4U1NA

Hla class i micropolymorphisms determine peptide-hla landscape and dictate differential hiv-1 escape through identical epitopes
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
278
structure length
278
Chain Sequence
MGSHSMRYFHTSVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPREEPRAPWIEQEGPEYWDRNTQIYKAQAQTDRESLRNLRGYYNQSEAGSHTLQSMYGCDVGPDGRLLRGHNQYAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAARVAEQDRAYLEGTCVEWLRRYLENGKDTLERADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, B-42 alpha chain
publication title A molecular switch in immunodominant HIV-1-specific CD8 T-cell epitopes shapes differential HLA-restricted escape.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 81
structure length 278
sequence length 278
ec nomenclature
pdb deposition date 2014-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4u1nA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4u1nA01
5DUML 4GMTH 3O45B 2R2CA 2QADB 3HRZB 2Q87A 1RZ8A 1WBZB 2E9JA 1XF1A 3OKEA 4LEXH 1HZHL 4JKLA 4WENB 4PRHE 5ADPL 4KFZC 3VW3H 2PTVA 1QOKA 3DURA 4Y4FD 4XT1C 1J1PL 3SJVD 4Y4FC 2VIRA 5EORH 3VXMD 3NA9H 5FYLD 1LO2L 3ULVD 1BOGA 2X4SA 3ULVC 3TN0A 1EJOL 2Q8BH 3VWKA 1JIBA 2D0HA 1MY7A 4HH8A 4JO1L 4HIEA 4RNRA 1EDQA 3JVGC 4L3EE 5FM5M 1FV1A 3QUKA 2AQ1A 4JFED 2WBJA 4PD4J 3GMNB 3C5ZB 4ZPTB 3ME0A 1ZWIA 5DD0L 1TXKA 1L7IH 5J6GA 4LMQE 2PN5A 3DBXA 4TNWK 4GFTB 1S3KL 5F89A 3I85A 2J6EH 4PRNB 1HHJA 4KTYA 2FB4L 3V7MA 1I7ZB 3RTQA 5I17B 3PWLB 5ID1B 4D2NA 1SJVA 3ARGA 5C3LD 1P4LA 2Z31D 1U8PA 3GIVB 4PV8A 2Z31C 3N1FC 5FOJA 1GAFH 2DBLL 4KRPD 1YMMA 4KRPC 3IGAB 1QRKA 3GKWL 4UIKH 3DVGB 3SKJH 4R26L 4XC3L 2R56L 2PYED 3ULUD 3U36B 1W72A 1KJ2H 4JKKA 3TIEA 1AXTL 1MNUH 1SYSB 5IM7B 4Q9RL 4PJCF 3MJ9A 5IEKA 2DQUH 4O02H 1HSAB 3QIBA 1CLOL 3MV8D 4ZUUB 3IS0X 4BKLB 2YUVA 3FCTB 1TZIB 1JNLH 1ZT4A 3JWOL 1MHCB 4OSUL 1S7WB 1CFBA 3C2AH 2APWA 2XZZA 3E6HA 4MAYD 1CGSH 4LCWB 4I48A 3WJLC 3AAZB 5I19H 2VDNH 5CIPH 3NCBB 2JJVA 4L29B 2C3GA 4M43L 3LMJH 4FA8A 3UBXA 2DYPB 3EYFB 2X9XA 1MFDH 4M7ZC 5I71B 2DWEB 4F3FB 4YK4B 3QNYA 1JUFA 5TGBA 3CCHB 5C2BL 2O5XH 3ULSB 4BZYA 5EU4B 4JCMA 2E6QA 1X5JA 3CVHH 4HIJB 5B4MC 1NSNL 1UJ3B 2D7NA 2FL5A 2UZIL 3D25A 3H9SB 3EFFA 2WNGA 1MJUH 5C7XL 4Z77B 1JYVA 3IXAB 3H3PL 2PYFB 4LASL 5EBWA 3SJVA 4KK6D 1M7XA 3K80A 3D1MC 4NQVA 3SDXA 4K9EC 3TFKC 5FUCC 3QXAA 1WEJL 2BOCB 2V5SA 4R4BB 4ONHB 2DL2A 4ODWB 1TCMA 3U9PH 5F70A 3BN3B 5D1XC 2MSPA 5EB9A 4ZTOH 4HXAH 5KSBF 5I1EL 4PB9L 2I07B 5MERB 4RAHA 5FM8A 3P4MA 4K3JH 4Y5VB 3F6IA 4WFHD 1S8DB 1ORQA 2B39A 2ZOLB 4PRID 3T77A 4ZXBB 5IJKC 3T0EE 4N8VA 2ERJB 4APQB 4JRYB 3KPMB 1BD2B 2D7PA 3DO7B 4S1SH 4RGND 3OXRB 4XBPB 4RGNC 1LO4H 3QCTH 1Z9LA 3R4DA 3PWNB 4H8WC 1G1YA 4M62H 3EIFA 4JFDD 3C09B 2NY4D 3ULVF 2FBOJ 2X4QA 3HZMA 1C5DB 1IJ9A 5GSRA 4JY5H 4IOFD 3GSOB 4G6JH 3G04A 4X8JB 3QFJE 1BIIA 1FVDA 4XP9L 1KUMA 2P44B 3TO4A 1L4IA 2N4IA 1U8JB 1UB6B 2IMNA 5EO0A 3GSRB 4JDVA 1NBYB 1NMCB 1I75A 4JZNA 5CKGA 1RIVH 2R69L 4JO4H 1UWGH 1X9QA 3IDIA 4PBXA 4NZRH 4JG0H 3RWJB 2OZ4A 3IXTA 3S36X 1Z3GL 5F88A 3HUJE 1MCCA 1NGZB 4XNQA 4FXGA 3CXHK 3R1GL 4P3DB 4MAYA 4KVCH 5KVMC 3B5TA 5GRJL 1FE8H 5E4EB 1JJUA 4PY7A 1S9WB 3HI1A 5HYQB 3EYSL 3QUYA 4HULB 2QR0B 1A4JB 2VZSA 3U6RB 1WITA 2X1QA 5F6IB 5KZCD 3ULUF 1DL7H 2HN7B 1U8MA 4A6YB 4Y16B 2IPUK 3RBGA 1GCFA 2P42B 1P2CB 4KUZH 1P9MC 4DN4L 1J0JA 2OLDA 4HC1A 5C8JB 4H25A 1LDPH 4XAKE 4ODUA 2HTLD 3MRCA 3IDNB 3DGGA 1NUGA 4XRCB 3WFBL 2HTLC 3B3IB 2AEWA 4S0TD 2EH8H 5EFIB 4YJZL 3C8DA 4K94C 2CKBB 1HHGA 1YZZA 1KJVB 2LAAA 3RL2A 1KJMA 4XMLH 5J0BA 1G7MB 5I6XC 4BSWB 2CLZB 3GI8L 5F44A 1T20A 4KI5D 4JB9H 5KVEH 2J7LA 4HDIA 2A77H 2OI9B 5EIVA 3RWIA 3GUTB 4DKFH 1HOCB 5BV7H 3DUHA 4JPKL 2H26A 2I9LA 2L0DA 2W59A 2EEAA 4TOYH 3G08A 4FABL 3ES6B 1TMCB 1A8JH 5EWIH 3MLSL 2ZJSL 2PTTB 4MD0A 5HHOD 1VEMA 2YS4A 4FQQB 5DF0A 1HQRB 3IU4L 1ZANH 2BSTB 3LQZA 3CUPA 1T2QH 3ALXA 3VJ6B 5EA0L 5F9DC 1BBJA 2I25N 5DTFB 2DN7A 4PP2B 5KVDH 1OAYL 1J5OL 4PY8J 4U7MA 4J3XA 5TJWK 1ZT1A 3KPLA 3GNMH 1OLZA 4B5EA 5BQ7A 3WN5B 4PJFE 2XZQH 4LSTH 2NY2D 4PJGB 1QFHA 3S34H 5DMJB 3GMMA 5HGAA 1FGVL 4OGYH 1ZXQA 3WIHA 2XPGA 4YFEA 1ZHNA 3HG1B 1CD8A 2R0KL 4IRJD 4XXCA 5IW1A 1E0OB 4IRJC 1I7TA 2OTWA 1UB5A 1EUTA 4HT1L 5DEGA 1IC4L 1ED3A 2PO6B 1FZKB 2VKXA 2V17H 1OAUH 1KJ3H 3VRLE 5FYJD 5JW5B 5CGMA 1TCRB 4ZS7H 5IB3A 3BQUB 3X3FH 1M7DB 1I1YB 3S37H 4B0MM 3DX9B 5L8JB 5JIHA 1MFAL 4AT6A 3QZWG 3CH1B 1ZGLP 1L7TL 5E94A 3UXFA 4C55A 1AGDB 1BQHB 3GO1H 1AIFB 3I75A 3FOMB 3EGSB 3VXNB 2VMFA 3RWFB 2BNRD 3D9AH 2ZCHL 3TZVB 4J3UA 4EN3A 1SYVA 4NFDA 4L4VD 2AJ3A 2R23B 3HC4H 1JWUA 1P4BL 4F37K 1R3LA 4HXBH 3B6SA 3LRSB 4OZ4A 1RJYB 4YDJA 1EA9C 3NIDF 4CAGA 1MCBA 4OI7A 2ZZUT 3UJIH 5L0QC 5IVXE 2ADGB 5JXAH 4LLVA 4JFOA 1BF8A 4EDWH 3L5JA 2EIZA 4XZUB 5ERWB 4V3DB 1U58B 5DSCB 3BYYA 3RWHA 3CX2A 4HUVA 3KPNA 5ADOL 1KIQB 2EICA 4Y1AA 3Q6GL 2EH7L 3X12B 1GSMA 4N1CA 1BEYL 4KDTC 3MMEB 4N0YL 3V5KB 2ZPKL 4BZ1L 3DX6A 4F7CA 4NQCD 4JQXA 5DVOA 1J0YA 3G9VA 3X13A 3RWDA 2EO9A 4P2CG 1KGCD 2NXZB 5CBEA 5GZND 2O61B 3BEVB 4HH9A 3RU8L 4X4YA 3O9WC 1I9IH 1E27A 2R0ZH 4P4KB 5F3BA 4WHTB 4XP6L 2H3NA 5HHOA 2C26A 4YHOL 4ENED 1YEEL 5TE7H 4YXLL 4ENEC 4NHUE 1CE6A 3BP6A 5FYKH 4MDJA 3QUZC 5IROC 1QSFE 2VDLH 1J0KA 2CSPA 2UZYB 2H1PL 5CUSL 1QSEE 5JORB 2WLZA 4P2RD 5I18H 5DHVH 4HWNA 3O3EA 3HAEG 1JPTL 4KI5F 3TV3H 1MHPL 3FQRB 3AMKA 5L7XH 2X4UA 3GMOA 5DDHB 3MRMB 1ZVSB 4G8IB 3DYMA 5IB4A 3U79A 1S7VA 4P2QE 4X80L 1MRFH 1PKQB 1A0QH 5ANME 4ZFOL 3QDAA 4MNHB 3EOAB 4ZO6A 3AB0B 1E4XL 4P23A 1DBJH 4R90L 1I85C 3KJ4C 2X9YA 3SPVB 1WZ1H 1UC6A 2DQDH 3LKQA 5TE4L 4L9LC 2DMKA 4H88L 1HYSD 4LBEA 1Y0LB 4PREA 1HYSC 12E8L 5TQ2H 5BV7B 4AG4L 1U41A 3RHWF 4U6YA 5BW7A 2VABB 4GXVH 2BFVL 5LCVL 4ZUWA 1JV5B 35C8H 4XBGB 1GJIA 3MROB 1DQMH 3QJHA 5ITFB 3SDAB 5GGRB 5BS0B 1BJ1J 4Y88A 4CW1A 1M6OA 3WDIA 2IANE 1I3UA 4GS7C 2X4TA 4YHZL 2R39A 4LGRB 2WWKT 3WUWG 4GW4B 1Z5LA 4UQ2B 3QFDB 4DUVA 1KB5L 1C7TA 3QRGH 1MCDA 4IIQA 2AK4B 3FQUB 4M3JA 3EO1B 4OD1L 1NFDB 1S7SB 5IFJB 4L4VA 2ITCB 5F7UA 5J11C 5DD5L 5B22A 4G9FD 3EYQD 3OR6B 3C08H 4PJ8D 3E3QE 5J1AB 4PJ8C 3PHQA 1NGWB 2D9CA 5EU7C 1AP2A 1FLTX 1SBSH 5IHZB 1L0YA 2R2EA 5F1OB 4I3RH 1VACB 2DQCL 4Z7OF 1NBZA 4FHBD 1GPOL 1KLUA 3MRBB 1UM4H 4NCC2 2CRZA 1NCCH 1HH6A 3MGOB 5HDOA 4EIZC 5CKAA 5D7JB 4HPYL 2E6PA 4P3CH 3EFDL 2XICA 1OLLA 2BNQE 1KACB 3WIIL 1Q94B 1S78D 4JFHE 3GMRA 1S78C 5IQ7L 4HGMA 1ZHKA 1WAAA 2DQHL 5E00B 1DLHA 1F6AB 4CVXA 4X6FB 4YC2C 4C4KT 2OJEB 4YDLB 3OJDB 5F9JB 4WRLA 3JV4A 4YHNA 4WDIB 4LLMB 5D7KE 3P77B 4LSVH 1JPSL 1GGIH 4KMQA 4P2RA 4XNUL 3MREB 3O2WL 4X6CE 5D70L 3TCXA 4LQFL 1FO0H 4XP1H 2PKDA 4X7TB 4Y5YB 3QBTB 2W60A 3CDCA 5DK2B 5C0BE 4XBEH 4OM1H 3BPLC 1FORL 2YSSA 4KK5C 1WAAF 5D2NE 5DD3L 1CG9A 3KXFB 1ZA6A 5D8JL 5EZJA 1OCWH 1IC5L 1T5XA 3QEHA 3W0WA 5D96C 2XG5A 4LHUD 3VFPB 2FBJL 2AKRB 1A6VL 3FB5B 3O81A 1AGCA 4JFXB 3MUJA 1EHXA 2V7HA 4I2XB 3VFMA 2XY1A 1EHLL 1RIHH 2X7LB 3ECBA 2YD6A 2V9TA 3MA9H 5C0AD 4F33A 3DX8B 2XTJD 1UKQA 1OGTB 2DBJA 4EXPX 3OZ9H 1E6JH 2CDEA 4AEIH 4QF1B 3TBSA 3VGDA 1YEJH 3GJFH 2BHYA 3MLRL 3RGVD 2YK1L 5GGSA 1FGNL 3VW3L 5BOPA 1FNSH 2CLVA 4RFOH 4BUHA 5IKCB 3BE1L 3AS3A 3NA9L 4DFHA 5IV2B 2KL6A 5ACMA 1TETL 3D85A 1UQSA 4BK4A 5J6HA 3TNNB 3BVNA 3N50A 2Q8BL 4OZHE 3NPSB 1WCQA 5FM5O 1WT5A 4HGKC 2ZUYA 5DZOA 2DLTA 1AHWC 3GBMH 4J3WA 4URTB 5IWLA 4L5FH 3A6CH 4W6XB 1G9NC 4M3KB 4NC2B 5IMLB 3BKJL 5JW3H 4O00A 5DUBA 3SKNB 4ZFZB 4FN0A 2PUQT 3LS5H 2JKXA 2WM0A 2J6EL 1IL1B 1DFBL 5DUPH 1JZ8A 3T0DA 1LP9B 3D39E 4N9OB 3MV7A 3I6GA 1I8LA 1S7XA 4HKZA 2HWZH 2I9TA 2F5AH 4KKAD 3L1OL 4QY8A 4YHIA 1GAFL 3STLA 2JCCA 4KKAC 1JGDA 4OCNC 4Z7VE 3EDFA 3GSNA 4AL8H 3O4OB 4FQJH 1I3RB 3PQYA 4UIKL 3FTGA 3AM8A 5F72S 4NBXB 4U1KB 3MRJB 3SKJL 3TNMA 2CD0A 2CK0H 1XT5A 1CDIA 1INQB 3Q6FA 1LVEA 3SKOB 2GT9A 3SO3C 4Y19D 1KJ2L 1T03H 5B3JF 3VFUB 1MNUL 3OKDB 3KPRB 5FO9B 2EC9U 2DQUL 4O02L 4QRPB 4RCAA 1GYAA 2ICWI 3F7PC 1XGUA 1JNLL 1FG2A 4V1DA 3HE7B 1FYTA 4HGWA 4TNVK 2WP3T 4N5ED 5CCKH 3QI9B 5E2TH 3SDDA 3QIUB 2JCCF 2Q7YB 3C2AL 3ORJA 2OK0H 2NY0B 3FT3A 3FQTB 1YYLL 5CEYB 1J88A 5I19L 2VDNL 3ARBA 1YEGL 1BWWA 4XNZB 3ROOB 2V2TB 2GYSA 4B53A 4KJYA 4UOJA 4F8QA 3P4NA 4EI6A 3OKOB 4RWYH 1MFDL 4UUJB 5D1QA 4E9LA 4LMQI 2GJ6B 2XY2A 5TQ0H 3BRFA 2BCKB 3BSZH 2BK8A 2E7HA 4HC1H 5C0CB 1JN6B 2O5ZH 1CN4A 4CMHC 1BFSA 2KKQA 3CVHL 5C0AA 1PY4A 3PABA 5TH2A 1S9VA 4HCRH 4YPGA 1MAJA 3VGFA 3P11L 1MJUL 1G7HA 2EKSA 4NZJA 2R1WB 1Z9MA 3DSFL 3SGJA 2AXGB 4YEFA 4K7PY 5DA0B 3MNVB 2NY1B 5D71H 4PRAA 1K6QH 5DJ8A 3PV6A 5KS9F 5L2JB 3E6FA 3U30C 2MQ0A 3QEQE 2CPCA 5GS1C 1E4JA 3ZDXF 5GRUH 4XPAH 3FO0H 3U9PL 4LKXB 2F19H 5GQBA 4ZTOL 4HXAL 2MCG1 3LEXA 4PRHB 4HQQH 4JZOA 4PRDB 1G7QB 2D9QB 3C60A 2IMMA 3BDYH 5IB1A 4O4YH 2ICWB 1UACH 5MEND 1HEZB 2HG5B 3WFCL 1Q9OA 2CMRH 4QRRD 4BELD 3VFTA 4S1SL 4PV9A 3MCKA 5AZ2H 4CVZB 4HBQA 4L8CB 1MVUB 2BP3A 2VLKB 1II4E 4P2OA 2RIKA 4L3EB 1F13A 2X42A 5HI5D 2QADC 3QXTA 4GRLD 1CU4H 1MAKA 2JJWA 4JY5L 1MEXH 5JNYB 1DCLA 2Y4SA 2G5BA 4O9HH 1AXSA 4G6JL 3DWTA 5C07A 1P6FA 3TT3H 4P9HC 2FSEB 2VWEC 1J1OH 1CGTA 1KTDA 1F2XK 3FFCE 1AD0B 4J12A 1XGRA 3C5JB 5GSVB 4M1GH 3FQWA 5CP7B 2JF1A 1ZEAH 4JY6A 1PQZA 4YBLB 2GSGA 3KYOB 4OLXH 1Z2KA 1PVHA 1UWGL 3VH8A 1OP3K 4NZRL 3K0WA 3NFNB 1MI5B 3NFSH 2VLJE 3WS6A 3MOAH 2HLFD 4R0LA 3ZYIA 1F8TH 4N5EA 2HLFC 4E5XB 4POUB 4UT7H 3MQIA 1KXQE 5F8QC 1UXWA 4HK3J 3MJ8B 1BZQK 2HAZA 4PJBE 4KVCL 3VG0H 4JJHA 1FE8L 3CC5B 5SX4H 3C5ZC 3I84A 1I9EA 3CDGB 1J8HD 2FZ3A 1GGCH 5AUMB 1VFUA 2FHFA 3AVEA 3NZHH 3G6DH 1DL7L 1U93A 5AWNH 2BVOB 2W65B 3RJDA 4D0DA 3MOBH 3PWJA 2XQBL 4P5TB 5HYSA 1LDPL 5E5MB 5TFSL 4NZTH 5TDNA 1AQDA 2EDNA 2EH8L 2IH3B 1EK3A 4KJPD 3GZKA 4KXZH 4KJPC 4MD5A 3QWOA 4C56A 2XXCB 1NGPH 5F7YC 2ICES 4XMLL 4X6EB 3WD5L 3GSXA 3HAEB 4HIHA 5CD5C 4JB9L 4MJ6A 5KVEL 2AK1H 3FONA 2A77L 5IB2B 3WEXA 2YD1A 4QYOB 3BESR 3QIWB 4UDTB 2DWDB 4FQLH 2GTWB 4OZIA 1AQKH 4TOYL 3REVB 3I6LE 1V7NH 3UZQA 3MLTB 2V7NB 4LCUB 5I30L 1RVFH 4ZUSB 2XWTA 2FR4A 1WVZA 4KROB 3FT2B 1ZANL 3K74B 4G80A 3T3PE 4HKXA 4WTZG 3BPCB 5LAXA 4PJEA 3DMMD 4I18B 4K3EL 1KFAL 3DMMC 4HWBA 5IF0A 5KSUB 2CLRB 3S5LB 5KVDL 2FIKB 4U33A 3F6LA 1FL5B 2Z35A 2DQTH 2DYPD 5C6WH 5I0DA 1F02I 3GNML 5I71C 2XZQL 2NX5A 4OZIF 4YK4C 3WUWB 2N56A 5E8EB 4WFFD 5C0EA 5DURB 5I1LB 4OGYL 3I3EA 2YA0A 2YN3A 4CU6A 4J3VA 5DJXB 2DD8H 5FHAH 5C0GA 4MA3A 4L8DA 2ATKA 3H9SD 3ZKMD 1UJ3C 1DDHB 1DR9A 4PJEF 4WJ5B 4W4OC 3RVWD 4BSVA 5DGRA 2HVJB 5F93C 4UNUA 5KOMC 3GBLA 4JPVL 4ZFGL 4YGAB 1GIGH 1DN0A 1C16A 2V17L 4FG6D 2CDGA 3IDGA 3SQOL 3CIQA 1OAUL 1X5AA 3AREA 4FG6C 1KJ3L 3I6KB 2IADA 3RZCA 4TVPD 2WBWB 1EPFA 4ZS7L 5M7QA 2VAAA 2FWOB 3X3FL 3VXPA 2LE9A 3NVQA 1KIPA 4OAWA 5DRXA 4DKEH 1TNMA 2K3TA 4OI9A 1INDH 1OAXH 4DWHA 1UCBH 3QFJB 3TP4A 1LEIB 1MCKA 1A6PA 4RFEA 3GO1L 3QA3A 1DQTA 1VGKB 3DTXA 2BY3A 3R06B 4OQ1A 2NTSP 5E6ZA 4JQVC 3D9AL 3JTCA 1J8HA 4Y5VC 3HC4L 5DFTA 4HXBL 4IOIB 3VDBA 4F9LC 2XA8H 4ZXBC 3EDEA 4NCDA 2R8SH 4JRYD 4J3TA 5DVMA 1BD2D 2ERJC 4UIMB 1XCQB 3UJIL 5FB8B 1E4XI 3FB8B 3O8XB 3A6BL 4PGCB 3CU7A 5AD0B 2HLAA 5DJCB 5JXAL 4YX2H 3HUJB 4W4NA 3FT4B 1KIUA 2KQMA 1EBAA 1I8KB 3C09C 3RY6C 5L8KB 5HI3D 1NLBH 5HI3C 3BP7A 1MCQA 4R4FH 5C0ND 3MUGB 5E5UB 4ZOAA 3ZT7A 5IMOA 4XPFL 1VSCA 4R4NC 4WTWA 1URLA 4DOHE 1QSVA 2IF7A 1NAMB 1CDJA 1YMME 3CFBA 1X4XA 1HXMB 1C1EH 1CFVH 4LF3B 1UG9A 1NMCC 4ORZC 3Q1SH 1BQSA 4GW5B 4UOW1 3DHJA 1I9IL 2R0ZL 3WKMH 3D6GA 3KYMB 3HE6D 2OR9H 2A6DA 5TE7L 2VXSH 3S3PA 5FYKL 3VI3E 1J0ZA 1QRNA 2VDLL 1J87A 1WFNA 5I18L 5T1LB 1G7PA 1TJGH 2D4DA 3IT8D 1EFXD 1RUQH 1RUPL 1CXFA 1IAIL 3GMLA 1CXKA 3TV3L 3TJHA 5L7XL 4JZJA 4PTUB 4RGOH 5F6IC 5IEHA 2CUMA 1IQWL 2Q76B 3KPPB 4Y16D 4UINH 4X9IA 2CGRH 4Y16C 1IEAB 1SMOA 3TESA 3BO8B 3LCYA 1MRFL 4GAJH 1A0QL 3HI5L 4YDVB 4NQDB 2BMKB 3IFOA 1QFWH 1DBJL 4L9DA 5EIIB 4HSQA 2VISA 4EXKA 4RMVA 2GQHA 2AEQL 5EZOH 4PY8I 1WZ1L 3IDUA 4MX7B 1H9VA 2DQDL 1CR9H 4F15B 1IGIL 1N6UA 3CFEA 4NT6B 5DS8A 3KJ6H 3VFWA 2FGWH 1YC8A 3L3DB 4PJFB 3BP4B 4GXVL 1KIRB 2OI9C 1YPZA 3GK8H 1ZLVK 3T2OA 1DQML 5DJYB 4QXTA 2YMXH 3RX8A 5HYJA 1N64H 1GVIA 3MV9B 5IOPB 2DOCA 1YA5A 1IM9B 3N1MC 4JPIA 4GRWH 4TUJA 3OGOE 5HGBB 2VE6B 3SDXE 4U1SA 1OL0A 4OFDA 5B39A 3FFDB 5D9SB 3GKZA 1PYWA 4RMUA 1SEQH 4IRSB 3QG7L 5EC1A 4PJ5E 5FK9B 3F7VA 1T6VN 1YYMH 4NPYA 1IQDB 3VXUB 3G5XA 1KB5B 3GBNL 3LQAH 3QG6B 2XWJA 3TA3D 1D6VH 5I1CL 3C08L 3TA3C 2H8PB 3WN5C 1AO7A 5ESAA 2HRLA 4X5XA 1SBSL 1DP0A 1MCOH 3LKRA 2EC8A 1O7SA 3H42H 3HG1D 3GSWA 1QVOA 4I3RL 1PZ5A 3W9DB 4X4XB 5DQ9A 4OKDA 1MWAH 1UM4L 1NCCL 4HEPG 3PUCA 4HLZG 3NH7H 3BZFB 4NNYB 2PO6C 4HK0A 4FZ8H 3L95B 4TTDD 4JAMB 5D5MB 3HMXA 5IVXB 1N2RB 4P3CL 4PG9A 2Y6SC 2WIMA 5A2FA 1YC7A 2ZUXA 5DYOB 2MJWA 4ZO7A 3BQUC 4GBXD 4I0PB 4G59A 3GSNH 3KDMA 3MO1A 4PG2A 1D5XB 2X89D 3LV3B 3HS0B 3HE6A 1JTPA 1Y18A 4X98B 4XP4H 2O5YH 3KPOB 5I66A 3VDAA 4LSVL 1N0XH 2G2RB 3MJ9L 1GGIL 3V5DB 5A3ID 2CIKB 2PTUA 3TZVD 3ZKND 3CPLB 3TZVC 1EFXA 4PYGA 1QA9A 2IGFH 5F1NB 1FO0L 3KS0H 3QDHA 4FTVA 4UDUB 4XP1L 3BN9C 1WTLA 3HB3C 3O2VH 2X4OA 4FRWA 4OM1L 4UNTA 4ZQKB 3L7EB 1WGOA 5IK3B 5LXGH 4YEEA 1RZKL 3K7UA 3T65B 5T3XD 1OCWL 1QSFB 4JFFE 3IU3B 1UXSA 2CDFA 5DD6A 3CDYA 1G9MC 1QSEB 2IG2H 4J4PD 2VB5A 3L9RB 2IAMD 4GXUN 1IGYA 2IAMC 3IJYB 3CFIC 1AKJD 4P2QB 1RIHL 5T5NG 4HX1B 5IJVA 3N06B 3JBG7 4JM2A 2NXZC 4CKVX 2PXYB 1LEKB 3VFRA 3WL9B 1PFCA 1T89A 4KZEL 1RJZB 4OKVB 4AEIL 4P4KD 1L0QA 4P4KC 1YEJL 1WICA 8CGTA 1HHHB 1FNSL 1QO3B 2NW3A 2ZUQB 4RFOL 1B0RA 1GOHA 4N90E 1BLNB 4R7DB 4BYHA 4ZDHA 5C0FB 1X5FA 1HXYB 3GMQA 3QO1A 2AV7B 3HHRB 3QEGH 2R0LH 1IKNC 1QPXA 5IIEA 5DVKA 4U1MA 5K9KA 3ZDYE 4QCIA 2VDKH 5EPMA 5DT1H 4L5FL 2HKHH 3A6CL 4JO3H 3VXTB 1WIPA 4U1NB 2EE6A 3AB0C 3WLWC 1CD1B 2ADFH 4D9QE 1CGYA 1D5BB 3G6JB 5FKPA 2DKSA 4Y4KB 3M8OL 2FJFA 2I5YH 3LS5L 4RZCA 4R2GB 4XPBL 5I9QC 4YAQB 3BMVA 1BGXL 1N59A 3KLHD 1ZOXA 3IS1X 3KLHC 2ATPA 1IEBB 3F8UB 5BV7C 1CBVL 1XF2B 3BKMH 4HS6A 3MRRB 3AU1B 1KT2A 3WJLA 5I1GH 2GFBA 2HMID 2R2HB 3MXWH 3V6FA 5HHPB 1TFHA 4AL8L 4LPTA 4FQJL 3IDJA 4IMLB 3TYFB 3UMTA 3UTPE 4YR6B 4ZG1A 1N0LA 5BS0D 4JRXD 3SDAC 2EYRA 2X89A 3NIDE 4OZFA 2CK0L 1N8ZB 3D48R 1QLRB 4IJ3B 1LEGB 2JIXB 1A14H 1RQ5A 4RAUB 1U95B 4N0FB 2YD8A 1T03L 4PJ7A 4GAGH 2EIDA 1CFQA 1GHFH 4CDHA 5CINH 3JWNC 5DD1H 4NUJA 5AZEL 3TIDA 5C2UB 1JF1B 2BNQB 2OZ4L 4ZUVA 1NGXA 5L9DH 4LLWA 2NLJB 1I1AD 3MGAA 2IH1B 3KNBB 4NM8H 4JHAH 3RDTA 1K3ZA 4LSPL 3GGWB 4MQTB 2P45B 4F2MA 1TVBA 4XCYB 4H26B 1XH3B 5I1DA 3QT2A 4XI5D 4NWTH 1P7QA 4QHMA 2UZXB 4LQ1A 1IBGH 1H15A 4XI5C 5DK3A 4NQEA 4L8SA 4YIQB 4AEEA 5EC2A 3P0GB 1HH9B 5D1XA 2GI7A 3O3DB 4HC1L 4X6BA 3ZSSA 4Y1AE 3DRQA 3B9AA 3GIZH 5D7JD 5EUOB 2F58L 5D7JC 2Z93A 1M71A 5GIRB 1U42A 2WW8A 4QRUA 5EOCH 1ZS8B 3L3GA 4HCRL 1BJMA 4KI5E 1DE4A 1CVSC 4RA0C 3DSNA 4PJ9B 4PLOB 3H9ZA 4XX1E 4JN2B 5D71L 1F97A 1F4XH 4NQTA 4OJFH 5FYJU 5J57B 3P9MA 4YDLC 3O11A 1XFPA 4WO4A 2E9WA 3ARTA 3UPAA 2B4CH 2Z92A 5EUKB 5GGQH 3MRIA 1XGQB 5GRUL 2QTEA 3FO0L 2F19L 2WY3A 1YDPA 3QXWA 1MREH 3ISWA 1JTOA 4Y5YC 4HQQL 5JMRA 1NPUA 2OM5A 3OXSB 1HQ4A 3RWGB 1BZ7B 4FXLA 3UBXG 2PF6A 2C1PB 2NY3B 5ITBH 3KXFD 3UTSE 4O4YL 2X5PA 1UACL 4XB8A 5JLZA 3SO5A 3FJTA 2JELH 3EO0A 1DQQA 4WW1B 3DVNA 3EOTH 4FFVC 5A16B 2VLRA 4MS8D 4MS8C 4OUOA 5D1ZD 3CFJA 2Z9TA 5HHMA 1TZHB 4XNXL 2EXWD 1FL3B 5KSVB 2R4RL 2EXWC 2P8PA 3CVIH 2C4FU 1CU4L 4X5WB 3TT3L 1X3DA 1J1OL 1FN4A 4MZ2A 4TSAH 2DI7A 5JHDA 4AIZB 1MJ7H 2FJHB 1QQDB 2VZ1A 4FXKA 1LK3H 1SEBB 2HTKD 1FFOB 4M1GL 4WI4A 4R3SA 1ZEAL 4OLXL 4L4TA 2C4FT 4PS4H 4HG4J 5IESH 2F9BT 5TDOA 4ELKA 3VD3A 1KLGB 4O2EB 5CBAB 4XCFL 4LL9A 4Z7OE 2F53B 3MJ6A 4Z7VB 4AJ0A 2VSDA 3IFLH 3MOAL 1MF2H 1F8TL 3H9HB 2BSRA 4G8GB 3NPSC 3RNQA 1I1AA 3EJZD 5BZDA 4UT7L 5I8EA 1U91B 2BVQA 4F58H 4L4VE 3AS2A 2LU3A 1KNOA 5JOPD 4XPHL 3VG0L 3LN5A 2HVKA 1MJJA 3CSGA 3IFPB 4PLKD 4Z18A 3QP3A 2IPTL 4PLKC 1K5NB 1JZ6A 3ARFD 8FABB 3ARFC 4LK4A 2BZDA 2OSLB 3G6DL 1ODAA 5AWNL 4OCMC 1O5DT 3ELAT 5EOTB 3U0PA 1A1NB 1FAIH 3N85H 3QXUA 3SGEH 1OSPH 1CF8H 4Z9KB 5E2WL 3PGFH 1XGPB 1OWWA 4NZTL 3PNWA 1NFDF 4PJXE 43CAA 5SWZD 3VI4F 1NGPL 3O4OC 3WO3B 3MBEB 2AJZB 4FFWD 5DO2D 5DO2C 2X10A 3VDCA 5DJDB 3X14B 1WAAE 1R5WB 1VFMA 2VZVA 4JCLA 4GKNA 1R3KB 3U46B 3C87A 4NRZB 1GOFA 3MRKB 1AQKL 4HHAB 3SDCD 1V7NL 4QRPD 1IE5A 2FEDD 3QUMH 1RVFL 4P46B 4Y4HB 4MXQC 3MGTB 3C9NB 5INDB 2P24A 4Q6IA 4PJIA 3HE7C 5KTEL 4MVBD 3G6AA 3QI9C 1U92B 4FQXA 3QIUC 4QXGH 5EBMA 2HFEB 3H7BB 1WIOA 4OQTA 1NCAH 4NN7B 4PP1D 1KTLB 4DEPB 5J1TC 4PP1C 3L7FB 4NO0D 4TULH 2GAZA 3S35H 1V05A 4LSUL 1I7UB 4MD4A 5JZ7C 2E9IA 1JWMA 4NQXB 5JR1H 4L3CB 5HHVH 5I16B 4K3DH 5D1ZA 3W0WE 1I1CA 3WFHA 1JL8A 1UADC 4PJIF 3W9EB 3Q2CA 3F12A 4K7PH 2B20A 5FHAL 4EI5A 2P5WD 5CD3A 1MOEA 4MSWB 4LHQB 4YDKH 2X4PB 3VWJD 3ZE1F 5C71A 3T09A 5ISZD 1U8IA 2FYYB 1GIGL 4P59H 4X7SH 2B1HH 4POYA 5CJBA 2NY1D 1U2HA 2NY1C 2EIBA 4G8FA 1JGLH 3DHMA 4NBYB 2NZ9D 2UWEA 4G43A 1CLYH 5BVJA 2YBRB 1T7VA 4Q2ZB 1VGEL 3O4LB 4DKEL 1H3PH 4BK5A 1OAXL 2E3VA 4KDTA 5J9PA 2AAVA 3LKSB 1UCBL 3O0RH 2IBZY 5K33A 4BQBA 4PRHD 1JNHA 1KXVC 1GGBH 1M1SA 5ID0A 4AQ1B 5SV4A 1IAII 5JOFB 4IEFB 1L9MA 3AS0A 2VYRE 4GLRI 1CL7L 3OPZH 4ELMA 1BF2A 2XA8L 2R8SL 3H7LA 1NDGA 3RWEB 3AUVA 2UWEF 3HFMH 5CGYD 3V0VA 5CGYC 5IW6A 3U9UA 4BA8A 3OTTA 1MRDL 4L3ED 4GG6B 2B8OT 4GKZB 1NLBL 2QQNH 1TTUA 4RIRA 3MV7E 5SWZA 1IILE 4TTGA 3JZ7A 1LE9B 3SEPA 2HFFB 4P9MH 1VPOH 2JCCE 1GZQA 1U8QB 2B2XH 1RUKH 1U3HD 3OKLB 2AXFB 4DVBA 6CGTA 1C1EL 2BC4A 4ELMF 3PQYE 3IRPX 1FNGA 1U3ZA 1I85A 4X7CC 3TH2T 4NKDB 4YBLC 4UNVA 5IHLB 3Q1SL 2ADJA 3SDCA 2F15A 2J12B 3CFCH 5EZLA 3WKML 1LP9F 4CUCA 4K8RH 5DK0A 5JDSB 2VXSL 4NOFA 5LWYH 4F9PA 1CDGA 5CSGA 3VRIA 1KG0A 1XAUA 4P3WA 4V1DE 1J7VR 5DWUH 1FYTE 3MLWH 4H1LB 3BIKB 1TJGL 2D31B 1RUQL 1JRHL 1RZGB 3QQ3B 4MXVF 4M8QA 4RGOL 1CFSA 4QLRA 3OWEA 1ERNA 1G6RB 1TJIH 1YUHB 2CGRL 4UINL 2Z4QA 4NC1E 4I1NB 4D94A 2VC2H 4GAJL 5TPWH 5T1DL 2CR6A 5FXCH 1IGJB 4NQSB 4P5TD 3I3DA 3U7YH 2A74B 4P5TC 3O6FD 3VCLA 4YDIH 4KAQH 5DGQA 5B3NA 1CICB 2ARJB 4Z0BH 2A73A 3ULVH 2QKIA 4XPGL 1CR9L 5F9AC 4HJGA 4UU9B 3VWJA 5CWSB 4F7TB 3ZE2E 5ISZA 5LJYH 1S7RA 1RIUH 2X70A 5C0AE 4XX1G 3D3VB 3KPQB 2FGWL 1EXUA 3V6OA 3THML 2DLIA 1D5ZA 2FATH 3GK8L 1WBXA 2R4SH 1K9TA 3QIWC 1MLCA 1VFBA 2YMXL 5H94B 2AJUL 1K85A 1N64L 1F3DH 1PD6A 4ZPVB 3WNPA 4JPWH 5IGXH 3EW3B 4DJMA 4CGTA 4JANA 2QQQA 2ORBH 4KROC 1RZIA 4X7EC 1U8HA 3EJJX 3FB7A 4PJDF 1U36A 2EECA 5J06A 3MNZA 5E2VH 4MA1C 4I18C 1X5YA 1QZ1A 5CJQH 4KKCD 3U0WH 3PWVB 1BPVA 2W38A 4KKCC 2OBGA 3QUXA 4MB5A 1JI2A 1G7LA 3CD4A 2YC1A 3DURB 3OQ3B 3LQAL 1D6VL 1F3JA 4OIBA 1UM5H 4X4MA 1EZVX 2BNUA 1RULH 1LNUA 4HAFA 5DURD 4ZYKB 4AENA 1BOGB 2X4SB 1MCOL 4WWKD 3TN0B 3UBXI 1BVLB 4WWKC 4BSJA 3QXDA 2HA1A 4KY1H 3MUY1 4RNRB 4YUEH 4GMSH 4WY7L 3U2SA 1MWAL 2C5DC 1FV1B 3QUKB 2XN9A 3T0ED 3T0EC 1U3HA 4EUPH 4FZ8L 5ICXA 5C07E 2NY7H 5J6GB 4NKMB 3DBXB 4LVNB 1V3JA 1H3TA 5F89B 5EU6A 4YE4H 1HHJB 1NBVH 3GSNL 2F74A 1OOAA 4QTHA 3RTQB 3FQXA 1DQLH 4JKPL 3ARGB 4G6FB 1P4LB 5TDPB 3VXSB 4PV8B 1T83A 3QFJD 4V2CB 5FO8A 3OG4B 5EO9A 3OL2A 3ILPB 4NDMA 2EDFA 4DOHB 1OGAA 2O5YL 3O41A 1C7SA 4KTDH 1YMMB 4NRYA 1N0XL 1F4HA 5HPMA 3RVVD 3U4BH 3RVVC 4M1CD 2IGFL 2GUOA 4M1CC 5C0JA 1W72B 5I1HL 3KYNA 2WWMD 3MV01 3O2VL 1PGRB 3O8XD 2CO6B 4MA7L 5D2LA 3O8XC 3ZKXB 5LQBH 2IFFH 5IEKB 5DZNA 5DZLA 4NBZB 4PUBH 1QSZA 1DEDA 5LXGL 5D93B 3RX5A 1ZT4B 3CSYA 2YN5A 3FAWA 1KXTB 4K9EH 1HKLH 2IG2L 5D6DA 2ZCLH 2EYTA 4XH2A 3BUTA 5CMAB 2YUZA 3E6HB 4I48B 1AHWA 4RMSA 2KPNA 3SKMA 4C56E 3KHQA 1MCFA 1T5WA 2BHZA 4XAKD 2YPKA 3MX0A 5JIIA 4LDEB 2V5MA 1J0HA 1MHEB 1NEZB 3QNYB 1JUFB 3RVUC 2EDHA 4FZEH 2J2ZA 4OCSH 4H8WH 5D6CB 5E6YA 3P4OA 3RUGE 1HINL 4U1HA 1I3GH 2FL5B 3D25B 2ZSVA 3DXAA 3EFFB 4JO2H 3DRTB 1KCRH 3S98A 1NKOA 2WQRA 4PJEE 4TPRH 2CUIA 2R0LL 1N4XH 2YPLA 3L5HA 3E8UH 4PGZA 5EBWB 4WVRA 3DUSB 2R9HD 3SJVB 1UWEH 3QXVA 2R9HC 4U6HB 2H2SD 2H2SC 1CLZH 3VXMB 2HKHL 4JO3L 4WHYH 4NQVB 5ESVA 3Q5YA 5I8OH 2ADFL 1KELH 2NX5E 2I5YL 3T04D 3MFFA 4LKCA 3KWWB 3BGMA 3QWRD 3HA0A 1FNLA 4F15C 5ACZB 4QHLA 3MJ7A 2A6IA 4JFEB 4JRWA 4WHCA 3P4MB 2RQ8A 3BKML 4PYHA 1ORQB 3T77B 5ALBH 5I1GL 4J3SA 1A6AA 4I13B 3MXWL 4N8VB 5FGBC 2H32A 4DVRH 3SHSA 2WQ8A 5DJAA 1AJ7H 3TF7C 1OB1A 4ZD3H 1IM9D 4I77L 2QL1A 3VRJA 1H5BA 1REIA 1A14L 1JNNH 2OL3H 1OTUD 3HZMB 4RGMB 4Z95H 1OTUC 4GAGL 5GSRB 3B9KA 4GG8A 1FIGH 3X17A 3U7WH 1GHFL 5CINL 5DD1L 4TQEH 4IRSD 1BIIB 4K94H 1FVDB 4IRSC 4ETQA 1UA6L 5JDJA 3TO4B 5L9DL 5IG7A 3ABZA 1QBAA 2CXKA 2R0WH 4HFUH 1J8HE 4JDVB 1BAFH 2C1OA 4FQIH 2I24N 1RZJC 4PGBA 3VFVA 5E03A 4NWTL 5DMIH 1IBGL 1FNHA 2CR3A 2HJLA 5F88B 1OM3H 4YXKH 5C6TH 4ZFFA 4Z78A 4XNQB 2FCBA 2HRPL 4MAYB 3P0YH 5JW4M 3GIZL 1U8KA 4PY7B 4MCZA 2JK5A 4I3SH 1I8IA 5EOCL 1MUJA 2XYCA 3QO0B 4M7ZB 1U8MB 4ISVA 1CFTA 2BXZA 2B5IC 3FKUS 4I0PC 5FGRA 1FSKB 4HWZA 3CSPA 3HUJF 1OT2A 4ODUB 2A9NH 3MRCB 2DF3A 3DGGB 3CFDA 4OJFL 2FEEL 3O45A 1YEDA 3CFKA 3WO4B 5GS2D 1HHGB 3HRZA 1KPVA 3RL2B 1WBZA 2B4CL 4KQ3L 3PG2A 2BVYA 5GGQL 5IMKA 3LN4A 4UB0H 3WXVH 1T20B 1QRNE 1OQXA 4JLRB 2OQJA 1MREL 3RWIB 1XMWA 4MJ4A 1NKRA 4DCQA 2H26B 2I9LB 4M1DH 4NSKA 3G08B 4HWEH 4ODHH 1DUYA 1U3YA 5ITBL 3O2DH 1UH2A 1G9EA 4MD0B 1QSFD 2JELL 3BPNC 3HN3A 1QSED 3LQZB 3EOTL 4F8TA 1Q72H 4KMLB 4G6AD 4ZFOA 4CRPA 3BJ91 4G6AC 2EE3A 2W9LA 5DLMH 2XA3A 4P2QD 2IQAA 3LKPA 2CRMA 4PRIB 3GMNA 3KLDA 3GRWA 5CFHA 3CVIL 4ZPTA 1Q0YL 2PCPA 1FIEA 1ZT1B 3AS1A 4PD4K 2PXYD 3KPLB 5T5FL 2PXYC 3QHTC 3ZKQD 2VQUA 5BQ7B 4G3YH 1YPZE 3GMMB 1UVQA 5CLTA 5HGAB 1CDCA 5I17A 2MNUA 1LK3L 2NY4B 4Q6YA 5HYJE 1DUZB 2XPGB 2ZUQC 1ZHNB 1EJ6A 1X7QB 5CZXD 5IESL 5CZXC 2BY0A 1T1YA 5IW1B 1I7TB 4WW2F 2OTWB 1T04A 1UB5B 2K1MA 1T0PB 2DQFA 4NFBA 2GITA 3HC0A 1K3IA 5DEGB 2MHAB 4KV5E 2Q8AH 3M07A 1ED3B 3IGAA 1EO8H 3B2VH 1MF2L 4P2YA 5B38G 2VDQH 3OAYK 2IAND 1MCRA 4F58L 1ZLWK 5BRZD 3STZA 2CH8A 2X1WL 1F4WH 3OSKA 5IT2H 1SYSA 2VITA 4KU1A 1KPUB 4AT6B 2NNAB 4ZTPH 1HSAA 4Y4KD 1HI6B 1AO7E 4Y4KC 5E94B 3FCTA 1QPPA 4R2GD 4R2GC 1FAIL 1S7WA 3WSQH 1OSPL 1B0GA 1CF8L 4OBRA 4G7VH 3WS3A 2AJ3B 1JK8A 1JWUB 1RMFH 1R3LB 3B6SB 3E3QC 3MLVH 4PJHA 3REWB 5KZCB 4YDJB 4KZDH 2DM3A 2X4NA 4Z0XA 3OB0K 3IJSA 4XXDA 1G0DA 2EIZB 4F3FA 3VH8G 4IJ3C 3MZGB 1G7JA 3CCHA 4HUVB 2C4XA 4Y1AB 3UPCA 5EU4A 1XIWD 3FZUC 3JWDL 4HIJA 3LPFA 3QUML 4EOWL 3BKYH 3DX6B 4F7CB 5E56A 1S7TB 2BNQD 4Y0GA 4LCIL 3X13B 3NCJL 4JFHD 3RWDB 1GC1C 3IXAA 1PX4A 4IOSD 4Z7UA 3ZYZA 2DQGH 2DI9A 4PJHF 1TENA 2Y25A 5CBEB 1X4ZA 4QXGL 2EO1A 2AEIT 4HH9B 5F8RC 1CL7I 4FTVE 5F3BB 1E27B 3ZSTA 2H3NB 3KLSA 2XIDA 5D7KD 5DC4B 5HHOB 3S35L 5HYSG 1CE6B 4N0CD 4N0CC 3C8KA 4MDJB 5HHVL 2HJKA 4K3DL 4M9PA 3NZ8B 4RMQA 4U3HA 4DKAA 2I07A 1OP3H 5H37H 5C0BD 5CEZE 4EQ2A 1OTTD 3EYOB 1FQ9C 4K7PL 2VZUA 1S8DA 4WI9A 1T4KA 3GMOB 5LKNA 4YDKL 1JGUH 4Z7UF 1FDLL 5IB4B 3FOLB 3I9GH 4APQA 2NY2B 3KPMA 1PEZA 4ONOA 4P23B 5LGJA 5FGSA 4X7SL 2B1HL 3OXRA 4PJ9C 2V5RA 2WMPA 5F1IA 1BREA 1JGLL 3CLEH 3LKQB 3GEWB 1VHPA 1KULA 1KSRA 5I15H 4UILH 3O0RL 1NL0H 4M7LT 4Q74A 5E7FA 4MJ5B 4ZUWB 2IANA 1SJHA 2Y7QA 3QNXA 1GGBL 1U8JA 3QJHB 5BRZA 1JRHI 4S1QH 1XF3B 2NY3D 1NBYA 4CW1B 1M6OB 5KBNC 4K07A 2NY3C 1ZMYA 2WUBH 3OPZL 3QPQD 1YJDC 3RWJA 5E8DH 2D2OA 1DBAL 25C8H 4XVTH 3HFML 4G8EA 1G84A 1SQ2N 5HVHB 1R3HB 1QFWM 1C08A 4P3DA 4L4VB 3KG5A 3UZVB 5H2BA 3BYTA 2J6EA 1CDBA 5GGTH 4OLWH 1I8MA 3K4AA 3SE3A 2HN7A 1CZ8H 1VENA 4A6YA 4P9ML 1VPOL 3PHQB 1D9KA 1RUKL 2B2XL 3V0WL 3F7YA 2E5EA 1I9RH 4UT6H 5C8JA 3CX5J 1AP2B 2R2EB 3D39D 1X5XA 4XRCA 3O6LH 2VUYA 3B3IA 1NBZB 1PSKL 3GM0A 5EFIA 5BZWA 1KLUB 2V9QA 3CFCL 3SCMD 1HH6B 4NQCB 4PJ7E 3J8F7 4BSWA 4R8WH 1KJ2A 4J3OC 1NMAL 4OZGA 2DAVA 2OI9A 1CFNA 4N0UA 5IFAH 5DWUL 1Z0NA 3P2TA 3GMRB 1ZHKB 1DLHB 3ARZA 3EDKA 3ES6A 2W92A 3NCFB 4U6TA 4X6DE 5CHNA 1FZOA 3UX9B 1TJIL 1HQRA 1IAOA 3JV4B 4YHNB 2AABH 4NYLB 3VJ6A 5CIPA 3U7YL 3F58H 4P2RB 4Y5XB 4NQEE 4KAQL 2X4RA 5EOQH 4XP5H 3HR5A 1R3IH 3G5ZA 4DW2L 3ULVL 3VMPA 2V6HA 1T66C 2W60B 1A9BA 2BOBA 3MBED 5CEZL 1N26A 3MBEC 4Y8AA 1RIUL 1J10A 2KBGA 2YSSB 3WN5A 2HFTA 4PJGA 1CG9B 1UJTA 4M61B 2GW5A 3CVHA 1ZA6B 2FATL 1T5XB 5F97E 5L8LB 1G9NH 4QRTB 3W0WB 5ENWA 1MQKL 4MXWH 1B4JH 2C3VB 4X6CF 4CNIB 1RFDH 3NMEA 4JPWL 5IGXL 2OP4H 3QCUL 4P46D 5TF1H 3ET9F 4NKIH 4Y4HD 1AGCB 4P46C 3NCYP 4Y4HC 1JNJA 3LN9A 3N1QC 3VFMB 5GJTH 4MA8H 3ECBB 4F33B 1MFBH 2CQVA 3PWPA 1KV3A 4NKOA 3CMOH 3U0WL 1FFQA 2CDEB 4FQ2H 4NN7C 3BQUA 5IVOA 5TE6H 3TBSB 4DEPC 1EMTH 1ONQB 5GGSB 1CXEA 3QEQD 1E6OH 1IFHH 5I8CB 1CD9B 1PX3A 1DEEB 3GHEH 1UM5L 3D85B 1RULL 1KLFA 1UQSB 1BQHA 1AIFA 5J6HB 4YWGH 3BVNB 2VLRE 1FZJA 1IGTA 1YY8A 5ECJE 4KY1L 4YUEL 4GMSL 3H2WA 5DVNA 4G9FB 5HHME 5L6YH 4PJ8B 1K4CA 1OF2A 3FHQA 1N6QH 2VDOH 3B4NA 4HF5H 1I4FB 2ADGA 1G7IA 5DUBB 2NY7L 5HYFA 1X5GA 4OCWH 3D39A 5JIPA 1WFUA 4YPJA 5JPMB 3W5MA 4BM7A 3ALPA 4EDXA 5DSCA 5JHDE 1PLGH 1NBVL 2XFXA 3X12A 1DQLL 4OZHF 3SCMA 2MFNA 1V5JA 5B39G 3MV7B 3I6GB 3MMEA 5FA3B 4L4TE 4HLJA 2DS4A 3RIFK 4HKZB 5T3ZH 3RKDD 1LE5A 3RKDC 2YRLA 4QY8B 2EE2A 3ZT6A 3STLB 2JCCB 1JGDB 3FFCD 5D72H 3VE0A 3OHXA 2PW1A 4JY4A 4OD3H 3PQYB 3FL7A 4LDOB 5E2UL 3FTGB 4DKDC 2O61A 4X7FC 3U4BL 4XAWL 3TNMB 1NDMB 3EYVA 3Q6FB 2VDMH 3PWUB 3MA7B 2GT9B 4WHTA 3T1WA 1QKZH 4LSRH 2VLJD 1W0VB 5DRNA 1UENA 5LQBL 4DQOL 1ZLVH 1ZSDA 3ZLQC 1H3XA 2OTPA 4PUBL 4CL7A 1FG2B 1FZMA 3PGDB 3LSOB 4HGWB 2E9BA 1HKLL 4K9EL 5EIQA 5F7FA 1B2WH 5J89A 3SDDB 5GISL 4R6UA 3FT3B 2WUCH 3LD8B 1A7NH 2VXVH 1RU9H 3CXDH 4HWUA 3ARBB 4OGXH 1PKQA 1XCTA 3WE6B 4ZNEA 4KJYB 2Z8WC 5D96B 3A67H 4PLJC 4EI6B 4JN1H 5D1QB 4OV5A 3BXNA 3DOSA 1TVDA 1XGYL 5EU3B 1H8OA 1IT9H 1QTYT 4FZEL 4OCSL 5J7CC 4H8WL 3RVTD 5C0AB 3VGEA 1FCCA 3PABB 4WNQB 1S9VB 5TH2B 2XTJB 1I3GL 4H5SA 4OLVL 1XGTA 1OVZA 3ARQA 4JFYA 1KCRL 3MROA 1WLHA 1G7HB 2EKSB 4XTRD 4XTRC 3RGVB 5GGRA 1N4XL 1TJHH 3GI9H 3I6LD 4P9HH 3E8UL 2A1WH 4Z5RA 4PRAB 3IDMA 4X99A 2DJSA 3DYPA 2AXHA 4G6KL 2R1XB 4NJ9H 1UWEL 5I75B 2UY7A 5DJ8B 3U82B 2NY6D 2DLEA 3PV6B 4HEME 1KCGC 1FJ1B 5E6ID 2DLGA 3E6FB 3EO9H 1NGQL 4P4RA 2HJFB 3T3MF 1ULVA 1J1XH 5I8OL 3LEYL 2AVGA 5CZVH 3EO1A 4IHOA 2BSED 4OLZH 2M8XA 4IM8A 1M05B 3KYAA 1T1ZB 2E7LA 3C60B 3OR6A 2F5BH 1OAKH 5ALBL 3PHSA 1TDQA 3B2UC 5CJXC 4QHUB 5MEOA 4DVRL 1Q9OB 5JXEC 4RX4D 3VFTB 1AJ7L 4ZD3L 1VACA 1R0AH 1E28A 3MCKB 4PV9B 4FFYH 3TBYA 4J1UA 2AJYL 2UWEE 3MRBA 4LCYA 4N1HB 1JNNL 2OL3L 4X5LA 4Z95L 1YNKH 5HSFA 4J2XA 4KJQD 3U7WL 4KJQC 1AXSB 5C07B 4ODSH 4TQEL 4UMGA 2APTA 5HI4C 1B0WA 3IVKA 1F5WA 2OXHA 1XGRB 4Y19B 3FQWB 2R0WL 2X09A 4UBDD 4HFUL 4JY6B 1PQZB 5B8CB 2GSGB 4RISH 4X6FA 2VLJA 5FUOH 2BVEA 5T1MA 4ELME 4BH7A 1A7PL 3VH8B 3OJDA 1YEFH 3I3BA 4WDIA 4LLMA 3P77A 3BH8A 4ALAH 5DMIL 3TN0C 4PJBA 3VWKD 5HDBE 2SEBA 3MREA 4LSQL 1NQBA 4YXKL 5C6TL 2FX9H 1JZ3A 4PR5A 3IJHA 3WUZA 1NFIA 1UXWB 5DHYB 4OUUA 4X7TA 1E4KA 2WBJD 3DUUA 2WBJC 2VTFA 4RFNB 4QWWD 2V5TA 1TLKA 3BZ4B 1S9YA 5DK2A 4Z8FH 2LU7A 4QWWC 2FZ3B 1NBQA 4I3SL 4U0RB 4HIIA 4OZFG 1T3FA 4DGIH 4I9WE 4LVNC 3QDGE 4XWGL 2IEPA 5IQ9B 4D0DB 3BFOA 3RTQD 5FDYA 4LGPB 4LLDA 3V6ZA 5A43C 3RTQC 2JB5H 1NANH 2G75A 2XI9A 4MNQE 5HYSB 2A9NL 3ARGC 4OT1H 4X9BA 2H2PD 2P49B 1AQDB 4PJBF 3QHFH 1MIEH 4G5ZH 2X7LA 4MD5B 1YMMD 3QWOB 4C56B 5GGUA 2AJVH 3OKKA 1CT8A 3GSXB 4UB0L 1UWXK 4X4ZA 4HIHB 3WXVL 4C54A 1HIMH 3MLYH 4LSSH 4MJ6B 4JDTH 2ARJQ 4YHKH 5FUZL 5C09A 1OAZH 3MRHA 4M1DL 5EBLA 4JGMA 4OZIB 2YRPA 5AG9A 4NFCA 4HWEL 3ZKXC 5DHVA 3SDYH 2UUDK 3QIBD 3DETD 4OQTL 3O2DL 1QEWA 3DETC 4P99A 2AEPL 4TVPH 5D93C 3EBAA 2FR4B 3OX8A 4BJLA 4G80B 3ROLB 3TNNA 4HKXB 5CS7A 4UAOB 1Q72L 5LAXB 4WEBH 4PJEB 4HV8B 2VRAA 1KEGH 2ZG2A 3VGBA 4YHLH 5T5NF 1RZKC 2ZCKH 2Z91A 2YOCA 1CGXA 2X41A 1P4IH 4HFWA 5GGVL 3BHBA 2EDBA 4YBQD 3V6OE 5F21B 3T3PF 3VXRE 3I02A 3VXQA 3MRGA 3WXWH 1WWBX 4WI8A 3MNWA 5L2KA 4LDLB 1UZ8A 3I2CL 3B43A 4GRLB 1C5BH 2APBA 4RMTA 2D7TH 5C0GB 1IGMH 4LCCA 4MA3B 4L8DB 2ATKB 2K7PA 3UZEA 3GSUA 4NN6B 2AI0H 2Q86A 1EO8L 1I3RA 5FHBL 1DN0B 3B2VL 1C16B 3FB6B 2CDGB 2QQKH 2VDQL 3AREB 4JM4L 4D8PA 1ES0B 2XKSA 1INQA 2IADB 3K8LA 1NMBH 3VXPB 5D7LE 3V5HA 1KIPB 4OAWB 1N5AB 1F4WL 5CSBA 5IT2L 1HCVA 3OKDA 4OIAA 1FG9C 5FO9A 5GS0D 5HDQL 4ZTPL 5I0ZA 4I0KA 5GS0C 3PHOA 3G5VA 4X4ME 5H35A 1HSBA 4PJ5D 3HE7A 4RFEB 1JZ2A 2CXGA 3WYRA 4OCXL 3DTXB 3QI9A 3V4UH 1KN2H 5DJ0A 4G7VL 4LIQE 5FGCE 1IMHC 1J8HB 5CEYA 1YNTA 2CRIA 1ZA3B 1RMFL 2XN9E 3MLVL 3KLAB 4KZDL 5IUSA 4YHYB 1P5VA 4CJ0A 5C1MB 2FX8H 2HLAB 5H8DA 3FQNA 4NCC1 4A6YH 4NO5B 4PRBA 2HP4A 5EU6E 4YGVA 2Q3ZA 3RFZC 3WHE0 5C0CA 4BFIA 4RGMC 3BP7B 3ZTJH 4KRNA 5LBSH 1ZLUK 1LHZA 1BIHA 3STBA 5IMOB 5FOBA 2CKBH 5HDLA 1OGAE 3OF6A 1VERA 3QJFA 3TO4D 3EAKA 3BIAX 3TO4C 3S8WA 3CFBB 3ULUC 1YEIL 4BZ2H 3MNVA 3Q3GA 3WHXB 1JI1A 4HZAA 5C08E 4R96A 3PE9A 5L2JA 4HKJB 2WBKA 2MKLC 3JTTA 1FO0A 3ESUF 5D2LE 4QHNA 1FFNA 3AXLB 2Y23A 3N0PB 1DBKH 1V7ML 3DNKA 3DMMB 3T0WA 5JW4N 1ND0A 1QRNB 4KK9D 1M7IA 3BISA 3QCVL 4MAYC 4MQ7A 2UV3A 1G7PB 5K59E 3HMWH 3GMLB 3QUYD 7CGTA 3QUYC 4JZJB 3PJSA 4PTTA 5IEHB 4NNPH 1HEZA 3I9GL 4JFFD 4NIKB 3MRLA 1FSKC 4IMKA 3IFOB 3WFZA 4CVZA 3VI3F 2VISB 3KPTA 2VLKA 4OI8A 4P5MB 3WO4C 3BD4A 5I15L 3GJFA 3NACH 5E4IA 3CFEB 5DS8B 2F8XC 3VFWB 3TJEH 3DXAE 2VXUL 2LV4A 5IB5B 4G42B 4KK6C 4M7LH 3C5JA 4QXTB 5D7SH 5CP7A 4HUUA 3KAAA 4RQQA 2YPLE 4N90D 3KYOA 1Q9KA 4MGXA 5INCB 3OR7A 1P84J 4FP8H 1OARL 2EDRA 4QTIH 1AE6H 4JPIB 1MVFA 4TUJB 1MI5A 4KGJA 4MCYA 2RB8A 25C8L 4XVTL 4PJ5A 4JHZA 5B39B 3S96B 3TWCH 2B0SL 4OB5H 1YEHH 5FIEA 5EC1B 1NLDL 3F7VB 3CC5A 4F7PA 4NPYB 4JG1L 3G5XB 5GGTL 4OLWL 4LIQL 4D9QD 9CGTA 1IKFH 1CZ8L 3HPJA 5DQDH 5CJOH 5AAMA 3SDXF 5F7LB 3L5XH 4X5XB 1I9RL 2YKLH 4UT6L 1U8NA 2AW2A 5HYIA 2NY4C 1YECH 3LKRB 1OSZB 3GSWB 1QVOB 1PZ5B 3O6LL 1UYWH 5T3ZE 3NFPA 5A1AA 2IH3A 4XXCC 4IOFC 3L3IA 1G9MH 5E1HB 1CGVA 1J11A 4FQHB 2DIJA 1ITCA 3UO1H 3UTPD 4HK0B 3R8QA 4R8WL 1ITBB 5SWQA 2BRQA 4PGJA 4PG9B 5FCSH 3GFUA 5IB2A 1NCTA 3OJMB 6FABL 5IFAL 1HCFX 3KDMB 3MO1B 4WV1A 5E08H 1JGEB 4ZOBA 1OAQH 2W91A 3HE6B 3PV7A 4BH8A 1Q9LB 1KEMH 1RUML 3ZO0A 4CADA 4KJWD 2AABL 5I66B 5CAYB 5I1AB 2YD2A 1P7KA 2YD3A 3TEUA 1P69B 4EN3D 1EFXB 3B83A 5EOQL 1QA9B 4RDQG 1R3IL 1Y6NR 2QSQA 3S5LA 3TYGH 4FTVB 5C3TA 4JFFA 5DR5H 5KOVC 4XVSH 32C2B 5DJ6A 3N1PC 5DRWA 1R3JB 1A7OL 3V8OA 1BZ9A 1UXSB 2CDFB 5DD6B 1G9NL 4HCRA 2DLFL 4G9DB 4Y1AD 5SWSA 5I1LA 4MXWL 3ZYJA 4MLSA 4HUKB 4O2FA 1RFDL 5HY9B 5TF1L 4NKIL 1IM3A 1KBGH 3HZVB 4MJIA 1IGYB 4KRLB 4OLUL 4LP5A 4KI5C 4MA8L 2HT3D 1LK2B 5IJVB 4PGDB 2GHWB 1MFBL 2LTQB 1HILA 4C4KO 3VFRB 3CMOL 4NWUH 3I6KA 4FQ2L 1FFPA 5JIKA 3KYKL 5DMKB 5TE6L 5KJRH 1ZVHA 4NKQB 1ZGLB 1E6OL 4PRPA 2NW3B 5F9WB 2AERT 4LOUD 1B0RB 4LOUC 1ZV5A 4Y2DD 3GHEL 5M94B 4ODBD 1U3JA 4QNPF 3SBWA 1MY5A 5KSAA 2Y07L 2D7OA 5DFVD 3GMQB 3BX7C 3QO1B 3T0VA 2RFXB 5IIEB 1V3KA 3UTSD 1EO5A 2JJTA 1A5FL 5L6YL 3TA3B 3GB7B 5EPMB 1S5HA 1YMHA 2C3HA 2N7AA 2NY2C 1XCQA 2KDGA 5FDWB 4E42A 4P23D 1A6TA 3DVFA 3FB8A 4P23C 2VDOL 3SY0A 3W81A 4HF5L 2WZPD 5AD0A 3DPBA 5KW9H 1A6ZA 4XVUD 4OCWL 1EGJH 3L3KA 2FJFB 4RZCB 2P5EA 1NJ9B 3UDWA 3WCYA 1PLGL 4CN4A 1DVFA 1N59B 3S97C 3DYOA 2ATPB 2VO5A 5IFHH 3MUGA 3PDGA 5HYEA 3ZDYF 2G9HA 5T3ZL 4HS6B 4X8XA 3V8CA 1KT2B 1I7RA 1QBBA 3WNMA 3V6FB 2WV3A 4OD3L 3IDJB 2I60L 5A2JH 4GBXB 2EYRB 4IS6B 4KI1A 1DTUA 4OZFB 1AY1L 2VQ1A 2VDML 3MPCA 1JTTA 4CMMB 2DICA 1QKZL 5EU5B 4LSRL 3BP5A 5GS3A 2A83A 2V2WB 5IHUH 1CFQB 2J88H 3C5SA 4IIQC 4NUJB 2ZOKA 5HVHC 3TIDB 5F9OH 2AXJA 3IF1A 3CLFL 4PGEB 4ZUVB 4CBPA 1NGXB 5T1LA 3ZHLA 2APVA 1B2WL 4YNYB 1DSFL 3SE4A 3TBTB 2Y36H 3I50H 3RDTB 3QDJA 2Q76A 2WUCL 1JPST 4PJHE 1A7NL 2ESVA 1JWSA 1RU9L 2VXVL 3CXDL 2GJZA 4QRSA 4F2MB 5JUEH 4NQDA 2BMKA 1AGFA 4FQ1H 1P7QB 2QJDA 1H15B 4JN1L 1BFOA 4NQEB 4L8SB 5EC2B 4LVOC 3FO9A 4MX7A 4X6BB 2IAMB 3IAPA 1IT9L 3DRQB 1AKJB 1M71B 2Z93B 3GJEA 4NT6A 1UM6L 4QRUB 2CKNA 3L3GB 4C58B 5GZNC 4JQIL 1K8IA 5EBGA 3ARDA 4GQPH 2ZP0T 4W6WB 1XZ0A 4Z7UE 1MCIA 3MV9A 4QXWA 4C83B 1K2DA 4P9HL 1TJHL 3GI9L 2A1WL 2EDEA 2J8UA 5F3HB 1OTSD 3PXHA 4WUUA 1OTSC 3P9MB 3O11B 4Y2DA 4WO4B 5DEFA 5C86A 1IAKA 4OTXH 1MIMH 2Z92B 4Y5XC 2MPAH 5CZVL 1YDPB 3AY4A 4OLZL 3UTSA 4X9FA 1H8NA 3RX7A 1T0MA 1KCVH 1DANU 2F5BL 1HWHB 1OAKL 5JLZB 3IAQA 3GRWL 2J8UF 3W0WD 3S37X 3DVNB 5I9QB 4ESKA 1EJOH 1R0AL 3W9DA 3O6KH 4JO1H 1VADA 1GOGA 3CFJB 3E0GA 1ZKAA 1J9CT 1DANT 3F7QA 1HWGB 1YNKL 4BFEA 1NAKL 4NJAL 1HDMB 3IETB 4JAMA 5D5MA 5F7DA 1N2RA 3MLZL 2J8OA 4ODSL 4WU7A 2G60H 4HMEA 4JRXB 4Z7NF 1S3KH 1FN4B 2W9DH 2V2XB 2FB4H 2QHRL 4FXKB 3LV3A 5BRZE 1FFRA 3PGCA 2JLLA 5J1SC 1R5IA 4RISL 3OV6A 4L4TB 4X98A 5FUOL 4AEHH 5TDOB 4Z7WA 1Q9WA 3D85D 4ELKB 1GGTA 1YEFL 1DBMH 2ZWLT 3QH3A 3D18A 4ALAL 1KYOJ 4GH7B 1D7FA 2N1KA 2BSRB 4UI2A 2ZUUA 1I1AB 3EOBA 2IC2A 5BZDB 4ACPA 1WT5C 2BVQB 2NPLX 4E41D 3TVMD 4UDUA 1Z6JT 3EYQC 5IWLC 2HVKB 4MNGA 1MJJB 4M5YH 2VLLB 5IVNA 4UTBL 4Q9RH 43C9B 1AC6A 4LPUA 3V4VL 3IB4A 4DGIL 5ESQA 3CAFA 2GCYA 4Q9CA 4OSUH 4MAUH 4UQ3B 3U0PB 3OB8A 4Z7WF 3UTTD 4PJXA 5FF6A 1X5IA 3MV7D 4Y89A 4U2ZA 1I8LC 4WI6A 3RA7L 2IALA 1MIEL 3QHFL 3K3QA 4G5ZL 1RJLB 5LG1A 5CILL 43CAB 4J8RA 1U6AH 4M43H 2AJVL 2YUXA 3PQYD 1TPXB 3AM8C 3AC0A 4OZGE 5BVPL 1PJ9A 3MLYL 4LSSL 4N0UE 5J8OA 5C2BH 4GKNB 1HHHA 1QO3A 2HT2D 2A9MH 4EBQH 3WIFA 2HT2C 4K55A 1RI8A 3SDYL 5JW4R 4O5LH 4TVPL 4PJXF 4V1DD 4Q6IB 3SKUD 2PETA 4PJIB 3F5WA 1FYTD 5C0FA 3SDDD 3G6AB 5T33H 3SDDC 1NC2A 3FO2A 4FQXB 4WEBL 3RKPA 1KEGL 5EBMB 3PP3K 3RI5F 4RAVA 3LD8C 3ARBD 2ZCKL 3ARBC 4NC1C 3MRQA 3ERYA 2GAZB 4M02A 4DGYH 2W0LA 1P4IL 5D1QD 3LH2H 3G6JA 3EHBD 3BW9A 3MSPA 5D1QC 4XNMA 4PJGE 2OS7A 3EHBC 1JWMB 4RBPK 2JJSA 1YNLH 4KPHH 4YAQA 5D1ZB 4GMTL 3CSBA 2GK0B 2X6MA 3T2QA 3WFHB 3VMNA 1IEBA 1QBLH 3QULA 1M4KA 2EDWA 5I2IA 1C5BL 1A3QA 2VQTA 3F12B 2D7TL 1IGML 3AU1A 3MRRA 4EI5B 5CD3B 2XTJC 4Y7MA 5K9OA 2R2HA 4LEXL 3E2HA 5HHPA 2AI0L 3D0LA 3TYFA 1JPGA 4ZODA 3RGVC 3PWPE 3ZE0E 4G8FB 1N8ZA 3TCLA 5I75C 1LEGA 4RMRA 2UWEB 5EORL 2ED7A 1NMBL 1Z9SA 4N0FA 2BERA 1EVTC 3QQNA 5MEQB 1X6NA 2NY5C 4KH2A 5J9PB 3LVEA 3RHWK 3T4AB 1RZ7H 5LGKA 2LABA 2LQRA 4U1JA 2D7MA 4E41A 3C60D 3TVMA 3V4UL 3C60C 1KN2L 5ID0B 3P73A 5I73B 1INEH 4WTXA 3GGWA 1L7IL 3ARFB 3B8YA 4ELMB 2A38A 4H26A 1EV2E 1XH3A 3ZHKA 2DJ4A 3ESVF 1MWAA 4XMPH 1NDGB 4D9RD 4CU8A 4JDZB 4Y8DC 3B9EA 2P8LA 3V0VB 1WISA 3DARA 5IW6B 1EEYB 3UTTA 3S6CA 3U9UB 4A6YL 1HH9A 3BOVA 4P2OD 4P2OC 3VFOA 2DQJH 2R15A 5TF0A 5EUOA 4HJ0D 4RIRB 4U1LA 5LBSL 5GIRA 2PW2A 3EYSH 4ZAKA 5SWZB 5C07D 4P5KB 4YO0B 3EJYD 3DROA 2CKBL 4K3GA 4RSVA 1GZQB 1EEUA 3B5HA 2QHLA 1EAPA 3GSVB 4DVBB 2BC4B 3HAEH 4PJ9A 1AGEA 4KHXH 4BZ2L 3VXOA 1AC0A 5B8CC 3ZDZF 2ADJB 3SDCB 3MACH 3CMGA 2Y72A 1UZ6F 4N8PA 1A1MB 1V3MA 4WIQA 5DK0B 2KH2B 5F6HJ 4N5EC 1T7WA 2FX7H 3VRIB 1KG0B 1DBKL 5C70A 3UTQA 4KUCD 1CGSL 2B1AH 2HKFH 2EC9T 5GRVK 3HMWL 3B9VA 4RFNC 1RSFA 1WZLA 4NO0B 2C1PA 4M8QB 3LMJL 4U0RC 3RRQA 1CFSB 5FA4B 3MLSH 4NNPL 2YD9A 1PKQE 2Z4QB 4OD2A 3IU4H 5DRZA 2Y5TA 3OAYH 4ZNEE 4O58H 1ZLWH 1XF5B 1W8OA 2O5XL 3VCLB 1A7QH 5GRYA 2M2DA 4WFEE 5HGGS 5KG9B 1D6EA 3T3ME 4AMKH 4PJDB 2A73B 2P5WB 2QKIB 5KSVA 4C56D 3LPWA 5HHXH 2GEEA 4HJGB 3DVIA 3VWJB 4F7MA 1DJSA 2P8MA 5ISZB 1RK0A 1S7RB 4POZD 1F42A 2X70B 5EO1A 1LILA 1UEYA 4JGJA 3TJEL 1BQLH 1EXUB 3PP4H 1OT1A 1D5ZB 4OCYH 1FGVH 1QHPA 1QQDA 1WBXB 3ARYA 4NM4H 3P40A 5D7SL 1MLCB 1VFBB 2VLMD 1J8KA 2ED9A 4PBWD 5D7IA 3L3HB 3OB0H 4JANB 4BFGA 4FP8L 4QTIL 4HG4K 1AE6L 4O2EA 3SGDI 1RZIB 1IC4H 2F53A 1U8HB 4LARH 1N3NA 4O2CA 3HNTH 3ZE2F 5F1SA 3FB7B 4UAOC 3FRUA 2AK4E 3MNZB 4G8GA 4W68A 1EERB 3TWCL 5B38A 4MYWB 2YWYA 4K3JL 1YEHL 3OKNA 2YWZA 2E7LE 4GRMB 1K5NA 1D5MA 3BH9A 1L7TH 1IKFL 1F3JB 2NX5D 3QZWB 2O26U 2BNUB 5DQDL 5KAQG 1LO4L 3QCTL 4JFQA 4OGZA 5CJOL 5D7IF 3EZ8A 1LNUB 4M62L 3UROR 2YKLL 3HLAA 4AENB 1BQUA 1E4WH 1L6XA 5HI5C 4GRLC 3QXDB 5FGCB 3P9WB 1UYWL 4N5UA 2X2YA 4YH6A 3U2SB 2GY5A 1G9ML 1JP5A 3TGXA 4NN6C 1TTGA 3B8SA 4FFZH 1FNEB 3T4YB 5IMMB 1U3HB 2ZUVA 5ICXB 3O3UN 3ARED 5FV1L 4Q0XH 3AREC 3RZCD 1QNZH 1NAMH 1RIVL 5EU6B 3ZYOA 5DJDA 1CD0A 4JO4L 4MWFA 1R5WA 1S7QA 3U46A 5ADOH 2F74B 5EZIH 3Q6GH 4JG0L 4M48H 4D0CB 5E08L 1OAQL 3FQXB 1FVEB 3LHPH 4DGVH 1HHKA 2LVEA 1NCDH 5FO8B 5FYKU 3V79C 1FAKT 4BZ1H 1KEML 5EO9B 4R97B 2BRRH 4NDMB 4HUMB 5INDA 1OGAB 4RA3A 2EIEA 3O41B 5JO5A 3MJGX 4NRYB 5HPMB 5DQJA 4YHPA 1N5YH 3NCYS 4TVSa 3H7BA 3OMZA 4WWID 4LRNH 2UYLA 1KTLA 5C0JB 4V3EB 3BWAB 3KYNB 4YHYC 4KUZL 2F54A 3S7GA 1YEEH 1BVKA 5DR5L 1RD6A 4XVSL 3O6FB 2E8ZA 1F3RB 1XF4A 4EIGB 5I16A 3CSYB 2NXYD 3T1FB 1TQBB 3PDOA 2NXYC 1KN4H 1DBBH 2EYTB 4XH2B 1PY9A 4KUCF 1KBGL 2X4PA 3FN3A 5K9QG 3SKMB 4DKFL 4D0BA 1S7UB 2HYMA 3QR2A 1E4XH 5BO1H 5BV7L 1T5WB 4S2SA 1LQVA 1RV6X 5ICZB 2FNBA 2H6PA 1SMAA 2YHGA 3W39B 3UYRH 5FYKE 4HS8H 5EWIL 3D2UA 3RUGA 4YBHA 5C09E 5KJRL 1T2JA 2IBGA 1JPFA 1T2QL 2CRYA 4AG4H 3LKSA 3LRGA 5ILTL 3P4OB 4MA1B 4GJTB 1QRND 4HAGA 3TLRA 5C9KA 2ZSVB 3DXAB 5I8KH 1PDKA 3VMOA 1I3VA 3H9YA 4S1DD 2YPLB 4H0IA 3TJHD 1FVCB 4JZJC 5JOEA 2APFA 4YHZH 5C0IA 3C6LD 4J23A 1H0DA 4LSTL 4TNWF 5HVFB 1QR1A 3SE9H 3S34L 2OCFD 1KB5H 1BP3B 5ESVB 4GAYA 1OP5K 5KW9L 4W81A 2ILLA 3MR9A 4LLUA 3RUGF 2Y9RT 4L8BB 4KVNH 4WWKB 1EGJL 1RZJH 4GKZA 4OD1H 3MFFB 4LKCB 3ZKMC 5L2KE 4YZFE 4QHLB 3T0EB 4MJ2A 2FH8A 3RVWC 2F8VA 4W70A 1LO0H 1A6AB 4XCCH 2H32B 4R7NA 5HYJD 3HNSH 5DJAB 3S37L 1UH4A 1OB1B 1IZJA 3K81A 1EUUA 3VRJB 1H5BB 2AS5M 3TBVB 1BQHG 5DHXB 5IHUL 2C7UA 3KPRE 1MAMH 1UT9A 2J88L 1TVHB 3PL6D 3IKKA 1WV7T 3Q0HA 4DN3H 2VZTA 5LVEA 3C6SA 2EXYD 5F9OL 4ETQB 5E1AA 2GSIB 4NHCH 2XV6B 3WLBA 4H1LA 5ETUA 1O0VA 3HZYB 5IG7B 5EN2A 1RZGA 2AGJH 2Y36L 2C9AA 2EKJA 3I50L 3NGBB 1AO7D 3MXVH 2C1OB 1ORSA 4EDWL 5JUEL 3VFVB 4AIXA 4FQ1L 2A74A 4JVUA 5J12B 2BY2A 5ACLA 2HJLB 2DB8A 2GJ6E 1CICA 4Z78B 2VDPH 1R24B 5C0NC 4HUXB 2BSSB 5C0CE 4B7IA 5MEPA 4EKXA 5HVGB 4XPTH 1U8KB 3LZFH 5ICYB 4MCZB 4G7YH 2JK5B 1FORH 3KPQA 5DD3H 1LWRA 3QQ4A 1MUJB 2GTZA 4ISVB 5F1KC 5CJXA 4MMZC 1QP1A 1IC5H 1P1ZA 3QUMA 3QAZB 3EUUA 5JXEA 4PG2C 7FABH 3LKOB 4HWZB 5H94A 3HE6C 4FFEX 3NA4A 1P7HL 3INUH 4I0CC 3CFDB 1YEDB 1EHLH 3CFKB 4U6VH 4OTXL 1MIML 1KPVB 3HZKA 3F62A 3KPSD 5IMKB 3LN4B 4QGTA 4FNLH 4ZNCD 4KKBD 2MPAL 2WIIB 4HS3B 4MMXC 4KKBC 4XCEB 3PWVA 1DQJA 1RY7B 1HNFA 2QV2A 2OQJB 4FTVD 3BDBA 3MLRH 2YK1H 1FGNH 2FJGB 3HPLA 4IRZH 5T1KA 3C6LA 4DCQB 4NSKB 5EH1A 5JPNA 3LOWA 1CDYA 1DUYB 1DN2A 1KCVL 2A0LD 3BE1H 3WJJA 1TETH 2A0LC 5CEXA 1HKFA 2VUOA 1CE1H 3KGRA 2V5YA 4QOKA 4ZYKA 3JTSA 5F7WC 1BVLA 3QNZA 4WW2B 1NANI 5CEZD 1BFVH 3A0OA 4XMKH 4ZFOB 3N9GH 3O6KL 3NTCH 2VLKE 5TQ2L 2XKUA 1A2YA 1FNFA 5FECA 5DJ2A 2L7UA 2IQAB 3LKPB 4EEEA 35C8L 4JM2D 2PCPB 3BKJH 4JM2C 1BVZA 2LTQC 4NKMA 1MFEH 3E1F1 4C57C 2G60L 1T89C 3ETBF 2W9DL 4PJCA 1UVQB 3QISA 4UV7H 4OF6A 3L6FA 1DFBH 3QDMA 5F9WC 2IPKB 5TDPA 3VXSA 4AEHL 4MDIB 3QRGL 1MHHA 1T1YB 3ILPA 3ZMRA 3L1OH 1T04B 3PL6A 1DBML 1MI5E 2DQFB 3LRHA 2GITB 3HC0B 1NUDA 5E99H 2IBBA 5C0DA 2CO7B 1SJEB 1BWMA 1YPZF 1GZPA 1K4DB 1GC1H 3STZB 1A4KB 4M5YL 3BKCH 2BVPA 2BHUA 2VITB 3HCVA 1GH7A 1U8LA 4WU5B 4QXUH 3UCRA 3HRPA 4QHKI 4KV5F 3BPOC 4MAUL 1BJ1H 1FC2D 1B0GB 2AQ2A 1AH1A 1TQCC 1CK0H 5F7MC 3WS3B 5CMAA 1YYLH 4U31A 4LPWA 1JK8B 4TTDC 4K71C 4PJHB 4EVNA 1YEGH 1WTGT 1CGWA 4YQXH 2X4NB 1U6AL 5J56B 4Z0XB 2B5IB 1FL6A 4GBXC 5A2KH 3S36H 3RGHA 3IJSB 1H3WM 3QB7C 4XXDB 1MHEA 1NEZA 1KOAA 5SX5K 1JZ7A 1G7JB 1U8OA 3S4SA 4PP8C 2XZCH 3V52H 1MCWW 2A9ML 4EBQL 5I74B 3ARVA 4FQCH 5B4MD 5KSBA 3UEZA 4O5LL 5D6CA 3KPSA 5A3IC 2FD6H 4XVJH 2ZG3A 3ZKNC 1ZVYA 3DRTA 3P11H 4FQPA 3VGHA 2AP2A 1L0XA 3DSFH 2MOVA 1MH5A 4Z7UB 5T33L 2VR5A 4WI2A 3ZTNH 5E8OA 3RDTD 4V2BA 3RDTC 4XBEL 4Y4FA 3DUSA 4NHUB 1FC1A 1HHIB 4U6HA 3L3JA 3VXMA 2FO4B 2VSCA 3BPNB 1P7QD 3TFKD 4DGYL 2ZSWA 4NQED 3LH2L 4L8SC 4J4PC 5D1XD 1YJDH 3C8KB 4HZLA 1C12A 4GUPA 4FMKA 1YNLL 2HJKB 3JVGA 3KWWA 4KPHL 3MRNA 2JB6A 4ZSOA 3FRPA 5SWSE 1B88A 5ACZA 4M00A 3OAUH 1QBLL 3DV4A 4JFEA 5ANMB 4QNPE 3MA9L 4LLQA 1T4KB 4MJIE 4PFEA 3OZ9L 1E6JL 3WFCH 4ODXB 1F2QA 5LGJB 4P57A 4TYUA 1MELA 5GHWH 3BEWB 5F1IB 5DC0A 2Z31A 4H0GA 5K9QI 1P6AB 4RMWA 4WO4D 1S9XA 4WO4C 3CJJA 3EOYG 1WCBA 4PRPE 5J13C 4M03A 5MHSE 1RZ7L 3BUYA 2IANB 4YFLI 4F37F 3SOBH 4JM2F 1SJHB 2Y7QB 3GBML 2H45A 2PYEA 3QNXB 5E8NA 5JA8B 1ZGLM 5BRZB 4D3CH 1INEL 3DI2B 1OW0C 3DIFA 5JW3L 1ZHLA 1UWXH 4KTEH 3MV8A 4U3CA 1SY6H 3MRFA 4NUGH 4XMPL 4PLNC 2VLRD 4G8EB 4JJ5A 5DUPL 1OPGH 2ED8A 4DZBA 4P48A 3QEUA 4EUPA 1XR8A 2P5EE 3MLXH 3UPRB 5HHMD 3RWCB 2HWZL 1C08B 1TZGH 2BJMH 2DQJL 1QFUH 2UUDH 2XOTA 2F5AL 5H2BB 1A9EB 3PXJA 2HMIC 2VKWA 1FLRH 1I8MB 3H6JA 3QO0A 4WFGE 2YR3A 5JHDD 1D9KB 3F7YB 1CGUA 2EDKA 2WLYA 3NCEB 5D4QA 2XQBH 2CK2A 4KHXL 1KPRA 1BX2B 5TFSH 1J0IA 4L4TD 3SN6N 3VD4A 1XIWB 1NGYB 5BZWB 4A2MA 4I5BA 3MACL 5F7KC 5HGHB 3RL1A 1KB9J 3VD5A 3MTRA 5F96H 4M6NH 2XQYK 3WD5H 1W0WA 5CCKL 5CP3A 1KJ2B 4N8CH 3RVXD 5E2TL 4OZGB 1I1AC 2FX7L 3RVXC 2OK0L 4JLRA 3FO1A 1CFNB 4N0UB 4ONGH 4X6DA 2B1AL 2HKFL 3QWQB 1CQKA 1VFAA 5BMFH 1JYXA 3TFKA 3QDJE 1R5VA 5I30H 4MQSB 5CHNB 1T22B 1FZOB 4RWYL 2ESVE 4P0DA 4BUGA 3TT1H 3UTZB 4X6CB 2IJ0C 1IAOB 3HC3H 3DV6B 4PJ7F 5TQ0L 2UVEA 4YHMH 3OKYA 4NQDE 1WBYA 3BSZL 4O58L 5CIPB 3GMPA 2O5ZL 1A7QL 4U49A 4K3EH 1KFAH 1T1WB 2X4RB 5C0BB 5GGSY 5E8PA 4AMKL 5AG8A 3HR5B 3G5ZB 2QQLH 4I3GA 4PRIA 5D2NB 2DJUA 5HHXL 5IJKA 4C59B 5HHQB 1A9BB 2BOBB 2Z0BA 1TPXC 1F11B 4AH2A 4X6DF 3RPIB 3NN8A 1ZAGA 3H0TA 1BQLL 3PP4L 3CVHB 1T2XA 1K6QL 4OCYL 4NM4L 5ENWB 1SM3H 4JFDA 4OF5A 3TO2A 3MV9E 4X9GA 1DUZA 3O3AB 3RY5A 2J8UE 4NO2B 1X7QA 4TUOA 4WUUE 4XPAL 5CSZA 2DM7A 2NW2A 4Q6IC 2EDYA 3P30H 2MHAA 3V0AC 4LARL 3HNTL 4JPVH 2WINB 4ZFGH 4FQXD 4FQXC 4AM0A 3SQOH 3CGTA 3PWPB 4NKOB 3BDYL 4S11A 5MI0B 4HLZH 1ZLUH 2W0KA 2EYSA 1JHTB 4CU7A 4Z7NE 3VXUE 3O6MH 3NAAH 3OKMA 1TTFA 2XZAH 1KPUA 2XACC 2NNAA 2CMRL 1HI6A 2N7BA 5AZ2L 4OF7A 4OZHB 2D03H 4U6XA 4H20H 1SJXA 5D1ZC 3NIGF 1FZJB 1E4WL 1IGTB 1YY8B 4WI7A 4EI5D 1MEXL 4XHQA 3P9LA 4EI5C 1EHAA 4O9HL 1FP5A 3Q48A 3REWA 1OWRM 1P9MA 4FFZL 1K4CB 3M17A 1OF2B 2OL3A 3LB6D 5D5ME 3A6BH 3NPZB 3LB6C 1G7IB 4TSBH 4Q0XL 2HTKC 1NC4D 3D39B 4EDXB