3MRKA

Crystal structure of mhc class i hla-a2 molecule complexed with afp137 nonapeptide
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
274
structure length
273
Chain Sequence
GSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDGETRKVKAHSQTHRVDLGTLRGYYNQSEAGSHTVQRMYGCDVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQTTKHKWEAAHVAEQLRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDEATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWVAVVVPSGQEQRYTCHVQHEGLPKPLTLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
publication title Crystal Structure of MHC class I HLA-A2 molecule complexed with AFP137 nonapeptide
rcsb
source organism Homo sapiens
total genus 82
structure length 273
sequence length 274
ec nomenclature
pdb deposition date 2010-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mrkA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3mrkA01
5ACMA 4XI5D 1FG2B 4M7JL 1HINL 3LN9A 2XA8L 3B9AA 1XIWC 4MA8H 3BPOB 3HE7B 4PJHF 4L8SC 5HD8D 3BZEA 5I1LB 3KXFE 4MYWB 3OKNA 3LKQB 2NY7L 5TE4L 1UWEH 2V5RA 3IDNB 3CX5J 3QQ3A 1RUAL 4MLIA 4P2QE 3E6HA 2CR3A 4GAGL 4E0RB 4P5MA 3NCYS 3T4AA 4YO0A 1QBBA 1S7VA 2DI8A 4U6VL 4NJ9H 3P77A 1A6WL 3GBNH 3F7PC 4GRLA 4PJDF 1M6OB 3KG5A 1QRNA 3ESVF 5I76A 4CU6A 2RFXA 4HIIB 4N8VB 1U91B 2YS4A 3QXDB 4Y19E 5D8JL 4AG4L 4Q9RL 5EU4B 2LTQC 2IAMB 4XTRC 4NQDD 1F6AA 3D39E 5E94A 1LNUA 5EU6A 4R7NB 3NIFE 3QA3A 1BQLH 4BKLA 4PYGA 3VH8G 4FFWC 4YFLI 2D4FA 2J8UE 1CLZH 4L3AA 4X4MA 1V05A 4LVNC 5I8EB 5ISZA 5ALCL 3WHXA 1DUYA 4NSKB 4P4KA 2RAMA 3ZYZA 4PLKD 4QXTA 3EYSH 3UDWC 4FXKB 1KG0B 3VXTB 3VXMD 5GJSH 4MS8D 5HI3D 4U1NB 1F2XK 4FTVD 2DQJL 1X7QA 3KPMA 3QCTH 5HDLA 4RWHA 1CFVH 3DSNA 5ITBL 1YEGH 2APVA 4K71B 5DEZA 2YD5A 4KKCC 5H2BB 1T7WA 2QKIB 3VD9A 5EZIH 3WNNA 3BZ4B 5JUEH 4KQ4H 1A9BA 2GT9B 3UC0H 1S78D 4OCNC 2VLRB 3C5SB 3QCUH 4E41E 1V7NH 2GJJA 2X4NA 3NA9H 4JFED 1BJ1J 1IGTA 3SDXE 4P2RE 4H8WL 5GS1B 3ZTJG 4PJ7A 3AB0B 1J86A 3KAAA 4FQPA 2FO4B 4ORZC 3L5XL 5CZXC 1PD6A 4XMLH 5ACLA 1YMMB 2R0KH 4H26A 5DDHB 3FB6A 5FYLH 2QQLH 2I07A 5IVXF 5JPNA 1NUNB 1HWHB 4EUPG 4KUCF 4HPOH 4IRZL 4JG1H 4CNIA 3EYOA 4WFFD 3JUZA 3MOBH 1AGEB 4GJTB 4LSRL 1YJDL 1XGQA 3LKRA 4HPYH 1IEAB 4OGXH 4NZRL 4U1HB 2DQHL 2GJZB 4HUWA 2RR3A 5T1MB 3O2DL 4PYHA 5E2TH 3VI4E 1FYTA 5DQ9B 5IKCA 1Q0XH 2E8YA 2R29H 2QADC 4K2UL 1T4KB 1MHPL 3ROLB 1IM3B 3BYTA 2WMPA 4PY7B 5EU7E 2Z91A 3IKCA 4KJQD 5GGVL 3KYMB 5HDBE 3IFNH 1A1NB 4A2LA 1MCIA 1OD9A 4AJ0A 3D85B 3OZ9L 2HFFA 4W81A 3TLRA 2BOCA 4CAGA 5FKAB 1OOAA 2BX5A 1C08B 2IALB 2JCCE 2APTA 4HAFA 2VOTA 4H88L 1F5WA 3KS0J 1CL7H 3MV8A 4ZTOL 5C0AE 5I17A 3SDDA 1EGJH 4NBYB 2CDEA 2SEBB 5GRUH 3H9HA 4OZIA 3PGCA 4KI1A 3NCFB 5EU5A 1LQSR 4OD3H 1HH9B 2UUDH 1ORQA 2NTFB 4NZTH 2A0LD 5DD3H 4ENEC 4IDLA 1NDMA 4BFIA 1FG9C 1OWRM 3MRKA 4NN5B 1G7JA 3BSZL 4GW5B 3F7VA 3QO0A 4WHYG 4N9GB 3MODH 2VC2H 1FCCA 2UY7A 1X9QA 4NKOA 3ESUF 3QUXA 3HB3D 4YQXL 2EIZB 3GHBH 1U8HB 2BOBB 1EEZA 2GK0A 2HG5B 4DUWA 4JJ5B 4PJ9C 5FAAA 1IAIM 1OP9A 1J11A 3A0OA 5DEGB 1KENL 5DJ8B 5GS0L 1OB1B 3CGTA 3MCKB 1IGIL 4H0HB 4JZJA 1MPAH 3QDJD 4F7CA 5HVWA 3PWJA 5CLTA 5JW4M 2CLVB 2NMSA 4MHHG 2J12B 3LH2H 3CSGA 3BQUA 4JG0H 2DM3A 5AWNH 3G6DH 2WWKT 2DQUH 4CKVX 1T1YB 3S36L 5HHOE 3K74B 2P49B 4LRNH 4FQXD 3EW3B 4BK4A 4G6MH 3NVQA 3G5VB 5D71H 3W11C 1MCLA 5MERA 3EDDA 3QI9A 1PG7L 4QHKJ 2BSTA 5GIRA 2X7LA 3QQ4A 2XTJB 3VE0A 4OD1H 1Y6MR 4EXPX 3ULUE 1NGWA 1Q9LB 4MAUH 1EUTA 3HR6A 5JDSA 4C56D 4AQ1B 4WUKH 4JM2D 3RWDB 1NCCH 5JA9A 2F5AH 4OCSH 4UNUA 2D4DA 2XA8H 5HHNA 5JHDD 1A6AA 5JIHA 2HVKB 4ZDHA 3KNBA 1RULH 2QJDA 4JRYD 4XT1C 2R39A 4ZUVB 3WLBB 4JZOB 3EZ8A 4JFOA 5DHVB 1BZ7B 1DBAL 2RJMA 1RUAH 1OLLA 4GAGH 5DJ6A 5E6IB 4IM8A 4XHJD 5A3IC 1A1MB 5DUMH 5JXAL 1MF2L 4U6VH 1JIBA 3RGVB 4HIJB 4M9OA 4PRIA 3L95B 2XIDA 2BNRE 2Q3AA 1ZHKA 3GSXA 3LKPA 3QZWA 4M7LT 1LQVA 4D0BB 2FJGA 2LU7A 4F3FA 2X42A 2BY1A 4Q74A 5D8JH 2NY0B 4UB0H 5FM8A 4AG4H 3HRZA 5IV2B 4Q9RH 4XPGL 1W0VA 3MSPA 4JY6B 1MCOH 3KPQA 3GO1L 4HKBA 1VEPA 2Q6WB 3NPSC 3F12B 3NFNB 4LEOA 3C9NA 2YWZA 4JY4B 3G6JA 3MRMA 2CKBL 1ACZA 2CPCA 1WCBB 3MV9E 3DRQA 1WBYA 4IOSD 3ZYIA 2FD6L 2EC9T 3U2SB 3DURA 3GSUA 2VLJE 4MA1B 1UH3A 4MSWA 1FVDA 5C0BB 4LIQE 5CGMA 1T1XB 4LNVA 2NY6C 3V4VL 3T0WA 1GIGH 4MVBC 3ZSTA 4N0RA 3A6BL 1KLUA 4HHAA 2DQJH 1IT9H 3OV6A 3SQOL 1HDMA 3QWRD 2JJTA 5C08E 1UWXK 4IMLB 5IJKA 4MNQB 4EN3B 4MAYC 1B90A 3E2HB 3QXAB 4JFYA 1JGVL 5GGQL 1FQ9C 4S0TD 3C8DA 4MGXA 3VCLB 4WU7B 1FG2A 1KB5B 1VHPA 3RNKB 4QGTA 2UVEA 1EJ6A 3AU1B 2KZ1B 3GJEA 5IR1A 3OKOB 3HG1B 3KXFD 1MJ7L 2E9JA 4XCEA 4H8WH 1KXTB 1ZVHA 3C09B 2XG5A 2IQAB 4P2QD 3P0VL 3EHBC 2GTZB 5EDXA 5HVHC 1R3KA 3L5XH 4LHUB 2ZOKA 2AI0H 3CVHL 3K1KC 2V5TA 3FO2B 4DZ8B 2X89D 1ZWIB 3T0EE 4AL8H 2VDNL 1M6OA 4E9LA 5J1TC 3VFMB 3FT3A 4AIOA 2L4OA 4Y19D 3QXDA 3G08A 4IRZH 5C0FB 3L6FA 5C70A 5JW5B 4HCRL 3QUZD 3PWPA 1JZ4A 2Y23A 3VG0L 5FDWA 3D39D 1MCJA 3KPRB 3SDCA 1UM4L 3RDTC 3EAKA 1AXIB 3SCMC 5J13B 1B2WL 1G0YR 2DMCA 1QLRA 5DHYB 4NZRH 3HPJB 1UH4A 3O2DH 3HUJA 1QBAA 1S7SA 1BOYA 1EAPA 4QHLA 3DXAE 4YPGB 5CGTA 3M8OL 1U93A 4NPYB 4GW1B 4K2UH 5GGSB 1MHPH 2JB6A 3MRFB 3MACL 4K8RC 3T2OA 4OFIA 2N7AA 5JQ6L 2EE6A 3OZ9H 3DPBA 1I1AD 1J1XL 4HIHB 4KI5E 5BW7A 4H88H 1K5NB 5HHPB 5CS7A 4ZTOH 4RMWA 4TRPL 1NEUA 3OR7B 4ZTPL 1DEEA 2YN3A 3LRSB 4O2EA 2Y9RT 3BZ4A 4ZFFA 4K3EL 4G6FD 1P7KB 4OFPA 5BQ7B 4E41D 5CD5D 3HZVA 2C3GA 3BSZH 1KYOJ 4NKMB 5DMYA 3T3MF 4ISVA 5IK3A 3HTLX 1RJLA 2W9EL 4P2RD 4HLJA 3ARDC 3ZHLA 3L3IA 1J05B 5HDQL 4YQXH 2KQMA 1LO0H 2FO4A 3DARA 2X4RA 3GSRB 3VDBA 1Y18A 3BAEL 4M9PA 3S4SA 4ELKB 5IG7A 2RIKA 3OJMB 5GS0H 2CK0H 4FFVD 3D69B 2HH0L 1IGIH 3PXJA 5IB3B 4W4OA 2IADA 4C59B 2IH1B 3VI3F 2PW1B 5FM4A 1JNJA 4KPHL 1GH7A 1AGEA 3IDXL 2EDYA 5CUSH 4LLMA 1UFUA 4P57A 4N0UA 4C55A 1CICC 5E8DL 1ZA3B 2GJZA 3MFGB 4Z77B 2BHUA 2WQ8A 4MQXC 3TZVC 1DEDA 5JR1H 4G80B 1ZHNB 5J1SC 3VD5A 3QEQE 3VXPA 1FL5A 3QWOA 2E9BA 5J1AA 1IM3A 4DKDC 1PG7H 3GK8L 2BP3A 2OI9A 4PY7A 5IFAL 3WFBL 1U3HB 3L5HA 4V3EB 1KN2L 5ANME 3KPNB 1A1NA 3ARED 1YMHB 5D5MB 4LGPB 3DO7A 3P4OA 4TNVF 4XX1G 3RPKA 1C08A 1RURL 5F9JA 2IALA 1DFBL 4XMKH 1GGUA 1T7YA 4L4VB 4Y4KC 3DBXA 5C0AD 2WSKA 2BFVL 5TF1L 5CCKL 4NC2B 4XPBL 5F7NC 2CJUH 5F1NB 3TBVB 5E8PB 1I9RL 2XKUA 1QFHA 4JFPA 2YRLA 4ZAKA 1DBAH 4TSBH 1FDLL 3NFPB 1LDSA 2E7LA 1RZIB 3MLRL 3GFUA 1A7RL 3P9LB 2J5LC 3O4LA 1QRNE 2COQA 2NXYC 2OQJA 5ESAB 3FO9B 5HPOA 1MF2H 4XGZA 2D2OA 1MCNA 4CJ1A 1F4YL 4IHOB 4QNPF 1SEQL 5EU6E 3VFGL 3ZTJH 2Z35B 3B9KB 5CD3B 5GGSY 3MYJA 2MQCA 3PDOB 1XF5B 2ATPB 4LP5A 1J5OL 3G5XB 1NC4A 4XPGH 4FQHB 4X4ME 3GO1H 4WI3A 4XP5L 5ISZE 4UILL 4I1NB 4S0SD 4KHXL 4N0YH 4V2CB 1FORH 2CKBH 3IXAB 3MLXL 2NYYD 1EEYA 1OY3B 1RUQL 4EUPH 3TFKC 5EUKB 4BA8A 4Z7VB 2FD6H 5FEBA 3GMMB 1QLFB 4RAVA 3CX5K 1T5WA 3LSOB 3D0LB 3QFJD 5HHOD 1EDQA 2P46B 1BJ1H 1LD9A 3O0RH 5T3ZE 1AO7A 3QRFM 3V4VH 2E5EA 1CF8H 5I6XB 2EEAA 4WO4B 3LKNA 2LABA 1UACL 3GJFK 3I75A 1PX4A 1QQDA 1WAAF 2JIXA 2AABL 3F58L 4LVHC 4HUMB 3NPZB 5DUPL 4HIXL 3ULUD 4U1SB 1JGVH 5GGQH 2CIKB 4OAWA 2EEBA 3C8KA 2ICWJ 1TPXB 2V9TA 2E6JA 3UJJL 4NZUL 1FL6A 5ESQB 1HQ4A 4PJ7E 4S0UC 4KTDL 5MENB 4XNXL 1EFXA 3WLBA 4NQCB 3TN0C 4JZOA 4PLJD 5JOFA 1NCWL 1BZ7A 2C7UA 4S1RL 1J12A 1K85A 3P0VH 5E6IA 2EDBA 5ACZB 3TNNB 2AK4B 1T1ZB 2DWDA 5LAXA 2VITA 3CVHH 3VXNB 4LLAA 2YD8A 4WHYH 3RGVA 1OLZA 1YUHA 4NC1C 1WWWX 5DJZB 4PLKC 1B4JL 1EHXA 1AJ7L 4ZS7L 2VDNH 4LQFL 4DEPB 1SBSL 1MY5A 2WNGA 4YAQA 1HYSD 3NGBB 4HGWB 4MS8C 4LBEA 4R6UA 4O4YL 1ZHBA 4HCRH 3KS0H 2D3VA 1CIUA 4CVWA 1UM4H 1FYTE 4F37F 1X5LA 3QIBA 4WWKB 5CFHA 2EDNA 4OTXL 5DT1L 4KJYB 1MCHA 1S9KC 1B2WH 4WHCA 2NCMA 1MI5D 3I02A 1FO0L 3T08A 3MV9D 4XCNA 5MI0B 4NUJA 2P47B 4W6YB 4KJPD 3M8OH 4XPFH 5K9QI 4NDMB 5FGBA 3FJTA 3U2SA 4OZFA 2BVUA 2VLJD 3MACH 5LCVL 2NPLX 5C0BA 2BHYA 2F8XC 5IW1A 4RFOL 2HRPL 5JQ6H 4RGMC 3MV8E 1DBJL 3R1GH 2H3NB 1J1XH 1UJ3A 4QRUB 1KB9J 2PXYA 2AXFB 5DRXB 3MLZL 2DRUA 3WKNA 1UYWL 2HTLC 5C08D 5EO0A 2X41A 4OZIE 4TRPH 4JFDB 3TESA 1J7VR 4OZ4A 5IB5B 2W91A 3RZCC 3E2HA 4RGNE 3QEGL 4JHWL 4M8VA 1S7QB 4U0QB 3TYFA 4K3EH 4NN6B 3DX6B 3FQRA 4Y8AA 2NY3D 4YHNA 4ZFGL 5IQ9B 3FZUC 3V4UH 4XC1L 2HT4C 3VXQA 5KSAA 3HG1A 3WNOA 2W9EH 1YN6A 4DOHB 4Q7DA 3OKKB 1TTUA 4X8JB 4CADB 2IQAA 1NEZG 3MV7B 4LCCC 4TULL 4P46C 5HDQH 5ILTL 1OT1A 2Q7NA 1I3VA 2QR0B 4S1QL 3BAEH 4OSUL 1H0DB 1IARB 4G8EA 3TJEL 5BRZA 2DM7A 12E8H 4OD2B 3C5JB 5HXMA 2X4TB 4JFXA 2Y6SC 1EX0A 4IIQC 3VFMA 2X9XA 5IHZB 1BPVA 4KPHH 1MJJB 3FRPA 4KKBC 1IRAY 3DMMD 4WGVB 2FJHB 1T7VA 3OGCB 4TTDC 5B39B 1T21B 3FQXA 2R4RH 5GGRB 1FJ1B 1YEEH 4X6CA 2YPKA 4PJEF 4Y5VB 4RA0C 1SVZA 5E8DH 2DDQL 2ID5A 3ET9F 2B1AL 4L3EB 3U46B 4PJ5A 2HLAA 1YEIL 3C5ZC 5BVJB 5L2JB 1LP9A 2VAAA 1D5MB 5D7KE 1WQVT 1FPTL 3WDIA 2J1KA 3RVUD 5GGSA 4EKXA 4JQVA 1ACYL 2R9HD 1VFAB 2Y7QB 3GK8H 3HLAB 3WFBH 5HHQA 1DBKL 1P7QA 2C3WA 1JV5A 3MRNA 2Z93B 3PXHA 5I8OH 1KN2H 1IKNA 1ONQA 5DURB 1MRCL 4UINL 3KLHD 1AD9B 3HB3C 3D0VB 4KI5D 1AKJA 1DFBH 4RAUB 2VERN 5F3HA 4U1IB 5JW3H 1U8PB 3L7EA 4NBZB 4GBXA 4P23B 1DL7L 3DUSB 5CCKH 4XPBH 4YE4L 4PJEA 2FEDC 1BGXL 1J1PH 1UB6B 1I9RH 1JYVA 1G84A 1QKZL 1UJTA 4CMHB 3RTQD 3PL6B 5IB1A 4PRIE 1A7RH 4KMTL 3WJLA 5EBLA 1X5GA 3ARGB 2X1XR 1CDHA 1D5IL 1LWRA 4NQVA 2W9LA 4JO3L 4DVRH 1WZLA 2APBA 4FQXC 1OM3L 5A2FA 1SEQH 1FNEB 2XTLA 3VFGH 1OTTC 2D7PA 5H37G 1G0DA 3G6JE 1L6XA 4ODSL 5ID0B 1H5BB 1J5OH 2E6QA 2QV2A 4K8RL 5JNYA 1J0IA 3P30L 5AUMA 4H5SB 4XNMB 4BJLA 4ODWA 4HWZA 5FOBB 5EPMA 1JYXA 4F15B 4UILH 4ZOAA 5D5MF 4C57C 2Q3ZA 5F1OB 3U0TB 1RUQH 4NCC2 4BQ8A 5D9SB 3C2AL 3JUYA 1YECL 5MEPB 4MXWL 1XGRB 2C9AA 1U2HA 1VFBA 2FL5B 3ZHKA 4UT9L 4WHTB 3OQ3B 2BVOA 3UTSB 4G80A 1T2XA 5I15L 1JNLL 4YXKH 3QEQD 2IWGA 1HKFA 2A83B 5EZJA 2XZZA 4XHJC 4Y16D 1UACH 2X4UB 5BW7C 1CU4L 3VXUB 4P4RB 8FABB 4PREB 2PCPB 4JO1L 2BZDA 2CQVA 4YGVB 5L6YL 2Z92B 3BDYL 3WEXB 3F58H 5DUPH 5C0IA 1FVEB 3ZT6A 1JF5A 1WV7T 4F58L 4ONHA 4LLWA 4HG4J 1R24B 3UJJH 3ARPA 4UUJB 1BIIB 1AE6L 5GRZA 4G3YL 5DTFA 4OUOA 4X7TB 2A2QT 4KTDH 4XNXH 3TBVA 2XNAB 1CQKA 3LHPL 4KDTA 1CT8B 2AV1A 3NFPA 5IF0A 4S1RH 3HHRB 4G8GB 4YIQB 3MJ7A 3ILQC 4Z7VF 5DA0B 1U8KB 5GGRY 1M7DB 3L3HA 5I73B 2EO9A 3FO9A 1OP3K 3MUY1 2PTVA 4I3RL 5J6GB 3PWPE 4ZS7H 1BFTA 2AK1L 2BXZA 3SDAC 4LQFH 5EU6D 5E9DA 1TVDA 1M7IB 1SBSH 4KQ3H 4W4OC 3SY0A 4MXVE 4XMPH 3VFWB 3QIWB 3T4YB 1OAQL 4RSVA 4MMXC 1PSKL 3HUJE 5CP7B 1U92A 4WI7A 4OTXH 1JGLL 5ISZD 1FO0H 4P4KD 1KLFA 5B3NA 2Z31A 4M1CC 3BP5A 1TJIH 3NCMA 4BM7A 2YXFA 1L7IL 3RJQB 1HH6B 1C5BL 5CGYC 3V4PH 1BF2A 4ONOA 4POZC 4K7PL 4R4FL 15C8L 1K8IB 1BMGA 5C8JB 5LCVH 5FYJE 5IEKB 5T3ZD 4RFOH 1DSFH 1S9XB 4IRJA 4B7LA 1DBJH 1MEXL 1HHKB 4WJ5B 4YGAB 1KLGB 1NQBA 2HJFA 1VPOH 3CFKB 1KT2A 2P8MB 3RA7L 2BVTA 4LCIL 2MNUA 3WS6C 1WEJL 2GSIB 4MHHI 1A3LL 2VLRE 3IF1A 3QXUA 3QEGH 1IGYA 2CIKA 4JHWH 5LJYH 4XCFL 1RK1B 3R4DA 5F9OL 5EU3A 4ZAKC 1M05B 2XKSA 4Q6IB 1WZKA 3WS3A 5IJVA 3QUZC 4Z7OF 5FB8A 3AGVA 5IMOB 2X4QB 2VL4A 5L2KD 5KSUB 4XC1H 3WJJC 1N6VA 1T66D 1QBML 3MOAH 3SGJA 3LD8C 3TEUA 2VQTA 4NQCA 5C0NC 4PP8C 2AJYH 4TULH 1Q94A 2F74B 1E4KC 5ILTH 3W39A 5DRNA 3LZFL 4R4BA 1QNZL 1FCGA 1TQBC 2Q87A 4AEHL 1T1ZA 4OSUH 2XA3A 2ZUSA 5F9WC 3AXLA 3HZKA 3DVFA 1ZEAL 4QT5B 1CDGA 4YC2B 1K4CB 1MVUA 3ARSA 1MQKL 4P2CG 1JHLH 3UZEA 3OKEA 1I4FA 3RBGA 3V8OA 5CAYB 3T3ME 5E4EC 4N0UE 2M26A 1QHOA 1ADQA 1FYTD 3QUYC 1I9JL 1II4E 1U58A 2R0LH 4L8CB 4NO3B 1FVCB 4G6KL 5DUBB 4QY8A 4M5ZH 3MRIB 2DDQH 1B6UA 2B1AH 3DVIA 1OTUD 1YEIH 4R7DB 1A7BA 5BZDB 1U8QB 2BK8A 3W2DL 2P5EA 1ACYH 1EJOL 2OM5A 5I1GL 4KUCD 3D2UB 3RQ3A 1WBXA 1HYRC 1DBKH 1RZJL 2VDOL 4Z7QE 3B4NA 3GM8A 1MRCH 3MV8D 3GKWH 2V7NA 1P6AB 1QO3B 4WTWA 3SDDD 3VW3L 1XCQB 1BOGB 4MX7B 4I4WA 3SKMA 1VSCA 5HGGS 1MRDH 1O5DT 1P84J 1ZANH 3D18B 5EZLB 4ZFZA 3P73B 1GGBL 4OLEA 4GRWH 4J3OC 2E7LE 3FMGL 1OTSC 5HYEA 2C4FU 4MD0B 5I0ZA 3OAZH 1A5FL 3O4LE 3TCXA 1T03L 1A3RL 1SEBA 1BGXH 2W0KA 1W0YT 1QKZH 2XXCB 1BJMA 1CFTA 3NOIA 3QUXD 4UIKL 3VD7A 3DX6A 1C16B 4TVPL 2G2RB 1EZVY 1CFNA 1D5IH 4EOWL 1GXEA 2CDGB 1TQCC 2VIRB 4LVOB 5KG9A 3HAEB 4HK3J 3EGSB 2FHBA 4S2SB 2YA0A 3O45A 4ODSH 1EXUB 4XVSH 2GJ6B 1H3GA 4K8RH 1GC1C 3BQUD 3P30H 1QSFB 2FX9L 4R26H 3VRLE 4W6WB 4BFGA 1KCUH 4F80A 4X5WB 4QNPE 3DV4A 4NKIL 3C2AH 1RZ8B 1YECH 1CR9L 3OGCA 4NO5A 3W5MA 1KTDA 4OQTA 2VYRE 6CGTA 4MXWH 3QI9D 4NO0B 4JFHE 4ODVL 1KPUA 1P2CA 3CPLA 5L2JA 2HAZA 4MD5B 1FFNB 2FO1A 2ITDA 4MQTB 5I15H 3W9EB 1JNLH 5D7KD 1RI8A 1G7MA 2ATKB 1CU4H 1WTGT 2ZUWA 3HLAA 2OR7A 4JO1H 2VDMH 5DJ0A 2Z93A 4ETQA 5HGHB 3BRGC 3BDYH 1CD1B 4H1LA 4F58H 1UADC 2MSPA 3D3VA 1NL0L 3CXHJ 2O61A 5DS8B 2EYRA 5IBLC 3OJDB 3BH8A 3MLUL 4L4TD 2CR6A 2QQKL 3MO1B 1W72A 5DI8A 3TVMB 4G3YH 4A6YB 4P23A 1BD2B 1ZE3C 3DUSA 1KJ3H 5IB2B 1S7TB 3LHPH 3U4BH 1L9NA 4XVUC 5KSAC 1N6QL 3G5ZA 1OAUL 5A2KH 4PJXA 4JANB 4PRID 2NY2C 4JB9L 3LN4A 5I30L 5DRZB 5GJTL 4RISL 3ARGA 4P2OB 4NHCH 1MSPA 4NNXB 4QTHA 4JO2L 4ZOEA 4NQUA 5T5NG 4JAMA 4KJWC 1GPOL 1FNEA 3EO9L 3BUYA 4AH2B 4NRZB 4L29B 2FBJL 1OAQH 3IFOB 3WNMA 2YA1A 5E08L 1X5JA 1D5ZA 3RVTC 1KCLA 4Y4HB 5FOBA 1JGLH 4DK3A 2BSED 4PRAA 2P42B 5F88A 3OAUL 1L0QA 3GMPB 3K4AA 3DOSA 4O51B 4ACPA 1JZ8A 4OIBA 4JDVA 1LO2H 2AJSH 4YFLF 1KV3A 3L3GA 5C0BE 3A67L 4D8PB 5DK2A 1C5BH 2IPKB 4X99B 1OSPL 1BLNA 5K9JL 5GGUB 5MEPA 3W9DA 1WGOA 4Y2DA 1JGEA 3ILPB 2VB5A 4R4FH 5JIIA 2Z8WC 3BD5A 1MCEA 3IT8D 2AXGA 5DQJA 4PLJC 3OPZH 1JGDB 4ZPTB 5DXWA 2A6IA 3UTSA 4APQC 1MEXH 4IOIA 1IGCH 3X12A 2WBWB 3MR9A 4HZLA 1MRFL 3MGOB 1UB5B 4U6YB 1U8NB 4LCIH 4YDJA 5C3TA 1WEJH 3DUUA 1A3LH 3ZKMC 2ADJA 4GBXC 5EFIB 3BKYH 2NY1C 5CMAB 4MNHA 3BH9A 2PO6A 3HE7D 4XCFH 3E8UL 5K59E 1JPFB 5EORL 3DYOA 3AAZA 3HG1E 5ADPL 4QRRB 3ECBA 4FQIH 1JZ6A 3QUML 4HWNA 3O8XB 1X4XA 4ZODA 5D6CA 5E95B 2HLFC 5J3HD 5IB4A 1YZZA 1J0JA 3TH2T 4FNLL 1X5AA 1AGDB 2VSCA 3ZDYF 1BP3B 5BRZE 2OL3A 3BW9B 4YBLC 3LZFH 5F96L 1QNZH 4AEHH 3O41B 2VH5L 1HSBB 4UDUB 2P44B 2VQ1A 1EZVX 3SPVB 1ZEAH 4GW4A 4QF1A 1BFVH 3D6GA 3E3QA 3PWPD 2IAMD 1G0XA 3SDCD 1A22B 4KDVA 4BELD 4X6CE 1D5XB 1Z5LB 5H37H 1JMZA 4HSQA 2ICES 4PJ5E 3WE6A 1MUJA 4Y1AA 1LP9E 1EHAA 4R8WL 2ED7A 3I6LE 1LGVA 5IM7B 5FF6B 1WT5C 2AERT 2M2DA 1R3HB 3LPGA 1S9VA 4JDZB 5LGJB 1RZGB 1U6AH 2H26A 1IMHC 4OLVH 1EJOH 3KPOB 2NY3C 5I1GH 4CVZB 1KN4H 5FYJD 3MLYH 1JI2A 2QSQA 5BOZG 4S1SL 3QJHB 3VXOB 3Q6FB 2FHCA 4MXQC 5L8LB 2X4OB 3KYOA 1AGFA 4N1EA 1HZHL 3MRDA 1KLGA 4HUVA 4PJEE 3V0WL 4AK1A 1GGBH 2VXVL 5D1ZA 2HA1A 5CJQH 5IW6B 3FMGH 3T65A 4L4JA 3O6FC 4OCWL 2VLRD 3KDMB 5IBUB 1A3RH 3PV6A 4KUZL 4OCYL 3FFDB 5KAQF 1DLFL 4JFFB 1MNUL 4LU5L 3S35H 1I9IH 3X13A 1SY6L 4TUJA 3ZLQC 4HUKB 4UIKH 3DIFB 2ENSA 4DAGL 3B3IB 4MB4A 4OZFG 4TVPH 5GPRA 4LGSB 4EOWH 1WUNT 2WIMA 4X0KA 4P3CL 1MCBA 4LNRA 3W0WB 1KJ2H 3O4OB 2H2PC 2VWEC 3L3OA 3RVUC 5ITFA 1LMKA 1T20B 2Q1EA 3JWDC 3NZHL 2O5YL 4QT5A 1QEWB 1K4CA 4UU9B 4UIMB 2FX9H 1XH3B 2YBRB 5BV7C 4CRPA 1GJIA 1XR8B 5DJCA 1YYLL 5B8CA 1W2KT 4HD9A 2GIYA 3RIFK 5B3JE 4Q0XH 5IMKA 3VJ6B 3BZFA 32C2B 4P5TC 3KPSA 1CR9H 3RVVD 4MJ5A 3DVGB 1SJEA 1IQWL 3BKML 4FFZH 5EOTA 4D0DB 3PG2A 5JZ7D 3RI5K 7CGTA 5SV3A 5I1IL 1S5IL 3CVIL 4LOUD 3VWKC 3D85D 4XVJL 4J12A 5HHVL 2ICWI 3DETD 3WSQH 3UBXB 3TH3T 2NTSP 1XF3A 4QHUA 3O11B 2H45A 3WUWG 3BJ91 1XCQA 1BOGA 1NL0H 2VLKA 3JV6B 4YHPB 3MLUH 3FRPG 1A21A 2QQKH 3TJHA 3L7FA 1H3PL 3ZTNL 3F6IA 4N90E 5DVMA 3O4LD 4PTUA 1RHHA 3BIKA 1Q9KB 5KVEL 1N6QH 4I48B 5D72L 2B7DT 1OAUH 2BRRL 4WV1A 3KPPB 3GGWA 3TNMB 5GJTH 3FT2B 5E9DE 3FT4A 1NSNL 4RISH 3HFML 4JO2H 5D1XC 4BH8B 1NBQA 3LRHA 2W65B 3TBTB 5CIPA 1WLHA 5FCUH 3WLWC 5I8CB 3EO9H 3OKMB 4U0RC 3EDEA 2FBJH 1L0YA 2IH3A 5E08H 4PS4H 3SKNB 3UYOD 1NC2A 1QP1A 1S8DB 4GQ9H 5C3LD 1B0RA 2FWOA 3TO4C 3RX7A 2R2BB 5AYUL 3SE8H 1LK2B 3A67H 3AROA 3RPIB 1TJGL 1FSKB 4FXGB 1RZ8A 1U8OB 4X4ZA 4O5LH 3V0VA 2WIIB 4U6HB 1RMFL 1U3ZA 2Z0BA 3AC0A 4JFHD 4M48L 1OVZA 4Y88A 3I50H 4UBDD 1JHKH 1IC7H 4JQXC 4L5FL 5T3XL 1D9KC 1CD0A 1MRFH 4IS6A 2YD6A 3DNKA 4J8RB 3JTTB 3MBEA 3CDYA 4Z6AT 2FJFB 3BKCH 1DQDL 3E8UH 2IG2L 4NQXB 5EORH 2V2TA 1EFXD 3IJHB 3EFFB 3EIFA 1D6EB 4NQCE 5ADPH 4Y5XB 2ARJQ 2OTWB 4HWBA 3QUMH 1R5IB 2YSSA 1GC1L 3G9VA 5M95B 5E6ID 1NUGA 3BX7C 4ZFOB 5IB2A 1S7TA 2AEPH 1GCFA 2PR4L 1D6VH 2JTDA 1UXWB 4GSDL 4N68A 5C0CA 3DYMA 3RGVD 1B88A 3HS0B 3DX9B 4WFHE 3U82B 3BPLB 2EZ0D 5HYQB 8CGTA 3DUHA 5EIIA 3STLB 4ZNEA 3T0DA 1U95A 2NW3B 2NY0D 4LLVB 2Q86B 5C0DA 3MJ8B 5C0RL 5TH2B 5LGHH 2ZSVB 3JTSB 4ZQKA 5IMLB 3QIBD 1X5ZA 1B4RA 4ZS6C 1I8KB 5J11C 1NKOA 2VXQL 2YMXL 4PGEB 4R90L 3HC0B 2BSSA 5EUOA 1SHMA 4Y4HA 1E4JA 1XAUA 1VGKB 3U0PA 2P5EE 4KRMB 4O51A 1N64H 2ZSWA 4HWEH 4FQCL 2HT2D 5GZOD 5C0BD 2HJKB 1S5HB 5IHBA 1E28B 4L9LB 4HWUA 4YPJA 2PXYD 1LK3L 3H2WA 4FQQA 3K80A 4JQIL 3IGAA 4S1SH 4WTZG 4H20L 3CLFL 1JGDA 4ONGH 3CDGA 4GKSB 1TVBB 1UQSA 2WP3O 3WNLA 3VRJB 1QHPA 4MNQD 2RBLA 2PTTB 4FG6D 3MGAA 3U6RA 2A6DB 2FYYA 3MGOA 1U2CA 3WIFB 5GSRA 2CRZA 3GI9L 1QFWL 3MOQA 4NP4L 1F00I 5CMAA 1NJ9B 4IEFB 5AZEH 4KHTL 4XCYB 3KJ6L 1GZPB 2V2XB 1DLFH 3HG1D 1WISA 1T3FB 5TQ0H 1SY6H 4LSQL 3LOWA 3WN5C 5K9OB 1BVKA 3T2PA 4G9DA 4KRLB 5HGAA 1P9MA 1P6FA 4RAHA 1A9EA 5F7FA 1JPTL 1U42A 4I0PC 2XKNB 1A4KA 3T2QA 4AM0A 3MMEB 5DR5L 4YNYB 4JRXB 4C56B 3QNZA 5HY9A 5I1HH 4JM2B 1V3KA 1IEBA 4KTEH 5AD0A 1AR1C 4P5KB 1P84K 3NZHH 2O5YH 2AJ3B 4KK9D 1U8MB 2EEDA 1OGTB 2JELH 2X1QA 1OF2A 3KPRD 4PTTB 5FYKU 4FFEX 2CGRL 1JN6A 3H42H 5L88L 1YYLH 2HKFH 3SKJH 2OP4L 4QOKB 5HHXL 4KROC 1OCWL 4JRYB 1U9KA 5IFJB 1ODAA 3A6OA 1MLBA 2HVJB 5EBMB 4NJAL 3NN8B 5HYIA 4HFUL 5JIPA 1CFQB 3IDJA 2YRPA 3GJFB 3LKOB 3I6LD 35C8L 1NCDL 1P7QD 5I1IH 1S5IH 1XEDA 5F7MC 3ARFC 1PLGL 4JDZA 3VFPA 3VGGA 1HHIB 4XVJH 3G9AB 1EGJA 4OCXL 3JV5A 1AKJD 1JNHB 4DCQB 3BOVA 5MEQA 3ULVF 2ICEA 1NBZB 3V79C 4GMSH 4PIRF 3PABB 3TF7C 2H32H 3SE4C 3C60B 4HJGB 3TCLA 4JN2B 4AEIH 1K9TA 4Z7WB 1EV2E 3SBWC 2UV3A 4PJXE 2GSGB 3ZTNH 2BSRA 4UI2A 1G7LA 4R0LA 2DKSA 2DQFA 1HQRA 3VWJA 1DVFA 5D72H 4ODTL 1CE6B 3F5WB 1F4XH 1G6RH 4U33A 5GGVY 2BRRH 3VFOA 1OPGH 4U7SA 1S7WB 1A1OA 1TCMA 2XWTB 3DIFA 2H6PA 1NSNH 2KH2B 1HXMB 2EKSB 1NAKH 4YJZL 3MLTB 3TA3B 4K7FB 1ES0B 3ERYA 1FFQA 1M1SA 1DDHB 1W0WB 3SJVB 4UV7L 4NWTH 3WIHL 1N6UA 2DLHA 3WKML 4Y4FC 3WO4C 2ED9A 3RWHB 2VUOA 1OARL 4RWYL 3K81A 3ZDZF 1WC7B 1LO4L 5ETUA 1TJHL 2YBRA 4MWFB 5DGQA 1KIPA 3Q2CA 1IAOB 1DTUA 1FAIL 1FL3B 3OKDB 1MCPL 1H3VA 5HYSA 2JKXA 3KXFB 5AYUH 3VXSA 1F2QA 4JFQB 5A1AA 2DLIA 2EYTA 1GGIL 1TJGH 2R2HB 2NR6C 4P2QB 3UTSE 3E0GA 3OWEA 4PY8J 2HFTA 3I3DA 3O81A 1T83C 1S7XA 4ZXBA 3NACH 2D03L 4R3SB 1DANT 2RQ8A 4L3CA 1HEZA 3P11H 2G9HB 3REVA 1OW0C 4X6BB 4M48H 3UTZB 5GGTH 4L5FH 1G7QB 5FM5M 2GCYB 2BVQA 5T3XH 2F19L 1FGVL 5CP3A 4PJCA 1EFQA 5CLWA 3D39B 1IVLA 1DQDH 2VN7A 2IG2H 4YHZH 5SWQA 2JE8A 2R69L 3BVNB 2J8UB 1R6VA 1X3DA 4PGJA 3H8NA 4X5LA 1TZHB 1GC1H 4G8GE 4C4KO 4N90D 3JWDL 3M17B 3GMQA 3DV6A 5BV7L 3KWWA 2X6MA 2PR4H 4RMUA 4U2YA 3V6OA 4GSDH 4GQPH 4I48A 3DLQR 2VTFA 1T22A 3ARBC 4L1HA 4OUUB 1FN4B 3E3QE 3N85H 3FFCA 1LEGA 2W60A 1E6JL 3QDGA 5EN2B 5E9DD 3PJSB 1I1AB 4PJ8A 3L3JB 3Q0HA 4F9PA 3V95A 1E27A 1PKOA 5D2NC 5C0RH 2E9WA 3NAAL 4AIZB 4Y1AE 4WFEE 3GSNL 1NMCB 2E7CA 3S5LB 1RVFH 3GEWB 3OKMA 2WW8A 4OJFL 4XXDA 1PKQA 1U8LA 2Z31D 4AYFA 2YMXH 5B38G 3K4ZA 4G6FB 1S8DA 4I18B 4JPWL 1QR4A 1FNGA 3BPOC 4CVXB 5FK9A 2FH6A 4G8IA 2Y5TA 2M8XA 1QSEA 4FQCH 4OIIH 3RL1B 3SDXB 4WRLA 1LK2A 3EO1A 2O26U 1F4WL 2ARJB 4IRJD 2D9CA 2AEWA 5J3HC 3PGFL 1ZLUK 2D7MA 3Q5TA 2I25N 1HWGB 1A6TA 3O2WL 5EIQA 1HHJB 1D3CA 1TLKA 4JHAL 2HMID 4HKZA 1H15A 4H20H 3CLFH 5TDNB 3TIEB 5HI5C 5CINL 4XBEL 4TYUA 3X14A 3BMVA 4M93B 5HVGB 3QAZB 3SQBA 4XNQA 1RIVL 4NFDA 3JTTA 3GI9H 1SBBA 2R8SH 1KCVL 4IBLT 3QPXH 3D48R 3BPCA 3RWFB 4NP4H 4XAKE 2IAMC 4LVNB 4NCC1 4KHTH 4Z0XB 4UDTA 1Q0YL 3EJJX 4B7IA 3IJHA 4NQCD 4AENB 3KYKL 4NZDA 5DRWB 4LSQH 4PP1C 4Y5YA 4LLDA 1XGPA 2CLRB 3R06B 1BQHB 3ULUH 3BP4B 3B6SB 3LIZH 1JPTH 2MCG1 2ARWA 1NANI 4JR9L 4WFHD 1T0NA 3T3PE 3AREB 4ORGA 3T8XA 3DRTB 1WITA 3EZJB 4M7ZB 4KKNA 3HNVL 4M4RA 3FCTA 3N1QC 3H6JA 3QG6A 3GUTB 3O2DA 2VQUA 2JCCB 4MMZC 3MJ8A 3DX8B 5TH2A 5DMKB 5E2UH 3TWCL 3TPUB 5C0AB 3KPSE 4PG2C 1NAMB 3NCYP 4IRSB 4X9GA 4F37K 3O2VL 3C08L 5L88H 1CS6A 4ALAL 5BCAA 4K71C 1G7IB 3IDIB 5HHXH 1OCWH 3MLVL 5I2IA 5J7CC 1ETZA 1IC1A 1TNNA 1A7NL 1HN1A 4X4YA 2BJML 5E1AA 3BWUC 4NJAH 1WSST 5C71A 4EXKA 4PJIA 1WWCA 3BHBB 3ARYA 2P7TB 2P5ED 1IM9B 5ALBL 3QXWA 4Y8DC 2V2WA 3K4DA 1NCDH 1ZS8B 4U1MA 5T1KB 3HRPA 1QRKA 2X4SA 1N26A 5JMRA 4HH9B 5GS1C 5EG6C 1K2DB 4IMKA 3RY4A 3AB0C 3QIUB 4EI5C 1G7PB 5SX4H 3V6ZB 4OCXH 4LQ1A 2VLKE 1G7HB 3EJZC 4JKPH 1I1YA 3VGAB 2IBBA 4C83A 4JFDD 1KFAL 5GSVA 4K3HA 4MZ3A 2X4PB 4LKCB 3EBAA 2Z8RA 1DLHB 3L3KA 1E6OL 2DM2A 1RU9L 1KPVB 3BIBX 4X9FA 5AYQA 4UT6L 3FRUA 4F7EA 1B9ZA 3OB0K 5HHOB 5FXCH 4ODTH 3S36X 3EOAB 3BO8A 2N56A 4UQ2A 3MV7D 3B5TA 1DE4A 1S9YB 3IJYB 3QNXA 3MRBB 2VLLB 4QHNB 1MJUL 2RCSL 4U49A 2MFNA 3BEWA 1I3RB 1PG7X 2LVEA 5IQ7H 2C1OA 3JVGA 1LO3L 4K55A 4UV7H 3WIHH 3TBWA 3KYNA 2XKNA 3WKMH 4I0CC 1CGVA 4FQJL 1OARH 3VH8A 2A9NL 4LCWA 4RWYH 1INQA 5DJAB 4I5BB 1HNFA 2FSEB 5DK3A 1U8MA 1TJHH 2YC1A 3T1FA 3PHOB 1ZLWH 3D25A 4G7YL 1PDKA 3VGEA 3S9DB 1MCPH 5DJXA 4TSAL 4JY5L 1NBYB 4L3ED 1GGIH 2NY4C 4Z7WF 1C7TA 1W72L 1LO5A 2DIAA 2AW2A 1CG9B 3RL2A 3I9GL 2UZIH 4NN5C 1RFDH 3GMRA 4M7KH 3QEHA 5DURD 2BNRB 2DIBA 1NCUA 2NLJB 2BCKA 2BVEA 2BNUB 2F8OA 5DYOA 1FGVH 1ULVA 1MLCA 3DI3B 3OB8A 2W59A 4KZEL 3FO1B 5J89A 5I16A 4P23D 2P8PA 3MQIA 3VMNA 3DHJA 5FHAL 4HJGA 2Q76B 5T1LA 3PWNB 3GSWA 5JXEA 3ZSSA 5DD6B 3E1F1 5C0CE 3MV9B 3JWDH 3ARGD 3B43A 3FONB 3FQWB 2VLJB 2H41A 4BSWB 4ZNEE 1CE6A 3G5YA 1Q8MA 4PR5B 1E6JH 1AQDB 5CJXA 5EO9B 2EKSA 5EO1A 3QFDA 2CKBA 1UZ8B 4K7FA 4M61B 1WICA 4EUPA 3RVWC 5C08B 1DDHA 3NAAH 2FATL 4KK6D 3QR2A 5KTEL 1NGXB 3RWGB 5EUOE 2XTJC 4TUOA 3GSNH 1MH5A 1BAFL 3HZYA 1BIHA 2F58H 4RZCA 4N8VG 1MIEH 1WC7A 3E6FA 5DC9B 5FHBL 4JPWH 1NGZB 4OKVA 2R1YB 3NIFF 4Y2DD 1GGYA 4LCYA 3S6CA 1KBGH 4RMTA 2Z8VC 1F58H 3TPKA 1F4WH 3UJTL 2J8UF 3UTSD 4P2YA 1WTLA 3PP4L 3GIZH 3PGFH 1HHHB 4X9IA 5CILL 1PW3A 5DC4B 3O2WH 4XPAL 2KDGA 1VB9A 1AIFB 2QHLA 4ZYKB 5LQBL 3BMWA 3HI1A 5CINH 5E00B 3T0EB 2PO6D 3ZYOA 2IMMA 1RIVH 1U8IB 1F97A 2NY0C 4XBGB 3C6LA 5FYLE 3LQAC 1B0GB 2ZJSL 2NZ9C 3QCVL 4U4BA 3SDYL 1MELA 3MREB 3N1MC 4K07A 4BZ2L 1X4ZA 2YUVA 3CVHA 1DVFC 3O9WA 3BVNA 1S9WB 3KYKH 4WENB 3TC9A 4G8GD 1GZQB 2NY6B 3DXAB 1PEZA 4KFZC 4OF7A 1C5DB 1Q38A 1CFSA 1A6ZA 4LPWA 3OKYA 5FO8A 4HULB 1DBBL 4HCRA 4PP2B 4MA1C 2H9GA 1QFWI 3SDXF 4U6XB 3QSKB 1MJ8L 1QLEL 2BDNL 4RRPG 1I1RA 3ZKND 2D9QB 1R5WB 2DYPA 3ETBF 3HNVH 3V6FB 3L3JA 4D9QE 3QIWD 2Y06H 4NOFA 4U31A 3PP3K 3G6AA 1AXSB 3TWCH 4Y1AD 1UA6H 4WFED 4ONFL 2XWBA 3O2VH 4EN3C 1XIWA 1JP5A 4H25A 3TO2A 3DTXA 3MLVH 4P3DB 3U7YL 4L8SA 1ZOXA 1A7NH 2OJZH 2ZOLA 1LE5B 3QDMA 2BJMH 4HS6A 3RTQB 3PWLA 1UKSA 2ZCHL 5HVHB 3NH7L 2AJZA 3SE3C 4F7PB 1CIDA 4ZOBA 5BS0A 3ARXA 1FFOA 1I8IB 3FB7A 3C09C 3VI4F 1Q1JL 2B8OT 2FZ3B 2LU4A 2EDRA 1BFSA 1HHJA 1I7UB 3HR5B 1R3LB 3PWVB 5K33A 1F4HA 3JTCA 3OTTA 5ICXA 1KFAH 5D96B 5EOCH 4PGCB 4Y0GA 3RDTB 1ZK9A 3WL9B 3SCMB 5H35B 4NN7B 1RU9H 1BJ8A 1NDGA 3BYYA 1JYNA 1JPSL 4UT6H 2Q8BH 2JCCF 1F11B 4RGOH 5IIEB 1FYHB 5DMJB 5JPMB 1MCKA 1UM6L 3QNYA 4LSVL 1ZT4B 5SX5H 4XWOC 1QYGL 4GG6A 4AENA 3H7BB 3T77A 3BP6B 2VXSL 4M6NL 4YWGL 3UDWA 1KC5H 1P4LA 2NQCA 1RZKC 2HWZL 2HYMA 3CH1A 1ZT1B 1MJUH 1IGFL 2RCSH 5CJBA 5K9KB 5HBBA 3BP4A 3OHXA 1ZVSB 4OLZL 3CUPB 5I75B 1LO3H 4S1DC 5DQDL 3O3AA 4YBQD 2CH8A 4J6RH 5CBAA 5IMMB 2P24A 3KPTA 2J6EL 1J9CT 4W70A 4FQJH 1T04A 2A9NH 3BZEB 3GUTA 4RFEB 4Q2ZA 3VXSE 3OKNB 4XCCL 3NCJL 5EBWB 4KXZH 3QQ3B 5EC1A 1CGTA 3KPSD 3LKSA 3E6HB 4Z7NE 4P5MB 3O3EA 4V1DB 3T4AB 4YO0B 4BQCA 4JY5H 1S7VB 2UWEF 3MNWA 3EOTL 3U83A 3UEZA 3P77B 4GRLB 2J8HA 4Y89A 1QRNB 4NC0B 1P1ZB 2OZ4L 4TQEL 5I76B 3OXRA 2RFXB 3D2UD 4PJCE 2CUIA 4GS7C 5T1KA 2ERJC 3HE6C 4P48A 4PBXA 1NKRA 3IDYB 1F6AB 5E94B 1LNUB 5EU6B 3CX2A 3B83A 3QA3B 3V7MA 4J1UA 4DKEL 3GSOB 5F71A 3EDKA 3MV11 1TNMA 2XI9A 4G59A 4G9FA 3TJHD 2XZQL 4POYA 4KZEH 3LB6D 4J3SA 1FZJB 4XB7A 2PYFA 2DLFL 3WHXB 1DUYB 4P4KB 2UWEA 3V6OE 1KPVA 3WIIL 4QXTB 3Q3GA 2ZKHL 3FFCE 3LMJL 3QDGE 3U0WL 2ESVA 4HJ0C 1G9NC 2FIKB 2HN7B 1X7QB 3KPMB 2KUTA 3HCVA 2C3HA 4FP8L 4XZUA 4PJFA 4XH2B 4MJIA 1PKQE 3MNZA 2GJ6D 4JVPA 2A1WL 4K9EC 1B6DA 2FATH 5CEXA 1U3HC 1T6WA 5DJYA 4DGIL 5KTEH 1NC2D 2W38A 2EIEA 3RNQA 1C12A 2P5WB 3EYVA 5DGRA 1BAFH 1N2RA 1NLDL 5KSBB 2X4NB 4LKXA 4PV8A 1AI1L 1IGTB 1QSEE 4I5BA 1N3NA 2EXWC 1UWEL 4NNYA 2UVFA 3MUGA 1NFIA 4PJ7B 3ZE1E 2J5LB 1CXEA 1RJCA 4RBPH 5KOMC 1S7UB 4D3CL 2CXKA 4G43A 2WWKO 1KTRL 3NCCB 1ZA6A 4JPKL 3UJTH 4NJ9L 4H26B 1YY9D 1GGCH 5C6TH 3GBNL 1FNFA 3FB6B 5ESVB 1NGYA 5FGRA 2I07B 4XPAH 3O6LL 5JPNB 2VZ1A 5CWSA 1FNAA 4PJ9A 1WFOA 1DBMH 5LQBH 4CNIB 3EYOB 3MFFA 1G6VK 4XXCC 1JNNH 5E6YA 1XGQB 3LKRB 1BQLL 3MLSL 3B9KC 2YPLA 1HSAA 1TMCA 4UAOB 4R2GD 4HUWB 2LAGB 5ID1A 5IKCB 2ZJSH 3GHEL 3QCVH 1UENA 4OGAD 1F8TL 2EE2A 3M1BA 5F7LB 5C0CD 5EIVA 1I8LC 2Z91B 3IKCB 5DVLA 3OKLA 1BWMA 2HKHH 3BE1H 1CGSL 1NMBL 2HFFB 5HYJA 4MJ6B 1DBBH 4LP4A 3QCTL 4KK5D 1MWAH 1KTLA 1Z0MA 1MJ8H 1QLEH 5I17B 1AQDA 3GIVA 5CBEA 1FO0A 5I6XC 4ZNCD 5JA8B 4WO4C 4LHUG 2CDEB 4UTAL 3GB7A 3H9HB 4OZIB 2HP4A 3PGCB 4KQ4L 5EU5B 1NGXA 1EHNA 3WD5L 1ORQB 4ONFH 4QHMA 1CDYA 2WWMC 3FQNB 4Y4HD 4EIZC 4PJIE 3RFZC 1NDMB 4BFIB 4RGNB 5CHNA 3V52L 4OGYL 3MRKB 3U7YH 1A0QL 1G7JB 1GOGA 3LQMA 3F7VB 3OG4B 1TPXC 1KCSL 3KPLA 3NFSL 4NKOB 1JTPA 4MQSB 5I18L 1EEZB 2GK0B 5IUSA 3NH7H 2ADIA 3AUVA 3BN9C 5H94A 5KJRL 2V5YA 1Q1JH 2QQLL 4JZJB 3C6SA 4F7CB 3PWJB 5C09A 2H2SC 4KKLC 1TXKA 1AIFA 2NY5C 4RMVA 1KJVA 4XNZB 1XCTA 3BQUB 3MOBL 2VO5A 4KAQH 4DEPC 4HPYL 3FQTA 4ZUSA 4KI5F 3NGBC 4OGXL 1UCTA 1JPSH 4QRRD 4RMSA 5E2TL 5FYLD 2BC4A 5MERB 1YDPA 4K7PY 1UM6H 2MTPA 1DUZA 4WWKC 3MREA 2YUZA 4LSVH 4MA3B 1VCAA 5E0QA 4DFHA 4K3DH 5KSVB 3QI9B 1S9WA 2BSTB 1IZKA 4M6NH 5GIRB 2X7LB 4YWGH 3QQ4B 5MI0C 4MVBA 2HWZH 1NGWB 5JDSB 2B2XH 2J7LA 4JRWA 4LCWE 2C1PA 1CL7L 4FS0A 3GSVA 2J6EH 5HHNB 5I1DA 4MAYA 1A6AB 4ZDHB 3QXTA 3KNBB 4ZUUA 1MCFA 3OAYH 1SJHA 4JFOB 5GRUL 4G8FA 3IAPA 1ED3A 1VADA 3AMLA 1AXSA 4JKWA 1A64A 4PY8I 5DJ6B 2EYSA 2CUMA 4F9LC 3RJDA 2IF7A 4JHBA 2PKDA 2R1XB 5CZVH 3REWA 5D7LA 4YEFA 1OGAA 3ALPA 3AM8C 3P4MA 5DVNA 3EOTH 2NNAA 4O02L 4PRIB 4PGDA 2OBGA 4LCCB 4XNUH 3MJ6A 5D7JC 3GSXB 3LKPB 2XFXA 3QZWB 3GHBL 4JCMA 4NN6C 2OZ4H 4TQEH 3LQAL 2FJGB 3GMOA 5DO2D 5TPWH 3CK0L 4F3FB 4IJ3B 1K4DA 5E5UB 4F7PA 3HRZB 1KNOA 1CDCA 1W0VB 4R4ND 4N5EC 1OQXA 2VJXA 4ZUWA 1A6VH 4HKBB 2IJ0C 4DKEH 4LEOB 5FO9A 3C9NB 4LLQA 3S37L 5IEHB 3G6JB 3MRMB 1R3LA 1N5AA 5IOPB 4YZFF 2XZQH 5DJDB 3RY5A 4X9HA 3DRQB 1QFWM 2P45B 4JG0L 5DC0A 5C9KA 1LE9B 5AWNL 1KOAA 3DURB 5C1MB 3GSUB 3RKDC 3VWJD 5E24E 3STBA 1FVDB 5FYJH 2ZKHH 3V5DA 3LMJH 5B4MC 3U0WH 1MOEA 1KLUB 4HHAB 4CDHA 2JJUA 3H7BA 4Y5VC 1HDMB 1TFHA 3SJVE 4FP8H 4WW1A 2VR5A 4OD1L 5F1IA 4PLNC 1JF1A 3RVXC 2ICWA 1KB5L 1ZT1A 4JFYB 4P9MH 4KRPC 5B22A 4WUKL 2A1WH 5A16A 4L8BA 4GXVH 2F5AL 3MYZA 3QQNA 1YNLH 4OCSL 2Q7YA 4DGIH 5BMFL 5IMMA 1YPZA 4NKDA 3JWNC 1A6UH 5DEFA 1NLDH 4HXBL 1RAMA 3GJEB 5IR1B 1AI1H 1RULL 2N1KA 4MNGB 4RFEA 4D94A 1DCLA 3VXSD 4Q9BA 4XCEB 5EBWA 5IT2H 4YXHL 5E4IA 4XP6H 3O6KL 3ROOB 1UEYA 4ZXBD 4V1DA 1R3KB 4D3CH 1CYGA 5DUML 1BZQK 2ZOKB 4WNQA 1P4IH 5L0QC 4JPKH 2A9ML 2E6PA 3ARDA 3SO5A 4CMHC 4XRCA 3PL6C 5KW9L 5BXFA 4UTBL 1P1ZA 3W5NA 3O6LH 4RQQA 1YY8A 3FT3B 5TQ2L 5E5RB 3BGAA 2X05A 5D1QA 3G08B 3L6FB 4UB0L 3PWPB 1SM3H 5FDWB 4QRSA 3SDCB 1MCOL 4MA7L 4HBCH 5JLZA 3MLSH 5GZND 3GSOA 1RZKL 3SGDH 2EH7L 3GMLB 5J9PA 3ISWA 1QLRB 1KF9B 1FNLA 1VEMA 1NMAH 1H5BC 3HUJB 1VENA 1S7SB 4QHLB 3GBML 1EAPB 1FZJA 3MRPA 3T0XA 1MHCA 1U93B 3GHEH 3QBTB 5D7IA 4BFEA 4F15C 1I3GL 1F8TH 2AQ1A 2JB6B 3MRGB 5KSBF 5DMIL 3T2NL 1CICA 2V5MA 2N7BA 1Z0NA 4BQ9A 2BVPA 3FFCD 3TZVA 1CBVL 1GIGL 1NEZA 1CGSH 1JJUA 3QDGD 1A2YA 1BQSA 1NMBH 3LS4L 4R97B 1X5YA 1L9MA 4PJ8D 4PJ7F 1OT2A 1EO5A 2DQIL 2OCFD 4K7PX 5TE7H 1N59A 2FIKA 2HN7A 1MHHA 1IT9L 1N0XL 3DSFH 4QWWC 4URTB 4U1LA 3F6LA 4WW2C 4N9OB 3P9MA 3RWEB 1DEEB 4XH2A 3R8QA 3SGKC 3B8SA 4G42A 1OP5H 2DF3A 4O2EB 4UTAH 1YA5A 3QDME 1JTOA 4ZFFB 4GT7A 4Y4KA 3WD5H 3P4LA 2P5WA 1Z6JT 3HZVB 3V52H 5KSBA 4OGYH 1A0QH 4ISVB 1G9EA 5IK3B 1RJLB 2V9RA 1KCSH 3NFSH 5BS0E 3L3IB 3U79A 2EDFA 5I18H 4ODUB 5M7QA 3X3FH 5SWZA 3AMKA 2X4RB 3C8HA 1S7UA 1Y18B 3S4SB 2K7PA 5IG7B 2AI0L 4YDKL 2X9YA 1N4XL 5KJRH 5E5MA 1PGRB 2XZCL 5ESVA 4AL8L 2CSPA 3N06B 43C9A 2IADB 1AXTL 1P69B 1G9NL 2VABA 1RZFL 3UPRA 2PETA 1CLCA 1N7ML 5I1KL 2YD1A 3ZKNC 4LLMB 3RIFF 2OTUA 2HTKC 4P57B 4N0UB 4GG6E 1CGWA 3TFKA 4K9EL 4OZIF 3W81A 3CFEA 4Z8FL 4LPYA 1B0WA 2EDXA 5DMGD 3VXPB 4D9LH 3RI5F 1FL5B 3QWOB 5J1AB 2OI9B 1MFCH 1HILA 4JREB 4MCYA 2QQNL 3UAJC 2OK0L 3DO7B 3P4OB 1MCSA 1PYWA 4MJ6A 4WEMB 5HPMA 4O9HL 4QLRA 5F9JB 1UGNA 3IRZA 1D5BA 4D2NA 1X5KA 3DBXB 3TPUE 5DHVH 3VFNA 4O00A 2HFEA 3F7QA 1V7MH 4JJHA 4TN9A 4LARL 3UX9B 3OX8A 3TBYA 2OTPA 4JFPB 3QHTC 4ZAKB 5HI4D 4OI9A 3CMOL 1FIEA 5MEOB 3FQNA 3I84A 1CLOH 1FP5A 3O4LB 4NQDA 3U36A 3NA4A 2OQJB 2XY2A 3QH3A 3LD8B 4XGZB 2W1NA 3TN0A 2XG4A 5AAMA 4O02H 3ALXA 3KR3L 5I19L 5E8OA 1HK6A 5B39G 1WF5A 1LO0L 3LQAH 3ORJA 2CIIA 3MYJB 3CK0H 3FN0H 4G6AC 5EWIH 5SWSA 4GRMA 4G9FE 1NC4B 1RZ7L 1XGTA 2CK0L 2WV3A 1AD0A 4XPHL 3BGFB 2DB8A 3K8LA 2HFGL 3VXMA 3S37H 3MRJB 4CGTA 3BXNA 5E4EB 5DFWH 2UWEE 4MS8A 1EEYB 4FTVA 5JO5A 3O3DA 1TZGL 3MRLA 4YC2C 1L4IA 4RAVB 1T5WB 5CUSL 2ESVE 1SMAA 2KKQA 1LD9B 3OG6B 1AO7B 5GS0D 3CLEL 3ARRA 4JE4B 5JR1L 1KJ2A 2IQ9H 4LSPH 3QG7L 3FKUS 2VZTA 4MA3A 1IFHH 1ORSB 3LKNB 4M62L 4PJFE 4MJIE 5KSVA 4EDXA 5TDPB 3CSPA 3KLDA 5ABDE 3KYAA 3I75B 3JXAA 1QQDB 1QSZA 2JIXB 4V3DB 1KB5H 4JRXD 4DW2L 4OAWB 3C8KB 4AT6B 5F3BA 4E5XA 1BZ9A 1K8DB 1IAIL 1ZKAA 3K8KA 1U3YA 4XMKL 5BMFH 1GHFL 1FL6B 1NUFA 5DSCA 5J8OA 1HQ4B 3RIAK 3V7AE 3RZCA 1FZOA 2UUDK 4HXBH 1YQ2A 4EVNA 2CJUL 4R96A 4QOKD 1EFXB 4KK8C 3G6JF 5JOFB 1T1WA 2C7UB 4TSBL 2NY5L 4YXHH 5KANG 5FUZL 3O6KH 5C0EA 5L9DH 4PRNA 2DD8L 2R1XA 2DWDB 5LAXB 4HMDA 2VITB 5JORA 4WGWB 1YUHB 1RSFA 2A9MH 4JN1L 1TQCB 5KW9H 4LCCA 4P46A 4YR6A 3I6GA 4UTBH 2OYPA 4U05A 4YAQB 1CXFA 5TQ2H 3NMEA 2YPLE 5ERWA 2IGFL 2WUCL 4LBEB 3CFJB 2W0FA 1ZHBB 1XMWA 2DS4A 4UOW1 5TFSL 3WUZA 4LDOB 3MJ9L 1UXSA 4MA7H 3QIBB 4LVOC 1RZKH 3C60D 1PY4A 2EH7H 3I02B 4IIQA 4N0YL 5FA4A 1BECA 5T1LD 5IEHA 1FORL 1INEL 5JXED 1IEHA 1RV6X 5IOPA 5DJDA 4XCNB 5KS9A 4NUJB 3GBMH 4WEUD 1LE9A 1I3GH 4OZFB 5HYJE 5DMIH 2WM0A 3T2NH 2ZG1A 4MQ7B 3O0RL 1T7XA 3BWAB 5IW1B 2CLZA 3C5ZA 3QQ9D 1CBVH 2VMFA 1CF8L 3LS4H 1ZT7A 4HS8L 1UJ3B 5L8JB 4ZMAT 4JPVH 3S8WA 2PXYB 2DQIH 3SGDI 1KEMH 3TA3D 2C3XA 1N0XH 5D7SH 2A74A 5EO0B 4BUHA 3SJVD 4OZ4B 3WCYA 1YN7B 5DFVD 4M02A 3IAGC 2O5XL 3TYFB 3LEYH 2NXZB 3FOLA 1CGYA 1EEUA 3L5IA 3FQRB 4YHNB 4F7MA 3B2UC 4Z95L 3VXQB 5CJ8A 4CN6A 2DM4A 4MNGA 3QDJA 4MXVF 5E8EA 5TDOA 5KSAB 1YN6B 2F53A 5I1JL 1T0PB 2J8OA 3HUJF 2FNBA 3ROOA 3TVMC 2G75B 4U7KA 2ADFL 2WLZA 4XX1E 1MREL 4YDKH 4O2CA 1N4XH 3RY6C 4G8EB 1AC0A 1BVZA 4FQXA 5BRZB 3J7HA 4O58H 2XZCH 3D5OF 2DTSA 2ORBH 4JFXB 1BBDH 2DWEA 1AXTH 1J18A 4P2OC 5D2LF 4HF5L 5FO7A 1G9NH 1JMXA 3QUMA 1RZFH 3C6LD 1N7MH 5I1KH 3UPCA 3FQXB 4X6CB 2YPKB 3GMLA 4PJAB 3O9WD 4YHIA 3DYPA 4IOFD 4PJ5B 2CUHA 2HLAB 2AKRB 1TITA 4K9EH 4Z8FH 4F7TA 1LP9B 2VAAB 3QRGH 3V7AG 4XPFL 3MRHA 5JHDA 4HC1L 3MRGA 4JVUA 5C86A 5HHQB 3C87A 1P7QB 1EVTC 1JV5B 3MRNB 2W07A 1ONQB 2QQNH 4BZ1L 4L8DA 2OK0H 5F89A 3R1GL 4J2XA 1ZSDB 3WMSA 5D2LA 4XAWL 1AKJB 4O9HH 2AJXL 4B41A 5F3HB 1YQVL 4ODXA 2GK2A 2OMBA 3L7EB 3RGHA 4GBXB 2NY1B 3MGTB 3ZMRA 1XIWD 4LARH 4PJEB 3RWEA 4D0CA 3LRGA 5D7LE 2HJLA 4Q9QH 2JF1A 5GRXG 1OGAE 1M71A 5F7KC 1I7RA 3QDMD 4J4PC 2CMRL 3CMOH 3K2MC 2NX5A 1FFPA 2EECA 4QRQA 5IB1B 4OF3A 5EBLB 1V8HA 2APWA 5C2UB 1VERA 1J8HA 3V4UL 5KAQG 3FQUA 2VXTL 2FGWL 4HUUA 1NGPH 1TCRA 1UZ6F 1Q9OA 4NQTA 5CEZL 4NQVB 4GRWE 4HT1L 4GKNA 1CL7I 3KR3H 2RB8A 4KDWA 5BS0D 5I19H 2D7NA 3O8XC 4U1GB 2GTWA 4ODUA 3RRQA 3ARTA 4QKXB 4PRBB 4I2XA 5D1QC 1RZ7H 5JNYB 5AUMB 2R0ZH 4XTRD 5FCSH 5T5NF 3SDAA 2QL1A 4HWZB 2QBWA 2KL6A 12E8L 4ODWB 4XPHH 5EPMB 5J6HA 2HFGH 2J88H 2VSDA 3N9GH 4U3HA 4LRIC 4FFWD 1VACA 4LSSH 1SY6A 1TZGH 2XYCA 4Z7QF 4HMCA 2X1PA 2R4RL 1YEEL 5IFHH 1VFBB 3OXSA 4OB5L 1OAXL 1EBAA 3H9SA 3CLEH 2BVOB 4ZPVB 4DFIA 4YHML 3VFSA 1JHTB 3QG7H 1MCCA 3H9ZA 4HIEB 3WYRA 5EZJB 4M62H 1XR9A 4YZFE 3ZE2E 1TVHA 5I8OL 3IVKA 4OF5A 5EB9A 2FIRT 4L1DA 2Y07L 3TIDA 3WXWL 5C0IB 4N0CC 5DVOA 4DW2H 4CN4A 4YXLH 4KKCD 2EDKA 4ONHB 4LLWB 3QULA 3MRRA 1IAIH 3CD4A 4JO4L 4M8QA 4ODBD 1GHFH 3WS6A 3LQZA 1HCVA 5JW3L 4R4NC 2X89A 4IRSD 5DTFB 3V0AC 3HAEG 5FUCC 4V1DE 5TF0A 1J1PL 3BI9X 1DZBA 1N8ZA 3TV3L 2AV1B 1AY1H 3CFBA 5C07A 2NY5H 5IF0B 5MEOA 3QUZA 5FUZH 2GKIA 3MJ7B 3RU8H 4JLRA 2DD8H 4RMQA 1ZAGA 5GHWL 5I1CL 3VRLF 3WJJA 1IM9D 1EVUA 3KGRA 2ZWLT 3A6CH 3L3HB 4I77L 5C2BL 4NRYA 5CZXD 5T1KD 4DVRL 4JN1H 4YDVA 2H32A 1LEKA 2P1YA 1E4KA 5E9DB 4PFEA 5HHMA 3QIUD 3SY0B 3MXWL 2A6JA 4XP4H 3EJYC 2IGFH 2WUCH 3VXRA 3ULVC 1MCDA 3ZKXB 5TFSH 2H8PA 5ENWA 2WBJC 4P0DA 1ZLVH 4U3CA 3MJ9H 4AMKH 1U92B 5BV7B 4DJMA 1NFDA 5D7IE 3O4OC 3P4NA 4YH6A 1AQKH 3MRJA 2LAAA 1INEH 1G6RA 2F54A 2G5BA 2Z31B 3H0TA 3BP5B 5M94B 1ZXQA 3LS5L 4ESKA 5DZLA 4XI5C 2VZVA 3QUYA 4YUEL 3CDFA 4OZGA 5HD8C 1AP2B 3NZ8A 2I9TA 4IRJB 2HRLA 1AGCA 4HS8H 4U1JA 4YXKL 3CFDA 1ORSA 5KZCD 3QEUA 2HJFB 3FB8B 2ZNWA 2GUOA 5TDPA 1KT2B 2XICA 4LLYB 3IU3A 5HVFB 3IF1B 2VZSA 2P5WE 3MTRA 1IGYB 5KSBE 4AT6A 3JV4A 5EOQL 1K8DA 5EU3B 2O5XH 5DF0A 3WS3B 5IJVB 3NIGF 5FB8B 4OT1L 4GXUM 5INCB 4QRPA 1XFPA 4Z95H 2ZUVA 1FV1A 2XWJA 4GKOA 5I1JH 1A8JH 1OAZH 1Q94B 4FRWA 3UZQA 1KIQA 4L9DA 3W39B 5DRNB 4R4BB 2ADFH 4U1KB 3VRIA 4PRPA 1MREH 5D1XB 4PJ9D 1IC4L 1I85C 3AXLB 3HZKB 4QXGH 1MVUB 2BNRD 4X6DA 5FYKL 3VFRA 2WUBL 3OKEB 4ELMA 1I4FB 1XF4A 4KQ3L 2YPLD 2DQCH 4XMPL 5FGSA 5HI3C 2FEEL 3CFJA 4HF5H 2PW2A 3RWJA 1U58B 3D87B 3Q5YA 4LLUA 4LDLB 4QY8B 3TGXA 4ZUTA 1UM5L 1TJIL 4XPTL 3CDCA 4CVUA 3V5HA 1S78C 3W11D 3V4PL 1J0ZA 3DROA 4HC1H 2P5EB 1NCNA 5K59F 1I9EA 1WBXB 4HX1A 4MQ7A 4NOBA 5I1EH 3WV0A 3BWAA 2RGSA 1DSFL 2CDFA 5FYJU 4XBPA 4BZ1H 2V7NB 1FSKC 2MQ3A 5DK0A 1ZMYA 3ZO0A 5ICYA 4XAWH 4I4WB 3SKMB 4GG8A 2AJXH 1VPOL 4ZFZB 1YQVH 3LN5A 3SKOB 4HGKC 1U8JA 4NQDE 1SEBB 1YN7A 2R2EA 5HGBA 3L3DA 4BH7A 1YC8A 2O5ZL 5EC2A 2CMRH 1CFTB 5IWLC 2MCPH 1TZIA 2DKUA 4Z7UA 1I1FA 5A3ID 3MOAL 2FGWH 2VXTH 1CFNB 5CEZH 5LGKA 4X6CF 4PJAF 3DGGA 1JF6A 2AJYL 2IANA 3B9EA 3FN9A 4HT1H 4NC1E 4Y5XC 5SWSE 5DD5L 2QSVA 5IESH 5KG9B 3BZDA 4YDLB 2VDLH 4PB0H 2G75A 1LP9F 4ZSOA 3VXME 3O45B 1PQZA 1T89A 3QFJA 2VDRL 3RAJL 3EFDL 2DI7A 5KBNC 1JZ5A 4FTVE 25C8L 4KJQC 1EA9C 1KACB 3T0ED 4K94C 3WUWA 3BPLC 1YJDC 1JHLL 4TVPE 5J11B 2X9WA 2DBLH 3AY4C 5SV4A 3IDUA 2EDOA 4AY0A 3DV4B 1AR2A 2BMKA 2R0LL 4NO5B 1KTDB 1Y0LA 4PJAA 4M5ZL 4OB5H 1OAXH 4OBRA 2AKRA 1KPUB 1P2CB 3CPLB 3MNVA 4YHMH 3TBSB 2NY6D 3DXAD 3U4EA 2ITDB 4FMFA 3MUZ1 2A0LC 2VDQL 1G7MB 2GFBA 3ZKQD 4WFGE 4NQEA 5DJ0B 4ETQB 4LFHG 4M1DH 2Y07H 4APQA 1BREA 3GKWL 1L7TL 4L9LC 3WXWH 4H1LB 4MAYD 3HNSL 1ZSDA 2O61B 4A6YL 3D3VB 2EYRB 1MRDL 1ZANL 3BH8B 4GUPA 4P59H 4JO4H 2JB5H 2NW2A 1W72B 1LEIA 5DI8B 4TUKL 2G5RA 3JZ7A 2XQYG 4HQQH 3MGTA 2YN5A 5D7LD 3ZYJA 2BY0A 1OGAD 3G5ZB 3TV3H 5KVFL 4DN4L 3CXDL 4PJXB 5JOPE 2PYEA 1E4WH 3LN4B 4NHUB 3MROA 1FZMA 1MHEA 2O93L 2DLEA 3EHBD 1FIGL 4J7RA 5GHWH 5I1CH 3U48A 1J0HA 5C2BH 4I77H 3PGDA 4QTHB 1ZVYA 1MI5A 4X7SL 1IAII 5B3JF 1BQUA 4JAMB 4WI5A 2ITCA 2P48B 4JZNA 3QDHA 1F3JA 3MXWH 3BUYB 4PRBA 3QO1A 3B2VH 3CNKA 4ODHH 4XVSL 5GS3A 2YR3A 1TDQA 1D5ZB 5KS9E 2AJUH 4OV5B 1T6VN 3RDTD 1C1EH 4R26L 4PRAB 3SCMD 3U30C 5F88B 1JWUA 3GRWL 1KCUL 5GS2D 4JDVB 3UBXG 4JM2C 1XGUA 3LS5H 1IILE 5I66A 5E6ZA 2KQNA 3L3GB 1H3TA 5DK2B 1BLNB 4HMEA 4YUEH 3RP1A 1UVQA 3W9DB 2DKMA 4FOMA 4Y2DB 5IBTL 1JGEB 5F1KC 5GISL 5CZKA 4K8RD 2AXGB 3UCRA 3WIHA 5DQJB 1WT5A 4ZPVA 2A6IB 2YEZB 3PUCA 3ARFB 4IOIB 4WUUA 3ZKSD 1JHTA 1ZTXL 3X12B 2B4CC 3MR9B 4HIEA 5DWUL 4HZLB 3QJFA 4HDIB 1CXLA 1WFNA 2VDML 3PV7A 4YDJB 1RUKL 1IAMA 3DUUB 4MXQA 5CJOL 2ADJB 3QUKA 4MNHB 3BH9B 1A4JA 2PO6B 1NFKA 1HI6B 2EICA 5EOQH 4MNGE 3AAZB 3P40A 2F53E 4J23A 3ECBB 3O6FA 5D6CB 4OT1H 5IB4B 1KJ3L 1RIHL 4V1DD 1QOKA 2UYLA 5I8KL 3C60C 3U4BL 4POUB 4RDQF 3ULSA 1A7OL 4M4PA 3ARDD 2OL3B 4M6AA 4GRLD 3DMMA 3Q1SH 1QRND 3WXVL 1AGBA 4FQ2L 4NHCL 1J8KA 2X2YA 2VQ1B 1IC4H 4W68A 4GW4B 4QF1B 4WTZA 4PRHA 3HA0A 3EO0A 5FYKH 2L7JA 2WUBH 1R5VA 4MJ4A 3FAXA 1J0KA 3L5WA 3RX8A 2J4WL 3X3GL 5JTWA 4XC3L 1SYSA 4QCIA 4TSCL 3WE6B 1MCWM 3JSSA 5BZWA 1MUJB 5D70L 4Y1AB 1IAKA 3OJVC 2VXUH 5FA3A 2AJVL 5JHDE 1UM5H 5INDA 1CICD 4XPTH 1LO2L 2AJSL 1BF8A 1BX2A 3VFVA 4MQXD 1RUML 2EH8L 4S11A 4P5TA 1WIOA 3KLAA 1S9VB 4YLQT 2H26B 3B5HA 5ICZB 5D2LE 3PWUA 3UZVB 1AP2A 1VKXA 1IBGH 3KHOA 3MJGX 3OPZL 4GAYA 43CAA 3GSNA 4Z5RB 3KYOB 3VWKA 1AGFB 3O3BA 1IGCL 3MRDB 2XQBH 1VFMA 4HUVB 2XACC 3FB8A 1AFVL 5D1ZB 4LLYA 3T65B 2NX5E 4Y4KD 4X98A 2P5WD 3BKYL 3RWIA 3WO3B 3PV6B 4LASH 1J8HE 2A77L 3MUJA 5A40E 1DANU 3F65A 2O5ZH 4TTGA 2R4SH 5F72S 4FQIL 3ULVL 4TVSa 4TUJB 3X13B 2VL5A 1JUFA 5I9QB 1PZUB 1T5XA 5INCA 2GAZA 4PG9A 3HAEH 2NXYD 2MHAA 4I2XE 4G6JL 4X0KB 4EZMA 5I1AA 5D6DC 5DD5H 4WU5B 1O7VA 3AS3A 4LNRB 3HZMA 4N0FA 3UTTB 4Z78A 4U1KA 3L3OB 5DJ2A 5IHUH 4GAJL 5ITFB 5TGBA 1WWAX 5D1XA 2VDRH 3RAJH 3EFDH 2LU3A 3EOBA 25C8H 5D2NB 1IGJA 1BFVL 3HPLA 3K7UA 1G1YA 4I3SL 5DJCB 1I1AC 4CW1B 3QEQA 4HV8A 1UZ6E 5B8CB 5IVZA 1Y6NR 4Y16A 3PDDA 3STZA 5IMKB 2R15A 3BZFB 3H9SE 1UEMA 3TFKD 4OM0H 3KPSB 5ANMA 2E8ZA 5KANI 4MJ5B 1NMCC 2BERA 1SJEB 3TO4A 5EOTB 1K6QL 1L0XA 1A7QH 3BRDA 1HXYB 1KYOK 3GSQA 3QT2A 4PDCE 3JWOC 4I18C 2VDQH 3K1DA 1U6AL 5FECB 5CD5C 4OLVL 1JWSA 2LV4A 1KN4L 4OQ1A 1IJ9A 3MLYL 1KXVC 2AP2A 5LXGH 3AS2A 3B8YA 1XF3B 4OCLC 4QHUB 5BO1H 3BGMA 4YHYC 5CEYA 2E27H 1L7TH 4HWBH 4JQXA 4JVWA 3IU4L 3HNSH 5MP6L 1D9KA 4A6YH 2I5YL 2VLKB 1PZ5A 1RY7B 1YEJL 4WI4A 4HEPG 4CMMA 5CJQL 1JWMA 3L7FB 5C07E 4TUKH 3SKOA 5BJTA 1PY9A 4FFVC 4PTUB 1KIRB 1RHHB 4RGND 4PJHA 2XN9B 5J06A 3BIKB 3I85A 4M93C 3QAZC 5KVFH 3TN0D 4DN4H 3CXDH 4XP9H 2BY3A 4WV1B 3S35L 1I9IL 4HUXA 3LV3B 3GGWB 1I7TA 4HK0A 1FIGH 3FT4B 5HHME 1PJ9A 2WZPD 3IDGA 3Q6GL 3I2CL 4N1HB 3VXRE 4X7SH 2D0HA 5SWSD 5CIPB 4PJDA 3IKKA 2Z8SA 5F8QC 1KJ2L 1NFDE 4OF0A 4YFEA 5HYFA 4U3XA 2F54E 1V3MA 3DVNA 5EU7C 2IH3B 2P43B 3N1PC 1NC2B 1ZGLA 3ARWA 3CCHA 1B0RB 3X11A 1I7ZB 3AREC 2H1PH 4N8CL 2FWOB 4TVPD 3TT1L 4M7ZC 1P53A 3PHQA 4JCLA 3GRWH 5GRYA 3VFUA 4OZGE 4Q0XL 1AO7E 4LAQH 2YHGA 3TM6A 4IRSC 5IBTH 3IFLL 3V0VB 2EDWA 5GISH 4FFZL 4QRTA 2I26N 4J3VA 3MBXL 1JPGA 2OR9H 3UMTA 2YD4A 4NIKB 3TBSA 4PJXF 5EH1A 1ZTXH 4EI5B 3M07A 3PQYA 4WFGD 5L2KA 4D9RE 5DWUH 2IPTH 3WSQL 1N5YL 4IS6B 4GKZA 1NLBL 4RIRA 1RUKH 3MBEB 2KBGA 2HTLD 4E42A 5CJOH 1WBZA 3GBLA 3RZCD 1F3RB 1NCAH 3QIUC 4X6FA 4QRPE 3OAZK 4M7LL 1X5XA 2WAHA 2V2TB 4ZFOL 4R2GB 1ND0B 2YSSB 5B38A 1I8MA 5FKPA 3VGAC 5T3XE 2ZUQC 5E2VH 1RIHH 4K94L 3TYGL 3FZUD 5I8KH 2HT4D 4PRPE 1VA9A 5C0CB 1A7OH 2NYYC 3RUGF 5JOPD 2R1WA 3WN5A 1NH6A 4P46D 4NHUA 4X6DE 3WXVH 1AHWC 4ELME 2V6HA 5EIIB 1HHGA 4CJ0A 4FQ2H 2L7UA 3EYFA 1DQLL 1A3QA 1T89C 3MA7A 1U95B 1QG3A 3IJSA 1R3JB 1RIUL 4UT7H 3NIGE 5C0DB 5KOVC 1CDJA 4I0PA 3SHSA 5C0JA 5CSGA 4ZQKB 2B5IC 5FCUL 2P8LA 4HZAA 1SQ2N 1DQJA 2Y6SD 5IVXA 4RNRA 1WJ3A 1EO7A 2J4WH 3X3GH 3BIAX 2QSCL 4XC3H 4TSCH 4KKBD 4PS4L 5D70H 5EUOB 2BSSB 4OV5A 4GQ9L 4H0IA 4TTDD 3ULUC 3U0PB 4MB5A 2AJVH 3VA2C 2ZSWB 4DN3L 3RUGA 3FB5A 4XVTL 2A73A 3SE8L 1RUMH 2NY4B 2EH8H 3C5ZD 2ZNXA 5AG9A 1MFAH 4O5LL 4FHBD 3VFTA 4FQQB 2FEEI 4JFZL 3IGAB 3CDGB 2YEZA 3I50L 1UQSB 3ARFA 3IFPA 1JHKL 5T33H 1IC7L 4F57L 1F02I 3OR6A 3U6RB 1IQDA 2FYYB 1BBJA 1AFVH 1VFOA 4HDIA 5HGDA 2AV7B 5GSRB 2VLME 2VE6B 4Z76A 4LSTH 2APXA 3TF7A 3BKCL 2CKNA 4Z7UE 1IL1A 1WFUA 2FEDD 3N1FC 1HI6A 3SE4A 1HYSC 2A77H 5ADOL 2F53D 4X6EA 2IANE 3SBWA 3ULVH 2RHEA 1BVKB 2EIBA 4F33A 3S5LG 4ZSOE 4G9DB 5HGAB 3GMNB 2AEPL 1D6VL 4G6JH 3QFJE 3CC5A 1A9EB 3WHE0 2ED8A 2FLBT 1RHFA 2DL9A 2ZPKL 4NT6B 2A6KB 1A4KB 4KJPC 4NO2A 4AM0B 2G60L 1OTTD 3QNZB 4GAJH 5HY9B 1KB9K 1IEBB 5AD0B 5LGHL 1GVIA 1OF2B 3G04A 4I3SH 4KY1H 4Y4FA 1JN6B 2GW5A 4MDIA 5D93B 3ARQA 2B4CL 4PJAE 4N5UA 3BEVA 7FABH 1UWXH 1MLBB 4M7JH 2C3VA 1A6PA 1HINH 5DZOA 3IDJB 3QB7C 1K6QH 1N64L 4FABL 2JJSC 2VISA 1XF2A 1KJMA 4NQEE 4HWEL 1MWAA 4LSUL 5CP3H 2NY7H 4L4TA 5TE4H 2OJEA 4QO1A 2E3VA 2IBGA 4J3UA 3VFPB 1T83A 2EDHA 4FN0A 5F6IB 1C7SA 5CKAA 5ICZA 3BUTA 1OW0A 2IFGA 5MEQB 5E99L 1ZHLA 3BD4A 5ELIA 2ICEB 4ONGL 4QYOA 4DZBB 4Z5RA 3WHE1 5E8NA 1A6WH 3IU4H 4OF6A 5C7XL 5KN5A 5MP6H 2I5YH 5BVPL 3TCLB 1YEJH 1BQHG 2X70A 3UTQA 1H3UA 1NCTA 2NX5D 3MRQA 4C54A 2BSRB 2VDKL 2PYEE 3T3PF 3RWCA 3T0EC 1G7LB 4R0LB 5CSZA 2DQFB 3HKFA 5AZEL 1J8HD 1RK0A 1HQRB 1YEFL 3VWJB 1DVFB 2HT3D 2XQYK 1MI5E 3VFOB 5TQ0L 2FH8A 4QXUL 3DMMC 1A1OB 4NRXA 2H6PB 3VGHA 3ILQD 3WFHB 5JW4Q 3Q6GH 2C5DC 1BHGA 3I2CH 5ALCH 2XPGB 1EMTL 1QVOA 3ARBA 4WU5A 4EI6A 4DWHA 3HNTL 1SYVA 1W8NA 3SDAD 3FOMA 3UTTA 3EDJA 4NQSA 5I1HL 2R9HC 3IS0X 4KTEL 5D2NA 5ETUB 2JELL 1KIPB 3TT1H 4N8CH 3KLHC 3H42L 5ITBH 4CW1A 1HNGA 4KKAD 4KI5C 2HKFL 3J8F7 3SKJL 5HYSB 4F2MA 1KPRA 4DKFL 1K3IA 3FTGA 4M1CD 3VXSB 3H9SD 4YEEA 1FZKA 2EYTB 4GO6B 2YA2A 1C8PA 4WUUE 5CGYD 1S7XB 4ZXBB 3IFLH 2VZOA 4POZD 4L3CB 5I0DA 1O0VA 3HE7A 1HEZB 3REVB 1HXYA 3MBXH 3R0MA 3EYQD 5I1LA 5GRVL 5TE6L 1UCBL 4HXAL 3LKQA 2J6EA 3RTQC 3IDNA 3LPWA 5T5FL 2BVQB 4KGJA 5FECA 4E0RA 1N5YH 1UH2A 4PJCB 1BFOB 1NLBH 4G7VL 1IZJA 4KGLA 4GMSL 2WLYA 3K8MA 4RMRA 2ZUTA 1EO8L 4M7LH 5SWQB 4TNWK 4AEIL 4HIIA 4N8VA 4ZAKD 1U91A 5EULV 5C07D 4M00A 3GMQB 5EU4A 1CI5A 2OZ4A 2IAMA 5D96C 1CCZA 3DV6B 1KIRA 4GAFB 4JEGB 4K94H 4LHJB 3KWWB 4LSRH 2XN9A 4R7NA 1YJDH 3TYGH 4NN7C 1T22B 1F4XL 1G6RL 5C0ND 1OPGL 3QISA 2DQHH 2J2ZA 3LV3A 4PRHE 2BXYA 1LEGB 3FFCB 2W60B 3QDGB 1S3KL 5HHMD 5I8EA 2ADGB 4PJ8B 1BVLB 1DQLH 1NAKL 1MFDL 2VWEE 2DJSA 3UTPE 3VXRD 4NSKA 1RIUH 1E27B 5C9JB 3VMOA 1NC4D 5GGVH 4NWTL 2DQGL 2JK5B 1X6LA 1H8OA 4FXKA