4LCYA

Crystal structure of hla-b46 at 1.6 angstrom resolution
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
274
structure length
274
Chain Sequence
GSHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRMAPRAPWIEQEGPEYWDRETQKYKRQAQTDRVSLRNLRGYYNQSEAGSHTLQRMYGCDVGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAAREAEQWRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, B-46 alpha chain
publication title Crystal Structure Analysis of the Human Leukocyte Antigen B*46:01
rcsb
source organism Homo sapiens
molecule tags Membrane protein
total genus 79
structure length 274
sequence length 274
chains with identical sequence F
ec nomenclature
pdb deposition date 2013-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lcyA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4lcyA01
3DVNB 2MKLC 5A16B 3T0WA 5T3ZE 1X5AA 4XGZB 1UH4A 4ZMAT 2P7TA 2E3VA 3LKSA 5AG8A 2VQ1B 3UTTA 1OP9A 2FSEA 2VQTA 4R26L 3CPLB 3BDBA 4G8IB 2C4FT 4HK3J 4YC2B 1G6RL 1A7OL 2Z35B 3QUXC 4LAQL 5H37H 4F7EB 5T1KD 3EJZC 3MLYH 1JZ5A 1KCKA 3BN3B 3G5XB 1AGBA 2VIRA 2ZCLH 2ZP0T 3ORJA 5HI3C 1JFQL 4PJHA 3V0WH 1ZHLA 4FFZH 1MIMH 2YUVA 2W91A 1IQWH 5DTFA 3JWDL 3DVIA 1NGQL 3LRHA 2RFXB 1IC4L 1NDMB 3SPVB 4Z7VA 4Z7QE 5C0FA 5IJVA 1I7TA 4F33A 1VERA 5A2FA 3SQOL 3RGVC 1CICA 4KK5C 4Q2ZA 1CLZL 5E70A 3RVXD 2DN7A 3GMOA 5FM5O 1Q38A 5ISZE 1XR9A 3D18B 1WFUA 3B9KA 3GSNA 3AU1A 4PJEF 2BVEA 3ARED 1J1XH 4TRPL 4OF7A 3E3QA 3DUSA 4MD5B 3T09A 2ERJB 4E0RA 2D7MA 2CMRL 3L5WB 3WN5B 3O4OC 2C3GA 1MI5D 3GMLA 2ZOKA 3O9WC 1LD9B 1OOAA 5IM7B 5F7DB 2GJ6B 5HXMA 5IFHL 2L7UA 2Q7YB 3QUMA 1YPZB 2AQ3A 2NXZD 4KVNL 4BQCA 3NACL 5D1ZD 1D5BB 1YYLH 3GSRB 3RWEA 3HG1D 4HUXB 2DJ4A 1S5IH 2IANB 3SJVD 2HTKD 3DV4A 3U4EB 1K4CA 2KUTA 2O5ZL 4FP8H 2VLJD 1I7RA 1D5IH 4Z0BL 1OP3K 4PY7B 4QYOB 4Q9RL 2DYPD 3C8DA 3GJEA 3LKOB 3V4UL 2XZCH 4D2NA 2R1WA 2P5EB 5E24E 3IDIA 1RULH 4ZUWB 4EJ1C 1BMGA 4LCCA 3PGDA 4ODVL 3HLAA 2DTMH 4F9LC 1G84A 3HE7B 4HXBH 1WF5A 4AT6A 4YDIH 3H42H 3HRPA 3MRGB 4QCIA 1OB1B 4F8TA 4NRXA 4LNVA 5T1LD 2V9TA 1WWAX 3MGTB 1J8HE 4H8WC 4P23A 4Q0XL 1QFHA 3QDGD 4LHJB 3AS2A 1S9XA 5KVFL 1UG9A 3S3JA 4G6KH 2EIZB 2I5YL 2VQUA 5D96C 1JF1B 1PEZA 4MQSB 4P2RD 2EZ0D 5T1KB 1A6AB 1Q0XL 1G7HA 4K23L 1ZMYA 5ICXB 1G7MB 4X98A 1KJVB 3M45A 3CFBB 2AI0L 2F5AH 1JYXA 2RIKA 1ITBB 1UM6L 1BVKB 5FKPA 3RX7A 3X12A 3BKML 1AY1H 2NZ9C 4HUVB 4WFED 4MAYA 4XPFL 3LD8B 1IRAY 5CLWA 3IXTB 1RUPL 5CBAA 3MRKB 3OX8A 4S1DC 3ARGC 5EO0A 3MRDA 1A1MA 1OHQA 2D31B 3MODL 3L3HB 5MENE 1B0RA 1KLFA 1G7PB 3MJ8A 5HY9A 1D5ZA 3RFZC 1KN4H 4NHCH 1TJHH 1QFUH 4X4XB 4WFHD 1UACL 3AREB 3DX8A 1FV1A 3MO1B 1NBZB 3KJ4C 1KPVB 1S9YA 3BWUC 4X9GA 4Z0XB 3UBXI 3Q6GL 4B7IA 5IV2A 5FAAA 3S88H 2ID5A 3EDFA 5IVXB 1RZKL 1RZIA 3R1GH 2CLRA 5FHBH 2IPTL 5HD8C 3R0MA 3PDOA 4HWBL 4HX1A 4KJQC 5FO9B 4MA3B 3H7LA 1HHJA 2FBJL 3BEVA 3BI9X 2NXZB 4YHIB 1VENA 4XPAH 3H9SA 3Q5TA 2IWGA 5GGVY 5D7LD 4QNPF 1YEIL 2YMXH 5D1ZB 5CEZD 2A6DB 3HG1B 3MACH 5AYUH 1H5BA 3SJVB 1ZANL 1OAZL 2QHLA 4MQ7B 2DYPB 1CGSH 4LL9A 3OHXB 2M2DA 3LKQB 2DMBA 1LDPL 4DQOL 1QLEH 3BKCL 1K9TA 1YNKL 1OM3H 1A8JH 5KS9F 4PRHD 3K4ZA 4OCXH 4UAOB 3CK0L 4ZUUA 5T1LB 1ZHKA 1AR1C 4YPGB 4LSUL 5IB1B 2Y36H 3U7AA 1AHWA 4QGYA 3U6RB 1D7FA 4O58L 5FYKU 3QDGB 1GIGH 2F19H 5F1OB 3TO4C 3A6BH 4PJ9C 4FQLH 1W0VA 4RA0C 4PJAB 2BHYA 2AXFA 4RMRA 1CLOH 4P2RB 3MXWH 3SKOB 3ISWA 3DETC 3QUKA 1MRCH 5C2BH 1ZLSL 2P8PB 1KJ2L 5IVZA 2GFBB 3GB7A 4OFYD 4UILH 1FL6B 1RJYB 4MS8C 5I1EH 1KC5L 2DWEA 2H32B 4WFFD 3C5ZA 3Q1SL 4PGEB 1SMAA 2X10A 4RAVB 1JWSB 2Y6SC 3ZE1E 3BWAA 1JF6A 5ESQB 3V0VB 2YA2A 3PV7A 4YDLB 4LSTH 1LO4L 1NEZB 1PAMA 3TYGH 2YRLA 3WFHA 5JPNA 1I9RL 1S7VB 1SJEB 1EH9A 5I71C 4HIHA 1PZUB 1I7ZB 4QOKE 1EEZB 1OSPH 5E6ID 1FQ9C 1IZKA 4MB5A 2XWTB 3RVVC 4ONHA 4UBDC 1CVRA 1X5IA 4NSKB 4XNXL 5B4MD 4XP1H 4FFVC 4KMLB 4Z7OE 1JWUA 1MQKH 2H6PB 1RJLB 4K3JL 5E00B 4DN4H 5EUOE 5D2NB 2VTFA 4GKOA 4RWYH 3RWJA 1UQSA 3EYSH 1B6UA 3G6JA 5FEBA 5DC0A 1KB5H 4M48L 3MV9D 4CMMB 5SX4H 4IOIB 5TDNB 2C7UA 1KCGC 5HHOA 3T08A 2IGFH 2LAAA 2MMXA 2Y25A 2HJFB 1DDHA 3HMXH 2BOBB 2H8PB 4KY1L 2E5EA 1J1OH 3GSWB 3CZJA 5HSFA 12E8L 4NFCA 5EZLA 2AGJL 3TBYB 4LF3B 1FJ1A 5IG7B 4KV5E 3EBAA 1QLFB 1U8KA 2V5MA 4TQEL 3CVHB 5D7LB 3DGGB 4ZNEA 4OZGE 1YEFL 3DIFB 3VE0A 5GRJH 5C0CD 5DVKA 3FN0L 3BYTA 3CMGA 3S98A 1J0YA 4M93B 3GGWA 4OD1L 4F9PA 3KG5A 4WUKH 4ZPTB 1ES0B 5DJDB 1LO5B 4PV9A 4ZSOB 1XF3A 2ESVD 4PJGF 4J3WA 1T0NB 1DBJL 1BBJB 5D8JH 4O00A 1J88A 2YA0A 1HNFA 5M7QA 4Y4KD 3PXHA 1JGVL 2CIIA 1MWAH 4YUEL 4PRHB 1T1XB 5E7FA 3QIUA 4WWKD 5T33H 5F7NC 3ZKND 4U6VL 5JDSB 3MA7A 3MOAL 3BIKA 4JHAH 3QO0A 3MC0A 4U1HA 4R4FL 2C1OA 5EOQH 1AI1H 5C0GB 4LCYB 3VFNA 1OL0A 3RL1A 2P45B 5IROC 1V3KA 4D0BA 2XA8L 4OD2A 4DK6A 1S7XB 2WWKT 3QEQD 2J8UE 1V7NL 3G04A 4C56D 5GS1B 5DK0B 5I75B 1YN7A 5DGRA 4PJGA 5DJ0A 2F54D 2GEEA 3HNSL 5DSCB 3LVEA 2JCCB 3C6SA 2VDNL 1KEGH 3IFPB 1OF2A 4JRYE 1X7QB 4U31A 5D1QA 1PZ5A 5JHDD 3T77B 4HFUH 1QP1A 3KDMB 1U42A 4O2CB 3ZTNL 2EH7L 2PUQT 3WFCL 2MNUA 1X5YA 4Y88A 1RQ5A 4Y2OA 1QTYT 3UJIL 4NKMB 2APTA 3QCTH 1FGNL 4DUXA 2ZSVA 3MXVH 4GAGH 2OSLB 5KSVA 4UT9L 3ARDD 3M07A 5E6IB 3QDAA 1XIWA 3B9AA 2R39A 3MCKB 4FTVA 4QY8B 5GRVK 1RIUL 4NFBA 3WIIH 3RDTD 2NY6D 5I15L 2VLRB 5IW3A 1AP2B 3DROB 3UO1H 3JV4A 5J9PA 3K4DA 4I3RH 3MRFA 1X5XA 1FZMB 3CFKB 4M1GL 5E8NB 2V2XA 3IKCB 1O7SA 3QPXL 4LCUA 3LH2L 1PD6A 3P11H 3VXMA 2LQRA 1U92A 1QR4A 4Q6YA 5EPMB 4OV5A 1OP5H 2V6HA 5EU4A 3QNXA 2FX8H 1F6AB 2JB5H 1OCWH 4XNUH 1U93B 2DIBA 4OLVL 3RVTC 4N0YH 3SKMA 3QA3A 1N6QL 2ZPKH 1YNTA 3JBG7 1N4XL 2BOCB 1FORL 4KTEL 4IRSC 3GSVB 4NRZA 5C0ND 3SO5A 4MX7A 1X5GA 3KPSA 5C0CB 1NMBH 3FO0L 3U0WH 1WBYB 2QEJA 1I9EA 1JZ7A 5C71A 3K1DA 4WI3A 1IGJB 4EBQH 4NO3B 2ESVB 1RK1A 4C55A 1JGDB 3VG9C 2IALB 1U58A 1TTGA 5C0RH 4Y4KB 1MIEH 4MVBC 5KSBB 1BZQK 1JK8A 5DUPL 5E2VL 2YC1A 3VGAC 4WWKB 2EKSA 2X9XA 1ZLWH 5AZ2L 5DT1L 5DHYA 1C08A 4XPTH 4LAJH 3BQUC 2YA1A 4BH7B 4GG8B 1L4IA 4XCEA 1FZKA 4OUUB 3DRTA 3PL6C 3QEQB 5GRVL 3ZYOA 2W65A 4KJPD 1UZ6E 4R8WH 2H26B 2AJSL 4BELD 4CNIB 2UWEA 4K3GA 2YEZA 1RI8A 2F54B 5F88A 2EDOA 2BNUA 2DQCH 3FB8B 1PBYA 2QHRH 4RWHA 5JHDB 1F58L 4K7FB 1R5VA 4JFDD 2IH1B 4I77L 5CP3A 4WFGE 2V7NB 4N1EA 4L1DA 3NCMA 1BFVL 1QFOA 4G6ML 4KI1A 5TGBB 3HRZB 1UJ3C 4L4TE 4JFOB 4TSCL 2EYTB 5SX5K 3ARDB 4F7EA 3VWKD 4RX4D 1FBIH 1DSFL 1N0XH 5DHVH 4UDUB 1KIQB 3IT8D 2C26A 1I75A 3TIDB 3MMEA 1KIRA 5I8EA 4RMUA 3LV3A 1B0GA 2DWDA 4IJ3C 5INDA 2DQGL 5C9JB 2DQFB 5SV3A 3RDTB 2NY6B 3GK8H 3TH4T 4DVBB 5B38A 2QQKH 3S37L 1MAML 3LCYA 1HILA 4I2XE 5E1AB 5B8CA 4OF0A 3KPTA 3R8BB 1U6AL 3TA3A 2AJXL 3WIHH 2VDLH 3L5IA 3SPVA 5L2KD 4FZ8H 2DQEH 3EZJB 5IMOB 3LHPH 5EU6E 4U1LB 1V7MH 4NZRH 2H1PH 3LOWA 5GZOC 2WY3A 3CD4A 3CC5A 1L0QA 3FTGA 3JWDC 4K3EL 1MPAH 2YD4A 5DD3L 4HULB 2CDFB 3S34L 1UT9A 1DQMH 3GKWH 3QDMA 2KBGA 4MD0B 4PTTB 2X1PA 2IPKA 1EO5A 3TPUA 3STLA 1NFDF 2CO6B 3DO7B 2EXYC 1HHKA 1S3KH 4HPYL 1HSAB 1QFWH 4MXQA 1U95B 5HHQA 5TQ0H 3L5WA 4OZFA 4G8GE 1FN4A 1NCNA 5BS0E 4KKLC 4Y1AD 4KHXL 3P0GB 4PP2B 4TSAL 1JNNL 2NLJA 5F7DA 4GJTB 2Y06H 1S7UB 4NN6C 4WHTB 5I30L 1YPZA 3QWQB 1L7IL 4LCWE 2Q86A 4JHWH 5ACZB 2NYYD 2IBZX 2NMSA 3RWCA 1EHLL 1D5BA 1TQBB 3OR7B 5F8QC 4FABL 1AQKH 4YEEA 4HUXA 4EKXA 2HKFL 4FQHB 4QT5A 2X4RB 4JDZB 1CK0H 1T22B 4NO0A 2D4FA 1ADQH 1IGYB 5IBLD 3LKOA 2Y07L 3SDDD 3EKCA 3D1MC 2CJUL 3HPJA 3STZA 5LAXA 3VXRD 1BZ9B 4ZAKA 2AK4D 1S7SB 4LASH 1FH5L 4P4KC 3H3PL 1BGXL 2PO6D 2X5PA 5KZCD 3D87B 4WCYH 4OF5A 1NC4D 4N0CA 1TETL 4JFDB 4F58H 5HYJD 1N5AB 4RRPA 5JDJA 4Y5XA 4IMKC 3C60A 4XC1H 5C0AA 5MEQB 1EFXD 1KCUH 4J3SA 3U7WL 3ZE2F 4X8JA 3QJHB 1D5MB 1ETZA 35C8H 5D9SA 4UMGA 1IZJA 3H9HA 4OAWB 5F8RC 4EIGB 3HZMB 3KYNB 1JF1A 3VWKB 2BSED 3GMMB 1Z2KA 1NCAL 4HD9A 4M7KH 1DLHA 1LEGB 2G9HB 1A7RH 2MQ3A 2BRRL 1VFBA 3L3IB 4H1LG 5CZVH 4I3SL 3OJDA 3T0ED 1B90A 4K9EH 2LU3A 4JY5H 3MUGB 1DLFH 1I1AC 3FCTB 4Z77A 1S7WB 2GJZA 1BVKA 5EU3B 1ZSDA 1BOGA 5D2LF 1EJ6A 5BV7B 2P47B 2R69L 2YZ8A 3K2UH 5BZWB 4EZMA 1J0JA 3UBXG 5HYEA 3P9LA 3PHSA 2WUBL 4FQCL 5L2KB 2BNQE 2FHFA 2Z4QA 4NWTH 4RGOH 1CXFA 3KXFE 3IXTA 1DE4B 2CH8A 5C08D 4XPGL 1NANH 1ZHNB 3HI1B 4LBEB 4XPBH 5KSAD 2PXYD 2D31A 4X6BA 1H9VA 5FOBB 2ICWB 3L3HA 1G7PA 4HGWB 2UZXB 1OD7A 2P43B 2X41A 4KRLB 2J5LB 3E6FA 1J8KA 4X4XA 5FGCE 1UGNA 4OGYH 5EG6C 5JOPE 4ODUA 1KPVA 1GXEA 1G0XA 3FB5B 4LLVB 2WM0A 1P7KA 3OGOE 1SM3H 1PYWA 1T5XB 4G6AD 2IQ9H 4KZDL 2YD2A 1F3DJ 4B41A 5IVXA 2F58H 4JB9H 1MI5A 1QSED 4PFEA 4Y1AB 2GW5A 2WIIB 1HH6A 1A6VL 1ED3B 4NQED 3E2HB 5IBTL 3QISA 4PS4L 5I76B 5JHLH 4OD3L 1WISA 4Y2DA 5TE7L 1RZKC 5FYJE 4B7LA 2HMID 2R4SH 1DANU 4FQQB 4LSRL 4X0KA 5CZKA 1UH3A 3IU4L 5HHMB 1TJGL 4Y4HC 4HBCL 2XZAL 3TC9A 4PJ5D 1Z3GH 4M5ZH 4EI5D 5JO5B 1K4DB 2VLJA 4MQ7A 2AJVL 3O0RL 3NAAH 1UB5A 3EYOA 3OG4B 1VGEL 3OHXA 1P6AB 3SDDB 1B88A 4CDHA 3G08A 5J12C 3P73A 2ITDA 4G8FB 2JELL 3DX6B 4YHLH 3VXRB 1YEGH 2AK4B 4TVPD 5GJTH 1XCTB 2MHAB 2PO6B 4OLEA 3LZFH 5KZCB 3SQOH 1M7DA 1EBPA 1MLCB 5SWZA 1ZA3A 4YPGA 3S37X 5HYJB 3KNBA 3MLTB 5IB1A 4YFEA 3QEHB 4NPYA 3K7UA 4OI8A 5IIEA 1EFXB 1XFPA 4PJDF 5D5ME 2XRAH 2JE8A 4ETYA 4PJAA 1Q94B 1U3HD 4TPRL 5IB5A 1HINH 4S0UC 3STBA 5KSUA 4W68A 1DQTA 1OTSC 4P2RA 4LPYA 4NQXB 5HTSA 2PW2B 4P3DB 4PRPB 1ZEAL 3SGJA 4XP9H 3O6LH 2CMRH 3T0EB 1FL6A 4JVPA 1RJYA 4NN5C 1AD9B 5TE4L 3RU8H 25C8H 2EIDA 2EYSB 3SE3A 4WEUD 5DD6A 1OY3B 3QG6B 1CQKA 5IEHB 4RAVA 4KJWC 2A2QT 4KMQA 5D7IF 3BP7B 4R4ND 4KVNH 5KG9B 4OLXL 5HJ3B 3NACH 5IB3B 3KYKL 4L8BA 4OM0H 5GJSH 4OTXH 1I7ZA 4UT7H 3CVIH 4NUJB 3NMEA 3EHBD 4LARH 4LU5H 5F96L 2PXYB 5KSAB 4DGYH 1EO7A 3VFOA 4OCSL 3V6OC 1RZGA 4AEIH 1CD8A 4DK3A 3H8NA 2L7JA 3PNWA 5ISZD 4POUB 2H6PA 2PETA 3PQYA 5E00A 5I1AA 1XF2A 1X6NA 5DZNA 3MUY1 1RMFH 2I9TA 1XGQB 4LHUG 5B39G 4NJAL 3ZL4L 5D7IA 1LP9B 5DVMA 3QQ4B 1RJCA 3TPKA 4R7NA 5GGRY 3IB4A 5GHWH 1A47A 4OFPA 5DLML 1F4XH 1QSEB 2IBBA 3DV6B 1JNLL 4DFIA 3UTQB 5KAQG 3CFCL 1ONQA 4NQEB 3NABL 4X6FA 3X11B 1L0XA 3TJHC 3HNTL 1J0HA 2W59A 5CD5C 2GYSA 3LMJL 4U1MB 5D7LA 5HHXH 1P4BL 3MRHB 4KC3B 4WJ5A 5JA9A 3WO4C 1HYSC 5K9OB 1OWWA 3X14B 4MA7L 1I1YB 4PJ5B 3F6IA 3WD5H 3O6FB 4EI5B 5JXEC 4JPVL 2HFGH 4URTB 3F65A 1WC7A 2D2OA 5EC2A 5IW1B 3BKMH 4ZSOA 2VDRH 1UCTA 3GMNA 5F9DC 4M1DH 4WGVB 1BBJA 1FFRA 1I4FA 1OW0C 3MYJB 1T03H 3S3SA 5INCA 1T1XA 1JP5A 3TCXA 1N5YH 5JDSA 4JZJB 2NY1C 3W0WA 3HS0A 3VJ6A 1M6OA 3T8XB 5C0GA 4LCYA 5H94B 5TQ2H 3NA9L 1XF4B 5GRUL 2QSQA 4DZ8B 3LKNB 2X4UA 1U3HB 1NFKA 5E2WL 4EDWH 4JVWA 3GSQB 4JQXA 2YUXA 1EEUA 3LS5H 4JZNB 5DK0A 3BZ4B 3R06B 4JLRB 2WP3T 4KRMB 3Q6GH 4G6FD 1BHGA 4DKEL 2VITA 2YSSB 2ZSWB 3FQNA 3ILPB 4Z95L 2JCCA 2VDQL 4L8DB 1M71A 1QSVA 5FGBA 2WWMD 4HWBH 1RHHB 3KPPB 3PIQA 2WUCL 1MAKA 4H88H 3E3QC 3K8MA 3A67L 4KK9C 2NXYD 4AEFA 3WHXB 3VRLE 2B1AL 5EOTA 2OS7A 3DX9B 3W9EB 2KH2B 4NKMA 1I9JH 1E4WL 2XKUA 4U0QB 2V5TA 1PEWA 2NY5L 1KIUA 1R3LA 1U8MA 4IRZH 5MERB 1NL0H 5KOVC 4XVUC 5HPMB 4KZEL 2H45A 4X6DE 3MCKA 4ZO7A 5CLTA 5MEND 1OAKH 1P1ZA 4WTXA 5ISZB 5ETUA 5GRWA 4JRWA 1MUJB 2VR4A 3L5XH 3SE8L 3B9EA 1FZMA 3MR9B 3MV9A 4JEGB 4RAHA 3KGRA 5I66B 3AXLB 3OKYA 3S3PA 4GRLD 4Y16C 3BAEL 4K8RL 1NMAL 1F6AA 3IYLW 2CRZA 4MMZC 1SMOA 3BZDA 1MFAH 1U8PA 5HYQB 5AUMB 1ND0A 3QIBD 2SEBB 4ERSH 4KPHL 3VW3H 4ZUTB 4F7PB 5DMGC 1U8QA 2BOCA 3LRSB 5FF6B 5C0CA 1EJOL 3L3GA 1QACA 4HUWB 4XNQB 3U7YH 4F8QA 1J5OH 2Q3AA 3WFDH 3RBSA 2PW1B 3C6LA 1T4KB 1TPXB 2I9LB 1DTUA 4N9GA 2DIJA 1GVIA 4S1SL 4LLQA 3BT2H 1NUDA 4NC1C 2ESVA 1LO4H 5BQ7A 5E2JA 2R1YB 5EULV 2YPLE 4CVZB 2IALA 1KPRB 5I8KL 3MUHL 2C4XA 3OXRB 3TT3L 3MLWH 1FE8L 3QR2A 3EW3B 4BFGA 4AEHH 3UTPE 3IU3A 3NGBC 1J8HB 4U6HA 5I1HH 2I60L 4MAUH 5LQBL 1CTOA 4I5BB 1TCRB 4KU1A 4OUUA 3T4YA 2C3HA 4QF1A 5EZOL 2ITCB 3QNZA 4C56A 2CK0L 5DJYB 3MGAA 5LXGL 1DL7L 4G6FB 4LQFL 1FIGL 2F54A 1KCVH 3ROOB 2YD3A 1PKQA 5JHDA 4KK5D 3L3OB 4XZUB 4CN6A 5ERWB 2VZUA 2IH1A 2YWZA 3PP3K 1B4RA 1W72B 1XH3A 2NXYB 2V7NA 4HCRH 1AXTL 2FX9L 2R23B 4R7DB 3ZDXE 1BQHB 2Z8VC 5TGBA 1BWMA 2CXGA 3EDEA 1YEFH 4QRRA 5EIIA 3AM8A 5DA4A 4L9LC 2EYTA 3QB7C 1H3PH 3FN0H 3O8XB 1CS6A 1DQQB 4QOKD 2F15A 4UDUA 3LEVL 1UKSA 3REWA 5T5NG 3TIDA 2EDJA 2YBRB 3ZLQC 3L3KB 1XAUA 4NNXB 4E9LA 3ERYA 1PSKH 5MENB 5I1GL 5D71H 1WZMA 2DQFA 5IGXL 3KPRE 1SJXA 3RWHB 2CLZB 1H5BC 1OGAD 1G0DA 3DARA 2AP2A 3U79A 5L9DL 4DAGH 1JGVH 5E1AA 1T83A 3H2WA 3I6KB 2R8SH 4NQDA 3FQXB 1LEIB 1IJ9A 4ZOEA 3PUCA 3T3PF 2E9JA 5FECB 3ULVC 3WJJA 2FEDD 3UTTE 1VFAA 1BQUA 1Z5LA 3BN9C 5FM8A 5IMOA 3L3DB 4GRLB 4M1CD 1C12A 1FDLL 1OGTA 1XGUB 4M8VA 1DEEB 3IFNL 3QIBB 5IFJB 4LDEB 3FO9B 4NNPH 5F9WB 5LG1A 3QPQD 3D85D 2YR3A 3ULUC 4LRIA 4R90L 3UJJL 4PJHE 2P4AB 4PB0H 3DO7A 5IMKB 2VDNH 3VRJB 2A77H 1UVQA 3N1PC 1GCFA 1OAQL 1U95A 3WE6B 4PJXF 3UDWA 4G3YL 1HZHH 3NCJL 4Z7VE 4YXKH 4XCCL 5CZXC 1JZ4A 5IF0A 3ROLB 2VE6B 3U83A 2YKLL 4MCYA 1FVEB 1IBGH 1LQSR 2GHWB 4M9PA 5J1AB 3C5ZC 4UUJB 4IRJC 1R3JB 1U9KA 5ACZA 2D3VA 4Y5YA 4FQ2H 3X3FH 3OKDA 4XMKH 5CMAA 3C9NB 4HMEA 1T04B 5F9AC 5C8JB 4NC2B 2X4RA 1C16A 4JDZA 4NYLA 1LK3L 4DZBA 2X4TB 5ALCL 3U0PB 2DMKA 3ARBD 4KHTH 4GO6B 3MFGB 1AGDB 1JIBA 2QQNL 3VH8A 3LQAC 2NW3B 3X17A 4S2SB 4P48A 4U7SA 1S7SA 4WVRA 2DOCA 5IHLB 3GFUA 5GGVL 3K74B 2OL3B 4J8RB 4JKPL 1EO8L 1X4XA 5FYLL 4JRYD 1HWHB 3BD5A 1H8SA 1N26A 1N5AA 1H8OA 2XI9A 3D6GA 3HAEA 1CU4L 1XR8A 4PLJD 3NIDF 2CO7B 2YHGA 3OXSB 3SDXA 4NO2B 3QJHA 3ULVF 2E27L 2WLYA 3QXDB 1JPGB 3FO1B 3HZMA 1U8IB 1CXLA 3VWKA 4DCQA 1AO7E 4RX4A 3L6FB 4QOKB 4M6AA 5IHZB 3SEPA 2G9HA 1GOFA 2DLFL 4R4BB 5CWSB 4OQTH 2BNRD 1EPFA 3H9YA 1GZQB 3MUGA 3ZDZF 3ULUF 3FCTA 2Z92B 1QSZA 1MJ7H 5EUOB 1DQDL 2BFVL 1RUML 5ENWB 1WK0A 2ED7A 4HKXA 4F9PC 5FGSA 4NWUL 3IJHA 4RZCA 3U2SB 1MFCL 1UM4L 2UY6A 5CEYB 2H3NB 3O3EB 1ZHNA 2NY0D 4G42B 3IAQA 5HHVH 3I2CL 4L8SB 2NX5A 1HIMH 2YD7A 1KJ3L 1Y18B 2ICWA 3QIUC 4NC1E 2HRPL 43CAB 2JIXA 3D85B 3VGHA 3TNNB 1MHHB 1U3ZA 5F7MC 1NAMB 3BZEB 1MJJB 3MLUL 3O4LE 2XQBL 1NUGA 4ZS6C 5CD3A 5EZIL 1ZWIB 1FRGH 1YUHB 4P4RA 1F58H 4XP5H 1L9MA 1F4WH 3I3DA 1SVCP 2IPUK 2QSCL 4Y1AA 1IC5H 2WIIA 5D4QA 4GW4A 1BFVH 2QQQA 4G6MH 4PJ9D 4Z18A 4BSWB 1YEHL 1Q0YL 1D9KC 3KS0J 5I76A 1NUFA 2XTJE 1IM9D 4HWZB 5D1QC 3P9MB 2XPGB 5FHAL 2DBJA 2CPCA 2EXWD 2FRGP 1MCLA 1CD0A 1HSBA 4WENB 5DRNB 5E6YA 3VWJA 1TVDA 3SHSA 3ULVH 4N5EA 1TFHA 1UXSB 4UV7L 5TDPB 4P5TA 5C0IB 43C9B 5JO5A 1K4DA 2ADIB 5BCAA 2RCSL 4EUPA 1T21B 5FYKH 2Y6SD 3ARBB 4YHYB 1G6VK 4PG9B 4J1UB 2J8UB 2PR4L 1XIWC 2D03L 4G8FA 4FFEX 3WFEL 5DD0L 3ULUH 3BGMB 1XCTA 4AG4H 1T2JA 2MHAA 3MLXH 3VFVA 5IJKA 3VGGA 4GMSL 1S5HB 2OR8A 1NC4A 4JRYB 2Q76B 4KKCD 3H9SE 3RVVD 3WLWC 1I8KA 4OF6A 1P4LA 4OBSA 1JHTB 1MVFA 4X7FC 2NY3C 4WFGD 1EFXA 4KFZC 1IGCH 5D70L 4YO0A 4Z9KB 5JZ7D 1D5XB 1F00I 5T1MB 4I8DA 3MLVH 2BERA 3SDAA 3SGKA 4BQ6A 2OLDA 3KJ4B 4J4PD 1GH7A 4L4TD 5LCVL 3D0VA 2PW2A 4P3DA 1Q8MA 4DWHA 2ARJB 1M1SA 5IOPB 5CILL 3FN3A 2PYFB 4WTZA 3PWLB 3MBEC 3PWUB 3MV7A 5CCKH 2A6IA 4I0PC 2EC9T 1E6JH 2Q20A 1YMMA 2FD6H 3BSZL 3VD5A 1T89A 2DLGA 3CXDH 4Z7UF 5DJ8A 4PUBH 5LGJA 4QRPA 4ZXBC 5KG9A 2BJMH 1YNLL 4QNPE 4IHOB 5J89A 2FJFB 3WCYA 1DN0A 4R2GC 5SX5H 1HYRC 2Y9RT 4FABH 3LQAH 1WBZA 2R0ZL 1JHKL 5C08A 2GSIA 2OP4L 5EU6D 4HDIA 2NY0B 5SWQB 4MQXC 2PXYA 3MRNB 4O9HL 4FXKB 1RUQL 1R3HB 3VXSD 5EC1B 3WSQH 4MCZA 3C5JA 5GS2H 3PGCA 4HF5H 1GL4B 2CJUH 1U8OA 3UP1A 1NCDL 1ZA6B 3KYOB 2HT2C 3IGAA 3MQIA 3H3PH 3PXJA 1XGQA 3UX9B 3PG2A 4NO5B 1LP9A 5LGHL 3TBWB 4WUUE 1WIUA 4NHUE 5E1HB 4G8GD 1NGWB 2BCKA 3QFDB 3ES6B 3MRMB 5ADPL 4XMLL 2Z91B 3N0PB 4YX2L 1IE5A 4FQXC 3TO4B 3KLDA 4PJ9B 4ZO8A 4LCIH 1ODAA 1W0WB 3X11A 2VXSH 1IM9B 5I1DA 4LCWD 4P2YA 1GGBH 2D7TH 3BE1H 3MA9L 2VH5H 4HJJL 2BRRH 2D0GA 2VC2H 4N1CA 4A6YH 3MOBL 3QCVL 4G80B 5ID0A 5C0BD 4NZUL 3G6JE 4YC2C 5K9KB 4LSVL 4JCLA 1BF8A 5IW1A 4PGBB 1F3DH 4YK4B 3DX7B 4LFHG 1MSPA 1QBML 3CU1A 4MJ2A 2WUBH 4MQTB 2DQHL 5E8EB 5I71B 1N6VA 4XPGH 4IS6A 2FX7H 4YZFE 3BJ91 1YMHA 3KLAB 2HH0L 5J8OA 2XFXA 1ZS8A 2Z31D 1EXUA 1ZTXL 2FR4A 3TT1L 4HKBA 2E7LC 1VEPA 3TA3C 3G5YB 1CI5A 5H94A 5A3IC 2BY3A 1E28B 2GUOB 3C2AH 5ITFB 4DZ8A 4G7VH 1NMCB 1U3HA 4I18A 4ELMF 2MKWA 4ACPA 4L4TB 4EQ3A 3V9FA 1QEWA 5TPWH 4AM0B 1JTOA 2AJZB 1Y0LA 4JLRA 1OTTD 2N7BA 4J6RH 2DBLH 2ZSWA 3L1OL 1N64H 5GSVB 1AFVL 3O3AB 4CN1A 1JRHH 5BOZG 1Q9OB 5GIRA 5KJRL 2K9UA 4A2MA 1Z0NA 4IBLT 1B2WL 4E5XB 1HXMB 2LVCA 3ARZA 5FO7B 3GUTB 2X4QB 4I2XB 2ERJC 1R0AL 3WN5C 5TE7H 3VCLA 1IEAA 4W4NA 1HH9B 2BNQD 2EICA 3LSOA 3KXFD 3Q6FB 2HJLB 5EU6B 4ALAH 3OKMB 1KXQE 2A1WH 3GNML 2F8VA 4GKZB 1EK3A 2AJVH 3TJEH 4F7CA 4QXUH 1E4KA 2W1NA 5HPMA 3E1F1 2R4RL 4PJGE 5ISZA 3KPMA 4JO2H 5GGRA 2ZUWA 1MNUH 1XMWA 2NY5C 4ONGL 5F6HI 3RIAK 1A2YA 3L3JA 3U48A 1S78D 3P0YH 4IIQA 4JPKH 3V7MA 3SE9L 1MFBL 5DO2C 2CLVA 3NFPB 5E5UB 2VAJA 2VDMH 5GRYA 3LQMA 4G8GB 1S9KC 3FQRB 1T3FB 3EO1B 3M8OH 1MRFH 1C5CL 1DBMH 3PL6D 1K8DB 1ZV5A 3P0VH 4LCWB 4N0CC 2DI8A 4X5XB 4Y5XC 4ZUTA 4FTVE 2PN5A 1TZHA 3B5GA 5FYJD 1NKRA 3ARFD 2X05A 3D3VE 4JFZH 3GDBA 4R6UA 3N1QC 2CKBA 5KVEL 1UB6B 4OLUL 1ZVSB 1NJ9A 3ZDYE 4L5FL 4HZLA 3SDCA 1KPUB 3VXME 3WXVL 4HQQL 1KACB 4PGCA 5IB4A 4CVZA 1NLDL 4X5WB 3HC4H 1KPRA 1T6WA 2WK2A 3JUZA 3GRWA 1P84K 1JUFA 4XAWL 3BPOB 1YJDH 3BVNB 4D3CL 4QXTB 1HCVA 4YHZL 4H1LB 5F3HB 5BXFA 2Z31B 2B4CL 3HNVL 1KNOB 3HUJF 4OIIL 2XOTA 1P7QB 4WHCA 3LD8C 5DK3A 3NFNB 3QIWD 4PJIA 4NCDA 3DGCR 3KPSE 3RTQA 3VFMB 5I0DA 3DYPA 1V3JA 1FFOB 1YN6B 4G8EB 3LQZB 4AIZB 4LSSH 1EX0A 2ZCKL 2F8OA 1G9ML 4NJAH 1RU9H 3RVXC 5EZJB 5ITBL 3VFSB 4RNRB 4WW2F 4F2MB 3QQ3B 4GW1A 3BDYL 4NM4L 1FNHA 3LPFA 4M6NL 4HLJA 2AAVA 1S7TB 3AREC 5ERWA 4KK6D 3MNZB 4AH2B 3V2AR 1JGEB 4LSPH 1HDMA 1W72A 4XVSH 2BDNH 4MA1B 5E99H 3HUJA 4R7DA 1BQHA 5HGAB 2GT9B 5T1DL 3DRQB 4FQ1L 3LEXA 3CSBA 3D2UD 4V1DE 2BNQB 4PR5A 4LHUD 4P57A 2W0FB 3KXFB 3RWGA 4NQCA 2V7HA 3FB7B 1JF5A 2EXYD 1NCBH 5FGRA 4PRIA 5IUSA 2UWEE 4NNXA 1XGRA 4Y2DC 4I13B 2AV7A 4M43L 5FB8B 1HHIB 4RFEB 1CE1L 2VISB 4UB0L 3VG9B 3QRGH 1YDPA 5FGCB 2Q6WA 1AXSA 4HH9A 4CVXB 3V5HB 3FQXA 1BM3H 3WHE1 4JFXA 4OFIA 4PLOB 4D8PB 1IGIH 4P3CH 4RDQG 1UWGH 3BW9A 3SOBH 4RIRB 2FJHA 4TSBL 3IVKA 4G7YH 2VXUL 3CDCA 4BFIB 3PL6B 5DHXB 4MNHA 2XACC 3QIBA 2A74B 5IEKA 2FL5B 4LVNB 1FNSL 1QKZL 4MJ5B 3BYYA 2WBJA 3FFDA 1A7PL 4U0RC 1P2CB 1U8NB 4O2EB 2P8LA 3HC0B 4YHNA 3V5DB 3ARFB 3LN5A 3BRGC 3DMMD 3U1SH 1JCKA 4I3GA 1RZ7L 2Y72A 1W8OA 1WEJH 3HZKB 1PY4A 3H3KA 4FNLH 1G9NC 2DQIL 2EZ0C 3FQWB 4P2CG 1QBLL 1BVLB 1P84J 3ZZ1A 5TJWK 1VKXA 1SHMA 1H3VA 2FECL 4WI2A 1JI1A 5CJXA 1K3ZA 5E8DL 5CJ8A 3SE3C 4UUJA 1R3JA 2XWJB 4Q58C 3VD7A 3KAAA 4HFWB 1J7VR 4LK4A 5B38G 1CF8H 5JOEA 3ELAT 4KVCH 1UJTA 1GPOL 3QDME 3BH9B 1QYGL 1O5DT 1T04A 1B0WA 1XGYL 5C8JA 3QIWB 1KOAA 2W9EL 3TPUE 2DQJH 3W82A 5I1LB 1CCZA 5D5MB 5DJXB 3U4BL 1G6RB 4OSUL 1JPTH 2X1XR 5BRZA 2X89D 3OB8A 3BZFB 4U3HA 5HDQH 3MRQA 4PGJA 4HS8H 2XQYG 4ODTL 5DFTA 4M6OH 5KW9H 5HVGB 2VO5A 3PDGA 1A14H 2VUYA 4PJCF 3KJ6H 4OKDA 1C1EH 3MCLL 1OPGL 5AZEL 2P24B 4KQ4L 3GSUB 5CINH 1CFQB 5T5FL 1DVFD 4CADB 3OXSA 4TUJA 1E4JA 3O6MH 3HC3H 2NCMA 1KBGL 2W60A 4OZFG 4OZIA 1BF2A 4LHUB 2FJGB 4KQ3L 4XCNA 5TF0A 2DL2A 4QOKA 5ICYB 4PY8I 2E7BA 1T1WA 3O6KH 2V2WB 4S1SH 3RWFA 3PV6A 1TNNA 2X1QA 1IL1B 4PJCA 4NN6B 4TVPL 1OGAA 5I8KH 3JSSA 3OZ9L 5ENWA 3CUPA 5E94B 5C0AE 4EQ2A 3MV8A 3S5LB 2XXCB 1JN6B 4XP6H 1RIVL 2YN5A 2Z0BA 3KPQA 2E8ZA 4YXLL 4P5KA 2H3NA 4JKLA 2I60H 5F21B 3BH8B 4G42A 4CW1B 5IR1B 5EBWA 4BSJA 4L8SA 4HUUB 3RNQA 1A1NB 3QG7H 3GI9H 3O45A 4O02H 4JO4L 4RFNC 3VGEA 4CN4A 5LXGH 2DKMA 2DICA 5DRZB 4HEME 4RRPG 3V6ZB 4BKLB 1NAMA 3BZEA 2HJKB 1TCMA 4KTDH 4MNQD 2FYYB 2UVEA 5TFSL 4JQXC 4ZOCA 4BK5A 3ARUA 4PB9H 5GS1C 5I75C 4XNZB 3QJFB 4APQD 3FO2A 2HLAB 1T0MA 2FX9H 2Q8BH 5DI8A 5LBSH 2BX5A 4YPJA 2YPLD 1NC2A 4WO4D 5FGBC 3P9MA 4NKOB 1HOCB 1QG3A 4N0UA 1RAMA 5I1JH 1OWRM 3IJSB 5L6YH 1X9QA 4R9HA 4ZDHB 4DVRH 2NPLX 4GH7B 1L9NA 2X9WA 4YDVB 3UTPD 4RFOH 1ROWA 4AL8L 5D2LE 1KLGA 4S1RL 4Q9QH 4ZTPL 3NIGF 1TNMA 4KJWD 4UTAL 5F72S 5E6IC 2ATPA 2FB4L 4CVWA 4PG9A 4JN1L 2AK1L 4OFVA 1IFHH 4WDIB 2PYEE 1MI5E 5B4MC 1BLNB 3TVMA 1KF9B 2OZ4A 4KGJA 3BGMA 1WCBB 4UINL 2I07B 3A6OA 4L4VE 1S5HA 1QVOA 1UXWA 5K9QI 3MFFA 3UYRL 2VAAB 2VZVA 2X1WL 1DVFB 3DSNA 3FONA 1LO0L 3RHWK 1G9NH 4ORGB 3QAZB 4XXDB 4U1IB 4OJFL 4C83B 3LS4H 4JRXA 3RA7H 3OKOB 4XWGH 5F7UA 2IJ0C 2APVA 4TNVK 3GMPA 4UDTA 1YEKH 4YXHH 4M6ML 5C0DB 2VLJE 1N3NA 4Z7NF 5JQHC 2H32H 4H25A 3M17B 5F1SA 1CVSC 4MSWA 2WQRA 2B1HH 2CKBL 1VEOA 2ICWI 2PYFA 3PWLA 2BNRA 4X6DB 5EO1B 5JNYB 4XCCH 6FABL 5ADOH 1HNGA 3KR3H 3PP3H 3KPRD 2KPNA 2VXTL 1FGVL 5SWZE 4TUOB 1A7QH 1CFNA 3E8UH 3UPCA 4R96A 2FJFA 2YWYA 3IXAB 5LKNA 4LKXB 1XCQA 4U6TA 5L8KB 4PGDA 3GMRB 3B2UD 1BP3B 3LIZH 3UTTD 2FNBA 2VL5A 4JDTL 5J56B 3VXPB 2OJEB 4MLSA 1CFVL 2HAZA 1BFTA 5EC1A 4WWKC 5CGMA 3C5SA 4UIKL 3ZKNC 4XNYL 5FXCH 4EN3A 5JXAH 4IDJH 1KB9K 4ONFH 1KXVC 3VXUE 1ZHBA 2Q8AH 2NY7H 4OCRL 2JJWA 5C0JA 3WLBA 4TULH 4NO5A 1ZGLM 1FC1A 1NBYA 5BMFH 1DBBH 5FUOH 4F57H 1I8IB 1W72L 4D94A 3MLZH 1CU4H 3DURB 1RIHL 4PJDE 3QFDA 3ES6A 3MRMA 3CVHH 4NCC1 2Z91A 4APQB 4C4KO 3JTCA 3VI3F 5CEZH 1N7MH 5J57B 4QXGH 1JYWA 5ID1A 3ZE0E 2YPLB 4P59L 1BAFL 2GY7B 4ISVA 1U2CA 4WO4B 1CICD 3MGOA 4EIZC 1YQVH 5E8PA 3SO3C 3ZSTA 2PCPA 3FQUA 1NGZB 4M62L 1CFBA 3B9KD 2CR3A 3PQYE 4G80A 3EFDH 2A9ML 4JG1H 2MPAL 3AM8C 1KENL 5I18H 5IT2H 2AS5M 5K9KA 1KTRL 4MD4A 3CFEA 1DFBL 3ARDC 3PGFH 1PG7L 4I1NB 4LLYA 5D7IE 2BFVH 5F7LB 2LV4A 2OM5A 1BEYL 4M7LT 4W6WB 2VLLB 3ILQD 4MB4A 4P3WA 1KJ2B 5DYOA 5IK3A 4UOJA 3HCVA 2CDEB 3CSYA 5FYLE 3RDTC 1U8JB 2NY6C 2IH3B 3KS0H 2UYLA 3P4OA 5MEPB 4UQ3B 5F1NA 1BWWA 1T83C 2XV6B 4JQIH 3P4MA 3WNLA 4XPHL 5BO1L 1F4AA 4GQPH 2O26U 2D7OA 2JJTA 5E2TL 5IKCA 2K7QA 1R5WB 2HT4C 3WJJC 3VXNB 4PGZA 2R0WH 2EDKA 1TJIL 2GUOA 1X5ZA 3RJDA 3TWCL 3GBML 1MHEB 3IFOB 3QDHA 4M61A 4HIIB 2XQBH 2AXHA 5IW6B 4AQ1B 3NH7L 1AO7D 1PQZA 2HTLD 4QHLB 5GGQL 1Z9SA 3T3MF 4GG6F 1EGJA 4PJ7A 4M7LL 1RJZB 4PP8C 4U7KA 1T2QH 1CIUA 3KPRB 5TE6L 4OF3A 1AGCA 5HVWA 1B4JL 5FO7A 1JBJA 4ZQKB 3U9UB 4I2XA 3W0WE 4EOWH 4YE4H 5FHAH 3UDWC 5DWUH 1SEQL 6CGTA 4P23D 2P7TB 1HH9A 3LKSB 3O2DA 3UTTB 1F4YL 3Q6FA 2HJLA 5EU6A 1C5BL 2FSEB 5I8OL 4HC1H 3VXSA 1UFUA 1KB9J 3KHQA 3U82B 4ZS7L 1TQBC 4PJBA 3CZFB 1IGMH 4X6EA 1I1FB 2D03H 1SEBB 1AGBB 2VIRB 5DD0H 4DTGL 2ZNWA 4PJHB 1ZHLB 3O4LD 2OL3L 1VHPA 3IF1A 4FXGA 2AABL 3FKUS 1FAIL 5L2JB 4KJPC 5DTFB 3CX5K 2DI9A 4XMPL 5CJQL 4OLZH 4MAYD 3V4VL 5C0FB 4TOYH 5IJVB 1I7TB 4ZYKA 3AMKA 3QO1B 3W39A 1K8DA 4BH8A 1CICB 4Q2ZB 2XTJD 4K94H 3ECBB 1KTLA 4QEGA 1RFDL 4MXWL 2P8MA 1XR9B 3B9KB 3PWPE 1E6OH 3GSNB 3AU1B 4KUZL 5C0BA 5IQ7H 1FPTL 3BSZH 4DKFH 3SGDI 4IM8A 3KWWA 3MV9E 4XBEH 4MJ4A 3VWKC 4KAQL 4YBQC 4Z78A 3DUSB 3RWDB 3TN0A 4E0RB 1LNUB 1YNLH 1KPUA 2BY1A 1OAYL 2G60L 2HVKA 1FYHB 2R2BB 3GMLB 2ZOKB 2MJWA 4MJIE 3RX8A 5ACMA 3DWTA 3WHE0 3EJJX 2R2EB 4QXTA 4POZD 3QUMB 1RUAL 1TQCC 2J4WL 5BV7C 5F3HA 1I3GH 3H9SD 1KNOA 3D69A 4PYHA 4HV8B 3KPLB 3RWEB 1LGVA 1EEYA 2APWA 3F7QA 1JWMA 5C0CE 3UJTL 3ZHLA 3P30H 1SBSH 3VU2A 1NAML 4OFDA 3QEGH 3DV4B 3UTSA 5A1AA 1K4CB 1A6TA 1M7IB 2EE9A 4LLUA 1GGYA 1I7RB 2B4CC 1AO7B 3MZTA 4OCYH 3GJEB 1T1YA 5IFAH 2FGWL 4QGTA 1F8TL 2ZCHH 2R1WB 2J5LC 1W0YT 3BN9D 3WDHA 3IDIB 2EH8L 4LCCB 4LP4A 5JIHA 2FATL 3HLAB 3ALPA 3GJFB 3RWIB 1I8LA 3QHFH 5E4IA 5LWYL 2UZIH 4Z5RA 1G9MC 4AT6B 4GLRH 3B9DA 2E7MA 4KKAD 5CIPA 5BVPH 4OZ4B 3FAXA 2D7NA 3MA9H 1JNHB 4P23B 3SCMA 2Y7QA 1S9XB 2ZWLT 3F58L 3OGCB 2W0FA 1UM5H 2X4NA 3FB7A 3QQ9D 4BZ1H 3G9AB 4C56E 4JREC 2NYYC 1CFTA 1KULA 1YEEL 1G7HB 1HHIA 4RFEA 1T80A 3I50L 5C6TL 3N9GH 2E9IA 4JFEE 1PKQE 3VWJC 1DBAL 2OZ4L 5DZOA 2RQ8A 4O5LL 2EEBA 1S7RB 4L8CB 4JY4B 3CX5J 3C5ZD 3O4LB 4ODXB 2EE2A 1FYTA 1A6UH 1EVUA 5IBLC 4NDMA 3X12B 4D8PA 4PREA 3I6GA 4WUUD 1KT2B 4LSQH 1PG7X 1JGUH 3SDDC 3UMTA 4RIRA 5HHPA 3N50A 3NGBB 4MAYB 1T7YA 1NSNH 4QRRE 4W81A 1IAOA 5CBAB 1K8IB 2PO6C 1INEH 3OX8B 5FUCE 5JW5A 4PRAA 3MRDB 2XTJB 2FL5A 4F37K 4P49A 4MJ5A 2Y5TA 2ICES 2GTZA 1B0RB 1EZVX 1P2CA 3MJ8B 3L1OH 5HY9B 1D5ZB 4K2UL 4WU5B 4EVNB 3V5DA 3ARFA 4HHAA 4YHML 1IGFH 3MBXH 2GQHA 3DX8B 5HYSA 3FHQA 1CXHA 3HZKA 4NQDE 1S9YB 4E42A 1JNJA 3FQWA 2IAMD 3BFOA 1MH5B 5HVHB 1KSRA 4GS7B 1E0OB 5IV2B 4LLMA 1G7JA 3IFLH 1FVCA 2EDDA 1RZIB 2CLRB 4CL7A 3THML 5D93B 3X3GL 4HX1B 1T89C 1HHJB 4IOSD 3D9AH 1NFIB 3QWOA 1RURL 4HUKB 3VXOA 3H9SB 3SE4C 1YEJH 4YQXH 2R4RH 5CUSH 4Q74A 3QIWA 2OTWA 3RIAF 3T65A 5F7YC 5DQDH 1RVFL 1H5BB 3C8KB 3E6HA 1PLGL 4JR9L 4LP5A 5KSAC 2PXYC 3T3PE 3RKPA 3BZFA 4PJ8D 4RMWA 2JTDA 3FZUD 5DJZB 3FT2A 4H26A 4WWID 1FLTX 1RPQA 2P24A 5T3XL 4DEPB 1BFSA 1CFQA 5DRWA 3QIUD 4LIQL 3CDFA 4G6AC 3L7EB 4ZUUB 1ZHKB 1AHWB 1AGFB 3GIVA 4QHMB 3D2UA 3WL9A 4MA8L 1GGIH 1W0VB 3C8HA 5F3BA 2DI7A 3N1MC 4LEOA 5CFHA 5E0QA 3VMPA 4MJ6A 1RZFL 1FLRH 5I17A 4PJXE 4AMKL 3G6AB 5BV7H 4OM1L 2V2WA 32C2B 3QUKB 3QHTC 2HMIC 2P49B 5I1KH 4DGVH 1VFOA 4EEEA 1IL1A 4N0FA 3N85L 3GB7B 3LEYL 5EO9A 2DWEB 1FL3B 3IDMA 1X6LA 3C5ZB 4EI5C 1A9EA 1VADA 2EYRA 5E94A 4WUUB 2B4CH 3DHJA 1JN6A 4NHUB 3SDXE 2DLHA 3WKMH 2HWZL 5JR1H 4U6XA 3LKPA 5JOFA 3EYVB 5CKGA 2OJZL 4KWUA 3WFHB 5JPNB 1N8ZB 2HFFA 4HIHB 4QRSB 5D72H 2B2XL 2ORBL 1J0KA 2CSPA 5K9JL 2H9GB 4S1QL 2AXGA 1G9MH 4JZJC 4UNTA 3EO0A 5DRZA 1ACYH 3V6ZA 3NCEB 4FTVD 3MX0A 2CUIA 3HAEG 2HJKA 1SJHA 3EOAA 2AEQL 2CK2A 1EGJL 5DF0A 3DMMA 4M6NH 5I1IH 2FYYA 1U3HC 2OTPA 1MF2H 1TVBA 3VFRA 4NZJA 3D3VD 2B0SH 2RAMA 1UQSB 2A9NH 3HA0A 4G5ZL 1P9MC 3G6JB 4UTBH 2IAMB 2DLIA 2J3SA 5GISL 2C7UB 2KL6A 5EA0H 4C57C 4PRDA 4XI5C 1DDHB 1YZZA 1MOEA 3UZVB 3VXMD 4BA8A 1G7LA 5M94B 5DC9B 3O2DL 3MLSL 3ZTJG 5L88L 2NX5E 2P46B 1HOCA 5EZLB 5K9QG 4R4NC 3IJSA 1U8KB 2DQTL 2C1PA 3AGVA 3EFFA 1GAFH 4M43H 4UOW1 3ZDZE 3T0DA 3HKFA 1KCRH 3SDYH 5I1CL 1LO3H 3VE0B 5C07A 1NAKL 3KPSD 1I1RA 4YFLF 5AAMA 3EHBC 3FRPA 3U0TA 5FCUL 2X89A 4X80L 2EC8A 3GGWB 3QHZL 2YXFA 4PV9B 1NQBA 4OFKA 3QRFM 1XF3B 2W9DL 3O3BB 4PJ8B 1QO3A 1MCRA 1A3LL 4R97B 1EUUA 1AC6A 1WCBA 3ESVF 2Y23A 4P9HC 5DK2A 2I07A 4X9FA 3CXHK 3H6JA 4L29A 4OIAA 1INDH 2BC4A 1AJ7L 2CIIB 2VAAA 2GKIA 2DQUH 1WVZA 3QIUB 4GFTB 4J12A 1NGPH 4JM4H 1X44A 3MA7B 5HHNA 1IC7H 2R0LL 3WFBH 2LABA 1IEHA 3LPWA 4U1HB 4PRBA 2HT2D 3VFNB 1KN2L 3RL1B 4V1DD 5C0DA 2NQCA 4D0BB 2MTPA 4JM2F 3G04B 3MCG1 4XTRD 4RMSA 1YN7B 5HGHA 5EUKA 4HXAL 4PJGB 5DJ0B 3HR6A 1W8NA 3J8F7 3O2VH 3C6SB 2RB8A 3H0TA 5E8DH 3RNKA 5D1QB 1PZ5B 4XX1G 4KI5C 1TPXC 2V5YA 3SQBA 5JW4Q 2A0LD 5CJOL 1BQLL 1IEBA 3F7YA 3VXPA 3HZYB 1HI6B 2PNDA 2R0KH 2ZSVB 3QULA 4OV6F 1PX3A 5C3TA 5J3HD 3NVQA 4FQJH 3O81A 3LB6D 4G6JH 1NCWL 4ZO6A 3MV7E 2V17H 4ZFOA 4FTVB 4JJ5A 4QWWD 3KPNA 4DN3L 3EGSA 1YMME 4GQ9H 4MNQA 1S9WA 4M7JL 3BXNA 1LE9A 4RGMB 3NCFB 5DURD 3OAUL 4U1GC 5J9PB 2VN7A 2RGSA 3D3VB 3JV4B 4QRPE 1OPGH 5AZEH 1WWWX 3TA3D 2NY3B 2EO1A 5IQ9A 4LCUB 1ZT7B 4P46A 1IQDA 5C08E 1OAUL 3VXMB 1IKNA 4OV5B 4WTZG 4M8QB 1SYSA 2ZKHH 3QNXB 4KQ3H 5DS8B 2WWMC 2YPVL 1HEZA 5E08H 5ALBL 4ODHL 3LPGA 2IFGA 4MGXA 2NXYC 1MFDL 3QWRA 5DUMH 3SKMB 3RQ3A 4H0HB 5B21A 3QDMD 1MY5A 2A83A 4NRZB 4WEBL 5KVDH 4POYA 2AJ3B 4DGIL 3KPSB 4TVPH 4QTHA 4G9FA 5DR5L 4NJ9L 3CSPA 4MXQD 2D9CA 1YY9D 3CXHJ 4R2GB 3BP5A 1IT9L 1RK1B 2BRQA 3EYUL 5T3ZH 4J3TA 1U8JA 3F62A 4X7SH 2VDKL 3D25A 1JK8B 2YC1B 5FDWB 2IFFL 5DHVB 4G9DA 4KROD 4JO4H 1A3RL 4XP4H 5DHYB 2QSTA 1C08B 3P4LA 5I73B 1MHEA 5J0BA 2X4SA 1JYNA 4OCNC 3TEUA 3MOQA 3L7FB 4V1DB 1FZKB 5IW6A 2BSTA 4JFPB 4X9BA 1QPPA 4D9LH 3GIZL 3G5VA 3QIBC 1CYGA 3TIEA 4K7PX 2MCPL 2UWEB 4DW2L 2YEZB 4JPWL 5D7SL 2R2CA 4GMTH 4ZAKD 5F88B 4YNYB 5I74C 3KPRA 3CLFL 2BVPB 1FO0H 2WBWB 4N0CD 5C6PB 1Q9LB 1R5VB 3C60D 1I85A 2NY2D 5C0AD 3MRIB 4YH6A 2YOCA 4P2QA 4K8RD 4RMQA 2AEPL 3CMOL 4P9HH 2J88H 4O4YH 4S1RH 1J1PL 4DJMA 5GGUA 2C3XA 3RUGF 3PP4H 4U1NA 1NDGA 3CZFA 3MMEB 1I1FA 1KIRB 5I8EB 2OI9B 2VXQL 1SEBA 5H2BA 4CU7A 3LV3B 1B0GB 2DWDB 4J3UA 4E41A 5INDB 3FT3A 5DURB 3W9DA 4PP1C 5B38B 3MV01 4ZFZA 1QQDB 3QUYD 5L2JA 3GHEL 3O3DA 3RHWF 1HILB 5B8CB 3SBWA 1A4KA 4XNMA 3C08L 1KUMA 2ICEA 3TA3B 4TNVF 5I6XC 1JE6A 4KDVA 1TIUA 1CDJA 4GKNA 2Q1EA 1LDSA 2QJDA 2JJSC 2VLKA 3QO1A 1WBXA 3UCRA 3WIFB 4ZTOL 4HPOL 5AWNL 4WIQA 3CC5B 3R4DA 3ECBA 3FTGB 1CGXA 4UIMA 1UYWL 3DYMA 1WZ1H 2XIDA 3OKKA 1ZOXA 5EIQA 3QDMB 2IPKB 1NKOA 3TPUB 2J6EH 3GI8L 3S35L 3STLB 5D6CA 3RWDA 1HHKB 4OLWH 5C09A 1G0YR 1LNUA 5HHQB 1U8HB 2GAZA 4OZFB 3VD9A 1FN4B 2R2BA 4W6XB 1MJUH 2PYED 5F7KC 4TTGA 4YIQA 3QNYA 2NLJB 1RY7B 1UWEL 2R2EA 5F7WC 4FA8A 5I8CB 2OR9H 1MRDH 4DOHE 2R56H 4L4VD 2Q86B 4AIOA 3H7BB 3K3QA 4Y2DD 3RWCB 4KROB 4HV8A 3JWOH 3KPLA 4ZD3H 2FEDC 1NGXA 5FM5M 5BW7C 5E8OB 4PJEA 2AJYH 4OGXH 4M1CC 4QT5B 1GGCH 3A6CL 3HI6H 2NTFB 2H2PD 4KI5E 3NCCB 4YHKL 4L8SC 3TF7A 3UZQA 1M7IA 2ZUTA 4NO0B 5DVOA 5BZDB 3ZT7A 1AO7A 1EMTL 5KTEL 5DMYA 3QPQC 3HPJB 3BRDA 3STZB 5LAXB 4M3KB 4Y89A 4S0SD 4ZAKB 3GJFA 4U49A 3RWIA 1Q1JH 5EDXA 1U91A 1CGWA 3INUL 15C8L 1KXTB 4OZ4A 5SWZD 3RPKA 1JGLL 2UVFA 4Y5XB 3C60B 4HKJA 2ADJA 2NY2B 1JNHA 5C0AB 4Z76A 2WINA 3RY5A 4PJIE 4M62H 3OGCA 1G7IA 1YC7A 4KTYA 4X8JB 3KPOB 2A9MH 1IKFH 4M7ZB 1IAKA 1ETZB 4FFYH 2BSSA 2VB5A 5D9SB 3HZVA 4ZFFA 4HW6A 3IDNA 1A7NH 5DZLA 4NP4H 3H9HB 1FVDA 2CRYA 3QXVA 1DLHB 1MQ8A 1VFBB 1MEXH 4Z8FL 1T1ZA 3RAJH 3ZE1F 3OJDB 1WTLA 3CFJB 3N1FC 2ZJSL 3MRPA 1S7RA 4L8CA 3WO3B 4JY4A 3VXUD 4W6YB 4Z77B 3BKJH 3O4LA 1HHGA 2GJZB 1ZSDB 1BOGB 3QUYB 4ODXA 2HP4A 4KK8D 5HBBA 3ARBC 4MDJB 3T0XA 4YHYC 1KT2A 3HUJE 2JB6B 4LEXL 5KN5A 5KBNC 4N5UA 3P9LB 5DQJA 2Z4QB 2IQAB 4NQCE 4NZTH 1K8IA 4YWGL 1U3YA 4Z7OF 4PRIE 4KDTA 3UAJD 4YDKH 3RGVA 4X6BB 4OUOA 1A0QL 3NH7H 5EUOF 3NN8A 4WI8A 4PLJC 1J86A 1I3UA 4WU5A 4EVNA 3E6FB 4XCFL 3PQYD 4LSDA 4M5YL 1BQHG 2QQLH 1AD0B 4Z6AT 3JTSA 4ODUB 1DCLA 5D2LB 3PF2A 1P7KB 1MH5A 1PYWB 1MCJA 3UPRA 2I25N 3MLPA 1BD2E 3MRCB 1QR1B 3TV3L 1RK0A 1MCPL 2F5BL 2PYEB 1MI5B 1L7TH 4KV5F 4NQVB 1HH6B 5D1XA 3V52L 2FIKB 4HBQA 3O9WA 1CBVL 5FYLD 1OARH 5I8OH 1F90H 4OZGF 5EIVA 1KGCD 4L4VB 1JZ3A 3B5HA 1NFIA 5FKAA 5GRZA 2FDBP 3RZCA 1WT5A 1MHCA 4LPUA 4Y2DB 3WXWH 3RY6C 3RP1A 4HSQA 4X0KB 4ZFOL 2LAGB 4QO1A 3S36L 3PHQA 4CRPA 1CD1B 2ZG1A 4YDJA 4N90E 4PDCE 2NY0C 3C8KA 4UV4L 2OL3H 2VLJB 1UA6H 2HKHL 4KMTL 1UB5B 3AS3A 1KELH 3EYOB 3GHBL 4HAGA 3D39D 2J2ZA 3I85A 1D6VH 3OKLA 5EOCL 3G08B 3P73B 2ITDB 1U8LA 4X99A 1BBDL 5DJZA 3SKJH 1EFQA 5JQ6L 2VR9A 2R29L 3EO9L 5CSBA 3QYCA 3OTTA 1M7DB 3L7EA 5SWZB 1ZA3B 2MCG1 2UV3A 4PJFF 3KNBB 3W0WD 2OQJA 5C7XH 2HLFD 4NPYB 4U0RB 1AGFA 2J8UF 4QHMA 5IIEB 4AQOA 4YEFA 5MEOA 4NGHH 4UNUA 4UQ2A 3VFPA 5IB5B 2GITB 5BRZE 5KSUB 4OLYH 4UOW0 1KB5A 3G6AA 1HKLL 5EORL 32C2A 3C09C 2EXWC 3HMXA 1VPOH 2FLRT 5EOCJ 1KFAH 1HE7A 1E4XH 2OR7A 4QRTB 3VMOA 4JGJA 1FL3A 3BP4A 4FG6D 4NKQB 3VXUB 4ZUSB 4N8VA 5KS9A 5DD6B 1RZJL 5ICZB 4Q9BA 3S35X 1LVEA 4WUUA 4PJFA 2B39A 4NHUA 1RUKH 3MLYL 4YK4C 1Y6KR 3EYVA 4MWFA 4OZIE 4PJDB 1IAMA 4L8BB 1N8ZA 4QHNB 2ZCLL 1NAMH 3OG6B 4QRSA 3OAZK 3V0WL 2H9GA 4FFZL 1UWXK 4H20H 1MIML 1FNFA 4JDVA 4KKCC 4I9WE 1SQ2N 1IQWL 3VFOB 2JJTC 1RZGB 5JZ7C 4XC3H 3PNWB 4H8WH 1F8TH 1ZE3C 4PJCE 4HH8A 3PQYB 1OGAE 3PWPD 5I1AB 3EYQD 1XF2B 1NMCC 4J4PC 2I9TB 1MWAA 4MXVF 2IAMA 5D7IB 3MV8E 2UY7A 2VSCA 4R7NB 5SV4A 1JPSH 3VFTA 4FQIL 4RGND 2HT3C 3LKRB 1MFEH 2X70A 4MJID 5DJ2A 1ONQB 4X6FB 1J1XL 4U4BA 3TBTB 3AAZB 1J0ZA 1OVZA 4WJ5B 5C6TH 4M4PA 1HQ4A 1N59A 2OTUB 3MJ9H 3UC0H 4JFHE 4GAFB 3NTCH 3C6LD 1WC7B 1QFWM 5EC2B 3GJFK 3UROR 3O3BA 4PJ8A 3GMNB 1WFNA 1YYLL 1I4FB 3ZHDA 2C3WA 4LRNH 5INCB 2K1MA 1S5IL 3GBNH 4N0UE 1GHFH 2XY2A 4FP8L 4RFNB 3SN6N 3W0WB 3HS0B 3VJ6B 1M6OB 3DNKA 3MJ7A 1UZ6F 2XZCL 3DOSA 4XBGA 1UCBH 2HVJB 2O5XH 3GSNL 4OB5H 1RULL 2IG2H 3EOTL 2X4UB 2AV1B 2DTML 4HXBL 4JG0H 1VACA 1BX2A 4YDIL 1IILE 1LEKA 2XZZA 1EIBA 2VITB 2VDPL 1UEMA 3FQNB 1I8MA 3S96A 4LVOB 4JFED 2P44B 3OMZA 1CXKA 3THMH 5L7XH 4KRPD 1CDBA 1CL7H 1M71B 4G6KL 1INQA 3QUML 3PIQB 3ULSA 4JO1H 4NBXB 5DD5L 3TN0C 5JW4M 2JJVA 3OPZH 2EE3A 3I9GH 5EOTB 4F3FA 3OQ3B 1N2RB 4JRXE 5I19H 3BX7C 1H3GA 1EAPA 1IAIH 3HZYA 4QRRD 1HI6A 1RVFH 3BPOC 3NIGE 5A2IH 2F5AL 2DD8H 1R3LB 1U8MB 4JR9H 1CD9B 2J1KA 2Z31C 5K59E 1MREH 2BNRE 2VDOH 3NFSH 1AY1L 3WNNA 1YA5A 1P1ZB 2IBZY 5ETUB 3PWPB 2YK1H 1F6LL 3D3VA 5ANMA 2M1KA 4QHKJ 3MV9B 4NQDD 1SY6H 1OTTC 3VFGH 1DQLH 1KIPA 1AQDB 2HT4D 1ZT7A 3DECA 2QL1A 4M8QA 1KN4L 3NPZB 1TJHL 3GM0A 3FT4A 4MJIB 5D7JD 1QFUL 5DS8A 3IAPA 1U8PB 1ND0B 4Q7DA 4MA1C 4AMKH 2PF6A 3QFJA 1WV7T 3UZEA 1J10A 1CT8A 5GS0D 5J11C 3B2VH 3S88L 1U8QB 3SCMC 2V9RA 2AXJA 2AJ3A 1JHLH 1VFUA 3R1GL 3N85H 4QTIL 5FA4A 5FHBL 3W11D 4XHQA 4ODSH 4HJGB 3L3GB 5DRXB 1J05A 2O61A 3FFCE 3C6LB 1GRWA 4Q97A 4N9GB 4PLNC 1QA9A 2MOVA 4LLQB 3FJTA 3TFKD 4XPAL 3EAKA 5BJTA 2YMXL 5BQ7B 3MACL 3PHOB 5T3XE 2Q87A 4LIQE 2G2RA 2R15A 2M26A 1UH2A 5AYUL 3U9PH 1S78C 4K7PH 5FDWA 5L8JB 5K9JH 5DHVA 1MCOH 3H3BC 4WGWB 4B53A 4GSDH 1CGSL 3FMGH 1WJ3A 3IU3B 4HUNB 4HMCA 1H15B 4U6HB 4V1DA 1FC2D 3L7FA 4JFPA 1AIFA 1NLBH 3T4YB 4QF1B 3S97C 3QNZB 4HLZG 5ILTH 4C56B 4LVNC 1HK6A 4V2BA 1ZLVK 4OCXL 3TCLA 3WIHA 4WI9A 1HKFA 1QNZH 3HB3D 2Y36L 4N8CH 3T4AA 3AY4A 2ICCA 3ARFC 4YNYA 4JFEB 1PKQB 2BVPA 2BZDA 5J1SC 1GIGL 4U05A 3A6BL 4H0IA 4FQLL 1KEMH 1Q9LA 2V2TA 3SO3B 3MLRH 5I9QC 4ZFGL 1XH3B 1CLOL 3MRIA 2EDTA 3MXWL 2XT1B 1V3LA 1MRCL 5C2BL 1J9CT 1OLZA 4QRRB 1VGKA 3AB0B 5EIIB 2RJMA 1MELA 4UILL 1NAKH 5I1EL 5DDHA 4XHJC 4YBQD 4HAFA 1ACZA 1H8NA 1IM3A 4X80H 3REWB 4PBWD 3VXTB 3ZO0A 1C5DA 3S8WA 2OI9A 1KLUA 1TZGL 2CGRL 4O2FB 4PJ7E 4DFHA 4LSTL 3QIWC 5C70A 5J6HA 3TYGL 2C3VA 3EIFA 1QQDA 2XZQH 4JN2B 4AY0A 4RBPK 2FO4B 4NQDB 3B3IA 3T04D 7FABH 1MCHA 2E6QA 3WBDA 2KZWA 1VFAB 1Z5LB 2WZPD 1WITA 4LVHB 1C12B 3WIFA 5D7JB 1MQKL 1OGTB 4DN4L 5TF1H 4XB8A 3VXSE 4KK6C 3EUUA 5FYKD 4F7TA 2NX5D 1EBAA 4ZUVA 1ADQA 3QUZA 1MCBA 4RWYL 4GG6E 4PJBE 5C0EA 2JIXD 1NEUA 2IGFL 3REVB 3HMXL 4HXAH 1K2DA 1J1OL 4IRSA 1UKTA 4YR6A 4I0CC 4J3OC 4BZ2L 1UVQB 5IESH 5FUZL 1BJ1J 1U8HA 1Z9OA 4H1LH 1JVKA 5KVGL 1UEYA 2MWCA 1KTKE 5IF0B 1KCSH 4XVTH 3TZVA 5I8CA 1CDYA 4MCYB 5DUBB 5GRJL 2BSRB 5HPOA 2CDGA 2X44D 4Y5YB 4MVBA 3H7BA 4I48B 1K6QH 3WYRA 4WUKL 2VLMD 1CLYH 3OKDB 2VXVH 2WBKA 1MJ8H 5CMAB 3VWJD 5E8OA 1UZ8A 4N5ED 5C0BE 4P5TD 1A5FH 3TYFA 1VA9A 1C16B 2NTFA 3B83A 1NFDA 4NYLB 5D8JL 4DZBB 2A6KA 3GO1H 5BZDA 4N0RA 1MWAL 5EBLB 2HN7A 4PJXB 5T33L 3IJYB 4U1KA 3VH8B 3NZHH 5I16B 3QXAB 4JHAL 1J11A 1G1CA 3FOLA 5EOQL 1GC1L 1AI1L 3DMMC 4MNGA 1PKOA 4KKBD 5F7EH 4WHYG 3E0GA 5ALBH 3HR5A 5CJ5A 2X40A 2WW8A 3HAEB 5GSRA 1XR8B 5J4MA 2L4OA 4XNZC 1JI2A 1EHAA 3BESR 1UC6A 3SDXB 4FZEH 3KPOA 2OK0H 1AKJA 3SDAD 1F11B 1AE6H 1BZ7A 3QCUH 5FFLA 5J6GA 5E2UL 3Q2CA 5IHUH 3UTSE 4ETQA 3F5WA 4RMVA 1UJ3A 1E27A 1N0LA 3F6LA 5FDYA 4DCQB 2VKXA 5DR5H 2DQDH 4HFUL 3WEXA 4HWEH 1OSZA 2BHZA 5GGSY 3CFJA 5KANI 3MV7D 3VG0H 4HIEB 1YMMD 3QCTL 2AJUH 3AVEA 4ZOBA 3QUYA 4Q6IB 4NM8H 5E9DE 3MXVL 1TQCB 4GAGL 4MDJA 4RISH 4QRPD 4HKXB 2JB6A 3IJHB 3CLEH 4UZGA 1NCUA 4RZCB 2IQAA 3VRIA 2VUOA 3FB6A 5E56A 5FYJH 5KAQF 3KVQA 3ZKXB 3WIIL 2COQA 4KDWA 4QHKI 5DMIH 4OCWH 2NX5B 4XVJH 1I3RA 4I3RL 4C59B 3GIZH 1DVFC 1S8DB 2XKSA 4KUCF 1ORSA 4TUKH 2JIXB 4GRWE 3B4NA 4NT6A 3QAZC 4DW2H 1IGTA 5MP6H 4QHUA 2PTVA 3P11L 1AD0A 2DJUA 5CD3B 5D2LA 5GGTH 1FYTE 5JUEL 5B39A 2FLBT 2FX8L 3K0WA 3CNKA 2JB5L 4G43A 4P4RB 3MRCA 1QR1A 1R3KA 1WQVT 1OCWL 4XNUL 2PYEA 4N0YL 3OR6A 4RQQA 4NQVA 5IWLC 4JHZA 5E4EB 4GW4B 2XKNA 2FIKA 2ZPKL 3CMOH 4R26H 4L4VA 4JREB 1G6RH 1NMBL 1A7OH 4ODBD 4LAQH 3U0WL 4GKSB 9CGTA 1VFMA 3O11A 4Z7WF 1JZ8A 3F12A 1BJMA 4EBQL 1HSBB 3VWJB 3EOBB 1CD1A 4P5TB 1CIDA 2Y5EA 1JFQH 4EUPB 3R0NA 1BIIA 4PYGA 1BFOA 5MI0B 4HG4K 3JWDH 4U1SA 1NGQH 1IC4H 4XPTL 2Z8WC 4F7MB 2XA3A 4UT6L 3VFVB 4P4KA 1WTGT 1NC4B 1CLZH 3N06B 5HYSG 1T20B 1I8KB 3KYMA 4GOSA 2EEDA 2XN9A 4Z7WA 1P4LB 4R8WL 3GBLA 2BXYA 4IMKA 1PGRB 1TITA 2QTEA 4APQC 4YO0B 1YQ2A 4NBZB 2C9AA 2L0DA 1IKNC 3SDAB 2X42A 2J8OA 2GITA 3PWNA 3GI8H 5DJAA 2DQCL 2CRIA 4WO4C 3S35H 4TRPH 2QHRL 1G7QB 4M3JA 4OI9A 3D0VB 2GK2A 2X4OA 2F53A 1Z6JT 4IMLB 4NCC2 3HI5L 4X4YA 4XI5D 2N1KA 3WDIA 3MV7B 2A6IB 5CAYB 4QRTA 1XGTA 3VXUA 4EXPX 1YMMB 4ZUSA 5IFHH 4AIXA 5DJ8B 5ICZA 5HVFB 4X5LA 5LGJB 2EIEA 4QRPB 5F93C 1FBIL 1N0XL 1DN0B 1QUNA 4LGSB 4PJDA 4QHNA 2OXHA 1WBZB 3JV6B 1RSFA 5C08B 2XQYK 2GSIB 1QSFD 3VI4E 1KG0B 1RZJC 3V4PL 4HDIB 3GK8L 1R3IL 2QQKL 2O5ZH 3W2DL 2VRAA 4Z0BH 4MCZB 4Q9RH 3C5JB 3PGCB 1TZIA 3V4UH 4AK1A 3WIHL 1U8OB 4FZ8L 3RVUD 4ODVH 1I9IL 2NNAA 5AD0A 3IGAB 4D0CA 1V7ML 4NZRL 5F44A 2H1PL 3PABB 3EZ8A 2D4DA 4PV8B 3CFIC 1JGLH 5TH2A 1AH1A 1MPAL 3TNMB 5GS3A 4Q0XH 2BCKB 3LKRA 3T2PA 5KVFH 1DQML 1DUZA 2I5YH 3CH1A 3TBTA 3AAZA 2QADD 5I1DB 1Q9KA 1G1YA 1Q0XH 1QFWL 4K23H 3VFWA 1I85C 5TQ0L 2WWKO 3S5LG 3B2UC 3F7RA 2OTUA 5ID0B 3NCYS 4JY6A 2AI0H 4HG4J 1DUYA 1I7UA 1UM6H 4XWOD 4KI5D 1HHHA 3D39A 4LPXA 5K93A 4B5EA 4LEXH 5SX4I 3SDCD 1BIHA 3DYOA 3EJYD 2Z93B 4XPFH 1OTUD 3EYFA 1AQKL 4WW1B 3TBVA 2IMNA 1RUPH 4IS6B 3GM8A 1CK0L 1YMHB 3CGTA 2XFXB 1ZS8B 1EXUB 2FR4B 1ADQL 3SBWC 3MODH 4HKBB 5B3JE 3IRPX 4U2ZA 2QBWA 4MMXC 2A6JB 2HVJA 5C07E 3RTQD 1OP3H 2AV1A 4I18B 4JPIA 4LASL 1UACH 1Q72L 1CICC 4LPVA 3BPNB 1QEWB 1JPFA 3TESA 4WCYL 5T5NF 1Y0LB 1CGTA 3JUYA 3B9KC 1R24B 1RZKH 2IPTH 1KCUL 2BY0A 5GIRB 5ESAA 4GRMA 1ZK9A 1X3DA 3ZDXF 35C8L 4IOFD 2R1XA 2FBJH 1WAAF 4HIJB 1IC1A 3ILQC 4M7KL 1YEIH 3VCLB 1A7RL 1IEAB 1N2RA 1HN1A 3MZGB 5CZVL 3LSOB 4K9EL 1EVTC 3GSOA 4JY5L 4NQCD 5IMMA 1DLFL 4HMDA 3FN9A 4Y0GA 2DM2A 2GJ6D 1NGYA 4PRID 1YYML 1ZANH 1OAZH 2QV2A 4F7CB 3TO2A 3WS3A 1WFTA 2FGZA 3K2UL 5IMLA 5EOCH 1PW3A 1LDPH 4DQOH 3V6OA 3KPMB 3BKCH 3VGFA 3PWPA 5GGRB 4RGOL 1P4IL 4NWTL 1FNGA 1YNKH 3OJMB 1A2YB 3L3JB 4IIQB 3TF7C 1WAAA 4XPBL 1CG9A 2EDRA 2HTLC 3P2TA 1AQDA 3CK0H 5DD1L 4LSUH 2DRUA 1BD2D 2CLVB 4A2LA 4O58H 4NUGL 3OKEA 4LCCC 1F3JB 4MJIA 4WI4A 5E5RB 2HG5A 3AS1A 4OGYL 1F42A 3MUZ1 3FRUA 3TH3T 4DOHB 4PJHF 3ETBF 2QADB 3TJHA 1SM3L 4WI5A 1T5WB 1HKLH 5EORH 2IQ9L 4CJ1A 2WBJD 5JA8B 1TZHB 1ZLSH 4P23C 2F58L 4MNQE 3HE6D 4JB9L 4QLRA 1KJ2H 2UUDK 4HJGA 4Z7VF 4AYFA 1KC5H 4I4WA 3Q1SH 5DRXA 3Q3GB 4N90D 1RZJH 5JXEA 2CKBB 5JHLL 4CGTA 4HJ0D 4Y4FA 5F89A 1NJ9B 4HCRA 4HZLB 4YGVB 3SDCB 1GSMA 4PGCB 5IB4B 3PHOA 2F74A 2R4SL 1I9RH 4HWUA 4I0KA 4PTUA 1JUFB 1FNLA 1OW0A 3VD3A 1Z3GL 1F5WA 4M5ZL 5BXFB 3ZKQD 3NAAL 4P2OA 1WUNT 1GZPA 1J0IA 4XNXH 4MAYC 1H15A 5C9KA 4PJIB 3RTQB 4U1GB 3MNVB 4PP1D 2IBGA 4K3JH 4G9FE 1YEGL 4YHLL 1LQVA 5GJTL 2HFEB 1Z9LA 4JFQA 4KDTC 3LRGA 4XBPA 2XWBA 5BRZD 2XTJC 1MVUA 1KJMB 3GSXA 3LZFL 4M48H 3RGHA 2LFGA 3JV5A 3P4NB 2ZOLB 3IRZA 4GW1B 4NZDA 2Q3ZA 4JFEA 4FQIH 4KY1H 2A38A 12E8H 4OGZA 2XRAL 3HTLX 1YEDA 2AEIT 2BHUA 2P1YA 1HINL 5I2IA 2QR0A 2AGJH 5JW4N 3M1BA 1HDMB 4OT1L 5HVHC 4GS7C 4LGRB 1DQJA 4F15B 4TQEH 3HUJB 5J13B 1RD6A 4PBXA 5CS7A 5EFIA 4XP9L 3O6LL 3LEXB 5D93C 4C58B 1M05A 4PR5B 4P57B 5D1XC 3RWGB 2EC9U 4NQCB 2OXGA 3RU8L 2V7HB 3UPAA 25C8L 4POZC 1CR9L 4PRIB 3VXTA 4OD1H 5LGKA 3RZCC 1Y6NR 4I9WD 1WT5C 1XGRB 5H37G 4WW2B 2AV7B 4O2FA 1RV6X 2VL4A 1DBJH 5DMJB 5DEFA 3DTXA 1YDPB 4OM0L 4WI6A 4JN2A 4X6CF 4D9QE 5GJSL 4OTXL 2Q6WB 1AXSB 3RY4A 4UT7L 3CVIL 4YUEH 2FO4A 3ZYZA 4HH9B 3IS1X 4JKMA 1A21A 3DI2B 3MRLB 4JFXB 4LARL 4LU5L 3MV8D 4U6VH 3W81A 3OF6D 4DGYL 3MOAH 2WLZA 1BD2B 4P2QE 4LNRB 2VABA 3BW9B 1DP0A 2DS4A 3BIAX 3OAZH 1FZOB 4R4FH 1SBBA 4YAQB 4AEIL 2FJHB 1UWXH 2XXMB 2OYPA 8FABA 3IVKB 5D7JA 1J87A 3GSNH 4D9RE 4Y16A 4HK3N 2XA8H 3EOTH 3AUVA 4DEPC 5GZND 4MNHB 1RMFL 4KKAC 4Y8AA 5JIIA 1V7NH 5IEKB 1AHWC 2WBJB 3FFDB 5GHWL 1V5JA 3REVA 4E41E 5DMKB 2P8LB 2VDPH 3HE6B 2QKIA 4YHNB 3I75A 3HNSH 1F4XL 3LN5B 5I74B 3BMVA 4OF8A 4X6CA 3T0VA 3QQ9C 1X5LA 4R0LB 4JFHD 3ZYIA 3QUMH 1WIOA 3RVWC 4X9IA 3ZTNH 2EH7H 5DD5H 3TFKA 2AW2A 3WFCH 3UTOA 3WUWA 2JF1A 5HHXL 1VKXB 1AR2A 3UJIH 2VLKE 3EDJA 3GKZA 3RPIB 5DUBA 1FGNH 1EUTA 2ZUQB 1NC2D 2BSRA 3V5KA 3RUGE 4UT9H 4RAUA 3WD5L 4I48A 5C86A 3OWEA 2HFGL 2HRLA 2CUHA 2VZTA 2VDRL 3K2MC 4OQTA 4LDOB 1RIUH 4M1DL 1D6EB 4OGAD 1UENA 1T03L 5I15H 3LDBB 3GJFH 3VXQA 5EBLA 5C09E 5F1IA 5BRZB 4PJXA 3N1GC 3IAGC 1N5YL 3IJYA 4M1GH 2VWEC 1QFWI 3MRQB 2P5WA 3QPXH 5I16A 3QXAA 5I6XB 3TVMD 2EDNA 3LH2H 4GXUM 5KANG 5TQ2L 3PWVB 4L3EA 1XZ0A 2X9YA 5JLZA 2LU7A 5TDOA 4EDWL 2IAMC 4OLVH 5F6IB 3LS5L 1A4JA 2KQMA 4TUJB 3G5ZA 3VDCA 1A6ZB 4PJEE 1P5VA 1R5IB 1N6QH 1GC1C 4KTEH 2W60B 3GMQA 1N4XH 1F11A 1FORH 4JRXD 2BVYA 4OZIB 4QTIH 5EWIL 1T7ZA 2DL9A 4XCYA 4KJYA 4XCNB 2P48B 4L9LA 3FO0H 2W0PA 4BZYA 3QI9A 1T1WB 4H88L 1F13A 1ZVYA 3RWFB 3PV6B 3MROA 2FWOA 4HIEA 1I9JL 1X4ZA 2R2HA 4PJCB 5DEGA 4Q6IA 1OGAB 4ODWA 4WV1B 3V8OA 2ATKA 2NR6D 1V05A 3CUPB 3X13A 4IRZL 1MLBA 2NY4D 5DUPH 1S7QB 5E2VH 1GGTA 1WFOA 4MDIB 3MV8B 3FOMA 5AZ2H 1A1OB 1NL0L 5DT1H 3PE9A 4PJ8C 4R97C 3KPQB 2ZUYA 3FZUC 1OAKL 4P5KB 4ZOAA 5F6HJ 5EBWB 1A6WL 3P40A 2FHCA 3RNQB 1S8DA 3L5XL 3O45B 5HGBA 3CDGB 2AJSH 2G75A 3VFUB 4EN3D 5C92A 5HGDA 2XNAB 1A9BA 2X7LB 3FFCD 1MFAL 4I77H 1CXEA 4ERSL 4ZFGH 3VW3L 3JTTA 4GW5B 4XRCA 3FO2B 1T0MB 5CGYD 5CEXA 5DI8B 3L95A 2IC2A 1NBVL 2ENYA 2DDQL 5T3XD 1NC2B 1X5KA 4TSCH 1NANI 4XT1C 1FNEA 3U7YL 4GKSA 1J5OL 4IRJA 1DSFH 3WFDL 4FFWD 4N0UB 3G6JF 3BT2L 1TZGH 2CGRH 3EOBA 2H2SD 1MAJA 2DQGH 3RBGA 3MJGX 1BOYA 1KLGB 4NNYA 5SWSA 2WANA 1XF1A 3S37H 1MAMH 1L0YA 2ATPB 1BJ1H 3VDAA 2X6MA 3MLWL 1U6AH 5ELIA 2AJXH 4YZFF 3F7VB 3TVMB 4AEHL 4F7MA 4RGMC 5I1HL 4MAUL 4HS3A 5CP7B 1QVOB 2EKJA 1UXWB 2VLRD 3MFFB 1T20A 2V9QA 2ZUVA 5HI4D 3FONB 5FA3A 4K3EH 1IVLA 5DD3H 3S34H 3Q5YA 3U46A 1KCVL 4JRXB 5GGSA 3GMPB 4UDTB 1ZLVH 1N3NB 1G7QA 4H25B 4BZ2H 3QDJE 4IMLA 4GAYA 4HPYH 3OJVC 4MSWB 5FUZH 3IETA 4ELKA 1Y6MR 1MCCA 1A6PA 1HWGB 5KVGH 2BNRB 1TMCB 2HT3D 4HCRL 4KHXH 4QRQA 4TSAH 1JNNH 1SYVA 4O51A 5CGTA 2HYMA 5I30H 1XF5B 1L7IH 1H3PL 2NY4B 3WMSA 1CFNB 4R96B 1EHLH 4CVUA 1M4KA 3SKNA 4AENA 1XCQB 4PGDB 4A6YA 5C2UB 1PSKL 4U1JA 2X2YA 3JV6A 1CE6B 2HKFH 5D71L 5DJCA 2VL5B 1CXIA 1KG0A 4XH2A 4OIBA 4YHPA 3CU7A 2D0FA 4GUPA 2WMPA 4DAGL 3C5SB 2Y07H 2R8SL 2ADFL 1T7VA 2LU4A 1FFNA 4EN3B 3KLHC 5IBUB 4BQ9A 5I73C 3OV6A 2DJSA 4RBPH 1ZHBB 1FH5H 5KS9