3H9HA

Human class i mhc hla-a2(a150p) in complex with the tel1p peptide
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
275
structure length
275
Chain Sequence
GSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDGETRKVKAHSQTHRVDLGTLRGYYNQSEAGSHTVQRMYGCDVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQTTKHKWEAPHVAEQLRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHEATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRYTCHVQHEGLPKPLTLRWE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
publication title T cell receptor cross-reactivity directed by antigen-dependent tuning of peptide-MHC molecular flexibility.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 80
structure length 275
sequence length 275
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3h9hA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3h9hA01
1KB9J 3V4PH 2NZ9C 3SHSA 4Y7MA 2DTML 1UEMA 3E2HB 1WBYA 1UZ8B 4XBGB 5HTSA 3TT1H 1W0VB 2VN4A 4CU7A 3BPLB 4CVUA 1Z9SA 1A1OB 5CGYC 2R8SL 1N4XH 4X5XB 5INDB 2JB5L 3EOAB 3NCFB 3QDGB 3TC9A 1KIPA 3O6FB 2APVA 2Y07H 2OTUB 2FDBP 5F6IB 3V8CA 2FL5B 5FF6B 4RFEB 4UQ3A 5KOMC 1DVFD 4Q2ZB 5KVDH 5ITFA 5C0CB 4JM4H 4FTVD 3OKLA 5KS9A 4PP2B 4PJEF 12E8H 4XHJD 2IAMD 5DUML 3GSXB 3HE7A 4BUHA 1BP3B 1HEZA 1MCBA 1N8ZA 3RPIA 3VRJA 2A6JA 5I1KL 3VWJD 5K59F 5C9KA 4PJCF 3U0PB 1YNTA 2WLYA 4MD5B 4R7DB 4K3EL 3VFRA 4R4NC 2XV6B 4Y5VC 3UTQA 4GXVL 4QRPA 1EHAA 3DUSB 4GW4A 4NZRL 3WS3B 2R1YA 4HJGA 2D0FA 2HWZH 3JBG7 4LHUD 1KJ2B 1NGQH 4MAUL 2F74A 4HUXB 4XX1E 5T1LB 3RKDC 3TBVA 4Z5RB 3BWAB 3NCCB 4CMHB 2EE9A 2YD9A 4AIZB 3OF6D 3H9SD 4NHUA 5BZDB 3W0WA 2YC1B 3DGCR 5DI8A 1GH7A 2X70A 4OUUA 5JR1H 3X13B 2IH3B 2QQNH 4GAJL 2Y36H 3GMQA 2GJJA 4K3GA 5E8OB 3G5VB 3PHQB 4D9QD 3N1GC 4NRYA 5I76A 1JTPA 1P2CA 3SDCC 5IB3B 1DN0A 1KB9K 4CL7A 2C3GA 3N50A 5DT1L 5B38G 5D7JC 1INEL 1XCTA 1T1ZB 3AROA 4LMQI 4PJGB 4OZHA 1IGTB 4S1RH 4LSUH 1MCHA 1NLDH 3MV8B 4NC1C 1YY9D 1NAKH 1ZKAA 2XWBA 3C5ZB 3VFOB 2VL5A 2HJFB 4YHIB 3P2TA 1TETL 5JTWA 4TSCL 3IDIA 2J8HA 3DUUA 3LDBC 5DF0A 3LH2L 1HHGB 3G6AA 5MEQA 2DQJL 1PQZA 4PRNB 4HCRH 4BZYA 3BP6A 2HJKB 2P24B 1JBJA 1JPST 4YO0A 3HNTH 3L3DA 3RVXD 1U8PB 5JHLL 1BD2A 1T2QL 4K7PL 5HY9B 4MDJB 3LN5B 2CLRA 3VXRD 4Y5VA 2ORBH 4HAGA 3RVTD 4EI6A 5E9DD 3S3PA 1QFWI 3SOBL 3U79A 3RA7H 3WKMH 4KVCL 2E27H 3LN9A 3KNBA 4MNHB 3ARDB 2BCKA 2PW1B 3E2HC 3PGDB 1TJIL 4HFUL 1G7QA 1C7SA 1U8IA 2JIXA 3GBMH 1T22B 3NCJL 1NMBL 5EUOA 2DIBA 3GMLA 4IOIA 3B9AA 5C1MB 2VWEE 2NXZD 4HJJL 5FKPB 5ACZB 4JAMB 2HFGL 4Y19B 5GGVL 4R96A 4U1LA 4H1LA 4QXUH 3GJEA 3JWDH 2BDNH 5E8PB 3QEHA 4X9HA 2FYYA 2GJ6E 1QSFB 3O6FC 1AY1L 3R4DA 1QRNE 3TBSA 3MRPB 5F6IC 2GUOA 4Z7OE 2ITDB 4UTAL 2BHZA 5DJDB 4PRPA 5TE6L 1I9IH 4B7LA 3JV6A 3SDCA 1HWGB 1SYSB 2DYPB 3V2AR 1KTDA 1A6AB 1EO5A 1NUDA 2ADIB 4ZAKA 3MRQA 1KT2B 1M7DB 3C60C 3PDOA 5IKCA 2SEBB 2ENSA 3WMSA 5DZOA 5KN5A 5KVFH 3VXPA 5CZVL 5HHOB 1CFVL 3O2DL 4N5EA 3N1PC 4Z0XA 3GFUA 4FFVD 2FR4B 1RIHL 1W0WB 2ZCLL 3N1MC 4YC2C 2YXFA 1G1YA 1FPTL 2VLKA 2F8XC 3DBXA 3J7HA 4KKBC 5EZJB 1OLLA 4U1NB 1ACYL 1KFAH 3CGTA 4KVNL 4CMHC 2EH7L 1ED3A 1NC4D 1S7QB 2RQ8A 3QJFA 3H9HB 3Q2CA 4Q0XL 2CLVB 4XNYH 2HFFB 5BS0D 1WICA 3MR9B 4QWWD 3SQBA 4S2SA 2COQA 5MENE 3B2VH 3RIFF 5JOEA 2JJWA 4G9DA 5KSAD 3ESVF 2PO6B 1T20B 4UMGA 1NFDB 4I3RL 3E2HA 4NQTA 1DANU 5FECB 3IDXL 1G6RL 1MJJB 4LNRA 5LCVH 1J1PL 1LO2H 2AJ3A 2VLJD 5CGTA 3ULUE 1YJDH 1XZ0A 2ITCA 1KENL 4ELKA 2A9ML 3OKDB 1R3IH 4WU7B 2BSRA 4L4VE 1DQQB 5INDA 3O3BA 3EOAA 3K2MC 1DN2A 5GQBA 1XGRB 3C5ZC 2OTUA 3FT3A 1KYOJ 3V52H 1FVDB 4C83A 3KAAA 1PZUB 4M48L 1OL0A 4HXAL 3LS5L 5D7IE 3W2DH 1RZGB 1B9ZA 2QKIB 3WJLA 4OGXL 2X4OA 3PWJA 5F9JA 4FNLL 4UNTA 2AK4B 4U1SA 5GS0C 4K7PX 4JDVA 3M07A 3ZTJG 3U36A 1Z3GH 5IJKA 3C60A 1FYTB 4J3XA 4UINL 2NY0B 1QBML 2Q6WB 5K9JL 1EJOH 4YQXL 1JMXA 1OTTC 5JXEC 3F12B 2QLVB 3S35L 3SGDH 4IOFD 3VFMB 3WS3A 4DUWA 4Q97A 3BH8B 4JPIA 2VLMD 2AAVA 2AJXL 3ARDC 3DI3B 3RX7A 4PLOB 4BZ1L 3RVWD 3BZFA 4MNGE 4Z5RA 3SE4C 3ZE2F 4M7ZB 3TH3T 4PGEA 1F8TH 2BVUA 4Y2DD 4KH2A 4OCWL 4LAQH 4XXDB 3L3OB 3KGRA 4Z18A 2FATL 6FABH 2J6EA 2NY4D 4PJXF 2C3XA 4JN2B 2F54A 2BFVH 5FAAA 4IMLB 5C09A 1YMMA 3DVGB 4X6DF 4U1JB 5C0BE 3D5OF 1CD9B 1ERNA 4KJPC 3G5VA 1YA5A 5FYKE 3BDBA 2Y4SA 2Q8AH 2EDEA 3SQOL 3UTSB 2EDJA 5TH2A 2GJ6D 4WHDA 1FNGA 5HYQB 3K2UH 3QXTA 5L9DH 3PP3K 4U6HA 2X4QA 2VLRA 3O11A 3O6ML 4H5SB 3STLA 1IAOA 3BPCB 3MV8A 5DJYA 2MCPL 1OP3K 2ARJA 2Y23A 2R4RH 3C5ZA 3WJJC 2XKSA 4Y4HC 3T65B 3HTLX 1BQHB 2X7LA 4GMTH 1J05B 2V5SA 4JHAH 5BZWA 3V4UH 3DARA 3VFTA 3P4OA 1NJ9A 4LVEA 4QOKE 3P30H 3ZDXE 4YDIH 3M17B 1CFQA 1A3LH 3CU1A 1KYOK 4MA8H 4BFIB 5IT2L 4DVBB 5EU7E 4WI8A 4XPBH 4P3DA 5DC9B 4O58L 4R4FH 1QLFB 3MBEB 4ONHA 5F7KC 2V9QA 2YPLD 4MS8C 2WP3O 3MPCA 5IROC 2X1WL 4XP5H 5DD5H 3KHOA 3LMJH 3RL2B 4G6JH 3ARDA 1IC4L 4HK3J 3H9ZA 3FAWA 1LDSA 5BVJA 1MAJA 3SE4A 3ZKXB 4NOBA 5I1EH 4OQTH 3L3JB 5K9QI 3TNMA 3TO4B 5TE7L 4NO0A 5FKPA 5ACZA 4JAMA 4Y19A 4FQJH 1M6OB 3MA7A 4PY8J 2G2RA 3GMRB 2YWYA 3FT2B 1AXTH 4U05A 5E8PA 1I8MB 4MJIA 2CDEB 2X09A 4RX4A 2XZQL 2O5YH 4HXBL 4YHOL 3ULUD 4X9BA 3CZFB 3O9WD 5DJDA 2XY2A 3D0LB 4MQXC 4OUOA 3B9EA 1AD0B 4L4VD 2UWEA 4F80A 2DKMA 1YNKH 4HUUA 4NNPL 5E2WH 3FONA 4ZQKB 3S35X 1LE9B 2SEBA 2NY0C 1MIML 2J8UE 4Y4HA 3WJJA 4HG4J 2B4CH 5C2BH 1UCTA 4NRXB 4KAQL 4LPXA 3UBXG 1AH1A 4B0MM 1B4RA 2DQEL 4KRLB 3T09A 5EUOF 1S7VB 3SPVB 4HS8L 3LV3B 1LD9B 4GRWE 4R4BB 1OQXA 2APFA 2ZNXA 4XBEH 1VHPA 1Q0YL 3T1WA 4IRJB 1NEZA 5EFIB 2X41A 4JPKL 4M7ZC 3EOBB 3RNKB 1LE5B 1FE8L 2HLFC 5SWZE 4UV4L 4UB0L 4O02H 1FNSL 4MCYB 1JNLH 4MS8A 5IROA 2XXCB 1RZIB 3G6JF 4ORGA 5LBSL 5GPRA 4ZOEA 4NZTH 1NFDA 2RFXA 3NIGF 3BZDA 2X4RB 2AEPL 1LDPH 4ZXBC 1S5HB 3LY6A 3OV6A 1NBVL 3OKDA 5DJ2B 1IVLA 1H9VA 4LCCA 1BFVL 3LB6C 1DQQA 1WZ1H 2EDNA 5C0FB 1BFOA 3HRZA 4Q74A 1XGRA 2PW2A 5C8JB 5E00B 5EBMA 3K4ZA 4NPYB 1I1YA 3HMXH 4HQQL 4R2GC 4BFEA 4G6KL 4U0RC 2CQVA 1U95B 5I1AA 3CH8A 3GZKA 1X5IA 2PYFB 4M5YL 4WY7H 3QIUB 4RAUB 5DRNA 2CK0H 2WBJB 2QR0A 5E8NB 1T5XB 1ZEAH 2R9HC 1QQDA 3A0OA 4OCLC 4RISH 2P46B 1HH6B 3AVEA 5DXWA 2R56H 5F1IA 3MBEC 4QOKD 1QFPA 25C8H 4LVHB 2BXZA 4AT6B 1MWAB 4MA7L 3WD5L 2YD6A 4YFLF 4OCRH 1RUQH 4LHJB 5KZCB 1CFNB 3F7YA 1QBAA 4HIXL 4JM2F 2BRRH 4UBDC 4HG4K 5CEZL 1FNLA 3BD4A 3ZHDA 4G42B 4L29B 3ZKXC 5HHQB 4FP8L 2HA1A 4DN3H 4DEPB 3QCVH 3QWRD 4R7NB 3TO4C 5K9KA 3O2DA 5JZ7C 3BP5B 3MLVH 1CL7H 4Z7QF 1AKJB 3WIHL 5CJQL 3T8XA 4JREB 2R0KL 3KPSE 5F1NB 2RAMA 1IQWL 4RZCA 3NZ8A 4G43A 2A77L 4W4NA 1HHIB 4JN2A 1FSKB 5IB2A 3ARQA 3PV6B 1RU9L 4OLUH 4P9HH 1UB6A 5D7SH 3MRGB 3QIBD 4NUGH 4MB5A 5FGCE 4P48A 3OKYA 3QXAB 2DBJA 5EOCH 4ZXBA 3D85B 5DTFA 3UTSA 1G7LB 1U41A 1J5OH 1YC7A 5K9OA 3WLBB 3QUZA 4YHZL 4PJ8D 2EH8L 4I18B 1AFVH 2EXWD 4NNXB 4XCCL 4TNVK 2CGRL 2BY3A 2QSQA 3GRWL 4HWZA 1GZQB 2X2YA 3WO4B 4XHQA 4PYHA 5HGBA 2C3WA 1JPGB 4P2QB 4Q7DA 5CJ8A 4L8DB 1A22B 2RHEA 3RHWK 2IF7A 3SGEH 3BE1L 4RWYL 3CSBA 4LSPH 3FB7B 4XNQA 4R26L 5JOFB 2J4WH 3O45A 3BN9C 1U6AH 4DVBA 2GSIB 4XAWL 1EO8L 1X4ZA 3MACH 4FQLL 2Z35B 4V2CB 3VFSA 2H6PA 2IGFH 1LGVA 1QLFA 3BPOB 1U58A 4E0RB 4X7EC 4BFBD 1A6WH 1X5HA 1QACA 5LGHH 2NY1B 3RL2A 1MREH 2HLAB 5EC2B 2VNCA 2WZPD 4HS6A 1H3XA 5JQHC 1EPFA 2ILLA 4WUUB 5IVZB 2DLHA 2LAAA 4OZIA 5DC4B 3VD9A 3MUY1 2GIYA 3DXAE 5T3XL 1JPSH 3P11L 4C4KT 4CAGA 2H26A 4P5MB 5EWIL 1M6OA 4PJCE 1NGPH 1GZPB 3CZJA 4OCXL 4MQSB 5FDWB 1I8MA 3BH9A 3LKQB 2XG4A 4I3GA 1SMOA 1FL6A 2QEJA 4IRSC 5LGJB 2Z9TA 2QQKL 1QRNB 5GZNC 2ZSWB 1X5AA 4Z7WA 3H3BC 2V6HA 1VGEL 1G6VK 2IAND 3G9AB 1XF3A 3DMMD 3D0LA 1A47A 4PRDB 4HIJA 3QIUC 3QRGH 3VG9B 2WBJC 1HN1A 1VESA 3HC0B 4XCNB 1CLZH 1E28A 3S36L 3N0PB 2OSLA 4MB4A 4CNIB 1BVKA 1FFNA 1RUPL 2HFEB 4I3SL 1DQTA 3AAZA 2NY3B 2YK1H 4Z95L 4J1UB 1VACB 5J12B 3VRLF 5C0EB 3ARGB 3JWOH 1R5WB 4KXZI 1DBML 1GSMA 4RFNB 3B2UD 3U1SL 3F7VB 4L4TA 1E6OL 1JVKA 4ZFGL 3MRCA 1O0VA 3LV3A 4P59L 4JY6B 3EZ8A 4YWGH 1R3HB 3F6IA 4GSDL 3NVQA 5IM7A 1BOYA 4P5KA 5C7XH 4DEPC 1JYNA 1OSPL 1YQVL 1N5AA 4P57B 4MXQC 4HKBA 4F7CA 1OT2A 4JREC 4TPRL 1IM3A 4MXVE 4I2XB 3X14B 2DN7A 4U49A 3A6CL 1FSKC 2JB6B 4B53A 5FYLL 5DEGB 1REIA 3L95B 5CZXD 1PX3A 5TF1H 1SEBB 3OXSB 4ELMF 4CUCA 5I9QB 3PUCA 4LKXB 1FNEB 1VFBA 3KPSD 3TEUA 3AFLA 4Y88A 1EHLH 3AMLA 3CDYA 4OV5B 4X6CF 1VGKB 2AGJH 1DJSA 4IRSA 4P2RE 2F53E 5D1ZB 5EULV 3EOTH 4IEFB 5J1AB 1ZK9A 4QRRE 5HHXH 1BQUA 3MSPA 1K8IA 4HK0B 4WRLA 4OFKA 1A7QH 1BBDL 4ETYA 1HIML 1QHOA 1CXFA 3GIZL 3ULVE 3EYOB 1RUAH 4OLXL 1CTOA 1BZ9B 1UXSA 1VADB 1TJGL 1MLCB 4OI8A 5D5MA 2OI9B 1D5IH 4WGVB 3RIAK 4M7LL 2E9WA 4XP1L 1JYXA 2C3HA 4WO4A 4P23B 3ULUH 4PRIB 4JFDB 4ZTOH 1S7WA 3NACL 3NGBB 1MH5A 4TSAL 5GRVK 1GGCH 4XMPL 1FH5L 3NOIA 4XNUL 2FZ3A 4FOMA 5TFSH 3VA2C 2G60H 3BIKB 3QZWA 3C2SA 1KELH 1J1OL 2K7PA 5EU6E 3IKKA 5IHZA 3IJYB 5DS8A 4LLVA 4J4PA 1MHCA 4MXQA 1NEUA 1DBBL 3AB0B 5MERB 1KTLB 4X7FC 1OM3L 5EBLB 1JF1B 1XGTA 2YRZA 3EJZD 3WL9B 4AEIH 2IJ0C 1KCRH 2E7HA 4KK8C 3PV6A 1EK3A 3KLAB 4XP9L 1CTNA 1CF8L 1ZVSA 4NRZB 4XNMB 2CJUH 3BRDA 5IB5B 5E7FA 1T7YA 3VG9C 2AS5M 4BH8A 1DBAL 1MOEA 3L5JA 3WLBA 4WEBL 4QGTA 3TN0D 5FA3B 1IC7L 4OFYD 4UT6H 4W70A 5JOPE 1T0PB 2VZSA 3VXMD 1FLTX 2NY3C 1TIUA 5BRZD 5J12C 5CEXB 2QSTA 1MRFL 4ISVB 1IT9L 5TGBA 2QQQA 4X8JB 4ZO6A 3KPQA 1C16B 2YA0A 2HH0L 2DQGL 4RFNC 1UM6L 1LP9B 4X4ME 4PJHF 4KROB 4NM4H 4PRHA 3DHJA 3VFNA 1QZ1A 1MFBL 5KVMC 1LK2B 1BVLB 3W11D 3WLWD 5DVMA 2B0SL 1ZTXL 2Z35A 4FQXA 3T2QA 5FYKH 3O41B 4DTGL 3CXHJ 1KBGH 1MPAH 4HJ0D 2BC4A 4D0CB 3T3PF 5KAQF 1CXKA 1WEJH 5BV7B 4TTDD 3FFCE 3T2OA 8FABA 2FO4A 1INDL 3QJHB 2WM0A 5H2BA 1OAXH 3MX0A 1RMFH 2V9RA 3C9NB 4XMKH 3SO3B 3DX8A 4O2FB 1WC7A 1V7MH 4KKCC 2EDOA 5I9QC 5E4EC 4S0TD 3RNQB 4MNQB 4HDIB 1FIGH 1JNNL 3D39D 4MJ6B 3IU3A 3O4LD 2H2SC 4GAYB 4P5MA 1UC6A 3UJTL 5EIQA 4XXCC 1TCMA 1QSEE 2ED9A 3BKCL 1C5BH 3LKQA 3LD8B 2WIMA 1AQDA 3H7BB 1EDQA 3WDIA 2A74A 5TF0A 4UU9A 3HG1E 3UYOD 4LNVA 1FAIL 2V2WB 1C1EH 4G8GB 3GSWB 4G80B 4EEEA 4HWEL 4PRDA 1YY8B 5MEPA 5B3JF 4UQ2B 4RMWA 4Y8DC 1DUYB 3Q6FB 4KI5C 1AP2B 4RA3A 5C0AA 5CD3A 1I1AD 1NEZG 1BGXL 4LEXL 5DFWH 1N4XL 32C2B 3FQTB 3P0YH 5DEFB 2P5WA 3QNXB 1WT5C 2NY2B 3VXSA 4PLNC 4TUOA 3GMPA 1INQB 1MJUL 1J9CT 2J8UB 1G9NC 2EYRA 4P23C 3DVFA 4WIQA 4PJXE 3TA3A 3NGBC 3ZDZE 1U3HB 3HB3C 5IGXH 4OZIF 4JM4L 1NCBH 4FFZL 1WIUA 1G7IA 1S9YA 43CAB 4M6ML 1FN4B 4JFEA 3RU8H 1SJEB 3PV7A 4GKNB 1JP5A 3RWGB 4H8WL 1PFCA 1I1FA 5C71A 3IFPA 1S5IH 5F9WB 2YPVH 4UUJA 3K1DA 3AB0C 2BVOA 3SN6N 1XF1A 1E4XH 5EO0A 1YN7B 5CIPA 5F1SA 2IPTH 1GC1H 3RDTD 1P6FA 2JB6A 1LO4H 4WFFE 1NGQL 4N9GB 5SWSA 5I1JL 3CXHK 1UEYA 5IBLD 3IRZA 3OXSA 1UB5B 2EZ0C 1E27A 3VWKD 4LKXA 2BXYA 3NZHH 3KLSA 4G8EA 3GNMH 4KQ4H 1BREA 3C6LC 4GRWH 1TVHA 4HS3A 3WHXA 4R97C 4XXCA 1LEGA 3OPZL 3MO1B 4LDLB 4JLRA 3MUGB 5JR1L 1HHKB 4EDWH 2CRIA 4HGWB 2IQAA 2EYSA 4KROC 3QPQC 4L8BA 4XVUC 5CP7A 3GMMB 4I9WE 3SDYH 5FGBC 4XNXL 5JOPD 2H2PC 4YXKL 5BQ7B 2FBOJ 4H88H 5D70L 5HGAB 1IEHA 1BEYH 3STZA 5DHVA 2H9GA 2C7UB 2A6IB 3MRBA 2YD1A 4XGZB 3HI6H 5JW4M 4S1RL 1NLDL 1NAKL 1R5VA 3EGSA 4NO3B 4ZS6C 2BHUA 1CG9A 3THML 2XRAH 1QBLL 4JFDA 2Y25A 3DGGA 3EFFA 3VRIA 5BV7C 1QBBA 5C86A 2P5EE 4XMLH 1FCCA 3NPSB 4H26A 4YHLH 2HRPL 1HI6B 3DUHA 3SO3C 3QCUH 2JCCE 5KAQG 1KIQA 2ESVB 2EECA 2YBRA 4LSTH 1U3ZA 3VXOA 3HNTL 5EZOH 3LN4A 1I9EA 4W68A 1B6UA 3VFVB 2J7LA 1YEGH 4UILH 4YGVB 2NX5E 2ZUVA 1JV5A 1T1XB 5IJVA 3LD8C 5M94B 2VDQL 3RA7L 1D5MA 2E27L 2VERN 1YUHA 4X99B 2UY6A 3C6SB 4YNYB 5HVHC 4XNMA 1CDCA 2NTSP 4D3CH 1A14L 1QSED 2IH1A 5D5MF 4PJ7B 1OARL 4HLZH 4PJAE 2M2DA 3FB8B 5EORH 4MJ4A 4V1DD 3C6LA 5FA3A 1DEEB 1KCUL 4UDUA 2FSEB 2VZOA 4ZD3H 5JO5B 4QXUL 3SY0B 1ZGLP 4TUKH 5ACMA 4L3EB 3CMOH 4GXUM 5ANME 1FAKT 3VMNA 2Z31B 4X8JA 3ARYA 5EBWA 4O4YH 4OCYH 1WAAF 1LP9A 5GGQH 3NIGE 5B8CB 5FGBA 5FK9A 3BKJH 1U2CA 1EHXA 1YEDA 1JI2A 2FHCA 2OMNA 2YR3A 3CXDL 1BWWA 1LK2A 4W4OC 3E6FB 4JFYB 3ROOA 4DZBA 2AJYH 4ESKA 4XCYA 5EN2A 1BECA 1W0YT 5LXGL 3VGEA 2GFBA 5F93C 3L3GA 1G84A 2NCMA 3GSQA 4OBSA 1MVFA 3O41A 5F7HA 1HKLL 1XIWB 3IAPA 3L5XH 5HYEA 2YUZA 3L3HA 5KVFL 2OP4H 4U31A 4M1CD 1RZJH 3TWCH 3Q6GH 1Q38A 3MOBH 5JPNA 3UCRA 4CVWA 5D9SB 1Q1JL 2FGZA 4YPGB 2WWMD 3WE6B 4HBQA 1KFAL 1HXYB 1EBAA 1Z9MA 3DRQA 3GI8H 3KYNB 2E3VA 4WFFD 4N90E 3EBAA 1MRCH 3B2VL 1JWMB 3RWHB 5EA0L 2JTDA 1KB5B 3OGCB 5HYSA 5C07A 2DMKA 3GMOA 1Z9OA 2V2WA 3X12A 5I16B 1W8NA 3VXUB 2VH5H 3GSWA 1BF2A 5DRXB 2ZG2A 5IMMA 5LCVL 5E99L 3CFBB 5HI4C 2D7QA 1HKFA 4KTYA 1VFAB 3Q6FA 1FZJA 1R3IL 2AKRA 2NXYD 1YZZA 4RBPK 5LQBL 3T04D 5FXCH 2BNRE 4Z7UA 1AIFB 1K8DB 2ED7A 5IBUB 2X4PB 2VDRH 3QULB 3OKMB 1ZLSH 1EZVY 5JW4R 4AENA 5E1AA 1JIBA 4TVPE 1HNGA 2IC2A 3NPSC 1T1YA 1MCKA 2R0ZL 2FX9L 5ENWA 3UC0H 5BJTB 5HDQL 4YEEA 1NGZA 43CAA 1X7QA 3PP3H 1P7QB 4RFOL 4M02A 5DR5L 1KIUA 3GSNB 4EUPB 3BMWA 1Z3GL 3LQZA 4OJFL 3BO8B 2WUCL 2P5ED 2R29H 1HQ4A 4PGJA 2AK1H 2FJHB 4POZD 1XCQB 3UZQA 1UENA 3LRSA 1EJOL 5ADPH 3KWWB 3GJFH 1ETZB 4M6OH 2B1AH 3IFLH 5JA8B 4Q9QL 3BZEB 1BD2D 3R1GH 1M71A 2BOBA 1IILE 4N9GA 1LNUB 4JRXE 3NFPA 2NX5D 5C08E 2A6DA 4FRWA 4U1MA 3RUGF 4F7MA 1UB5A 3T0EE 1RJLB 3U9UA 1HHJB 1QNZL 3CVHA 2DL2A 1NANH 2JIXD 4LAQL 1UH4A 3ZT7A 4PJFA 4OF3A 1I7RA 2A9NH 2YUWA 5DJ8A 1HHKA 1A1MA 3JUYA 2BVQA 1CE6B 5CS7A 1YNLL 3FCTA 5I17B 4YAQA 3GMMA 2OJZH 1A6TB 1IAKA 5BQ7A 1B0RA 1U92B 4YK4C 1PSKH 3DYPA 5HPMA 3MJ7B 3QZWG 4XGZA 3SDXB 2HT3C 3LCYA 1VA9A 4J3SA 4NO2B 4JO3L 1KN4L 1D5BB 4JGMA 4N8CH 2EDBA 1DUZB 3MV11 1D9KC 1XIWC 3NA9H 4Y5XB 2NYYC 4ZAKD 4X0KB 5CBEB 4GMTL 2R4SL 5DVLA 2I60L 1MCOH 4MLIA 4WWKB 3V4UL 3N1QC 1PBYA 4NKMA 4GG8B 4OZGA 3P30L 3HUJB 4YDIL 1N0LA 1MAKA 3P0VH 1A3LL 4DOHB 4G9FE 4HWNA 4N5ED 4TUJA 4NFCA 3IFOB 5CSZA 1TFHA 3MNVB 3QNYB 2W0FB 5GGSA 1IARB 3TPUA 4CVXB 4G8IB 4XP5L 1RK0B 5C70A 1ADQH 5DD5L 3REVB 2YKLH 4KK5D 5L8JB 4G6JL 3W9DA 3DX9B 2XTJC 3OG6B 4X99A 1BJMA 3SGKA 4CN1A 2M8XA 3MRNB 3DV6B 5EZIH 3QISA 4K8RL 5C3LD 4N90D 4KY1H 5I1EL 4OQTL 1TTFA 3FB8A 3RWJB 3QEQB 3UJJH 2FSEA 5DJAB 5JIPA 4JM2D 1L9NA 1AXTL 4UOW1 4CW1B 4U7SA 4JRYA 5IK3A 2RGSA 4HZLB 3W82A 1V8HA 5E7BA 1M05A 1OWWA 3GSOB 3P3YA 2O5YL 3SJVA 3Q5OA 1K5NB 1KGCE 2CIKA 3NTCH 4X83A 1I8LC 4ZOAA 4YH6A 3L3KB 2A38A 2HN7A 1A1NB 4JQXA 4OD1H 1JTTA 4ELME 3ABZA 1RJYB 3JWDC 3MFFB 1T4KB 2BNRD 5L6YL 5MI0C 1YDPA 4PJ9B 1MCNA 3DETC 1EMTL 5I30H 2X40A 4MAYA 2R2CA 1DQMH 3O6LH 4JDZA 1U8MB 4PJDA 1CGYA 2Z91A 4P2OB 1D9KA 3ZSSA 4X6CE 5GISL 4F9PC 1S9VB 2B4CL 5C2BL 2HMID 5HD8C 4F37K 1A7BA 3FFCB 3V5DA 5F7WC 2WBWB 3PGFL 1NBZA 1I7TB 5SX5H 5JW4Q 3RGVD 5HHPB 5DYOB 5D9SA 3ORJA 2D7NA 4YDVA 3TBWA 2OJEB 4Z78B 4NQEE 1JGLL 3MJ8A 4O02L 4JFQA 3ZKNC 3KPTA 1JNLL 1MAMH 1QFHA 4ZFZB 1OTSD 1NDGA 3I84A 4HCRA 1NDMA 1KCLA 3U46B 5I16A 4U1KA 4YDJB 3RL1A 4LMQE 1QR4A 1LDPL 4H0HB 4PBVC 5C09D 3T77B 3SO5A 4MQ7B 2R39A 1UADC 2PYED 3IJSA 4FTVB 2ZUQC 3Q48A 1JWSA 4XVSH 5DD0L 3RZCB 5D93B 4I0PD 1OB1B 1F11B 1KCVH 1RI8A 2PTVA 3JTSA 2GEEA 4Y5XC 2YUXA 1MEXL 3A67L 3VWJB 2VLRD 2X4PA 3HMXL 5HYJE 1YJDC 5CSGA 5IMLA 4C56B 1I8LA 5ERWA 4WY7L 5BJTA 1CLYH 5HVWA 5JHDE 3GSNA 1ZEAL 1ZT1B 2JKXA 2P44B 4EUPA 4HHAA 2AV7A 3QPXL 3GSUB 1EAJA 4GG6B 2R56L 3EHBD 1QSZA 4F9PA 3EYVB 3H9SB 3VDBA 3BZEA 4PJHE 1XR9A 2GK0B 5E6ID 2MWCA 1GGIH 2DBLH 1GL4B 1NL0H 5IG7A 3UTZA 3VU2A 1D6VH 3BISA 1HHJA 4QHUB 4DN3L 4Z76A 3QUKB 4GH7B 3KPRA 5FUOH 1HYSC 3L3IB 4MA1B 3MA9H 3NFNA 5D7KE 2X9XA 3TBTB 1Z5LA 4EVNB 4YJZL 3B9KB 4OLUL 3SEPA 5D7SL 3T4AB 1KJVA 1QFWM 5EZLB 3WFDH 5EOCL 5FDYA 4BKLB 4OGZA 5F9DC 4DGVH 3OKNA 4YIQB 4F2MA 1WBXA 4AEFA 4BSVB 1N64L 5EUKB 4PJ9C 3X11B 3QT2A 5GJTH 4KUZH 3UP1A 1KGCD 1JN6A 5EU3B 1YPZE 1U3JA 4ALAH 4FA8A 2MOVA 4P2OC 3MXVL 1MFNA 3KPLB 1VPOH 4HUKB 4X0KA 4QY8B 5ISZB 2DQUH 3KJ4B 3WHE0 5I8KH 2R69H 4ODVL 1SY6H 2Y7QB 5FUZL 4UTBL 5CBAB 3DSFL 4KUCF 3Q3GA 3G08A 3PQYE 4LSPL 4P4KD 1TMCB 4NSKA 4OIIH 2J4WL 4PRAB 5E9DB 5IIEA 2BOCA 3U4AA 2CLZB 5B3JE 5EOTA 5INCB 2W0FA 3MACL 5FYJE 3NABL 3KXFE 2IGFL 1JK8B 3GBLA 3U4EB 4D8PA 1BJ1J 4NQCE 5DD1H 3CFCL 2QADB 1L7TH 4K94L 4N9OB 3QQ4B 3ZZ1A 5C0JA 1CBVH 1A6WL 3EAKA 1A0QL 2DLTA 3O2WH 2CKBL 4UIMA 1UCBH 3FO2B 5D1QA 4FQ2H 4MX7A 4F58H 3LS4L 5TPWL 3GUTA 4NUJB 4XCFL 3MRDA 2HJLA 3VFWB 1DVFC 4PJAB 1JPSL 5I1IH 4XAKE 4YGAB 4XHJC 2W65A 2IAMC 5D93C 4ZTPH 1GOGA 1PKQA 4JKWA 4Z7VA 1Y18B 4OZGF 3V6FB 5KSBA 3WIIH 1I3GH 4PY7B 3VWJC 1KCSH 2YA1A 3EKCA 3OSKA 3RX8A 1AO7A 1T7ZA 4TTGA 2KH2B 4U33A 1N6QH 3P4MB 2LABA 4X7TA 2EYTA 4LLQA 1MVUB 1HSAA 2Y6SD 1J1XL 4OZFG 3BDYH 3UROR 1I1RA 3HCVA 1TITA 3CC5B 4M1DH 1K85A 5KANG 2FJGB 5F96H 1U8MA 3TV3H 3V4VH 3ZYOA 2DJUA 2ERJB 3CDFA 4M3JA 1J8HA 1CGSH 3JWOL 2V7NA 3RWIA 4TN9A 4FQHB 3S3JA 1NC4B 4X80H 5GZOD 3RTQA 3DVNB 5BS0B 4X98A 1OGAE 3BW9A 3IU4L 4K9EH 5HHPA 2PXYA 5HYSG 5DO2D 1IGJB 3MGOB 4Y1AE 2DM3A 2FWOB 4KDWA 2MMXA 4U1HA 1WFOA 4HAFA 5C7XL 3QFJE 2CDGB 4QNPE 1TJHL 1YMHA 4MA1C 2ATPB 3LQAH 3PABB 5J89A 1LO3L 4XWOC 3CFEA 2Y06H 2VLJB 1T21B 1BIIB 3ARUA 2IMNA 3CIQA 2VXSH 4J12A 4NM8H 1B3JA 5AYUH 3KYOB 2P42B 4LLYB 1H3PH 1M4KA 4PYGA 3BIAX 1DBJH 4X5LA 1IGIL 1YY9C 2DQDL 4B50A 1JGUH 1T0MA 2ZOLB 3H3PH 4IIQB 5JNYB 4JY5L 1PLGH 5KSUA 2E7LE 1DVFA 2OM5A 5TQ0H 1ORSA 1EHLL 2IPKA 3D3VE 5IW1A 3CK0H 2JLLA 2IAMA 1U8JA 1WTGT 1N59B 3U0WH 1GAFH 1EFXB 3QUZD 4NQXA 1DFBH 1OAYH 5E56A 1BZQK 3S88H 3EOTL 4OQTA 1OVZA 4WHYG 1OAUL 3VD5A 5KVEL 1JYVA 1ZS8B 2BSSA 4BQ8A 4LSVH 1IQDA 3B9DA 4ODTL 2LU4A 5I15H 3RVTC 2P47B 2VIRB 4LHUA 2LAGB 1IGFH 1JUFB 3ZE1E 1UA6H 3HZKB 1UKQA 2XG5A 4YZFF 1FP5A 2B2XH 3MCG1 4KKLD 4E41B 2I9TB 3TNNA 2NXZC 2QADC 3MV7A 3ULUL 4ZTOL 4KRNA 2YWZA 4CVZB 3S34H 1AGFB 5JW5A 2BNQA 1PW3A 1GGCL 5F44A 1A6PA 2OL3H 1KPRB 1KEML 2NY4B 4NQCD 2VTFA 3T0EB 2E6PA 1BQSA 4L1HA 4TVPH 4R6UA 3GO1L 3OKEA 1U0QA 1RUKH 3L3IA 2G75B 3QXDB 2XQBH 3ZDYF 4LASL 4Y4KD 2KBGA 1DQDH 3HI5H 3FB5B 2DDQH 1A6ZA 3V0AC 4Y5YB 1YYLH 3TFKD 3UPRA 1T66D 3ZT5A 2C1OA 4AEIL 2AJZA 2V17L 4AG4L 5D6DC 4RIRA 4JFXB 5B4MD 3RZWA 1NGXB 3MLTA 3HA0A 4D0DB 3WN5A 5DD3L 3BDXA 4M5ZH 4FFVC 2BK8A 3HS0A 3X11A 3BMVA 4LU5L 1KC5H 3M8OH 2UUDK 4WU5B 2OTWA 4P9HC 5BOZG 5C0RH 4JCMA 4WJ5B 2AJUH 4NWUL 2ERJC 3MCLH 3MC0A 4PJBA 1RV6X 3P4NB 3RY4A 1CDYA 4OD2A 3VXRA 4ZSOE 3BHBA 1D5XA 4QWWC 1W72H 4NM4L 3LHPL 1ZOXA 2YPLB 1A9BB 4F15B 5E9DA 1VFMA 1KIRB 2AQ2A 2CLZA 2G9HA 1SHMA 4NQDD 3MYJB 1NFIB 5KSAC 5F9AC 5EC1B 1ZA3A 3HMXA 5FYKL 2VKXA 1ULVA 5EIIA 3G5XA 2YPKB 4QRSB 3VFPA 5FHAL 3BJ91 1KBGL 4NGHL 1IM9B 4POUB 2J12B 1QRKA 4Y1AD 5JUEL 2NY5L 4C54A 2GTWA 1OAXL 3OAZH 4X4YB 3BVNA 1FHGA 3QFJD 4JFFE 4WFGD 4P46D 1HXMB 4N68A 1WVZA 2R8SH 3HZVB 4NUJA 3PWPB 3V8OA 1SJHB 2IWGA 1PGRB 2JB5H 4JKPH 1GYAA 2LU3A 4OF7A 1U8KA 4DUVA 3CLEL 1JRHH 4KDVA 2FJFA 3CMGA 5DGRA 5KG9A 1DE4A 3MYZA 5D6DA 2OLDA 4OFVA 1FC2D 1MI5E 1C12B 3SGJC 3MRJB 3D3VD 1C1EL 4QRUB 2VYRE 2D0HA 2QBWA 3RUGE 4IOFC 3QG7L 4IS6B 5KSVA 5DJ6A 2RIKA 4GXVH 3P0YL 1OGTA 3RVWC 1U8QB 2Z8VC 3BRGC 1ZV5A 3SKJH 4MAUH 4A2LA 1NC4A 2WLZA 3UTPD 5IGXL 3I75B 1VKXB 4WO4D 1NCBL 4O9HL 4YLQT 2NY4C 4R0LB 3RU8L 4MA3A 2X6MA 4ODXB 2VWEC 3LEYH 2H45A 5KSAA 3V5KA 5L2JB 2AEQL 2C3VA 1Q9KB 2CDGA 1S5IL 2EE2A 2ICCA 1U8HA 2YPVL 3VXNA 1ZWIA 2J88H 3D1MC 1M7IB 3JSSA 1E4XL 1HOCB 3MLWH 4N1EA 3SKOB 5IR1B 5GIRB 4P4RA 4J4PD 4XBPA 2VITB 4FQCH 1EEQA 1GC1L 4IBLT 2XWJB 1LO4L 2BVEA 5JLZA 2ADJB 2VDNL 1FL3A 1INEH 5GJSH 2NLJB 1JZ4A 5DHYA 3O3DB 2L7UA 3OJ2C 3QNZA 1HHHB 2PR4H 3GNML 4KQ4L 4ZNEE 3WSQH 5ESQB 3QDMD 4ZUTB 4HH8A 4NDMB 4YHMH 1N59A 2P8LB 3I3DA 2OR9H 4CMMA 1HQRA 1KEGH 4TOYH 4EDWL 1AGEB 1GGTA 3LH2H 1F6AA 4Z9KB 2DQJH 4X7DC 5DZNA 3SGJA 1VFUA 2G5BA 3QO0A 1ZS8A 5BO1L 4E42B 2FEEL 3H6JA 4FFEX 4Y4FB 1IGCH 2AQ3A 2QHRH 1QO3B 5IBTL 1AGBA 4H88L 3VFUA 1T2QH 4YDLB 1BEYL 4RNRB 5D7LB 3U0TB 3HI6L 4WDIB 5E5MA 4PJ5E 2X4NB 5I74B 3GM8A 4Q58C 1ZGLM 3SOBH 4IHOA 5IMOB 4I5BB 2XRAL 3IFNL 4K23L 4FQXD 4Y2DA 1R3LB 3NCJH 5K33A 2MHAB 2Q86B 2UYLB 1ES0B 1TNMA 4YHLL 2XKUA 3VCLB 1G0YR 4RGND 1KOAA 1KPRA 5GGVH 2HFGH 5HGDA 3IXTB 3QO1B 5HHVH 1UT9A 3ESUF 4EKXA 5ITBH 4TSBL 5HHMB 3QIBB 5EZOL 1AY1H 2VXUH 2VDOL 2VLLA 1YEGL 4DKDC 4UILL 1E4JA 1PJ9A 4HIHA 2R15A 2VZTA 4LVNB 3FB5A 3VI4E 2GJ6A 4JFFD 2Q7YB 4UTAH 4HF5L 2YD3A 3SKNA 5J6HA 4UAOB 2FRGP 2EDFA 2F5AH 4ZPTA 5CEZD 1QFWH 4D0DA 1CIDA 2HAZA 2XICA 3ARXA 2X4SB 5EORL 4GUPB 3TCXA 3MUZ1 3L5WB 1Y6NR 4ZD3L 1MHHB 3PHSA 1FNAA 2B8OT 1R6VA 2ZCLH 1FPTH 3ES6B 4O4YL 4LCWE 5GS3A 4JFHD 1RZ7L 4TULH 4CGTA 3VXSD 1ODAA 1ACYH 3QUYB 3W9EB 4EQ3A 4GOSA 5FIEA 3TA3D 4Q0XH 4R0LC 1NGYB 2GAZB 4K3HA 3IDNA 2G5RA 5L2KE 1PYWB 5GRZA 3L5HA 3QUXB 2YN5A 4EBQH 4JFED 5I66A 5DRZB 1ZSDB 2ZSVB 2VDPL 5MENA 4I3RH 1WCQA 3IDXH 1A9EB 2V9TA 2OP4L 1G6RH 4MD4B 5GSVB 1S7SB 1H8OA 2EDKA 3MOBL 1C08A 2J2ZA 2VOTA 2YXMA 3IRPX 3FO1B 3W0WE 1KENH 2AXGB 2A9MH 1DR9A 4PREB 1SJHA 2XZCH 2IANB 3LRGA 1XMWA 3KPNA 3O9WA 4POYA 4L4VA 3AS2A 3MNWA 5A16A 4PJBF 3LS5H 3OXRB 1MRCL 2VE6B 3P9MA 3G9VA 5HBBA 2UVFA 5FYJH 5D7IA 3MRHB 4ZMAT 4X5WA 5FUCE 1RIVL 2DWDB 4OZHE 1T2JA 2MTPA 3MRJA 5IVXF 4TQEH 4QRUA 1NSNH 4Y4FC 3SDAA 4NZDA 2Q76B 3JV4B 1X9QA 4JFPB 1LEIA 4J8RB 4PP1D 4I0KA 5IB4B 5T3XD 4GAGH 4UINH 4YDLC 5AAMA 5D2LA 1QBMH 1KPUA 3NAAL 5IOPA 2Y5EA 4AH2A 2DI7A 4YQXH 2ENYA 3U2SB 5I74C 3PP4H 3S35H 3ARSA 2I07A 2AJXH 1X3DA 2XQYG 1FGNH 5D1XA 1DQJA 1F3JA 2R2BA 5B38B 4BZ1H 5CMAA 2YD7A 1JFQH 2OXHA 3CD4A 5B22A 3KYMB 3VG0H 4GW1B 1KB5L 3QA3B 3QEUA 5T33L 4KDTC 5IB1A 1LMKA 5L2JA 4I77H 3QIBC 4PP8C 4GRLA 1MFEH 2FATH 4YBQD 1DEDA 3S4SG 1J88A 3RWDB 4KK9D 3BUYB 4LVNC 3SKOA 5ADPL 3RY6C 1EGJL 4M6OL 3IFLL 4PJ8C 1ZLWH 2EXWC 4ZUSA 2GW5A 3VE0B 4WHTB 3UTTD 1JFMA 1RJZB 4UAOC 4HX1A 4O2EB 4V3DB 1ZAGA 3FOLA 2NLJA 3T1FB 3PWUB 3O3DA 3CUPB 3IDGB 3CCHB 3KLDA 3O6MH 2VXVH 2OK0L 4BZ2H 1QKZH 4LHUG 3QAZB 2KDGA 1CICB 4X6FB 4LQ1A 3DURA 1ZHNB 2CIIA 4KWUA 5F97E 3MRRB 4KPHH 4QRQB 5D2NC 4LKCB 5FYLD 4A6YB 3QCTH 4QOKA 5DMGD 3IF1A 4YHPB 4O58H 4NC1E 1RPQA 2ADGB 1PSKL 3MJGX 1ZLVH 3T3ME 1OAQH 5JDSB 1G7HA 1R3JB 5GGTH 1HCVA 4LCWD 3BEWB 4OF5A 4N8CL 4XCEA 2XN9E 2R23A 4PV8B 4RDQG 3IDMB 1MFCH 4Q6YA 1DL7H 3QWRA 1MCOL 5HHNA 4KMQA 2Q86A 3QQNA 5F7DB 2VISB 5BMFL 5L2KD 4PJEB 3T4YB 1CT8A 3P0VL 3OAUL 2FH6A 4U1IA 5EU5A 5KJRH 4N8PA 4JO1L 4KDTA 1RAMA 1BWMA 1XGQB 4U7KA 1UJ3B 2H1PH 5I8CA 3DMMC 3TZVB 1MCEA 2XZQH 4YHNA 4YHOH 4GKZB 3PHOA 1IEAA 2DL9A 3ULVL 1T5WB 2W0PA 1CK0H 1KNOB 4PJ8A 1LHZA 3LOWA 4RAVA 1ADQL 1H3WM 2YKLL 3VXMB 5LWYH 1RZKL 3CFDB 3ROLB 15C8H 2H8PA 4NNPH 4E9LA 5BRZB 1Q72L 3HRPA 3OR6B 3DO7B 4XB8A 5EZIL 2MKLC 4KY1L 1A4JA 3LKPA 3B2UC 3QDGE 1EVUA 3OB0H 3GJFB 3PGCA 2H32H 3QQ3B 4L4JA 2EE3A 3S3SA 1TZGL 2W91A 2DQEH 3IXAA 2DQFB 3MNZB 4M61B 5C0CE 1HDMB 4HS8H 2EC9T 5C92A 5D2NA 3TYFB 3FZUD 4OLWL 1BOGB 3G04B 1X5FA 2AXJA 2DWEB 3H8NA 2XNAA 1U93A 2B5IC 4FMKA 1S9WB 3WCYA 3U7AA 5CZXC 5SWZA 1SQ2N 1CXLA 3O6LL 4GRMA 3R06B 1Q0XL 1R5IB 2UV3A 1OTUC 5IFJA 3D39B 4PJIB 2DIJA 3VGFA 2OQJB 1A9EA 2AEPH 4TNWF 5AUMA 3DSNA 3KPPA 4PGCA 3GB7B 3QUMB 43C9B 1ZHKB 5AD0B 4I8DA 4ETQA 1S9KC 5IEKB 3FO1A 2AXGA 1NBVH 1NAML 2VXQH 3RI5F 4J23A 3DIFB 3AY4C 2VUYA 1P7KB 2IEPA 2D9QB 4I48B 5FGSA 3RKDD 3DMMA 1NH6A 4ZODA 2F54E 1RZJC 1YMME 1J7VR 4KUCD 1TVBA 3LKRB 3HI1A 3MV9B 4XC3H 4ZS7L 4EXKA 4M5YH 4ZUUB 1T3FB 3G5YA 5E2VL 1DBKH 1K2DB 4PJGE 4BH7A 3LSOB 1OP5K 2AV1A 2JJVA 3L6FB 2CMRL 3JV4A 3MV8E 4JFPA 1BJ8A 4ODSL 3S7GA 4XX1G 1T83C 2CH8A 4XVSL 5ID0A 3B3IA 4M9OA 4B41A 1CGUA 5TE4L 3KJ6L 1MUJB 1AE6H 2VAAB 5IESL 2P4AB 2DKSA 2EIDA 3EO0A 2JELL 3CH1B 4PV9B 5FCSH 1KN2H 1T80A 2C4FU 3TGXA 4JQIH 2YD5A 4HKXA 1YN6A 1MQ8A 3D0VB 4FP8H 3MRLA 1KF9B 3ULUF 4IRZL 1Z0NA 2R1XB 3U6RB 1XGPA 3O3AA 1L9MA 3EJZC 1DLFL 3WIHH 3RDTB 3BKMH 2Y9RT 1XF2A 4BSWB 4ZPVA 2R0KH 1NUNB 1UJ3C 2X89D 5KTEH 2HFTA 5IVNA 4HSQA 5A2IH 2A77H 2GITA 4N0YL 3VMPA 3VWKB 4KZDL 3KPSA 1J0ZA 1G9MH 1RU9H 1N3NB 1PY4A 4QXTA 2HTKD 5SWQA 5DUBB 3TN0C 4Y0GA 4WHTA 1RJZA 2CR3A 4MDIA 3HPLA 3WS6A 1UKTA 1GGIL 2DBLL 4ZO7A 4Y19E 1NL0L 5GGUB 4LBEA 3HKFA 4ODWB 4XCCH 1X5YA 4LLWB 2CGRH 5ALCL 4IOSD 2XY1A 5D6CA 4MJIE 3ALWA 4NN7C 1QSFE 4GT7A 3GRWH 5FUOL 1MCJA 3MMEA 3MA9L 1KV3A 1T03H 4WW2B 3W11C 3WLWC 5IP4A 2M26A 3BE1H 4RWYH 1MIEL 4QRQA 1EX0A 5KW9H 1NGWB 2E8ZA 3MJ9L 3EDKA 4LKCA 5H94B 4XP4H 5ESVA 2PCPB 1EO8H 1H3UA 4HJ0C 2ZJSL 3QB7C 4OT1H 3WFDL 2X4UA 4TTDC 5BXFA 1B2WL 3LVEA 4DGVL 2I9LA 5C0CD 3DECA 2KZWA 3QXUA 3ZL4H 4LAJH 1MCWM 4KGLA 5EPMB 2EO1A 3C8DA 3KDMB 4JRWA 5HHOE 3PNWB 1X44A 4JQVC 4V3EB 1QEWA 2NNAB 3B8YA 4MAYD 1CDUA 3FJTA 5GHWL 1SY6L 1YYML 4Z6AT 1HH9B 4PJEA 3MRMB 2KKQA 1D7FA 4LCYB 4NYLA 1IJ9A 2GJZA 3U7WH 5FO8B 3MLRL 5MEOA 3UBXB 3MCKA 1OD9A 4HIIB 1XGQA 1UJ3A 5T1LD 3ARPA 3ZKMD 3E1F1 5CINH 2QQKH 4PJCA 3ZMRA 4GKZA 1NFDE 1WBYB 2AI0L 3ZDXF 3TN0A 1I1AC 3LKOA 1UCBL 3VXMA 3ROLA 1FFRA 1JZ5A 3S36H 5F88A 3CU7A 3DROB 3OR6A 1RUPH 3UTOA 4I3SH 5I2IA 3O6KL 1Q9WA 4Z95H 5HDBF 4ZO9A 3GJFA 1KIPB 3V6OC 2W0KA 1AR1C 4ONGL 4L8SC 5ETUB 4S0UC 3MODL 4FABL 3U1SH 3B6SA 4UQ3B 4ZTPL 3QXWA 3M1BA 3MNZA 1E6OH 1AXIB 4MZ3A 2RBLA 4P59H 3H3KA 1WWCA 3WIIL 1BJ1H 4GW5A 3D9AL 1I3GL 5FEBA 5KS9B 1KCSL 4X6DB 1C5CL 2AK4E 9CGTA 4R3SB 4GSDH 3EDEA 4U6XA 1HEZB 3RPIB 4OM0L 2CD0A 3VRJB 2A6JB 3GDBA 1FYTE 1OSPH 2BMKB 3P9LA 4HT1H 3RDTC 1YNTB 5J11B 4TPRH 4UIKH 3RVUC 5IBLC 4QRPB 5T3ZE 4GW4B 3RY5A 2R1YB 3A6CH 4H25A 3TV3L 3V4VL 3R06A 5IW6A 4JQVA 1P4BH 3LZFL 3VWKC 4OFIA 5CHNA 5ABDE 4FXLA 3V79C 2F74B 3O4LA 4X80L 4J3OC 3MLPA 3TBVB 3ZTNH 3GB7A 43C9A 4QEGA 1EO7A 3QG6A 1EXUA 4KXZH 2LTQB 4K9EL 4WFHE 4NHUB 3VI3E 2CRZA 5DK2A 2X70B 4YBHA 1MNUL 2X5PA 1ZHBB 2J8UF 4ZFFA 1WISA 4MD0A 3GMQB 3GHBH 3OG4B 1E4KC 2Y06L 4G3YH 5GRVL 4PGDB 4WW2C 3ILPB 2VZ3A 4NRYB 2F53A 1I1AA 4ZUUA 4XVJL 5I76B 1P2CB 5EU4A 1DN0B 1BBDH 4QHNA 2H3NA 3UTSE 5IHLB 1DBJL 5IV2B 1QSFD 5J9PA 1RULL 1XCTB 2B39A 3GIZH 3MTRA 4OLXH 1FO0B 4G7YH 4PB9H 4QXGL 1KLUA 1TJGH 5TQ0L 3V6OA 2XWBB 4WHCA 4XP1H 2KQNA 5C9JA 1WCBB 2DYPD 2VL5B 4FXGA 4L8SA 1ADQA 1A6VL 3AM8C 1J0YA 3NACH 2ICES 3U0WL 4JJ5A 3IDIB 4TSAH 1FH5H 4XNUH 2WWKT 4XPTH 5T5NF 1F3DH 1OAYL 3G6AB 5MEQB 3S88L 1PQZB 3FFDA 5IF0A 4M62L 3UDWC 5I8EA 4KHXH 3BP6B 4PG2A 3U30B 4LSVL 1F58H 4G6AD 5HHOD 5I15L 1J1OH 1J0IA 1BD2B 4LARL 3RDTA 2W9EH 2CLRB 2W60B 4JPWL 5EU6A 2YHGA 4Y5VB 3I6GA 1T2XA 4OB5H 4EI6B 2B2XL 3VWKA 5FCUH 4FG6D 4KTEL 5EB9A 3KNBB 4BYHA 2BCKB 2XA3A 4HV8A 1G7QB 1L0XA 4WWID 2JIXB 5FO7A 4X9GA 5EUOB 1T04A 3GMLB 4IOIB 4EZMA 3W5MA 1WFTA 3EYQD 4WEBH 3WEXA 2R2EA 5E2JA 2FX8L 4U1LB 1GPOH 2PO6D 3SE3C 4G6FD 1EVTC 3GJEB 5D1QD 3QEHB 2FYYB 4TVPL 1FZMA 4KKAD 2XQBL 4FQQB 3TBSB 2HH0H 1DQDL 1E4KA 1VENA 2WIIA 1MY7A 1UM6H 3BWUC 1E6JL 4WNQA 1YYLL 5IQ7H 3OKOB 4PRPB 3G6JB 3JV6B 3SDCB 1HILA 4X4MA 1KTDB 5H94A 4U1GC 3IS0X 2ZP0T 3V9FA 3QHFL 3E3QC 4ZAKB 2B0SH 4FS0A 3WXWH 2EKSA 5C0IA 3MRQB 2IBZX 3NCYP 3VXTA 3PDOB 4M1CC 4DTGH 5IKCB 2OXGA 1LO5A 5HI5D 3QIWA 5F7MC 4RMQA 5HJ3B 5J11C 5KN5B 4RMSA 1KC5L 1V7NL 2F8VA 1IC1A 3VXPB 4JKLA 5C0RL 3OTTA 4Z0XB 4PFEA 5FM5M 4DAGH 1S7UA 2XI9A 1K4CA 3LDBB 1K3IA 5JDJA 2DM2A 5DVNA 2X42A 1J0JA 1FYTD 2DQTL 2VLKB 4JCLA 1FZOA 4DGIH 3UDWA 3DBXB 1J8HD 3MREA 1HH9A 2OS7A 1ED3B 5EO1B 3QJFB 3S5LA 4NBXB 3RTQD 1ONQA 4WV1A 4IJ3C 1CIUA 3UJTH 5CEYA 3UBXA 2GK2A 4S2SB 3UYRH 4N0UB 2PXYD 3T0XA 5DWUH 4N0RA 4G9DB 4X4ZA 3L7EA 1QSEA 4N8VG 4OZ4A 4WFHD 1KSRA 1FAIH 4V1DA 2EO9A 1ZVYA 4HWEH 2BY0A 4LNRB 3RJQB 4JM2B 2NXYC 4AL8L 1I3VA 3HG1A 2AJ3B 1XZ0B 2ITCB 3O3UN 4PLJD 3DROA 4ELKB 1BGXH 4LEXH 2BSRB 2P8MA 4F8TA 4LCIL 3SE3A 3BEVA 2FH8A 3RVVD 3O3BB 2I25N 1JGDB 2EEAA 4JKPL 3T0DA 3QDJD 1MJUH 2LFGA 3H0TA 5DQ9A 3FT3B 4C83B 5ETUA 4Z8FH 1JRHL 2AERT 4YHYC 3S37L 4HH9A 5I1LA 4PJXA 2X4OB 4FFZH 4X6DA 3PWJB 5F9JB 4M6MH 2AJSH 5DDHA 1TLKA 2OR7A 4MZ2A 4JHWL 4R3SA 1UM5H 4U1SB 5H37H 4POZC 1WZMA 4JDVB 3RWCA 3E3QA 3U30C 4H8WH 3U36B 5ID1A 4K8RD 5T5NG 3S8WA 2Y72A 4GQ9H 5GRJH 3C60B 2BMKA 4H0IA 1FRGL 4IM8A 2ZWLT 3P73A 2CRYA 4JPIB 4YC2B 3SKJL 5I1JH 3TM6A 4YR6A 3BZFB 1BQLL 2IBGA 3PIQA 4PGEB 3MV7D 3OMZA 3QI9A 3BZ4A 2AQ1A 2BNQD 3LEYL 1D6EA 5L0QC 3OPZH 3GM0A 1ZHBA 1GJIA 4EDXA 1SMAA 2EKJA 1SY6A 3O2VH 2J88L 3U9PL 2F54B 3N1FC 1YMMB 5C09B 5HGGS 3GEWB 2HT4C 3MLWL 2HTLD 4PGDA 3ILPA 2PYEB 3IVKA 4QYOA 4FQCL 4XNXH 3K74B 2BRQA 4YXKH 5IV2A 4MJ5A 5TH2B 5D70H 1FQ9C 1ZANH 5GJSL 4HULB 1FNGB 1KJ2H 4HLZG 4U6HB 1FO0A 2X4QB 3LQAC 4ZAKC 2VLRB 3O11B 3STLB 5FFLA 1IAOB 5DJYB 1JZ2A 4GQPH 1NLBH 2ARJB 2CK2A 5ILTL 3THMH 1WCBA 2F9BT 2PR4L 1QBLH 3BP7A 3WSQL 4MXVF 2X7LB 4P2QE 2EC9U 4YHML 1I4FA 5BZWB 4OTXH 2D31A 3VFTB 1TVDA 4N5EC 2OR9L 2GCYA 3P4OB 1NJ9B 1KEGL 4TOYL 3MGAA 1P69B 1ORQA 2HRPH 3C5SB 1S3KL 4KV5F 2FNBA 1CFQB 2P5EA 2BSTA 1UWXK 4UDTA 2Z8WC 4XPAH 4P3DB 1YQ2A 4OSUH 3WV0A 1IGCL 2QHRL 5E94A 4RAHA 1MHEA 4ONHB 2W60A 4GJTB 4KK5C 3PDGA 1XGUA 5I1GH 2NX5A 4IRJD 2VDQH 4R90L 2YEZA 4PB0L 5F6HJ 4Y2OA 5I71C 1YEIH 3EW3B 5SX4I 4WUUE 3EIFA 2W9DH 5BVJB 1A14H 4WEUD 4JM2C 4PS4L 3DYOA 3TNMB 1OARH 4KMTL 3ULVF 2Q1EA 3GBNL 4AM0A 4NO0B 5JIHA 1P4IH 3PJSA 1KCUH 1Y6MR 3MA7B 5HHVL 2G2RB 4LHQB 5GS0H 2ATKA 1EERB 4MVBD 3S37X 5ITBL 3GGWB 4APQA 3NCEB 4MJIB 1A7NH 1CQKA 2VXUL 3TH2T 1H15A 2BVTA 4FQQA 2F15A 4BQCA 2IALA 2IFFH 2VC2L 4F33A 3HUJF 5ANMA 5I0DA 4JO4L 5GRWA 3WJLC 3OKOA 3G6JA 2UWEB 5GSRB 1B0GA 3VDAA 3CXDH 5D8JH 3CDGA 2F5AL 4HUUB 1QFWL 5C0AE 5LXGH 3FONB 2DQHH 2HMIC 2P48B 5IEHA 2YUVA 1NBQA 5IJKC 2P7TB 1HKLH 1Z6JT 3V5HA 1XAUA 4Y4HB 2WAHA 5HJ3A 4DUXA 3D25A 2OR8A 4P4KB 1IAII 3MZGB 1OW0C 1XH3B 2XFXA 5LJYH 2D9CA 1Q1JH 1U42A 1SVCP 4TULL 1NEZB 3ZE0F 3CPLA 4LOUD 5EO1A 5KZCD 1OTSC 3BPNB 1I7ZA 3RWFA 4OCSL 1UVQA 5DC0A 5I1DA 4N0UA 3MGTA 4I2XE 4EBQL 5EA0H 5HI3D 5I19H 4ORGB 1OQOA 1Y6KR 2O5XH 1MJ8L 5ICXA 2RFXB 2EICA 2LU7A 1AKJD 5TQ2L 1P4LA 4JM2A 5E99H 4I0PC 3RGHA 3K7UA 3DI2B 1CXIA 2MQCA 4XVTL 1T7VA 5J06A 4LCCB 1RVFL 2FCBA 5FB8A 5LQBH 2XZCL 1JGDA 1BFOB 1B0WA 1FV1A 3HRZB 2V7HA 3RBGA 4NHCH 2PW2B 3Q0HA 2N56A 5EBMB 3BSZH 3C08H 4HBCL 1I1YB 4FQIH 2OL3A 4ZFOL 3G5ZB 2BNRA 5I1AB 3A6BH 2QV2A 2R0ZH 5FYJL 2FX9H 1KJMA 5HDQH 3IKCA 4L9LA 5DRNB 4HIEA 3UO1L 3UZVB 4KI5E 3EHBC 2QR0B 4RFOH 5DR5H 1OSZA 4TQEL 1QQDB 1NSNL 1OAKL 4OJFH 3IYLW 2WUCH 5F21B 2K7QA 5F1IB 3QH3A 2UZIL 4GAGL 2A1WL 5E08H 3MRFA 1CFSA 4HLJA 3QEGL 5E6IC 4PRIE 4JFDE 3RGVA 1WLHA 4BQ6A 2VABB 1S7TB 1I85C 3V95A 4Q9QH 2R1WA 3PP4L 3F7YB 1OW0A 1UM4L 4GO6B 4TNVF 1LEKA 3RX5A 4LPCA 1AGDA 1JPFA 5J4MA 1FGNL 3WXVH 1M7XA 4D0BB 5GGRA 5C3TA 1F02I 1XFPA 4DW2L 4JO2L 2X05A 1JFQL 4C55A 4JRXA 1CCZA 3MLZH 1QNZH 4FZEH 3RHWF 1H5BB 2IFGA 3VG0L 5K9KB 5C08A 2NY1D 5C0DB 4XRCB 4PG9A 3T8XB 4UV7H 3V0WH 4I77L 4WUUD 5I73B 1MFEL 4RZCB 3NZ8B 4G43B 4NJ9H 2DM7A 7FABH 1W72A 1TZIA 2DS4A 3TBYA 3ZDZF 1YNLH 2FEDD 1UB6B 2PYEA 4CN4A 2V5YA 5JQ6L 5T3ZH 3QRFM 4ZXBB 4I0PA 5DTFB 2YRLA 5K9OB 3QUZB 1QRND 1OCWL 4GG6F 1DSFL 4KTDH 2VXVL 4JO3H 1KN4H 4BZ2L 1QKZL 1OAZH 4GLRI 1FFOA 4HWZB 2VXTH 4EJ1C 5HGBB 3BQUA 4HWBL 4N5UA 2R4SH 4P4KC 4CKVX 2I60H 2YOCA 1CR9H 1LP9E 5CZKA 4R2GB 1QLRB 4U0RB 1PKOA 1SEQL 2CO7B 1QP1A 4KPHL 4RWHA 4XNQB 3LKNA 3C5SA 2R0LH 1KUMA 2XWTA 4ZDHB 3O45B 3QCTL 5DVKA 3ARGD 1PD6A 3VFSB 2H6PB 3RPKA 5DQJA 3BPNC 5HDBE 2DF3A 1OAQL 5E6IA 1U58B 5GGTL 2XACC 1I85A 2IPUK 1QLEH 2KQMA 2MNUA 1GRWA 5E2TH 3P40A 5C6WH 2VB5A 1MFCL 1DL7L 4HS6B 2R2HB 2DD8L 2YZ8A 3SDDA 4K8RH 1BF8A 2YMXH 4MNQE 4OZIB 2WBKA 2VR4A 5MEND 4RRPG 4XTRD 1KG0A 2VDKL 4O2CA 4WGWB 4HUWA 5KJRL 4LCCC 2H26B 5CAYB 1CXHA 1AQKH 3GGWA 4BSJA 3BH9B 2H1PL 1U91B 1FL6B 3DRTA 4Z7WB 2Y6SC 1JTOA 4YE4L 3RQ3A 5C07E 3FT4B 1XF3B 4G8GE 1CK0L 1QYGL 2JCCF 4HIJB 5GSRA 5LWYL 4LFHD 3FQRA 15C8L 5L6YH 1E28B 2OSLB 1EMTH 5D1ZD 4QTHA 1BVKB 4RSVA 4Z0BL 1FFNB 4ELMA 4ZO8A 3AAZB 2AW2A 4Q6IB 3WFEL 3WUWA 2P7TA 3S5LG 5B21A 5GISH 5DMYA 3SDAD 4P4KA 4LF3A 4L4TB 1S9XA 4X6CA 3PGFH 1XH3A 4NQDB 1UZ6F 1AC6A 2MPAL 3MRCB 1BBJB 1NANI 1BLNB 4DK6A 1FL5A 4PRID 5IM7B 2NW3A 1S7XA 4PJAF 4P5KB 3O3EB 1PEWA 3BXNB 1H5BC 1IMHC 3PWNB 5D1XD 4JFOA 4OF6A 1N5AB 3NH7L 5F7FA 1G7MB 4HKBB 4LLMA 4F7CB 1JGLH 3FRUA 2D4DA 3S6CA 5GS1A 1IM3B 1RUMH 4P46B 5I73C 4NQEA 1IC5L 2EE6A 3R8QA 1X6NA 3RIAF 2RJMA 4QLRA 4GRLD 1VFBB 3HR6A 4Q9RL 3QUZC 3IDYC 2VXQL 1CYGA 1HSBB 1ZHLB 5DJ0A 5C0BD 2QQLH 5DD0H 3W39A 4K7PY 3F8UB 1NBYA 4S1QL 1CFTB 5FYKD 3VW3H 2WWKO 4IRSB 3A67H 1MEXH 2BNUB 2B20A 1LO0H 3FO0L 1NCCL 2AXFA 3G5ZA 4XC3L 3SCMD 2C4XA 1A7RH 1K8IB 5FOJA 1IBGH 5EBGA 3UJIL 1SM3L 1DBKL 1OY3B 3NMEA 3PDDA 2EDTA 2X9YA 4ONOA 1SJVA 1UFUA 3PWLA 4KKLC 3FOMA 1BM3L 4LPUA 1UXSB 2ICWB 4IDLA 3QPXH 3IAGC 4U6TA 5JHDA 1X4XA 4S10A 5D5MB 2W0LA 2XPGA 3O4OB 1QUNA 3OWEA 4WO4B 1BPVA 2VABA 1S7TA 1S7WB 2VQUA 5CCKH 1Q9LA 1ND0B 4OGAD 1MH5B 5A1AA 5CGMA 2FZ3B 1AE6L 4JKKA 1L0YA 5SV4A 3QBTB 1KN2L 4K07A 2ESVE 1CD1A 4D9LH 4JQIL 5CKGA 4D0BA 4KRPD 4LCUB 4PJHA 3QZWB 1H5BA 2UZXB 3TFKC 5IHZB 1T66C 5DS8B 4LLVB 1MHCB 5FM5O 5C0DA 3BKML 4XRCA 2PKDA 1IGYA 3D2UD 5KTEL 5DMIL 5B4MC 4FZ8L 1XGTB 3UX9B 5E95B 3C09C 4OFPA 4DGYH 2Z92A 1MCIA 1G9ML 5EOQL 3GI9H 1ZVSB 1MWAH 2XQYK 4NQVA 1FFPA 3HNSH 4PJ7E 4BH8B 5HSFA 1N64H 4KJYB 1FYHB 5HGHA 3FMGH 4Q6IC 4JRYE 4L3EE 3LKSA 3MXVH 1G6RA 5TGBB 3KPQB 1N2RB 1IAMA 1YPZA 1QLRA 1T03L 4QF1A 4ODVH 4OFDA 5FUZH 4UTBH 3DSFH 4PRHB 4NT6A 2CXKA 3VFNB 5J3HD 5KW9L 2NY2D 3NIFF 2ZCKL 3OKKA 3FQWA 4ZDHA 5B3NA 4XP4L 3PQYA 1ZT7A 4WEMB 4LEOA 1JJUA 4OT1L 3NABH 3X3FL 4FQXB 4QTIL 4ZUVB 1U3HD 4ZFOA 3ZL4L 3PXJA 3CFCH 2BC4B 3KXFA 4K94H 4RGNB 4P46C 2DMCA 1A0QH 4NQCA 8FABB 1MHPL 2CKBH 2FO4B 4FFYL 4OGYH 4M43L 5H2BB 5DMKA 3W5NA 5EG6C 4FXKA 3F58L 2R2HA 5SWZD 3LS4H 5TPWH 3DX8B 1EEZA 1WC7B 3BRFA 1AHWA 4Y4KA 4XCFH 3IU3B 3TFKA 3UBXI 1U8NB 2CRMA 5L88L 3U7WL 3AGVA 2E7LC 3SE8H 1U91A 1TPXB 1AQDB 1HINL 5CINL 2F58L 2A74B 1B88A 5B39A 4UU9B 5HYFA 3U82B 3FT4A 3REWB 3VXUE 3CLFH 1Z9LA 3KPOA 3ARWA 1J1XH 5MEPB 4JG0H 2O5ZH 1ITBB 5C0AB 5CD3B 1AD9A 4N1HB 3IETA 1EEYA 1KLFA 4Q6IA 2P5WB 1MFAH 3VXSB 4TUOB 3GMPB 3O4OC 3AXLB 4WO4C 2EYRB 5CJOH 5HI4D 1IKNC 3KYKH 3TA3B 4OF0A 3BN3B 4NN5C 4NQDA 4UNVA 3IU4H 4WI9A 1BBJA 3VH8A 4ERSL 3JTTB 3PL6D 1G7IB 1S9YB 1BLNA 4JFEB 1OGAA 3ARBD 3WIFA 5MHSE 3CX2A 1CS6A 3IDUA 4YPJA 3O3EA 3BXNA 4F7EA 1I1FB 3PWNA 1JI1A 4Y1AA 3IFPB 1TJHH 1JHTB 1G7MA 4J4PC 4JEGB 4UUJB 4E5XA 4DFHA 4HT1L 1LO3H 2VDLH 2BVOB 2A73A 1SJXA 5EO0B 3QFJA 3TIDA 4UIKL 5CIPB 2ESVD 4P46A 3UYPA 1P4BL 5JW3L 1IGIH 5SWSB 2DQDH 3SE9H 1G1CA 4KV5E 4JY5H 3ZTNL 4ODHH 5E4EB 1E27B 1DANT 1LK3H 1X5JA 4G8FA 4K3JH 5GGTA 4TRPH 4G8EB 1HSBA 1ZHLA 4P49A 4NN6C 1TVHB 4WI7A 3KYAA 4HS3B 2E7LA 3WHXB 1LEGB 1O5DT 1CFTA 4JLRB 3D3VA 2GHWB 1OT1A 1WUNT 1AXSA 3EUUA 2BNUA 3GHBL 4UT9H 2IQAB 3QR2A 3QWOA 5IFAL 2EYSB 4G3YL 2RCSH 1OAUH 3KHQA 5KVEH 5TDOB 2FO1A 4L8BB 3HMWL 3ALXA 5CP7B 2X1PA 2E6JA 3GIVA 1XGYL 4ODTH 1KTKE 2Z8RA 4AEEA 2XKNA 4L3ED 3STZB 5DHVB 1U8OA 2Z31D 2H9GB 3MRBB 3SDXE 2ICWA 4GAFB 4G7YL 4PB9L 4YXLL 4FQXC 1PG7H 4OKVA 1I7UA 2ICEA 1R5VB 3EGSB 1CG9B 2XA8L 3DGGB 2HKHH 3EFFB 3MJ6A 3VRIB 1IKNA 4RGNC 1ND0A 1CDBA 3AREA 3FTGA 3HUJE 4X6EA 4XPTL 4H26B 5CLTA 1NFKA 4MMXC 1R3KA 4DOHE 5I1CH 1KEMH 1KIQB 1D3CA 1WAAA 1NC2A 1XIWD 3CFKA 3NCBB 4FQ1L 4LCUA 2H32A 3MLSL 4KHXL 2YBRB 4X4XB 3VXOB 1F58L 5DRWA 3AMKA 5L7XH 3LN4B 3GO1H 3FKUS 3E6HA 3RFZC 4KZEL 3IDJA 4LASH 1HK6A 3VA6A 2W9EL 4PUBL 3UTTB 1JV5B 2MQ0A 5IJVB 4OB5L 4HUVA 3BUTA 1YECH 1TPXC 1OF2A 2V17H 4AG4H 4HZAA 1D5MB 1SBSL 1YEEH 5FCUL 1J87A 3DXAD 4XC1L 1YUHB 3FN9A 5FGRA 1G9NH 3S36X 4NNYA 3HAEG 3QDMA 1XF4A 3ARFA 5DD3H 2IH1B 3ZE0E 5C0GA 3QEQE 4KJYA 3WNNA 1ZXQA 1GIGH 4LU5H 3C6LB 3H42H 5SV3A 4UDUB 1GPOL 2F19H 4R97B 4LPVA 4Z7VE 4HPYH 4NWUH 3TJHD 1ZA6A 5EBWB 1PY9A 4JY4A 1AO7E 1N2RA 3TA3C 3B43A 3BGMA 5IQ7L 3X3GL 5IVOA 3LHPH 5FK9B 1YEDB 2Z93A 3RWEA 4NCDA 3T08A 4F7TA 1VSCA 3ROOB 4ZSOA 4DZBB 4XCYB 5EN2B 5IMKB 2GFBB 3WXWL 2E9IA 3L3GB 3GSQB 4ZUVA 4WI3A 2EDWA 4WTZA 4OF8A 5FHAH 4WW1A 1R24B 3CSYA 3L3HB 4NGHH 4EXPX 1F4YH 3K0WA 4NZUL 1DQLH 5JUEH 2VSDA 2NY5H 1JZ8A 4DAGL 4HKZB 1X5KA 5JPNB 2ADFL 1P5UA 4OZFB 4DGIL 4F3FB 5ESAA 1PVHA 4JFFA 2AEIT 1GVIA 3DRQB 1U8NA 5I8OL 5DA0B 3CLEH 1YPZF 1BX2B 5E6YA 3UYRL 2BSED 4LL9A 3IJHA 3UXFA 3WUWG 3P77A 5DWUL 3C8KA 1N26A 4YFLI 4KK6D 5HYSB 2RB8A 2CR6A 4PP1C 5C07B 3GMOB 2VMFA 3X12B 3REWA 5BV7H 5HVHB 1A6UH 5D96C 5IMMB 3WIHA 1WWBX 1CGXA 2P45B 1MI5A 3OGOE 5FYKU 1S7RA 2W1NA 2V2TB 2FECI 4FTVE 3QG7H 1CVSC 4P2RD 1FZJB 3VD7A 2F53D 4DKFH 2AKRB 3RUGA 4N1CA 5J1SC 2BJML 1MCWW 3TP4A 4QRRD 4TNWK 3QHZH 3FQXA 1KLGA 3AXLA 4QHLA 4Z7UB 5E6ZA 4Z8FL 4UI2A 1MJ7H 4AENB 5E1AB 1G7PB 4C56E 3TESA 3ULVD 5IQ9A 5A3ID 1QVOA 1T1YB 4JANA 5ENWB 4M00A 3JTTA 4O9HH 3ARTA 1DDHB 1NGZB 1X7QB 2AJSL 4YBQC 3VXQA 3GRWA 1UM5L 5T1DH 5M7QA 4DZ8B 4WCYL 3LQZB 4WWKD 2AEQH 4GG6E 4GQ9L 5GRJL 4NCC2 1JHTA 1HQ4B 2JK5B 1PEZA 3J8F7 3LRSB 1MFDL 3H9SE 1NMCB 3DX6A 3PWVA 1M71B 1NMAL 2BOBB 2VDNH 5EU6D 3NFPB 3IAQA 2MJWA 1UQSA 1VFOA 1FLRL 2A6DB 4U1MB 4F7MB 3U9UB 3WBDA 3BI9X 1ZGLA 2BVPA 3CVHB 4D9QE 5GRYA 1QFUH 4DKEL 1P53A 1YEKL 2EIZA 4IDJH 4PJFB 1I7RB 5DJ8B 4D94A 4ZNEA 5DMGC 3L1OH 1A1MB 3S97C 3O2VL 3IGAA 2BVQB 1OPGH 5FOBA 4ODUA 2FD6L 5C6TH 5TDOA 4HFWA 3FCTB 5BO1H 4YAQB 1QR1A 4EI5A 1IAKB 3L9RA 4L3CA 5IBTH 2VJXA 1B0RB 1ZANL 4KQ3H 1KJ2L 3BD5A 5HPMB 1TTUA 3STBA 1P1ZA 3NIDE 4QNPF 4XH2A 5JORA 2EEBA 3ZYIA 1NLBL 2HG5A 3ZO0A 3IFNH 5ISZE 4K23H 4JZNA 4PJ5A 4JFZL 4OTXL 4PJ9D 3EFDH 4NKMB 2DLFL 4OD3L 3ECBB 4OZGB 5I0ZA 3QIWD 4N0FA 5E9DE 3JVGA 1CLOL 5E8EA 3Q1SL 4TUJB 4GKSA 4KGJA 4AY0A 5CSZB 4X4XA 4XPAL 1S78D 4OSUL 2EDLA 1X5GA 4TSBH 5GGSB 4B5EA 2ZOKA 3FFCD 2VDOH 1CD0A 1JF6A 3HFML 4W6XB 1E4WH 3UTTA 3OL2A 2ZPKH 4QCIA 2A83B 4HF5H 1CWVA 3TPUB 1UWEL 5I1GL 2YN3A 2Q87A 1MF2L 1FVCA 2I5YH 1CDGA 5E1HB 3W9DB 1UZ6E 1YEIL 3EYUL 3HE6A 1FIEA 4ZG1A 2W9DL 3QQ9D 1ROWA 4F37F 5FUCC 1CI5A 3QWQB 1OHQA 3FL7A 1P4IL 4PTUA 1FZKB 4NKDA 3ZE1F 2AVGA 3PG2A 3FZUC 5GS0L 3HG1D 2GTZA 2EIEA 4JRYB 5IK3B 1A7NL 5I1HL 3SKMA 1T0NB 1M05B 3SJVB 1TTGA 3QP3A 2Z8SA 1VEOA 2IFFL 3EZJB 2CIKB 2FIKA 2OBGA 2NW2B 1RZ7H 4XZUA 4JDTH 4LQFH 3MLXL 2HN7B 3RZCD 4L8CA 3GHEH 3WFCL 1ITCA 4LCWA 3FRPA 5D8JL 4YK4B 5IMKA 1YDPB 2D7MA 2DQHL 2VKWA 4MAYB 4JDZB 4PJDB 4C56D 2Z91B 4S0SD 1D9KB 2VDPH 4CBPA 5L2KA 1R24A 4WI5A 2C5DC 4U6YA 1NMCC 5BS0E 3V5DB 1CGVA 4HKZA 1NBZB 2APWA 1FNFA 5B39G 4OZFA 5CKAA 1MCLA 4PGZA 4F3FA 2VQ1A 1II4E 3U4BL 4YDVB 3TBWB 4F57H 5JW4N 2FHBA 3T0VA 1T6VN 3MJ8B 4LLUA 4JFQB 2VLJE 5CJ5A 1BX2A 1NDGB 3D48R 3QI9D 5DJCA 5I19L 1NDMB 2O5XL 2EC8A 2XTJB 1RIVH 5AAWA 2NR6D 1T1WB 4U1KB 3DO3A 4XWOD 1CU4L 3RL1B 3MBXL 3KPMA 3VH8G 1MCRA 2V2TA 3NAAH 3IJSB 4LSRH 1OWRM 1RHHA 1JWSB 3B9KD 4OCMC 1MLBA 1UGNA 5J13B 1Q9OA 1KXTB 2GYSA 5HPOA 1Y0LB 3JTSB 2UY7A 4NHCL 4K71B 4MB3A 4PJIF 1UKSA 4I9WD 1KJ3H 1N6UA 3BSZL 3C08L 3S96A 4FQIL 4ZYKA 1G7PA 5IMLB 5ERWB 3A6BL 1OD7A 1DDHA 1ACZA 1KB5H 5MI0B 1TXKA 1CE1L 2VLME 3OR7A 5T33H 1VERA 3TLRA 5ISZD 4HHAB 4DZ8A 5DUPL 1OP3H 3V6BR 2AV7B 2HTKC 3HZMB 4L3AA 2JK5A 2HKFH 4A2MA 1RFDH 5E08L 4E41E 1WBZA 5GRUH 3K8MA 4GXUN 2WY3A 5EO9A 3B5GA 1EGJH 4M8QA 1MCPH 4R9HA 1XR9B 2QTEA 4H8WC 3TO2A 3WXVL 3SGKC 3FQUA 3BPLC 5IG7B 3NIFE 3UTZB 2QADD 2OK0H 1U8LA 3MLZL 4FZEL 4Z76B 3LRHA 4NKOA 3KPRB 1BFSA 3WHE1 3DYMA 3MOAH 3NFNB 1MY5A 4UV7L 3V0WL 3GSNH 4EUPH 3WFZA 4RA0C 1RJCA 1Z5LB 4NJ9L 3FN0L 4WI6A 7FABL 3LIZH 3K81A 3DX7B 4APQD 1IFHH 5DJZA 5JA9A 1KJVB 1F6FB 4YUEH 3HNVL 5IFHL 4JQXC 5T3ZL 1HNFA 5D7JA 1KTRL 4O51A 1C5DA 3OKNB 4U3HA 1TDQA 4F2MB 1WBXB 5ALBL 2ZUQB 2GT9A 4MAYC 5I75B 1JN6B 3I6KA 4KTDL 2NTFA 3L7FA 3FAXA 4PRBA 3OHXA 5K9QG 1OAZL 2VXTL 3OJVC 3GSRB 3ULSA 1CR9L 4YFEA 1OLZA 1I3UA 3I2CL 2XN9A 1YEFL 3ECBA 1CQYA 1KXQE 5BMFH 1QPXA 3Q3GB 2YPLE 3G08B 2X89A 3INUH 2R0LL 4NSKB 5IIEB 3F6LA 2BOCB 3OAUH 1JNHA 3ZKMC 4C4KO 1AJ7L 5EOTB 3W81A 4JO1H 3WNMA 5AZ2L 2P8PA 1SYVA 5DK0A 5T1KD 1WJ3A 3N9GL 4NO5A 4D8PB 4WW2F 1UACL 3O8XD 4PDCE 2A83A 1VEPA 1FGVH 3ULVH 2WW8A 1QLEL 5C0JB 5D72L 5GGSY 5DD6B 1U36A 2OCFD 4UIMB 4G6FB 4LPWA 5E2TL 5ELIA 5D1QB 1RZKH 1UZ8A 4XBGA 4MX7B 1W0VA 3QSKB 5F7YC 1Q72H 3MZTA 3PWPE 3GUTB 2YMXL 3MRDB 2HJLB 1A1OA 4WI2A 4X5XA 1FZKA 2W65B 1GOHA 3NBNA 3QDGA 1TZGH 5J13C 3O6FA 1AQKL 3WFBH 2XT1B 1PKQB 4Z7VB 4K71C 5KSBB 1T0NA 4GMSH 4WTZG 1VEMA 2FL5A 5FF6A 4RFEA 2Q8BL 1QOKA 4Q2ZA 1AO7B 4OLWH 2NW2A 3H9YA 4PIRF 5C0CA 4NZJA 4X7TB 2EYTB 4PP2A 1TCRB 4LLQB 1HSAB 2J8OA 3GSXA 1U2HA 1NCAL 3EO9H 1EFXD 5M95B 5D2LE 1DLHB 3HCVB 3T0BA 3U0PA 4EQ2A 5C0ND 2IG2L 4MD5A 4R7DA 4TVPD 1Q0XH 3VI4F 1A02N 1J8HB 2V7NB 3D6GA 3RWIB 3DUSA 2WINB 3HC4H 3RTQB 3V7AE 4X98B 5L8LB 3KVQA 1KJ2A 4RGMB 3BW9B 1KXVC 4HUXA 2PXYB 5T1LA 1NAMH 3BWAA 1JHLH 4WFEE 1HYRC 4E41D 4P99A 4AIZA 5BZDA 4U1HB 2YC1A 3ZKQD 5F7EL 1YMHB 2MQ3A 35C8L 3CFEB 4NQUA 4JRXD 3X13A 3DHMA 2IH3A 4ONFL 4ZS7H 1RUML 1BAFH 5C08D 3T0ED 5E2VH 4S11A 1B6DA 4FFWC 5E8OA 1VDGA 1JZ7A 3PHQA 3QDJB 1T0MB 1T1WA 3ET9F 2OYPA 3V7MA 5IB3A 2GY7B 5IUSA 2CMRH 5KSUB 2NZIA 1H0DB 4ODSH 5F7UA 1T1ZA 4PJGA 1DVFB 1IGTA 1ORSB 3S4SB 2IPKB 5IW1B 4CU6A 2QQLL 2IAMB 1U8JB 5I75C 1FDLL 1Y0LA 3KJ6H 5TE4H 3VFOA 4F9LC 5IESH 3VW3L 1HE7A 2HJFA 4YHIA 4G6AC 4NQXB 2JELH 2JJTC 1LO0L 1QTYT 3LEXB 3T2PA 3GJFK 5BVPL 5J8OA 1HHGA 3RAJH 2BSSB 1A7RL 1IQDB 4L9DA 4J3VA 4IRZH 1IBGL 3BQUD 3OJMB 4PRNA 1AI1H 1DLFH 5FV2A 2ICWI 2HJKA 2P24A 4LHUB 2FB4L 1U8PA 5D7LE 4FG6C 3HZMA 5HY9A 4K3DL 4MDJA 3LN5A 4N0YH 4KZDH 3LPGA 3TNNB 3MV7B 3CAFA 5JXEA 4G9FD 3EYQC 1YC8A 4LSSH 5CCKL 5JW5B 2D4FA 3EYFB 2BNQB 4GBXD 4XPFH 2PO6C 4MNHA 2PW1A 3PGDA 5D1QC 4OZHF 1T22A 4D9LL 4KKAC 2E7MA 3I85A 4ZOBA 5ALCH 1IM9D 5HHME 3OKEB 4ENED 4JR9L 4NWTL 3SDDD 5IHUH 4KC3B 1QSFA 1A6ZB 4P3WA 2EDDA 3UPRB 3OAYK 2C1OB 3PWPD 2AJZB 2LVEA 1MIEH 3MRPA 4KJQD 4AIXA 2AABL 4DGYL 3MJ9H 1KCGC 4RIRB 2ITDA 3DX7A 4P0DA 3K4AA 3GI9L 4AMKH 2A6KB 2X4TB 2W9LA 3GK8L 3MLTB 5HI5C 1SYSA 1MWAL 2DYPA 2ZJSH 3C2AH 1A6AA 2DB8A 3WN5B 3HNSL 1B2WH 1Z0MA 2ADIA 1R0AL 3HS0B 1KT2A 5DLML 1M7DA 1PG7W 2OTWB 3FMGL 4F9LA 3VGHA 3G6DL 4AZ8A 4U0QB 4KMLB 2AJVL 5HHOA 2JJTA 5D2NE 3GSRA 4PJBB 5GHWH 4XWGL 3RTQC 2FR4A 3MQIA 5E2UH 2FGWL 1W0WA 4OD2B 4JPVH 3LQMA 4RGMC 3BHBB 3DVIA 1D5XB 1YYMH 3HZYB<