4LCYA

Crystal structure of hla-b46 at 1.6 angstrom resolution
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
274
structure length
274
Chain Sequence
GSHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRMAPRAPWIEQEGPEYWDRETQKYKRQAQTDRVSLRNLRGYYNQSEAGSHTLQRMYGCDVGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAAREAEQWRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords HLA class I histocompatibility antigen, B-46 alpha chain
publication title Crystal Structure Analysis of the Human Leukocyte Antigen B*46:01
rcsb
source organism Homo sapiens
total genus 79
structure length 274
sequence length 274
chains with identical sequence F
ec nomenclature
pdb deposition date 2013-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lcyA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4lcyA01
3DIFB 2MQ3A 4MCZA 5HDBF 5GSRA 2ZG2A 1H5BA 5GHWL 5DDHB 4XXDA 3BYTA 4WTZA 1A1OA 4L8SB 3L9RB 4TSCH 5CEZL 5D7JD 4P2RB 4PY7B 3PWPE 5T3XH 3SKNB 4PYHA 1VGKA 3MRMA 4HUMB 5J1AA 5F72S 5E00B 4BSVB 4Z77A 2C7UA 4PRAA 4XVSL 2HJFA 3KPLB 1LO2H 2J3SA 4QHKI 5E1AB 4PTUA 3I2CH 1EUTA 4LCCC 2R0LH 5HPOA 2A83B 1MQKL 3V2AR 1UA6H 4Z7UB 5GGRY 1P7HL 1JYNA 2XA3A 4P2RA 4PY7A 3V8OA 1N0XH 2JJWA 3SDDD 2X70B 1OHQA 2DMCA 4JFEB 3UDWA 3CH1B 4JGUA 4I48A 4NQVA 4OCWH 1TZHB 5DUPH 1HH6B 4LVHC 4U1HA 4WI2A 5L2KB 1J1PL 3BISA 2YWYA 3OKEA 4HUKB 5TDOA 3SQOL 4PREB 1A64A 4I0PB 4NT6B 3QIBD 2AK4E 5BXFB 3O0RL 4DVBB 3WIFB 3WDIA 3VXOB 2CKBH 3S37X 3TNMA 2D9CA 2HP4A 2WW8A 3E3QC 4G8GD 4DN3H 5JHLL 1TZHA 3TBYB 1CR9L 3PP4L 5D93B 4M6NH 3U79A 1HQRB 2YD1A 1IJ9A 3KNBA 5DMGD 2BSSA 5IVZB 2VISB 1Q9LB 3QPQC 2AV1B 3RVXD 1J0ZA 1BMGA 2CGRL 3JTTB 1CDCA 3F58L 3U46A 1B0RA 1C08B 4J12A 5BXFA 3ARSA 3L3IB 4GRWH 5GGQH 2L0DA 5I1GL 5D7SH 2HG5A 3GSXB 5A1AA 1K6QH 3HS0B 3QCVL 5MEOA 1I8KA 5DJZA 4I5BB 3D0LB 3ZYJA 4Y4FC 4U2ZA 2EO1A 1QPXA 2DYPB 1IL1B 4XP4L 5IVZA 4I18C 4R3SB 1T1ZB 4RNRA 1RVFL 3WDJA 4XNUH 3P0VH 1NGYB 3JSSA 1C08A 1JGUL 5GRUH 3MR9B 4FQ1L 4L9LB 1YNKH 2DJSA 4G6AD 4CDGC 5IKCA 4JM2D 5IMMB 4O02H 4HSQA 2BSTB 3HS0A 4R6UA 3V5HB 4Z0BH 4PJBB 1CFTB 3DYOA 3KYAA 3SDAA 1AD0B 4MA3B 2I60L 4U33A 1HHGA 2YRLA 4RMRA 4ZTPH 1BF2A 4NNPH 2UYLA 3NZ8A 4KWUA 1NGYA 1G1CA 3LKPB 4X6DF 3GEWB 4OM0L 3WJLA 3LZFH 5DF0A 4WCYL 2N7BA 3O3EB 1FNAA 4OLZL 3LEVL 2BY0A 4QHUA 1KULA 3DV6A 3L5WB 2BVPB 4LVNC 2H1PL 4L4TB 3MBED 1CFTA 4KMLB 4PJBA 4XPHH 3MNVB 3WIIL 2ZG3A 2P44B 4JVUA 2G75A 1CYGA 1EGJH 2CJUL 5IM7A 3CNKA 3KR3H 2BVUA 5FHAH 5T1KD 2GI7A 1LO4L 3ZE2F 2ERJC 5C09E 1CD1B 4JO2L 1U3HC 1HHHA 3DUSB 3L5WA 5BZWB 3QXUA 4L4TA 1NCBL 3CCHB 3MNVA 2AXJA 3QG7H 5C0DA 4JM4L 3QFJE 4RA3A 3MRIB 1B2WH 4EN3B 1JVKA 1S7XB 4PRBA 4JM2F 1CFNA 1CD1A 3D85D 2VWEE 3VXPA 1ZSDA 5EO0A 5FUOL 1ZVSB 3DUSA 4LSRL 3LHPL 3CCHA 5DLML 5FYLD 3O2WL 4N8VB 3OSKA 2FEEI 3KHQA 5HGAA 1CFBA 5A40E 2XXMB 5F7UA 1MI5B 1VESA 4JQIH 4OJFH 4FHBD 1FAKT 5BO1L 2ZOKB 1NBVL 3KYMB 3BZEA 4PJ8D 4HX1B 4ZYKA 1JZ3A 3ULVH 2FWOA 4Q9CA 1BFSA 4ELME 1QFUL 4J6RH 2M26A 2EE2A 5BS0D 1ZLUH 3SGDI 4KMQA 1IAKA 4ACPA 4IIQC 3FB6A 5DHVA 5CIPA 1MREL 3OWEA 2FJGA 5DD1H 5LGJA 1DDHB 3T1FB 2OK0L 3KYMA 3BT2H 4FTVB 2OZ4L 4QHMB 5AD0A 5T1DH 2ID5A 4HX1A 4JZJC 2EDXA 1I1FB 4ODSH 4K3DH 4JO4L 4LL9A 1KC5L 1NLDL 2EXYD 5L0QC 1RK1A 2AVGA 3WN5C 5DVKA 1J1XH 1Z0MA 3SO3C 3BZFA 1ES0B 1HOCB 1F4WL 1BD2D 4I1NB 2ESVD 2AJSL 1DDHA 3WFBL 1EHAA 3B9KD 4ZXBB 3T1FA 4B53A 1YY8A 2QQKH 3U0WH 3FAXA 2F19H 5BRZE 3QP3A 1E4WH 5MENB 1FG2B 3NN8B 4JKMA 4P57A 2A74B 3BJLA 3AGVA 2R4RL 2EIEA 3VXTB 1FSKB 4KVNL 1BX2B 1G6VK 2XFXB 3QSKB 4PGJA 3VWKB 1T20A 4UZGA 1ES0A 1HOCA 1F02I 5FKPA 3QNYB 2NY5L 4MDIB 3A6OA 4S0TD 1ZS8A 3WLWC 1ND0B 1D5MB 4P23A 2QTEA 4ZSOE 4HWBA 2JJTA 1FG2A 1NCCH 1YQVL 3NN8A 4F7EB 5TE6H 1CICB 1E6JL 1IGJB 1N2RA 2FX7H 4PPTA 2V17L 3PHQB 4PRHB 5E9DE 3VXTA 3S34L 3ARWA 5F96H 3SJVD 4YHNB 3D39E 2R0ZH 4G7VH 1XF5B 3L1OL 1U8NB 4IOSD 4Y16C 3UPRA 2NXYC 1ND0A 1Q0XH 2VXTL 4PV8B 1UM6H 4LHJB 1KF9B 4XC3H 2VLKE 2BCKB 3C60C 4PRHA 1KEGH 1YNTB 3D87B 4XAWL 4YXKH 2X9XA 4NBXB 2X9YA 4H1LB 4XP9L 4XX1G 2QKIB 1FJ1B 5HHOE 3BIBX 1G6RA 3NCEB 2VZSA 1I1AA 5TFSL 1HKFA 3BYYA 3V6OA 4F37F 2NY1D 3ARFD 3MRHA 1U8NA 4I3GA 2XQYK 5J13B 4FQXD 4K07A 4UT9H 4PV8A 2CSPA 1T80A 2A9NH 2R23B 2BCKA 3NPZB 1K3ZA 1R3JB 1P4IL 5E8EB 4AEHH 1KN4H 3TN0D 4LKXA 1INDH 2YA2A 5CFHA 4D0DB 4AG4H 1CDJA 3WJJA 4AIXA 4DEPC 4HFUL 5T1MB 4ONHA 4D0BA 4X4MA 1KPRB 3T3MF 2J2ZA 4DGIL 2MMXA 1AJ7L 1R3JA 5E8EA 3GO1H 2AXGB 1P6AB 5IUSA 4TQEL 1AD9B 4G6JL 5E1HB 1FZJB 1CTNA 2IQ9H 2ZCLL 3CLEH 3GJEB 2XICA 2W91A 5FYKU 2HLFC 3ARBC 1FNSH 1J05B 4H0IA 4DVRL 5KN5B 5DEFB 5EOCL 4JFDA 3IDXL 3C2AL 1MF2L 2YK1H 3EYSH 5DWUL 2WBJB 3MRJA 4HXBL 4KJQD 4EBQH 2YKLH 2XPGB 2XZAL 2AXGA 1VKXA 3MUHL 1NFKA 5D1ZB 3QNZB 4YHIA 5I71B 4KK8C 1FZJA 3HAEB 1MRCL 4BQCA 1OTSD 2FZ3B 3SBWC 2ZKHH 1JFMA 3KDMA 2C4XA 1J05A 5KN5A 3GJFK 4ENEC 3C9NB 5CJQL 1UWEL 3FOMB 5GRVL 2WBJA 5EO9B 3ROOB 3WKMH 3U30C 2XPGA 2PW2A 2HT4C 4TSBH 5IT2H 2X4NA 2LV4A 4OT1L 4KAQH 5D1ZA 3MACL 5EIIA 2CDEB 2FDBP 1I7ZB 4Z7VE 4G6FB 1RUPL 4RGND 3F6LA 4OCXL 3RU8H 5ALBL 4RGMC 3V8CA 4LOUD 1ZA3A 4WFFE 4LLVA 3C5JA 3KPSD 4M3JA 3S96B 4QGYA 5I8EB 5IFAH 4YBHA 1LVEA 2ED7A 3C9NA 3FQWB 1IT9H 1EO5A 3V0WL 4KKNA 3VWJD 1U8QA 5EO9A 3ROOA 2NY0D 3QIWA 4N90D 1WFTA 3Q6GL 1MJ7L 3B2VL 2CDEA 5JA9A 4MA8L 3WFDL 3MBXL 1QNZL 2VXSH 5D6CA 4D9LH 1H8SA 3LRHA 1T0PB 3MCKB 3T3PF 3AS1A 5EU6A 3EOYG 3S96A 3PWVB 3DGGB 3K0WA 2WLYA 3FB8B 2JJVA 1JI1A 5EIQA 1YMME 4XCNA 3KYNA 3EO1B 4JKPH 2R8SH 5IQ9B 4ALAH 4S1QL 3NACL 5FYLH 1BJ8A 1ADQL 2K3TA 1Q72H 2CH8A 1NLBL 5DRZB 2Z91A 3DVIA 3O2DL 1RURH 6FABH 1DE4B 4HWEH 5EOTA 2FGZA 3MCKA 2N4IA 2OYPA 2BC4B 3TFKC 1T4KB 1W8OA 1ZTXH 2OR7A 4XP1L 2MOVA 3FB8A 5E8OA 4U6XB 4HMCA 3DPBA 3EO1A 1HI6A 4Y8DC 4JDVB 3HN3A 3QFDA 3BN3B 1DE4A 1MCOH 2HJLA 1YEJH 2MKLC 4AQ1B 5EWIL 3TT3L 2X40A 1CGYA 3RQ3A 4WI6A 1NBYA 4GAGL 5F97E 4ZO9A 1IM9B 2V7NA 3PIQA 1NKRA 3SDXF 3BGMA 2PR4L 5D1XD 3TZVA 3ETBF 1RZGB 3BQUD 2VE6A 1B4RA 2W59A 2E3VA 3JTCA 4MJ4A 3PGCA 1JL8A 4W4NA 3H0TB 3LQZB 4Y4KD 3SOBL 4C56B 4KHXL 5HY9A 1EO8H 1WC7A 2JJUA 3S36L 4ZUUA 4BZ2H 5GGTL 4R0LA 4YQXL 1I3VA 3FN3A 2RGSA 1A8JH 3HNSH 3AMLA 2KPNA 4TVPD 1J18A 1FL3B 2MSPA 1MHPL 3MLZL 3MRKB 5EPMB 5IROC 5GSVB 2X1OA 4C56A 1CD9B 5IR1B 1ZVHA 4OQTA 5DS8B 4Z5RB 3C5ZC 2ZNXA 4J2XA 4DGYH 4AYFA 4PYGA 1Y6MR 5GGSY 1F4AA 3GMPB 4LSUH 1SJVA 3OL2A 5I1AB 1X5IA 3F65A 1CGWA 3ARZA 3FAWA 5GSVA 3IKCA 3WXWH 4OB5L 3H42H 5DS8A 4Z5RA 4XCFH 3TO2A 3MRBB 2FNBA 4UV4L 1SMOA 2MNUA 4Z7UE 2J4WL 1AXTH 1YUHA 2LVEA 5HHNB 4P2OA 3KPPB 1I7RB 3VFVB 4JFEE 5JMRA 2IF7A 2NNAB 3UTSB 3O8XB 4PJ5A 2RAMA 1CIDA 4N0FA 5DJ8A 5L2KE 4KXZI 3VA2C 1XF3B 5FK9A 4QHNA 4TPRL 2BSRB 2COQA 5F93C 1OAYH 3TVMD 3VFTB 5TJWK 5HHNA 4I77L 2IADA 5E8DL 3FN0L 2ORBL 5E8NB 3VFNA 4GAJH 4P5MB 4Y89A 5ESVA 1ZHNB 2HWZH 4UV7L 4QKXB 3BEVB 4EDWH 3HKFA 3QEHB 4XPTH 4D8PA 2E7MA 5C08D 2HVKA 4Y5VC 1MFNA 3U4AA 3VFTA 1X5XA 4WO4D 3CXHJ 3TGXA 3D3VD 1AR1D 4L3CA 1N5YH 2DJUA 3ZSTA 1TENA 2Z92B 4D9RE 1QRND 5IGXH 1V3LA 5D8JH 4NM4L 4HV8A 1DBKH 2AEWA 4Q58C 4WI5A 1DBJH 3NCYS 5B3NA 1NDMB 2Z8RA 1GIGH 4PRDB 1FFNA 2DAVA 4JY4B 1UXWB 1LD9B 5DK2B 4C57C 3IDJA 3VXUA 1YDPB 4FP8H 4JFFE 5I1CH 4ERSL 4XTRD 3G6JB 5E94B 2GY5A 5B39A 5E2WL 3B3IA 1FCGA 2DKSA 3WIHH 1A7QH 2Z92A 1RHFA 2QJDA 2QSVA 1GC1C 3L95A 5D7KD 4JY4A 1OPGL 4IJ3C 2KL6A 3IDIA 5DK2A 2IFFL 3U0PB 4DZBA 1DL7L 2FATL 1HZHH 2BVYA 4I9WE 4XWGH 5CSGA 3EGSB 3G6JA 1AFVL 3IB4A 3MGOA 4FFWD 1T7VA 5CSBA 2EDOA 4Q2ZA 5EZIL 2DLTA 2MTPA 2HTLC 1XZ0B 4G7YL 3QHFL 2CIIB 1DQML 5E6ZA 3SGKC 3ZDZF 1P4LA 1EUUA 2WUCL 1MQ8A 1JCKA 3WUWB 1NGZA 2C3WA 2BOCB 3KJ6H 4LRIC 5CEZE 3EGSA 3Q3GB 5IK3B 1X6NA 5IVXB 4CU7A 1JUFB 3DURB 3V5DA 3QCUL 1BOGA 4P2RD 4XI5C 5I1JH 2CIIA 1FGVL 5I1KL 1JNLH 1N26A 1L9NA 1SJHA 2H8PA 4LAQH 1X4YA 7CGTA 2DKMA 2H26A 1UT9A 1VPOL 5AZEH 1VFMA 4M00A 4DKFL 5KG9B 5IFJB 1A1MB 2PTTA 5I9QB 3TO4C 4YHLL 2B20A 2C26A 5IK3A 1TCMA 5IVXA 5DJDA 3DURA 2JF1A 5DRWB 5FGBC 1FN4B 2QBWA 2R56H 1OTTD 5DK3A 5CZKA 2GJJA 1VCAA 5EBLB 1OF2B 1OAXL 4W4OC 3MUGB 15C8L 3GSOB 2WBWB 5F88A 1MI5E 2WWMD 4AM0B 1A6VL 5DD0H 4MQXD 5DJYB 5KSBE 3C5SB 3P73A 5K9QG 4FFVC 3N50A 1R5IB 3ZTJH 5FIEA 1MIMH 4MA7H 4KQ3H 4ONGH 3RDTA 4L8BA 1YJDL 5FUCC 3R0MA 4IOFD 3OX8B 5KVGL 5F9AC 1NEZB 4ZFOA 4JZOA 4PLKC 2IPKB 1OF2A 4R7NB 3P11H 1SYSA 4NWUL 1BPVA 1BVLB 1MCEA 2FIRT 1X5YA 3EFDL 4I13B 3OMZA 3PV6B 2W60B 2CXKA 5C6TL 4ODBD 4FTVE 3GMLA 2NMSA 1FLRL 1FYTB 3G6DH 3SCMC 4HS8H 1XGYH 1R5IA 3HZVA 3MUZ1 5JW3L 1A22B 3OX8A 2PETA 3OBAA 4LSTL 2Y5EA 4Z7QF 2IPKA 4YWGL 3H7BA 1K8IA 3C8HA 2WM0A 4HKBB 4QRSB 5L8JB 4PDCE 3SDAD 3O81A 4JRYA 3ELAT 2W60A 1AGFB 3NPSB 1BBDH 3ZL4L 4IRSC 4TVPH 5DO2C 5FECB 5MENE 5C0FB 4Y5YC 1WWBX 1BHGA 1RUQH 5ADOL 3JV5A 1CU4H 4TYUA 1JPTL 1CTOA 4UBDC 1LQVA 2OMNA 1OCWH 1IBGL 1E4JA 4HKBA 3N06B 3FMGH 2MPAH 2J6EH 2XRAH 1IQDB 1K4DA 1KJMA 1AGFA 3DI2B 1OAQH 1U41A 1DUZB 2VLRA 3HI6H 5FECA 5D6DA 4RMSA 3UPAA 5C0FA 3BP4A 1BAFL 1JHTA 3QRGL 4U1IB 2QR0B 1HSAB 3BH9A 3OKOA 4C58B 5D2NB 35C8L 2O5XL 1YEFL 4L4TD 3MOAH 3LKNB 2EDHA 3X11B 4LNRB 3NFSL 2VZVA 5C0BB 1TFHA 1XGRA 2EDYA 3HG1B 4HLZH 2GTZB 4ZFZB 1YYLH 2ICEA 2QEJA 2NYYC 1ETZA 3NFPA 4HIIB 5DQJA 2YC1A 3RY6C 2AJ3A 4HULB 2G2RB 3O6MH 5EFIB 2B4CH 4MD5B 4P9MH 3EDDA 2B1AH 5KAQG 3DO7A 2WNGA 1R5VA 3DETD 2M8XA 2F54A 4LSSL 4YZFE 5D2NA 5HDBE 1AGBB 2EIZB 3QZWA 4OTXL 1LQSR 2R69L 3X11A 4LNRA 4NKIH 5C0BA 5CILL 4X4XB 4WU7B 1CG9B 3I6GB 2FL5A 4BQ8A 1F3DH 3W0WB 1X5LA 1FO0H 5EFIA 1JWSA 2J8UF 4I3RH 3W39B 1IE5A 4G43A 3I6LE 1MJJB 4K3GA 4KKLD 4WV1B 2EH7L 4OD3H 4DK3A 1JZ2A 3MV9A 2JCCA 5E08H 4BZ1H 4X6BB 5TGBB 4ODWA 1IGCL 4M1CC 1YC7A 2VDPH 4GMTL 1SYVA 3B9AA 2L7JA 4GKSA 3VXQA 3X13B 4X7CC 1MJJA 4JFHE 1Y18B 4FZ8H 4YBQD 4Z76B 5L88L 1SBSH 3OJVC 4OI9A 1U2HA 4E41A 3BAEL 3S35L 4X6BA 1EMTH 4MXVF 1LDSA 1PBYA 2W9DH 5LJYH 3S9DB 4WUUA 5I16B 4V1DB 2ADIA 3REWB 3X13A 3NABH 2Q86A 1RZFL 4PBXA 4UIMB 1LK3L 1MY5A 1Y18A 4MJ5B 4Z76A 5C7XH 1BQLH 1DR9A 1D9KD 2HJKA 3BDYH 3EO0A 2X5PA 3HC3L 4NPYA 2LE9A 4DKDC 4QXUH 1EHNA 5L9DL 3SDCB 3MV7B 4XPAH 4G6MH 1JZ6A 1I85A 4LVOB 5A2LH 4P23D 4XXCA 4KXZH 3OR6B 1EFXB 3LAFA 5I16A 1CF8L 1MVUB 3J8F7 4V1DA 3REWA 2NCMA 3WE6A 4HIHB 4NCDA 2A6JB 3WFEH 3DX6B 5HDLA 1MRFH 2KH2B 4HGWA 3VG9C 4UB0L 4YDVA 2OSLB 3ILQC 4ORZC 5JZ7C 4ZS6C 3OHXB 3IU4L 3HE7B 4RFOH 3W9DB 4JY5H 1I9RH 5FDYA 1R3IL 3O3DA 2QL1A 3OR6A 1DEDA 1WV7T 2Q76B 1E6OH 1WIPA 3IFOB 3QUMA 4TRPH 4UDTB 2ZUQB 4U1LB 4QLRA 3QDHA 3P9MB 3MC0A 3QULB 2A6JA 4GFTB 4HEPG 3FONA 4K23L 1NGWB 5IEKB 2OSLA 4HC1L 1VFAA 2AW2A 3W9DA 4QRUB 1I1AD 4EDXA 4XNXH 1QBML 1FRGH 2VH5L 1MLCB 1A9EB 2OJZH 4P4KA 5ECJE 3IFOA 4UDTA 4LPVA 4U1LA 3LKRA 3C2SA 3JTSA 2P46B 4X83A 1GPOL 5DQDL 1ZGLP 2HKHH 3TWCH 3MXVH 4M93B 3GI8L 3AY4C 3ZE2E 2DTSA 4WI4A 3RVWC 2YD3A 3QHZH 4UT7H 1MLCA 1FNEB 1NBQA 1FIGH 1A9EA 5CD5C 1S7VB 4R2GD 1OT2A 2Q8BH 4HS3A 2EDDA 4K7PH 3ZYZA 4LK4A 1LK2B 3TEUA 1KIQB 1FNGA 2R2HB 4B5EA 3AREB 3NCJL 2GJ6B 3EYVB 4N0CA 1NDGA 2D0FA 4G8IA 3QIUA 1WEJL 3IYLW 1TITA 4PFEA 3EOBA 1NFIB 1N3NA 4JFDD 4G6KL 3DVFA 2EYTA 1M7IA 1LK2A 3FOLA 1G7MB 3H9SB 1KIQA 1J1OH 2PKDA 4XPGL 1U8MB 3G5XA 5B4MD 2R2HA 2OI9A 4NZRL 4JDZA 2GJ6A 7FABL 3CSYB 4CN6A 5EN2B 4NQCB 5BJTB 2LABA 1JNNL 4OF5A 3WNNA 3B9DA 5IFHL 2V9QA 2WBJD 1FLTX 3TIEB 4KKAC 3IF1A 3H9SA 1N8ZB 1U8MA 2RQ8A 3B2UC 5D1ZD 1IVLA 4XVJL 1HIML 4HMDA 2AGJH 3FRPA 2DLFH 5EN2A 5B8CC 3FO0H 5DJ0A 3UAJC 3DHMA 1I9JH 1RZKH 4JFYA 4KJWD 4PJ9B 4K8RD 4HAFA 5HYFA 3QUXB 4LARL 5EZLA 3RVVD 3QYCA 1C1EH 5GIRB 5J56B 4B7LA 1KGCE 3QUZB 5H37G 3QIWD 4YDJA 4P5KB 1J8HB 1QFWM 5GHWH 4LBEB 1RJYB 3D5OF 4H20L 3LKQA 1JHKH 3O41A 4G6FD 5HD8C 3ZKXB 3RWHA 2FR4A 3CVHL 5EU6D 3KPMA 2FHBA 1MCWM 3MJ7B 1V7MH 4PJGB 3STZB 2VWEC 3N1FC 1KLGB 4OLYL 1HINL 4OLEA 5AWNH 3HZKA 4X6FB 3UC0L 4RIRB 3QUZA 2MCPH 3QUYB 2XA8L 4KMTH 3TPKA 3MJ9A 4LBEA 5B21A 1NAKH 5I1HL 3BPCA 1RU9L 3UTSE 1ED3A 4LKCA 5J89A 1T04B 3VXRA 5FCUH 1ZWIB 5TH2B 3MJ7A 5CD3B 4PJGA 5KSAB 3EDKA 1UB5B 3E6FA 4RWHA 2P5EB 3MOQA 3VI4F 5E2TL 4MXQC 2XTJD 5DHVH 3B9VA 1NMAL 3QUYA 3F7VB 2OQJA 5CIPH 1CXFA 2QSQA 2WMPA 3IS1X 4MAYC 5MI0B 1PEZA 4O9HH 3IU3A 5GGRA 1HKLH 3MRFB 4P5TB 3PGDA 3O0RH 1PD6A 1VHPA 1A7PL 5TH2A 2HA1A 5KSAA 1JIBA 3I02A 4NBZB 4UTAH 4PJEB 3KPRE 1JPSH 3VJ6B 2H41A 4NZUH 3TZVD 3F7VA 3HI5H 4NGHL 1Z9LA 5I74B 3LEXB 3WHE1 2YUVA 4KU1A 4TUOB 4KKCD 4XBPB 1T89C 4P5TA 2QADB 1LO3L 2X4RB 5KZCD 1YEKL 2FX8L 4AMKH 1DQJB 4DZ8B 1P5UA 2J8UB 4PJAA 3V4PH 3NCCB 1BEYH 3IXAA 1X4XA 3T0WA 3P77A 3VU2A 5CBAA 1T1XB 4PJEA 3DSFH 2ZOLB 4OBSA 1A3RH 3VJ6A 1EHLH 4PTTB 1WZLA 2DDQH 4N9GA 1RVFH 3LEXA 4TUOA 1IKNC 2VDNH 1JTTA 2AJUH 4HIEB 4HWBH 3FQTA 3T3ME 5FUZL 1FAIL 4EUPA 4XHJC 2BFVL 2ITDB 3UTZA 3G08B 4B7IA 3UTTB 3QDJB 5FF6B 4C56D 1KN2H 3GRWL 1DQLL 2I60H 1SJXA 2DQGL 1FDLH 3BSZH 5I1EL 1RZ7L 5E2UL 1TVBB 4PB0H 4L3AA 2UY7A 4GRLC 1UGNA 4IHOA 1HXYB 4HIEA 4S0SD 1TZGL 3U9UB 1WWCA 2EKJA 4W70A 4OGAC 3S37L 1N6QL 2DD8H 5FF6A 1Z2KA 5MHSE 4O2CB 2VR9A 3LY6A 4DKEH 4Y2DC 2E6QA 4UI2A 1G6RH 1OT1A 4UDUB 1LP9B 1ZANL 5D71H 4PUBL 3MXWH 3QEGL 1PJ9A 4P2OD 1AY1H 3CVHB 4OLXL 4OF8A 1HSBA 3EYFA 2V2TB 4NQSB 4PJ5D 4GG6F 3QQ4A 5B38G 5IMLB 1QO3A 4TN9A 2JJSC 4KTEH 4O2CA 5DJ2B 2NXZB 1HHJB 2BNUB 2DL9A 3FQUB 2HRPH 32C2B 1HCVA 5K9OB 1BF8A 1BREA 1LP9A 2PYEA 4JO1L 3FQRB 2ATKA 3HR5B 3LRGA 1F3JA 3PHOB 4NNXA 3O9WD 4RFNC 1UH3A 3BE1L 5AZ2H 5LVEA 3WS3B 4L4VB 1MCPH 4LPUA 3H9ZA 2KUTA 3AM8C 5JTWA 1UXSA 3AAZB 3GHBL 5ID1B 4LCCA 4JPVL 1EEQA 3T3PE 2OXHA 2UZXB 1MH5A 2FD6H 4XH2B 1OGAE 3PHOA 2CR6A 3O6KH 1MFCL 4JY6B 5E4IA 2AEQL 3C6LB 3U1SL 4XVUC 4XC1H 1NUGA 4GQ9H 5BV7L 1CXKA 2FEDC 4XCCL 2VXUL 2B0SH 4L29B 1C5CH 3OAUH 3QXDB 1M7DB 2AK1H 3AAZA 5ID1A 4O51B 1ACYH 1FYTE 1U8KB 2H2PC 4KTYA 4MSWB 3VXUD 5F9JB 4H5SA 4XMPL 5I75B 2ZSVB 4XH2A 1MFDL 1OAUH 2OJEB 1T2XA 2ICWJ 2PXYC 4JY6A 1F3RB 5IV2B 2D7MA 4U7KA 4PY8I 3E3QA 4PGCA 4JHZA 1EX0A 2JK5A 3LN5B 1JRHH 3KJ4C 3UYRL 3TM6A 2WV3A 4O51A 3LOWA 1DLHB 4H8WL 1YY9C 5F9JA 1JFQH 2AJSH 3AS0A 4OF3A 1DVFC 5EUOF 3GGWA 3HMXH 1JF1A 2NY4B 4K8RH 4OZ4A 1MJ8L 3L3DB 4K9EH 4YPJA 3WHE0 4X4YA 3SDXE 3Q1SL 1E4XL 3HMWL 5C0EA 3GHEL 3MUJA 5T3ZL 4Y4FA 1A7RH 2OLDA 3BN9D 1DLHA 3OR7B 4I18A 1FH5L 4LP4A 5DEGB 1WWAX 3D9AH 5AUMB 2AJXH 4YK4C 2W65B 3VDAA 2B4CC 3QNXA 5DTFB 4RZCB 3VRIA 1AC6A 1Z5LB 1FC2D 2WY3A 1U91B 5KSVB 3VFUB 2YPLE 3V7AG 2KBGA 4LLDA 2J7LA 3TT1L 1IEAB 3HG1E 3JV4B 3V4VL 4KUCF 1RZIA 1Q94B 4XHQA 1GZQA 1AHWB 1FVCA 3RWFA 3BGAA 3FO1A 3BPLC 5EULV 1UFUA 2W65A 4OSUH 4LHUG 4M03A 4RZCA 4XCYB 5FO9B 1U3HB 1Z5LA 5LBSH 5HYSB 1U91A 2O5YH 3BIKB 1RQ5A 1BVZA 3MRRA 3N85L 1QZ1A 5INDB 4N1EA 4U6YB 4XP5L 2HFFA 4GRMA 2XQBL 1G9NL 1IEAA 4KRPC 3T2NH 3ZTNH 1ZHBB 4YFDB 3W0WE 3U82B 4Z7NF 1RMFL 1MPAL 1XF4B 4QRRA 4KROC 1JPGB 3CXDH 4XCYA 3RDTD 2HRLA 5FO9A 1U3HA 4MNHB 2NY3B 2E27L 2A77L 1NMCC 1S7TA 1XCQB 3FRUA 6CGTA 5INDA 1PAMA 1D6VL 1GAFL 3EJYC 1EEZB 3UTQB 1RD6A 4NSKB 3IKKA 5ALCH 4NCC1 2PN5A 4P2QB 5JPMA 3INUL 4JFOB 3HUJB 4MWFA 1N64H 5ADPL 1J12A 3T4YB 1H3PL 5BV7B 2VUYA 25C8H 1N7MH 1XCQA 2OR9L 4NHUA 5ESAA 4IIQB 5JR1L 4TQEH 5GGVH 4HJJL 2VDRL 2ZUVA 1EZVY 3UTQA 2DQUL 4QRQA 5DURB 4JRYD 4ODUB 3JWDH 3MODH 4WWKB 1ZT4A 3HUJA 4M7JH 2V9RA 3VMNA 4NP4L 2VL5A 2HMID 4WFGD 5CEYA 1T22B 4GKZB 1KG0A 4QO1A 4FFZH 4GS7B 4GJTB 4CVZB 3LSOB 1AKJB 4IIQA 4B0MM 3WN5B 2C1PB 1KJ3L 1MWAL 3SO3B 3BH8A 3KYKL 3MV7E 3MOBL 4L8SC 2K9UA 3MYJB 5FOBA 4OGXL 2CD0A 5IB5B 5HI5C 1Y6NR 2OL3L 2VLRD 4QWWD 1BZ7A 4IS6B 5CINH 3MJ8B 4U6TA 4JZJA 5DJ6B 2ZCKH 4K2UL 1OGTB 1A0QL 3NFNB 1Z9SA 4KVCH 2BOBA 4R4ND 1AKJA 3H3BC 2EIDA 2EH8H 5K93A 3ET9F 3WN5A 3MLXL 4MD4B 4LCYB 2GEEA 1U95B 1MNUH 1RUPH 3ZE1E 1R3KA 3MYJA 2ED8A 1GGCH 5JW5B 1EJOH 1BJ1J 1PFCA 5DJ6A 4V2CB 5I76A 1OGTA 5I2IB 1EBAA 3GI9L 1RULL 2IFGA 2F54D 3CFCH 2O61A 3IDYB 4URTB 3R1GH 3GMNA 3GM8A 4MD4A 2IG2H 5EU5B 3MNZB 2FHFA 4JQVC 4I0PC 1KCSL 5IMOB 4ZDHB 1IC7L 1TDQA 5ESQB 5C0BD 4JVWA 2NXYB 4IOFC 5CCKH 2DTML 3ZDZE 1K4CA 5C08E 3VGFA 1QSEA 4QOKA 5SWQB 3EJZD 4S1QH 3C60B 3RL2A 3TBSA 3RUGF 2B2XH 4YHZH 1T6VN 2P8LB 3B4NA 3MNZA 3MV9D 5EO1B 5KOMC 4H25A 3L5XH 4EJ1C 5IMOA 4ZDHA 4Y16A 3X17A 3H6JA 1JYVA 5SWZB 4DW2L 3CDGA 2DQEL 4GG6B 5SWQA 4Y0GA 3JWOL 3C60A 3NIDF 1JV5B 1LNUA 3QDMA 5C0GB 2GW5A 1FVDB 3HPJA 4C54A 5GPRA 2H32A 4E41D 4WVRA 1KJ2L 2ZSWB 4Y5XB 3I9GH 2GCYB 1YEEL 5TDNA 1RZJH 4L9LC 4NQEB 1IC5H 1A5FL 2B8OT 4YDIL 4MD0A 3DX9A 2CK0H 4WUUD 3V6ZA 4OLUH 4KI5F 1TQCB 2VITA 3MA9H 3T0EB 4I4WB 1BVKA 3FQXB 1UC6A 5JHDE 2OTUB 4NQCE 4M1GH 2GFBB 1HEZA 4Z0XA 1RZKC 2C3VA 4U1MB 3MRGB 3UTPE 4U6HA 5TPWL 1RPQA 5EIVA 5IHZA 2F5AH 1FV1B 4FN0A 4V1DD 5KVEL 5F7YC 2XACC 4KKBD 4HBCH 4F7PA 1CDIA 3TJHC 1YN7A 2EDEA 3WKNA 1EJ6A 5FAAA 4HAGA 5A43C 3MCLL 4W6WB 2OTUA 1H3XA 2VIRB 3C8DA 2XG5A 5E7FA 1OD7A 2V5MA 3ARBA 3ABZA 2BVQB 1QLRB 5GZNC 5A3IC 1CGSL 1MEXH 1MHPH 3UEZA 4OCRH 1AI1L 1J8HE 2CDGA 1R3LB 4HEME 4OM1L 1A6AA 3BP6B 4HPOL 4HWZA 4HDIB 4PJHA 4OZIA 1L6XA 2YOCA 5GGSB 4N8CH 1D6EB 2VIRA 4EN3C 3SBWA 5C9JB 3VDBA 3GMQB 2GK2A 2AKRB 1QLRA 4WHTA 3OXRB 5ERWB 3HNVL 1KIRA 3L6FA 2LU3A 4JFPB 4P4KD 4YIQA 4LDEB 4EOWH 4JPIA 1R3LA 4MNGA 4NRZA 1MJUL 1V3MA 5D72H 5LCVL 4RFEB 4C59B 4P99A 3HNTL 2Q20A 1IAIM 2MHAB 2X4QB 3GSQB 5F1IA 1U8IB 4FABL 1XGQB 3GMQA 5DVOA 2AKRA 2MJWA 5I19L 1TXKA 2P5EE 2X89A 2RHEA 1A6WH 1NSNL 3S6CA 4JE4B 3NTCL 4ODXB 5EC2B 4LLQA 1N0LA 1DQQB 2VR4A 2CLZB 3FT3A 4RFEA 1ZHLA 5KW9H 4GG8B 4UOJA 2P42B 4UQ3B 2X4QA 3GSQA 4O58L 2OMBA 1U8IA 5B3JF 1XGQA 4N0CD 2NR6D 2JIXB 1HHKB 4NKDA 4MB4A 4HHAB 5HI4D 3QIUD 4LQFH 1PSKH 3KLHD 3MRLA 4UQ2B 1G7HA 3RPIB 1F4HA 3V0VA 4ZO7A 5E8PB 4GUPA 3AROA 4UNUA 4UU9B 2APFA 1BFOA 5EBMB 4RWYH 4XNMB 1AXIB 3SE3C 1HYSC 4PRNB 2VC2H 4TUJA 2Z8VC 5DRXB 1DQQA 3H8NA 5MP6L 2Y72A 5TE7H 1UM4H 3WD5H 1ZT7A 4ZXBC 3MLRH 2GJ6D 2QHRL 1KJ2B 3TFKA 1S7UA 2J8UE 3PNWB 4IDJL 4ODVH 1TNNA 1KIPB 1FSKC 5EZOL 1CZ8L 4WI3A 3VWKC 4MCYB 5DRXA 3H9SD 1QOKA 3F5WB 1T0NB 3MREA 1A9BB 2D31A 3VXMB 4Z7OE 4RX4A 4QTHA 5ANMB 3PNWA 2NX5A 1JYXA 3QEQA 3JZ7A 4AY0A 3UTTE 1CICC 3UCRA 1P2CB 1LEIB 3T0BA 2H2SD 4W6YB 4CMMB 3OKDB 1UQSB 5F3HB 1C12B 3NIGF 3WFHA 4XNQA 2LU7A 5AYUH 4O2FA 3CXHK 5I18H 5JW4R 1U0QA 1YZZA 4OZGF 3QEUB 4MXVE 3OXSB 1I7TA 4QT5B 2DLIA 2ZPKL 5ANMA 5HJ3B 1D5XB 2BMKA 4EI6A 4BFEA 1XMWA 3W2DL 3QI9B 5TQ2L 2VAAA 1P53A 1NCWH 4RRPG 2IBZY 5ID0B 1QP1A 4QXGH 2CRMA 4CMMA 4D3CH 2HFGL 1QFPA 5HYQA 3QUZD 2WINB 3KYOA 4M61A 3L5JA 4HJGA 2R4SH 3R4DA 2D03L 5C0CB 1BQHA 5J13C 3THML 3OXSA 1AO7B 2W9EL 4DAGL 1VB9A 2KQMA 3HZMB 1I3GH 4GXVL 5HJ3A 3VXRD 4JZNA 5IROA 1SEBB 5ID0A 4OKVB 4ZFFB 2YD4A 1S5HB 1R24B 5C3TA 1OWRM 5HDQH 3C5ZA 3MGTA 1CFSA 1U42A 2LAGB 3QUYD 4PRPE 4DKFH 3DMMB 5DD3L 5FDWB 1AO7A 1TJHH 3ZT7A 1KTDB 3HC4H 1JN6B 3HZMA 3D18B 3ZZ1A 4L4VE 5GS3A 2I26N 5KSAD 4E0RB 2PTVA 3EJJX 3BHBB 1HXMA 2CLRB 3QDAA 5EH1A 2VN7A 4QRPA 2O5ZH 3T0XA 1CGXA 1JMXA 4GBXB 5F89B 5I6XB 3LRSA 3G5ZB 1KTDA 5EU3B 4P5TD 4KV5F 3DX8B 4LLWA 5HYJA 4JN1L 2VDOL 2V6HA 4NO0B 3RVUD 3RUGB 1OSZB 3WBDA 4OFYA 3V9FA 4JFZH 4G9FA 5F1NB 4M5YH 2BY2A 4ODTH 2R0KH 5F89A 3G5ZA 3VRLF 5EU3A 3QUML 5EBWB 3DX8A 3VFWB 5J3HC 1AGDB 3OZ9L 1CD8A 3ILPB 3MNWA 4JREC 3SKJL 3VXSA 1J0YA 4Y5VA 4U1JA 1BZ9A 5FV1L 2JELH 5EU7E 1NGXB 2VDML 2VLLB 4XVTH 1VGEL 2A6DA 3FHAA 1OP9A 1EAJA 5D4QA 3VE0B 2ADFH 3VFWA 2DQDL 4DN4H 4TOYH 5GRXG 4P9HH 2V5SA 4K3JL 1GOFA 4IJ3B 5TF1H 2B1HL 1A2YB 1SBBA 3EO9H 1S9XA 1PGRB 2NTFB 2GAZB 3NH7H 4L3EE 4DQOL 1BIIA 1G7LA 1QTYT 1QPPA 3HB3D 3MROA 3PWNA 5CLTA 5EA0L 3MLVH 2XN9A 3M17B 4PJAF 4YXLL 4ZUSB 4MAUH 4NZTL 4KDTC 4X99A 4GO6B 4W6XB 5IEHB 1A2YA 4UBDD 1NGPL 3ZKMC 3CFEA 3GIZH 4FG6C 1WAAF 4Y8AA 4JRXB 3QO1B 5TE4H 1XR9B 2PYED 1TPXB 4G42B 1YYML 3UBXG 2N1KA 4ZQKA 3BUYB 1FBIL 2FSEB 1CT8A 1CBVH 4OGYL 4PR5B 1KLUB 1LDPL 3ULUH 2A6KB 3SGKA 4M6MH 4OKDA 1PEWA 5KJRH 1T7YA 5IEHA 1TETH 4FXKA 3LS4H 5HGDA 4KKCC 2Z31B 5DI8B 4OQ1A 1T1YB 4LRIA 3QO1A 1LEGA 3DVGB 3TO4B 3LH2L 5FO8B 4RQQB 4M02A 2DQTH 2BNQB 2FSEA 4ZOAA 2EE9A 5FO7B 4G8EB 4TNWK 2GK0B 1WCQA 3IFNH 1DTUA 1U93A 1F58H 5HHXL 4P2QE 4M9OA 4FZEH 2IANA 2Q3ZA 2HLAA 3EYQC 4Z9KB 4YDKL 1DP0A 3DVGA 1F4YH 3TO4A 2DN7A 1CE1L 5FGBA 2R1WA 4JB9L 3VI4E 3LN4A 3T77B 3I84A 1L7IL 4Z18A 5FO7A 4FQHB 4PJXF 4Q7DA 2FLBT 4A2MA 3W81A 5IWLC 3BKML 3WO4B 2ILLA 1CI5A 1QHOA 1R0AH 2ARJA 4G5ZL 4QGTA 1O7SA 3IXTA 3JWNC 3HHRB 1T0MA 3NMEA 3SCMB 4RGOL 5FB8A 4YUEL 5JOPD 1G9MH 3DV4B 4LSVH 3FO9B 3A67L 4FQHA 4OCSL 2AJYH 4APQB 4N0UA 3VFGL 3MV8B 2R29H 1E28A 3U9PH 2I9TB 1Q8MA 4MMZC 4Y4FD 5F7DA 1SEQL 4Q97A 3HC3H 3HE6B 2DLHA 4GW5B 3SCMA 4NO2B 4RMVA 1F4XH 4M62H 4LVEA 1IM3A 1T1WA 4TULL 3P4NA 4KQ4H 2IALB 3FO9A 4NO3B 5T3ZE 1AH1A 2ICWB 3BOVA 5I15L 3RX8A 2VXVH 1SM3L 1YPZF 4P48A 2I9TA 3MJ9H 3WNPA 1M71B 3NVQA 2Y5TB 12E8L 1LWRA 4GW5A 2YPVH 4IRSA 5SWSA 4Y5YA 3O8XC 1D5ZB 4FQPA 2Y36H 4CGTA 2IALA 1FE8H 1TJGL 2D2OA 3L3HA 1ZA6A 4YHOH 2Z8WC 5GJTH 5EDXA 3C08L 5T33L 2BVOB 4P4RA 4OZGB 3X3FL 1JPFA 2F53B 3T2QA 4M48L 4FQCH 1BP3B 4YAQA 4K94H 4J23A 1L0XA 1S9YA 4PG9B 2DQFB 1DBML 4QRRD 3TA3C 1TNMA 1U3HD 2DWEA 2P7TB 3QH3B 5IB3B 2D7QA 4XP6L 3UX9B 4ONFL 1I8MB 2WP3O 4CVUA 1SY6A 1ZLSL 1MAKA 2BVOA 4ZOCA 3OKKA 4MJ6B 4X9IA 5SWZE 5KAQF 3DVNB 3D69B 2WQRA 3RPKA 1X6LA 3RY6A 5KVDL 3EOAB 3BRDA 1JNHB 1S9VA 4GG6E 1GSMA 5I1LB 2F58H 2R2BB 3IDMB 3VRJB 1GGIL 2R2EA 2NY3D 2P7TA 3FJTA 5H2BB 2VLJA 2XKNB 5IB3A 5FHBL 1I8MA 1RJZB 5D5MF 2R1XB 1JGLL 1MFEL 1Q9KB 3KPOA 4MJ6A 2VDLH 4NQEE 1I3RB 3DXAB 4R8WL 4JFXB 4LEOB 3F7PC 5KS9F 1G9EA 3U2SA 4EUPH 3P30H 1RY7B 3T0EE 3CX2A 1T6WA 3AXLB 2NW3B 1EH9A 5H2BA 2XKNA 1RJZA 4O4YH 4U1KA 1DLFH 2CIKB 4KC3B 4X5XB 4GXUM 5CKGA 4OZHA 2DWDA 4J1UB 3FCTB 1KT2B 5IG7B 1IGYB 1AGCB 5HPMB 4WY7H 1PG7H 5HXMA 2X7LB 4MXWL 1KCRH 3H9YA 5FYJD 4H26B 5HHMB 5F6HJ 5HHPB 4OI7A 4JPKH 1EPFA 1AKJD 4QXTA 1K2DB 2IPTH 1A14L 1CGUA 2CDFA 4XBEH 2PCPA 1K8DA 4GKNB 4AENA 1UKSA 4N0YL 2DRUA 1EEYB 1IGML 2RCSL 4NM8L 3DRQB 5IG7A 2VABB 3PWPB 3O4LB 3JV0A 3HZYA 4H26A 2XZZA 3I50L 5HHMA 2J1KA 4XRCB 1C8PA 5HHPA 2J8OA 5D7IF 4FFYH 1K2DA 3VGAC 5FYKL 4HPYL 5EUOE 1ZKAA 5DUML 1F90H 4WW1B 5D1QB 4CW1A 4AEIH 1EEYA 5KTEH 4K7FB 5DUBA 1OSPH 1BWWA 4WTZG 2PO6C 3PGFL 3WLWD 3PWPA 4OZFB 4BFIA 3I75B 1QSED 1NMBH 1LEKB 3QWOB 1RIHH 4QOKD 4XRCA 1MOEA 1FPTH 4O00A 1XH3B 2P1YA 1DEEB 3MO1B 3GDBA 5GRJL 3HR6A 1F8TH 5D1QA 4WW1A 5CHNB 2JB5H 4YGVB 1QKZL 3F12B 4JAMB 2F74B 4Y16D 2YPKB 2NXYD 2AK4B 5FCSH 4Q9QH 4OZFA 4PJFF 5F9DC 1LEKA 3FB5B 4NO5B 1KTLB 2CKNA 1UCTA 5EORH 3C60D 4QTIL 5CEXB 1XH3A 3LDBB 1NCAL 3MO1A 3O3BB 4PV9B 3QDMD 3QA3B 2FJFA 1KUMA 3PDDA 1ACZA 2F5BH 1U3YA 1ZMYA 2AI0L 1RUAL 3H3PH 4Y19B 2F74A 3K2UH 2AK4A 4MQTB 1MFAH 3MRNB 4XPBH 4R26H 3BKJL 1A3QA 3ARXA 1K85A 1KTLA 5HSFA 4UIKL 5GISH 1A6ZB 1NGQL 5MERB 2BJML 3QJFB 4HZLA 1YA5A 3NPSC 4Z7NE 1AR2A 1U8HB 3AY4A 1N6UA 5CAYB 3EBAA 3ARTA 4IOIB 3MPCA 1DSFL 4HIXH 3B5TA 1IC4H 3KAAA 4OCYL 3U0TA 4F58H 4UINH 2Y9RT 4ZFGH 3BP7A 1MUJA 3ES6A 3WO3B 3CAFA 1EXUB 1NCDH 5MERA 3QJFA 3VXME 4JGJA 1H15B 4BM7A 1URLA 1U8HA 4FQIL 3IDGA 1CGVA 2HLFD 2XNAA 3ARBD 5CZVH 4CVXB 3MQIA 3GUTA 5J0BA 5CJ8A 1N59B 3NAAH 1C16A 4PJXB 2DJ4A 1C5BH 3LB6C 3SDYL 2D7TH 3QXTA 2DBLL 4M6OH 5FM5O 1RHHA 4AIZA 4HUUA 1UWXK 4KK8D 4F8TA 5I1EH 5IHUH 4LSPL 5DT1L 4XZUA 5B8CB 5IQ7H 2NY7H 3AB0B 2E6PA 3VGEA 3E6HB 1F6AB 4ENED 3VGBA 2CUMA 4HXAH 5IIEB 1WT5C 5D7LE 3VD7A 3ZYOA 1II4E 1N6QH 4WEMB 5KSUB 4R4FH 4E5XB 2HT4D 4RMUA 5C0CE 1WCBB 1TVDA 3U7WL 4X8JB 5A2JH 4PUBH 1LO0H 1W72B 3QFJB 4YC2B 5B8CA 1J5OL 2DI7A 1CFQB 4GAYA 5C09A 3E6HA 3FZUC 4Q9RH 4QRTB 3BDBA 1X5ZA 1Y6KR 2X89D 2GSIB 1KTRL 3VH8A 4WV1C 3T0VA 4K55A 5FA3A 4E5XA 3G9AB 2I07B 3K4DA 1YPZB 4JKWA 4PP8C 1RK0B 4X8JA 1NAMA 4FOMA 3BXNA 3F7YB 3MLYL 3QFJA 5JPNB 4BA8A 2NW2B 5SX4I 1YJDC 4M7KH 2AEPH 4X7EC 1CFQA 3MMEA 1HDMB 4QRTA 4YXHH 1KLFA 2GSIA 1X7QB 2JB6B 1IAIL 4WFHD 2I07A 4GW1A 4NQDE 2YA1A 5E4EB 3NOIA 4EQ3A 2CMRH 4HKXB 2X4TB 1I85C 4OUUB 4AH2B 3TFKD 3TYGL 5CMAA 2YWZA 4MX7B 4YHKL 4ZUWA 4JRWA 3U1SH 1UKQA 1YEHL 1HDMA 1Z3GL 1P7QA 3RUGE 2GJZA 4UILL 4ELMA 2JB6A 3NIFF 4MXQA 1FIEA 2YEZB 2VLRE 4U0QB 4MAYA 2F8VA 4M43H 1WZMA 3SDCC 3IJSA 3P0YL 5BQ7A 4LVOC 1XR8A 4P3CH 4RX4D 3GSVA 3LKOB 1B90A 2DQJH 2NX5D 3QEQD 3NIDE 2Z4QA 3U7YL 4JQXC 1FORL 5C0NC 4P9HC 5HI3C 5JORB 3M8OL 4F2MA 4OD1L 1CVSC 3WXVL 2QQQA 5BW7C 3T65A 3V7MA 4BH7B 3HE7C 2G9HA 3VFMB 1XGUA 1KPVA 2NY2C 1T89A 1OLLA 3WIHA 4BELD 4I2XE 8CGTA 3RJQB 4KI5E 3LKOA 5BRZA 2ZUQC 5TQ0L 1T2JA 2FX9H 4NUJB 3TH2T 3KPNB 3IAPA 1FL6B 5J12B 4J8RB 5MEPA 3AS2A 5J11B 4HG4K 5E2VL 3S35X 5M95B 1JWMB 4Y1AB 1G7IB 4BH7A 3BEWA 3T2OA 2CLVA 1NC2A 1IKNA 4BUGA 4XNYH 3BZ4B 1CXHA 4L8DB 3MRCB 3ULUC 4ZSOA 3BKCH 5IMKB 4HKJA 2YMXH 4P59H 4XWOC 2VLKB 5E9DA 1A6PA 2AQ2A 3V79C 4Y2DB 4JRXE 1JHLH 4M93C 1JNJA 5CWSA 3GBMH 3ARRA 3D39A 3C5ZD 4N0CC 5HHOB 5HI4C 5IB2B 4JHAL 3KLHC 4WW2F 4GRLA 1AO7D 5CKAA 2BDNH 1NCUA 5JDSA 5DRNB 4HS6A 5C0IA 5D2LF 5I0DA 1NCTA 3VW3L 1P7KA 4TTDD 5IMKA 4ZTOH 4D2NA 4BSWB 1MIEH 4NN6B 2VLKA 2C5DC 5ILTH 2A1WL 1BFVL 3MRQA 1ZOXA 3IVKB 4Y2DA 3AREC 3EW3B 5EUKB 3T4AB 4QRPD 5HHOA 3V4UL 3GM0A 4ZG1A 2BNQE 5IW1B 5IB2A 1Q9OA 1T2QL 3MZTA 1EAPB 1KFAL 5DMIH 3TBTB 3ARDB 4RFNB 3IFLH 1BGXL 1BQUA 2X41A 4HQQL 1OM3L 4RAHA 4OIIL 4DTGL 5HYJD 3KPQA 3HRZA 1IGIH 2G60L 2R0WH 2BVEA 2OX5A 1NH6A 5C8JB 2JJSA 5CP7A 2B5IB 3IVKA 5IJVA 2Z35B 3W9EB 4OFYD 2VRAA 2Y06H 5J1TC 4G9FD 4PJCF 3REVB 3WL9B 3T4AA 5DC9B 3UP1A 3P9LA 3WHXB 4KTDL 2AEIT 2PF6A 2BVTA 4PGEA 3OAZK 3T8XB 5SV4A 5GZOC 2A73A 5F7EL 5ADPH 4LEXL 1CFVL 4NNYA 4PJFB 4TSAH 3K80A 3WFCL 4P3DB 1MCWW 3ZE0F 3X14B 1OL0A 2XY1A 3AM8A 4JR9L 1QFWI 5L2JA 3EFFB 4GQPH 2Z35A 3M1BA 5CJXC 3W9EA 3VXSD 5B3JE 1GHFH 3REVA 3ZHKA 3UZEA 4IRJB 4RBPK 4S1DC 1AQDB 4A6YB 4PJ9C 1B4JH 1KB5L 3QUXC 1JWUB 3SKMB 1UB6B 4JPWL 4DOHB 3MV8E 3GMRB 2VDKL 5IBTL 5GS0H 3QUZC 3BVNB 1ZAGA 1DCLA 2X1XR 1IEHA 3PWJB 4FMFA 3V52H 2UUDK 5JUEL 1JF5A 3ZKXC 43CAA 3GK8H 4HFWA 2EE3A 3O45A 1S8DB 4HCRA 4A6YA 3IFPB 4WUKH 3S88H 1RUKL 4FQJH 1JWUA 2XN9D 2PXYA 5C0AB 4AT6B 4KUZL 5JW4N 1R5WA 2V5YA 2NY6B 1QEWA 4JG1H 1U8PB 5I8CB 3L3KB 5EOQL 1MRDH 5IF0B 1CDHA 4Z7VA 4JLRB 4ORGB 1LO5A 4GRWF 1DVFA 1S3KH 1S8DA 5IB4B 4OAWB 2X4OA 2OP4H 1JGEB 5E7BA 1DFBL 2VDQL 4J3SA 1U8LA 1J0JA 4PJIB 2HTLD 3P2TA 4GMSL 4PS4L 5LGHL 3HC0B 3NIGE 3TBVB 3NZHH 1GZPB 2OCFD 4OZGE 4YHYB 2F53E 3L3KA 2A6IB 3TC9A 4CDHA 1VACA 4AK1A 1RIUH 4GSDH 5IF0A 2Q7YB 3AUVA 4P5TC 2AXFB 5DHYA 5IB4A 1AP2B 1NBZB 4J3WA 2CO7B 3LMJH 1W0WA 4G9DB 1OP3K 2A9MH 4XI5D 4PJ7F 5HVHC 4X5WB 1YMMA 4AL8L 3HC0A 2DQCL 1JZ7A 2AV7A 4UUJA 1GZPA 2RB8A 4KHTL 2ICWI 3RWDB 5F6IB 2A6IA 1B0GB 2DIAA 5I74C 4KRPB 1QACA 2FCBA 2DQHL 2X9WA 2DS4A 4LU5L 5E5MB 2IAND 2PYFB 1A02N 2QADC 4KPHH 3TO4D 4LF3B 1AP2A 1MCJA 1P1ZB 1DBBL 1R3HA 4G9DA 5I17A 4X80H 4X5WA 3HLAB 3VFOA 1BM3L 5CUSH 3MJ6A 4WRLA 5L8KB 3DRTB 1GYAA 4NC1E 3JXAA 3KXFB 3LS5H 1YEDB 1CDGA 5ISZB 3DXAE 5TDPB 1H0DB 5E5MA 4FA8A 3K2MC 3UJTL 3ECBB 4LF3A 4M5ZL 4FFVD 1N5AA 2Z93A 3S4SA 4DJMA 1P1ZA 5JDJA 3KWWA 3CIQA 1H9VA 3AMKA 3KG5A 3CFDB 5L7XH 2A0LD 2HT2C 2WWKO 3L7EB 4Z8FH 5I30H 5I1IH 4PLKD 3QJHB 3GB7B 4KY1H 4TSCL 1AGEB 5T3XL 1MY7A 3CPLA 2P5WB 3SCMD 1LO2L 1CLYL 1KB5B 3RX7A 1BBJA 1L6ZA 4X7FC 1J7VR 2W1NA 3MLWH 5CGTA 3VFPA 5HVWA 4E42B 1EO7A 5EZJB 3GSWB 3I2CL 3L7EA 2R0LL 4ELKB 3GJFA 1FZKB 3GSNB 3GB7A 1FFPA 2GT9B 1UA6L 3VRLE 4C4KT 5GJSH 5SX4H 2VLME 1AGEA 4NQUA 4U1SA 1N0XL 3QISA 3O4LE 3ULVF 4IRSD 3RNKB 4OCWL 2EZ0C 5DO2D 5DUPL 5SWSD 5T1LD 4F57H 1I8IB 4HUWB 1LHZA 3B8YA 2E7HA 4HIJB 4D0CB 5DJXA 4E42A 1A7OH 5EZJA 3IJHB 1F13A 2NXZC 1ZLWH 4LNVA 3DIFA 4ELKA 3IDNB 2EDBA 1FZKA 3K1KC 1CIUA 2GT9A 3CC5B 5DDHA 1MCFA 5CGYC 4L8SA 3L9RA 1KACB 3RWGB 1YN6B 2CKBL 1M7XA 2VXQH 3SKNA 3NCMA 4P46C 4M7LH 1D7FA 3B6SB 3RNKA 5E00A 4BSVA 2FIKB 3ARQA 3KPLA 4F9PC 5LQBH 4D0CA 4M6NL 3BMWA 5E1AA 3IDNA 3WNLA 3RNQB 1EFQA 4JDTH 4MJIB 4UMGA 2A83A 4J3OC 1HQ4B 4Z7UA 5GGQL 1I1YB 5D7SL 1TCRB 2NYYD 3C6LC 3QCTH 2X70A 1K6QL 2QSCH 1KXQE 2FIKA 4JFEA 3CH1A 2QQNH 3ISWA 1JPST 4FQQB 1HH6A 1WLHA 4UT6H 5L2KA 2LTQC 4MNQB 1WAAE 2VLJD 4J3UA 3RIAK 3P0VL 2FBJH 3HTLX 4PREA 5I75C 5GRUL 4Y19E 4JQVA 4I0PA 4JHBA 4NT6A 2N7AA 1YNKL 4DVBA 4Y2OA 3WIFA 2BHZA 4JEGB 3VXOA 5C2BH 4O02L 1TZIB 2CRIA 4Z0BL 1PDKA 3TBYA 4E9LA 1M6OB 4Z95H 1HH9B 5JXAH 4ZTPL 1HQRA 3BPOB 2VISA 1Q9LA 3TIDB 2M2DA 2AV1A 3RAJL 3LPFA 3U36B 2YRZA 3JTTA 4JFFB 2NY4C 3TCLB 3LZFL 4Y4HB 5EU7C 5B38B 3L3IA 2X4SB 3NGBC 1QSFB 5LAXB 4M1CD 5AYQA 1I9IH 2X1QA 2V2XB 3GSXA 2UWEF 3OB0H 3RGVB 2GIYA 4XPHL 5HVFB 4S0UC 1OARL 4CNIB 2XYCA 2DQIH 4I5BA 3D0LA 1EGJL 4JN2B 2DYPA 5I73C 1IL1A 1CE6B 2Y23A 3KHOA 3KR3L 5FHAL 1S5IH 4R3SA 1T1ZA 3TIDA 4XT1C 1RIVH 1P4BH 5HHQB 2WUBH 4JFFA 3TCLA 4Y4HA 1PLGH 2X4SA 3MR9A 4L9LA 1SHMA 5B39G 5LAXA 4QNPF 4LLUB 4PJXE 3ZHDA 1GC1H 5IMMA 4QY8B 3IAGC 2BSTA 3V5HA 3O11B 3O2VH 3RZCB 3FFCB 4KK9C 5HHMD 1AD0A 3QG7L 4MA3A 4TNVF 1CE6A 4GW4B 1PG7W 1AHWC 1B2WL 4YX2L 1NL0H 3LKPA 2P47B 3BPNB 3K3QA 4NN5B 1SVCP 2IC2A 1VFBB 2XV6B 4FXLA 3DUHA 3O3EA 4JHWH 4LLUA 3PWPD 4QY8A 2BVPA 4ISVB 4WGVB 1U6AH 1MHEB 4KRLB 5F70A 1Q1JH 1XGTB 5DD5H 5FYKE 3TJHA 1E4KC 1A3LH 2NZ9C 1IGFL 4JQIL 4OJFL 5C0RH 3ILQD 5JZ7D 2XWTB 4ZS6D 2CKBB 4R90H 3ULVL 4J6RL 5ACZB 1NQBA 2W9LA 3VA6A 2NY3C 3UMTA 1KPUB 1QFWH 4G3YH 5BZWA 1QLEH 1YPZE 1NFDB 1F11B 1XGTA 2Y7QB 3BFOA 5DD1L 3WSQH 3TPUB 4HT1H 4UAOB 1SQ2N 1WICA 3BT2L 1P84J 3MRIA 2XWTA 1KNOB 1YMHB 4EN3A 5T1DL 1YEGH 5KSBB 1S7XA 3QO0B 4S1SH 4N9OB 5ACZA 5LWYL 4ODSL 4K3DL 3FQNB 1F42A 2AK4D 1ZVSA 5ENWB 3G5VB 5BV7C 4QXWA 1QLFB 2XG4A 1J1XL 5IESH 1F11A 3OKLB 4N8VA 4FXGB 3IS0X 1R6VA 1MI5A 3U0WL 4KI1A 2ZOKA 1YMHA 4WWKC 2VYRE 5KSBA 1E4WL 3RVWD 3SN6N 2UVFA 4GS7C 5CD5D 5ENWA 4PJ7B 3G5VA 2FJHB 1TJIH 1OAKH 1UACH 5T5FH 4H8WC 3STLB 4BH8B 1MSPA 1VEOA 3QR2A 3E8UH 3E0GA 4M1DH 4PLJC 4FTVA 5EBGA 1NCCL 4QHMA 2FB4H 1AXSB 4LPTA 2FX7L 1I1FA 5JXEC 4X6CB 3SE3A 4OV5B 5D5ME 4YBLB 2IMMA 2R0ZL 4G7VL 4Q0XH 3QDGB 4J3XA 1FFRA 3ZO0A 2E5EA 4AJ0A 3ZKQD 1S9WB 1ONQB 1Q0XL 2IQAB 4ZXBA 1UM6L 5KS9E 3PL6B 5ICXB 4XC3L 1AXSA 5MENA 5LXGH 1B3JA 1KEGL 2FGWH 2A74A 4YXKL 2IPUG 4LGPB 1I1RA 5IBUG 5IBLC 4F9LC 1BX2A 3IDYC 4Y1AE 2P45B 2XFXA 3VFSB 4ZAKC 3VWKA 4WNQB 4KKAD 3BW9B 3A6CH 3QNYA 2Q7NA 4MDIA 3B2UD 4NYLB 1IAOB 4UT9L 2IQAA 3B5HA 1FCCA 1D5MA 5BMFH 3PL6A 1A21A 5J57B 2A9NL 4X0KB 3UAJD 2XY2A 5KANI 2XIDA 3RHWK 3W11C 4AEHL 4F7EA 5HYIA 2AABH 4XB7A 5C09D 1A7BA 1CICA 1IGJA 1KN4L 2L7UA 3PHQA 5EU4B 3A6BL 4YDLB 4YHNA 1SY6H 1INDL 4ZO8A 1G9NC 4J4PC 4GT7A 1XF5A 4PRIE 1IFHH 4AG4L 5CSZB 3ARGB 2ENSA 4PBVC 2ZUSA 3P9WB 5HD8D 2J12B 3QFJD 1QQDB 2FO4B 3QBTB 3GO1L 1YNTA 5D7IE 5EU4A 2IQ9L 4MHHG 3CLEL 4H1LA 3EOTH 5I66B 2QKIA 1FJ1A 1G7QB 1FNSL 3QZWG 3WDHA 5CSZA 2LVCA 4Y5XC 1MCDA 3L3OB 1XIWB 2YK1L 4KJYB 3EYSL 4X5LA 1VSCA 4EBQL 2YKLL 3RTQB 2R23A 1TQCC 3T0EC 3QQ9C 3QXVA 1P7QD 4LCUB 1U92B 3OAZH 5I66A 4U1GB 3WYRA 4K3EH 4MXQD 3UO1H 5HHXH 1V7NH 3RY5A 2ZKHL 3VD9A 1FG9C 2I24N 4UNVA 4MAYD 4D0DA 1UH4A 2QHLA 1ZGLB 4M7ZC 1CE1H 4LPCA 5T1MA 3QWQB 4JB9H 4PJFE 5DJCB 4BQ9A 3WKML 1KPRA 4FNLH 3RTQA 4RBPH 4TSBL 3TNNB 5IT2L 5GS0C 4Q6YA 1LGVA 4KAQL 4WDIB 1CK0H 3DX7B 1AD9A 2YD9A 1FFOB 5JLZB 3PQYE 1P9MC 3GJEA 2ICCA 5D7JB 3RU8L 1D5IH 3NA9H 3MLSH 3SE8H 4PG2C 4POZC 1MAMH 5IFAL 4DOHE 5DEFA 1IT9L 3TV3H 2C3GA 3SE9H 3HPLB 3TNNA 5BRZD 4LCWD 3R06B 4WI8A 4XPFH 5F9WB 3QNZA 1KBGH 4JREB 2WLZA 3HAEA 1FFOA 4LLYB 2VXSL 2VB5A 1A6TB 1KB9J 2FZ3A 3CFIC 4HUNB 4PJDF 2XZCH 3SDDB 5ICYB 3HMXA 1YNLH 1NC2D 2C4FU 1KCLA 3HFMH 1WF5A 4JKPL 5C0AE 3FOMA 2R8SL 4ALAL 5FYLL 4JG0H 1VA9A 1Q72L 1F45A 4XHJD 5I15H 2Q8AH 1RURL 3CUPB 5E9DD 3QIBB 1I7ZA 4ODHH 4RAVB 4ZNEE 1ZTXL 3D39D 1UH2A 4X6DB 4Q6IB 2EDKA 4G8GB 2Y6SC 3ZLQC 1DN0B 3CU7A 3LPGA 5I8EA 4GRLD 1JGVH 4PJIE 4YE4H 3LV3B 5F71A 3DGCR 3FQWA 4OZFH 5IW6B 1KELH 1GGBH 3QDME 4YNYB 4YPGB 4OGAD 5E70A 2I25N 1FGNH 2EXWC 2VLKD 1W8NA 1IKFH 1F6LL 2X4PB 1MCOL 1YEJL 4Y2DD 5BVPH 4NRXB 4M48H 1UWGH 4Q6IA 3PWVA 3DGGA 1TVHB 1ULVA 3UJIH 3BKYH 2WANA 5GGUB 4LLMB 2X6MA 5IW6A 5IQ9A 2CUIA 5ICZB 1BJ1H 4KDTA 4YPGA 4XP6H 3SGEI 1F6FB 5DRZA 1PZUB 1S7SB 2ZUXA 2BC4A 3S98A 1T4KA 4S1RH 4JM2B 3BUTA 4U6XA 1EO8L 2XT1B 2W0FB 4BZ2L 4DK6A 2RBLA 4ZPVB 2FHCA 5ICZA 3KXFE 4C83B 1NEUA 1H8NA 2HN7B 1X5JA 1OP5K 5ISZE 3OAYK 2W0LA 4JDVA 2HTKC 3ESUF 3HNSL 3SEPA 1MFEH 5T5NG 5KVFH 1PKQE 5F7NC 1MCRA 5A2KH 3CSPA 4JM2A 3ZHLA 4Z7WF 3MBEB 1T03H 2W0FA 1IM9A 2FEEL 3RY4A 4XVUD 4WFEE 3WFZA 4X8XA 2ZUWA 1GCFA 3CH8A 1RZGA 2HN7A 4DGYL 3FL7A 3OB8A 1F97A 4MLSA 5T1KB 2FEDD 5D70H 5AEAA 4LSUL 3FO2B 5H94B 3WUZA 2H2PD 4L1DA 2P5WE 2EDRA 4XMLH 3H0TA 5TF0A 1GH7A 3LQZA 3QI9C 3PWUB 3WXWL 3BMVA 2PXYD 4U3CA 4XCFL 1IQWH 1UCBH 4FQLH 1QYGH 5IWLA 2DMKA 4JANB 1AXTL 4IMLB 5H94A 5DK0B 2ZUUA 3VXNB 3DYPA 2APVA 3D85B 2I9LB 1YY9D 4G8FB 1I7UB 2IGFL 1DVFD 3FRPG 4QCIB 4TTDC 3SGDH 4M3KB 1FL3A 5EPMA 5FYJU 3MRKA 4NJAH 3PWUA 4WFFD 1T7XA 1IGTB 3FB7B 5CP3A 5IR1A 3IJYB 5DC0A 1OAYL 2YXMA 3D25B 4JANA 2XI9A 4CAGA 5DK0A 1FC1A 4PJ8B 5CJOH 2AJVH 1MAJA 3DMMC 3VXNA 1NAMH 3GMPA 1W72H 5I1AA 4GAJL 4X9GA 5BS0B 2HWZL 5GXBB 4EDWL 1IGTA 4XPTL 2VZ1A 1DBAH 1YMMD 4MJIE 5IW3A 1L7TL 3OG6B 3ROLB 4EI5B 4MZ3A 3MRBA 2Q87A 5CBEB 3OKNB 4GBXC 5HHVH 5FKAB 5I6XC 1N5YL 3KPPA 1I7RA 5IGXL 5D8JL 5DJAB 3VFVA 4DGVH 1DBKL 1I8LC 2IMNA 5BOZG 2NNAA 1DBJL 3UTSA 3O8XA 3RWIB 1GIGL 1ORQB 4CMHC 5DR5H 4MNQE 2Y07H 1ZHKB 4NRYB 4OCMC 3SQBA 1XF3A 2I5YH 3MLUH 3MCG1 1X5FA 3TA3B 1ADQA 3CFKB 1BD2B 4U6VH 4X6EB 3U4EB 2ESVB 5CJ5A 5GRYA 4EI5A 2BSRA 4FP8L 5I1CL 3KPRB 3RI5K 3O2DA 4CKVX 4J3TA 2RR3A 3WIHL 4KRPD 1A7QL 2D3VA 3U6RB 4UTBH 2DOCA 5DJAA 5DQ9B 5J1SC 5D2LE 1JTOA 3GSRB 5E8NA 1H3GA 1FHGA 4P5MA 1I75A 1ZHNA 5CJBA 1KENH 4KROD 4YO0B 3BEVA 4NRYA 3TA3A 4FQ2H 3CFKA 3QEHA 3EYOB 1CL7I 1HZHL 3KPRA 4XWGL 1NGQH 1C7TA 1ZEAH 3ZYIA 3EJYD 1CWVA 1QSFE 3LD8B 1JF6A 4LGRB 5DYOB 3GSRA 1JZ4A 2X2YA 5K9JH 5I8KH 3SJVB 4NDMB 4KI5C 1NDMA 4PRDA 4YO0A 2HVJB 1UXWA 1ZVYA 3KJ6L 1LD9A 4PJCE 1QRKA 2P48B 1MLBB 2PNDA 3G9VA 2K7QA 1YDPA 5T3XE 3X12B 2DM4A 5E94A 5MEQB 2UZIL 3C87A 1UM5H 5I1JL 3PWLB 4X7TB 4EXKA 1KXTB 3LIZL 1JNLL 3FFCE 3ZE0E 2P24B 2KDGA 4LAQL 5JO5B 5F9OH 4EUPG 5AZEL 2NY1B 3U0PA 3ARFB 3MRPB 4FQXB 4TVSa 1TPXC 2AAVA 3QXAB 4HF5H 3X3GH 1QUNA 3TJEH 1O7VA 2R56L 5JQ6H 5HI5D 4X7TA 1XZ0A 3GKWH 4LPXA 5J8OA 1C5DB 1Z6JT 1WZKA 1G7PB 3TN0B 1MCSA 4QRPE 3RVTC 2ENYA 3BDXA 1T3FB 5DD0L 3WUWA 1WZ1H 3MRPA 4NWTH 1JMZA 2BOCA 2Z31C 3EYUL 4LFHD 3VGAB 1YEIH 4PJDB 3QXAA 3Q3GA 3W82A 1MIML 4MA7L 4KQ3L 4ONGL 2CO6B 5DXWA 2YS4A 1JUFA 5SV3A 4M6AA 2EDFA 2PO6B 3LEYH 4D9QE 1X5GA 1NFDE 3P11L 4JFED 1CLOH 3CDFA 2BK8A 3IRPX 3TPUE 4WHYG 4HUVB 3GNMH 5L2KD 1FVEB 2WK2A 4RISL 3SPVB 4GRWE 3G6DL 5IFJA 5KG9A 3G04B 1A1MA 4HS8L 1XGYL 2Q6WB 2HKFH 4I0PD 5DRWA 1FN4A 2PO6A 1OGAB 2A0LC 5CLWA 1X9QA 2DLEA 5INCB 5EBLA 3MUGA 3GSOA 3WO4C 3WNKA 1FVEA 4AM0A 1INEH 1VEPA 3DARA 1BBDL 1DANU 3K7UA 5DZNA 3G04A 4TVPL 5DJYA 3C5SA 1OB1B 2BNRE 5D96C 1NUFA 5F6HI 1RUQL 1I9EA 3I6KB 1AQKH 1CU4L 3V7AE 1EHXA 4PJ7E 1OGAA 2VJXA 4N5EC 1NEZA 2G5RA 5IVOA 3MTRA 4D9RD 4APQC 1OCWL 4R7NA 1HWGB 3FMGL 2MPAL 1BVLA 4RGNB 1QR1B 2J6EL 2XRAL 3UBXB 4F15B 3MLPA 2DYPD 3PV6A 4JFQB 4R96B 2IAMB 3HE6C 1OAQL 1NANI 3AC0A 3HI6L 3PABB 5KOVC 1FYTA 1GRWA 4QYOB 4HCRH 4A6YH 4JFFD 4Y4HD 1Y0LB 2NY0B 4X6CE 1NUNB 3O6LH 1FQ9C 3SDXB 3MOAL 3QDGE 5ITBL 4QRSA 1PQZB 5I8OH 3HI1B 4NFBA 5J9PB 1ZT1B 3FT4B 4R96A 1YYLL 2IAMA 1B88A 1D5BB 1GOHA 2OXGA 5F1KC 1A6UH 2B4CL 2VUOA 4I9WD 4P9ML 2YBRB 4Z7WB 2B1AL 4LRNH 4CN4A 3KLAB 5TQ0H 1A7NH 2XKUA 4YFEA 3SDXA 1S7WB 3SGJC 2UZYB 1XGPB 5ELIA 4NKIL 2APTA 2MKWA 3S5LB 5J9PA 1ZT1A 3TJHD 2YPLB 1IQDA 3MZGB 1UZ8B 3DOSA 1Q0YH 1DUZA 1FO0L 5DMJB 5CEZD 2YBRA 3CFBB 4I3RL 4WJ5B 3KLAA 2X4UB 5GZND 4U1IA 5A3ID 2QR0A 1HSAA 4BZYA 4OD3L 1T5XB 1XGPA 1UZ6F 5E08L 3MFGB 3S5LA 4BZ1L 3LKNA 4NUGH 2YPLA 2UY6A 1UZ8A 4L4JA 3HG1A 2GTZA 3IT8D 4ZFZA 3ULVE 5C07E 4HIIA 2ZWLT 4EN3D 1IZJA 5DHXB 3CFBA 2G2RA 4MD5A 5D1XB 4KDWA 2X4UA 3BQUB 4PJBF 4FZ8L 1SBSL 1KCVH 1WT5A 2W07A 3NBNA 1A4JB 1N4XH 2EEBA 4IRZH 1AGBA 2EIZA 4G80B 4NC1C 3TH4T 1EMTL 4XMKL 3K4ZA 4X4XA 4WU7A 4Y4KB 1CG9A 3I6GA 1MI5D 3ULSB 1T2QH 2W9DL 3D0VB 3W0WA 2V5TA 4PGDB 4NFDA 3NABL 4OLVH 1MHHB 3CLFH 3GBNH 3W39A 2NQCA 5L6YH 5C7XL 1BQLL 4XAKE 4L5FH 5JOEA 1A4JA 4WV1A 3O6FC 3BDYL 3OTTA 3Q6FB 4QXUL 3BP5B 2ZJSH 4C55A 4XPAL 4G6ML 5TGBA 5JNYB 3CMOL 1L8JA 3CK0H 4FTVD 4PGDA 2IH1B 5KVMC 1UJ3B 3NCYP 3ORJA 4NN7B 3WFEL 3EDFA 1MRFL 1CLZH 1HYSD 1AE6H 3GJFH 1U58B 4RFOL 4JY5L 1I9RL 3Q48A 5F7FA 3N0PB 4ZXBD 3WV0A 1E6OL 3N9GH 5MEND 4UIMA 5IB1B 3BIAX 2SEBB 4MJ5A 3GSNH 3VCLB 4NHCH 3KGRA 4R97C 1U58A 4LMQE 3VWKD 3UJJH 5GRVK 5D1QC 4XNXL 1FRGL 1PG7X 1DQDH 3SDCA 2Q3AA 3MV7A 2NY2B 2OJZL 1CD0A 5E6YA 3CU1A 2UWEE 4U1NB 3STBA 1EFXA 4NKMB 1MVUA 4ZD3H 2QQLH 2HKHL 2HH0H 4HIHA 4JQXA 3MXVL 3TWCL 1CICD 3DTXB 4PRHD 3DX6A 3ALWA 4MS8C 3RA7H 3U4BH 4S2SB 5BW7A 3OHXA 3H9HB 4X6DE 3NA4A 3HE7A 3L3GB 3QHZL 4G8GE 4UT7L 1X5AA 1FIGL 4TUKL 4QNPE 2Q8BL 4U1NA 1EVTC 4K7PL 3C6SB 2Q76A 2DL2A 2O26U 5C08B 5A2FA 1CL7H 1NCNA 1RZ8B 2H6PB 3P9MA 4F3FB 3QULA 1EV2E 4BYHA 4KZEH 3B5GA 3LDBC 3LKSB 4WO4B 3D3VB 1NGWA 5IEKA 5JMOC 2EECA 4YHPB 4S2SA 4QRUA 2MCG1 4I3SH 1UENA 3VG0H 1IEBB 4BKLB 4F8QA 2VL4A 3RIFF 1OLZA 3QQ3B 2DIBA 5EC1B 1J1OL 1INQB 3L7FB 5DSCB 3QAZB 3HCVB 1T7WA 1W0YT 1ZK9A 2GITB 3I6LD 3TBWB 3GFUA 2ATPB 4NQXB 3BJ91 1QR4A 3VFRB 1WBXB 3UROR 3OAYH 1FNEA 8FABB 4YHML 5E5RB 1S7VA 5A2IH 3QQ3A 3ARPA 2OR8A 1NJ9B 4F37K 4MCZB 5GSRB 5DSCA 1H5BB 5K59F 2XZQH 5BCAA 4XXDB 4LIQL 1KCUH 2AGJL 1A1OB 3AREA 4JFHD 2DLFL 2XOTA 3EYVA 3FO0L 3OPZH 4NQXA 1I9JL 1RZKL 5JHDB 1VGKB 3MRMB 5J1AB 4WEBH 2C7UB 8FABA 4PRAB 2HJFB 1NFIA 1C1EL 4W81A 1L0QA 1NJ9A 4PB9L 1UYWL 4PTUB 4QHLB 4YZFF 1G7MA 5DFVC 3ME0A 1QBLH 1JHKL 4ONOA 4X7SH 4PY8J 2EDWA 4LSQH 3N1QC 5E99H 4MDJB 3CSYA 5JHDA 5IHLB 4NQCA 3AB0C 4OLWH 5BJTA 1V7ML 3QHTC 2E7LE 4I48B 4NQVB 1CLYH 2XKSA 4U1HB 5AWNL 1EDQA 4QHLA 3TIEA 3CVIH 2MCPL 5J3HD 3OKEB 4KMTL 4QEGA 5TDOB 1N8ZA 1NAKL 5CJXA 1L9MA 2O93L 2X44D 4MYWB 5DZOA 4MDJA 5CEZH 4YC2C 5FCUL 3TNMB 4Z6AT 5FYLE 4PJ9A 3QUXA 2GTWB 4XVSH 5LGKA 1J88A 5GIRA 2H45A 3KNBB 2BSSB 4XNZB 4P5KA 1J8HA 4O9HL 1HKLL 1RJYA 3U46B 1MQKH 4J7RA 1B0RB 5BS0E 2JLLA 2HG5B 4MLIA 2YD8A 3STZA 2GTWA 5MEOB 1I8KB 4UTAL 5DJZB 4NJ9L 1JPSL 1KLGA 4JJ5B 1V3JA 4NZUL 4GOSA 4X6FA 4RIRA 1J1PH 1NANH 3HI5L 4RNRB 5E4EC 3SQOH 4HC1A 3ZKMD 4FG6D 4AMKL 1T04A 1ZWIA 3V4PL 1IZKA 1BEYL 5IKCB 5CD3A 1UB5A 5JHLH 1BD2E 2P5EA 3DSFL 1CR9H 2ESVE 4JJ5A 3SDAB 5HVHB 1A3RL 3PXHA 4NC0B 1EHLL 3PP4H 3RKDC 1HHGB 2DDQL 2UYLB 3NZ8B 2VDNL 3VMPA 1SMAA 5DC4B 2CGRH 3UZQA 3F58H 2AJUL 3MRFA 4HWBL 2C4FT 1IC1A 4QHUB 5I1GH 3DV6B 3MSPA 1KN2L 3QCVH 1IM9D 2G75B 1FDLL 1J0IA 3BSZL 5IM7B 4XP4H 4PB0L 3RAJH 1JBJA 1KYOJ 4XBPA 1JGUH 2X4RA 3UYOD 3EYQD 1DQJA 3SJVE 4FQ1H 1HHHB 1VDGA 4DZ8A 1MELA 2J8UA 2DD8L 1D3CA 1A47A 5J12C 4DKEL 1T1XA 5J11C 1OARH 4FS0A 2ZOLA 1G6RL 2P4AB 5C0DB 4PTTA 5D71L 3MXWL 4PRBB 1AY1L 1RUML 1CFNB 4OM0H 2AERT 3VXPB 1ZSDB 5EO0B 4WCYH 4OLZH 3LEVH 2ITDA 4KTEL 3G08A 3UTTA 2H1PH 3QDJA 4PP1C 2HRPL 3KPTA 5HGAB 3WIIH 4OIBA 2CJUH 1KGCD 3RJDA 1WGOA 3BZEB 3K4AA 1TVBA 4YX2H 1HXYA 5AZ2L 4ZYKB 1LO4H 4WI7A 4HKZB 4K71B 2FWOB 3GBLA 1GGYA 1MCPL 3U9UA 4JO2H 1IAKB 4NN6C 3FB6B 3G6AB 5DHVB 1NCBH 5CIPB 1QHPA 4H1LH 4WEUD 4EKXA 4RMQA 2FJGB 1WFUA 4WHCA 4PJDE 1IGFH 5LGJB 2D0HA 1RFDL 4UDUA 4JM4H 2FD6L 1J0HA 3O6KL 4PRPB 5AD0B 3ARDC 3DO3A 3CVHA 1BQHG 4HKZA 4P46B 1WQVT 4GQ9L 4XC1L 1BFTA 5IJKC 4OFKA 1KTKE 2V2TA 3UTSD 4NQSA 5FUOH 3O8XD 2UV3A 5IMLA 4LSRH 1RK1B 5E6IC 1T83C 2B0SL 3OAUL 1C5CL 2NLJB 3G6AA 3LHPH 5DJ2A 2AXHA 2AK1L 2B5IC 3BZFB 5DLMH 1HHJA 1F00I 3O2WH 1ACYL 2BNUA 4AZ8A 3FQUA 32C2A 5K9OA 3RGHA 1WFNA 1BECA 1CGTA 4EI5D 1YY8B 3FQRA 1OAUL 1WIOA 3HR5A 4PRPA 5BO1H 5F8QC 1NBVH 4P57B 4P46A 5FGRA 5LWYH 4FRWA 1QFUH 2E9IA 3WS3A 1S78C 2YZ1A 4L4VA 4F9PA 1D9KB 1JRHL 2NLJA 1T20B 3TA3D 2CRYA 2LTQB 4LCIL 5FKPB 1V8HA 1MREH 1JFQL 3KPRD 1ZS8B 4IRJC 3HMXL 4K8RL 4P23B 2OK0H 3OKYA 4LCWE 4K9EL 2FRGP 2OZ4H 4R7DB 3C6LA 1N2RB 4PIRF 4JO4H 1KC5H 4RGNE 1D9KA 1NLDH 1QVOB 1A7RL 4L29A 3KPSE 3QXDA 3F7RA 1M7DA 3P4LA 3HAEH 1QFHA 4NIKB 2AQ1A 1F4WH 1P84K 1U8KA 3SE4C 1E0OB 3D9AL 4MSWA 3M07A 43C9B 3UPRB 2AJXL 1BZQK 3WFBH 1JTPA 2ZSVA 1JZ5A 4KK6C 4N90E 2OJEA 3L3JB 3NGBB 4R7DA 5IV2A 5HGBB 4KJPC 2R4RH 1QVOA 4KVNH 2NY6C 3LN5A 1G6RB 4KZDL 4HGMA 1I1AB 5I73B 3DROB 3MRHB 1L4IA 2NY5H 43C9A 4Z7WE 3MA7B 4X98B 4L3EB 1ZXQA 4OSUL 4L8CB 3L3JA 4YEEA 3L3DA 1YQVH 5LBSL 3ALXA 4K3HA 2O5YL 2YD7A 1E6JH 5HGBA 2V17H 2IEPA 4LKXB 3GRWA 3S34H 4YHYC 2FH6A 3DI3B 3T2NL 3ZTNL 5MHSD 3DROA 3OR7A 3L1OH 3UBXI 4R2GB 5DEGA 1OW0C 5AUMA 3MA7A 4X98A 4L3EA 2J88L 2VXTH 4ONHB 3CXDL 4D0BB 1WK0A 4L8CA 5DTFA 1WBZB 3I3DA 5F21B 2FH8A 4XAWH 2OBGA 5KSVA 1WTGT 3A6BH 3VFUA 4XP9H 1FFQA 5F6IC 3G5YB 3JV4A 5ALCL 3G6JF 2ZUYA 1Q94A 5TFSH 1AHWA 4Q9BA 4JFDB 1N64L 2WZPD 1F2QA 2JKXA 4MVBC 3MRJB 3UZVB 2PO6D 1WBZA 1G0DA 25C8L 1N7ML 2VN4A 4EIGB 5HYSA 1VKXB 1P4IH 3BIKA 3FN9A 4YHIB 5GGVL 4U6YA 3C8KB 2HT3C 3G5YA 1E4KA 3QRFM 5GS1C 3KDMB 3JWDL 3MODL 5I0ZA 1ZHBA 4HZAA 4M7JL 4ZMAT 3MV01 1XF4A 4HFUH 4FFZL 1JPGA 3M45A 1OGAD 4OQTL 4MNHA 2PW2B 4DGIH 4BK5A 1M1SA 2X4NB 1AJ7H 2WBKA 5EIIB 1CDBA 4G6JH 4JCLA 3C8KA 1K9TA 2ZCLH 1EEZA 4TVPE 4Q74A 1UADC 5C70A 5IVXF 1ZA3B 4NSKA 1GGTA 3C5JB 4LLVB 4P2QA 3OF6A 2F8XC 1DZBA 4RDQG 4DVRH 1FYTD 4JFOA 2R9HC 5EOCH 5CINL 2ZCKL 3IDXH 1WSST 3C2AH 5FA4B 1MF2H 1U8QB 5DWUH 4KVCL 1EVUA 3QIWB 3T4YA 4HXBH 2XZAH 2PUQT 2EH8L 4IDLA 5A16B 2Y4SA 1MNUL 1U9KA 5D6CB 1MRCH 3ESVF 1GGCL 5EU6B 4ODUA 2YD5A 2IAMD 1EJOL 4H88L 4WWKA 4XCNB 3KYNB 5FA4A 5CJQH 1T22A 1UWEH 4GKZA 5CP3H 1OQXA 4CVZA 1KV3A 3CFCL 3LSOA 2YZ8A 1MCQA 3R1GL 2IG2L 2Z91B 4OT1H 3MACH 1TTGA 5A16A 2C1PA 5EOTB 4RCAA 4U05A 2EDQA 4CN1A 4OCXH 5CCKL 5ALBH 5IB5A 5E8OB 4IS6A 4PLNC 3MJ8A 2XTJB 3FT2B 2WIMA 3V0WH 1FNHA