYA 3VW3H 4HT1L 2HLFC 1NSNL 2J6EA 5A16A 2F53D 1K8IB 1MJ8L 4QXTB 4WHDA 4O4YL 3C6SA 1A8JH 5K9KB 4LLYB 3P4MA 2A6KB 1MFNA 1DR9A 2GSGB 4I3SL 4P2RA 5C3LD 3RGVC 1XF5B 3TH3T 1GOHA 3KLHD 2E8ZA 1S5HB 2JB6A 5DQDH 3JV4B 4JPWL 1CDHA 5LKNA 5H8DA 1B9ZA 2OJZL 3FT4A 5E5UB 1INQB 2JJTA 3H9ZA 5D70L 3O41B 3LRSB 1A7NH 1MWAH 2IQ9L 1R5VA 1PD6A 1ORSB 5BV7C 4M4PA 2UV3A 3B83A 5J1AB 4RZCA 1T20A 4HPOH 1BECA 3MLYL 4XXDB 1JZ4A 3GSUA 1EGJA 1NBYA 1YEIH 1IARB 1WEJL 2BSSA 2YD5A 3B9DA 4ZQKB 4HC1A 3FFDA 2PYFA 3VFTB 2IAMC 2K7PA 2R2EA 4I77H 1MHEB 4RWYL 5CJ5A 2JELL 2VH5H 2LAGB 4FQXB 1P1ZB 4LEXH 3RJDA 4O5LL 1JZ8A 4L9LB 2UYLB 1FH5L 3BWUC 2GFBB 1FBIL 2RCSL 1WWCA 3DURB 3BKJL 5DJDA 3WFHB 3QA3B 3C2AL 4LLUB 5EZIH 3PL6C 3C60A 3CUPB 3HLAB 3QPXL 2ESVB 4MAYC 1WBZB 2IG2H 2EE3A 4M1GH 5D2NA 4QTHB 3IJSA 3NABH 4PJIF 5BRZE 3U83A 1TMCB 1CTOA 3QUZB 2CQVA 5J3HD 3T3MF 4O02L 1CL7H 3UBXA 5CEZL 2IFFL 2HT2C 4GOSA 4XHQA 1PLGL 4B0MM 4RGOH 3D69B 5E2UH 3EYVB 4FXKB 4R97C 4Y2DD 3O2DH 4L8CB 3Q3GA 4LRIC 1NCDL 1FYTA 5MERA 3STZA 4K3HA 4L8BB 5C8JA 4ZO9A 4K23H 2B8OT 4NIKB 2WBJD 3CSYA 4JPKL 1QG3A 3SGEI 4DGVL 1CGUA 5GJTH 2Z8SA 4NBZB 1I7TB 1DBML 1BJ8A 1EIBA 3T4AA 2XPGB 5I16B 5CEYA 3HS0A 3JVGA 1AGBB 4G80A 5C6TH 2XN9A 3MUJA 1UYWH 1OGTB 2L4OA 2MQ3A 1XT5A 4LMQI 4ZYKA 5FYLE 1MHCB 4P9HH 1F6AB 5JO5B 5CEZH 3ZL4H 1NMAH 3P0YH 2R4RL 4GSDH 4GG6B 4PJAB 3TT3H 3MX0A 7FABL 2WQRA 4UV7L 3ARWA 3HMXA 2X4OA 5KW9L 5EFIA 1A4JB 1ZOXA 4UT9L 5EOQL 2NY4C 4NN7C 5DMGC 4N0YL 3O3AB 1BPVA 3O9WA 1G9MC 4CADB 5F93C 2HRPH 5J06A 4DK6A 2IBZX 2EIZB 1QPPA 12E8H 3UZQA 1AGEB 1WCQA 3O8XC 4KI1A 1GPOL 2DJSA 4XWGH 4V1DB 1RJZA 2ZJSH 1Y6KR 5SWZB 2OTWB 4OCYL 3S9DB 4Z7WB 4GQPH 3MV7A 4M6MH 3EZ8A 2QADB 4KH2A 1TQCB 2BK8A 3DX8B 4ZDHA 2PN5A 4GMTH 2BFVH 3IGAA 2MKLC 3UTTB 4R6UA 3BRFA 2XRAL 4KQ4L 5FYJL 2EO9A 5EWIH 3I02A 4HGKC 1A0QH 2LTQB 4ZTOH 1F3JB 1HQ4B 2WUCH 4PUBH 1QBLL 2BOCA 1T4KA 1ZTXL 2OL3B 4U0RB 3QNYA 1JMZA 1IQDB 2N7BA 3CZFA 5E99H 4QRTA 5E6YA 1I9IL 1JNHA 2PXYA 3C5SB 1KNOA 4U1IA 1I3RA 1AGDA 1VGKA 2K7QA 3PGDA 3D85D 3HC0B 1YECL 2VLJD 2FEDC 3VFGL 4JGMA 5J6HB 2DDQH 1WBYA 3PQYB 1ZK9A 4NZUH 2R1WA 1H3UA 1TCRB 1KBGH 4U3XA 2EIBA 1Z0MA 3HB3C 4TTDC 4XHJD 5B4MC 4G8FB 4GKZB 1J1OH 3V6OC 4M7KL 5HTSA 3E3QE 2BVYA 2BVTA 4HEME 4E42B 5IQ9A 4FFVC 3C6LC 1MWAB 2OSLA 4HIHB 3MNVB 3BP5A 3OKEB 5HHNB 1ZVHA 3CCHA 4BSJA 1C5DB 1ACYH 3UMTA 4ZNCD 3TFKD 4Z7OE 1U8IB 3I6KA 1PY9A 3HZVA 1AI1L 2AJXH 3IXAA 4I1NB 1DLFL 1M4KA 4QWWD 4KTEH 1T1ZB 1IKFH 4S1DD 2AV7A 2DQGL 2X1XR 1S9KC 3C5ZB 3RVXC 4CDGC 2IQAB 3TBVA 1UGNA 3VFPB 4DN3L 4ZPTB 4J3XA 2A6DA 1T7WA 2R15A 1VFUA 1ZE3C 4NSKA 1JFMA 4PP8C 2X70B 1LO5A 1MPAH 3TO4B 2EXWD 4H0HB 4YPJA 2I9LA 4XCYB 3EJYC 4P4KC 1YEEL 3BN3B 4HHAB 1EFQA 1U92A 4K7FA 3X3GH 1B0RA 5DD5L 4HJJH 1DQJA 5FUCE 3GHEH 4NJ9L 3LSOA 1LO0H 2YN5A 3QFJA 4MB4A 3CVHH 1AQKL 3BSZH 4C83A 3QWQB 4Y16C 1V7NL 4BQCA 3ALXA 1WJ3A 1G6RH 1G7JB 3NMEA 2XFXB 1QA9B 3FONB 3PGCA 5DYOA 3RRQA 5ICXA 1MFEL 1BAFH 4F58H 1R5WB 2NXYC 1RZIA 1KXVC 3G6JF 3T77A 4RMSA 4BFBD 3KR3L 1XF2B 2QSCL 3LHPL 1X7QA 1TIUA 5IB4A 2Y7QB 5D8JL 1OAZL 4DCQA 5EZOL 1NFDE 4WENB 4LAQH 3MJ7B 2BMKA 1MFDH 4JPIB 2GT9B 3D5OF 4PD4J 3I6LD 5IEKA 2GAZA 2OJEA 4KDTC 3WHXA 1JPFA 3RU8L 2W65A 1J1PL 3D25B 3IDNB 3S4SA 3SKNB 1LQVA 4PJIA 2VC2H 5I75C 4FG6D 1DUZA 1LO3L 1S5IL 1UM5L 3CAFA 1KIPA 2V7NB 2QSCH 5HJ3B 4WW1B 3Q5OA 4UOJA 4TNWF 1QBAA 4FQXC 1MIML 1NGQH 3SQOH 5LWYH 5KVGH 1BVLB 2DQIL 4R4BA 5I1AB 3VXQB 1JNLL 3NZ8B 4P49A 4HDIB 3TA3C 1ZA3A 3MLTB 5JA9A 4UILL 3IXTA 3QO1B 1I8IA 4DEPC 5GZNC 3BKYH 1RK1B 4KDWA 4NUJB 5A2IH 5IHBA 4KTDH 4U6XB 1QRNE 3GRWH 1P9MA 2EZ0D 3HNVL 4ZSOB 1DBBH 4P46D 3AS0A 3QUZC 1EHLH 4QRRA 2AI0L 3LD8C 5JXAL 3KYMA 1U8KB 2X4UB 4Y2DA 1LMKA 2I24N 1MCNA 1HOCB 3TH2T 3HRPA 2WINA 1NGPH 3F8UB 5SWQA 5HGHB 2MMXA 4GG8B 1RULL 3H7BB 1ADQH 2AXGB 2WBJA 5B3NA 2VZVA 2VYRE 2VR5A 4M1DL 4PG9A 3LOWA 4TSAL 3WMSA 4NZDA 3TYGH 5CAYB 1EZVY 5CGMA 3MRFB 2GY5A 2ZUYA 3QDGD 4GJTB 3SY0B 4OIBA 5K33A 3BGMB 5J11B 3ILPA 3C8DA 3UTSD 5FF6A 2RIKA 4WUUD 4Y8DC 3B3IB 5A2FA 3WXVL 1HSBB 3TCLA 1J8KA 3MLWH 3MO1A 4U1NA 4KVNL 5JNYB 4G59A 1S7QB 3FTGA 5IEHA 5KS9A 2XTJC 4BQ8A 1KEMH 4NYLA 3K80A 3OKMB 1MH5B 5DRXB 3OWEA 4L4VE 4RA3A 2YPVH 2CIKA 3HG1E 1ZHKB 3VH8A 2B2XH 2YOCA 1UZ8A 5IMMA 4NQXB 4ETQB 4L3AA 5ANMB 5HDLA 3B9AA 3KJ4C 4ODHL 5D2LF 3T0WA 3IKCB 4G8EB 3QSKB 1W0VA 3OB8A 1RIHH 1HINH 2QTEA 1IEAB 4PJ5E 4PJBE 1K4DA 1Y0LA 5F7FA 3VFWA 3G5YA 3TJHD 2QADC 3AGVA 3WNKA 4AT6A 4KGJA 2BHYA 4H1LG 4Y0GA 3VMOA 1B3JA 1A1NB 3CVHB 4R0LB 4J3VA 4U6YA 5GRJH 4KHTL 1BIHA 2LTQC 2RQ8A 1JZ2A 1BZ9B 3GZKA 1KCGC 4LSSL 4KY1H 4PRHD 3RNQB 1G6RB 2R0WL 3CPLA 4RX4A 4U0RC 4Y4FC 4HXAH 3I50H 1T5XB 1EBPA 5IVZB 4JCLA 1DVFC 5ACMA 3SE8L 4MXWH 1A6VH 1FZMA 3GM8A 3D85A 1OF2A 2WQ8A 2W59A 3S5LA 3LCYA 4K9EL 2VLJA 1TVDA 4MX7A 5IQ7H 2ZG2A 4XPTH 5IB5B 4AZ8A 5CUSH 5A2LH 2FO4B 4WWKC 1CDGA 4I2XB 1ZEAH 4HFWA 2HKFL 4YE4L 3INUH 3JXAA 4GXVL 4OQTA 4QXUL 1CLYH 1I7ZA 5JMOC 3WSQH 2EYRA 2P1YA 4HFUH 5BMFL 3MUY1 2I27N 2Z93B 4NUGH 4MQXC 2ZKHH 3U30B 1Z9OA 3RI5F 3QRGL 3QCVL 1SQ2N 1F45A 2D4DA 5D93B 2NPLX 2AXHA 2R2BA 2W91A 3TFKA 3KPRE 4TVPL 3NCJL 2ED7A 4LVOC 4K3JL 4ZMAT 1QFPA 4GBXB 5GISH 3ZKXB 3TZVD 3D87B 1R3LA 2FX9H 2EXYC 3C5ZC 4X5XB 1P4LB 1NAKL 3G04B 2P5WD 2M26A 3GSQA 4KK5C 1GCFA 4XZUA 1FNSL 1MLCB 3WYRA 3ECBA 4NQCD 5FCUL 4PRID 1X3DA 1N0LA 2I25N 1NEZA 3G6JA 4Z7VB 5JUEL 3TO4C 4NBXB 3KWWB 2HFTA 1J8HA 1KTLB 1EMTH 3HZMB 4NFDA 3JTSB 4OGXL 1WITA 2X4TB 1MJ7L 2YXFA 1T1YA 1F3RB 2MFNA 4MXQD 1B4JH 2VLKE 3LEYL 2Z8VC 5GS1B 3KS0J 1I4FB 4U7KA 1MHHB 4K94L 1KLFA 5FB8A 4KHXH 2LU3A 1OARL 3LEVL 5D7LB 1K6QL 1X4XA 3HE6A 5F6HJ 5J4MA 3BESR 1KYOJ 1DE4B 4J12A 4P5TA 2DLFL 1LK3L 2XY1A 5EU7E 4X7DC 1WT5C 4TTGA 1EHXA 4OB5L 4XRCA 1W72A 1KJVB 1JYVA 1LGVA 5FFLA 3KXFB 1YMMB 3PQYE 1KPUB 3SCMC 5IKCB 4N9GA 4ISVA 1LILA 5GS0D 1LDPL 3OXRB 1HHJB 2PO6C 1ZVSB 4NQEE 4FQLH 3LKNB 1ZT1B 3AUVA 2G75A 2Y72A 2R0LH 3WIHA 5E8DL 3G6DL 3BPLC 3EOTH 4M1CD 3D39D 1V7MH 2Q76A 5BZWA 3BPOC 4PJFB 3KAAA 3PWPE 1RZ8B 4M3JA 1UH2A 4XPHL 5HHMA 3A6CL 1L7IH 1D6VL 1PYWA 3GJEA 2JF1A 3MACL 1NGXA 4P5MA 3WUWA 4FQIH 2DOCA 5I30L 4G7VH 4Z7UF 4ZTPL 3U4BH 4L4TD 1JYWA 1XIWD 5IW6B 3Q1SL 2A9ML 1YNLL 1IAIM 5F1IA 4QXGL 3MA7B 1FZJA 2NLJB 3G5ZA 1DBAL 5F9AC 1L4IA 4M93B 2NY6B 1S9VA 5JW3L 4RSVA 4HH9A 4P3CL 4J8RB 5HDQH 3ZSSA 1CICD 1LE9A 1AE6L 1UB6B 5H35B 3PV6B 1W72L 2FZ3B 3MFFB 3T1FA 4DZBB 3OX8A 5AUMA 2C1OB 2D4FA 5CJXA 2PTTA 4EEEA 5T1DL 1OP5K 3V5DB 3ZDZF 2DKSA 5JZ7D 5EO0A 3I3EA 1MCOH 1OGAD 1SBSH 2C26A 4LLQB 3QULA 5ISZA 4ORGA 2ZP0T 5A3IC 1SYVA 5AG8A 4XVJL 1JRHH 3SE9H 3HNTL 1OB1A 4X6DF 2Z35A 3QDGA 1MCBA 3KPTA 2BSED 5EUOE 1OOAA 1T1WA 4MJ5B 5GS2D 4G8GD 4WUUA 5T3XD 1M7IA 5J11C 3O3EB 3V5KB 1QTYT 1BBDL 3GGWA 3MOBH 1N5YH 5JHLH 1WIPA 4FQ1H 4XAKD 3EJZD 3HNSH 4NO2B 1FG2B 1ZANH 2H1PH 1F8TL 3QUYD 4AMKH 3V7MA 3H9SE 2IANB 4LSVL 5TGBB 5C3TA 25C8H 1GRWA 5HYEA 5F70A 3MV9D 4N0UE 5DI8A 2BJMH 5F7DA 4JM2D 4PTTA 4AYFA 2ADJA 5FYJU 3MZTA 2Y07L 3VXSE 1YY8A 2HT3C 5GSVA 5I1DB 1V3JA 3RX7A 1AHWC 1RUAL 5JW4N 5KVEH 2VZ3A 5IMLA 1H0DB 3QIWA 4JFQB 3HR5A 4NP4H 4TSCH 2B4CH 1FJ1A 3U2SA 3WD5L 3TJHA 4JLRB 1GAFL 4NQDB 4U2YA 5EU5B 3QG7H 4ZXBD 1A7QH 3DTXB 5DFVD 1ZA6B 1JE6A 5IW1B 4YBQC 5E5RB 1UM4L 4QT5B 1L8JA 1AC0A 1BM3H 2ADFH 4X6EB 2CO7B 2OI9A 4PRHA 4N8PA 2X4NB 5HY9A 3BEVA 2IPKA 4YGAB 2X4SA 1QBMH 4UTAH 3RVUC 2R8SL 4JM2F 4XPFL 2HVJB 4KRPD 3S35H 5EOCL 3QJHB 5GRVL 4GLRI 4E41B 3PWLB 4P23D 4DFHA 1AFVL 4JHAL 3GSXA 3UJTH 3NA9H 5FYKD 4EXKA 1IBGH 4XNQA 4PRAA 3QZWB 5DUPL 2GITA 5EUKB 1CLZH 3QFDB 1BGXH 4PY8I 5C08A 5B39B 1U93A 3I6GA 4RFOH 3VMPA 2JJWA 3ULVD 3MRKA 1K4CB 4LF3B 2E7LC 2G5BA 5IW3A 2NX5A 4Q6IA 1LDSA 3EKCA 4LCCB 4WI5A 4LDEB 4WWID 5FYJE 3BD5A 3U30C 4HKZA 4KKNA 1QNZH 4RDQG 4OGYL 5D93C 4JN2A 1BWMA 4OZHF 2HKHL 3EOYG 4M8QB 1YYLH 1SY6A 4WTZG 3C5JB 4R4FH 2JJUA 3LKPA 1QUNA 1T80A 5TFSH 4PJ8B 5IJVB 5C0CA 5E2VL 3O4LE 4GBXC 3ZKXC 1YNKL 5HVHB 2KPNA 4PJ9D 5IBLD 4LLMA 1DDHB 2P5WA 4NNYA 2XN9E 5JIPA 5ERWA 3QO0A 4YXHH 7CGTA 2DYPB 3TV3H 4PRIA 2A0LC 4HWZB 3ULVF 5ANME 5BW7A 4G6ML 1O0VA 3EDEA 5T5NF 1AR1D 5FGBA 4PRDA 2VDKH 3LQMA 4P5KA 5DT1H 4OF0A 4N1EA 5D5MF 5HI3C 4B50A 1VFAA 2QQLH 4O00A 4MXQA 4X6CF 4PY8J 3U7YL 2KZWA 3V0WH 1C7SA 3L5HA 3BAEH 5GZOC 1VADB 1FCGA 4TOYH 5GS1C 1F13A 3LQZA 4X5WB 3V4UH 3DOSA 2DLGA 3TM6A 3VXPB 1HKFA 5BQ7A 2J2ZA 2AJVL 5LXGL 1BLNB 1Z3GL 1FNHA 4UTBH 3NGBB 1OTUD 1VDGA 4MXVE 1ITBB 4AM0A 3SKOA 3VCLB 4OCXL 1C5CL 5CZVL 1VFMA 2NY2B 5IFHL 4LCWB 1XZ0B 5D1XB 1MCFA 2Y6SD 5CHNB 2E27L 1CG9A 2FJFA 3T2QA 4L3CB 1T2XA 4NZRL 4PRPD 5LG1A 4ETYA 2NTFB 1OTTD 5DJZA 4Z7UA 1UWEH 3G9AB 1MIEH 2VB5A 1W8OA 4GKSB 5HPMB 1RK0B 4JZNA 4PP2A 1AQDB 1I8LA 4I13B 4IHOA 1BQLH 4G43A 4KUZL 1H5BB 3E6FB 3QQ9C 3L5WB 3BXNB 3D39A 5D71H 2OTPA 5A2JH 3I75B 2VO5A 3SBWC 4JY4B 2VL5B 5JPMA 3V8OA 1D5BA 3KPSE 2DMKA 3QEHB 1INDH 2AK1H 1N6QH 1ZHNB 1FFNA 2VZOA 4G7YH 4OD3H 3V6FA 5JOPD 4OM0L 4NDMB 4MLIA 2H32H 1QFUH 4L4TA 4X9BA 1XIWA 4JFZL 3CX2A 4M5ZL 5E2WH 4KKCD 1B2WL 3X3FH 3X13A 4LPXA 4JFEE 4M61B 1HYSD 3T2NH 4DN4L 2CK0H 3Q6GL 2PW2A 3S36L 4IS6B 1EPFA 4YHNA 1KJ2H 2JB5H 3CK0L 4M93C 4QY8A 2MJWA 2XWTA 4TPRL 3QXAA 3FAWA 4X7CC 4RBPK 3HPJB 2VLRD 1L0XA 2ZSVB 1CFVL 4W4OA 2W0FB 3QIBB 5EC1B 3PDOB 3QDJB 4J1UA 3VD7A 2IALB 4RIRB 1YNTA 1YEKH 2VDQH 4RISL 2G60H 5BXFA 1KELH 2J8UB 3MGAA 4OZFH 2HFGH 3NBNA 4EI5C 1LE5A 5GIRA 3M17A 4BSWA 3WFEL 4YJZL 1MUJB 1Q0YL 3L7EA 5DK3A 3VFOA 3U48A 1IGIL 2FHFA 2P24B 4OSUH 4Z77A 4YHZL 4BZ2L 1S7TB 3CZJA 4OLVL 3RP1A 3W39A 4WFED 2BNUA 4OGAD 2DICA 4R26L 4AEIH 1ZVYA 4XP1H 3AXLB 2NY3C 4RQQA 3JWNC 3EYFB 1JGLL 1F90H 2DI7A 2P48B 3MLSH 2HAZA 4G8GA 1NJ9A 2IH3B 4YXKL 1J0HA 5I73B 4NCC2 5EBWA 1XF3B 5IFAH 1H8SA 2F53E 5DJ2B 5EA0H 4DVBB 32C2A 2BNRD 5I1JL 1I85C 1PX3A 1FVCB 3DI2B 4HS3A 3SKMA 2BVPA 2F5AL 5DJ8B 3EOAB 5TPWH 3VXRB 4UT6L 1E6OL 2R1YA 3W0WD 4QKXB 1AXTL 1LEGB 1CD1A 4ZO8A 4G3YH 4LKCA 5IHLB 2J8OA 3MV9A 2CJUL 2C3XA 4APQD 2XKNA 1FFPB 4J3WA 4PJEF 5C0FB 4FQPA 3WNNA 3S3PA 3KNBA 1Q0XH 4MJID 5AAMA 2ED9A 3L5JA 1N4XL 1D5ZA 5MEPB 2P42B 2DM7A 4NOFA 4FQQB 5EIQA 4PBWD 4UQ2B 1JGLH 1QSFD 4XTRC 3GJFA 4U1GC 3T3ME 1RHHA 3I2CH 3FB5A 4I9WD 4ZXBA 3FN0L 3D0LA 5DJAA 3ZT5A 3CX5K 3DUHA 1N5AA 3MXVH 1CF8L 1FL3B 5GGTL 1W0WA 5DJXB 5GJSL 3GSRA 1YEFL 3E6HB 5AZ2H 5JW4Q 1JGVL 1KLGA 2EH7L 4FP8L 4OZHA 4U49A 2EC9U 4ERSH 3DVIA 1A7RL 3KDMB 3X14B 3MGTB 5C0AB 3BKMH 1NCWH 1IGMH 1D9KD 5HYSG 4XPBH 3FB6B 1T2QH 2CIIA 4P23A 5T3XL 3NIFF 1OP3K 4ZUTB 3LS5H 2ZCLH 1LO4L 3EHBC 1J0YA 1JHKL 3OR7A 4P4RB 2YPKB 3S7GA 1UM6H 3L3GB 4NPYB 2E7MA 3U46B 3DMMC 1ETZB 3OAZK 3BN9C 4MD5B 3EOBA 1KFAL 4GW1B 5CP3H 4WI6A 3ROLB 3UTZA 3WFBL 3DVGB 3O3BA 5E0QA 4WGWB 5I8CB 4WEBL 4XWOD 2UUDH 4WV1A 5T1MB 5D5MA 5J0BA 3MUGB 2VDPH 3QHZH 4BFIB 1C12A 1YN6A 4X6CA 2HFEB 1BD2D 2VLLA 1GOFA 1MCKA 3BUTA 3HAEH 3MBXH 4QRQA 3QBTB 5FA4B 5HYIA 4X98B 1ES0B 2VXTH 4PR5B 1VPOH 4NCDA 4PJ9A 3MJ9A 3TIDA 4WNQA 4KI5C 1RURH 1YJDL 3H3PH 4KK8C 2H32B 3S34L 3OBAA 1PG7W 4MB5A 1MHPH 4ODXB 1T22B 5ENWB 3QPQC 5K93A 1G7QB 4YHML 2F8VA 1FL5A 4RGND 3RL1B 2YN3A 5EBMB 4D9QD 4POUB 3X12A 2C7UA 1IGTA 2VUYA 3FT3B 1KJ2B 4MDJB 3GSNA 3QEGL 1M7DA 4BZ1L 1YEJH 1EJOL 2VE6B 5DFTA 2P5ED 1FDLH 2VSDA 4NNPH 5HVFB 5FYKL 2B1AH 4TVPE 4LCIL 1T0NB 2ZUXA 3PWUB 4Q9CA 3PXJA 3JTCA 4U6HB 4XMPH 1ZLSH 2F5BL 1ODAA 2GSIA 2Y36L 3DBXB 3G6AA 3NGBC 4BZYA 1A3LH 5E8EB 4QHKJ 1QO3A 1PKQB 4OZFB 3OJMB 3SE4C 2NY2C 1KIRA 1HQRA 5C6PB 1CDYA 4LHUG 4YGVA 1QR1A 3OGCA 5TDOA 4LOUC 4PRPA 3NACL 4RMTA 4M7LH 5D1ZC 1A1OB 43CAA 3E8UH 3ISWA 1NFKA 2APXA 5JDSA 3NFSH 3QEQB 5K59E 1OM3H 4WTWA 3SDCB 3E3QC 4KAQH 4GMSH 3UPAA 2J6EH 4CMHB 2PYED 2IGFL 1T03H 1IAMA 3GIVB 3MLVH 3RX5A 1H5BC 2NXZB 3IDJB 5CBEB 4M62L 1BF2A 4CAGA 4GAGL 1TZGL 4R3SB 4PB9L 1P7HL 2A74A 4PGZA 2WW8A 3QDMD 3OTTA 3VFUA 1MSPA 3HZKB 3BUYA 3K1KC 3MV8B 3O45A 5I8KH 3W9EA 3B9KB 2O5XL 3TNMB 4NN6B 3R1GH 5H94B 5FUOH 4QOKD 5DVLA 5C0DA 1T83A 4BUHA 1EGJH 3CFDA 4P99A 4KQ3H 5JLZA 1A64A 4WW2A 4YAQB 2P8PB 3CC5A 3MRIA 6FABH 1TJIH 4DUXA 4HC1H 4G8IA 3T0EB 3SJVD 3VA6A 4H8WL 4JY5H 1N2RB 43C9B 3MRHA 3P9LA 2XA8H 1AJ7L 4MA1C 5C07D 1MFCL 3BIKA 1GGTA 4EJ1C 8CGTA 2X7LB 4K7PY 1MRCL 3LKRA 2JIXB 3G6JE 3TBTA 3SKUD 4O2EB 1NBZB 3TF7C 1XGTB 2Z31A 4H20H 4JJ5B 1LEIB 3KGRA 3FQRA 3RKDD 1YUHA 2ATPA 3P73A 2VDLH 1OY3B 5EIVA 1CR9L 1IGYA 3DRTB 5BO1H 3O11A 5I1CL 1WZ1H 1HWGB 2DLTA 3NAAH 5KSAC 5CEXB 2GTZB 5KZCB 4YHYB 2FWOB 1WFUA 3SN6N 3MXWL 3QUKA 2YD8A 3DROB 1KLUA 1WF5A 5MP6L 4PB0L 3O4OB 5EC2A 5ESVB 2EO1A 3HCVA 4PYGA 4M48H 4HQQH 5I73C 2BNRA 2FL5B 3MRJB 4YK4B 4DAGL 3LMJL 2GTWB 3PABB 4TRPH 3VGGA 3VRIB 3HAEB 1DUYB 3WJJA 2AJ3B 5GGUB 1A7OL 5JXED 1EAPB 2FIKA 2O26U 3OF6A 4KRNA 4D0CB 4JB9L 1XAUA 3VFVB 1IE5A 4ODTH 3GMLB 3O6KL 4UDTA 1MCQA 4HLZG 3TLRA 1VSCA 4Y1AD 2GK0A 2P4AB 3N9GH 2YEZA 1N64L 5TDNB 3V5HB 2RB8A 3RVVC 4O51A 2X9XA 1CD8A 5D7IF 1MI5A 2WWMD 1B0GA 5LCVL 5F21B 5KSVB 4ODVH 3EYUL 2IEPA 3HMXH 2QHRH 3OB0H 3SKJL 4JZJA 2N4IA 4UBDD 2VXUL 1J05A 5IHUL 1OAKL 2QR0A 3RWJA 1IGJB 5IESL 1NC2B 4PV9B 4LMQE 2VAAA 2X4PA 5K9JL 4R7DA 3U0TA 2G2RB 1YDPB 4GRLA 5EU6D 3QCTH 5HGAA 1JHTB 1KC5H 5IB2B 2D7TH 1ZHBA 1CD9B 1NANH 4HF5L 2CGRL 4OUOA 3LH2L 4PJHB 4E0RA 4LHQB 2OR9L 3QDJE 1QFWI 2B20A 1T7YA 1T0MB 1ZS8B 3IU4L 2OK0H 4CU8A 3QNZA 4XC3H 5F71A 3T1WA 5LGHH 3ZYZA 1H8NA 5KG9A 1P7QD 4Y4HD 3MNZA 3SDDD 2DBLH 1UACL 4BSVA 4YHKH 4DKDC 1KN2L 2CKBA 2V17H 4FZEL 3A6BL 4JO4L 3IAGC 3CVIL 1RU9H 1SMAA 2EDYA 5A16B 1C5BH 2OP4H 4XNUH 5EBLA 3QG6A 2AXJA 3C6SB 3K2UL 4MA3B 1F3DJ 1NUNB 4P2RB 5I1HH 1JF1B 4NN5B 3GMPB 3QEUB 4UIKH 4N0FA 5IWLC 4HUVA 4HUKB 2IPTH 3QDGE 5D2LE 4ZFGH 4A2MA 5ACZA 2H2PC 3UTSE 4YPGA 1R5VB 1B6DA 5ID0A 2YZ1A 3TBWA 5F7HA 4RZCB 3BD4A 1T20B 4XNXH 5I9QC 3EYOA 3MOAH 3GSUB 1CDIA 5IK3A 5C0RL 1SBBA 3FCTB 2BSSB 3GI8L 5EZJA 5C7XH 3FFDB 1AO7D 3BYTA 3IRPX 3MLUL 2FX8L 3SGJA 1UADC 4ZFOL 5JPNA 3ZKQD 4IJ3B 2ERJC 2W9LA 4HS6A 3CNKA 2NY0B 5E03A 4MWFA 2P5EA 3H9YA 4NO3A 4LVEA 1ZGLA 3OR6A 1S7WB 2IADB 5DJDB 5HDOA 1E6JH 4JN1L 2GJZB 5DVOA 1G0XA 3C60B 3W9DA 4HIIB 4O2CA 1FN4B 4XAWL 4L4JA 4F80A 1AH1A 4XC1H 1NKOA 5D2NB 4WI4A 5FEBA 2NY1C 5LGJA 2NW2A 4YNYA 3WDHA 3FRUB 3AY4A 5E08H 2FD6H 3ES6A 3MGOA 4LAJH 1RZJL 4N5ED 2BNQD 4PRHE 5I17A 1XEDA 1RIVL 1O5DT 3RJQB 2QSTA 3Q3GB 5CJOL 5D7SL 3QI9D 4E9LA 2EE6A 2BVQB 5MERB 3STZB 2PYEA 5E4EB 1IAOA 2XKUA 4CMHC 4MNQB 3CSYB 1IVLA 1DSFH 3NZHL 2OZ4L 4P2QD 2F19L 4MQSB 3F65A 3REVA 3ULUH 4G9FD 2B39A 4HWNA 3S35X 5CD5C 3O3DA 5KVDL 4X4YB 4UIMA 5MI0B 3QDMA 2HWZL 2B5IB 5C9KA 1H9VA 4FRWA 4G80B 5KSBF 2VJXA 3CH1B 5ACLA 3CFKB 4ZYKB 3F7VB 2WBWB 4NN6C 5DMKA 5JDJA 1KJ3L 1LK2B 4LSPH 4KPHH 4XVSL 3VXUA 3TPUA 1ZWIB 3WFDL 1WBXA 4C59B 5ALBH 4TQEL 1R24A 3BGAA 1EUTA 1RFDH 2VDRH 3SJVA 5C0IB 4EQ2A 3O9WB 4LCUA 3PP4H 1FQ9C 5FV1L 4F33A 1G7PA 1U8NA 5FM5O 4DGIL 2P5WE 5C07A 4EDXA 5L88L 5L7XL 5DJYA 2ZSWA 5CZKA 1EHAA 4D9RE 2ZPKH 4I3RL 4NQCE 3SO3B 5I2IB 1IFHL 1X5HA 4TN9A 5GRUL 4HCRL 1RJZB 1N0XH 3RIAF 5EU4A 5T3ZD 3BD3A 1R5IB 3MV7B 3MRLA 1NAMA 1G0DA 1E4WL 1M05A 3D3VB 4WO4A 2AEQH 3STLB 4NKMA 5HHQB 4JM4L 3C8HA 2ICCA 3I02B 3IU3B 1GJIA 3HE7B 4UQ3A 2O61B 2BOCB 1OAUL 1T4KB 3P9WB 4LSUH 4IDJH 4YFDB 3DVFA 1CCZA 2H2SC 4BQ9A 3QH3B 4WY7L 1INEH 1QEWA 4AQ1B 1A1MB 1NLDL 4NFCA 2CXKA 5DTFA 1I3RB 1VGKB 1RUPL 3PGDB 1WK0A 2FCBA 1CGTA 1A14L 2VXQH 3RAJL 1JWMA 1MFAH 4Z5RB 2R1WB 1TJHL 2DQJL 4YK4C 4P9ML 4KKLD 2NZ9D 3Q6FA 4MS8A 1TTGA 4WI2A 1KB9J 1M1SA 3AM8A 1YPZF 3PHQA 4Z7UE 5DSCA 1MCLA 5DO2D 1W8NA 2ED8A 5E8NB 3ARFD 4YXLH 4Z7NF 3T08A 5IQ9B 3MRGB 2OSLB 3U4EA 4Y1AA 3MRCA 4L5FL 1AXSA 1OW0A 3WHE1 1JZ7A 3CCHB 3L3OB 3EO9L 1HH6A 1IRAY 1L6ZA 1XF4B 3HZVB 4HWEL 4FQHA 1G7IB 3IXAB 3U9PH 5DD3L 5E00A 1RUKL 5IGXL 2AV7B 3L3HB 4QRPB 3TBVB 5TE6H 1RVFH 4W6WB 4N9OB 2VR9A 3WV0A 1O7VA 1P7KB 3IFOA 5HYJD 5EU6A 2FRGP 4NSKB 2PR4L 5HD8C 1LO5B 2Y06L 3MRQB 3ZDZE 4L4TE 3WKMH 2Z91B 4X99A 3SCMA 3MRDA 2AXFA 5F1NB 5HHPB 2I9LB 2RGSA 1H15B 4HK3J 4G6KH 5FKPA 4EVNA 1U3JA 4K7FB 1NBVL 1DCLA 5JOFB 4OTXH 4QXWA 1DQJB 1QLFA 4QNPF 1TLKA 4Q97A 5F97E 3LSOB 5TF1L 5MENB 4X6DE 5JQ6H 5B8CC 4CJ1A 5IR1A 2D31A 2R0KH 3DPBA 4LSRH 4P2OD 8FABA 4LIQL 1A6PA 4QHMA 4LPYA 1S3KH 4JFDD 1P7QA 3PUCA 3TIEA 4PGBA 4Z6AT 3C08H 3ZT6A 1K5NA 2EYTA 2VXSL 5DA0B 1F02I 1KN4L 1IEHA 3T0AA 2DQTH 1G9NH 4J2XA 2HJFA 3T77B 1N6UA 1OGAE 1EEUA 4OIIH 3L6FA 2R23B 4OD2B 1EEQA 5IB4B 3JTTA 4JRXD 1FVDB 4LSQL 1DEEA 1JMXA 3GMNB 2QLVB 1CXLA 4DCQB 4NN5C 3PIQA 4H1LA 1JI1A 2BMKB 4OQTH 1FGVL 1MF2L 2HH0L 3JWDH 3TT1H 2ICEB 4IEFB 2JJTC 5T3XE 4OIAA 1YN7A 4LSTL 3WHXB 4XCCH 1JPFB 2W65B 1ZT4B 1E4XH 3W11C 1CBVH 4H26B 3S4SB 5I71C 2DI9A 4PJIB 1DUZB 2VDNH 1EEYB 4LGPB 4DGYH 1AO7A 2YKLH 4U05A 1U6AL 1KIPB 1U95A 1DQDL 3NH7H 4YDIH 4YUEL 3WLWC 5AYUH 1JF5A 1HI6A 4R96A 4OZGF 3MCLL 2NY0C 5F9OL 5E2TL 5HHOE 1TETL 5I66B 5BZDB 3QCUL 2XZCH 3O6MH 1ZA3B 1IM9D 1OAQH 3O6LL 3T3PE 3C60C 3ZE1F 3IXTB 1I8IB 3M07A 2VIRA 4N8CL 5IB3A 3M8OH 4DVRH 3NCBB 5D2NC 4Z0XB 1NMBH 4A6YH 2EC9T 3O3UN 5GGVY 5KSBA 1R3KA 3BP7B 5IV2B 2V2WB 3RUGB 5IHZA 4QRRB 3HC4L 3NTCL 2BY3A 4N5EA 2BNQA 3EUUA 4LARL 3KYMB 4WFFE 4Z78A 3MUHL 2YUWA 3B2VH 4OZHE 5JMRA 5FOBB 3GIZL 2E7BA 3CFBA 3OL2A 2R2HA 5CILL 5HPOA 5GXBB 1N6VA 5CCKL 3BP4A 3CD4A 2FLRT 2WBJB 3MRMA 2Q3AA 3DECA 5E4EC 1ZLVH 4P2QA 4HPYH 3Q2CA 4PG9B 4ZO7A 1DBKL 5FYKE 4V2BA 3CJJA 3UJJH 3Q0HA 4RDQF 3TVMA 5CSZB 2V5MA 5M94B 5C70A 2HN7A 4YEFA 3BX7C 4JY6A 4XMLL 5DHXB 4FNLL 4ZO6A 3BE1H 3JVGC 3ILPB 1UVQA 2DM4A 5FF6B 1S7XA 2ITDA 1KPRA 3LS4H 3PWNA 3CMOL 3BFOA 5DHYA 4CW1B 3SGEH 3WIHH 3TCLB 1SYSB 4M7JL 3MO1B 1HHKB 5IEHB 3FTGB 3UCRA 3KLDA 5KS9B 4X6CE 2DN7A 3DUSA 4AENB 1DQTA 3V79C 1A3QA 3VE0A 4NRYA 1TFHA 1MVFA 4U0QB 3FQWB 3Q48A 4AL8L 1Y6MR 4U1JA 2X1PA 1S9YA 3O9WC 4R90L 3V9FA 5ADOH 3AAZB 3VH8B 4XBEH 3REWA 2R9HC 3H42L 1UZ8B 4U6VL 4F57L 1XGPA 4I48B 4CN6A 4TULL 3NPSC 3SO3C 5HHXL 4KJPD 4KC3B 2H3NA 1W0VB 5H37H 4XPGL 2EDJA 2ADGA 2R56H 2VRAA 4OCWL 4JPVL 3VFWB 3RA7H 4HK0B 4AT6B 5DMYA 2P8LA 5D7JD 3UYRL 3O6FD 2YWZA 1YPZA 1FC2D 1Q94A 5FYLD 4EIZC 1Q1JH 4LU5H 5ICZA 4U6YB 4LLDA 3HRZA 4F8TA 2JCCF 2GY7B 3N0PB 4P3DB 3CLEL 4F7TA 4Q9RH 5LAXA 1WTLA 2IAMD 5DR5H 2KUTA 4NKIH 4ONGH 1MJUH 5JHDB 2PXYC 1FZMB 3GFUA 3UAJD 3ARRA 2VLJB 1FZOA 3IFLH 4HAGA 1OAXL 4PRPE 1TVHA 2IF7A 2YD3A 4HFWB 3QQ3A 3RDTA 4PLJC 1FFOB 1GGUA 2EDXA 1U8JA 4AH2B 1I7ZB 4MAYD 2EYRB 2YD7A 3ARFA 4S1SL 3DRQB 3PHSA 3GSWA 5FGCB 3FZUD 4NQSA 1JPSH 2R2BB 3DYPA 1RZFL 4XX1E 5F88A 1OPGH 3VD3A 1CZ8H 2HT4D 4NO0A 1CU4L 5T3ZL 4OD1H 2HJKB 2PUQT 4HIJB 1IZKA 3VWJB 4HJ0D 3P0VL 1A3RL 1KGCD 3ARDB 3GSQB 5JOPE 1S9WA 5HYJA 3FL7A 4JFHD 1IQWH 3IRZA 3MLRH 1NEZB 4ONFH 1D5XB 4Z95L 5JHDE 4JG1L 3IFNH 1J8HB 3OAYK 1QFWL 4PGDB 2CUHA 2NYYC 3F7PC 1DN0B 4JFYB 3DETC 5DD1L 3MLPA 1X6LA 1T1YB 1DQML 3QHFH 1U91A 4A6YB 2XYCA 4NHUA 5I19L 15C8L 2VLRE 2F74B 2HVKA 4JFDA 3VXMD 1AGCA 2QKIA 5FB8B 4M8VA 2FHBA 5E8OA 1AD0B 2NY4D 3QZWG 3HE6B 3CX5J 4JFFE 3QUMA 2ZUQC 4P5TB 2EYSB 5EIIB 3SDXF 5B39G 4X0KA 1KEGH 1F58L 2EEAA 2AKRB 4F15C 4OAWA 4K8RH 4XRCB 4HULB 5EU3B 3O8XD 1RMFL 4X9HA 1WAAF 5DJ6B 3ULUC 1T1XA 4WEMB 1OL0A 3OHXB 4PJEE 5FDYA 4ISVB 3PWVB 4WFEE 3KLHC 3MOQA 4HMCA 1U3HD 3UTQA 4OT1L 3VDAA 5IVXF 2ICWI 4OM1H 3V0AC 2G75B 5KOVC 4GH7B 1XGYL 4DTGH 5TDPB 2YK1L 1T7XA 4IMLA 4MSWB 2BNRE 4F2MA 3IJYB 2Q76B 1SY6H 4FQCH 3QB7C 4Y5YA 2F54D 5TQ2H 1T04A 5EPMA 3P9MB 4D0BA 5HHMB 3L9RB 2JJSA 3W0WE 5GSRB 4IRZH 4ELMB 1P4BL 3ETBF 4EOWH 4JO1L 1FIGH 1X5YA 2V5SA 3CSGA 4NHCH 4MJIE 4LCYA 3E2HA 1P53A 1JK8A 1FNLA 4HIEB 1YYML 4I5BB 5CFHA 3RWEA 5F1IB 3BQUA 3W2DH 4FMFA 2LQRA 1QSFE 1IM9A 1S9VB 1UENA 4Q0XL 3QQ4A 4UAOB 4IBLT 4J3TA 3C6LD 3QUML 4I9WE 4NZTH 1FPTL 3A67H 1LP9B 4PGEA 4WTZA 1BBJA 1QYGH 3EDDA 1P9MC 1QKZH 3T1FB 2ICWJ 5J3HC 3OX8B 1RZGA 1YQ2A 2V7HA 5F7EH 3IDXH 4JHBA 2PTTB 2PTUA 3R8BB 4Y2DC 3WNLA 1I9JL 5L2JA 5SX4I 3KPLA 4OKDA 4K3EH 1REIA 1I1YA 5GRVK 4HKJB 4GKNA 2E9BA 5F9JA 3QULB 5ISZB 4ORGB 4K3DH 4BH8A 4FZ8L 2BCKA 2IPUK 2WBJC 5B22A 2BRQA 3PHOA 4KKAD 3S37H 1CWVA 2AW2A 2MPAL 2DI8A 3EJYD 1HYRC 1OB1B 4PRBA 4PYHA 2Z35B 5GS0H 2XZAH 4BKLA 2DQDH 4N0CA 1U8PA 5HHVH 4WUUB 3B5TA 4MNGB 4YR6B 1QRND 4DZ8A 3VJ6A 5ICYB 1R0AH 1A6TB 4WDIA 2XNAB 1NC4D 3SHSA 5J8OA 1BD2E 1CGSL 4JKPH 1CDUA 2LAAA 1P69B 4I0PD 1F00I 2Z9TA 2HG5A 5IT2L 3FO2A 3JWOL 2JCCA 4LHUD 5F7DB 1K3ZA 1YC7A 2ADJB 1YY8B 3M1BB 5GSVB 4BA8A 4TNVF 1KTDA 1YQVH 1CFQA 2VABB 2R29L 2W60B 3QIWB 5K9OA 2GCYB 2MCG1 4DOHB 1KT2A 4X7SL 3R0NA 3U2SB 1FORL 4D9QE 3P30L 4LASH 4O9HH 3BISA 1CLOL 3EDFA 3O6FA 5D7JA 3MBEA 2WBKA 1DQLL 1GZPB 2KL6A 4B53A 2RFXA 5J57B 3BO8B 1MJJB 1VGEH 2N7AA 1FV1A 2P5EE 3D1MC 1KCUL 2OI9B 4KTYA 3FB8A 4HZAA 3BEVB 3TBYA 5HY9B 3KPQA 2FJHA 3FMGH 2IPKB 3K81A 2X4SB 2Y23A 4WI9A 4GAYA 3VGAB 1ZSDA 3N1PC 4Q74A 1RZ7L 4AQOA 1KG0A 4MYWB 3HG1D 4NM8L 1G9NC 3KYOA 3FT2A 3I85A 5KTEL 1I1CA 4XNQB 4M43H 3GK8L 1UCBL 4FQ2H 3H9HA 1EVUA 2GITB 1F2XK 3IKKA 4JG0L 2MNUA 1IAIL 3CLFH 5C08B 4D9LL 2WP3T 1H3TA 1EFXD 1KCRH 2G5BB 1DQLH 2NX5B 2QL1A 2ESVD 3PJSA 4Q6IB 5IROA 4M6AA 4GAFB 2NW3A 3DSFL 4HKZB 4OKVA 3ZTJH 2E9IA 2YD4A 2A1WH 4XCFH 3GM0A 5HVGB 3VFRA 3DV6B 3KPNA 3TFKC 1NEUA 2VITA 3CXDH 3KS0H 3RVTC 5DMJB 3S3SA 3K8KA 1GHFH 2ARJA 4B41A 3ARGA 5C0CB 1BEYL 3QDME 4QWWC 2DQFA 2FSEA 4ENEC 5E6ID 4LLMB 1V3KA 4NNYB 3UDWA 2BSRB 3FOLA 2EIDA 3MA9L 5HI4D 1R3JA 4QOKE 1NDGB 4Y5XA 2WMPA 4PJBF 1YC8A 3OJDA 4PRIB 3U36A 2M8XA 3SDXA 2HFFA 3EO0B 1Q9LA 1WUNT 3TPUE 3ZE0F 3DV4A 2EXWC 1NLBL 3LV3A 4QTIL 3FFCB 3KYKH 3DXAE 4XPAL 4P5KB 3QQNA 1WAAA 1MAML 3CFCL 5DLMH 3HMWH 3WUZA 4NCC1 4JFXA 4ZUWB 3VGFA 2C1PA 4GW5A 3HZYA 1Q9WA 1UJ3A 2UVEA 4Z76A 4KROD 1K9TA 1HHHA 1MEXL 1AIFB 2BDNL 4JZOB 5C07E 5EBGA 5DZLA 3OKNA 4MAUL 5ADPL 5DK0A 1UA6L 3SGDH 5KN5B 5FA3A 3QUXB 3RY5A 1J5OH 4JDZA 4OI7A 4NFBA 4JFOA 4AM0B 1WLHA 4PS4H 4NRZA 3HE6C 5C0BE 5JA8B 3UO1L 1KPVB 5BV7H 4JQIL 4P5TC 1CG9B 2FJFB 3GKWH 2A73A 4M7ZB 2UZXB 1J0KA 2YBRB 3UP1A 5EORH 3SQBA 3HUJB 4BUGA 5INDA 2Q8BL 4N8VB 4V1DD 1A5FH 2Q20A 4Y5VA 5D7IE 1J0IA 1U3HA 1A6AA 4JZNB 4LLVA 3THMH 1NGYA 4PP2B 3ULVH 4PTUA 1FO0A 3OSKA 2CO6B 2YUVA 4HLJA 4G43B 3K4AA 1XH3A 1IC7H 2V5TA 4Q9BA 4LGRB 2BC4A 3OG6B 3UTTD 4GG6F 4PJAF 4QRUA 3QRFM 1FNGA 3MROA 5KAQG 3D39B 4LIQE 1MQKH 4LGSB 4NT6A 4IRJD 1KB5A 3ME0A 4GS7B 4Z8FL 1QACA 4DW2L 4FG6C 1FE8H 5HYSA 4OCRL 5SWSE 4XVUD 1BOGA 2AEPH 5DRNB 3MJ9H 4WFGD 1RIUL 5CIPA 4P57B 1QQDA 4Y1AE 2CDGA 2AJUH 2XXCB 5CGYD 4I4WA 3T8XA 3JV6B 3LB6D 5GHWH 1PW3A 3PQYD 4PJCB 1HH9A 1VKXB 1JN6A 1NFDA 3AS2A 2FATH 4XMKH 2DQHH 3CSBA 4EN3A 2PW2B 4GQ9H 2C3GA 1CDCA 3GSNH 2AK4B 2XWTB 4R2GD 2FLBT 3U1SH 2QSVA 5A2KH 1AY1H 1SHMA 3LN5B 2EZ0C 5L9DL 1QLRA 2GHWB 4P46C 2NR6C 1VEPA 4MA7L 3PWPD 4IRSB 2P43B 1VHPA 2D9CA 4OCSH 2CLRB 4J1UB 5IB1A 3C87A 2O5YH 4DQOH 3FHQA 1X5JA 5CJXC 4F7EA 4FFYH 1H3XA 3C5ZD 4JANA 1D7FA 1FO0L 1OT1A 2VUOA 3QDHA 4BSWB 2OR8A 2H26A 5BOPA 3L7EB 1A4KA 1G1CA 4K2UL 4NJAH 4U3HA 3DO7A 4OUUA 4J4PD 2AJZA 3WIFA 1DFBH 4D3CL 1DP0A 3W39B 1KB5L 2BNUB 3V52L 3GMRB 3LZFH 4RQQB 4MDIA 1G9MH 4XP5L 3X11A 4OLWH 1GGYA 1BZQK 3U0PB 2XY2A 3DJ9A 4G6FB 1QRNA 3ZMRA 4M7LT 5ILTH 5EBWB 1Z2KA 4ZAKD 3B9VA 3GI9L 4LQFH 32C2B 4QGTA 5F8RC 4UINL 4R7NA 2CLZA 4HS3B 4NQTA 5F6IC 2BVPB 2NNAB 3SKMB 5J12C 1YZZA 2X10A 5I1LB 1J1XH 4HZLA 2NCMA 1UWXH 2WWKT 4I0PA 1RJLA 3MLZH 2NTSP 4LKCB 4V3DB 3GJFK 4HUXB 5I1KL 3MV9B 4LHUA 4HUUA 4JO2L 2XKNB 5TH2B 5C09E 1K8IA 3ESUF 3DI3B 1D5ZB 5AWNL 1A6UH 3OAUH 3HI5H 5K9KA 5DF0A 4LPUA 4LLYA 2A6KA 4JAMA 5EZLB 1ULVA 4PV8B 3DX7B 4KZDH 1NFIB 2AJSL 2D3VA 3QJFB 2APVA 3LPFA 3JV4A 1AO7E 3BMWA 3TJHC 3BPCA 1BFVH 5FHAL 3WE6B 3D0LB 5DJAB 3ZTNH 3O41A 1N5AB 3L1OL 5CS7A 3PNWA 2BRRH 1ORSA 1X4YA 1H3PL 4EZMA 4GAJH 4ZS7L 3RGVB 3IF1B 1LP9E 1G0YR 4X9IA 5CEZD 2I5YH 2OI9C 1MCPH 3T4YA 4S10A 4FOMA 1MRDH 3ZKND 3O0RL 2P45B 5E9DB 4JQXA 5EO1B 3HG1A 3VFTA 4OLZL 1NDMA 2OMBA 5BV7B 1ED3B 1F2QA 4NM4L 4OV5B 1QLEH 4K8RC 5KSBE 2W9EH 3P77B 4L9LA 5D6DA 2X41A 4PJBA 5KVFH 3QA3A 1EFXA 4LLUA 1TTUA 3N1MC 4GLRH 3BKCL 3HLAA 3UTZB 4O2FB 5DUML 4Q6IC 5F96L 1H3PH 3ULSA 4QTHA 5GQBA 4WV1B 4BQ6A 1JHLL 4MNGE 1C12B 1YN6B 4P2QE 3EFFB 2AVGA 3TEUA 4G9FE 1ZLUH 4UU9A 2PCPA 3BHBB 4QRQB 4X6BA 3U7WL 1HKLH 3EO1A 5I1EL 2ICWA 5EDXA 1PSKH 1IGFH 4PJ9B 1UKQA 5E6IA 3TIDB 5C0GA 4X9FA 3DX6A 1A6WH 3RY6A 2ZCKH 3H3BC 2I07A 4FMKA 5JIKA 5IJKA 4UMGA 1RZKH 3GO1H 5DD0L 1I3VA 1JPTL 2FEEL 1FNFA 1FL5B 4W6YB 4XT1C 3C8KA 3UJIH 2ZOKA 1KENH 1QRKA 1I7TA 1YEDB 3X12B 3PP3K 5FGBC 4PIRF 3PE9A 4JKWA 3BEWB 2AGJL 3GSNB 1AGBA 5C9JA 2I60H 3LDBB 5FYJD 5D72H 3VFSA 1C16B 1E28B 1RHFA 2K1MA 4MXQC 3KPRA 5BVPL 5IBTL 3U0WH 1MHCA 4POYA 1F6AA 5DDHB 2VR4A 4GG6A 3B43A 1EDQA 5IUSA 5T3ZE 1JYNA 4M6NH 1A4JA 3HI6L 4UT7H 2WK2A 1QOKA 4HKBA 3O3AA 4MQ7B 3BZ4B 4R8WH 5EO9A 4CADA 4LP4A 5E2JA 4YGVB 5TDOB 2FYYB 5A1AA 1QPXA 1AGEA 4U1SB 4Z7NE 4XCNA 5DMIL 5GGQH 2I9TB 3RQ3A 3VWKA 4V1DA 4LPVA 3PV7A 5JDSB 2OTWA 4JDTH 3TESA 4H25A 2CKBH 2XQBH 4NC1C 5GS0C 4NRXA 3LQAL 3TBSA 3WFCL 4Q6YA 1I8LC 5IF0A 3UTTA 5AZEH 3EYSH 1I9RH 4TUKL 1F3JA 4M1CC 4IRJA 3ILQD 3RFZC 1VCAA 2BP3A 4GS7C 3VFUB 4JKLA 4MZ3A 5DHVH 5FUZL 1IQDA 1HIML 3FO0L 4NGHL 4O58H 5FHBL 4XVTH 5AD0B 2QSQA 1T5WA 3L5XL 4G6JL 3C5SA 4U1HB 4HJGB 5IVNA 3WO3B 2OX5A 4QF1B 1ITCA 2R4SL 1MRFL 4YHPA 3CFDB 4QNPE 1XIWC 4IOSD 3PQYA 4MD4B 4KMTL 5JLZB 3IDMB 4WW2B 1GIGL 3MRIB 1IGCL 5DZOA 3V4VL 2JKXA 4QEGA 1IC4H 4PJ7E 4AIOA 5CMAB 2DD8L 3BIKB 1MWAA 4HIHA 2YA2A 5T1KB 3OKEA 5HYJE 4L3EE 4ESKA 1C5DA 1U8IA 4W4OC 3OKOB 3PWPA 1N59A 1HXYA 3TBTB 4M6OH 3KPSD 2J4WL 1NCBH 5TE4L 3GB7B 1J7VR 4GBXD 5IMKB 1QD0A 2Z31B 3TWCH 1LO2H 3S88H 3FQRB 2ATPB 5I6XB 2IBGA 1HZHH 1JPGB 4H0IA 4ZPTA 5JZ7C 3GMOA 1KCVL 1UXWB 1IGYB 2DTMH 5AEAA <