4U1NA

Hla class i micropolymorphisms determine peptide-hla landscape and dictate differential hiv-1 escape through identical epitopes
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
278
structure length
278
Chain Sequence
MGSHSMRYFHTSVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPREEPRAPWIEQEGPEYWDRNTQIYKAQAQTDRESLRNLRGYYNQSEAGSHTLQSMYGCDVGPDGRLLRGHNQYAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAARVAEQDRAYLEGTCVEWLRRYLENGKDTLERADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, B-42 alpha chain
publication title A molecular switch in immunodominant HIV-1-specific CD8 T-cell epitopes shapes differential HLA-restricted escape.
pubmed doi rcsb
source organism Homo sapiens
total genus 81
structure length 278
sequence length 278
ec nomenclature
pdb deposition date 2014-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4u1nA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4u1nA01
3LS5H 5GGSA 1LO0L 4WFEE 2V7NB 3AROA 1BFOA 1CVRA 2Z8SA 1B0WA 5F6HI 3G04B 3QWRD 1M71B 1TQCC 4GRLA 3W39B 1GIGL 5J4MA 1RIUH 4QY8B 4YFDB 5IROA 4LLVA 1IC7H 1K8IB 5D7LE 3LN9A 3S97C 1H5BB 4DKFL 2BNUB 1MPAL 2VDLL 2AJVL 2XKSA 5E8NB 4I4WB 2VXQL 4KI1A 3GMQB 2UZIL 2YZ1A 4IRSB 4P3WA 1Q94A 3ARFB 4FFEX 1E28B 3L5XH 1UZ8A 3X14B 4P3CL 4PRIE 1LP9F 3QNXA 4WO4A 1CQKA 4OZFA 3KPSD 2UUDK 5I16A 1MEXH 2GCYA 3HE6C 3K1DA 1GPOH 4ZUWA 1FH5L 2C1PB 4G3YH 3VH8B 5IWLA 4LRIA 3B9KC 3WEXA 1YEDB 1N6QL 4XI5D 5DMGC 5KVDL 3TN0D 1AXSB 5TDOB 2CDEA 2FBOJ 4XVTH 5E4EB 3WFBL 4YK4B 4PYGA 1KTDB 1N0XH 3R4DA 5EU6B 3FRUB 4KJWD 1S9XB 3PV6B 1ZGLB 4M3JA 4U1IB 2VJXA 4J3OC 3PWPD 4KI5F 4A2LA 3QIUD 5FGCB 4O5LL 4WVRA 2VE6A 2GJJA 1HQ4A 1PW3A 2BY1A 4JR9H 5I2IB 1T1ZB 2FBJH 1HHIA 2ADJA 5SWSA 5F3BA 2PO6D 1QLRB 3F7RA 3W82A 1J05B 2VLKE 3RI5K 4LGRB 2Y5EA 4PGCB 1UZ6E 1NMAL 2DB8A 4ODSH 1U8KA 3HE7B 4JO3L 4ELMB 1IGTB 1PX4A 2GK2A 2RGSA 2JB6A 1YEEH 3TBVB 8FABB 4L4TE 4P5TA 1OTSC 1DBBL 4PG2A 3F7VB 2G75A 5GS2H 2WUBL 5JLZB 4P5KA 1MIML 4RWYH 1TCRB 5C6TL 5CBAB 4LCUB 1BZ7A 2V5SA 4RFOL 4HUWA 3GSQB 4R7NA 4LRNH 1MWAH 4KGLA 4UAOC 1JGUL 5E8OA 5D7JB 3HNVL 5LJYH 5HHPA 2AQ3A 4I3SH 4JFEB 5J13C 1JE6A 2FWOA 4MD0B 1Q8MA 2HFTA 1DBJL 5BO1L 2Y25A 3MRJB 5D1QB 3TBYA 4Y4KB 2VL5B 5CGMA 1SJHB 2VC2H 5EBWB 3MREA 4Y2OA 5C0EB 3UTZB 4K94C 4BQCA 3VFNB 4ZUTB 1RZJH 3O2VL 3P0YH 5IF0B 4Y2DD 3RVWD 2KKQA 2DI9A 3EO0B 3WFEL 2XA3A 5BQ7B 4DZ8A 3LOWA 2AJZB 1BIIA 5E9DA 3CC5A 3LV3B 4F7EB 1N5YL 1TZGH 3VFPB 4X4XA 1PEZA 5ALBL 1OGAA 1T22A 5F93C 5ID1A 5I19L 1XCQB 1HK6A 3VI3E 2V7NA 2R4RH 4ISVB 1FZJB 1HHGB 5F7WC 1A7PL 3G04A 3RZWA 3AS3A 3CVHL 1JZ5A 4OZHF 3W39A 3MRMB 5F21B 4QY8A 2E5EA 4R4FL 5HHOB 1K8IA 1T7YA 3OAYK 4OZFH 4RGND 3QT2A 2BNUA 5E8NA 1ADQL 4PRPA 4I4WA 3GMQA 3WUWB 4TUOB 1FSKB 1NUNB 3ULUD 3ARFA 2DQFB 1JZ4A 3X14A 3BAEL 3ZHKA 3B9EA 3DYMA 2NY3D 2EE6A 2H32B 1U8JB 3WHE0 4TPRL 2C3GA 5GGVL 3N1PC 4NRZB 3QQ3B 2C1PA 5BVJA 3VH8A 1KTLB 1YEDA 3L5IA 4LAQH 1T0NB 5T3XL 5DJDB 4C4KO 1AXSA 3IDUA 5DK2B 2D9QB 2V9TA 5TDOA 1PEWA 3B8SA 3R0MA 3ARBD 5EU6A 3FRUA 1S9XA 3PV6A 5ALCH 5E0QA 5E6YA 1TTGA 5FYLE 1U58B 1ZGLA 4U1IA 1DEEB 4NNPH 4BJLA 3TNMB 1MJ8L 4JDVB 2ZSWB 5GISL 1FAKT 1W0WA 5GS2D 1NGPH 3OB0K 3RWIB 5GGVY 5I2IA 1T1ZA 4LU5L 5CEYB 5KVEL 4H0HB 5D72L 1QLRA 1HYRC 3CLFL 2E27H 4R0LC 1J05A 1FGNL 5I1KL 3N9GL 5IVZB 3K3QA 4PGCA 1V7MH 2UY7A 5EO1B 4N0UB 3T2NH 1MAML 1QRND 4ELMA 1IGTA 4OIIH 3N06B 3MRNB 1C16B 2WBJD 3T65B 3ARBC 3TBVA 2UWEB 8FABA 2KQMA 4JO2H 5D7SH 1KN2H 5TH2B 3F7VA 1RZFL 3HC0B 4E5XB 4KRNA 5DC9B 1TCRA 5CBAA 3FN9A 4LCUA 4QXUL 3BUTA 3GSQA 4GRLD 4M7LL 4B0MM 1NBZB 5D7JA 4XP4H 4WCYH 3ZL4H 4DZBB 3TFKA 5EBMB 3WFCH 4JFEA 5T1DL 3DVIA 4UT7L 3U9PL 4E9LA 4D8PB 1G9NH 1YNLH 1H8NA 3VFWB 35C8L 3MRJA 4AQOA 5SX5H 1FPTL 4Y4KA 2VL5A 1SJHA 3TT1H 3MLSH 5B3JE 1ZANL 5C0EA 3UTZA 1DQML 3RKDC 3VFNA 2HT3D 4ZUTA 4G6ML 1VFUA 3SDXF 3V0WL 4ZTOL 5IF0A 3EO0A 1VACA 5BQ7A 2C26A 3HC3H 5B4MC 4EDXB 2AJZA 3KPPB 5I1HL 3U30C 3LV3A 4QOKE 4F7EA 5TFSH 1RZJC 3VFPA 1Q9OB 2XTJE 1MIEH 1Z3GL 2OP4H 4GRLC 1XCQA 3RWCB 2YZ8A 4Y8AA 1HHGA 2YOCA 2HKHH 2ZCHL 4OI9A 1D5IH 4LKXB 2QBWA 4MA1B 1ZLSL 3MRMA 2IG2H 4OFKA 3U7YL 4EVNA 1OCWL 3PE9A 5HHOA 4C56E 1TTFA 5I18H 1B0GB 2F5BL 3DSFH 2ICES 3I02B 4K55A 2DL9A 4HWBL 1E6JH 2BFVL 3WUWA 4WO4C 4N8VG 5GGUB 4XP9L 2C9AA 4AENB 3M17B 3UAJC 3VGDA 3K81A 5IWLC 4LRIC 2DQIL 1QSEE 5FA4B 1U0QA 1RIVL 4XP6H 2H32A 1U8JA 5E5RB 5C0ND 1MH5B 4KPHL 2BVTA 4ZODA 3QQ3A 1MNUH 3KWWB 5FM8A 3UBXB 4M6OL 1KTLA 1C5BH 4LNRB 2IAMC 1T0NA 3R0NA 5DJDA 5DK2A 4I1NB 2XPGB 3IJSA 4TVPH 2D9CA 3QG7L 2EZ0C 1E6OL 4YDKL 1TXKA 5HXMA 4MA8L 3VJ6B 1X44A 4LVOC 2FDBP 5KSUB 1U58A 2BHUA 1DEEA 3TNMA 4JDVA 2ZSWA 1F45A 4RISH 4G7YL 3BP6B 1G7QB 4PJBF 3LN5A 3RWIA 2ICWJ 4K7PL 1P4LB 3FFCA 5CEYA 1A6AB 4JQXA 3QZWG 5IJKA 3HA0A 1F2QA 4R8WH 4TQEH 3UPAA 3JWNC 5IVZA 2E7CA 1GCFA 1SM3L 1XR9B 2LABA 2N1KA 5EO1A 3WL9B 4N0UA 4P5TC 3EYOB 4YWGL 1IM3B 4PG2C 4HIHB 1C16A 2VDRH 3T65A 5E9DD 2UWEA 1A7RH 1EIBA 5BJTB 5TH2A 5IQ9B 4K7PY 4TSBH 3HC0A 4E5XA 4OCSH 5CD5C 4NQTA 1NGXB 4OLWH 3CLEL 1ZT4B 1FNEB 3RX7A 2VQ1B 4IRJD 4DZBA 3EO9L 4PGEB 4AMKH 3O2DL 5EBMA 3IFLL 4YHML 4PRPD 3C87A 1QG3A 5SX4H 4PTTB 2W9EL 1S7XB 1UWXH 5IESL 2P45B 3VFWA 4WHDA 1RVFH 3C9NB 5DXWA 4U05A 4KRPB 3ZE0F 4OAWB 4EDWL 3DX7B 1NBVH 3NH7H 1G9NC 4LVNB 4R3SB 3DUUB 1DQDH 1QPXA 2EECA 1P7QB 2V17H 1ORSB 3MMEB 3VGGA 3QAZC 3A6CL 5I1GH 4X5WB 4EDXA 3KPPA 1J1XL 4GMSL 4EOWL 3QFJB 5CJBA 4X6DF 3QH3B 1Q9OA 2R4SH 4F33B 3RWCA 1AQKL 4JN1L 3UTOA 2FNBA 1FIGH 3V0AC 4XPAL 2M2DA 1H5BC 1AO7D 1CXFA 2W07A 5FHAH 1OQOA 1WCBB 1E4KC 1NPUA 2R0ZH 1UVQB 1A6UH 4HAGA 2NXZD 3WFDL 2VZVA 4IRSC 5LWYH 3ARFC 4U2ZA 1B0GA 2DM2A 2H32H 3HC4H 3I02A 4G7VH 4UV7L 5CGYD 4M6NH 5GHWH 4NM4H 2PYED 5HYSG 1WZ1H 5DEZA 1OPGH 4D9LH 4O02H 4UTBL 5GGUA 1UM6H 4AENA 3F62A 5C0RL 1TJHH 3M17A 3MV8A 4XP1L 4X9GA 4JJHA 3F65A 4PJXF 5FA4A 5GRUH 4JANA 2YPLD 2WP3T 1A6TA 3D39E 1MH5A 2VDNH 3RGHA 4Y8DC 3KWWA 3UBXA 4FFVC 4LNRA 4XMKL 5E4EC 1OOAA 2NZ9D 3LHPH 4YK4C 4N90D 4KVNH 4M6ML 2W91A 3GBNH 2XPGA 1FFPB 2NR6C 5F7EH 4LASL 4HC1L 2DQCL 3VJ6A 4RNRB 5JXEA 2BVPB 3I6LE 5KSUA 2BNRD 4KDTA 5KSVB 1AR2A 5L8LB 5SWQB 1EUUA 1ZKAA 5D7JD 1UJ3B 5JUEH 1NEZB 1KIUA 2D0HA 3BP6A 5FYJE 1G7QA 4BH7B 4PDCE 3ZT5A 1P4LA 5GGQL 4KKNA 4ZYKB 3RBSA 1REIA 2CJUH 3IFOB 3HE7C 5DC4B 1MHPL 5FCUL 1XR9A 1D6VL 3N1MC 4R4ND 3WL9A 2NZ9C 5D2LB 1J5OL 3NCMA 3EYOA 1IM3A 3QPXL 4DGIH 1EHLH 5IGXH 5E2UL 1KGCD 1JWMB 1ZVYA 1T20B 3BPLB 1XGTB 3MOQA 3MRHB 2NYYD 2VZTA 3OQ3B 4UQ3B 4HKBB 5BJTA 5IQ9A 3LS5L 2ZCLH 1YYML 1MF2L 3TFKC 1T2XA 5L6YH 4OZ4B 3VRJB 1HILB 2ZSVB 3B5HA 1NGXA 1OQXA 3SQBA 4U2YA 5F3HB 1RIUL 1ZT4A 2AKRB 1FNEA 1DP0A 2VQ1A 3A6OA 3GZKA 4OB5L 1NC2D 1FLRH 5D1QC 1IKFH 2EIEA 4URTB 4Y4KC 1SBSH 4PTTA 1S7XA 1SMAA 3C9NA 2GUOB 4OAWA 5H35B 3DX7A 3TEUA 2YKLL 3DUUA 2I26N 5FM4A 2DYPB 1P7QA 1ORSA 4JFYB 3MMEA 4XB7A 4BA8A 1RI8A 5EN2B 2XQBH 4X5WA 3QA3B 3C2AL 3QJHA 1N8ZA 3VA6A 3QFJA 2APFA 1N26A 3QH3A 4I0CC 2C3HA 3S35X 4XVTL 3TT3H 4F33A 1FNGB 2XWBB 4F7PB 1BWWA 2W38A 1JTTA 3R1GL 2JE8A 4XB8A 5C9JB 1WCBA 2VXVL 2J8UB 1UVQA 3UTTB 4CDHA 1LNUB 3V7MA 3STLB 3UJJH 1FSKC 1F5WA 2FBJL 3FFCD 5FEBA 1RUQH 2AI0L 3MUHL 4CU8A 1G6RB 3SGEI 1SQ2N 3T2PA 1AC0A 4ODSL 5E2TH 5D6DC 2F58L 1LO5B 4GH7B 3O45B 2CPCA 4LHUB 3CMGA 1YEEL 5D71H 3JV0A 2NQCA 3IAGC 1GZPB 1FFPA 2IPUK 2R0LL 4OFVA 4GS7C 4JFXB 4RWYL 4C83B 4PY8I 4RNRA 5BV7B 2BVPA 2DBJA 4LRNL 1MCRA 1MWAL 5SWQA 5KSVA 1UJ3A 5EG6C 1NEZA 4BZ1H 5IJKC 3IETB 4BH7A 1SY6A 3SDXB 1NH6A 4JFQB 1M05B 4LIQE 4NT6B 2AXHA 1UGNA 5C09A 4ZYKA 1BQLL 4U7SA 3MZGB 2NW3B 1WIOA 1ZA6A 3IFOA 3MLZH 2MMXA 1EEQA 1OAUH 3MJ9A 4RWHA 2AXGB 3EOBB 2B2XH 1NGYB 5D2LA 5KVGH 4XCYB 2OK0H 5DJ6B 3SDAD 1Q9WB 4XNUH 1JWMA 1T20A 2VZOA 5DEGB 1XGTA 3MRHA 4UQ3A 4HKBA 5F96L 1NFDB 4P2YA 4N9GB 3P0VH 4ZO6A 4GRWE 2ZUSA 2R4RL 5GRZA 4MAYD 3SGDH 1WUNT 4X7SH 4OZ4A 3VRJA 1HILA 2ZSVA 4FQIH 5F3HA 4DQOL 2AKRA 1Q9KB 1L6ZA 2K1MA 5GGRY 3ARXA 4M8QB 4L3EB 3T2OA 4MQXD 1K4DB 4J8RB 1TETH 1CIDA 1OAQH 4JGJA 4RAUB 4ZTPH 5IW3A 1KXTB 3MV8D 3U0PB 1O7SA 2XN9B 2GUOA 5H35A 4M02A 3PL6D 2D7OA 4X7EC 5TPWH 1PLGH 2DYPA 4P49A 2Z92B 4QHNB 2WWMD 4JFYA 5JHLH 1E4WL 5KG9B 3SJVB 3NCJH 4LSPL 4JM2F 2BSSB 2HLAB 5EN2A 4LAQL 3QA3A 5C8JB 1N7ML 1EMTH 1J0HA 4JPVL 5F1IB 4GT7A 3MBXH 2Z35B 1FNGA 1MCEA 2XWBA 4HFUH 1NAKH 1A21A 2XZAH 4HBCH 4HJ0C 4TSAH 4F7PA 2FHFA 2E7BA 4E41B 5ALCL 4PRHB 4FTVB 4W4NA 4CU7A 5C9JA 4NNPL 5I8EB 5ABDE 4PLKD 5H2BB 2J8UA 3BI9X 3HNSH 3UTTA 1LNUA 1NGPL 3STLA 1QBLH 2C4FU 4MCYB 4DJMA 4F15B 2DJUA 3QIBB 3MQIA 2JCCF 1DUYB 3NCBB 4PBVC 4WDIB 4BQ8A 3FB6B 2CKBB 1UB6B 1OLZA 4OGYL 1X5HA 2X70B 4OZIA 5EUOF 1LO5A 4M7ZB 5E00B 1G7IA 3O45A 4LHUA 4HUVB 3GMNB 1YY9C 1X4ZA 4JO2L 3GMPB 2WP3O 1KN2L 4CJ0A 2VLMD 5HVHB 1GZPA 25C8L 2D03L 5JXEC 1SY6H 5D1XD 3KPRE 4KDTC 4JFXA 4Z7UB 15C8H 2EC8A 4C83A 3LKNB 3KR3L 1H3WM 1VEMA 1DVFB 1AFVL 2OCFD 3K8KA 2HN7B 3FQXB 4XP4L 4WCYL 4OI7A 4MJ6B 3WFCL 1TFHA 3IETA 5EO9B 2RFXB 4HULB 4Y4FC 3SDXA 5BOPA 1EUTA 1CGXA 4M61B 2D2OA 4JFQA 1M05A 4NT6A 1G9NL 1YNLL 2WMPA 3OAZH 4G8GB 2NW3A 3SE3A 2GAZA 2MKWA 4KAQH 1AHWB 4MB4A 3EDFA 3MLSL 1WAAE 1T89A 2AXGA 3P2TA 3QHZH 5IB2B 3F58L 2ADIB 2B8OT 4YHKL 3EOBA 1NGYA 1HYSC 1P7QD 2ZOKB 4ONOA 2AP2A 4XCYA 1XAUA 4OQ1A 3DGCR 5DJ6A 3GJFK 4NHUB 1J10A 1Q9WA 3LSOB 4FQPA 5DEGA 4AIXA 2GJ6D 3QFJD 2ZUWA 4H0IA 1H0DA 1NFDA 4N9GA 2LV4A 3MGTB 3GSRA 2FATH 1D5IL 3BJ91 2IG2L 5C0CE 1LEKB 1Q9KA 2A74B 4QHUA 1K8DB 1B6DA 4Z7NF 5I18L 4M8QA 3C6SB 1CGSH 1E6JL 2IMMA 4J8RA 4KRPC 1JHLH 5MEQB 5F6IB 4LVNC 1ERNA 1QR4A 1ZMYA 5D70H 3U0PA 4P5MA 5BW7A 2XN9A 2FH8A 4KTDH 4GAFB 1IAKB 2MTPA 1FLTX 2Z92A 2P5EB 4QHNA 2HLFC 3SJVA 3LH2H 1C5BL 2BSSA 4G43B 2HLAA 3MLYL 5C8JA 3UTQB 3FL7A 3P4OB 1I7RB 1ZV5A 4RMSA 4TVPL 5F1IA 4O4YH 2EDDA 4EN3B 2Z35A 3O0RL 1CF8H 1MFDH 4E41A 5IVXF 4PRHA 4FTVA 4M1GL 1GSMA 4ZG1A 1G6RH 3OHXB 2Z8RA 5I8EA 3LEYL 4QF1A 2RR3A 2NY0D 1MCDA 3DO3A 2VLKB 1TIUA 5T3ZE 2VZ3A 4MCYA 3BDYH 1D9KD 3SY0B 2GK0B 5C09D 1F4XH 4PGBA 4YEEA 2PW2B 4R8WL 4TQEL 3QIBA 5HI4C 1DUYA 4WDIA 3HG1E 3QISA 2R0WH 3FB6A 4JPIB 2CKBA 1ZVSB 4DTGH 5IVOA 4CGTA 3QDGE 4O9HH 4Q9CA 1VEOA 2X70A 2RJMA 3TCLB 4LAJH 2EIZB 5E00A 4XRCA 5BV7H 2VDRL 5I71B 1PAMA 3RTQD 1A7RL 3TO4D 3GMPA 5IQ7L 1KCRH 1ZHLB 2GSIB 4POZC 4TSBL 2BSED 4Z7UA 5FUZL 4NQCE 4ZQKA 3DURB 2PR4L 1UJ3C 2FJGB 3LKNA 1UKQA 1OD9A 1R5VB 4OLWL 1DVFA 2AEQL 3VD5A 4YDIH 4Z95H 5EIIB 1KSRA 4PJ7F 5I74B 2HN7A 3FQXA 3OAYH 5E56A 1JJUA 1ZK9A 4MJ6A 2RHEA 4PLNC 3JUZA 4LARH 7FABL 3NIDF 1INEH 2RFXA 3NGBB 4QRTB 5EO9A 2EE2A 4NKQB 4M61A 1MQKH 2XYCA 3QI9C 4G8GA 1RMFH 2VYRE 1QKZL 2EDEA 5E8EA 5BS0E 4BK5A 3NH7L 2NX5D 3G6AA 4WW2F 1NJ9B 5IB2A 1DQDL 5D1ZD 2ADIA 4PJ9A 1QUNA 1WITA 3BPLC 2ZOKA 1CL7L 4I8DA 2A83B 2CSPA 2JB5H 4LCYB 4RDQF 3ARRA 4WY7H 3RP1A 3ALXA 3PGFH 4NHUA 5CAYB 5I1GL 3LSOA 3WXWH 1T1YB 5IBTH 3TV3L 2R4SL 2VN4A 3V2AR 4XAWL 4GKSB 4JG0H 1NCWL 3MGTA 1HXYB 1MCIA 3PQYE 1HEZB 2VO5A 2P46B 4B7IA 4RIRA 5FHAL 5I1IH 5I1CH 3GDBA 1A6UL 3UTTD 1K6QH 5KVMC 1LEKA 3RZCB 3OB0H 1K8DA 1CTNA 5FV1L 4OBSA 4PRIA 4JGMA 3HC4L 4G7VL 4NM4L 1WZ1L 4D9LL 4O02L 5MEQA 3QWOB 1YC8A 4QEGA 4BM7A 1UM6L 2SEBB 1TJHL 1QFWM 3UPRB 1HINH 1L4IA 1QR1B 4D94A 1F58H 5GRUL 1IAKA 1WFUA 4M1DL 1U8MB 5MI0B 2DM3A 3T0XA 3L3KB 3RY6A 2VDNL 2P5EA 2XIDA 3TJEH 4G43A 1GHFH 3LHPL 3LKQB 1G0XA 3UTQA 2DIJA 3P4OA 3GBNL 1I7RA 2UYLB 2JF1A 1A6VH 5F7EL 4EN3A 5DVKA 4Z77B 1RHHB 1BJ8A 1EEYB 4NHCH 3S5LG 3IU3B 3N1QC 1NC4B 2ARJB 4JE4B 5D2NE 5JUEL 2VDQH 5M94B 1CLZL 2CKBH 4F2MB 1GL4B 2DBLH 2VLKA 3INUH 4HWUA 3SDYL 4U3CA 2VXSL 4ODTH 1U3YA 2D0GA 3SY0A 2GK0A 2P1YA 4AZ8A 2ESVB 2CJUL 2PW2A 4JCLA 4TVSa 4PGZA 3ARZA 4NNXB 5FUOH 4JPIA 1OM3H 1ZVSA 3DARA 3TCLA 4Z7WF 4DGIL 2EIZA 1EHLL 2R2CA 2ZNWA 5IGXL 1XMWA 2YD6A 4G5ZH 3RVXD 2ZCKH 1F4WH 4LCCB 2ARJQ 5GRXG 1ZHLA 4QNPE 2GSIA 5F89B 5BV7C 5DLMH 4XXCA 3LRSB 1CDUA 4NKDB 3DURA 1AJ7H 2DF3A 2FJGA 3GRWL 5I6XB 5L6YL 2AABL 7CGTA 4IOSD 1QSFE 1R5VA 2CRMA 3HRPA 4KXZH 4M43H 5EIIA 1NDGB 1FLRL 1P4BH 5GRVL 1HN1A 1IKFL 4KJPC 1LO3H 4QRTA 4N0YH 4HZAA 2D7TH 3RWDB 1SBSL 4JKWA 4DN3L 4JM2B 5J1SC 1T89C 2XG5A 2QLVB 3WE6B 4XCEB 3ZDXF 3MLWH 3EDEA 3VWJB 5DMJB 2F53B 3BN9D 4JQIH 4OD3L 1NJ9A 1KCGC 4S0UC 3TNNA 2A83A 2FX8H 1Q72H 4LCYA 4XVJL 3SJVD 4GXVL 2XQBL 5J57B 1FHGA 1X9QA 1SEBB 3WIHA 1E4XH 1T1YA 4PBXA 3W2DH 1B9ZA 3AM8A 2V5MA 3K4AA 4C56B 3G6JE 4X9HA 1YPZF 4GKSA 1HXYA 3RA7H 4E41D 3GM0A 1HEZA 1DR9A 5DC0A 4PRHD 4FTVD 1YECL 5I0DA 4DOHE 4OF0A 1YYLH 3RZCA 4JLRB 2IAND 3UJJL 5JW4N 5HDLA 1RUQL 2XY1A 3S7GA 1JCKA 1FG2B 1OHQA 4OT1L 3MJ7B 1IEAB 3UC0L 3QWOA 1AI1L 4Z7QF 5EA0H 4P2CG 2SEBA 3D9AH 2VAAB 3UPRA 4V1DE 5F7HA 2EXWC 2ZJSH 3PDOB 4UV4H 1QR1A 2VAJA 1Q9LB 3RVVC 3QQNA 5E2TL 1U8MA 1CN4A 3L3KA 1HHJB 4I0PD 5D71L 1G7PB 2X10A 3SBWA 3LKQA 2VIRB 1MSPA 3P9WB 5LCVH 1Y0LB 4D9RD 2UYLA 5MENE 5F9JB 1RHHA 1EEYA 2F54E 2WLYA 3IU3A 5K33A 5T1LB 2QQLH 3O41B 1NC4A 5K59F 5HD8D 3ZTNL 4HQQH 3VG0H 1BEYL 3BKJH 3PXJA 1JFMA 1TDQA 3PWVB 4BZ1L 4F2MA 3QUXB 4F15C 1WWBX 3RU8H 3QIBC 4PJAE 5DD3H 3RDTB 4PRAB 2X4OB 5CJXA 2I5YL 4ZDHB 3UO1H 2ESVA 2R8SH 5E70A 5ID0B 2DLFL 3MLZL 4CNIB 4JZJB 1W8NA 3W5MA 4M7ZC 4PREB 1A7NH 2B2XL 4PJ9D 2G2RB 3ZYIA 1VGEH 5AZ2L 4WFED 5HVHC 2OK0L 1F4YH 4QKXB 1I9RL 1EVTC 3NIFE 4LCCA 4U6VL 1MRCH 4LDLB 4FFZL 1DVFC 3P0VL 4YHZH 5D7LD 5C0BE 3LRSA 4BSWB 1SYSB 2X05A 4G42B 4OF6A 4FXKB 3VFTB 4FQIL 2E7LE 5B38G 4XBPB 4ZD3H 1KLGB 2H2SD 3U82B 2R1XB 1NDGA 3ES6B 3LQAL 4GAJH 4P2QE 4F58H 4PRID 2XICA 1AHWC 5DA4A 1U8OB 3RWDA 2EIBA 4S1RH 1TETL 5HHVH 1OAQL 5EU7C 4ZTPL 5D7KE 3WE6A 4XCEA 3VWJA 4QHKI 1AE6L 2VLJE 4QOKA 2F53A 4YHNB 2H9GB 3L1OL 5TPWL 4Q97A 1U8NB 3HI1B 1PLGL 5MEOB 2P5ED 3NCJL 2QQKH 4K3JH 3HCVB 4PP1D 1L7TL 3MBEA 1SEBA 2YK1L 1EMTL 4F57H 3PWLB 5E2VL 2IBZX 3MBXL 2HWZL 4OCRL 4EN3D 4HFUL 1NAKL 4TSAL 4HBCL 4WNQB 4C56A 3QIWD 5C6PB 3MA7B 3VFGL 4ZUVB 4CVZB 1NCAH 5IIEB 1H3PL 2VR5A 5EWIH 2QTEA 4L29B 3GI9H 2VLKD 4JLRA 5F6IC 2DICA 3B83A 1QBLL 3S88L 1LO4H 3HHRB 1BJ1J 5E6IC 1VDGA 4ODXB 4MXVF 1FG2A 4Y19B 2LU3A 3MJ7A 1IEAA 4U6YB 1JK8B 4OLXH 3D48R 3V4PH 1RJYA 4WI8A 2DQHH 4B5EA 4LPUA 2PKDA 3TA3B 2VAAA 4XNXH 3RY6C 4L4TD 3IFNH 4LSDA 3PDOA 2NXYD 1Q9LA 3SO3B 4G6KH 3GKWH 1HHJA 1G7PA 4EN3C 4PJ7B 2X1PA 2YMXH 4IIQB 2VIRA 1I1CA 2BZDA 2EICA 1Y0LA 4YFEA 4R96B 1GJIA 4NRXB 1KJVB 2ED9A 2W1NA 5F9JA 3LPFA 15C8L 1W0YT 4Z9KB 5IMMB 5T1LA 2Q86B 3O41A 4Z5RB 5GQBA 2NTFB 1OARH 1ZTXL 4V2CB 4YGVA 4JRWA 4WW2B 4HWEH 3PWVA 2ENYA 4NZTH 3RDTA 4PRAA 2R9HD 4OV5B 3MRLB 1A2YB 4ZDHA 1I8MB 5AG8A 4KAQL 2J88H 4J4PA 5ID0A 4K07A 4CNIA 4JZJA 1PG7X 2Q6WA 5HHXL 4IJ3B 2AJUH 2ZP0T 3QDMB 5AZEL 3EDJA 5ANMB 4KVCH 4PREA 5I71C 2Y36H 1U6AH 2G2RA 1PQZB 3KHQA 5D8JL 5DUBB 1KB5B 3W0WB 1K85A 4XAKE 4XXCC 2YWZA 5C2BL 1MCWM 2MHAB 4O58L 4QXWA 1UWEH 2LVCA 5I74C 4BSWA 1SYSA 4KRLB 2NY4B 4FZ8L 3CFCH 5DK3A 2VDPH 4FXKA 3V7AG 3VFTA 1CFTB 2R9HC 5E6ZA 4XBPA 3RZCD 2R1XA 1DBMH 3ES6A 1DL7L 5T33H 4S1QH 1T66D 2GIYA 1U8OA 2HT2C 5C3TA 2HFEB 3C08H 3VFOB 1KJ2L 1WFOA 1EGJA 1F6LL 4MJIE 5D70L 3QXUA 2ID5A 3V5DB 3QEGL 3VGAC 3VD7A 4KTDL 4YHNA 2ZWLT 2H9GA 3FCTB 4P0DA 2HJFB 4LMQI 1U8NA 3HI1A 1XF3B 4LSUH 1OT2A 3D2UA 5MEOA 1OAXL 2DKMA 3AM8C 1DN0B 4IRZH 4PLJC 4KQ4L 1JNJA 3HCVA 3T1FB 3GHEH 5FYLD 3LEVH 3PWLA 4O4YL 1RIHL 4DGVH 4PJEF 3DRQB 1CF8L 5DZOA 3V4VH 1MFDL 3MA7A 2Y06L 4ZUVA 1J86A 5E7BA 3RZCC 4L5FH 1NC4D 1G6RL 5IIEA 3ET9F 3QP3A 1N6UA 5E1HB 4L29A 5CILH 3U4AA 1JPGB 4LMQE 2Y1VA 5DEFB 4ODXA 3VH8G 1F4XL 4U6YA 4NN7B 3D39A 1JK8A 3THMH 4QYOB 3TLRA 1CGYA 3TA3A 2DL2A 3AS1A 4JPKL 2MQCA 3PGDB 4TNWK 4DTGL 4O9HL 5EO0B 4C55A 3KLHC 4LDOB 4MNHB 3VDBA 5BV7L 3VWKB 4CMHB 4HXBL 5ICYB 3MRGB 4P48A 1IZJA 1L0XA 4QGTA 4R96A 4UZGA 1KJVA 1B4JH 3O6LH 3N1FC 1KYOJ 4X9BA 3KPSE 3QCUH 5IMMA 1CDYA 4JFOB 3GJFA 2Q86A 3LQZB 2AVGA 3RQ3A 4Z5RA 5H37G 2NTFA 1AY1H 4YDIL 4I3GA 1A3LH 5IHUH 5CJXC 4GXUN 4KV5E 3CUPB 3IDXH 2Y23A 3OXSB 1INEL 3MACH 4IOFD 4OV5A 4OQTA 1R3IL 2C3XA 1MQKL 3MRLA 1T0MB 1A2YA 4JB9L 4TN9A 1FAIH 1RV6X 1NBYB 4PJHE 5ERWB 1I8MA 1KELH 1RMFL 1P2CB 2J6EA 2E7MA 2NNAB 3EOYG 1B0RB 3ROOB 4QOKD 2F53D 3QDMA 5ANMA 4LLQB 1PQZA 4LCCC 5DUBA 4WY7L 4EXKA 3AB0B 1KB5A 3MBED 3W0WA 1EHNA 1UM5H 4HLJA 2MHAA 5I6XC 5L88H 4OLEA 4QHMB 4C56D 1FORH 3DECA 4JG0L 1CFSB 2KL6A 3CH1B 6FABL 5JXAL 2M8XA 2I60H 1EGJH 3P73B 5I1IL 5F8RC 4PJGF 1CFTA 1K6QL 2LQRA 2H1PL 4HBQA 4JM2C 4FG6D 1CDIA 2EDTA 2MOVA 3LIZH 3W5NA 1QSED 3VWJC 3KAAA 4U1GB 3VFOA 3QUYB 4XPGH 1IQWH 4GQ9L 3MA9H 2YUZA 5M7QA 3VU2A 4M48H 3OX8B 1F58L 1IILE 3FCTA 1T1XB 2HJFA 5JHDB 4U7KA 2YRZA 2FX9H 3ORJA 3EYUH 1A14H 2BHYA 5J89A 3TJEL 1DN0A 1GHFL 1UG9A 3T1FA 1VB9A 5DJXB 3AREC 5C9KA 4N8VB 1RUAL 1A6VL 3DRQA 4XC3H 3RWHA 3WUWG 1M4KA 2WM0A 4RAVB 4NHCL 3SHSA 5T1LD 1CDBA 4G8EB 4DW2H 2FX7H 4X98B 2DBLL 1S9WB 3INUL 3HB3C 1Q38A 1S78D 4OV6F 4CVUA 3RJDA 3B5GA 5DEFA 1KJ3L 1LQSR 4ODTL 4MA7L 1AGFB 1B2WH 5C1MB 2OSLB 5I17B 4U1NB 5CS7A 1MRFH 4QYOA 4YDLB 5T5NF 3HMXA 1C7TA 1OM3L 3PGDA 3DI2B 5EO0A 4DKAA 3KPRB 4MNHA 2E6PA 5DT1H 2A77L 1AQDB 3VWKA 4G5ZL 1NCDL 2ZCKL 5ICYA 4G6AC 4WI4A 1F4WL 3MRGA 3QZWB 5DLML 4ONFH 5EH1A 2V5YA 4OQTH 2IQAB 2X41A 2DQEH 1AJ7L 2HTLD 4JFOA 3QUXC 3LQZA 1A6WL 4RGOH 1NKRA 4XCCH 3X3FH 4CN4A 3RDTC 2YD1A 4P2RB 2J6EH 4DKDC 3ARUA 1OTTC 3S3PA 3CUPA 3QJFB 3UTSE 1P4BL 3O6FD 5ILTH 1EFQA 3OXSA 3BJLA 4I2XB 4J4PC 4N0YL 5JMRA 2D7TL 1KB9J 4JZJC 1EDQA 1T0MA 4ZOCA 1GZQB 3IVKB 5ERWA 1KB5H 4D9QE 3MLWL 1P2CA 1TENA 2NNAA 3MRKA 3ROOA 3BWUC 3MYZA 4JQIL 4U1LB 4ZNEE 4LLQA 1H3XA 3MNVB 3D2UD 4HS3A 2FX8L 4P9HH 3ZMRA 4RX4A 1IJ9A 5DDHB 5JZ7D 3PHQB 3RWEB 4NZUH 2YUXA 3LZFH 2X9XA 1E4XL 1KCSL 2W60B 2R23B 3MRIB 4RBPK 3VXRE 1H8OA 1Y18B 5C0CB 4PV8B 3ZDYE 4QHMA 2P24B 1CFSA 2YPKB 3OKDB 5FFLA 4N5EA 3CH1A 3OKOA 1OLLA 3QPQC 3A0OA 3MNZB 3RUGB 4AH2B 1DANU 3VXSE 1EH9A 5EORH 1GC1H 2F8OA 3P73A 1PZUB 3QYCA 3SGJA 1B4RA 4U1JB 5HYIA 2BVOB 2CRZA 5JQ6H 4YH6A 3FN0L 1FL6B 1CDHA 1YEHL 2ZUXA 1J0ZA 1ZT1B 1JWUB 4GOSA 4X7TB 3D39D 5EA0L 3MODH 3MRCB 3QUYA 5DMYA 1S3KL 4R6UA 5KANI 1UA6L 1UH3A 3TA3D 2GI7A 1R3LB 3OX8A 2HJLB 5JZ7C 1YC7A 1G1CA 1T1XA 4KKLC 1ZSDB 4IM8A 3V6ZB 4MYWB 3ZKMD 3UJTH 1IGIH 1K4CB 5DJXA 3I6LD 5HYSB 5INCB 3TZVB 3ZT6A 1R3KB 4N8VA 1ND0B 3AY4A 5FYJD 4HD9A 4RSVA 3G5XB 2QQLL 1UH4A 1G0YR 4FZEL 4G8EA 2XV6B 4HQQL 1UB5B 5L8JB 3HMXH 5ESQB 5FGRA 4X98A 4EI5D 1S9WA 4DN4H 2C4FT 5DD3L 5HYJB 1KPUB 3GGWB 5HPOA 1SVCP 3K74B 3TA3C 4NZDA 3SKOB 4EUPG 1CIUA 2OSLA 3UO1L 5I17A 4U1NA 2R8SL 4PS4H 1OWRM 5JDJA 3SO3C 1FNFA 4KKAC 5GGSY 5EZOH 3VI4F 1JWSB 1P1ZB 2R39A 5ACZB 4TTDD 4IIQC 3KPRA 5SWSE 4Z7OF 4NQCB 5DMKB 3IJYB 3FZUD 1AQDA 3ARTA 1T0PB 1YJDH 1GH7A 3P11L 3QZWA 4DKEH 1LEIB 4BZ2H 5IFJB 5F9DC 4YHZL 1UCTA 2E3VA 2IQAA 3MUZ1 2WWKT 2Q8BH 1TQBB 5JOPE 3Q6FB 1I8KB 4WW2C 3KLAA 3HUJB 4K3EH 4P2RA 4ZD3L 5ISZB 4GAJL 3QJFA 3GHBH 5AUMA 4RMQA 4I2XA 3FQUB 3WKMH 1K3ZA 3B2VL 3FO0H 4S1RL 5T1KB 5D96B 2DQDL 1GZQA 4IJ3C 3IVKA 5J3HD 1R0AL 4M5ZH 3VGHA 4EBQL 4PR5A 5KTEH 3PWNA 4TTDC 3SEPA 2CLVB 5DQDH 1H9VA 5A43C 3MNVA 3ZKXB 5DDHA 4K3JL 3PHQA 3RWEA 2VDMH 2J4WL 2W60A 4KJQD 3V7AE 2R23A 2NY4C 3MRIA 4P9HC 1Y18A 5C0CA 4PV8A 1XIWB 2P24A 4MX7B 2YPKA 3OKDA 3RUGA 3MNZA 4AH2A 2DDQL 3PABB 1NCAL 5I8KH 4HGWB 5EWIL 1VFOA 4U1JA 2BVOA 3GI9L 1FNSH 1OGAE 3FQRB 4PP8C 5J3HC 1FL6A 1GC1C 4UMGA 1LO4L 4WGVB 5A16B 4UBDC 1RQ5A 3MRDB 5M95B 1ZT1A 4V3DB 3CDGB 1BECA 4X7TA 4M3KB 2V2TB 5DD0H 2VLRB 3MRCA 3V4PL 5JORB 4XNXL 5DA0B 4XHJD 1R3LA 1IT9H 3O2WL 2B4CL 2VDKL 2EO1A 3WNPA 2HJLA 5CSZB 4L8SA 3MGAA 3GKWL 1ZSDA 3V6ZA 3N1GC 4TRPH 4GJTB 1PG7H 1K9TA 2BDNL 3VXQB 1K4CA 3I50H 4OLUH 1JMZA 5HYSA 5INCA 4LSQH 3QXDA 4LSSL 1R3KA 3U9UA 1OP5H 1MLBB 4LGPB 5F8QC 4NIKB 5JQHC 3EYSH 3G5XA 3LKOB 4KY1L 1MCOL 2OJZL 5HI3D 4CJ1A 1OARL 4IS6B 5GS0L 1UB5A 4GG6E 2E9IA 3KJ6H 5ESQA 5IHBA 2BY2A 4NN7C 3T3ME 4EKXA 2V5RA 3O9WB 4NZTL 5HYJA 2V9QA 1KPUA 3GGWA 5F72S 1XZ0B 4CUCA 2A0LC 5EU6E 4BYHA 3SKOA 2OMBA 3EW3B 4N1CA 5AAWA 5FHBL 5EBGA 1ZE3C 2QQNH 5FGCE 1WFNA 2AJUL 3CFBB 4FA8A 1JWSA 1P1ZA 5TDNA 4NYLB 4KVCL 4TVPE 1U6AL 4OCNC 3VWKC 4CMHC 4PD4K 2ED8A 3T0VA 4JKLA 4RX4D 4KK5D 4NQCA 5DMKA 3IJYA 4PJGB 4HG4K 4QCIB 4TNVF 1QSFB 1NEZG 5KSBB 4LFHG 3DX9B 1LEIA 1UWEL 5IFJA 4OCWH 4WTZG 3QDJE 4NC1C 4N5ED 1YJDC 4I3RH 3Q6FA 1I8KA 2VDPL 5C07B 1LDPL 1GOFA 3HUJA 1ZEAL 3Q1SL 5BZWB 5BCAA 2FZ3B 5JIIA 3QRGH 4UOW0 5ISZA 5BZDB 3H42H 4RAHA 5T33L 3C5JA 3FQUA 5A3ID 3RIAF 5T1KA 2DMBA 3C08L 2XWJB 1XGPB 3ILQC 3QUYD 2XG4A 3OJMB 5SX4I 3FQNB 1MJ7H 2PN5A 1BF2A 1N3NB 3KHOA 4UILH 1H8SA 2AK1H 2CLVA 3AB0C 4QTIL 4X6CF 4LSUL 4JFEE 3NIGE 5TDPB 4IRZL 4BFEA 3ZE2E 3NABH 4Y16D 3EJYC 4Q6IB 1CL7I 3LEVL 4WTWA 4N5EC 4PJ5B 1AGDB 1S5HB 4BUHA 2HTKC 2AQ1A 4DGVL 1F3DH 3QULB 1XIWA 4LVHB 3SGJC 4MX7A 4XPHH 1YEIH 2JELH 3PABA 5E08L 4HGWA 5EZJB 3SE8L 4K7PX 5DGRA 4MD5B 5CILL 4U1GC 3FQRA 2WIIB 2EH8H 3QUYC 5I73B 5A16A 4Q0XH 1N64L 5IMLA 3MRDA 3SDDD 4GSDH 4G6FD 3CDGA 3RAJH 1CBVH 1KULA 3CFKB 4TTGA 3THML 2BJMH 2V2TA 4NP4H 5JORA 2VLRA 1QRKA 3AUVA 2NY2B 1YZZA 1V3LA 4UNVA 5HHOE 4XWGH 5CSZA 1OTUD 4ZAKD 4NBZB 2HG5B 3BZDA 3KPRD 2V2XB 2NY1B 5KSAA 4HUMB 3VXQA 2HVKB 1X5AA 1I1AB 1ZHNB 2NY5H 2OTPA 1G7HB 4OIBA 5D2NA 5JPMB 3O6LL 4KZEH 5CEZH 4PJ8C 5GXBB 1MLBA 4UTAL 3O3AA 1NGWB 1T1WB 1EFXD 5IHUL 4IS6A 5J6HB 1PFCA 1CVSC 3IDXL 3O9WA 3MACL 2PXYB 1F3RB 1XZ0A 4YDLC 4LHUG 4Y0GA 1NFIB 1FAIL 2HFGH 1OTUC 3U4BH 1YMMB 3CFBA 1S7WA 3X11B 4NYLA 3L3GB 3RHWK 3BP7B 3RVTC 3EFFB 4UDTB 2H8PB 4PJGA 3IF1B 3C5ZD 1UM4H 4QCIA 1QSFA 5KSBA 1UM5L 5DK0B 4NWUH 3AAZB 3GM8A 5C0CD 3QEUB 2WW8A 4AL8H 2GTZB 4P2QB 1OAKH 4N0UE 3EHBD 4IBLT 5BOZG 2I60L 5C07A 4JFFB 2VQUA 5DYOB 3TESA 1W0VB 1HIML 2UWEE 1QLEL 4G6JH 5BZWA 2WWKO 2FZ3A 2GT9B 5E8DH 4RFNB 2XZCL 3ERYA 2VLJB 4O2EA 1DQTA 4H1LB 1XGPA 1NCCL 2FSEB 5KOMC 3OJVC 3QNZB 3FQNA 3VFSB 5I9QB 1N3NA 4KMLB 1A5FL 5DRXB 5TDPA 1FNAA 4LPWA 4XPBH 4LSVH 4DVBB 1A14L 4Q6IA 3JUYA 4X7DC 4K8RH 1AGDA 1S5HA 5TE7L 2EDYA 2Y07H 3QULA 5LBSL 3VE0B 3P4NA 1RU9L 1HCFX 2YRLA 4MXQA 3L3HB 1ODAA 1LO0H 1YEJL 2XACC 4QXGH 4XVUD 5IW1B 2BRRL 3CXHJ 3UZQA 2B39A 4NQUA 4MD5A 4MLSA 1E27B 2WIIA 3MV01 1O7VA 3HI5H 1T7XA 4BFIB 1R24A 5FKPB 2AEWA 3QDGD 1FL3B 2WK2A 1MPAH 1B2WL 3RVUD 3CFKA 1YEGL 3WO3B 4TSCH 1GYAA 3KXFB 5F7NC 2DM7A 3EJJX 5DVMA 3FT2B 3ARDB 5CWSB 3BISA 2HG5A 5SX5K 4HSQA 5MENA 5C08E 4QRUB 5DT1L 3TZVC 2V2XA 4AK1A 4NQCD 1ADQA 2HVKA 5EFIB 1FH5H 4W68A 1I1AA 1EX0A 1ZHNA 5DMIH 4CRPA 1N6QH 3VW3H 1G7HA 2WIMA 3OG4B 5KVDH 4ONFL 5JPMA 3NZHL 4X99B 1JRHL 2QKIB 1KIQB 2NY5C 1NGWA 3WFBH 1T1WA 4RGOL 3UROR 5EC2B 5J6HA 2KQNA 5BS0D 4O5LH 5ICZB 5FM5O 1PG7W 4U1MB 4L8CB 1HE7A 4GUPB 3PV7A 3ABZA 3CCHB 5T1KD 1NFIA 2OMNA 3NN8B 1KB5L 3DBXB 4WFGE 2QSCL 3O6KL 3EDKA 1YMMA 2YSSB 5CSGA 3X11A 4MDJB 3L3GA 1NMAH 3BP7A 4P9HL 3EFFA 4UDTA 2H8PA 1O0VA 4LDEB 4NZUL 4JO3H 3IF1A 3VMNA 5DK0A 1F2XK 1TQBC 2OZ4L 3AAZA 1XR8B 4DCQB 5I30H 1EO8L 1DBBH 3QEUA 3SOBH 2VISB 2GTZA 3MLTA 3U83A 4P2QA 5L2KB 4KKCD 4HCRL 1BD2E 2WUBH 1BLNB 1MI5E 3OV6A 1GC1L 5EORL 4JFFA 5DYOA 4MQ7B 4RFOH 1W0VA 3VGFA 4MJIB 4AEHH 5D96C 2VLME 5JQ6L 2GT9A 5K9OB 1JGUH 1Z5LA 1BM3L 2VLJA 1FZKB 2DN7A 3BPCB 2P5WB 4H1LA 4ZFGH 2W59A 2FSEA 3QNZA 5IT2L 4Y4HD 1AR1D 5E4IA 3VFSA 1QZ1A 3GSOB 3ZKXC 1TVDA 2DLGA 4NC0B 3DMMD 5DRXA 3ZSTA 1KBGH 4HWNA 4DVBA 5KSAD 1F11B 1XIWC 4OF5A 3MCKA 3O2VH 3BO8B 3STZB 2IPKB 5FKAB 3S3JA 3HE6B 1N5YH 3VE0A 1QLFB 3L3HA 5I19H 4K8RC 4I18C 1ITCA 4MXWH 5A2FA 5IW1A 2A38A 4PRNB 5C92A 1XFPA 3JWDH 2Q76B 2ZG1A 1QSVA 5IM7B 1E27A 5IW6B 3QUMB 3KJ4B 4XXDB 4BFIA 5FKPA 3DVNB 1FL3A 1AR1C 2CUHA 1ADQH 4PS4L 4NQVA 1FZMB 3H8NA 3KXFA 3L3OA 3FT2A 3ARDA 1QFHA 5CJ8A 3ARGB 5CWSA 2ZG3A 4MSWB 4YEFA 3JV5A 2C5DC 1NFKA 4S0SD 1U3HB 4QRUA 3KYMB 1I3RB 4OSUH 4TPRH 1H3UA 5GGVH 4HWBA 1PX3A 5HPMB 5EFIA 1DBAL 1QSFD 1YJDL 1CDJA 2FJFB 2EDHA 1IAIM 2B0SL 4BZ2L 4OFDA 3PHSA 3BHBB 4N1HB 5T3XH 1WAAF 5ADOL 4X99A 2XTLA 5F7MC 2QKIA 1KIQA 4PB0L 4M8VA 4NUGH 3O9WC 4K3EL 5EC2A 1BWMA 4IMKC 3MXWL 3GHBL 2X4UB 3WKML 5ICZA 5GISH 4U1MA 4L8CA 1YMHB 3FO0L 1EZVX 4GUPA 3JZ7A 3CCHA 4JFPB 2CK0L 3NN8A 5KVEH 3DBXA 3U2SB 4KDVA 2FH6A 2DLIA 3CLFH 5J13B 2YSSA 1FGNH 2VDOH 5I1KH 1QFPA 4MDJA 3ARYA 2FYYA 4V2BA 2EKSB 3UX9B 3BRGC 3NVQA 2VN7A 5DR5L 4PPTA 1T2JA 1XR8A 4DCQA 1JF1A 3K80A 4RQQB 2VISA 4MXQD 4NJ9L 4JZOB 5LGHL 3ZDZF 4H1LH 5D2LE 4LEOB 1BLNA 4Z78B 5EU4B 4MQ7A 1EJOL 4QXUH 4MJIA 2IWGA 4OLZL 5K9OA 4V1DD 2EC9T 1RZ8A 4AG4H 4NUJB 1FZKA 3BPCA 4FXLA 4NCDA 4M7LT 1FZOB 5SV4A 5T1DH 1WF5A 4JPWL 3FHQA 5DD0L 3UTPE 4WW1B 4UT7H 1EERB 3U9PH 3FO2B 2LU7A 2NY2D 3A6BH 1IT9L 4U6HB 1HKLL 1IC4H 35C8H 1NGQH 3GSOA 4WU5B 1FPTH 4Q6IC 4OLVH 5MEND 3O2DA 2WLZA 4OGZA 3EOTH 1PG7L 3BT2L 1F11A 2F54D 3I50L 4U33A 2AERT 4OLUL 4LVHC 3BO8A 3STZA 4HJGB 4LSQL 2IPKA 5FKAA 3TH3T 3HE6A 2AJXL 4GAYB 5IFAH 3MV9B 4KHXH 1QLFA 1A7QH 1P84J 5DFVC 4JRYE 4UB0H 2BVEA 3SGKC 5I73C 3TIEB 1KCVH 2ZCHH 3KJ6L 4PRNA 4F37K 2Q76A 5EU5A 4EZMA 1ZLSH 5IM7A 2NY2C 4XXDA 3PHOB 1QVOB 2F5BH 3JWDC 1AD9B 5GRVK 3NACH 4HWBH 4GKOA 4PGDB 1V5JA 3OWEA 1R5IB 1FZMA 2IH1B 1A4JA 2AV7B 4M7JL 4XP9H 3UJIH 2NY1C 5DSCA 3WLWD 3ARGA 4MSWA 3NA4A 3CSYB 1I1AC 2FIKB 3HZKB 5C0BD 1YUHB 1U3HA 4HIEB 3L7FB 3KYMA 1RIVH 1I3RA 5ITBL 4PBWD 2CK2A 4RBPH 5HPMA 2FJFA 4CU6A 1P6FA 1MCSA 2QR0B 4Z0XB 2Q7NA 4AT6B 3BHBA 4OCWL 5SWZB 3UTSB 2X4QB 4P2QD 1UQSB 3QG7H 4XNQB 1WVZA 2AEPH 1J8HE 3KLDA 3SKJH 4MA8H 2PXYC 5D7KD 4ZOEA 1XF4B 3QRGL 1XEDA 3IRPX 2BY0A 2X4UA 2PTTB 2VLJD 4GKZB 4PJIF 1YMHA 2F5AL 2WV3A 4YNYB 5IBLC 1LO2H 4K7PH 5KBNC 3U2SA 2CIIB 5EOCJ 3Q5YA 5IOPB 5IJVB 1MJ7L 4UILL 3EO1A 4APQB 2AK1L 5MERB 3EZJB 2I9LB 5B38B 1WT5A 4HPOH 2BSRB 3SDXE 2HJKB 2EKSA 1SM3H 3EJZC 1NANI 4XNYH 3NABL 5FAAA 1WIUA 5BVPH 2BXYA 2P8PB 4RQQA 2P42B 4XVSL 1N59B 4HPYL 4JZOA 1PZ5B 1YEIL 2AJYL 4M1CC 2O5XL 4XTRD 3ZYZA 4DGYH 4RFNC 4Z78A 5GGRB 3BIAX 5EU4A 1BX2B 1JPSH 5AAMA 4HGKC 2H2PD 3CLEH 2EH8L 1IC5H 4Q0XL 4NUJA 4KHTH 1DUZB 3GUTB 2QL1A 2VITA 3RAJL 1Z9LA 5I9QC 1FZOA 4NP4L 1YEKH 1TZHB 3FO2A 3CK0H 2W9EH 3QXTA 4GW4B 1JMXA 4U6HA 5F88B 1DJSA 4WU5A 4EDWH 4MVBA 4L3EE 1JZ8A 3GB7B 2Y4SA 1CYGA 2NY5L 3A6CH 4HJGA 5DZLA 2XN9E 4X83A 4KZEL 1J1XH 4GMSH 4P2OB 4K71C 4EOWH 5CEZL 2DQTL 4GAYA 3QUMH 4TYUA 3MV9A 3MV11 1IEBB 3QR2A 2IAMB 1GGUA 4JN1H 3SJVE 2BCKB 3TIEA 3DRTB 3ESUF 2CDGB 4S1DD 3ALWA 4P3DB 5F7LB 4PJBE 4I9WE 4JCMA 5T5FL 3PHOA 3OKMB 3ARDC 1QVOA 1KN4L 2HFGL 4FTVE 3SKMB 4PGDA 3U0WH 1R5IA 1C08B 3CD4A 2IH1A 3O6ML 5JO5B 3E8UL 2AV7A 4UTBH 3WIIL 3CZFB 4NM8H 1WBZB 2VSDA 3LKSB 2XOTA 3CSYA 4XP1H 4MWFB 2FIKA 1YUHA 4HIEA 1NCBH 1QO3B 4JKKA 1UM4L 4ODWB 5GZND 4NWUL 4JZNB 4XMKH 2QR0A 4EEEA 4AT6A 5I1JH 3KPQB 3F6IA 4AL8L 5HGAB 3UTSA 1OAKL 2X4QA 1UQSA 5DFWH 4XNQA 3JTTB 4JY4A 1NEUA 5GIRB 1G7JB 4LASH 4F9PA 4KKBC 4JHBA 2R69L 1FIEA 4G6JL 5C7XH 4NPYB 4MJID 3U6RB 1X5YA 3G5ZB 5E8DL 3S36H 2AK4B 4A2MA 2PTTA 1RZGB 4GKZA 4P9ML 5EU3B 4Z7UE 4YNYA 4BH8B 4ZNEA 3EUUA 5GGQH 5CLTA 1IAMA 2CIIA 3OBAA 2VABB 5IJVA 1X3DA 1TCMA 3QO1A 3PP3K 4HX1B 4HH9B 5MERA 2I9LA 3VXRA 5IR1B 2FGZA 5B38A 2BSRA 1MHPH 2HJKA 3RL1B 1D6VH 4ZFFA 1FBIL 1MCKA 1ACYH 1KNOB 3VCLB 4G8GE 1J5OH 5I0ZA 1CGTA 4K8RL 3I3BA 4WWID 1UADC 2Y07L 4LOUC 5EU7E 3HE6D 1E4XI 2P8PA 4MB5A 1N59A 3MRQB 5F70A 1YN6A 3B9KD 1DANT 4PRBB 5DMGD 1HH9A 1YYMH 3QWQB 4FP8H 2W9DL 1MF2H 4QXGL 2PTVA 1G9EA 5GGRA 4NHUE 4GKNB 4WI3A 3LRHA 3CJJA 4NGHH 1BX2A 1OSZB 3IDIB 4DVRL 2FCBA 4JHWL 5GSRB 3HI5L 3QEQB 5JIKA 4OB5H 5HDOA 1DUZA 4LHJB 3GUTA 2ADGB 4H20H 1BREA 3S37X 3DV6B 5DF0A 1TZHA 3PXHA 4TSCL 3R06B 1UWGH 4PLOB 4PJCB 4GW4A 4ONGH 3QXAB 2KDGA 3OAZK 5KZCB 5F88A 3H3BC 4PJXE 3ARGD 2CMRH 4Y1AE 4FS0A 2ATPB 1U3HD 2YKLH 4P23B 3GB7A 2MQ0A 5TGBB 2M1KA 4MJ5B 5DMIL 4XBEH 3VW3L 4GG6B 3C2AH 2FO1A 4P2OA 1NGZA 3NCCB 1IEBA 2IAMA 1IE5A 2P5EE 1OTSD 5GPRA 5EOTB 3R1GH 2BCKA 3KJ4C 4FQHB 1SJVA 3IRZA 4P3DA 2VXVH 1T04B 3WS3B 1QBBA 4H5SB 2CR6A 4FQJH 2A1WL 2Z9TA 5KVFH 4HIXH 3RPIB 3OKMA 1EVUA 1T4KB 2AI0H 3ARGC 4UINH 1TJGH 3SKMA 1S9KC 1ZHBA 1C08A 1N6VA 5JO5A 1U3HC 5L2JB 3CZFA 1WBZA 4UNUA 3MROB 3LKSA 1J88A 2FJHA 4MWFA 2XA8H 4X6BB 3QDJB 4XT1C 2X7LB 1QO3A 3IDYB 4Q7DA 4WI2A 2F58H 1IVLA 4ODWA 5HHNB 4FQXB 3DPBA 4JZNA 5I30L 5HDQH 2EH7H 3KPQA 3SOBL 4RDQG 5HGAA 3ULVF 3JTTA 2R0LH 1FN4B 1PBYA 1QNZH 2NLJB 1FCGA 4ZO8A 5GIRA 2K7QA 2E9WA 1FFOB 4AEHL 4NPYA 5J0BA 3OF6A 3U6RA 3G5ZA 2Z4QB 5I1EL 4OFYD 1VEPA 4JKMA 4GBXB 5EU3A 1I3GH 1LEGB 5HDBF 4BH8A 5IUSA 3GSWB 4OJFH 4ZFGL 2DTSA 1WT5C 3WHXB 1BQLH 2VABA 3IAPA 5A2LH 4HX1A 4HXAL 4HH9A 1J11A 5IR1A 2YD3A 4OCMC 1KBGL 3RL1A 3X17A 5E2JA 3ARSA 3VCLA 5C0AB 4Z8FL 1ZXQA 2YD9A 3MV9D 1BVLA 3CX5K 3MRQA 3WUZA 5F96H 4PRBA 4MXWL 4G80B 4QRRB 4GKNA 1G7LB 3L3JB 1KOAA 3BKMH 1M71A 1A22B 3JWDL 5K9QG 3AGVA 1OSZA 1U8IB 3IDIA 1V8HA 4DQOH 5AG9A 2FHBA 3QEQA 5E94B 1H5BA 3ESVF 4OGAC 3FB7B 1E4KA 2ADGA 1BJ1H 2GW5A 4MVBC 4IRSA 4PJCA 3T09A 3QXAA 1E28A 5I1LB 1WFTA 1ITBB 3RGVB 2ATPA 3OG6B 4ORGB 2YPVL 4P23A 3GSUB 3C60C 1S7VB 4OSUL 1RJZB 5ECJE 4ENED 5J1AB 1E4WH 4MJ5A 4HMDA 4LSPH 1PSKL 4GG6A 1N7MH 4PJIB 5GZOD 3VXTB 4JPVH 3UTSD 4XHQA 3P77B 5DRNB 5TE4H 2MCPL 2WY3A 1RUMH 1JPTL 5KS9F 1FC2D 1KTDA 2OLDA 4NUGL 5EOTA 4D9QD 4FQHA 3QEHB 4DWHA 4N8CL 2QADB 1HHKB 4GS7B 4JG1H 3WS3A 1T04A 1IRAY 4H5SA 1DQQB 2FECL 5HHMB 4YHIB 5MP6H 3RPIA 2A6KB 3U7AA 1S9YB 4ZPTB 2EYTB 4S1SL 4NN5B 2O93L 1RHFA 2VDOL 5AWNH 1X5LA 1QFWL 3VXRD 2ATKB 1B88A 3MROA 2Q8AH 5EPMB 4ENEC 5ESVB 3QXVA 2QV2A 4OGYH 4X6BA 3QDJA 2X7LA 3HE7A 1V3KA 2ESVE 5GZOC 3VXSD 4M4RA 5HHNA 4FQXA 3RKDD 2E7HA 3P0GB 1W8OA 4YHLH 4F9PC 1VGKB 4UT6H 3BP4B 25C8H 2D03H 5B4MD 3VRLF 4KK9D 2EDKA 3Q3GB 1FN4A 5JLZA 2NLJA 1XGUB 3QDHA 9CGTA 5FV2A 3KR3H 3WYRA 1FFOA 3W11C 1WC7B 1AFVH 3JBG7 5EUKB 3E3QA 2Z4QA 4AG4L 1AIFB 4HMCA 2X44D 2Y5TB 3V0VB 1LEGA 3AMKA 4KUCF 3CAFA 3GSWA 4APQC 1B3JA 4CDGC 4HKJB 4MD0A 1OL0A 3TF7A 3A6BL 3WHXA 1WEJH 4NNYB 1IC4L 1NGQL 5D1QA 3CVIH 3HFMH 3OR7B 1IFHH 5EBWA 4OLVL 4WO4D 1KEGL 3EOTL 4KFZC 3F58H 2Q1EA 4YHKH 3UAJD 4UT9H 2C4XA 4KK9C 5C0AA 4P2OD 5E1AB 2F53E 4YXHL 5IFAL 1DSFH 3KYNB 4KHXL 1A7QL 3UCRA 3P40A 2IAMD 2DJ4A 1IAOB 2H26B 4UB0L 1ZLVH 4LLAA 1CE1H 4G80A 4ISVA 1FZJA 4Y5YB 4QRRA 1KCVL 1G7LA 3L3JA 4KUZH 2EZ0D 1KPVB 4KQ3H 1U8IA 3A67H 1BQHB 3OTTA 5C0FB 5I15H 4X8XA 5F44A 2OL3B 5E94A 2VXTL 3QFDB 1J0YA 3GO1L 2J1KA 3BQUB 3FB7A 5C08B 2JCCE 1F02I 3NACL 5SWSD 3BPNB 1PYWB 4TUOA 4JAMB 4HW6A 3UJIL 2DQFA 5I1LA 5K9JH 5INDB 3TYFB 2ED7A 3RGVA 4ORGA 3GSVB 3GSUA 2AXFB 1S7VA 4P2OC 5JOPD 1RJZA 3MCG1 4NQDB 4NRZA 5J1AA 5IFHH 4EUPB 1UEMA 2WBKA 3MLYH 4P5TD 4Z6AT 5D6DA 4PJIA 1SMOA 4HV8B 3VXTA 5LXGL 3P77A 5DRNA 3O0RH 1EO5A 1CZ8H 2AEPL 3SKJL 2EE3A 3PUCA 4S2SB 4M1GH 3QEHA 1HHKA 5H37H 3LEYH 1NAML 1P4IH 4LPXA 1HCVA 5CD5D 4NO2B 1JGEB 1DQQA 1LK3H 4ZUUB 3BMVA 1LO2L 2BMKB 2A6KA 8CGTA 3KVQA 3HR5B 1OW0C 4ZPTA 1MCWW 4R9HA 4Y4FB 2EYTA 4O51B 1DN2A 2ATKA 1A1OB 4HPOL 1R3JB 5EPMA 5C0GB 2XKUA 4XNYL 5KN5B 3N85H 1EA9C 2JTDA 1BD2B 4PJDF 2H41A 2R2HB 1MI5B 2DAVA 3MRNA 3WNNA 2UVFA 2HA1A 3P3YA 5BVPL 4OD1L 1VGKA 5IQ7H 3BP4A 2BNQB 1OGAD 3Q3GA 4DGYL 5FUZH 4TULL 2PR4H 4MD4B 4JREB 5JR1H 1JPSL 2Z31B 2AEQH 1WC7A 43CAB 1EHAA 2APWA 2XKNB 1IC5L 2DWDB 1LP9B 1NBZA 4FMKA 1AIFA 4KHTL 3V0VA 7FABH 4OM0H 1FC1A 1YEKL 2D3VA 2QJDA 2XRAL 4HKJA 4NQEB 3CK0L 4D8PA 1MJUL 3GRWA 4IRSD 4ZS7H 3ARFD 4NNYA 3TCXA 4KK6C 4BQBA 1QKZH 1Z6JT 3OR7A 3U4EB 5CINH 1VENA 2GITB 3MLRH 1D5ZB 4JRXB 4P23D 4ODVH 1CL7H 1Q0YH 1UXWB 4MMZC 1QYGH 4XPFL 1TNMA 2X42A 5E1AA 3OGCB 3QUML 1ZLWH 3TV3H 2XT1B 4XAWH 5IVXE 4FFVD 5J7CC 1EO7A 1IAOA 2H26A 5EU6D 1NCWH 1NCUA 1FV1B 1I4FB 4QGYA 4Y5YA 4F8QA 2EXYC 4J3SA 2APBA 2NR6D 3ULUF 4LKXA 1SHMA 1BQHA 5C0FA 1U36A 3QFDA 4TVPD 1RZ7L 3U36B 3BQUA 1S8DB 1U8PB 3DV4B 5C08A 4WFHE 3U0WL 1PYWA 3IAQA 5DZNA 1WISA 4UQ2B 3DIFB 4JAMA 1FRGH 3BESR 4NM8L 4P23C 4FQCH 3ZYOA 5INDA 3WXVL 1UACH 1TPXB 2V9RA 3QDJD 4BFGA 1NCBL 3GSVA 4M1DH 4Y19E 3HE7D 1XGRB 2AXFA 3D3VB 2XI9A 4NQDA 1RPQA 4EUPA 5I1JL 5DVNA 3KYAA 4HV8A 1IGML 3IS1X 4G8FB 4FQ2H 2EDXA 3C5SB 4YBHA 1JRHI 2P7TB 3WFZA 4XC1H 4PJ7E 4S2SA 5C7XL 2VOTA 2IBBA 4UIKL 3S36L 3NIDE 5DD5H 2DJSA 4QRPB 4NO2A 1JGEA 2X89A 1CLZH 3TFKD 4DUVA 3D18B 3ZDYF 4ZUUA 3SDYH 4JFED 1HKFA 3OSKA 3TGXA 1BMGA 1A6AA 2VXSH 2Y9RT 1SJXA 4ZUSB 3HR5A 2X1WL 5D1QD 4Y4FA 4O51A 4RCAA 4Y4KD 3IDYC 2H6PB 1A1OA 1R3JA 1BBJB 3QI9B 5C0GA 3S37H 4IOIB 2X40A 4FQXC 2K9UA 5KN5A 1ACYL 1BD2A 5DVLA 2R2HA 1MI5A 4OZHB 2HH0H 4HIHA 3DOSA 5C0AD 5FYJL 3QDME 4NKMB 3WD5L 5ANME 5JW4R 2BNQA 2IEPA 2XQYG 1KC5L 3ROLB 1F4AA 2JJVA 2M26A 4FP8L 3Q5OA 3E3QC 3KYOB 4U4BA 3GRWH 4NGHL 3W0WE 4GBXC 4MD4A 2AABH 4NKOB 2Z31A 4RZCB 43CAA 1IEHA 2XKNA 2DWDA 1LP9A 5CJ5A 5HHOD 3TF7C 4PGEA 4XWOC 5K9QI 2FIRT 3HR6A 5EBLB 4H20L 5FUCC 5DI8B 4NQEA 1FE8H 1G9MH 1UWGL 4DN3H 1UC6A 4ONGL 2WSKA 4OKDA 4HUKB 3QQ9D 2VXUH 1A8JH 2CMRL 3U4EA 4ACPA 2GITA 1T2QL 5C0DB 5KS9B 3RGVD 1MQ8A 4LLUB 4OD3H 1D5ZA 4JFDB 4PY7B 4JRXA 4R3SA 3NOIA 4JRYB 4J1UB 2VH5H 4XZUB 5L8KB 1EBPA 3TJHA 4XVJH 3OKNB 4XBEL 3VMPA 1KJ2B 4GXVH 2OL3H 4GG8B 5IKCB 3JTSB 1CFQB 1FV1A 4QLRA 4BSVB 1I4FA 2CUIA 4NKIL 3MOAH 1UKSA 3VXMB 5FGBA 1YECH 4YO0B 3RWJB 4L1DA 4FQJL 5HYFA 4D0BB 3D0VB 5KVFL 3PWJB 4HIXL 2EE9A 4M9PA 3U36A 3VA2C 1S8DA 3DV4A 3QQ9C 1BIHA 4UINL 1TJGL 4OT1H 5E5UB 3UC0H 5BXFB 4EUPH 3RWFB 1AI1H 3RGVC 4UQ2A 3DIFA 3WJJA 4MNQE 3FB8B 3H3KA 4QHLB 4LP5A 3T0EB 2XA8L 5D7IF 4YFLF 4LSTH 1XGRA 3D3VA 1J8HB 3D5OF 1CLYH 1P5VA 5HGBB 1T5XB 1Q0XH 2IJ0C 5HDQL 2EH7L 5FGSA 1IGJB 4G59A 1S7RB 1H15B 4WUKH 4G8FA 2DS4A 3DXAB 1QNZL 1INQB 2QADC 5CJQH 3C5SA 2NCMA 2P7TA 5B8CB 5IV2B 4Y88A 5HJ3B 1CGUA 4M93B 3I75B 3I84A 2C3VB 5IB4B 3RIFF 2UV3A 4DK3A 3ZTNH 1CICC 1BEYH 4QRPA 5F6HJ 1WJ3A 1I3GL 3D18A 2BK8A 1I8LA 4OJFL 4NN5C 1JI1A 2RCSL 3ZDXE 4WTZA 3VXOB 1MFBL 1U8QB 2I5YH 4ZUSA 4NC1E 2D0FA 4LVEA 5JMOC 2DLFH 5IVNA 4W4OC 1QD0A 1MY5A 2H6PA 1EK3A 5EULV 2OQJB 1F3JB 3QI9A 2JJWA 4IOIA 1B90A 2P8MB 5AZ2H 1LMKA 4OZHA 3O3EB 1MFCH 1QFOA 1I9RH 1NDMB 1YPZE 3MJ8B 4NKMA 4OCYL 4ZSOB 1TNNA 1F97A 4U6VH 4X80L 5F9OL 3ROLA 3IS0X 4OGXH 4FFZH 2D7QA 1XT5A 4N0CA 3KYOA 4POYA 4DK6A 3BKML 4GLRI 4NKOA 4HJ0D 3OKEB 5FYKL 4RZCA 3MC0A 1DQLL 2VLLB 2D4DA 3SE9L 4AM0B 4FFWC 3LQAH 5EBLA 2D7PA 3BQUD 2I07B 5C08D 3AXLB 4WI7A 5DI8A 1T21B 3PWPB 3GMOB 3QIUB 3FT4B 2B7DT 1WWWX 5AYUH 1AE6H 1JBJA 1G9MC 3D85B 5KS9A 3T3MF 5E5MB 1ZLUH 3L1OH 4JFDA 4PY7A 2YC1B 5T5NG 4O2FB 1PKOA 1LILA 2PO6B 4JRYA 4YC2B 4J1UA 4XZUA 1EAJA 3OKNA 3WJLA 1KJ2A 5JIPA 1L7TH 3MRRB 5MHSE 2IBGA 2YK1H 5EDXA 4PJBB 4Y5YC 5E2VH 1WQVT 2IBZY 4GG8A 5JHDE 2HWZH 1YY9D 4OCRH 1RUML 5DRZB 5TE4L 5IKCA 4X5XB 5K59E 1CK0L 3ETBF 3JTSA 1CFQA 3VFGH 4BSVA 5JXED 2BXZA 4WFGD 5DO2D 1H3PH 4JG1L 3VXMA 5KOVC 3BQUC 4YO0A 1VPOH 3RWJA 1VFBB 3ULVH 3BPNC 2EDQA 3QUZB 4D0BA 3D0VA 5MP6L 2R15A 3PWJA 3S88H 4ODHL 4PJDB 4AIZB 4MNGB 4ELMF 3PP3H 4H8WH 4LK4A 2ICWI 5GJTL 5BXFA 3RWFA 3ZKNC 1G6RA 4Y4FD 5AWNL 3FB8A 2Q8AL 4QHLA 3BRDA 2IFGA 1ES0B 4ZXBC 1BD2D 3QHFL 5C0JB 1YY8B 2IH3B 1MI5D 4Y5XB 5KJRH 1J8HA 3IT8D 4WJ5B 5GRJH 3WO4B 5HGBA 1T5XA 4YHLL 1HYSD 4UT6L 3BEWB 1C8PA 5HYQB 1IGJA 2BNQD 1M7IB 2N56A 4BELD 1S7RA 1H15A 2R0KL 2J8HA 3Q2CA 4X8JB 3MPCA 3DXAA 5DO2C 3MTRA 1INQA 2NY7L 3NIGF 3L5JA 1RD6A 1KENH 4Y2DB 4CW1B 5B8CA 5IV2A 5HJ3A 5F71A 3I75A 5IB4A 2AJSL 2C3VA 2XWTB 3GNML 5GS3A 2CO6B 1GXEA 1ZTXH 5L0QC 2Z8WC 1LGVA 3D69B 1HSAB 1X5FA 1MHEB 4X4ZA 3SQOL 1QBML 1NMCB 1JNNH 3QWRA 3VXOA 1V7NL 1U8QA 1WEJL 3BOVA 1FFQA 4P2RE 2LFGA 4X6DB 3CVIL 3HFML 4KRPD 4RGNB 1IFHL 1CQYA 5HHXH 4I2XE 2E6QA 5DHYB 5AZEH 2OQJA 1F3JA 2ICCA 5CIPB 1F90L 2O5ZL 2P8MA 4UT9L 5D8JH 3V8CA 2VQTA 1FO0B 3TJHD 5CBEB 3O3EA 1T03L 1NDMA 3MJ8A 5C2BH 2VKWA 4ZSOA 1MCPL 2W0KA 1DSFL 4O58H 2VWEC 5JOFB 4H1LG 2HLFD 3OAUH 4JREC 2NY3B 2Z31C 1YQVH 1FVCB 1CXLA 4YDVB 1CE1L 3GSXB 4IMLB 4UU9B 3BGFB 2EDFA 4FZ8H 4KUZL 4BZYA 3D6GA 3OKEA 3LDBB 4KQ3L 3A67L 5I15L 4K7FB 2VLLA 4RMWA 4G9FB 1JYVA 4PJXB 4AM0A 4MXVE 4Y1AB 5D5MF 3UXFA 1DL7H 1HH6B 4E42B 3RUGE 3T3PF 4L3EA 2I07A 4XCFL 1K4DA 2W92A 1T21A 1CI5A 3CFEB 1ZAGA 4RAUA 1KJ2H 3GMOA 3PWPA 3QIUA 3LQAC 3FT4A 5TQ0H 1U9KA 2HP4A 5E6IB 4Z76B 5K9JL 3BZEB 3QEGH 3WIFB 4YPJA 3TJHC 4KI5C 3D85A 5HI4D 1WBXB 3GBLA 5E5MA 4O2FA 5DVOA 4HUUB 3B2UD 2PO6A 3D3VD 1OAXH 5KG9A 3Q6GH 3L9RB 5IFHL 2ZNXA 4KQ4H 1JVKA 3MRRA 2NZIA 1UXSB 3UYRH 4PJBA 4I48B 12E8L 4N68A 1RIHH 5DRZA 5FGBC 1CLCA 1CZ8L 1QRNB 4X5XA 2PW1B 2I27N 1Y6KR 2J8OA 2Y06H 3MOBH 5FOJA 1IQDB 4POZD 3HZYB 1A3RL 1QACA 5H2BA 1P4IL 4ZOAA 2EDJA 1P53A 2XNAB 4QRPD 1VFBA 1LK3L 3H2WA 4HEME 1AKJB 3QUZA 4LFHD 3IDMB 3WJJC 4PJDA 4P4KC 3VXUE 3JWOL 4GQPH 4AIZA 4MNGA 3ULVC 4KTEL 1TPXC 1KIRB 3TPUB 2KH2B 1QA9B 2UWEF 2YXMA 3B2UC 3GBML 1JPFB 4JPKH 5CEZE 1A9BB 2X4SB 1UB6A 3QI9D 4H8WC 5HYJE 5E8PB 5JW5A 1PJ9A 2MSPA 1ES0A 3N85L 3HAEB 3VXPB 5DUPL 1YY8A 2IH3A 4Y5XA 3RBGA 4WJ5A 4HUVA 3GMNA 4XH2B 4HXBH 3BEWA 5HYQA 3FQTB 1Y6NR 3TO2B 3UYOD 5T3ZL 1M7IA 4ZFOB 4RFEB 2LTQB 4N0CD 4KMTH 3H9SB 1FFNB 1XCTB 4OCLC 4Y2DA 4CW1A 5JR1L 3UTPD 5DQ9B 2XWTA 1EPFA 1JYWA 1I8LC 2CDEB 4WENB 1N0LA 3PP4H 2DQGH 3O81A 3D69A 1HSAA 1MHEA 3ECBB 2ICEB 1IC1A 3NFSH 4FHBD 3LQMA 4OM0L 5IEKB 1R3IH 5CCKL 1QHOA 1MCBA 1N5AB 4C54A 3HUJE 4JB9H 4ZS7L 1AHWA 5ISZE 4X6DA 5CINL 2N4IA 1FYTE 3RFZC 4NZRL 4YXLL 5DHYA 4Y7MA 3IXAB 1NANH 3MLRL 3B4NA 2E8YA 2BSTB 4LPTA 5CIPA 4ODVL 2WZPD 2DYPD 2Q20A 4JRYD 3VGAB 1FO0A 1Q0YL 5CBEA 1QYGL 4KU1A 3FAWA 4N0CC 1A3QA 3LB6C 5JOFA 1IAIH 3QCVH 1U8KB 1OT1A 3BDBA 3GSXA 4UU9A 1V05A 6FABH 5JXAH 1JYNA 2DLTA 2A74A 4K7FA 5E99L 5D7IB 4G9FA 2H1PH 4I77H 4PJXA 1ONQB 3GI8H 3B3IB 1KLFA 4Y1AA 4E42A 1HH6A 3C6SA 5A2IH 3CFEA 1HSBB 4LLMB 3T8XB 1FRGL 1J0KA 5TF1L 4FQCL 4GQ9H 5E6IA 4Z76A 3BZEA 1I1RA 1UACL 3ZO0A 1JI2A 5FDWB 4MQSB 3WJLC 1WBXA 4ODBD 43C9B 2W0LA 4HUUA 3G9AB 2VLRE 1J8HD 1U3ZA 4LHUD 1EJ6A 3L9RA 3F7YB 1C5CH 1UXSA 3I6GB 4I48A 1RUAH 5A1AA 4FQ2L 2D31B 1QRNA 2PW1A 3DUSB 4XC1L 5BMFH 1IQDA 3UDWA 5E9DB 2Z0BA 3HZYA 3OHXA 5DD5L 4MLIA 1X4XA 2XNAA 1L6XA 5ID1B 1AKJA 4YZFE 3IDMA 1MREL 1KJ3H 3H9HB 1I9IL 2YA0A 5DJ8B 4MA7H 1CT8B 3T0EC 1F00I 1KIRA 3V6OA 3TPUA 1QFUH 4KJPD 1QA9A 1AGCB 4IRJB 1KACB 3JVGA 4AEFA 2F74B 1OWWA 3FMGH 3L95B 2HT4C 1JPFA 3S37L 5D93B 1A9BA 2X4SA 4OD2B 5F7YC 4PRPB 5E8PA 5ETUB 2F19L 3HAEA 4XPTL 4BQ6A 3VXPA 3CZJA 2I9TB 2E6JA 2A6DB 2O5YL 1F42A 5C70A 2HH0L 2ZOLB 4DAGH 2A77H 4XH2A 5CHNB 3TIDB 1NCDH 5B8CC 1TTUA 3BZFB 3FQTA 3TO2A 4M93C 2YN5A 3K0WA 4ZFOA 1RULH 2FD6H 4GW1B 4B41A 3FFDB 5C3LD 4RFEA 4PJGE 2YD4A 3H9SA 1FFNA 1XCTA 5BVJB 1OP5K 2L4OA 4WFFE 5DQ9A 5KSBE 1A6WH 3GEWB 4L1HA 5DJYB 3DI3B 1HHHB 2YD8A 5F7KC 2X4TB 4YHOH 3H7BB 2D7MA 3CMOH 5CIPH 3ECBA 4L3ED 2ICEA 4J3WA 5IEKA 3LPWA 5C07E 1FE8L 1G9ML 1AO7B 1FO0H 3ULUH 1N5AA 5FO9B 2NXZB 3DO7B 2VXUL 1FVEB 1W0WB 2XN9D 4DFIA 3D85D 4MMXC 3IXAA 3K8LA 2BSTA 2PYEB 3MO1B 1EV2E 2VH5L 2EXWD 3AC0A 3DNKA 4WHYH 3RVVD 4RRPA 1KCSH 2OL3L 1VHPA 3MV7E 4XI5C 2YPLB 4I9WD 4MS8A 4LHQB 3TN0C 5HHQB 3IB4A 5DURB 3AREB 2A9ML 2N7AA 3MOAL 2JCCB 4I0KA 4PJ5E 4KJWC 5GSVB 1RSFA 2XY2A 4S0TD 1EEUA 5D7IA 1X5XA 2ILLA 3QUZD 1ONQA 3FN0H 3B3IA 3NPZB 3QIUC 2X1OA 5EUOB 1YEHH 1HDMB 4J3TA 4WI6A 4WUUB 1HSBA 3KPOB 2BNRB 1W72L 3QIBD 4LLMA 3T8XA 1S3KH 1UA6H 2PO6C 2DMKA 4YC2C 5TE6H 1LE5B 5FDWA 4LSTL 43C9A 4P59L 4AEIL 1CLYL 2FB4H 3F7YA 3HKFA 1Q0XL 4LCWE 1KV3A 3IJHB 2UZXB 4LF3B 3Q0HA 4WUKL 3I6GA 3HLAB 4L4VB 2G9HB 5CJQL 2D31A 2YUWA 4Z77A 1CCZA 1J9CT 3MLVH 3DUSA 1B6UA 1VACB 1Y6MR 3BKYL 2P47B 3MLXH 3KLSA 3QUZC 1DVFD 2ARJA 4FZEH 2R56H 3MLUH 3V5HB 2COQA 1MCFA 5JTWA 2ZUTA 1YEFL 4KRMB 3HAEH 2FECI 4QWWD 3H9HA 5D2LF 3K1KC 5DJ8A 4V3EB 2HMID 4G8GD 1CT8A 2V7HB 1FNLA 3KPNB 4EVNB 1AGCA 4IRJA 2W0FB 1FCCA 1NC2B 2F74A 3T08A 4NNXA 1T80A 5T3XE 3L95A 3ME0A 4Y5XC 4OD2A 5ETUA 3WO4C 1QFWI 1C1EL 5HVGB 1VADB 2I9TA 2A6DA 4LQFH 4JFHE 2ZOLA 4KK8D 1MFCL 4FQ1L 1YMME 4QRSB 5CHNA 3TIDA 5HVFB 4Y2DC 3RVWC 3BZFA 5D5MB 3P11H 4K9EH 3KS0J 4OGXL 5F89A 4GW1A 1UT9A 2BVYA 3FFDA 4NKDA 3CSPA 3MFFB 2BX5A 3DUHA 5DJYA 4OF8A 4QWWC 1NMCC 3IJSB 1MAKA 1HHHA 2IGFH 4G9FD 4JHAL 2X4TA 1ACZA 2HMIC 2VSCA 3H7BA 4Y1AD 2LE9A 1BOGB 3B2VH 3MSPA 3PNWB 3U7WH 4RGNC 3REVB 4JFFE 1AO7A 2DQDH 4JM2A 4NWTL 5DJAB 4KTYA 4NCC2 3RI5F 5FO9A 1R0AH 5E6ID 4EBQH 3K2MC 3DO7A 1FVEA 5AYUL 4LCIH 2OJEB 4HT1H 3LN5B 3TH2T 4L9LB 3ULUC 4KK8C 3FFCB 3BH9B 1RZKH 5IVXB 2PYEA 3BD4A 3MO1A 2NY3C 2YN3A 2J4WH 2J8UF 5JA9A 3V9FA 5JW4M 3BGFC 1CXKA 3MZTA 1BZQK 1D5MB 2YPLA 3LDBC 2DKUA 3I3DA 1DBKL 5HHQA 1MY7A 3AREA 1ULVA 2VNCA 2E9BA 2XQYK 2DDQH 2JCCA 2F9BT 2WQ8A 2ZPKH 1VPOL 5GSVA 4KGJA 4PY8J 3ULVL 4M62H 1AKJD 4BKLB 3V4UH 5EUOA 5B3NA 1HDMA 5KANG 4OZIF 3K4DA 2JJUA 4H8WL 4WUUA 4ZS6D 3KPOA 3VI4E 2BNRA 1IGCL 3BP5B 4PRDB 3O2WH 2NMSA 2B4CH 2VDKH 2WBWB 1LE5A 1T7VA 3E6FB 4Z7OE 4XMLL 5HGGS 1D3CA 3NAAL 5KJRL 3E0GA 5GRJL 1GAFH 2BDNH 3KXFE 3MGOB 1XH3B 1RJLB 3IJHA 4LF3A 2WBJC 1U2CA 3GKZA 3T4AB 4LSSH 1MVFA 3UDWC 3HLAA 4L4VA 3S3SA 2G9HA 1P9MA 3WNOA 3TC9A 1KENL 3H9SD 3SDAB 1A9EB 4KY1H 1MCOH 4KJYB 2OJZH 4J12A 5GS0H 3DHMA 2GSGB 3V5HA 3QUXA 4ZS6C 1I1YB 3V6OC 4MAYB 3FONB 1Z9SA 2X4OA 3JVGC 5IROC 1JNNL 3EFDH 5I66B 3SKUD 3BN3B 5FHBH 3T4YB 1TJIL 2V7HA 3V95A 3KPNA 5EOCH 2HT2D 2W0FA 1NC2A 2VR9A 5E24E 3BPOB 1A7BA 1NFDF 3CXDH 5J06A 1VADA 3HPJB 3EDDA 2HT3C 3MV8B 5SV3A 4QRSA 2BERA 2LTQC 2CRIA 3OAUL 3PL6B 5D5MA 2LVEA 4PLJD 4JANB 1YQVL 1YNKH 4MS8D 4Q2ZB 1A6TB 2AS5M 4JO1H 2A9NH 2BOCB 3MFFA 1J8KA 4G42A 4K9EC 3S8WA 1LDPH 5DJ0B 1ZEAH 1WZKA 3Q1SH 2J7LA 3WDIA 1KLGA 2D7NA 3KYKL 5L2KE 32C2B 1BOGA 1U8LB 2XXCB 3FOMB 4ZMAT 1N4XH 1UH2A 3PNWA 1J0IA 4ZO7A 3REVA 1AXTH 5I1AB 1QOKA 5DJAA 3MJGX 2YXFA 5TQ0L 2QQQA 1OSPH 3G5YB 1SBBA 2OJEA 4L9LA 2P5WE 4B7LA 3BH9A 4QTIH 4YBQD 3G6DL 5IVXA 2DOCA 3Q6GL 5IB1B 3FO1B 4MS8C 4Q9BA 4LQ1A 3N0PB 1RZKC 5C0NC 1S7SB 3KLHD 1BHGA 1SYVB 5GRYA 3UYRL 3NA9H 3O4OB 3T0DA 1D5MA 3QXWA 4WNQA 1U41A 3MOBL 3TH4T 4CVZA 5E08H 2CXGA 4BQ9A 4M9OA 2VR4A 3SE8H 1BQUA 4FABH 4Q9QH 1NMBL 3PDGA 4MNQB 5D1XB 2DI7A 2IC2A 2MFNA 4BKLA 2HRPH 1T7ZA 4Z7WB 1N64H 1CFNB 4D0CB 4Y19A