3H9HA

Human class i mhc hla-a2(a150p) in complex with the tel1p peptide
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
275
structure length
275
Chain Sequence
b'GSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDGETRKVKAHSQTHRVDLGTLRGYYNQSEAGSHTVQRMYGCDVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQTTKHKWEAPHVAEQLRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHEATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRYTCHVQHEGLPKPLTLRWE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
publication title T cell receptor cross-reactivity directed by antigen-dependent tuning of peptide-MHC molecular flexibility.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 80
structure length 275
sequence length 275
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3h9hA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3h9hA01
4GMTL 4NHUB 3EFFA 5JXAH 5GS0L 3VE0A 3T0DA 3HE6A 3GMNA 3AMLA 3FB8A 4GXUM 4MNGB 4B7IA 1NCBH 2AXFA 1QD0A 1GGCH 2COQA 1YMME 3FB5A 4OGZA 3FQRA 2QKIB 1J05B 1JYWA 3MRKA 2I9TA 3T4AA 1JPSL 4OZ4B 1UJTA 2V2XA 1C08B 1V3KA 4WRLA 3RPIA 3S88H 3QFJA 4D9RE 3QSKB 4QOKE 2Z9TA 3MV9B 5GPRA 3VXQA 5TFSL 1HN1A 1FN4B 4U1HA 5C7XL 4GXUN 4XNZB 4Z76A 3B3IB 4JPVL 3VFVA 1FL6B 3QQ4B 3MJGX 1KIPB 3BI9X 4UT9L 1X5GA 2QTEA 3S3JA 4U6HA 5I1JH 3CAFA 1D6VH 4XHJC 3WIHL 1ES0B 3NBNA 4P0DA 3RWIA 4MXQD 1AY1L 43CAB 2FJGB 4NJ9H 3T77A 1SJVA 4E5XB 1FNHA 1J8HA 1X7QA 4KRPB 1YN6B 4UTBH 1DL7L 4WNQB 4HWBA 3QT2A 4EI5A 1KB5A 3HNTL 5IHBA 4O2EB 4KKCC 4MDIB 1OWWA 1CE1H 1AP2B 4J4PC 2DAVA 1SEBB 4H1LB 4PTUB 3IDJA 3QPXL 1L7TL 4MJID 3WDHA 2DM7A 3ROLA 4NWTL 1IGFH 3H0TA 4UILL 1KCVH 1SJHA 5SWZB 4ORZC 1KCLA 1MHHB 4K7FB 5IOPA 5IEHB 4L9LA 4DUVA 1QUNA 3D2UA 4PREA 3RVXC 5IJKC 3F7VB 3CFBB 1BVZA 4PRNA 2BVOB 1T0PB 1OAZL 3BT2L 4HUKB 5C2UB 3HCVA 3O8XD 4PJBE 1T1YA 3QZWG 4OFIA 1T89C 4DW2H 2VNCA 1D9KC 3GBMH 5HHNB 3IKKA 1FLTX 1EFXB 1G6RA 5EO1A 5JOFA 1BD2B 2EEDA 3E6FA 3LQAC 1DUYB 4M03A 4MNGE 3PHQA 1N7MH 4LSRH 3EKCA 3LKOB 4FQCL 3VDAA 4H25B 4NSKB 4E41B 2W0LA 1BOGB 1I3GL 1XIWC 3TVMD 3T0EB 43C9A 4LCWA 3SDXB 3RWHA 1KC5L 3SKOB 3WIIL 4RNRA 3KLHD 2E5EA 1OTTD 4Y4HB 3MV9E 4I13B 1YMMA 3NCYS 1QLRA 3N1QC 3CVHB 2QV2A 1DFBL 1P7HL 4F57H 3QEQD 4JPKL 4JY6B 5D6DC 3F65A 4QOKA 4HHAB 4G6KL 1RJYA 1O5DT 2BHZA 1XZ0A 2XY2A 2R56L 3MUY1 3TYGL 4DAGL 3H9HB 2VLRD 3VA6A 1HSAA 5DUBA 3ARFC 3O11B 2GQHA 5JO5A 3RZCC 3QUXC 4X4ME 5SX5H 4I77H 4YDIH 3DX9A 2ADFL 5B39G 5GS2H 4XBGB 1GVIA 2FD6L 5D7SL 4ZXBA 5DVMA 4L29B 1C12A 2GCYB 5A2KH 3DX7A 3RGVC 4M1DL 3MODH 4NQUA 3BW9A 2OI9C 2UZXB 1UZ6E 5F72S 4A2MA 4GG6B 5D7JB 1A6ZA 4V2CB 2DQCL 4PJGB 3SBWA 1QSZA 5LQBL 2Y5TA 3BGAA 2NW2A 5F21B 1T2QH 3VU2A 3V4PH 1AIFB 3C9NB 2D4DA 1MVFA 2IALA 1S9KC 4RAVA 1ULVA 2C1OB 3LKRB 3CSYA 2IANB 2W60B 4HLZH 4MLIA 3V5HA 1T5WB 1IAKB 3VXRB 5KG9B 2BZDA 4HCRH 3MBEC 3OL2A 3QWOA 4P2YA 4FABL 1KN2H 4PJBA 1ZLUK 1N26A 3P40A 3BKYL 3OKMA 1GZPA 3BZFA 3T2PA 3IAQA 5DC9B 3X14B 4DGIL 4E41E 5I75B 5AYUL 3ARYA 3T0EE 1RZ7H 1FZJB 1AC0A 2ZOLB 3SDXE 2XXCB 1CXLA 4MQ7A 2RAMA 5GGTA 4MNGA 3QULB 4X4YB 2PNDA 2YBRB 4HW6A 4CMMA 4G8FB 3TO4D 4LSQH 5F9JB 2Y06H 3HR5B 3T3PE 5EOTA 2KKQA 5ESQA 4OZ4A 4CKVX 2W0PA 1A3RH 2B1AL 4KKCD 2XFXA 2D03L 3OGCB 1C08A 3EYQD 1XGPA 1AR1C 3VD3A 3ISWA 1RUKL 1FV1B 3MV9A 2E3VA 3SKUD 3QAZC 2YKLH 4XVJH 4Y89A 3GMQB 2J6EL 4Q6YA 4QKXB 3B3IA 1YUHB 1KTDB 1FL6A 2A0LC 1KIPA 4BSVB 5D93B 3CSBA 4MD0B 3RVXD 4ZO6A 4HZLB 1ZS8B 4PJBF 3IVKB 1W0WB 4F2MB 1ES0A 43CAA 2EIBA 5IFJA 4A2LA 4I3RL 4E5XA 3V2AR 4WNQA 4I3SH 5HGGS 5CFHA 3KNBB 3T2QA 3FTGB 4X4MA 4O2EA 3HI5L 4MDIA 5D1QC 4GG6E 4XNQB 2MCPH 4OZHE 4H1LA 3RBSA 1NFDE 3VXME 3QIUD 1KV3A 1XIWD 5EORH 4G9DB 1FNFA 1MHHA 4K7FA 1UJ3C 4JM4L 1CFVL 5DQJB 2QQNL 1KCRH 4AMKH 2IANE 2BY3A 4ZQKB 3CFBA 3H3PH 4LVNC 4G7VL 4OTXL 3R1GL 3B2VL 4JDVA 3VXRE 1DUZA 5CD5C 3PWVB 3BPLB 5FYLL 2DLTA 3QDHA 5HHNA 3UPAA 3GI8L 4QT5B 2A6IB 4QRRD 5I17B 1YY8B 3PGFH 4ELMB 1INEH 5I1GL 3LKOA 3QDJB 5F6HJ 1B0WA 1CFSB 3VWKC 4E41A 1M4KA 3ARFD 3T0EA 1NUNB 3RZCD 3QUXD 2EXWD 1G9NH 4EBQH 1SHMA 3SDXA 4XCCL 1OF2B 1DDHB 1Q9WB 1QOKA 1UCBL 4KI1A 4ZUVB 3L5XL 4MAYA 3PP4H 3CDGA 3GIZL 4LIQL 4Y4HA 3VMNA 1BQLH 1UZ6F 4PB0H 3LQZB 4CVZA 3RGVD 5I19H 3K81A 2NMSA 3HN3A 4PRAB 4G7YH 1NEZB 3WHXB 4S0UC 5JW5B 1SJEB 5AZEL 1H15B 2P7TB 5BS0B 4JY6A 1KN4L 5HHMD 4YDKL 3QWRA 3ZL4H 2G75B 4LSPH 3RAJL 2OP4L 4CNIA 3BAEH 5CSZB 1D5BB 3H9HA 1RZJH 2X44D 2YR3A 1F6AA 2ED9A 3QEGL 2CKBB 3O11A 4ZTPL 5C0AB 4P46B 1NGYB 3QHFH 3GSUB 4XBGA 4BUHA 3LPWA 3SDXF 3OHXB 1L4IA 3BPCB 2Q8BL 4TVPL 4Z7UE 5F70A 5HHPA 4ZO8A 1R5WB 3RWCB 3BRDA 3BH8A 3O2WL 1JGVH 4PUBL 4KVCH 4GG6A 4G5ZL 5D7JA 3T3PF 1C1EL 1ZE3C 4OZHA 4LCUB 5E9DB 3UTTB 5F1IB 5MERB 2XQYG 4AIOA 4WEBL 2VZTA 4IRJB 1NFDA 2KZ1B 5L88H 1NCUA 3VXMA 3IDUA 3GHEL 2G9HA 2NX5D 1AIFA 4M1GH 5D2NB 1H3VA 4GAGL 1S7XB 5KSBE 1HZHL 2C1OA 3LKRA 2IANA 4HS3B 1XCTB 1Z5LB 4Z18A 3NA9L 1T5WA 3SGDI 2X40A 1IAKA 3MPCA 3TT1H 3VXRA 4YHKH 5KG9A 3C8DA 4X7SH 4ELME 3I84A 4NZUH 3DV4B 5D8JL 1X5YA 2A0LD 3QDJE 1MCOH 3IU4L 3X14A 3BYTA 5DDHB 1P7QD 3LEVL 5E8NB 4G8GB 3D69A 5T33L 5F1OB 2GJZB 4OQTA 5DVKA 3E2HB 3QCUH 1FVCB 4TNVF 3QULA 2DL9A 3WDIA 3OV6A 1FFNB 1O7SA 4GG6F 5F9JA 4FP8L 4OZHF 4DKEH 5TQ2H 2F8VA 4HIIB 1F5WA 5HJ3B 5DJ6A 1HYRC 2D3VA 1CLOL 1NFDF 4NFDA 5I74B 5D1QD 4O2FB 5M7QA 1A2YB 1U95B 4TRPL 5BS0E 3LH2L 2PYEE 2APXA 2P5WB 3NFNA 4QF1B 5ISZB 5BCAA 1DLHB 3NVQA 1N5YL 4LSVH 3GMQA 3MOBH 4UQ3B 4P4RA 5TF1L 1YUHA 4OLZH 1KTDA 1I85C 5ITFB 5C71A 5CINL 1OVZA 2W65A 4HZLA 4Z95L 1ZS8A 5C0AE 2W59A 2XN9E 1H3TA 5T5NG 1W0WA 1YEHH 2B0SL 4QHUB 4F2MA 1MRFH 1KEGL 5JW4R 1TZGH 4EKXA 3MRHA 3OJVC 3SE9H 1JZ7A 2HFEA 3GIVA 5C2BL 3C5ZD 3PGCB 1XR9A 4L8SA 1L7IL 1S7RB 1TZIA 3KNBA 3FTGA 5MP6H 1RUQH 1KCGC 3G04B 2R0KH 1ACYH 1XCQA 3GMOB 4XNQA 2EKSB 4PRHE 3EAKA 4ZOCA 1T1WA 5DJ0B 5E9DE 4MX7B 2BRQA 2CK2A 1GOFA 1WWWX 2VDKH 4Z7UA 5HHOB 3U7YL 4DVRH 5ICZB 3AS1A 4G9DA 1KNOA 5D2NE 1RIVL 2CLRB 3SE4A 5IFAL 5DQJA 4KHTH 4AZ8A 5KSUB 1FVEB 3D0VB 4RFEB 3TCLB 1XMWA 3M17B 5GS0H 1UEMA 4PP8C 2JIXB 3C6LC 3VGBA 4W4NA 2FLBT 5KSBA 1IL1A 4G8GE 1NCTA 4GMSH 1CBVH 4HWZB 1YY8A 3O9WC 4ELMA 4XPBL 1JPSH 4NC1C 3QDJA 3P9LA 5L7XH 4JHZA 5E2VH 3EOTH 2DWDB 4Z7UF 2NY1C 4JKPL 1Z3GL 4QRTB 1WCBB 1DDHA 1Q9WA 5BVJB 5C3TA 3W81A 4X7TA 1DBKH 2P5WE 3EDDA 4Y4FD 1AE6L 2V7NA 4ZS7L 1RZKH 3LQZA 2J4WL 4ZPVB 1I1AC 2FATL 5I2IB 3BGMA 4JZJC 3C5SB 3FQTB 2Z8WC 3W9DB 3O0RL 1LD9B 1AQKH 4N0CD 1JGUL 1F4XL 4PRAA 1NEZA 4P5TB 3WIHH 5JW5A 1SJEA 1XGRB 3X3GH 4FXLA 5FIEA 1IE5A 5DHVH 2BJML 5BS0A 1UH4A 2PYEA 1P4BL 1ZLUH 1KOAA 1NCWL 2YPVL 1RMFL 4S1RH 5HVHC 5IG7B 4KMTL 4OV6F 5KSBF 3QCVL 3D85D 2G75A 1FC1A 1DL7H 3WNPA 1UWEL 5CSZA 4FQPA 2QL1A 2JJVA 4PRID 4ELMF 3RX8A 1CD0A 2CKBA 1QQDB 4MSWB 3D5OF 3AMKA 5C0AA 4I5BA 1NGYA 2XN9A 3HS0B 5FO7A 1NC4D 4NWTH 3DMMC 4UILH 5CBEB 2FSEB 5FA3B 2Q7NA 3CPLA 3GSUA 2XWTA 1N6UA 5F6IC 5J89A 2Q20A 4RDQF 3BPCA 12E8L 2GY5A 1R5WA 3RWCA 2DQEL 1N5AA 3KPSD 5KN5A 3BDYL 3HKFA 5DK0A 5JXEC 1OAXL 4PRHA 4LCUA 4N0RA 5E9DA 4M7LL 1RUAL 1NCDL 5MERA 1FRGL 2NXYB 4NKOB 4PLJC 5L2KD 2H32A 4OBSA 2OL3B 5D2NA 3BH9B 1CU4L 4U7MA 2AJVH 4JJHA 1OOAA 1S7XA 4QCIB 4Y16C 5L8LB 3MA9H 4U2ZA 3RWJB 3WKNA 4LL9A 1P9MA 4HS3A 1XCTA 3HLAA 1Z5LA 3KPLB 3UAJD 3V9FA 3GI9L 2VXSH 4FQCH 3VWJB 5E4EB 4ELKB 5C8JB 5L9DL 4GO6B 4UV7H 1I3GH 4AQ1B 5EOQH 2ZUQC 1HQ4B 3WIIH 2BNQD 2DQIH 3LEYL 3R4DA 5DDHA 5E8NA 4G8GA 1CT8B 2DI8A 1AXTH 3HB3C 3BPNB 3WXWL 3K0WA 1YEIL 1FVCA 1DBBH 5EO9B 1IM9B 1FFNA 1IQDA 1Q0YH 1UYWL 1U3HD 2V5RA 1F4AA 4M62L 4EOWH 4HIIA 5HJ3A 4WWID 2F8OA 3OAZK 4G6KH 5IWLC 1O7VA 1F97A 4HFWA 1U95A 3SDCB 1FO0H 5CEZD 2P4AB 3VD5A 2P5WA 5DMJB 4QF1A 3GSXB 2R56H 3RDTC 3GRWL 3S98A 4DAGH 1DLHA 3MC0A 4JZOB 5T3XL 4NRZB 1JPGB 2IEPA 1EVTC 4UQ3A 2VLJD 4I9WD 5JNYB 2HLFD 2HP4A 2BERA 5ITFA 3O3BA 2NXZC 2ADFH 4PG2C 4R7NB 5D7LD 3K4AA 4QHUA 1B0GA 4OF8A 5BJTB 4IRSC 5F97E 2OR9L 3CX2A 4LBEB 4MAUL 3NTCH 3PGCA 2E7CA 3IB4A 3G6DL 3QXUA 3QIUA 3FFCD 1S7RA 3HNVH 2NX5E 2QQQA 1F3DJ 1MSPA 4ZSOB 3GMOA 2XWBB 3O9WD 2FIKB 5DJ0A 5J57B 4S1DC 4MX7A 4APQC 1BQHG 5FKAA 1MHCB 3V5DB 4NRXA 2WBWB 4F7PA 3UC0H 1P1ZB 3MJ9A 3AB0B 3LS5L 1QVOA 2CLRA 2NY1D 1JNHB 4Z77A 3B9VA 3S4SB 3T0XA 3D0VA 5MEPB 4RFEA 2BXYA 2GJ6E 3CK0H 4DGIH 1I1AD 1GGUA 5AYUH 3M17A 5T1MB 5I1HH 3GSRB 4N8VB 4YXHH 2JIXA 4MA8L 4PR5B 2YZ8A 4A6YB 3OKLA 3C60B 1AXIB 2R4RL 3CVHH 5HGAB 4HWZA 1I1FB 3U46A 3V0WL 1VFAB 1E4KA 5CJOH 2IBZX 2HTKC 1KLGA 4U3HA 1H0DA 3U4BL 5F9WC 1G7QB 3NMEA 3GBNL 1MAKA 1WAAE 3DMMD 1BFTA 3BIKA 4QRTA 1WCBA 1E4XH 3WO4C 5ELIA 2IPUK 5BVJA 1YQVL 2CJUL 3ARDC 3SE3A 4CN1A 1MHPH 4PY7B 5HY9A 3U48A 1MCBA 3C5SA 3FQTA 5TQ0H 3X11A 2HT2D 2KDGA 1LD9A 4CVUA 4HT1L 4P5TA 2UZIL 1XGRA 4K94H 4FFYL 4XNYH 1W8OA 3AS3A 1D5XB 2E8ZA 3KLAA 2VABB 1A6UL 2JELL 2V9TA 5D6CB 4G3YH 3FN0H 4AH2B 4HBCL 3QUYB 1G9MC 1QRND 4HX1B 3LS4L 1E6OH 2NPLX 4O58L 4Y16D 3WSQH 2J1KA 4MSWA 1QQDA 4TTGA 5DRXB 1Q94B 3F12B 4UU9B 3HS0A 3F5WB 4ZSOE 1FFOA 2FSEA 5FA3A 1MLBB 4R4NC 1E4WL 5E5MB 1BLNA 3KPMB 4F80A 5DGQA 1YNLL 2DTML 1MFDL 4K3JL 3K8LA 4K3DL 4HIJB 3MLXL 35C8H 2Y36L 2NX5A 3HB3D 4WY7L 3K7UA 3L3DA 2R1WB 4P4KC 3IFOA 3QI9C 3OWEA 1WQVT 1WBXB 1MELA 3UBXI 1KTLB 1VPOH 3BGFC 3UBXG 4FNLH 2BCKB 2ZP0T 1CGUA 1WLHA 3ALWA 4NKOA 3MCKA 5FYLH 4ODHL 4QO1A 1IKFH 2DBLL 2O5ZL 3JVGC 4JCLA 4R96B 1TPXC 4PRBB 5FHBH 3BH9A 4WHCA 4XMLH 4PJXB 2YD6A 2ZJSL 4OD1L 1KUMA 3RWJA 4TQEL 1MIML 4GBXB 5DC4B 1AHWC 3KPLA 5LG1A 2R0WH 4XMPH 3VWJA 5C8JA 1PQZA 4ELKA 2GJ6A 4K9EC 3DURB 1UKTA 3FKUS 3CIQA 3MZGB 4P9HC 4ZFZB 3L3JB 4XCCH 3L5XH 4NOFA 5DJZB 2GIYA 3GIZH 1CT8A 5DZNA 3NCCB 3W82A 3O3DB 3QJHB 5F3BB 4IRSD 2B2XL 5C0JB 5EO9A 1KIUA 4LARL 1UXWB 4QXGH 2WIMA 4OQ1A 4F58L 5FYJD 2LAGB 5IJVB 5D1XC 2O93L 1RD6A 3RBGA 4FOMA 4YDKH 1WAAA 1I9RL 2BNRB 3RAJH 3SDCA 5CEXB 3QXAB 2H26B 4NDMB 5K9OB 4S1DD 3GSXA 4APQD 2V2WB 4LLDB 1MRCL 4NRZA 3LKNB 1JPGA 1IAMA 3QEGH 1I3VA 2MCG1 1JPST 4ZTPH 4OM1L 5JNYA 4FZ8H 5CJXC 5T1KB 4F9LC 5IEKB 3MLVH 1BJMA 1FYTE 2GK2A 5GGUB 1IVLA 3UTQA 3OG4B 4YNYB 1PFCA 1RIHH 4HEPG 3EDJA 4DOHE 5BJTA 2AK1H 1F90L 2E7LC 4ZFGL 1WC7B 5C0BB 4YXKH 3W0WB 4G5ZH 5BMFL 3MFFB 2GUOA 3T04D 2B39A 5BXFB 4X5XA 4ZSOA 1IZKA 2XWBA 3GHEH 5F1SA 1NLDL 1WAAF 3O3AB 1U8PA 3TBVB 3MLZL 3V4VL 1YC7A 3V5DA 5IV2A 1HZHH 5E6ZA 1JHKL 5AZ2H 1P1ZA 3NZHH 5MENB 1AJ7L 3AS2A 1J0HA 3NA9H 5EU6B 4PJXE 5E8DL 4QXWA 1JNHA 2IAMC 4FTVB 1WFNA 3ARDD 4KWUA 1FHGA 1Z9LA 4HIHB 4JFPB 5D8JH 1VB9A 3IU4H 4HBQA 1CD1B 4NM8H 1U2CA 5T1MA 5T33H 4J3WA 3GSRA 5HHXL 1HHGB 4PR5A 3S36X 4OZFG 4Z8FL 1G7MB 3BDBA 5HGAA 2ORBH 1I1FA 5J8OA 5CILH 2VDRL 2WK2A 2CMRL 5DWUL 1EHNA 1R5IB 3CFJA 1CLOH 1VFAA 5IHZB 1B4JL 1OGTA 3IDYC 4Y4FA 4L5FL 4TRPH 1G7QA 2JB5L 2IQAB 4N5EC 1J11A 2BNRE 2ESVB 4MXVE 5ALBL 4R4ND 2CKBH 4N8PA 3D48R 5JHLL 5LXGH 5TF1H 2XKUA 5D7LE 5BW7C 2VDQL 1DQJB 1IAIH 2R4SL 2B0SH 4JO3L 2C3VB 2CKNA 3QI9D 3SDYL 5GQBA 1D5XA 5DFWH 3FFCE 1X5HA 1NGPH 2VABA 4PGDB 5D6CA 5FKPB 3N06B 5JMRA 2D7QA 2WLYA 3ULUC 3P9WB 1L7IH 3QUYA 4AG4L 1T3FB 1VADB 4HX1A 3L1OH 3BJ91 3W0WE 1XF5B 1DVFD 5IT2L 1FYTA 5DRXA 1J7VR 1PEWA 4P23D 5I73C 4BK5A 1X5IA 3F5WA 5HHQB 1NBVL 1MLBA 3ZHKA 3U7YH 4JR9H 5E5MA 3OAZH 2VITA 3GUTB 3AXLB 2DM2A 2JE8A 3O6ML 4HIJA 1UC6A 3MLYH 5MENE 1NMAL 5CCKL 2EC8A 3FT3A 3WFCL 4KZEH 2R1WA 4HWBL 4FTVE 4PJ9B 1WBXA 1XEDA 1KB5L 1Y0LB 4JG0L 1KTLA 2BVYA 2HFTA 1A7QL 2BCKA 5D1XD 4I18B 1VCAA 3FHAA 4R96A 3SDAC 4PRBA 2IJ0C 4PJXA 4AK1A 3CLEH 3STBA 2Z31C 4YZFE 4GBXA 5EZLB 4UIMA 4XRCB 2IQ9H 1Q1JH 5EOCH 3QFDB 1CXHA 3TLRA 3KXFD 5F88B 2E9WA 3RKDC 1FE8L 1X3DA 2Y1VA 3RHWK 2GYSA 1U3HA 3RNKB 5JA9A 1CD8A 5DJZA 4Y5XB 4MD5B 1Q9KB 4GRWB 4KXZH 4ZS7H 2MQCA 2ESVE 1H3XA 2XPGB 1ZA6A 3O3DA 5C0JA 1BVKA 1G6RL 3MSPA 1QSVA 4TUOB 1CZ8H 2PXYD 2BJMH 4NQEB 1P4BH 4QY8B 3DRTB 1CLYL 1NCWH 2YPVH 2O61A 1AO7E 2BNRA 2X9WA 1JHLH 4HS8H 4QHLB 5JDSA 5C6TH 3W11C 5CEXA 5DD0H 3ZDZE 2H26A 4NDMA 4QLRA 3BVNB 5EUKB 3T0AA 4PJXF 4RWYH 3DROB 1ZT4B 2FX9L 2VERN 5D7LA 2BFVH 2VAAA 3LKNA 4Y5VC 5J1SC 1OSZA 4GW4A 2HLAB 1TJHL 5T1KA 5BOPA 3LCYA 1Y18A 2ATPB 4NT6B 4LHJB 5GGUA 3OB8A 3VFRB 3FFCA 5FA4A 4OCMC 3MRBB 5FO8B 12E8H 4IEFB 3TYFB 2CUMA 1HDMB 3PWLB 1WC7A 3BDYH 3CZFB 3W0WA 4MHHI 1OAXH 2AXGB 2GTZB 5A2JH 3MFFA 5IW3A 4M7LH 3U1SH 5BRZB 1NCDH 5BXFA 5TH2A 1S5IL 1GYAA 4HWEL 4Q6IA 1RSFA 5I1CL 1TJGH 4N68A 3NPSC 4MXVF 3TBVA 5HXMA 1TNMA 2G60L 1JWUB 5F7YC 5MENA 2EDTA 4GFTB 4N5ED 5ALCL 2AS5M 1QSED 5L9DH 4WENB 4FTVA 1C5CH 4KK9D 4HIHA 4PJ7B 5DURD 1T7VA 2WLZA 2YPLD 1JPTL 1UQSA 3BPOC 3MRNB 3QDMD 1KJVA 4KGJA 4P2OC 5GGQH 1HHGA 3MRFB 2LTQC 1KFAH 2WBJD 3VI3E 4ONGL 1G7MA 4GRWE 4NYLB 25C8L 1D5MB 3ULUD 4HFUL 3GO1L 1R5IA 1NGWA 1RULL 1JK8B 4NC0B 5IHZA 4M48L 3ZE0E 4N90D 1X6LA 3DO7B 4K8RD 2AEQH 4NQXB 5JR1L 4NO3A 4NQEE 5A1AA 2IQAA 1QACA 4LPXA 4XAWH 5T3XH 2ESVA 3MOAL 5FYKL 1KGCE 1T04B 3TV3H 1K3IA 1J1XL 1JFQL 1M7XA 4WHTB 3KYMB 3MROB 1F4YH 1FSKC 1XGYH 1A1NA 1DQJA 5KTEH 4NM4L 1AO7A 2YOCA 4OF7A 1J87A 3G6JB 2C3VA 3TBWA 4HAFA 4U1SA 5D9SB 4MAUH 1P6AB 5FKPA 2F9BT 4JFYB 1BFOB 1BQHA 3G6DH 4YZFF 2YWYA 1T3FA 2ZCKH 1LO2H 2X9XA 1XF5A 3T09A 1VFBB 5KAQG 3KVQA 4HJJL 2OL3H 4G80B 3G9AB 5HHQA 1NCNA 5GGSB 1MHEB 3U0TA 4C56B 3O4OC 4FQ2H 5GS0C 3ARED 3RP1A 4XPTL 3TFKC 3AXLA 1F4HA 2HAZA 3MMEB 5EDXA 4D0DB 1MWAB 4W4OA 5I0ZA 1SYVB 4PGJA 4PJ9A 2VXQH 3VDCA 1RHHA 4L1HA 4PJ7E 4ZMAT 3ZDZF 1RUPL 3MYJA 3L5JA 4G43B 3STLA 5AUMB 5LGHH 3TZVB 3TBYA 5C6PB 3GKWH 2P8PB 3HZYB 3W11D 1MFEL 2KL6A 4J3OC 5M95B 3V0WH 1NEUA 1WWAX 3LB6C 3HE7C 4XRCA 4F7TA 5T3ZL 4Z0XB 2VO5A 2P5EB 3QFDA 5F88A 5B8CB 5IBUG 3GBNH 5GRVL 2EH7L 3RNKA 1YQVH 4Y5XA 3OB0K 4MD5A 5LWYL 1OAQL 1Q9KA 1VFMA 5JHDB 3LKQB 2XPGA 3CDFA 1S9XB 4HQQL 5ERWB 5JZ7C 2BSTA 2M26A 4TUOA 4YEEA 2HN7A 2UZIH 5TDPB 2M1KA 1DANU 2VXTL 4NQEA 2ITCB 4QY8A 1OCWH 4QXUL 3SQOH 3DRTA 3SHSA 4XI5C 2A9NH 4QHLA 4LCCC 4XC1L 1A7OL 1XR8B 3ZZ1A 5EUKA 3BVNA 1U6AL 1BIHA 2LU7A 3DROA 5ECJE 4K3GA 3ARZA 3ORJA 3FQWB 1D6EB 2NY5H 2AJYL 2ATPA 4NT6A 4TUKL 5C0DB 3VFRA 2CLZB 2DTMH 1FAIH 1MFDH 4K3JH 3VI3F 3MRBA 5FO8A 2G2RA 4XPHH 4C56E 4K3DH 3BWAB 4DEPC 3TYFA 1A47A 3MLXH 4GRWF 3DUUA 3IDIB 3PWLA 2C3WA 3FJTA 2LVCA 3IXTB 2GTZA 3S97C 3DXAD 1GSMA 4PJ8D 5GS3A 4NQSA 2VLKB 3ZE0F 4JO4L 5DK2B 1KXVC 4K3HA 4A6YH 1GGBH 2YMXH 1Q0XL 1BEYL 2R29H 4R0LC 3Q5TA 2B5IB 2ZOKA 2AV1B 5AWNH 3DGGB 1PW3A 2QSCL 1HI6B 1QSFD 2NR6D 3F6LA 2KQMA 1NBZB 3N50A 1Z0MA 4GLRH 3HAEG 4HD9A 4X80H 4PJ7A 5I6XC 1DQMH 4MJIB 5ACZB 4ODTL 5ANMB 5IM7B 2P5EE 1SBSL 4EN3B 1SJXA 3MRNA 2HKHH 3MNZA 2ATKB 3RQ3A 3ZDXE 1RURL 3WUZA 1CFQB 4LARH 1IC5H 4NYLA 2WP3T 5JHDE 4KC3B 1MI5B 1NAMB 1D5MA 1S7WB 2OZ4A 3IJHB 1MEXH 1JK8A 3DX6B 3DO7A 4GH7B 4NQXA 1MFCH 2AJZB 4FQQB 2Z8VC 2YD5A 3KR3H 2X4OB 3BISA 5IK3A 4TPRH 2EICA 3QIBC 1MRCH 4LQFH 1T66D 3FB7A 1T04A 4BZ1L 1JBJA 1KENH 2AJ3B 4NRYB 2Q8AH 4OM1H 4WHTA 1B88A 3KYMA 4LDOB 4OQTL 3MGOB 4GW5B 3MROA 4UBDD 4M6ML 4D2NA 4PJ7F 3B9KB 4GRMB 2X4QB 4L4TD 1N0XL 4XNUH 4N8CL 4O5LL 5JQ6L 1F90H 2AK4B 3V6FB 3CMGA 3MREA 5GJTL 4JJ5B 3ERYA 5D9SA 5T1DL 4JFYA 4K23H 4EXKA 4WI2A 5IB2B 4OKDA 2ICES 4PFEA 4NNPH 4JM2B 1X5JA 1MY5A 2H41A 2VLKE 3WUWG 3ARTA 3MLZH 3MXWH 5FDYA 1IQWH 3LB6D 4KMLB 5HYJD 1JHKH 3OKYA 1MHEA 4C56A 1J0KA 1OL0A 4PY8I 3MMEA 5E8DH 3PXJA 1OW0A 1MWAA 1HCFX 2VJXA 3RVWD 2YPLE 5GRUL 3QG6B 1SYVA 4WJ5B 5HYSB 3CU7A 1CWVA 4HH9B 4YHML 4M43H 1Z9OA 2AGJL 3S5LG 2PTTB 4PRPB 2OTWB 3U6RA 3DRQA 2EZ0C 5ANME 4Z8FH 5EZOH 1EAJA 3ILQD 4Q0XL 4Q74A 4NCC2 5AUMA 3TZVA 2HTLC 3UTSD 2OM5A 2P8PA 3HZYA 5CEYB 2I26N 5I0DA 4M7LT 3ARQA 3ETBF 4XPFL 4YQXH 4RGOH 1B4JH 1HWHB 3C2AL 2LQRA 3N9GH 4H0HB 2P5EA 1AGCB 5I8OL 1IAOB 4NN6B 4BFIA 4G6ML 4LQ1A 4E0RB 5DD5H 5CP7A 2XRAH 4P2RE 2VWEE 2GITB 2I60L 5CWSB 3WYRA 3MLTB 3LKQA 5JHDA 1KJMB 1S9XA 3WEXB 5ERWA 2BRRL 3WO3B 1RFDH 2ED8A 4JEGB 2N4IA 5TDPA 3P73B 2ITCA 3SDYH 3LY6A 1CIUA 3IFNH 5H2BB 2YUZA 1QEWB 2X89D 1ZVHA 4AG4H 2GAZB 1T7XA 1ZGLP 1OB1B 2EEBA 5IT2H 3F58L 1CXIA 3CH1B 3K80A 1PG7X 4I0PC 5C0DA 2CLZA 1BFVL 3LN5B 4O4YL 3ZDXF 2Q7YB 1G1CA 3O6MH 2DS4A 3BWAA 3L3KA 3ZMRA 1NMAH 4G6JL 1A1MB 1XGQB 3WFCH 3KYOB 4K7PX 3FO0L 3TIEA 3IXTA 5CAYB 1UADC 4KKLC 1QFWM 3LDBC 4JG0H 2VLKA 5DK2A 2CDEB 3P4OB 2F5BL 2OCFD 1QBML 4LPWA 3UO1H 4HPOL 4XGZB 1VERA 2X41A 3DTXB 1I8MB 1ODAA 4H5SB 4J12A 5I8KH 4PRPE 1YECL 2H3NB 4XX1G 2YPLA 1D9KB 1N4XH 3I2CH 3QIBD 4XPGH 2R69H 1NBZA 4KK8C 3SDDC 5KZCD 5DLML 2BDNH 3K2UL 1CIDA 2WBJA 3HC4H 5HI3D 4KJPC 1FE8H 5DZLA 1CGWA 2DYPB 2WM0A 5ACZA 4ZAKC 5ANMA 1CGVA 2WW8A 4EN3A 5IM7A 3QDGE 3GKZA 2ATKA 2DMBA 1F2QA 3BKML 3BRGC 4N1HB 3SGEH 1NAMA 1IM3B 4LLUB 1T5XA 1S7WA 3IJHA 3NZ8A 3DYMA 1CLYH 1PD6A 1AI1L 2VDNH 3DX6A 4OFYD 4ODBD 4LLYB 4FQ1H 2AJZA 4FQQA 4ACPA 2VN4A 4JHAL 4P2RA 5SV4A 3BQUC 4BQBA 4LSDA 2HFGL 4Y5YC 3MCG1 5C0GB 1U41A 3MRPB 1LEIB 1HNFA 3SJVE 3U9PL 2VC2L 3MLUH 1KXTB 3MGOA 4GW5A 1CG9A 4ZTOH 3WLWD 4GW1B 3OQ3B 2XTJC 3B9KA 3ARFB 1B2WL 4GRMA 2X4QA 2FIRT 1TVDA 5DEGB 2F58L 4Z9KB 4XB8A 4L8BB 2EZ0D 2HTLD 5DRWA 2OI9B 5I15L 5IB2A 4HWEH 1CDGA 4P59L 4JM2A 3BZ4B 4C55A 4LEXL 1W0YT 4KH2A 2VUYA 3BYYA 1E28B 1HSBB 1SYSB 3TH3T 3CX5K 3V79C 3BZEB 1QRKA 5DHXB 5ALCH 3S9DB 1MFAL 1QPPA 2OS7A 3PQYD 2ZCHL 4ZO7A 3R8BB 3QG6A 3WE6B 5HYSA 5BV7B 1JPTH 4X99B 4HH9A 5D71L 3MBEB 3FRUB 2PTTA 3MLRL 4PRPA 1HIMH 2NY4C 1EX0A 2NW3B 2X9YA 5E2TH 3U4AA 4AQOA 25C8H 5DJDA 3Q6GH 4L4VB 5F7MC 1DN2A 4U1MB 4HFUH 5IMLB 2YK1L 4X9IA 4R4FL 4MA7L 3VXUD 1P84K 1WVZA 3TA3C 4JM2F 3TO2B 3QDGA 3EUUA 4L4JA 1IAOA 1OAUH 2AEPL 1GGIL 4J8RB 5EBLA 4E0RA 4R4BB 3QBTB 4L1DA 2GITA 4KDTC 3QUMB 3MLTA 5F93C 1UB6A 4K71C 1GH7A 3QAZB 5MI0B 5EO0B 3WEXA 2GTWB 2QR0A 1GXEA 2VQUA 3L3GA 4L3ED 1JHTB 3MRJA 1T83A 5J9PB 3ULVE 5H2BA 3ARGB 4UV4H 1NAKH 5GS1A 3SJVA 1TETH 1OPGH 2GAZA 3RX5A 5HDLA 1OB1A 3NCMA 3O81A 4LLWB 1KJ2L 4UT7L 3I3DA 1MJJA 4LVOC 4YHZH 1HYSC 1A5FL 1MCLA 3O2VH 3SDDD 5E6IC 2EC9U 1IMHC 3MV7B 1NBQA 4Y1AB 2IADA 4J4PA 4KJPD 3KG5A 4J3VA 3V6ZA 2Q7YA 3BWUC 1ITCA 1RPQA 2YEZB 1RZFH 1IGIH 1YNKH 4FQHB 4Y2DD 4HGWB 1A1MA 2HYMA 3KYOA 1UJ3B 5IGXH 4K07A 5IJKA 4NKMB 2PR4H 1SY6H 2CDEA 3P4OA 2M8XA 3RTQC 3UTSE 2EO1A 1RUPH 3QPQC 3DTXA 2V7HB 3OJMB 1MFEH 2H3NA 3EO9L 1JGDB 4WUKL 3BHBB 3IDXL 4XCYA 2B4CL 2HWZL 1LO5A 2R2CA 3AY4C 5GRJH 1MOEA 5T3ZH 2HA1A 2BOCA 3UJTL 5INDB 4WCYL 2QSVA 3QUZC 4GKSB 3D39B 1YEKL 2DYPA 3KJ4B 1K8DB 3VFGL 1DEDA 4NHCL 3VWKB 4EJ1C 1QKZL 4MS8A 3AVEA 5LWYH 4OLYL 1TQBC 4P48A 5K59E 3DI2B 3QCTH 2O26U 5ACMA 4YEFA 1Z2KA 1IM3A 1UXSB 1C5DB 4QXUH 3ZKXC 5E08H 1M6OA 5J3HC 4LLYA 3EFDL 5EFIB 3ZTJH 4LCIH 3Q3GB 5C0GA 1AR2A 3MRPA 3NFSL 1H9VA 1B90A 1QLEH 4OLWH 5BOZG 3HRZA 3BKCH 4D9QD 4XP4L 4GW1A 4TUKH 3VFNA 3D9AL 2VRAA 1HKLL 1F13A 1LO3L 3U79A 5IMKB 3KPOB 5DEGA 3FOLB 3MV7E 1ZAGA 1VENA 5FECB 5D2LB 1PJ9A 2P8MB 4YE4H 4L8BA 2X4TA 3QIWB 4UTAL 2LVEA 4IDJL 4JO4H 4RAUB 4WI9A 4RGNC 1Q0XH 2R1YB 4CRPA 5HGDB 1BEYH 1FZMA 3THMH 4MQSB 3HAEA 1E28A 2ZG3A 1YYLL 3TA3D 3BZEA 1YEGL 3S6CA 4R2GC 3KPRD 1G7HB 3EDFA 4PRIB 3FO9A 3U4EB 1T0NB 3VGFA 1SM3H 4WW2C 1NC4B 3UTSA 4V3DB 3QXVA 5D1ZA 4X99A 3CJJA 4CW1A 4LGRB 4HKZB 3ULVF 2UUDK 1ADQL 1ZEAH 3H9SD 3D39E 1OARL 1KJ3H 2NY6B 3M1BB 4YXLL 1GJIA 4BM7A 2BVPA 2FGWL 3FL7A 3S36L 4U7KA 3KPSB 4U1MA 5LBSH 5ILTH 4WHYH 1DBAH 2FBJH 3Q0HA 5EH1A 3UJJL 5CUSL 5DHYB 4FQXC 1LK3L 3VG0L 2XYCA 2C3XA 1NSNH 4KTYA 1HYSD 3TBSA 1UA6L 4BZ1H 1KF9B 4J8RA 4RSVA 3DUSB 4R4BA 2VUOA 1TMCB 3JWDL 3QUMA 4LSUH 2FX8L 1NL0L 3BX7C 1FVDB 3QNZB 3UROR 4Q97A 1CXFA 2GTWA 5I1IL 5JOPE 3I50L 1S78C 3IJSB 2EXYD 4UNUA 2K9UA 2FZ3B 4JFDD 4O5LH 3RTQD 3ARGA 3CGTA 4S0SD 5T1DH 4XB7A 3WUWA 1MAMH 3QPQD 3OR6B 1YYML 5J11C 1X44A 5DZOA 5F8RC 3WJLA 1DQDL 3QNXB 4HC1A 3FQNB 2A2QT 4KV5E 3MNWA 2WUBL 3OR7A 1MCDA 4P99A 4WO4C 3OPZL 5JPMB 1H3PH 1BBDL 2EIDA 3MV7A 3X3FH 1I9EA 3QUZD 5CSBA 3OZ9L 5K59F 2UY7A 1YEFL 3H2WA 2P47B 5GRUH 4FQHA 4HGWA 2ZKHL 2W0FB 4K3EL 4RQQB 2WANA 2ZNXA 4OFPA 3ARWA 4YHMH 4JG1L 1NANI 2AGJH 4NKMA 1YA5A 5H37H 1JMZA 5A40E 4TSCL 4URTB 4JRXD 4UT6L 5DEFB 1GZQA 4K7PY 4NBXB 3WS3B 2V7HA 5K9QI 3QISA 1MLCB 3OKKB 4E42B 2A74B 3C6LB 4YR6B 1JGDA 1ZHKB 1ZK9A 3BHBA 4XPFH 4Y4KC 1CVSC 3C2AH 3ARSA 1U3YA 3O6FB 2DKMA 4R90L 4P2CG 5INDA 3CX5J 7CGTA 1CL7L 1WTLA 3D39A 4MWFA 3KPQB 1K8DA 1J8KA 4LFHG 5TDOA 3VWKA 1INQA 2VR4A 2I60H 1UVQB 2C9AA 2BK8A 2NY1B 2YHGA 3ZO0A 3K1DA 4O02L 3PL6A 5EIVA 1UXSA 5D7KE 4AIXA 4BQCA 3T8XB 4OLXL 4JZJB 4KRNA 3QEUA 5EFIA 3SKNA 1HILA 4X8XA 5HVHB 3Q3GA 4PLKC 2E9BA 4DFHA 1P84J 4X9FA 3F58H 3OXSA 3VFUA 4G42B 4U6VL 3O4LD 4R2GD 1I1CA 1BFVH 3KPOA 3NGBC 5KS9B 1EAPB 4U6TA 4YHNB 5FECA 4G59A 4G6JH 3BKJL 4M61A 4M6NL 1A7NL 2Z4QB 3MCLL 3QIWA 3LZFL 4JLRA 4ZYKB 3PWPE 1BJ1J 4L8DB 4RAUA 3PHSA 1QBMH 2VQ1A 2DF3A 3VXSB 4M8QA 3I3EA 5FM8A 2GI7A 5BQ7B 3DPBA 3DSFL 5EUOB 4WHDA 3QHTC 1REIA 4FQXD 1A6TA 2VYRE 4RZCA 4EEEA 4GAJH 1LP9B 5KSAC 2EE9A 1G7HA 3DVNA 4Y16B 2F54B 1T0NA 3WNKA 4YC2C 1T1ZB 3UYPA 3HZVB 3NABH 5IUSA 3RIFF 4Y8DC 4JDTL 2YD3A 3SKMB 4HKZA 4LFHD 1S78D 3TF7C 4K2UL 4QTIH 2B1HL 1CF8L 2HJFB 3BIBX 4X6DB 4NKDB 5D96C 2A73A 4KV5F 4F8TA 3P4LA 1CFBA 1U8JB 3FQXA 4FFZL 4FQJL 1AI1H 2EIZA 3QA3B 1DLFL 2R15A 2D7NA 5DHYA 2RFXB 3O3UN 1EHLL 1LO4L 3GB7B 5FUZL 1X5AA 1JNNL 4GQPH 4KAQH 2MJWA 1DQLH 4WO4D 2WWKO 3DUSA 3U9PH 1TMCA 2W9EL 2D0FA 4NQCD 3RDTB 4WGVB 4ZOAA 3QNZA 3IJSA 5K9KB 4DZ8B 3SCMC 3E6HA 1I85A 1ZLSL 1BVLA 2A83B 1WZLA 2NXZB 3ZKMC 3H7LA 1FPTL 4IJ3C 5SV3A 3VFPB 3OR6A 5KS9E 3HZKA 1JF1B 3ZE1E 5I15H 4P2QD 5E99L 3QNXA 4P59H 1HEZB 3FQNA 5DVOA 2CGRL 3ES6B 3G5ZB 3QNYB 4LEXH 4Y4KD 3V95A 5C07D 4GAFB 5JPMA 1A6VL 4MJ5B 3VXSE 4PV9B 3BMVA 2XOTA 3TIDB 1MFAH 5EUOE 4LCYB 2ZUSA 3EYSL 3LQAH 1UZ8B 5L6YH 3SOBH 5SX4I 2W0FA 3MA7B 3PWPA 4RQQA 4Q9CA 1LP9E 5T5FH 4YBQC 1V7MH 2EO9A 4HXAL 4NBZB 1CLCA 2F54E 1FFPB 3DECA 4GT7A 3AFLA 5DC0A 2DLEA 5DEFA 2Q3ZA 1JV5B 3WS3A 3IETB 1MLCA 3CUPA 4DVBB 1TLKA 3C6LA 3UPRB 1IJ9A 2C3HA 1ZHKA 2ARJQ 3EBAA 3VA2C 2AABH 3RVTC 4YO0B 3HE6C 4R4FH 1TVBB 4HJGB 5DFVC 4PLKD 3O6FA 3WFDL 3QJFA 3S37H 4UIKH 2AJXL 4JQIL 4U0RC 3CDYA 5DQ9B 1ZWIA 4U6YB 1ZLWK 3KPQA 3L95B 5C0CD 1A3LL 5F9WB 5I1KH 2QADC 5F6HI 3RRQA 1UVQA 1X9QA 4OV5B 3FB6A 3JWOL 1EEUA 4DZBB 2VDPH 2D9QB 3PWUB 3RU8L 5EPMA 4JZJA 5SWSD 5IVXB 2OBGA 2UUDH 5L2JB 3NIFE 3HI6H 4XBEL 4KK5C 3JTSB 1IC4H 1SQ2N 1MH5B 2R23B 1KJ2H 1DZBA 4JREC 1JYXA 4D9LL 1N6QL 4ZS6C 1E27B 3GJEB 4G42A 5KSAD 4EI5C 1U36A 2A6KB 4KVNH 4JVUA 4LNRB 2BNUB 2MTPA 4RISH 4HIEB 1P2CB 3QRGL 3KS0J 2GEEA 4JRYB 3ULSA 4YUEH 3I85A 4EUPG 5KS9A 1EAPA 4S11A 4NC2B 1NUFA 2ADGB 5EA0L 3O6LL 1LILA 2Z4QA 2EDHA 2V17H 4PGEB 4L9LC 1ZGLB 2AI0L 4ZYKA 1FAKT 1CE6B 3KYNB 4ZPTB 4P4KB 3VXSA 2C7UB 4X6EB 5BQ7A 4ZFOL 5IESH 5EUOA 4JKWA 4WUKH 2B4CH 2HWZH 4LRIA 5E2UH 1TPXB 3O3EB 1S5HB 3ALXA 3FN9A 5DUPH 1JZ4A 1LP9A 4BKLB 3UJTH 3TJEL 2F54A 1R5VB 4WCYH 4AL8L 2LE9A 2R0ZH 1DR9A 1YEKH 1AHWB 1T1ZA 3EYUL 3VFGH 4NHCH 3E8UL 5E00B 3SKMA 5JA8B 4OLYH 3TP4A 1QR1A 3X17A 3MNVB 5KS9F 2HJFA 3HG1D 4NKDA 3ZKMD 2JB6B 1RZGA 1KCKA 3SGKA 3VDBA 3VG9C 1KEML 4DTGL 4JHWH 4Z7QE 5FOJA 1U8JA 2VL4A 1K9TA 3H42L 3T0WA 3RIAF 3QA3A 5HGHB 4HK0B 4KZDL 2VXUL 4TTDD 4WEMB 1MJ7H 4XMKL 2RFXA 5D1XB 1TJIL 3GB7A 3HNSH 2XQBL 4PGBB 4BJLA 4J3SA 5EUOF 5J0BA 3KAAA 4AEEA 1G7IB 3NFSH 1FDLL 1WBZB 1YMHB 4NIKB 4DN4H 3VFOB 5SWQB 1G9ML 2P1YA 4OI8A 1LP9F 1PYWB 2ZPKL 4XP4H 5E6YA 2EYTA 4D0CB 2C4FU 3D9AH 1NC2D 1HKLH 5IROA 4OSUL 3B8YA 5K9KA 4DZ8A 2PN5A 1ND0B 2OZ4L 2A83A 1UB5B 3PV6A 4NGHL 1DP0A 3WN5B 3CCHB 4ZFFB 3VFPA 4GUPA 4ZXBC 4G6FD 1AD9B 4FQIL 5K9JH 4U1NA 1BP3B 2J88H 2I24N 5KVMC 4LHUG 3ES6A 3G5ZA 3QNYA 3RVTD 1PAMA 3OAUL 3HE6D 1YYLH 5DFVD 3SGEI 5CJ8A 4KHXH 1M71B 2OK0L 3SBWC 1J0JA 4LCYA 4LSSL 1HH9A 2VXVL 1UZ8A 3QG7L 8FABA 1GIGL 3RUGB 4PP1C 5GGVY 4X6BB 2QADD 3MA7A 3QFJD 2IAMB 3ZLQC 1IGJB 1KSRA 1ADQH 3LMJL 4P9HL 1MVUB 1QFWL 4WWKB 3NIFF 3S36H 1JV5A 3SGDH 3IETA 3WFBL 4DVBA 3PE9A 2HRPH 3TNNB 3T2NL 2XV6B 2IWGA 1G9EA 3UPRA 3MLWL 4YO0A 1E6JH 5CUSH 1CICA 3DETC 3PIQA 3T08A 2BSSB 5I30H 4QHKJ 2RCSH 4NKIH 4ZS6D 5DQ9A 1J8HD 1EEYB 3IDYB 2CPCA 4GRLB 5IVOA 4HGMA 2VZOA 3CFCL 4OV5A 2FX8H 1ETZB 4L3AA 1NL0H 2UVFA 4LVHB 5I1IH 2Z91B 5I76A 1F3JA 2OSLB 1ZT7B 4DZBA 1OY3B 3FT2B 3GSVB 2CUHA 4XNZC 1QBBA 5J7CC 3D2UD 3GMLB 2RB8A 3ZT6A 1YYMH 1U2HA 5L2JA 1VESA 2PW2A 1IT9H 1RUMH 1CCZA 3TJHA 5CGYD 5I1AA 2DQFB 3OG6B 1MH5A 5EWIL 1E27A 4KRPC 2H8PB 3OPZH 4HIXL 1N8ZA 1BBDH 2FB4L 4KY1H 2A6KA 4M02A 4LNRA 2BNUA 1XF3B 2JJSA 5HBBA 2VE6B 5A2IH 1PG7L 1P2CA 3LEXB 5I73B 2BX5A 1EA9C 1CDBA 3PG2A 3CC5A 1A8JH 3BESR 2ZKHH 1EZVX 4LOUC 4MCYB 2ADGA 5C09E 4K7PL 1D5ZB 4JG1H 4LCWD 4PGEA 3RUGE 2YD4A 4QRPD 1ZGLA 4X5WB 4TSCH 1Q9LA 2Y23A 1CE6A 3KYNA 4IS6B 4OF6A 1B0RB 4P4KA 2C7UA 3HPJA 1EEZA 2CDGB 1K8IB 1YN7B 3BSZL 4M93C 5I18H 3O3EA 3SDAB 3BN9C 1S3KH 1T6WA 4R90H 5DD3H 5BVPL 3MRIB 1NQBA 4D9RD 4QOKD 3UTPE 1YQ2A 4BELD 1CL7H 2Z31B 4KROB 4ZUWB 5F9DC 4Y19B 3MV8B 1MQ8A 1INDH 3LV3A 1GC1C 2FWOB 3MNVA 3T0EC 1TXKA 4M7KL 4O02H 2JB6A 1R3LB 4MNQE 4MAYC 1G7LB 1JNLH 4Y4HC 4ZXBD 2UY6A 3SE8L 5HGHA 4JFEB 1V7NH 2A77L 2AV7B 4IMKA 4EXPX 3RA7H 4PGBA 2ZUUA 4WI7A 4S2SB 3C87A 1G7IA 5FGRA 3QYCA 1WBZA 3VXTB 3VFOA 3OMZA 4LAJH 1A7PL 2OMNA 1BMGA 1PYWA 1EJOL 2IH1B 4D0CA 3S35H 4H1LG 3A6BL 1MJUL 2NY0D 4K8RL 5CEZH 4UB0H 1NAML 1ND0A 3JV4B 3WNNA 4ZUSB 1ZLWH 3HMWL 3JUZA 5CZKA 3WN5A 3CCHA 4ZFFA 3MCLH 1A14L 2I25N 1AD9A 1BFSA 3LZFH 1TVHB 3IDMB 3BDXA 4U1JB 5D7IB 4N0FB 3DSFH 1MJ8L 5D7JC 1QBLL 5IBTH 3DETD 2XA8H 1M71A 3W2DL 4HCRA 3C6SB 2AEIT 3IRPX 4U1KB 3NPSB 5C09A 2NZIA 2CQVA 3RUGA 4X6BA 4CVXB 4OIIH 3WL9B 3VH8B 3KJ6H 5ICYB 2IAMA 1IGJA 3MV9D 2FNBA 2FX7L 4QXTB 2BP3A 3DARA 4M5ZL 2E6JA 4K2UH 4NQDB 1IGCL 3L6FB 4WWKA 1CF8H 4IOFC 4Y19E 1MQKL 1WCQA 5DD6A 1WIUA 3BPOB 3MV8E 5CSGA 5I75C 3U9UB 4P2OB 1ZMYA 3TNNA 1H3UA 1YEJH 3RY4A 5B3NA 1DQQB 4FFZH 4X83A 1J5OL 1DLFH 3VRIB 1JMXA 4PV8B 2BSSA 4X98B 4TULH 3WNMA 4PJFB 4NWUH 5DRZB 4JFEE 4KRPD 5JDJA 1EEYA 4GRLA 1FJ1B 4BFEA 2BVUA 3GHBL 1FL5B 2W9EH 4MVBD 4MNQA 4NZDA 3UYRH 2DDQL 1ETZA 5GJSL 3RUGF 2D31B 4Y88A 2Z91A 4LOUD 4G6AD 2OSLA 1NGQL 5DMIL 1LO0H 1ZT7A 1BQUA 4RMSA 2C1PB 3GSVA 5IB3A 3D18B 1QG3A 5DYOB 3B43A 4J3TA 2WQRA 2DQTL 1CD9B 3GMLA 1YEDB 1FPTH 5K33A 2X1QA 3T1FB 2A6JB 3OKOB 5FM5O 3JXAA 3T4YB 2XG5A 2Y7QB 2Y07L 5EIIB 1CR9L 2DQFA 5EG6C 2VISA 2CUIA 4S10A 4P9ML 3TT3H 5HPMB 3GMRA 3BN9D 2H8PA 4L8SC 5D7IE 1UM6L 1A6VH 4YBLC 1XF3A 2VE6A 3G5YB 3LEXA 4LMQE 4TNWK 1T22B 3VXOB 3V7AG 1BGXL 4ORGB 5I16B 3REVA 1NMCC 3O4OB 2X42A 4LAQL 1UM4H 4E41D 1NLBL 4KTEH 5EZJB 2ARJB 4HXAH 4H8WL 3W39B 3T0ED 1D5ZA 3D3VB 3SE4C 3TH4T 1ZT1B 3FO1B 5DJXB 4P3CH 4YDVB 4MAYD 4IS6A 3I3BA 4OGAC 1NBYB 1B0RA 1U8HB 4Y4HD 1VGEL 1A4KB 5IQ7H 2F53B 1JI1A 3RVUD 4ZNEE 5DQDH 4S1SH 4NQDE 4N9OB 2YN3A 3BD4A 4UNVA 4WTWA 4JN2B 1YN7A 5TE7L 1Z6JT 4ODVL 3SDAA 15C8H 4YX2H 1RHFA 2O5YH 3MRIA 4XP9H 4OCNC 2AJXH 4JQIH 2D0HA 2H9GB 3TVMC 2Z31A 3QWRD 4OUUB 2HVJB 5J13C 3HE7B 3INUH 5HYJB 4WFED 1RIUH 4Y19A 4DGYL 3MV8A 3RKPA 5FUOH 2QSQA 2X4UB 3MRDB 3EJJX 3N1MC 4U2YA 4P5KB 1F8TL 1KIRB 5DHVB 2PCPB 3O45B 1NCAH 1CGYA 1R0AL 5J56B 3Q5YA 3GEWB 5FO9B 2Q6WB 3RI5K 1FG2B 4JFEA 2AV7A 5J6GB 4Z5RB 4KJQD 1BAFL 3DGCR 5HHVH 5MEQB 4NJAL 2WUCL 2UVEA 5D7JD 1MRDH 5FYJH 2CRYA 3RI5F 4QHNB 4D9LH 1N6QH 3CFKB 4JHBA 5EC1B 3NAAL 1M7IB 1DN0B 4X0KB 5GRWA 1DE4A 3O2DL 1O0VA 3N85L 3QRGH 1WEJL 2EDLA 2IAND 1GPOL 3JV4A 4LSTL 4KK6C 5E2WL 1ONQB 4ZUSA 3VXRD 4LCWE 4W81A 4QRPE 3O6LH 1RVFL 5JPNB 5BZWA 1ACZA 4IOFD 4DEPB 4HWUA 2AI0H 3BP5A 3IDMA 4X6CB 2R2HA 3JV6B 4U1JA 5DUMH 3QH3A 5D7IA 1LQVA 3S8WA 3D3VE 5D72L 3U7AA 1WK0A 2VZUA 4OCYL 2DIJA 1F4WL 1K2DB 3ULVL 1JWMB 2F53E 2RQ8A 4FXKB 4R0LB 4U1KA 5J6HB 3TJEH 3RL2A 1F42A 3MRLB 5D2NC 4AEHH 7FABH 4KI5D 4FRWA 4NUGL 4OGXH 4CVXA 3EYUH 3QXTA 5ICYA 3E8UH 3U2SB 5FB8A 4LVEA 1EUTA 2IGFL 3IDNB 4QXTA 4RDQG 4ZNEA 5I6XB 4MCZA 4NQDA 5IHUH 1LE5B 3L6FA 4E9LA 4WUUB 3ZKNC 4PJDB 1FG9C 4DTGH 3TO4C 1FO0B 1NEZG 1DQQA 4PRDB 2EDRA 1VEMA 4BUGA 2JJTC 4KQ3L 5D7IF 3VRIA 4X98A 4XZUB 1TJIH 3EYQC 5DEZA 2XQBH 4F3FB 1MCIA 3K2MC 4ONFH 1KPRB 2V9RA 1FJ1A 5I74C 1G9MH 1FL5A 2Q1EA 5TF0A 3NH7L 4R26H 1H5BA 5IVZA 5KZCB 2D31A 4OSUH 4LLVB 1MCPL 5IW6A 1W72L 1T1XB 3FOMB 2C1PA 1T21B 3D18A 1ZHNB 4TSBH 3WNOA 4U1GB 1QHPA 4QGYA 4LHUA 1AKJB 5GHWL 9CGTA 4OGAD 3ARXA 4NHUE 2L7JA 3ILPB 2QHRH 3T4YA 2Y7QA 5EIIA 3LKPB 1FGVL 3CSGA 2DBJA 2CD0A 4AY0A 1DEEB 5HPMA 1JRHL 3W5NA 4X6CE 4JFFB 5FV2A 3RJDA 5KJRL 3GSNL 2GSIB 3QIUC 5DJ2B 3WFEL 1QNZH 3VD7A 5GGVL 4QRPA 2EH8L 1T22A 4S1QL 2WP3O 3VXOA 4NQVB 2VXVH 1GAFH 2VIRB 1GIGH 3IGAB 1RJLA 3QDJD 1AGBA 1G0XA 5A3IC 4K9EH 3S3SA 2ARJA 4NCC1 3EOBB 3D3VA 4XAKE 3IDGA 1QO3B 4P9HH 1ZT1A 3FO1A 5DJXA 5GZNC 4LRNL 4HC1L 1EZVY 1IBGL 3BE1H 1U8HA 2WV3A 1A4KA 2D7OA 2F53A 1PGRB 2P42B 4YHLH 3T2NH 4Z6AT 4NNXA 4WUUE 3FZUC 4JN2A 1Q9OB 5FF6B 3QB7C 1E0OB 3A67H 5C86A 3RWDA 1BQSA 5BS0D 1FGNH 5GXBB 5JW3L 2PYED 3IFLH 3NN8A 4OZFH 2H9GA 4WDIB 2VSDA 2EXWC 4OF0A 4OUUA 1MREL 2HVJA 2IPKA 2OX5A 3L5IA 2YD1A 3WFHB 3L7FB 1E4KC 1XF4B 1A1OB 1L9NA 1Z0NA 2MNUA 3I75B 5D70L 2HKFH 1C8PA 2VTFA 2X4UA 4IMLB 5SWZE 2DL2A 2F19L 3WIHA 1KIRA 1PKOA 5C0AD 5DHVA 2XN9D 4KK6D 3V52L 2PCPA 3O45A 2NNAA 3Q6FB 2CH8A 3SE3C 4D94A 2D7TH 1PLGH 3ECBB 2Q6WA 1FG2A 1EGJH 2H6PB 4DGVH 4QEGA 5MEQA 3GGWB 4HUNB 3OSKA 3U0WL 1YY9C 1AQDB 4PRHD 2EDJA 3CU1A 3D25B 3Q2CA 4R97B 5E9DD 1I8LA 4YWGH 4H20H 4IRJD 5EC1A 1BD2E 2FB4H 1BJ8A 1S9YB 3LKSA 4NUJA 4X0KA 5F1KC 4V2BA 3MUZ1 4JFFE 2NQCA 4AEIL 3PHOB 4NHUA 2JTDA 1ONQA 4JANB 2IFFH 2R0LH 4JDZB 1F58H 2M2DA 4I0PB 4W6YB 1WWCA 2VLLB 3HC3L 4R6UA 5KVGL 3ZKND 2B4CC 2IPUG 4X6CA 4KTDH 5GGRB 3JV6A 3A6OA 4PP2B 3HA0A 4G8GD 3ARBB 4YHYC 4L3EB 2G5BB 2QKIA 1J05A 3LAFA 5JW4Q 3LDBB 1JVKA 5EU4B 4XPAH 4GS7C 2XZAL 3S34H 3D87B 2NXYC 4U7SA 1J1PH 1YEEH 1OP3K 3D6GA 5J6HA 1FIEA 4GQ9L 1KCUL 1AXSB 5A2FA 4YHPB 1BF8A 2XNAB 3KWWB 1FN4A 3MRLA 1EBAA 5CJQH 4O2CB 4WFEE 4C54A 5TE4L 3QQ4A 3SDDB 2P5WD 3EZ8A 3VWJC 4UDTB 2V5SA 5CP3H 2GFBB 3P0YH 1LE5A 1KPVB 4ZAKB 4WUUA 4PJDA 5IKCB 2FJGA 3GM8A 1A21A 3B6SB 4XCFH 2DJUA 1YN6A 1FO0A 4OI9A 4PRDA 2P48B 4X6CF 1PZ5B 2A77H 4MVBA 4XZUA 3LHPL 1AP2A 4F3FA 4PJGE 1SEBA 3EO0B 3UDWA 4PTUA 1KPRA 4HG4J 1JGLL 5TGBB 3KLSA 5SWZA 5CZVL 3ULUH 4UUJB 1MNUH 3SDCC 1KXQE 3BQUB 1CDYA 5IEHA 3A6BH 1MJUH 2R2BB 3F7VA 1KELL 3DSNA 3V7AE 4M9OA 1TIUA 2BVOA 4LLVA 5A3ID 3FOMA 1T21A 1IEBB 1KIQB 3M8OL 2XTJB 5GZND 1NMBH 1J12A 1AKJA 3C5ZC 1D7FA 2EDFA 3HC0B 3GJFK 3ILPA 1CGSL 1H8SA 1EFXA 4Z7NE 3LKPA 1BD2A 5FYLE 1DUYA 4NPYB 4UNTA 3FZUD 3FQUB 3H6JA 2NTFB 2JIXD 1OLLA 5CHNB 1QBLH 4JFFA 1A22B 4HV8B 4H25A 4NSKA 2GSIA 5JUEH 1EO8L 3W2DH 1BOGA 1L6ZA 4LPVA 1OAKL 4KI5E 3SKOA 5KANI 4NQVA 3VI4E 1K85A 5KANG 2VIRA 2R2EB 5IFHL 1FORH 4JGMA 2EE2A 4UOW1 4HKJB 3UJIH 3EOBA 4M8VA 3MRQB 2FX7H 4HUXB 3CVHA 4CBPA 1LNUB 4AIZB 1NDGB 1IGCH 1Q72H 4FZEL 2FHCA 1QTYT 1F02I 2AAVA 4OGYL 2QQLL 4HHAA 3F8UB 3OKEB 2BVTA 5FHAL 3MXVL 3TN0B 3AU1B 2NY4B 3JWDC 1Q9OA 4P5TD 1YY9D 2OMBA 1WJ3A 4X5LA 4Y7MA 1A64A 2RR3A 1HOCB 1I7UB 1Z9MA 1LHZA 2VDOL 1MPAH 5HDQH 2D2OA 1DBJH 3WFHA 3L7FA 3TA3B 2CO6B 3C08L 3GHBH 5CIPH 4Y4FC 3I75A 4L29A 5F96L 2DDQH 3BO8B 4JN1L 2GCYA 5GJSH 3H9ZA 5HDOA 2HJLB 3ARUA 3JWNC 2NY7H 2HH0L 4N0CC 4LPCA 4X7CC 5DMIH 3Q6FA 2FCBA 4PJGA 3ZYZA 2JF1A 3QO1B 3ECBA 2OTPA 3AC0A 4XNXL 1XGUB 3EZJB 2H6PA 4ZO9A 2I5YL 3GGWA 4M7JL 2Y07H 2XTJE 1JGEB 2QJDA 3C9NA 1AQDA 4YDJB 3QDAA 5JORB 1LK2B 2W60A 2NXYD 4Z7OE 1S9YA 3QUYC 1KLUB 4EDWL 1SBBA 3K4DA 1I7RB 3OAYK 2C26A 4LVOB 3I6LD 1CLZL 2WBKA 5E6IB 3VWJD 5T1LB 1FZJA 4I0PA 2GJ6D 3CNKA 3DWTA 2ZOLA 4LAQH 3S4SG 5E24E 2VLLA 1NLBH 3BOVA 2A38A 4H8WH 4ETQB 4OB5L 4X4YA 3ZKQD 2YBRA 4H88L 1FBIH 5GGRA 4PP2A 2KQNA 4G8FA 4PJIB 4PJGF 1I7ZB 3ARBA 4N8VG 2G5BA 3HR5A 5I66B 2EYSB 5DJCB 2BSRB 4TOYH 5IP4A 4V3EB 3OGCA 1IM9D 4IRZL 3UAJC 1FV1A 4YHPA 3KWWA 1MCFA 4O2CA 3TPUB 3SDCD 4BSVA 2SEBB 1SVCP 4MD0A 4M3KB 4GBXC 2UWEB 4UDTA 4DGYH 5KVEH 3LD8C 3IVKA 1T7YA 3NFPB 1A0QL 5E94B 5IKCA 4Z7NF 3G5VB 3B6SA 1X4ZA 1U3HC 3ZYOA 1R0AH 3DVGB 3REWB 1YC8A 3EW3B 4Q9QL 1PZ5A 1G7PB 1U8KB 2WUCH 3VW3L 1U8IB 3EO0A 3UTTE 1OQOA 4KI5F 3ZKXB 1WBYB 4Z0BH 5TGBA 4C57C 3SKJH 4NZRL 1BM3H 2IPTH 4J3UA 2MKWA 4J6RL 3RWFB 2AJSL 2VDLL 1N0LA 4UUJA 4ZUTB 1KG0B 2HLFC 4OFKA 4PB9H 3N1FC 5FGBA 2R2BA 4ZQKA 3O2DH 5C0FB 5M94B 3MLSL 4EIZC 4CVWA 1GPOH 4GMTH 3RWEB 4PBWD 3PWVA 1IEBA 1KIQA 5GRZA 2UZYB 3HMXL 4LNVA 4KQ4L 1CL7I 3NCEB 4NO5B 2J7LA 3AM8C 4QT5A 3GMPB 3U7WL 2DQDL 2A6IA 5I17A 4NPYA 4UAOC 3FQUA 1QFPA 2H1PL 2NTFA 1UWGL 1AH1A 4KKBD 5CHNA 5CZXD 3RJQB 4HV8A 4YGAB 1CFSA 5KBNC 4RGNB 1OM3L 3ZE2E 2N1KA 5DFTA 4Q6IC 2H2PC 5TFSH 1OF2A 4ZUVA 2ICEB 5C7XH 5ISZE 4NUGH 1OWRM 4JPVH 4HKJA 4UT9H 4LP5A 3OJ2C 3MRQA 3O4LB 4GG8B 2XZCL 4HUXA 3MGTB 1LNUA 5DD1L 4AIZA 1NDGA 3WHXA 4WW2B 1H15A 2ZSWB 2AXHA 1AY1H 2P7TA 2UWEE 1XF1A 3EYFB 4AT6B 1CFNB 4M7ZC 2BVQB 3OKEA 1QR4A 2HG5B 1T7WA 4J1UB 3TN0A 3AU1A 2X5PA 3BXNB 4BQ6A 3HNTH 1D5BA 4M5YL 4WFGE 4Z7OF 4MZ2A 4CU8A 1CVRA 2FO4B 1PKQB 4TUJB 5JXAL 3QPXH 1FNLA 1L7TH 4P46A 1C16B 1HOCA 1I7UA 5F1NB 4HKBB 2AXJA 3QUYD 1NCBL 4H26B 2VMFA 4BSWB 1U8NB 3OHXA 3BO8A 1FYTD 5IF0B 5HHOE 2HJLA 1OP3H 2HT2C 1YJDC 2VL5B 5ESAB 1OAZH 3BT2H 2WWKT 4XTRC 5E5UB 3S88L 3UTTA 5F1IA 1PEZA 5DRNB 4IRJA 3EOAB 1S9VB 1A6WL 1JGEA 5JOEA 3IS0X 5DVLA 5JORA 1NFIB 5I1JL 4P3WA 5J11B 1D6VL 5KJRH 3GSNH 2VH5L 3IJYB 1CDHA 1DBML 3H8NA 5BZDB 4AENB 1KLUA 4NJ9L 4JFOB 2I27N 1I7RA 3DV4A 1KC5H 4S1QH 1JTPA 1FIGL 2AJUL 4UTBL 3ZHLA 4RGNE 5I1DB 4GBXD 2WY3A 1WWBX 2EDWA 5T1LA 5FGCB 5F7LB 4U49A 4WV1C 1CE1L 4LGSB 5FOBB 2GJZA 4ETQA 3E2HA 1AGEB 2J8HA 1BECA 1IGFL 4LRNH 3GSWB 4W4OC 1KCVL 1DFBH 3QEHB 4JPKH 1X5ZA 5C6WH 5DJCA 1V8HA 3O41B 1A9BB 4O2FA 4I4WB 4PJ9C 1A2YA 5ISZA 3TYGH 1WT5C 3JWOC 4WTXA 3SO3C 3GJFH 1OP5H 4HKXB 2BNRD 4Y4KB 3A6CL 1MREH 5T3XE 4ZD3L 3KDMB 2SEBA 5I8CB 4DW2L 2UWEA 2YPKB 3GBML 3RL1B 2FD6H 5I9QC 3FFDB 5D7SH 4PG9B 5AG9A 3NFPA 2F19H 1HXYB 2EECA 4M1DH 5E94A 3OJDB 3G5VA 5T1KD 3P4MB 3V52H 1PX3A 3DVGA 3REWA 4BH8B 2DQCH 4LKCB 1G7PA 1U8KA 5LQBH 1A02N 4YBHA 3G04A 2GKIA 3ZE2F 2EKSA 1U8IA 5MEOB 4PD4K 3W0WD 1IAIM 1WBYA 2PW1B 4V1DB 5HHOA 1MCRA 2WIIB 5ICZA 2D4FA 5CBAB 4YPGB 1OGAB 2AW2A 4ZUTA 1FP5A 1KG0A 2H2PD 4Z7WB 4Q9RL 3I6LE 5KSUA 4F57L 3WCYA 1FVEA 4FABH 5GIRB 1G7JB 3BKYH 4AEIH 3TCLA 3GM0A 2UWEF 5MEND 3KYKL 3RX7A 5EU6D 3RWEA 4KUCF 3HC3H 4FTVD 1EHXA 5KVGH 4NO5A 5EN2B 3ROOB 3WS6A 3NGBB 1ORQB 1GL4B 2E6PA 5FGCE 2GK0B 4I77L 2BMKB 4YDIL 1L6XA 2B1AH 3CXHK 2D03H 1RUKH 2DWDA 4GQ9H 1KCUH 4Q58C 2YWZA 2ICEA 2J6EH 3FRPG 4RX4A 4WFHD 4EZMA 3E0GA 1MCQA 4QNPE 4ZPVA 1T2QL 5I2IA 3V4PL 4GG8A 1OT1A 3W9DA 1ORSB 1QFOA 2ESVD 3MGTA 4LK4A 4P3DB 2ZSWA 4XTRD 1HXMB 1WISA 3EYFA 3OAYH 4DWHA 4AT6A 4MJ6B 1CFNA 2BVQA 4I3RH 5FDWB 5IG7A 3PNWB 2HG5A 4J1UA 3BXNA 4PGZA 1U3JA 1AO7D 2AP2A 1KN2L 4WGWB 3HI5H 2GY7B 4MD4B 2FO4A 1RU9L 1RZ7L 4R3SB 3B5GA 5CBEA 1H3GA 5A2LH 5CZVH 3V8CA 3D0LB 1F6FB 3OKDB 1U8NA 2KPNA 1CFVH 4JM4H 1WTGT 4LSQL 1T20B 2Y06L 2WZPD 2QQNH 4V1DE 3SPVB 1KELH 4N1CA 4G7VH 1OGAE 4LLQB 4OTXH 5ESAA 3R1GH 3B2VH 2HMIC 4MXWL 4Z7WE 5IMOB 1JE6A 1WZKA 3MJ7B 2Y9RT 1CK0L 5DRNA 4X6FB 3EOAA 2YKLL 3SCMB 5J4MA 1F2XK 2OL3A 1LQSR 3GI8H 4ODSL 5ID0B 3C09C 4PJ9D 4QCIA 1DVFC 4IJ3B 4P23C 5I1GH 3L3IB 3IJYA 5BZDA 4JFOA 2MMXA 3IU3B 1HQ4A 3FT4B 4OLVL 1UCBH 3VXNB 4I3SL 5IFHH 4LIQH 5FOBA 3BD3A 3G6AB 2MCPL 4C4KO 4FFVC 1IM9A 1OW0C 2ITDB 5AZEH 4PJ5B 3U30C 5EORL 1KN4H 2KBGA 2QQLH 5FHAH 3O41A 2CXGA 3MXVH 1XAUA 4I4WA 1KCRL 3H7BB 4NQTA 2OP4H 4AMKL 3H3PL 2FL5B 3C8KB 4JZOA 4NQED 4MJ4A 2ARWA 4HKXA 3VE0B 1KGCD 3DLQR 3FB8B 3KDMA 5I8CA 1OD7A 2AXFB 4R7NA 4PG9A 4G8EB 5F96H 3FB5B 4TVPH 2EDEA 2Q8BH 3PGFL 4U0QB 3V6BR 3OJDA 2HH0H 3O2WH 3UTOA 5GGRY 4PUBH 1KTKE 5INCB 4LBEA 2PXYC 1MF2L 4BH8A 1C1EH 3EJYD 4I0KA 1U8MB 4EBQL 1G9NL 3H3KA 4WEBH 3DO3A 3PP4L 4M7JH 2FIKA 4MJ2A 4LU5L 5MEOA 1BQLL 3VFVB 4GAGH 4DCQB 1MHCA 2X09A 2PW1A 1ZHLB 1QFWI 4V1DA 5I19L 3W9EB 4YPGA 1OGAA 1LEKB 4JAMB 4FMKA 4QNPF 2E7MA 4MA1C 4Z7WA 5E5RB 2Q87A 2ZUYA 3S4SA 4F15C 3JZ7A 4WW1B 5MEPA 4JREB 1G7JA 4LSPL 4EI5B 5DMYA 3LEVH 1KB5B 4PTTB 4TN9A 4P57B 2FEEL 4N8VA 3MV11 2YS4A 4A6YA 3C60A 5E8OB 5EN2A 4OF5A 1ORQA 4H88H 3QHFL 3ROLB 2D7MA 2GK0A 3GFUA 2BMKA 1SJHB 4FP8H 1ZSDB 3DJ9A 5HVFB 2ZG2A 4D3CL 1H8NA 1VDGA 2YRPA 3LH2H 4IRZH 5HDBE 2QQKL 4PRNB 4OLUL 1JGVL 2NTSP 4KVCL 1EK3A 1N5YH 4KK9C 5HYFA 3HCVB 4Z7WF 1CI5A 3ZYIA 4PY7A 1T1YB 1NUGA 4LLAA 3WJJA 5CINH 4XP1L 4M1GL 4Z95H 1ORSA 1G6RB 2DWEB 1LGVA 1ROWA 5JOFB 2HMID 4P3DA 1FYHB 2WBJC 1DANT 5B4MD 1HXMA 3PHQB 2OR8A 1KEGH 2DKSA 4MJ6A 3TT1L 5FDWA 5C2BH 3PNWA 4AH2A 5ESVB 43C9B 4CU6A 1N64L 4NZUL 4PDCE 5C0BE 4MD4A 4RNRB 1MCOL 4K8RC 3VG9B 1FNSL 1Q94A 4R3SA 5C3LD 3F12A 4UU9A 1YMMB 4CUCA 3QCUL 1G0YR 2AJSH 1ZLVH 3KPMA 1RIVH 3OKDA 5IFAH 2XWJB 1T20A 4DKEL 3F7QA 5TQ2L 2VWEC 3SPVA 4RMVA 5EU6E 2NZ9C 4C56D 2EDKA 3MJ7A 4FFVD 1XZ0B 4C58B 3HMXH 1HSAB 2B8OT 4OCWL 4OCRL 5DUBB 3SCMA 3B9KC 3MOBL 3QHZL 5JO5B 1TQCC 5EOCJ 3ZYJA 2DQDH 1JWSB 5ID0A 3ET9F 2BC4B 2H1PH 1AGDB 1C12B 4XPBH 1UG9A 4PYGA 3GK8L 1YEHL 3L3IA 2A9ML 3TZVD 3DURA 1TZGL 4I48B 3AREC 5JW4M 5C9JB 4ZFZA 3IU3A 4JKPH 1Z3GH 3L3JA 4JM2C 4WFHE 3VXNA 1PY9A 5MP6L 1AE6H 4F7MB 1RUQL 2JKXA 2P5ED 2J4WH 3Q48A 2FATH 3G6AA 3QJHA 5F3BA 3RHWF 4RCAA 3O0RH 1UXWA 3ARPA 4KMQA 1JGUH 1F4XH 5DD1H 2IALB 2FJFB 2ITDA 5IJVA 4PLOB 5H37G 4NO0B 3LN4B 1RK1B 5JHDD 1RMFH 4KMTH 3QCVH 4KHTL 5JW4N 5J1TC 3H7BA 1UWEH 3QWOB 3QXAA 4MDJB 4JPWL 5K9OA 2FL5A 3C8KA 4PJBB 3OKMB 2V2WA 4LLDA 3T3ME 1BWWA 3CXHJ 2ED7A 5BO1L 1QPXA 3SGJC 3LRHA 2JJWA 2OXGA 1W2KT 2W38A 4MQ7B 3LRGA 5IEKA 3FN3A 4GMSL 1CBVL 4CMMB 4G8EA 4YNYA 5EU7E 1ZOXA 4NN6C 5EOTB 2V5TA 5ESQB 4MMZC 2DQEH 1FZOB 1FNGB 5INCA 5C0BA 2XFXB 1XGPB 5L7XL 5LAXB 1RUAH 2RJMA 1U8MA 5HI5C 5E2VL 1FRGH 3EOTL 5K93A 2BHUA 4EQ3A 5HDBF 1A6WH 4ZOBA 1DBKL 1CU4H 3O3AA 1RZKL 5JIKA 4DCQA 3V4UL 1ZHLA 1T83C 2VLKD 3W9EA 1AD0B 5CGTA 1AQKL 4JAMA 1LEKA 5EU6A 3GI9H 4H8WC 3X3GL 2VH5H 1DBMH 5GS1C 5IFJB 1TENA 4MMXC 4WW1A 4S1RL 4JFPA 1CTOA 3PDOB 4P5MB 1FIGH 2AJUH 3LEYH 1CD1A 3P2TA 4PTTA 5HTSA 4P57A 4U1IB 3QUKB 3WXWH 1YEIH 1VEOA 2XZQL 5DA4A 3CVIL 5E8OA 1U3ZA 3BIAX 2J8OA 4PJ8C 4BQ8A 5HYSG 4XWGL 3LIZL 1UYWH 4EN3D 1NGZB 4M62H 5FM4A 4HMDA 1ZSDA 2J2ZA 4DUXA 3ESVF 3GRWH 2BOBB 2NR6C 3MX0A 4JDVB 1MI5D 1DUZB 1RY7B 4W68A 1NANH 4M4RA 1Y6NR 3A6CH 4M93B 4ZD3H 2DM3A 2VDML 4OCLC 5GGTL 1TTGA 5FYKE 4P2RD 4FFEX 1J1OL 2V5YA 5DMGD 5E2JA 2DWEA 2NZ9D 2AJVL 5GZOC 3CDCA 3MA9L 5CLTA 4NZTL 5EU3B 2OR9H 2VXSL 2NY3B 4PGDA 4UV7L 4MS8C 3B9KD 5ESVA 5EOQL 1VADA 4PYHA 2DQIL 4G9FB 4MAYB 2AK4D 3CDGB 1OTUC 4BYHA 5BRZE 5IW1B 1AXTL 2ZCLL 4JRWA 4CVZB 1T66C 1DBBL 4F7EB 3LS5H 5IIEB 1Q0YL 3GUTA 2NCMA 4R9HA 2XWJA 1J10A 4JM2D 4UBDC 4EOWL 4Q9RH 2X2YA 3GNML 5B38B 4Z78B 2EDQA 5CGMA 1JUFB 4HS6B 1EHAA 1FO0L 4ERSL 3KYKH 4CNIB 3HHRB 1GGTA 3TPKA 1Y0LA 5C70A 1UWXH 4MA8H 1F6AB 4I18A 2D9CA 1BZ7B 1URLA 2DLIA 3ULVC 2R4RH 2PO6B 3W5MA 3T3MF 1JWSA 3I6GB 2BC4A 1AGDA 4PRPD 3L5WB 5EZLA 3FRPA 1EXUB 5HHPB 4ODWB 3KPNB 4JY4B 4TYUA 3U4BH 1P53A 3BH8B 4I48A 5C9JA 2QLVB 4CN4A 2RGSA 4YIQB 3NTCL 5T3ZE 1V3MA 4OZHB 5DR5L 2CJUH 3RVWC 3HNVL 3OGOE 5DTFB 4F7MA 5C08B 1NFDB 3VXMB 3QDGD 5DK3A 4YDLC 1GCFA 2G9HB 2IMMA 3OTTA 5CD3B 4EI6B 4HT1H 1BWMA 5EBMB 3RY5A 2FJFA 1C7SA 4FFYH 3UC0L 3ILQC 4NO0A 3LN4A 5HI5D 1RK1A 2DKUA 5BV7C 5D1ZC 1A6UH 2JELH 1T6VN 3G6JE 4YK4C 1GC1L 4MDJA 4HBCH 1UKQA 3LS4H 3VFTB 1ZT4A 3CK0L 4O58H 1RU9H 3D69B 2HFFB 5I1HL 4YGVB 3KHQA 4YXHL 2HLAA 3LPFA 4XHJD 4G9FE 3DYOA 3SJVD 1E4WH 3CVHL 2R1XB 3RNQB 1YNLH 3PABB 3E3QE 3B9EA 4Q2ZB 5DJ6B 3Q5OA 1FZOA 2Y36H 1HDMA 1FNGA 5CJOL 4MXWH 1J0YA 3CZFA 4WY7H 2AXGA 2NY2C 4J4PD 3CMOL 3VGHA 3NFNB 1IILE 3O6KL 5LAXA 5BRZA 1CK0H 3PWNB 4GKNB 5F9OL 1FNAA 5MI0C 1E4XL 4M6OL 4ODHH 2O5ZH 2DBLH 1RJZB 4N0YL 1VA9A 4ODSH 4P4RB 1MHPL 2D0GA 4UOW0 2ZJSH 4OD1H 3F7RA 1JWUA 2W65B 5TQ0L 4TQEH 1AD0A 1MIMH 5CKAA 3ARGC 4K94L 4XNYL 3SN6N 3FAWA 3MRHB 3WJLC 4DKDC 2HFEB 3GIVB 4NBYB 4YFLI 4OLVH 3PDOA 4P5MA 4QYOB 1LE9B 1XR9B 4L8SB 4XXCC 4G3YL 1D9KD 3FN0L 4YBLB 1TZIB 4HZAA 5TE6L 1EEQA 1MUJB 6FABL 1SY6A 2XICA 1E6OL 3QUKA 4U1IA 3MRFA 1XCQB 5GZOD 3WSQL 1T1WB 2B2XH 1U93B 5HD8C 4CDGC 3KPPB 2DYPD 1NMCB 5DF0A 5C08E 1NGZA 4F58H 3GBLA 4Z7UB 4MS8D 4JKLA 5E7BA 1KNOB 1ZKAA 1HK6A 4X9BA 4KRLB 4J2XA 1I9RH 3O8XB 4F33B 5SX4H 1OTUD 35C8L 2V6HA 2BOBA 2EKJA 3DVFA 2AERT 3P4NB 5HI3C 4HXBL 4D8PB 1VPOL 4TSAL 4JQXA 4RBPK 3J8F7 4O00A 3EDEA 2H45A 4FNLL 2Q76B 5KSBB 1CFTB 4MNHB 1WFTA 2P44B 1IKFL 1BZ9B 1IL1B 4JO2L 5C0EB 5FHBL 3TVMB 2EIEA 1JRHI 2MHAB 4XMLL 3G6JA 5J13B 3SY0B 5EU3A 4YHOL 3KJ4C 4ZFGH 2R0WL 4XMPL 3BUYB 4FMFA 5BMFH 1MF2H 3P9LB 1BFOA 4BSJA 4OAWB 2ERJC 1HH6B 1U9KA 3ULVD 4ZUUB 2VB5A 5GRVK 4G9FA 1VFBA 4EQ2A 3N1GC 3PL6C 4X7TB 5I1LB 1D3CA 1NLDH 1LEGB 4LU5H 4G80A 1JF5A 2V7NB 3QEQB 5IW1A 3V4VH 2OYPA 4OZGB 2EC9T 1TFHA 1HQRB 1Q38A 5GGSA 3E3QA 3BGMB 4DN3L 3V6OC 4F7EA 1AJ7H 3OXRB 5IIEA 1RZIB 4QXGL 4D0DA 3WLWC 3WMSA 2VLRB 1AC6A 2PYEB 3HFML 1IKNA 5B38A 4Z78A 4YH6A 1JUFA 4HS6A 1XH3B 3JSSA 2FGZA 3DIFB 5HHXH 3G6JF 2P45B 3K46A 4MJIE 5J12C 1BZ7A 4G43A 2ICWI 2CRMA 4I5BB 1P5VA 2XN9B 2PO6A 1BBJB 5FO7B 4FZ8L 5D1ZD 2MQ3A 3KHOA 3CPLB 4ZOEA 2VDRH 2CMRH 1BOYA 2XWTB 3I6GA 3MBED 3MLVL 4CMHC 5DWUH 4OUOA 3L5WA 4EUPH 2LU4A 4D3CH 1RIHL 1EXUA 1PVHA 3QIWC 4L5FH 4ODWA 1MI5E 4XT1C 4Z0XA 3KPNA 4JY4A 4F9PA 2AK1L 3QZWB 2JB5H 2QQKH 1N5AB 4WFFD 5HVGB 4OLUH 5B8CA 4L4VD 4W6XB 4OT1L 3RY6A 5KN5B 3ZHDA 4YXKL 5DK0B 4YIQA 4PRHB 5ALBH 1FFQA 5JHLH 2XIDA 4B53A 5DTFA 5C08A 5IQ9B 1MCKA 2H32B 4XP1H 2VDQH 4HUMB 2PYFB 5CD3A 4EI6A 2R4SH 4NCDA 5EBMA 4JO3H 5FUCE 5AZ2L 1AR1D 2J5LC 2NY2D 3HLAB 3NZHL 1N6VA 1T2JA 1PG7W 4XVSL 1XR8A 4TNVK 1N64H 2AK4E 2NY6C 3VFTA 3TO4B 4NM8L 2APFA 1FNSH 4QWWC 2HFFA 3FQWA 4YGVA 3ARGD 3LOWA 1D6EA 4AYFA 5E95B 1NBVH 1NPUA 4WI4A 4YAQB 2R1XA 1IQDB 3C2SA 3QEQE 3RNQA 3PABA 2ORBL 4OZGE 5CILL 1B3JA 4QHKI 4Q2ZA 2X4NB 2I