3MRKA

Crystal structure of mhc class i hla-a2 molecule complexed with afp137 nonapeptide
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
274
structure length
273
Chain Sequence
GSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDGETRKVKAHSQTHRVDLGTLRGYYNQSEAGSHTVQRMYGCDVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQTTKHKWEAAHVAEQLRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDEATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWVAVVVPSGQEQRYTCHVQHEGLPKPLTLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
publication title Crystal Structure of MHC class I HLA-A2 molecule complexed with AFP137 nonapeptide
rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 82
structure length 273
sequence length 274
ec nomenclature
pdb deposition date 2010-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mrkA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3mrkA01
1CL7I 4CU6A 2V6HA 2CKBH 1FVDA 3GKWH 1CWVA 4P2OA 5FV1L 1PSKL 4NM8L 5A43C 4MA1B 5EIIA 3TPUE 1AP2A 4P57B 2VABB 1TJHH 3T0WA 3B83A 4IRSD 1GPOH 4JFHD 4RGNC 1UM5L 4U1NB 1GZQA 1H3PL 1J7VR 2GJ6A 3L9RB 1FFOA 1XT5A 3KXFE 5L9DL 1F8TL 5JW4M 5IBTL 5IJVA 1T5WA 1R5WB 2QEJA 1MIEH 4ZXBB 1YEEL 4LLVB 4UQ2A 1WBYA 3IAGC 2ESVB 3RVVD 4DZBB 32C2B 2Z4QB 4Y1AD 1P7QA 2BY0A 3IFNH 3DURB 3HE6C 5I73B 2LQRA 4QNPE 4NHUA 2HG5A 1OAZL 1JRHH 1EGJA 2H9GB 4OZFB 4LCWB 1H3XA 1OAQH 3DARA 3QFJA 1CVRA 3UDWA 5GGTL 1S7SB 4K8RH 4OGYH 1G84A 3QQ3B 2XRAH 5H2BB 4Z76B 3P77B 2ITCB 1U8OA 4H88L 1VACA 1RUML 2EH7L 4IBLT 5E8NA 5KANI 4F7MB 1RQ5A 5C07A 4CN6A 1DQQB 2DKMA 4RFEB 4Z7UA 1G7IB 3LQAC 1QNZH 3ZKXC 4PJFB 3BZFA 2A6KA 1DFBL 4S2SB 3ZHDA 1KTLA 3INUH 4RISH 1ZLVH 4FQPA 8CGTA 1UZ6E 5HGHB 2CJUL 5LGJB 3L5HA 3VXNB 5L6YL 1YN7B 5DR5H 3KPRB 3CXHJ 3MLYL 4N1CA 4NKIH 3T4YB 4YHYB 1YNKH 3QHTC 4JN2A 4HJGA 2BMKB 2UUDH 3O2VL 4LCUA 5HGBA 4Q6IB 5GZOC 2YSSA 3RVUD 1ZLVK 1FH5L 4Y4HA 2B4CL 1SJEB 4KRMB 5MEND 4MNQA 3TCLA 1JWUA 3B9KB 5C0JA 2O5YH 2MHAB 1A7NH 2DBJA 3KPMA 2FX9H 5HHMA 1OTUC 4LCIL 4PJAB 3T1FB 3LEVH 3TIEB 3P4NB 2VZUA 2VLJB 2FD6H 3MV8D 2UUDK 3FHAA 1FL5A 3WIHA 5LBSL 3FJTA 4DGVL 2X42A 1XMWA 1Q9WB 3FQRA 5E94B 5IVXB 4XAWL 2BSRA 3V6OC 1J9CT 5E8OA 4M6ML 1IM3A 3D69A 2DWDA 4O51A 5F6HI 3IDYB 4NQVB 2EKSB 1ZHKA 3L1OL 4N8CL 2ADJB 5EZOL 3P3YA 4Z7VF 1NFIA 3FT4B 4EBQH 2QHRH 2Q8BL 3QEGH 5HHVH 4DGIL 4HK0A 2R4SH 4S1RL 4TULL 5T3XE 5E5MA 4ZTPH 5ACMA 1MRCL 1MF2H 2AJYL 2QQNH 3ARFD 1TVBB 2KPNA 3FO0H 3MLSH 3ZT5A 5I8CA 1HYSC 3OGCA 3DO3A 2AI0H 5FM4A 3ZYZA 1B4RA 4X6CB 5F7NC 2MNUA 1TPXB 4Z0BL 4F37K 2M8XA 3ULVC 4YJZL 4FQQB 2JLLA 4NYLB 1DVFB 4P4KB 1EGJH 1VFOA 2EIZB 5EPMA 5LAXB 3G5XB 4ZYKB 4PJGE 1T7YA 2WM0A 3ZDYE 5FKAB 2AXGA 3P30L 5IG7A 1A5FH 5AWNL 1KEMH 4WV1A 2OJEA 2CUHA 2AJXH 5INDB 1XH3B 2IQAA 1OSZA 3QIBD 3AUVA 2MPAL 3M8OH 3S4SB 3L3OB 1ORQA 3SE8L 3H7BB 1RSFA 4K9EH 4KROB 3S5LA 3MA7A 3MZTA 3TH3T 1CE1H 4LVHB 4JQIH 3DIFA 4MAYD 1U6AL 1ZXQA 3C6LD 3KPSA 4ODUA 1ZHNA 1EFXB 1VCAA 1HKFA 4Q2ZB 4W4OA 3ZYOA 2F19H 1MFAH 3K1KC 3LQZB 3MRPA 3T77A 1TZIA 1HH9B 1T4KA 1M7IA 3QHFL 1XF5A 3TJHA 5DI8B 3S5LG 1AQDB 1A2YA 1QRND 2RCSH 4DKAA 2DQEL 2FIRT 1AGCB 1BZ7A 2IPKB 4G6FB 1VPOL 4L1HA 2X6MA 1C1EL 3IJSA 3MRKB 5FB8A 1IGIL 3U4EA 5FO9B 3WNMA 2PF6A 3QQ4B 3PUCA 5C6WH 2IBBA 2YPVL 5DD5H 2ICCA 4NQSA 5FUCC 3D39E 2DQTL 3O45B 5C0CD 5E00B 1GGCH 1JPTL 4K7PL 3V5DA 5IIEB 1JTTA 3HPJB 4Z7OE 3BP7B 3PDDA 3MNZA 4HG4J 4JHAL 4ODTL 4PS4L 2OI9B 4CNIA 2MTPA 4IMLA 4LDEB 2P8MA 2Z0BA 4I4WA 3UP1A 1UGNA 4PD4K 2Q7NA 3U7YL 5L88L 2Y1VA 4LPVA 2UYLB 1LEKA 2AV7B 3TZVB 3C60C 5IKCB 2Q1EA 5JUEH 4JFEB 4POYA 2DTMH 1J11A 1NLDL 5DQDL 4PDCE 5KSVB 1NBQA 3K7UA 5EBLA 5DJ6A 2DI8A 4ZFGH 2EYTA 2X4UA 2EXYD 2D03L 2HVKB 3KWWB 1LK3H 3FTGB 1CD1B 1IC4H 2FZ3A 4N5UA 1QQDB 1HYRC 4QTIL 3MRBB 3JV5A 3GUTB 3NPZB 3T4AA 5CJOL 5GGSA 4D8PB 2F74A 4R7NA 4EOWH 1C16B 4N5ED 5IB2B 3DVGA 4APQC 3CPLB 3DSFL 3C9NB 2ZWLT 3UJJH 4N8VA 4NWUL 5CSBA 2B20A 3VFOB 5F9DC 1AE6L 1PGRB 3ZSTA 4Z7VA 3QCTH 1V7NL 4R9HA 5HGDA 4HIXH 3GIVB 3B8SA 3EZJB 5B38B 3FB5B 3TA3B 5HDOA 1MRDL 1MIMH 5ILTH 2VLME 3GBNL 5LGKA 1MH5A 1ONQB 2N4IA 1IT9H 1FGNL 4N8VG 4NZRL 3VXQA 4IEFB 4IOIA 2C4FT 1INQB 1J0KA 1CLYH 2FYYA 4L8SC 4O4YL 1KN4L 4OLZH 5EIVA 3RTQC 3T0EB 5HHQB 3AREA 4X4YA 2Z9TA 4F7TA 5GGRB 1GGIL 3D2UA 2DQCL 4WU7B 1JZ3A 4GG6A 2PR4H 3PQYD 2E9BA 2IGFL 3BAEH 5HD8D 3DXAA 3DLQR 5FYJH 4WHDA 5JXAL 3ZHKA 2EXWD 4HC1A 4JY5L 1KPVB 3SQOL 4O02H 3TN0D 1EFQA 5D72H 1UKQA 4KGLA 1L8JA 4CVXA 4HBCH 1Z3GH 3S35X 3ZTJG 1GHFL 5DJZB 3C2AH 2HTLC 1MQKL 2NY0B 4ZUWA 4ODHL 1XR9A 3FFDB 4YDLB 3SDXB 3MRFA 2R0ZL 3WXWL 2PW1A 4PUBL 1W0YT 4Y2DB 4YXLL 4I0CC 1QG3A 4RQQB 5FEBA 1S7VB 4B7LA 3CFEB 4P2QE 3SO5A 4MNGA 2E6PA 4NT6A 3T0AA 2R23B 5F6IC 1UB6A 4I3SL 3Q2CA 4ZSOE 2CRZA 3GRWH 2MQ3A 4ZOEA 4MA3A 1T22B 1W8NA 4BQ8A 4MCYA 5T5FL 2P8PB 1WFTA 1KJ2A 3FCTA 3TIDB 1JNHB 3H3KA 3ARGA 2GJZA 1B0RB 5D7SL 2XY2A 4S0TD 1H3GA 2I9TA 2WP3O 5HHOA 4HIHA 2IH3A 4TUKL 4YK4C 4NOFA 4JAMA 1ZGLM 1RUAL 3GKZA 1JPFB 4CMHC 1W0WA 4HWBL 1YN6A 4HK3J 1U8LA 2CGRH 2DQIH 5FHAH 2RBLA 1J18A 4NKMB 3EUUA 4F9PC 4MD5A 4ZFZA 5CKAA 2NQCA 4PJDB 1U3YA 2PO6C 1VFMA 3GSNL 4FMKA 4ZMAT 5T3ZH 5FA4A 5C6TL 4U7SA 2C3HA 3KPOA 3MA9L 4J3TA 4QRRA 2Q20A 5F7KC 1FZKB 4WUKL 4KGJA 3RWDA 4YEFA 3MGTB 3V7AG 3P73B 3UO1L 3O0RH 3GDBA 4HFWA 5D7IF 5J0BA 4FFZH 5JPMA 5HYSA 1UKTA 1F13A 5DQ9A 3B4NA 3PGDA 5KBNC 1NBZB 2BNUB 3RHWF 1FNSL 5EU5B 4CU7A 2RHEA 3Q6FA 5CZVL 4U2YA 5JDSB 3L3JB 1IAKA 4R8WH 4YE4H 3E2HB 3HNTH 3Q3GA 5B8CB 4NNPL 5SX4H 2ICWI 4HUUA 2IANA 1J8HA 3MROB 3C8KA 1SEBB 3CIQA 1T1XB 3IYLW 3EGSB 4RIRA 1H9VA 1YUHA 2PUQT 5GRZA 4MS8A 3BYTA 1OP9A 1Q94B 3ZTJH 5HYSG 5I76A 3JV4B 2GJ6E 4M6NL 4XP6L 5HHNA 3D18A 2WLYA 1F4WH 3TBVB 3OAZH 3IVKA 3MCLH 4G9FB 2F54A 1DSFL 3BKYH 4OGAD 3EJYC 4HC1H 2E9IA 1TCRB 3QB7C 5CJQL 1HHGB 5ITBH 1KC5H 2YD4A 1TVHB 3GSOB 4XNMB 5DC0A 3SGEI 3HI5H 4FQHB 3U46A 1AGFB 1ZT7B 1BF2A 2CKBL 4PRNB 1H15B 3GKWL 1YQVH 3VXUB 1SQ2N 1JGDB 3KPLA 2DQFB 4NHUE 4N0UA 1TJHL 4QHLA 4MVBC 1GPOL 3OAZK 1UB5A 4PLJC 3QFJE 4X4ZA 3RVTD 5DLMH 5CD5D 4CN1A 2XWTA 3C60A 3MNWA 1MAKA 1Q0XH 2CQVA 1JV5A 1CBVH 1ZHLB 1KEGH 4GKNA 1CD0A 3SKOB 1MIEL 2DMCA 2VDQH 3QQNA 5DWUH 1FVCA 1IM9D 4NKOB 4YHIA 1XF3A 3DMMA 5DJAA 5EZIH 5C07E 3IFNL 5IQ7H 5C9KA 1KJ2H 5F1NB 3EOYG 4JRYB 4Z7UE 2AV1A 1I7TB 2W38A 1JRHL 5JW4R 4JDVA 1OAQL 1MHEB 3VFTA 2XACC 4BSWA 4PJIB 3KHOA 3M1BB 4OGYL 4K8RL 5BZDB 3J7HA 2VLJD 2XRAL 4PRDB 5GSRA 1T1YA 5IM7A 1CXIA 3X14B 1S8DA 3ULVH 2CKNA 2W07A 3B9DA 4QLRA 3VD5A 3IDIB 4KHTL 3OHXA 3HTLX 2VDKH 3K1DA 2AW2A 1FL6B 4HH9A 4M9PA 3WSQH 1LNUA 2VNCA 5ICYA 2EE6A 1QNZL 4H5SB 4KMTL 2VKXA 1IGTA 3INUL 3IF1A 2CUMA 2WUCH 4RISL 1OLLA 2BCKB 5JA8B 4MNQE 4ONOA 5K59E 2R29H 2NY6D 3GSRB 4HCRA 5HHME 2C1OA 4P23B 3FRUA 5DR5L 4NKIL 1AHWA 3MODH 1YNKL 3TO4D 3IJHA 1Q9OA 1CDIA 4GQPH 3U7WH 4ODSH 2HWZH 5D70H 2DQJL 3RTQA 4P46B 2UZYB 3BDYH 5K9QI 2H2PD 1QPPA 1F45A 2DRUA 2OTWB 3CFBB 1Q72H 2O5YL 1X5LA 1QBLH 5T5NF 1A7NL 3FFCB 2FX9L 4CUCA 3LEVL 1IFHH 5D7IA 2FD6L 3BIAX 4NQXB 2VZSA 1FG2A 4GW1B 8FABB 1R3KB 3KYMB 3V5HA 4YC2C 1LP9F 4OUUA 5T3XD 1DQLH 1EFXD 4MB3A 2X4NB 4NN7B 1UXSA 5F7WC 1A14H 3IS1X 3PWVB 1WSST 1JPGB 3FO2A 2J8OA 3S37X 3W2DH 3WHE1 3QXTA 4PJEB 1JPST 1P84J 2FJGB 2B1AH 4QY8A 4EBQL 3ROLB 2QHRL 5HHVL 3QEGL 2R4SL 2VR5A 5ESVA 3I85A 3PWPB 2EDYA 2IMMA 1T6WA 4WI5A 4ZTPL 5KVFH 1QR1B 3TNMA 4FFVD 1MF2L 3MLSL 2QQNL 1TVDA 1G7PA 3FO0L 3T04D 4UAOB 4WW1A 5EUKA 4M1DH 3DYMA 2N7AA 2AI0L 5ID1B 1EV2E 3PV7A 3OAYH 3BISA 3HG1A 4XP1H 4QF1B 4D9QD 4MJ4A 1XCTB 3KPSE 4DW2H 1FN4B 3NACH 1EGJL 2V2WA 2VE6A 1H3UA 5I1HH 2R2HA 4B7IA 4DAGL 1A5FL 3HLAA 2ZP0T 1KEML 5DEFB 3I50L 2AJXL 1JE6A 3ARBB 3QJFA 2VMFA 1K6QH 3M8OL 4FTVB 3VGAB 1Z2KA 1BD2A 2WBJA 4MX7A 3OAYK 2LVEA 4K9EL 4F7CB 5FYJE 5JXEC 1CE1L 4JQIL 1NFDF 4CKVX 3VXSD 5ICXB 1N6VA 3TYFB 4RDQG 3V8CA 4Y19A 1XGQB 2F19L 1QR4A 5I75C 1CFVL 1MFAL 3OKKA 5F9WB 3MUJA 3WFEH 1I8LA 1F58H 3LN4A 2YC1A 2R15A 3U4BH 2A83A 1C5CH 5F88B 4NQDD 4PJ9A 1NGWA 3N1GC 5FCSH 2RCSL 4PJ5B 3KLAB 2NXZD 1XGUA 4W68A 3HAEA 1VGEH 3BP6B 5DD5L 1TQCC 2FJHA 2ZCLH 1GGCL 4RGNE 3MLZH 5KG9B 6FABH 4U1HA 4Z77A 1S78C 1Z9SA 3D0LA 4P4RA 2H26B 3GSWB 5J12C 5IB3A 3PL6A 4GO6B 3RUGF 5CGMA 4JCLA 5T1KB 3T8XA 3OKNA 4LHJB 1SVCP 3G9VA 4IRJC 2YKLH 1HKLH 3HAEG 4G8GB 1UJ3B 1JZ7A 4KJPD 2VZVA 3ZT6A 1EEZB 5JUEL 4PJ8A 4RWYH 2DTML 3QIUC 1ND0A 4MVBA 1BQUA 5ICZB 3DYPA 1TITA 3DRQB 1UEMA 2FGWH 3B2UD 4M8QB 4KK8C 3TM6A 4ZFGL 1GJIA 3RBGA 4NRXB 3BZEA 1F11A 4Z7VE 3RU8H 1LK3L 2YA1A 4XI5D 5DD0H 2IFGA 3SKNA 5FGBA 4PG9B 1GXEA 1Q8MA 1AY1H 1A9BA 2BDNH 3MJ7A 4XT1C 4RFNB 4C59B 3QDMA 3HR5A 1H0DB 1NC2A 3MUGA 3F5WA 3RWFA 1LGVA 2HYMA 3GMLA 2X9XA 1KYOK 3NFNB 3SEPA 1LP9A 5IFJA 4EOWL 4JDZA 4WENB 4JFDA 2VLMD 1WQVT 2AJSH 2XKNA 2WBWB 1MCWW 4AIXA 1HXYA 2JCCF 5IB4B 3CVHH 2W92A 2F8OA 3EYVA 5EBMB 5EO1A 4G9DA 5HI3C 4LFHG 3PE9A 3UJJL 3R8QA 3STZA 2NY0D 1P4LA 1ZGLB 2OXHA 2YMXH 5E4EC 5CSZA 1ZHBA 2HJFA 3G5YB 5C0IB 3H9SA 4QXTA 3QCTL 4N8PA 3BPOC 1UYWH 4HIXL 1P5UA 3EYFA 4WHTA 4X6FB 4FQCL 5ESAA 4Q9QH 1MIML 5ILTL 1D5ZB 1IGYA 3GJEB 4GG6E 4GW4B 1S9WB 4S1SH 2XXMB 1FCGA 4FZEH 4YZFF 1MCFA 3DXAE 3R8BB 1IT9L 3IDUA 5GISH 2HMID 3VRIA 4G43B 1CLYL 2EZ0D 2W60A 1V7MH 1W0VA 1U92B 1XCQA 1I3UA 2B5IB 3HZYA 4WI2A 5GSVA 4WI9A 3QNXB 2F53B 4ZUTB 4OLZL 4XGZB 1KLGA 1KCRH 1RK0A 3AY4A 2PR4L 4NO2A 4Z78B 1UXWA 3BAEL 2YEZB 1SYVB 5FYJL 2YD6A 1NFDA 4M61A 4MNGE 3HAEH 3BUYA 4S1DC 4O02L 1CGVA 5D72L 2NCMA 5FHBH 4NRZB 4Y5VC 5TDPA 4J3SA 4WO4C 2G5BB 3V6FA 4HBCL 3K0WA 1PG7W 5SWSA 1CDUA 3C2AL 3MCKB 2XWBA 3VI3F 5HYJA 3ILQD 4PJXF 1F6LL 4NO0A 5E6IA 2EDRA 4H0GA 2Q3AA 5F1KC 5DC4B 2JJUA 3UTTB 5HHOE 1S7TB 1CFNA 4BH8B 2PNDA 3I75A 5B4MC 4PRIB 4ZS6D 1IAOA 4X4MA 5AYUH 2QADC 3NCCB 1DLHB 3EFFA 3V9FA 3AAZB 2OK0H 4M7JL 4P5TB 1BLNB 4PGEB 3GRWL 2NW2B 5FGCB 3X3GL 4EXPX 3KYKH 3V7AE 1TQBB 3CFDB 5DVOA 5EUOB 1MHCA 2XWJA 2X1OA 4XNZB 4C57C 5IK3B 1WZLA 2Q86B 4YGVA 5E2TH 1I3VA 2HRLA 3RUGA 5E5UB 1UZ8B 4I18A 3QUKB 4KUCD 5EZLA 3VFGH 5E08H 5DDHA 2D7NA 1IAIH 4QRRE 2BVTA 5C2UB 3K8MA 3QXAA 5IROA 4EI6B 2D7PA 4G9FD 4R3SA 3MMEB 3SKUD 3KJ4C 4FFEX 4LKXA 5TDNB 1C08A 2Q7YB 2YA2A 1II4E 2R2EB 2CGRL 4U1IB 2DQIL 5FHAL 3MRGB 1NKRA 2EYRA 5K33A 3KLSA 3IAQA 4H0HB 1GRWA 4FHBD 2L7UA 4K71C 5KVDH 3C6SB 2X4PB 2IANE 1J8HE 1QFWH 5T3ZL 4LLAA 4P5MA 5DD6B 5ACLA 1QLFA 3K8KA 3SCMA 1MFDH 3O4OB 4PJHF 5JXEA 4P2OD 1AH1A 1A6VH 4WU5A 5I1CH 1DDHB 3BD3A 4NHCH 1HDMB 4DKEH 1NGYA 3O0RL 1IGMH 2F54E 4MLSA 5J6GA 4ELMF 1T0NA 4I0PB 2JCCA 4WI3A 3T2OA 4PRBA 4B0MM 4UTBH 3VFUB 1J87A 1LEGA 2AJUH 2K1MA 4JRYD 1JF6A 2PCPB 1BIIB 4HIJA 4R0LB 4R8WL 4YE4L 3SDCA 3HNTL 3TBYA 4ODWB 5DRWB 4P2CG 4L29B 4K3HA 5TF1L 5KSBF 4E0RA 1F6AB 2W0KA 5SWZA 3CDGA 4N0UE 1MUJA 3IFLH 4D9RD 4G42A 1P7QD 5HY9B 4XXCA 3UX9B 1A6PA 2D7TH 3PHSA 4H8WC 5IVZB 3WIIH 3VW3H 1F4WL 3C5SA 3MCLL 4JFQA 1IEAB 3BKYL 4HC1L 3F6IA 3NPSB 4NFDA 5BV7C 4Z6AT 5ITBL 1OW0C 5K9OB 1KC5L 3EHBC 3HI5L 5MERB 3T1WA 3SKJH 3O81A 2IH1B 3KYOA 4EI5A 1QD0A 4NM4H 1TCMA 1IC1A 4GKSB 1YQVL 1RZIA 3JBG7 4LCCB 5E9DB 3SE9H 4OSUH 2ZNWA 2LABA 1QEWB 4ZNEA 4XVUC 4HK3N 1MFBH 4WNQB 5E2VH 5DLML 4X80H 1GGBH 2VDLH 4P23D 4JPKH 1ZMYA 2AEQH 5F44A 1Q0XL 1WCBB 5B39B 1CBVL 2R1XA 1FQ9C 1KEGL 1WWAX 2DQUH 3VG9B 4V1DB 2VDQL 1I8KB 1U95A 3MRCB 5DWUL 5L2KA 4HLJA 3G9AB 1IQWH 1KT2B 3QNZB 1HSAB 3EJJX 3MZGB 5EZIL 1JNNH 5IQ7L 2F8XC 1MCWM 1NJ9A 1KJ2L 3T0BA 4GBXB 3RZCB 2QQLH 3CUPA 2X4SB 1NGZA 5C0DA 4L8BA 4PJXA 1RU9H 2Z35B 3FFCD 2A6IA 2AGJH 4PY8J 5E6YA 4Z0XB 3RBSA 1KCGC 2NTSP 4G8FA 1MRFH 2HFEB 3HI6H 2AK4A 5ETUB 4POZD 3QISA 1IEHA 5B3JF 4CVUA 1MREH 3CSYB 1M05A 1CGTA 1NMCC 4HKZA 3ULVL 4O5LH 4JPVH 1B4JH 1QBAA 3GMRA 5IT2H 1V5JA 1QSEA 1YEGH 5CJXC 2VDKL 1FNEA 1CFTA 3WSQL 5A16B 4HS8H 4UOJA 4BQ9A 1P7HL 3PGCA 3WFDH 2WUCL 4KHXH 3N1FC 4X99B 5BW7A 1RIUH 2R29L 1FPTH 1RI8A 2ZSWA 1ZEAH 1GSMA 1S5IH 3OL2A 1LWRA 4LNRB 4IS6A 2E9WA 5D7IE 5I74C 2OLDA 5C0NC 4NNYA 4X5WB 1BJ1J 1I4FA 2JJWA 3MODL 5LCVH 1EIBA 5CGTA 3U7WL 2J8HA 4ODSL 2HWZL 5D70L 3IS0X 4KDTA 3ULUF 1MI5B 2VITA 3BDYL 3HE7C 2DM4A 1JWSB 3O6FD 3A6BH 1FFPB 5CWSB 1I75A 5FKPA 5FECA 1A6ZB 1Q72L 2P42B 4OLVH 1CDHA 4PJHA 4R2GD 2IALB 2QSQA 3AGVA 2AJZA 1QBLL 2JK5B 2Z31B 3QO1B 1VADA 4NCC1 4FTVD 1TZHA 3SY0A 1K4CB 3MRNA 1JZ4A 1I7RB 1IFHL 3H0TB 4ELMA 4PRHA 4FABH 3MV7B 1DBKH 5D1QA 2XXCB 5GRXG 1DP0A 1UVQB 3QUMB 5F3BA 3ZT7A 3PWUA 1DQLL 2DKUA 5FK9B 4X5LA 4XCNA 4LKCA 3HG1E 1A14L 3QEHB 5KSBA 4JFOB 2HLAA 4EN3B 2H1PH 5J56B 1BBJB 3W2DL 3CMGA 4OD3H 5DO2D 2COQA 3CFJB 1T7XA 2B1AL 2P5EA 2BVUA 3GSUB 1XF2B 2O61A 2FX7H 2HJLB 3KPSD 1TNMA 2VLKA 3DX7A 2WWMC 3UTZB 1CGUA 4MD0A 3WE6B 4Z9KB 2YK1H 4F33A 1X7QB 5KVFL 3DO7A 1BD2E 3OKLB 1T66C 3QXDA 1JWMA 3TJHD 4M1DL 3V5KA 2OL3H 2R39A 4QHUA 1WIOA 4XP1L 4M43H 3PV6A 4RAUA 4NNXA 2JJTC 4DW2L 3MRMB 3NACL 4Y19E 4NDMB 5B21A 4F58H 2J88H 3T09A 3VA2C 5CINH 1TTFA 5I1HL 3OMZA 4HGKC 2A77H 25C8H 2IEPA 4BYHA 4PP1D 4HD9A 2D31A 3JTSA 4OZGB 1IKFH 3NIFF 1K6QL 1MCHA 3S36X 1SMAA 5L2JA 5JDJA 4O2CA 4P2RB 4OLEA 5J11C 1S9XA 5D7JC 1E28B 1KUMA 5C09B 1W2KT 1CXLA 2CDGB 1XIWC 5KSAB 4KQ3H 5F8RC 3WFEL 1EPFA 5DJDB 3RWIB 2DQDH 1H5BC 1KPUA 2GFBA 3U4BL 3B9VA 3G6JB 1B90A 4XCEB 1C5CL 3HZKB 2CO7B 3OR7A 2FRGP 3NZ8A 1EEQA 5C0BA 1A4JB 5AD0B 3VGDA 1Y0LA 1I1YA 4TOYH 1YEFH 4UTAH 3F7YB 1FO0A 1VGEL 3TO2A 1SY6A 1CGSH 1HCFX 3CSGA 2ZPKH 3QDGB 4CW1A 4G6AC 2ZCLL 3T2QA 1HHHB 3PNWA 6FABL 3J8F7 4O2FB 4QOKB 4OM1H 2VZ3A 2YOCA 1QRKA 4PD4J 1OW0A 2YKLL 3OWEA 2NY3B 1HKLL 4HUWA 1A7PH 5JPNB 1MFEH 1CCZA 3BDXA 4PJGB 1DN0A 3F65A 4HUVB 3QDME 2JJSC 4HUNB 4YDIH 1BJMA 2YN5A 4F3FA 6CGTA 3KNBA 1LP9E 1PKQA 1NQBA 5CLTA 5DJ0B 4RWYL 4JFDE 3IXTB 5F71A 3E3QA 3JV6B 1S7RA 5JQ6H 4ORGB 3T0DA 2FGWL 2H3NA 2HH0H 1G0YR 1RZ7H 3QXWA 4PREB 2X70A 4YPJA 1LD9A 3RU8L 5E1AA 3BQUB 4L3CA 5DD0L 1OT2A 3FN0H 4HDIB 4PGBB 1AY1L 2BDNL 2WK2A 1A6UH 4LHUA 2YD5A 5MI0C 1YEJH 2B8OT 3MRLB 2NLJB 3I2CH 4J7RA 4MMXC 2E8ZA 4C56A 1JI1A 5DHYA 3TVMC 1KELH 4X4XB 1NKOA 4HIEB 1C5DB 2QLVB 2WIIB 2AJSL 1G6RA 5DMGC 4NZJA 3ZZ1A 4LLDB 3W9DA 3KPNB 4WWKB 3CVHL 3SPVB 2PYFA 4ZUSB 4JEGB 1NAMA 3EO1A 4GS7B 3VE0A 5D1XC 3MO1B 4S1QH 1UJTA 3V6ZA 2YMXL 2XICA 4LHUG 3BP5A 2VKWA 5L8KB 3RL1B 4U1GB 4IOFD 2HT4D 5I8KL 1MCJA 1UYWL 1KIPA 3U2SB 4HKJA 5EIQA 3L6FB 4Q9QL 4NWTH 3ARYA 5IB5B 5KANG 2OTUB 4S1SL 2VZOA 4FZEL 4L3AA 2JKXA 3EOTH 1NFDE 5GISL 3G6AB 4HGWB 1V7ML 4L8CB 5EULV 2V7NA 1YZZA 4BKLA 4GG8A 4JPIA 5SWSE 2FL5B 5C0EB 1LO2H 5DS8B 1MCSA 1U3HA 2EDTA 4JM2C 5HYJE 1ROWA 2Y07H 4MB5A 1KCRL 3NTCH 2DWEB 3VJ6B 5KJRH 4HWNA 1BQHA 1VERA 5DD1H 4HT1H 3GSNB 2XFXA 3ARGD 3DVIA 1IGJB 5JA9A 3B8YA 2ZUSA 4X4ME 5HHOD 4NQEA 1SY6H 5JOPE 1MCBA 1FNFA 1OM3H 3T2NL 3H3BC 1CL7H 1I9IL 3DV4B 1CU4L 5M94B 4H8WH 1BQHG 3VWKC 4KK9D 3RUGE 3ES6B 5C0AB 4RMQA 5LVEA 1JNLH 4G5ZH 3ULSA 3MNVB 4IMKC 5GRVK 1CDYA 4UV7H 3HRZA 3HMXH 4R97C 1RIVH 1KB5H 5FYLH 2FHFA 2VISB 2V7HA 2YXFA 4I0PD 5AYUL 1D6EA 2CIIB 4QRRD 1J10A 2OK0L 4H25A 5ANMA 3T3MF 1CICB 3NAAH 5BVJA 1A64A 4BZ1H 5KAQF 3KYKL 1Z9MA 2AEIT 3NCYS 4JRXB 1JN6A 1CZ8H 1IKNC 4R4BB 2C26A 4UIMB 4FMFA 3VFPB 2O5XH 4UZGA 2GAZB 1OGAA 1S5HB 1YDPA 3C5ZA 3UPAA 3VFGL 5E08L 3TBTB 1IAIL 2CKBB 4OKVB 3AM8A 5JW5A 1J8HD 4MA7H 3C5JB 4IRSC 1BFSA 4OCXH 4KKBD 5JO5B 2JJTA 3GMNA 1U8MB 2ZZUT 1G6RH 3QCUH 2WZPD 2JCCE 4LSVH 3LMJH 1FRGH 4DTGH 5GS0H 3UXFA 1QSFA 3GHEH 2NYYD 1X5AA 3OKMA 5DJ8A 2F58H 5DQJA 3RVVC 2EDHA 4I13B 5KVDL 5MEOB 3BRGC 5EOCH 4ZDHA 3HNSH 4K3JH 3FT3A 5SWZE 2VYRE 5BXFB 1K5NA 4PV9A 4PJ7B 1MFDL 4XVJH 1T20A 3G04B 1A6VL 1FZOB 4YZFE 4NHCL 4DKEL 5DRXA 3Q0HA 1NLBH 3KAAA 1IGML 3MQIA 3U7AA 3CVIH 1M6OB 4X7SH 5DC9B 1XIWA 4DK3A 4U0QB 4UTBL 2GEEA 3OKDB 4NCDA 2AJUL 2IQ9H 4D0CA 1PQZB 4GBXD 4M9OA 5BS0B 4HUKB 1CI5A 1IRAY 3E1F1 4TYUA 1BQLH 3NCFB 5JOFB 4MAUH 3IFLL 3DMMD 1BF8A 5JORA 4WW2C 3DTXA 1I9JH 5D2NC 4ZNEE 4JZOB 2V2TA 3WIIL 2D7TL 1SBBA 3VW3L 4AQ1B 2XA3A 2XN9B 5MEPB 2BOCB 3B9EA 1QA9B 4LLYA 5E7FA 3RVWD 4Y5YC 2EIDA 4JREC 1TTGA 3RX7A 5DRZA 4FQXD 5L2KE 3MRHA 2J8UB 2ZG3A 3SKJL 5HGAA 2P48B 5J13C 1BBDH 3U83A 4NM4L 1GOHA 3B5TA 4AQOA 1X9QA 3L5WB 3NGBB 3VI3E 3LRSB 4PJXE 5FOBB 5JLZA 3ESVF 1K8DA 4LLWB 3SE9L 3QWOB 5CBEB 4OSUL 4U6XB 5F93C 2H32A 1MFBL 2DJSA 3PABB 1NCAH 5E2VL 3RVUC 3VFVB 4X80L 4XXDA 1GGBL 2VDLL 3QI9B 4WFFD 4JPKL 4XP4H 1AKJA 3ARDA 3HC0B 2AEQL 2FEDD 2NY4B 4Y4KA 1AD0B 2AK4E 5EN2B 3HPLB 1WGOA 2DQUL 1RJYA 4NO3B 3WN5A 4OZHB 1IQWL 4D0BA 2BERA 3IDGB 1QSEE 1MI5D 1HILB 1NGXB 4PYHA 1JNNL 5EA0H 4Y16B 3DV6A 2QQLL 1RZJC 1PD6A 4UBDD 5D93C 4TUOB 1NUNB 3VG0H 1BZ9B 3O3AB 1YPZB 1AXSA 1M4KA 2X4OA 2AGJL 1A9EA 3RA7H 1JTOA 5GGSY 1ZE3C 1RUPH 5DEGA 1MRFL 2EC9T 3HI6L 1HNFA 1MREL 3TF7C 2OR7A 4N0FB 4O5LL 4JPVL 3HCVA 1B4JL 4PGJA 1NUDA 3MYJB 4DN3H 5IT2L 1RJZA 1N59A 2ATPA 3LKSB 5IJVB 3ARFC 4EN3D 4XPGH 2HFTA 4HS8L 2JTDA 4UQ2B 4U6YA 1R5IA 4L9LC 5DHVA 3WFDL 5BQ7A 4KHXL 1QPXA 1A1MA 1CG9A 5H94B 3RIFF 4PJHE 3DVFA 5TGBB 5HYEA 3WMSA 1RIUL 2VQ1B 4J12A 4RMTA 5F97E 5I1LB 5ADPH 5KAQG 1FPTL 1AIFA 4GUPA 1ZEAL 2ARJB 1S5IL 4X6BB 2F9BT 4J4PD 3S3JA 3WFHB 5C92A 2JE8A 2VB5A 4ELME 3QFJB 3QIWB 1E4XI 5F7HA 3X13A 4PRHE 5D6CB 3FB7A 4UNUA 5LCVL 3TWCH 2ZOLA 3OJDA 2DAVA 1WVZA 4JY6A 2X1PA 2ADIA 1I1AA 4OD2B 5E8NB 2NNAA 5BZWA 3A6BL 5KSBE 3RNKA 4JQVA 5FF6A 1CDBA 4MAYC 3L3GA 2GITB 3QXVA 3C6LC 2P5EE 2EICA 3D85A 2I9LA 4ZUUB 4P2RD 1V3MA 2Y5TA 2VLKE 2ERJB 1KXVC 3DUSB 3F8UB 5D1ZA 4MSWA 4XRCB 1WV7T 1RUKH 4FABL 3UTQA 1DBKL 5C09D 3E6FB 1K4DB 1LK2A 1AO7B 1OGTA 4ONHA 5HI4D 3ZKMD 3SN6N 2WBJD 1X5GA 5J7CC 2G9HA 5I66B 5CIPH 3VGEA 2H1PL 2APFA 2H8PA 3IXAA 4OD3L 4QO1A 5LXGL 3RL2A 1LVEA 2LTQC 4URTB 2FX7L 3ZTNH 4Y19D 2DYPA 3VD4A 2C4FU 4JFXB 2XTJB 3VFWA 1ZSDB 2YK1L 4MNQB 1FYTA 1TFHA 3AC0A 3OZ9L 1YA5A 1QP1A 2BVPA 4GAGH 1N5AB 2YPLB 3I6GA 1A1OA 1QFPA 5HHMB 2OL3L 4NC1E 1SJHA 1MWAA 3SGDI 3PWNA 1FL5B 4M43L 3V0VB 2XNAA 5T1MA 4ZAKB 1T5XA 4MJ6B 4F58L 2Z91B 2J88L 5CINL 2A77L 25C8L 2BXZA 2NY3D 3L3KA 1IM3B 3I6LD 5EZJA 3ARPA 1IKFL 3RDTD 2A74B 2YUXA 4O51B 5B3JE 2EXYC 4QHKJ 2EKJA 5C0BE 3MGOB 3PL6D 3QYCA 5C2BL 1KPRB 2DTSA 2WANA 1NFIB 2GCYA 4JG1H 1I1FB 2E6JA 3P0GB 4JFFD 5A40E 2NY1B 3LEXA 4HK0B 1D5MA 4U1MA 5J8OA 5KVGH 3MBEB 5DGRA 5IEKA 4NJ9H 1PJ9A 1DBJH 4F7EB 4KQ3L 2PTUA 2FWOA 2DQDL 3QUXC 3BQUD 3CXHK 2ICWA 4OGXH 2MMXA 2QHLA 5GIRA 1PY9A 2P45B 1EAJA 2A0LD 4BFBD 4Y88A 2H2SC 1OP3H 3FQTB 5IOPB 5DYOB 2BSTA 5DJYB 3H3PH 1A1NB 1I7ZB 3F7RA 4TOYL 1YEFL 1KCKA 3P9MA 4MJ2A 4UTAL 5I1GH 2NY2C 1Z0MA 3VFNA 1A7BA 3FB6B 4PBXA 4XMPH 1NCUA 1CGSL 3G5ZA 1PKQE 2ZPKL 4LLMA 3QDMD 2NXYB 1NC2D 3E3QE 1ORQB 3W11D 2DS4A 4QRPA 1ACZA 3GIZH 2FEEL 2X44D 5DMJB 3S5LB 1OP3K 4X9GA 3DIFB 3MRRA 4JFDD 4OLXH 2HT3D 2JB6A 4YXHH 2YBRA 3U36A 5ACZA 2I24N 1ZLWH 4GLRH 3A0OA 4KVNH 5FYKE 5ISZB 1G0DA 3IGAB 1A7PL 3ORJA 5EC2A 1NPUA 5DSCB 1MFEL 1FNHA 3VWJB 5L7XH 3T77B 3ZE2F 3SDDA 1T4KB 4ODVH 4YDIL 4WEUD 1XF5B 3WL9B 1XF4B 1A3LH 4BUGA 2NX5D 3NBNA 2BP3A 2M26A 4IIQB 3LN5A 5J1SC 4HFUH 4Y8AA 3VDAA 5HD8C 3HB3D 1A2YB 3QPQD 4ZNCD 2P7TA 1BVLB 2EXWC 1BZ7B 1JF5A 2HH0L 4QXGH 3E0GA 1ZLWK 4J3UA 3IFOB 1FZJA 1RHHA 1RZ7L 4MDJA 5EU7E 5MENA 4PLOB 4QTHB 4YDJB 4NQSB 4MQ7A 5FDYA 5KSUB 1LILA 3RWEB 3HZVA 3SKMA 3MRJA 3BIBX 3FN0L 1Q9LB 3TLRA 2GY7B 3CH1B 3PHOA 1A6UL 4GRLB 1YEJL 3MV8A 4AJ0A 3CK0H 1HHJA 3I2CL 4I48A 1EH9A 5IHZB 1FC1A 4UT7H 5LWYH 1KELL 1L9MA 3LKNB 4U3CA 1I85C 3RIAK 1P2CA 4LEOB 3EOAA 3U1SH 5E24E 3IKKA 3V4PH 4LRIA 1IAMA 4S1QL 1U8QA 3QDJD 1XR8B 3DETD 4MJIE 3CDCA 4XH2A 3PDOA 4JVPA 2EDXA 4IHOB 4RGNB 4ZFOB 4HJ0D 3NIFE 2E7BA 2O5ZH 4NWTL 1LO4H 2HTKD 5I8EA 3WLBB 3RWHA 2F5BH 3EOTL 5E6ID 4ETYA 1MCRA 5I1KH 4NQEE 4WFGD 4L9LA 4JRXD 4KTDH 3MUHL 1AXIB 3HE6B 3IFPB 5HHPB 1LO2L 1U91A 1PW3A 3O8XA 2Y07L 5EO0A 2VH5H 3K4DA 3NTCL 4MD4A 1OF2A 5KJRL 3QIBA 3GSVB 4HS6A 5DD1L 4HT1L 4JN1H 3QAZC 1KOAA 1Z9LA 1JGVH 2RGSA 5GRVL 1Q9KA 2MOVA 2CLVB 5HGDB 5BRZB 3A6OA 4HG4K 1YMMB 1RZGA 1SY6L 2N56A 4OCWH 5ANME 4HKXA 4MAYA 3H7LA 1OM3L 4GH7B 1I7UA 5K9QG 1CL7L 3HR6A 2DL2A 1J0YA 1TJGH 3VXTB 4H8WL 4QRQA 4P59H 1DQTA 3ZKXB 1FV1B 1JNLL 1UH2A 4G5ZL 4ZPVB 5GS1A 1LO0H 5BV7L 3K2MC 1G7JA 4Z7WF 4UV7L 2D2OA 2FYYB 1LO5A 3HMXL 3U0PA 1IILE 1RIVL 4XTRD 4RCAA 1KB5L 3QEQA 4OQTH 5FYLL 1QRNA 4AK1A 2OR9H 2I60H 4YBQC 3FO1B 3MOBH 3LSOA 2X4RA 4X0KA 2GTWB 2ZOKB 4F7TB 4KTEH 5BS0D 2Y25A 3D2UB 3NAAL 4BZ1L 4GG6B 4GRWB 3O11A 4YDVB 3VXOA 3SDAA 4OGAC 3FOMA 1CZ8L 1T03H 1QSFE 4QRTB 2APWA 4L4TA 2O5XL 1F4AA 1CLOH 3OG4B 1I9RH 2OMBA 1KN2H 4K7FA 4AT6A 2MWCA 3OB0H 3B43A 1BQSA 4ZOBA 1MCNA 5IHUH 5JHDA 4JZJA 4LP5A 4EDWH 1WK0A 4MA7L 1YNTA 1S9KC 4OCXL 4ZUWB 2XZCH 1RZJH 3NZHH 3GMPA 4JO4L 3RVTC 3S3PA 1ES0A 3RWJB 5CD5C 1PY4A 1G6RL 4LSDA 1UWEH 4TSBH 4LSVL 3LMJL 2ITDA 1FRGL 4DTGL 5GS0L 4NC0B 1MVUB 3QBTB 3GHEL 1DQJA 4N90E 3OB0K 3KPPA 2F58L 1U8JB 1UB6B 1U41A 1MLCB 2IAMC 5EOCL 2H45A 3HNSL 4K3JL 3W9EA 4HSQA 1IAIM 2APBA 1BVKA 5DURB 4EI5D 4JFPB 4XVJL 3QJHB 1KJ2B 2YUVA 3FCTB 3RI5F 1SBSH 2FO4B 2WNGA 3IDJA 3LKPB 5J57B 1G7QB 1NLBL 4NPYB 4CBPA 4RZCB 3CVIL 4X7SL 2GK0B 1H8SA 2IH3B 4KH2A 2N7BA 1FHGA 5DA4A 3U6RA 3T65A 1X5YA 4N5EA 4Y16D 2IQ9L 3DHMA 1RAMA 2GT9A 4OI8A 1KXTB 3ARXA 1ZWIA 3MUZ1 3OXSB 1QFWM 1BQLL 2R1WB 3AXLB 5L2KD 4ZFZB 5T1LB 4MAUL 4XHJC 2D0GA 4Y2OA 1Q0YH 4HZLB 4Z18A 4HULB 5IB1B 2VLLA 3B6SA 2C1PB 1LE5B 2JELH 2Z93A 5C7XH 1RVFH 5FA4B 1DLFH 1KB9J 1EJ6A 1T3FA 4BK4A 3MR9B 4KRNA 1RPQA 2PTTB 2I27N 2NY6C 4WCYH 4KJWC 4OGZA 2AK4D 3L3DA 1BBDL 4YWGH 3VXPA 1N0LA 1S7WA 4UILH 1K3ZA 3TO4C 1KNOA 3BKCL 2WSKA 4PJFF 2HN7A 4NQCA 4GFTB 3DX8A 4JFYA 4XBGA 4JCMA 4Q97A 2GW5A 4KPHH 1NCAL 2UWEB 1YEDA 1IAKB 2H2PC 5DJ2A 2FR4A 2IANB 3PQYA 1BX2A 3QIWD 1RZKC 4MYWB 5AAMA 3T3ME 2ED7A 1G1CA 2YD9A 3FZUD 4JO2H 2P44B 3TN0A 4XCCH 3EFDH 5EC1A 5D9SB 4HX1A 5EA0L 5F1OB 1JZ6A 1FORH 2F54B 1J05A 3A67L 4YDKH 4DVBB 3CLFH 3VG0L 3UC0H 2B0SH 2YPKB 2Q6WB 3WDIA 4Z7WA 2DKSA 4QYOB 3RA7L 3PDGA 1RUPL 4RGMB 2QV2A 5DJXA 4DGYH 4PJAF 2HJKB 2FJFA 2OR8A 2OSLA 4KJYB 5EG6C 3P4MA 4U31A 1O7SA 4JPWH 5I16A 2K3TA 2X2YA 4DN3L 4ZTOH 2BNQB 3OKEB 5IVXF 2XWTB 3C60B 4UNVA 5F96H 2W65B 5C3LD 2VQUA 1KJMB 1HXMA 4XPGL 2VIRA 4PRHD 4M7ZC 5D1QD 2XI9A 1QLRB 1IQDA 1XF3B 3UAJC 5I1DB 5D6DA 4Q74A 5JOEA 1A6AA 4GKOA 5IGXH 5F21B 3HC3H 5ADPL 2AV1B 4M02A 2AAVA 2G60H 2W59A 2YPLD 4OT1H 3QQ9D 3ARUA 4KTYA 1QLEH 1TNNA 3DBXB 5GSRB 4X6CF 3K4ZA 2WBKA 4GQ9H 4APQB 4ZAKD 2B1HH 1S8DB 5KVEH 4P57A 2VABA 3QUYC 4KKAD 4KXZI 4U1NA 4FXLA 4MNHB 4K3EH 3L9RA 3KPQA 4BFIB 4M6AA 4OV5B 4HH9B 4UUJB 4G6KH 1RK1A 2L0DA 4ELKB 2HVJB 1CTOA 2Q76A 3G08A 5D7KE 2C7UB 1T04B 2JB5H 4ZXBA 4LLVA 4E5XB 2ESVA 1I8IB 1FYTE 2NY1D 1FLTX 1RUKL 3D9AH 4EUPA 1MCIA 32C2A 3WS6A 4RA3A 3EYSH 4DUXA 3DURA 4WGVB 2FNBA 3JV0A 5CILH 1UWXH 5ECJE 2H9GA 2NXZC 3GMOB 4L8SB 4P48A 3VRJB 4LCWA 3BRFA 4JANB 1S7SA 1WWBX 4N0RA 3JWNC 3QQ3A 4NFBA 5H2BA 4JFHE 4Z76A 3P77A 4EUPG 2ITCA 3ZTNL 1W72H 2DIAA 1PYWB 4GAGL 1DQQA 1UWXK 3DUHA 3OX8B 4LVOC 4I2XB 4RFEA 2NXYD 4ZO6A 1HE7A 1UADC 1G7IA 5DMYA 2BSED 4PJFA 4R6UA 4S2SA 4X9BA 1FG2B 3A6CH 3FQWB 4K3DH 3N1MC 1SYSA 4OUUB 5ISZD 5HGHA 5LGJA 4F8TA 5I18H 3VXNA 1HQ4B 1MCPH 4EVNB 1YY9C 3B2UC 9CGTA 4OTXL 3VWJD 4NKDB 1FNAA 2VR4A 1YN7A 2E7LA 2J3SA 1T0PB 3GJFH 3KPRA 5D5MB 3T4YA 3LN9A 4XI5C 2BMKA 1INDH 1I8MB 4JG1L 3NA9H 5F6IB 1CF8H 3S97C 4DZ8B 4DUVA 4Q6IA 2Y36H 1FYHB 2X1WL 4GAYB 1J0IA 4NJ9L 1YEHH 4TNVF 1SJEA 1X4YA 1KG0B 2YD3A 4QRPE 1QACA 3B9KA 1KGCD 3VU2A 3GJFK 3ULUD 4OGXL 1FAIH 4M1GH 4PJAA 3IDXH 3T1FA 3TIEA 3CVHB 3P4NA 1D7FA 2VLJA 4JKMA 2IBZY 4YK4B 4G6MH 5ENWB 4G80B 4LQFH 1B0GB 4E41B 3H3PL 3D1MC 1Q9WA 4XZUB 4CMHB 2R2HB 5E94A 5IVXA 3EJZD 5I1GL 1P7KB 5FYKD 4XMPL 2DMKA 2AKRB 3S34H 4MZ2A 1NGQH 1WICA 4RMRA 3H42H 5D2LB 4NQVA 5F7YC 3GIZL 2EH8H 2PO6B 2ADJA 4J3VA 2HMIC 3FT4A 4OLXL 2EZ0C 4YXHL 5MENE 4NN6C 4XNQB 4QT5B 4XP5H 4F7PB 4Q9RH 1ZA3B 1TVBA 5L7XL 3PG2A 3MV8E 4NUJB 4EUPH 2E6QA 3TO4A 4JM4H 4X6CA 1EJOH 2AXHA 1A3LL 1EZVX 1P84K 3SHSA 5DJCB 3FOLB 4HFUL 4NYLA 1DVFA 4P4KA 2EIZA 5LAXA 3G5XA 4QXGL 4ZYKA 5FKAA 4X6EB 3DX9B 3OB8A 4XB7A 1X6LA 4OM0L 4OKDA 1XH3A 5INDA 3WDHA 1T7ZA 2JF1A 4WTXA 3S4SA 3REVB 3L3OA 3H7BA 3BMWA 3D0LB 12E8H 3KYNB 3CK0L 4MJID 4OIBA 3O3BB 1YMMD 1DQMH 3LPFA 5E95B 4UT7L 4YNYB 5LWYL 4OV6F 3U1SL 1HQRB 4JJ5B 4ZS6C 1EFXA 43C9A 1D5BB 4Q2ZA 5CSGA 3TBSB 3S4SG 5CEZE 3LQZA 3NN8A 1LEIB 2P8LB 3MC0A 4NQED 1AQDA 4UT6H 3SDXF 2NTFA 5F7UA 2YD8A 5F9JB 1T1ZB 2O5ZL 1LO4L 1AGCA 1OD7A 2IPKA 2F5BL 3MRKA 2HLFD 4B5EA 5FO9A 5TH2A 4JHZA 3QQ4A 1DEDA 4Q9CA 3SKNB 5I1KL 3O45A 1XZ0B 3MJ7B 1ETZB 1SJVA 2IMNA 5E00A 4KTDL 5E70A 3OXRB 5IIEA 4M48H 1DR9A 3HPJA 4LLQB 3BP7A 2CO6B 2XY1A 3IT8D 3SGJA 1KJVB 4HWZB 5IFHH 2OI9A 3V4UH 3MFGB 3HZMB 4QRSA 1MCQA 2LAAA 3GB7A 5FXCH 1OTUD 3QH3B 4OCSH 1FFQA 4JN1L 2UYLA 1JGVL 1ZHBB 4P3WA 3H9SB 3QEQE 2AV7A 3P0VL 5IKCA 3C5ZD 1YNLL 4JFEA 3WV0A 4UDUB 5FFLA 4P2OC 1G7LB 4JE4B 3EYFB 5KSVA 4OCWL 5EBWB 1VGKB 3BIKB 3VXSA 3S88H 1F97A 4QGYA 2A2QT 4PJDF 5CJ8A 2R69H 3VCLB 4X6DB 1TJGL 5LJYH 1WCQA 3QULB 2CR3A 4HKBB 1U9KA 2ARWA 4P59L 3KWWA 3VDBA 3FTGA 4L4TE 5DURD 2YHGA 1CD1A 1QQDA 1LO0L 3MRBA 3GUTA 1W0VB 4XCYB 3JWDH 4LVNC 3L7EB 4NQDA 5JHDE 5IBUB 4OD1L 4OQTL 4PJBB 4D8PA 2HAZA 3ZE2E 5GS2D 3QRGH 5KZCD 4NGHH 1G7HB 2OR9L 2I60L 1C16A 2YS4A 3I6KB 3MOBL 1RK0B 4Q0XH 5IB2A 3C9NA 2W0FB 1L6ZA 4AEFA 2DIJA 5CEYB 4NO2B 3VFOA 1X5XA 1T03L 3BT2H 3UDWC 3VRLF 4YFLI 5IW1B 3BUYB 3GIVA 1CLOL 1I9RL 3O2DH 1FNLA 1KN2L 1RZKH 4O2EB 5B38A 3FB5A 4YPGB 1VB9A 4N90D 4KUCF 5IHUL 1LDPH 1NDGA 1YC7A 4PV8B 4G3YH 1ONQA 3HS0A 2YZ8A 5CHNB 1JCKA 4EDWL 5DK0B 5C3TA 1A3QA 2XZCL 4XNUH 1RZJL 3NZHL 4NO0B 1INQA 3VXRD 4OF8A 4RAVB 1CE6A 5T3XH 1UWEL 1RV6X 3KVQA 3I75B 4YC2B 5B38G 3TV3H 1IAOB 4PBWD 4GXVH 5HHQA 3HA0A 3KLHD 1KIRB 4ZOCA 5GGRA 2XT1B 2AERT 4WU7A 3MJ9H 1ZT1B 4JJHA 1SJXA 1A7QH 1SBSL 5KS9B 3KG5A 1ED3A 3LDBC 1T7WA 4M03A 1KPVA 3QDHA 5MEQB 2FDBP 2AXFB 1NBVH 3PP4H 3QXAB 4POZC 3ARDD 5IMMB 4Y4HC 4I77H 5HVGB 3ZKNC 1CDCA 4M7LH 3SJVB 2ADFH 1C08B 1F4XH 1QFUH 2BNRB 3FFDA 3BMVA 4R4ND 3SDXA 4NQCE 4PJIF 1Q0YL 4AEIH 4Y2DA 2ZJSH 1U0QA 2BK8A 4RQQA 1S7VA 2LV4A 5D96C 3CFEA 3FN9A 5IHBA 1AGDB 3ETBF 4LBEB 4DEPC 5C7XL 1KLFA 3PQYE 1RVFL 1DLFL 1GH7A 5DUBB 4HXAH 1J12A 1FNGB 2XPGB 1HN1A 1QLFB 2BNQD 1T22A 2E8YA 2XG4A 3CLEH 1C8PA 4WCYL 2P8PA 3SGKA 2Y06H 4YWGL 1Y18B 3TIDA 4MXVF 4NRYB 1JNHA 4UILL 2C5DC 2K9UA 4ONFH 1ZLUH 5I75B 1ZS8B 5ALBH 2H6PB 3CDFA 4Z7WE 2BHYA 4KPHL 4U6HB 1JPFA 3O6FC 5FM8A 4PR5B 3MCG1 4PTUB 2PXYD 3DGGB 3MRQB 4YX2L 4LARH 1CN4A 4R2GC 5HTSA 3GBMH 2CDFB 3SQBA 5F6HJ 1OAYH 4JO2L 1NMAL 4APQD 4PJDA 4XCCL 1BFVH 3GK8H 1ZLUK 1QKZH 5K9KB 3EFDL 3EYUH 4XNYH 2EDBA 3WUWB 1WT5A 1FORL 1TQCB 5HJ3B 4F8QA 4YDKL 3CLFL 4WV1C 3HHRB 5F70A 3UC0L 3DRTB 2B0SL 3QPXH 1FZKA 5J12B 3MGTA 1R24A 3WD5H 4IRJB 4DGYL 1I1AD 3CZJA 5D8JH 4G7YH 5DO2C 4TNWK 1A47A 4OZIB 1XGPB 4JPWL 3VMNA 1NBZA 1NDMB 5F7DA 1FZMB 2BNUA 4OFYD 4W4OC 5EU5A 3ARZA 3D85D 4NN5C 5F96L 5H35B 3TPKA 5JDSA 3W5MA 3L3JA 4ZFFB 3DECA 3SDYH 5B8CA 1EO7A 3QIUB 3E2HA 2C3GA 1KCSH 2I25N 3MROA 1SEBA 1T1XA 4TQEH 5D1ZD 2VL5B 3EGSA 3TJHC 3QUZB 3ZE0F 1Q94A 2C4XA 4PJEF 2OL3B 1F3JB 3BFOA 1MY7A 3ZLQC 1N8ZB 5IGXL 3TBVA 1FVEB 2ZUVA 3HC3L 4G9FA 1NGZB 1B88A 1AGBB 5DFVD 1TVHA 3GSOA 4XNMA 4OT1L 4FQHA 4PP1C 2ESVE 1ZOXA 1AGFA 2VXVH 1QLEL 4PRNA 1H15A 1NCNA 4O9HH 1S3KH 2DYPD 4DKDC 5FM5O 1JGDA 4U1SB 2B1HL 4WTZA 5C08B 4AENA 1FYTD 5KVEL 3HI1B 4FFYH 3R0NA 4LCWE 4LGPB 5E4EB 4K3EL 3TP4A 3OKOB 3BPOB 4A6YH 4G6KL 5JNYB 2X7LB 2A9MH 4FG6D 2VO5A 4PP8C 1ZHLA 1ZLSH 5L0QC 3SKOA 2JB5L 2YUZA 4NKOA 4WTZG 5L8LB 3D9AL 5IUSA 3EYSL 2VJXA 3CD4A 5F1NA 3QEUB 5CILL 4JRYA 1ZT4B 1I7TA 5B22A 4WY7H 4PJFE 4CJ0A 2XQBH 4WHCA 5INCB 1MHEA 5HSFA 2KL6A 4PJIA 3M1BA 2OZ4A 4EIZC 4TPRH 2IPTL 3MJ8A 5BZDA 1JNJA 4XWOD 4PRDA 2Z92A 4XPTH 4CGTA 1E6JH 2VITB 1JHTB 1LHZA 3O41B 4XWGL 3X14A 1VESA 1W72L 1QOKA 4BFGA 2E7LE 3WIFB 5FECB 3IDIA 3KPRE 1IBGH 4PRPB 3MV9B 1I1RA 4CVZB 5DMKB 1FL6A 4ZOAA 3GZKA 5DTFA 4H5SA 3WNLA 2QKIB 4Y5VB 2PO6D 3HUJB 2G75A 4MGXA 4WO4B 1LQVA 1N5YH 3A6CL 3W0WB 3LVEA 4K3DL 1BM3H 2BCKA 3DX6B 3UZEA 5I18L 3GSRA 1MCPL 2R2BB 1MCOH 2OM5A 1KSRA 4PJAE 4P23A 3RGVD 4QRPD 2HLAB 2VLJE 1BJ1H 2GSIB 1FCCA 5GRJH 5CFHA 1PG7H 1UM4H 5IQ9B 2QADB 1INDL 3O4LB 4KZDH 3DI2B 3NA9L 5IVXE 1CF8L 4P46A 1X5JA 2Y36L 4PB0H 5HDLA 1I1CA 1FIEA 1YEHL 3AREC 3WEXB 2OTWA 3CFBA 3SDDD 4GW5A 4KRPD 1WISA 1HH6A 1VFBA 3WS3B 1JWMB 1DBBH 2KZWA 2VLRB 3FFCA 2R2CA 1FAIL 4QHUB 4M1GL 2E5EA 3IDXL 3U4AA 1HWGB 2BC4B 2A6DA 3MYZA 5HI5C 4RAUB 4NQXA 4G6ML 4LQFL 4IOFC 2HT4C 3KJ4B 1HZHH 4YAQB 1WFNA 4GW1A 8FABA 1R3KA 3KYMA 3O9WB 4OCMC 2X4NA 4X6CE 3S34L 3MRIB 1NGQL 1JPGA 4WHYG 5CD3A 3BN9D 1OTSD 3H42L 1T80A 4N9GB 4PJEA 1S9XB 4F2MB 2FJGA 4K71B 1C7TA 2CLRB 3UZVB 5J4MA 3ROLA 1KTRL 4XC3H 4XP5L 3FQNB 1U58B 2Z8SA 3U79A 1QR1A 3RRQA 4Q9RL 2HFFB 1PEWA 2XKSA 2QL1A 1CQKA 5DZLA 2X41A 4XBPA 2MKLC 1L6XA 1YJDC 4JM4L 5ID1A 1EJOL 3B2VH 2GKIA 1S7QB 4QF1A 3ARGC 1EXUB 1XCTA 2VDRH 4DCQB 5HHXH 2Y7QB 1J1PH 2J5LC 1I1YB 3CX5K 1N4XH 3O6FA 1ADQA 2V2XA 2C3VB 2WAHA 2OZ4H 5DEFA 4X98B 2EDDA 1T89A 5CEZD 4FTVA 1OPGH 3LS5H 1CXFA 1WC7A 4P0DA 1IEBB 3GNMH 4KK9C 4BH7B 1NANI 4F7CA 4YBHA 5DVMA 1DQML 3O8XD 4S10A 5BV7B 5ICXA 4NZTH 3BH9B 3HC4H 3TYFA 4KWUA 2FH8A 4M93B 1JVKA 4OF3A 1KB5B 4I5BB 4PG2A 2UZXB 4PTTA 4U1JB 4D9QE 5HYQB 5TFSH 3VFSA 5GGUB 3T0XA 3KNBB 4R0LC 3MRDB 4KKLD 4UT6L 3O2WH 1RJLB 5F88A 4MCZB 1V05A 4HIIA 5IMKB 3D25B 3EZ8A 3KLAA 4HS3B 4R90H 2XOTA 2X70B 2OQJA 4LLUB 1D5XB 4JFEE 2L7JA 3V2AR 1LO3H 5EUOF 5KG9A 5AUMA 3QEQD 4KKBC 4M48L 3VXSE 5F3HA 2C3WA 4FXGB 4MS8C 1OAUH 4C56B 2VDPH 5JHLH 4TTDC 5T1KA 3ZHLA 3V4UL 2CDEB 1FFNA 2NYYC 3MLRH 3SDAD 4G8GA 3EO1B 1ZVYA 3D3VB 4OCSL 3ECBB 3UYRH 1NC4B 1R3LB 4NQDE 4L4TD 4PP2B 3F62A 5J9PB 1EEZA 1NMCB 3UZQA 4GSDH 4HKJB 1G1YA 4X7DC 3TJEH 5ICZA 5JHDD 4I3RH 3WFCH 3S88L 1RZFH 3DRQA 1RJCA 2X05A 4M8QA 1JUFB 3U9PH 2R69L 3WIHH 4NRXA 2LU4A 4IDJH 1ORSB 4ONGH 4PY7B 1CVSC 3I9GH 2EC9U 1ZK9A 5F9AC 1D9KD 3JWOH 2OJZH 4PG9A 3ALXA 4K94C 4PLKD 3JWDL 3GBLA 1SHMA 5ALCL 1H0DA 2WINB 4JPIB 1NEZB 3NFNA 4KDVA 3QRGL 3DMMC 5CEXB 4H20H 4NGHL 5I74B 1ZANH 4Q0XL 3BPCB 5C0GB 5EBMA 1R3JA 1BQHB 3EIFA 4KK5C 4OLWH 1ZGLA 3RVWC 3MLTB 3P40A 1ADQH 3BESR 3G5YA 3BT2L 4S0SD 5JIKA 4FQXC 3HE7B 1FGVH 2RB8A 4N9OB 3T0EE 1RZKL 3O2DL 5TDOB 4X6FA 5C6PB 4AG4H 4R96B 1D5ZA 1T21B 3GJEA 1LDPL 4ISVB 4GW4A 1EX0A 1S9WA 4ZS7H 4G3YL 2W9LA 2P49B 4YH6A 4N68A 4XNUL 4LIQE 4G43A 4HAFA 1GGUA 5T3XL 3VXMB 1UQSB 1E27B 2GY5A 1AD9B 5DVNA 3TV3L 4O00A 3CXDH 3P9LB 3QNXA 1R0AH 2XV6B 2DL9A 1D6EB 3BDBA 2F53A 4GXVL 4ZUTA 4AZ8A 2Q8AH 5ANMB 4XGZA 1ZVSB 4C4KT 3WXVH 3CU1A 35C8H 4MQXC 2FO1A 3SDXE 3ME0A 5DEZA 1JN6B 3MJ9L 2EE9A 4UBDC 3BGFC 1AHWC 4UINH 4LGSB 2YEZA 1SYVA 4ODBD 4FQJH 4NQCD 1IL1B 1EEYB 5A3ID 1OGAB 4EZMA 4ERSH 3IKCA 4XCFH 1NBVL 3PP4L 5E7BA 4NRZA 1E4XH 2VXTH 2G5BA 4Q6YA 2WWKO 1WBXB 4I77L 4M7LL 2ADFL 1VKXB 3F7VB 3BPNC 1F4XL 4Y4FB 1QFUL 2P1YA 3L7FB 3MXWH 3GMNB 5IHLB 3M07A 4IOSD 3UTTA 1S7TA 4IRJD 4JFZH 4AEIL 4BH8A 1H3VA 1E4KA 4PRIA 1V3LA 3I02A 3ARQA 4UDTB 2ICES 4P5TA 1DBAH 4HXAL 1BLNA 4PGEA 1X5HA 3BP4B 2NW2A 5D7LB 3L3HB 5J11B 5E6ZA 3CLEL 3CFDA 3R4DA 5EUOA 4P5KB 3QIUD 5D7JB 5IK3A 1UC6A 4PJDE 5J1AB 1Y6MR 2Q86A 4J4PC 4NQTA 4OCYH 5GGQH 5MHSD 3QUZD 5K9JH 1UZ8A 4PPTA 5IW6B 4ONFL 1XIWB 2LE9A 3QZWB 5ALBL 1H5BB 4EI6A 5C70A 3MMEA 1DQDH 3DUUB 3IAPA 2CIKB 5TDNA 2Q7YA 1DBMH 2R2EA 4U1IA 5JIHA 4LARL 4M4RA 1NEUA 1UG9A 1WF5A 3MRGA 4PJCB 2YR3A 3GBML 3WKMH 1BFVL 3GK8L 4NO5B 5C08D 1QKZL 4XVTH 3EYUL 2BXYA 4XNYL 5HI3D 1DTUA 3SGDH 4GAJH 3C6SA 3VRLE 1P1ZB 4YHZH 1G6VK 5I2IB 3QG6B 5DD6A 1HSBB 1T0MB 3QPXL 5HI4C 7CGTA 4J8RB 3ZKMC 3S96B 3MSPA 2KH2B 2WBJC 4HWEH 1P6FA 3WD5L 4L4VB 1DDHA 3PJSB 1HDMA 4G9FE 5CIPB 3F58H 4OCLC 3LCYA 2RQ8A 5D8JL 4I0PA 1K8DB 3PIQB 5I30H 5JW3L 2EO9A 5TE6H 3VFUA 4KI5F 2VAJA 4I9WE 2PCPA 1BIIA 4R0LA 1I8LC 3SDYL 4ODWA 5DRWA 4ZXBD 1KCSL 4L29A 2ESVD 1F6AA 4TQEL 1GOFA 2P24B 5HY9A 4PJ9C 1H8OA 1A0QH 1GIGH 2D9QB 5IVZA 3AMLA 4KZEH 2ORBL 4OFDA 4AM0B 3QO0B 1I3GH 1KBGH 3AVEA 4LCWD 1CK0H 4PRPD 5MI0B 4FA8A 3MV9D 4W6XB 3UTSB 2ZCHH 4YHNA 4WUUB 2X4OB 2G2RB 4QGTA 1S7UA 2VXVL 4PRAB 1X4XA 4S1DD 3TVMB 5IMOB 2IH1A 3LKRB 2JIXB 3RDTC 4A2MA 4DFIA 4O9HL 5DXWA 1S3KL 4HLZG 4LNVA 4WO4D 3PL6C 4R4FH 4R7DB 4JRYE 2SEBB 1HHIB 2NW3B 4LCCA 1YEKH 4FFYL 2AEPH 5D1XB 5E9DA 4OZ4B 1QEWA 1IVLA 4PJIE 4A6YL 4D9RE 2A9ML 3BJLA 4OZGF 2BRQA 1KULA 5B39A 2FHBA 1ZLSL 1K2DB 4M5YH 3BQUC 4PJ8C 4V1DA 1I8KA 1PFCA 2QADD 3O4LD 3MRCA 5E56A 1EAPB 1KT2A 3QNZA 2A0LC 3NFPA 3BVNB 1HSAA 1JZ8A 3S35H 1XGYH 3WLWD 4GUPB 4X5XB 4CADA 5FA3B 5BJTA 4U3XA 1VFUA 4GBXA 4I0KA 4MXVE 3RZCA 3KPRD 3IETB 3JSSA 3V7MA 1OB1A 4WY7L 2Z35A 3BZ4B 3ILPB 2XQBL 2ATKB 1K9TA 5B39G 4YUEH 4UB0H 5FGBC 2DF3A 2ZOLB 4FP8H 4Z0XA 3OJDB 3I84A 4JM2B 4TPRL 3G6JF 4DWHA 4XPTL 1YJDH 2HFEA 1E6JL 3W11C 5ETUA 2FBJH 3CSYA 3B9KD 4J1UB 5J3HC 3O9WD 2HT3C 5CZKA 5IESH 1IBGL 1KFAH 4FQXA 5GXBB 5A16A 2IBGA 3I3BA 5EFIB 5IEHB 1N5YL 1BM3L 4X99A 1OTTC 4JKPH 3VWKB 3EO0B 1PX3A 3FFCE 3QPQC 4HHAB 4MDIB 1HI6B 4UIKH 3RX5A 4YIQB 4R97B 5ESQA 4PJGF 4X5WA 3ZDYF 1L7TH 5GRJL 3VMPA 1PG7L 1UM4L 4LASH 2A9NH 3VD3A 1S9VB 4KZDL 1DUYB 1G7MB 4OBRA 2BX5A 2X89D 2VDNH 1MI5A 1RUMH 3ARTA 4PB0L 1N3NB 2PYEB 4WI8A 1FFPA 5CWSA 1A6ZA 1F4HA 3ZE0E 2O93L 2IALA 3AFLA 1DBBL 3AY4C 4PJEE 4P9HH 2JK5A 2Z31A 1QSZA 3QO1A 5IFAH 1SJHB 1UA6H 1CLCA 1KIQA 4AY0A 4M1CC 3THMH 1K4CA 1I7RA 1DVFD 1IARB 3VFRB 4P4KD 3H0TA 2BSSB 3DETC 4X7FC 5KW9H 4Y0GA 1T5XB 1CQYA 1U8KB 2CSPA 1HZHL 3KS0H 3MV7A 4IRSB 1UVQA 3QUMA 1ODAA 4HJ0C 1U42A 5FK9A 2HTKC 3EYOB 3QEHA 5A2LH 1CD9B 3RFZC 5IJKC 4K7PX 2VXQH 4EN3A 2XZZA 1EBPA 4KROD 1BBJA 5E6IC 5SWQB 1AGEB 3CFJA 2DICA 1XF2A 3GSUA 1V3JA 2HJLA 4XVUD 3ARWA 4Y1AB 2AJ3A 1AR2A 1J8KA 5EOTB 1A6WH 4XC3L 1CFQB 3UTZA 5IEKB 1L4IA 3WE6A 4FTVE 1X7QA 4UOW0 2UY7A 1SVZA 2W0PA 3OKLA 5GZND 2NR6C 4J4PA 3K3QA 3LH2H 3RWGA 3N1PC 4MQSB 3CFKB 5EU3B 3MXVH 4LRNH 5T33H 3B2VL 4OLUH 4YO0B 2DLGA 3BGAA 5KN5B 2VDRL 1X5ZA 5HHXL 1HOCA 4K94H 4I18C 1J1PL 3MRMA 4G6FD 5HPMB 3KGRA 1B6DA 4NDMA 4WTWA 1N4XL 3OJVC 3P9MB 1ZA6B 5IROC 3VFNB 2OZ4L 1UWGH 4Y5XC 2E3VA 2FSEA 3G5ZB 3PWLA 4OZGA 1U2HA 4OI9A 4WW2B 2D7QA 1OPGL 5D2NB 5FUOH 3RWCB 3LS5L 4P2RA 3GO1H 3GNML 4QXUH 2YD2A 3FB8B 3LEYH 5FCUH 5DFTA 1E28A 3U36B 4Y5YB 1F3RB 2X1XR 5C09A 5I1JH 2DI7A 4NZTL 4XTRC 3HC4L 2PW2B 2VZ1A 2CDGA 5J13B 5KSAA 3TZVD 3RWIA 5DJDA 4HPOH 1DJSA 4X83A 3SCMC 5TFSL 4JFED 4PYGA 4UU9A 4WJ5B 3G6JA 2ZUTA 2PTVA 4XCEA 3MLWH 3TH4T 3HZKA 3O2WL 1A4JA 1JYNA 2GUOB 4FFWC 4G8GE 5AD0A 5EDXA 1JF1B 1S9YB 4R90L 4X7TB 3F7YA 2LVCA 1B9ZA 1W8OA 3HZVB 3SDCC 3QDGA 4HCRH 1P9MA 3O3DB 1LO3L 3U82B 1HHHA 4B53A 2UZIH 1INEH 1N2RB 5I9QC 1HHJB 1N64H 3OSKA 3AB0C 1FSKC 3FO9B 3LY6A 4O2FA 1OAUL 2VDPL 1P6AB 4OIIH 4QOKA 3GI8H 4XXCC 1KJ3H 5D93B 1PZUB 2EE3A 4CVWA 1MEXH 2QQKH 1FP5A 3IJYB 1YC8A 3MLRL 5JPNA 4OF0A 4HUVA 3RDTA 3UYRL 3D48R 1XGRB 3GGWB 1MHHB 1WZKA 5FO8B 3QUMH 3TA3D 4ZODA 4EI5C 5GGVH 4KJQD 1GZPB 3CMOH 4U7MA 4GSDL 3IXTA 4JFFA 3TJEL 3JV6A 4ORGA 4I3RL 3WFCL 1RZFL 4XPHH 3U9PL 4QCIB 3RWHB 1C1EH 3WIHL 4V2BA 4N1EA 3ARFB 4PREA 4IDJL 2UVFA 1RZ8A 4ONGL 3I9GL 3JWOL 2OJZL 3BQUA 2WW8A 2ARJQ 4U33A 5AYQA 4HDIA 4PGBA 4U1LB 4PJ7F 4JY4B 2V9RA 3MRLA 2NLJA 4YHOH 3UMTA 3T0ED 1U91B 4ZQKA 3LZFH 4X4XA 4H20L 4HIEA 3ISWA 1C5DA 1HHKA 1T66D 1ZANL 2I26N 4LLDA 1IC4L 3KPNA 1WIUA 4P3DB 1DUZB 2YA0A 4WWKA 3SPVA 3RHWK 4ZUSA 3X11B 4OLWL 3S37H 4RWHA 4Y4FD 3MO1A 2HKFH 3R06B 5C9JB 4KRLB 4TVPD 1ADQL 3RL1A 3SBWA 1FGVL 2F53E 5GQBA 4DN4H 4MAYB 2GQHA 3U2SA 3F12B 5T5NG 3L6FA 2BRRH 5SV4A 4AG4L 3C6LB 5IB5A 2OTUA 4ZS7L 3O3EB 1P4IH 4PGDB 4U1KB 5EWIH 3MACH 4NQUA 3G6AA 4Y2DD 2B2XH 2NX5A 4HGWA 3LV3B 2J8UF 4XPFH 3ARRA 1QYGH 4L8CA 3GHBH 3QIWC 3DI3B 3L3IB 1QRNB 4MA8H 1G9EA 3CXDL 1R0AL 4BZYA 5BW7C 5DS8A 2Q8AL 3FZUC 4X0KB 2DB8A 1YMHA 1NCDH 2R1YB 3P4OB 1DCLA 2DWEA 3WXVL 35C8L 3VJ6A 4DFHA 3UTTE 2VTFA 2LTQB 2Y9RT 5C0CB 3TCXA 1FJ1B 1AE6H 3GSNA 4P2YA 4UINL 1IGJA 4QWWC 5HYIA 4PRIE 2AQ3A 1BFTA 1WTLA 4FQJL 3W5NA 4W6WB 2EC8A 1F90H 4KDTC 4ERSL 4OZHF 4WFHE 4XCFL 1FE8H 5FGCE 1E4XL 2VXTL 5EUOE 4QXWA 3DV4A 4G6AD 3TBWB 1KTDB 3DJ9A 3U30C 3GMPB 3ES6A 5C0AA 3MXWL 4K3GA 3RKDC 1C12B 3L5IA 3QDJA 3MNVA 1YPZF 5D71H 4NUGH 4L4VD 3BO8B 1UH4A 4JFZL 5IBLC 4Y89A 5F89A 5AEAA 1Z3GL 4M4PA 4YFLF 1UH3A 2VDOH 5D1QC 2CIIA 4HJJH 1AXTH 1P4BH 5IJKA 1DBAL 3BXNB 3MFFB 1CICA 1BVKB 3B3IB 3P0YH 4JRXA 3PXJA 4R4BA 4UIMA 1EHAA 4OCYL 3K2UH 5GGQL 4UQ3B 3VFPA 5K9JL 3QQ9C 2GAZA 1S5HA 3TBTA 3T65B 3ALWA 3QUXB 2CKBA 4OKVA 2FEEI 3CU7A 1AJ7H 3P4LA 2PN5A 1DQDL 3WNOA 4KKAC 4F9LA 3C5JA 5EU6B 5A1AA 1ITCA 1DBML 3ZO0A 4WUUD 5JO5A 4MJ5B 1U8MA 5DZOA 2JIXD 4LHQB 3SE3A 5BOPA 5FGSA 3WKML 2NY2B 1RUQH 1VEMA 3B6SB 4Y5XA 3BEWB 1IGCH 4XVTL 5D1XD 4GAJL 5MEOA 4YHZL 1KF9B 2ZUUA 4HAGA 1CFSB 2PETA 3UTOA 4I9WD 4JKLA 4PJ7A 3M17B 4E42B 1T83A 5JZ7D 3U9UA 2BOBB 3G04A 4HWEL 3BOVA 3VXUD 1J1XH 1FZOA 3F58L 4NC1C 5ITFB 1M6OA 3DX8B 5I71C 5E8EB 5I30L 5TE6L 3OKDA 2BVQA 3AU1B 1PQZA 5BS0A 4TRPH 3CCHB 3DPBA 1WWCA 5DJ2B 4LCYB 1W72B 4NBYB 3WNKA 4HMDA 5JOFA 4FFZL 4ODXB 3KDMB 4JM2D 5E9DE 2NXYC 3OR6B 1S7XB 4WEMB 1A0QL 4JZOA 1GIGL 4FRWA 3GSNH 3DSNA 1U8PB 4FZ8H 4HX1B 4KZEL 2XN9A 5MEPA 2BOCA 5IWLC 1JK8B 1QA9A 1I3GL 3FQUA 1MJJA 1CK0L 3UPCA 2ZCHL 4V1DE 4WDIB 2EDNA 2Y5EA 2J8UA 2DOCA 4EQ3A 2R4RH 2VERN 4LPUA 5CBAB 3IDNB 1MJ8H 5TPWH 2AABH 1U3ZA 5LGHH 3L5WA 3GJFB 5HYFA 1NBYB 2OSLB 4R4FL 3GM8A 1DL7H 3LRSA 1JBJA 5FOBA 2ENYA 4IIQC 1YEKL 4LLWA 2AEPL 3QWOA 3VWKD 5CBEA 1E4JA 5C0FA 4U6XA 1KB9K 2AVGA 3PABA 3VFVA 2FH6A 4PB9H 3QI9A 3S8WA 5FDWB 3HC0A 1AD0A 5EN2A 3HPLA 2P5WB 4NO3A 1F3DH 4M5YL 2FLBT 2J12B 4OZHA 4YHPB 3ULUC 5GRWA 1IQDB 5EO9B 3E3QC 1RY7B 4PGCB 1Q1JH 1A6AB 2R0WH 3S35L 1NGXA 5C1MB 1XGYL 2PYED 3RVXC 4Y16A 4D2NA 1MQ8A 3LKOB 4TUOA 1BZ9A 5I17B 5J6HB 3EJZC 5DK2B 3O3AA 1YPZA 3UTPE 3VH8A 1M7DB 4YUEL 4UB0L 4D3CH 4P46D 4FP8L 3UPRB 1YJDL 2LFGA 3CH8A 2FBJL 4JZNB 4WFFE 4JB9H 4N0FA 3BSZH 4DOHB 4QHMB 3X17A 4DKFH 3QAZB 4Z8FH 3MYJA 3KPQB 4Z7NF 5IESL 4IRZH 1KFAL 2VN4A 5GS0C 1RK1B 4OBSA 2XKUA 4L3EB 3VH8G 2Q76B 3G08B 3LKSA 5EU7C 3EKCA 4C83A 4YGAB 3L95A 1LDSA 1MI5E 3FKUS 1R3HA 2I07B 3BKJH 1Y6KR 4EUPB 1GGYA 1R5VB 5H94A 3MLUH 5TGBA 4JKPL 2VQ1A 3W81A 3C09C 4AEEA 5I1LA 2ARJA 3FMGH 1JGEB 1CT8B 4X6BA 4UIKL 3WFHA 2EEBA 1KCVH 1G9MC 1L7TL 2YRLA 1UEYA 2ZUWA 3QIWA 5HVHC 5D6CA 3MJ6A 4KI5E 4LASL 1MAMH 2BHUA 2A9NL 3MV7E 5IR1B 4LDLB 3FHQA 3PWPD 2VDNL 4CJ1A 2A73B 3TPUB 4DVRH 3GSXB 2XZQH 1BOGA 1QBBA 1U3HC 4OD2A 3ZYJA 4KHTH 1BZQK 2APXA 5GGRY 3BRDA 2OMNA 3RP1A 2GITA 1EA9C 4XC1H 5AZEH 5FAAA 4P9HL 3KXFB 1TENA 5IFAL 1NH6A 1UA6L 4ZUUA 3IU3B 3THML 2IJ0C 1XEDA 4U6VH 1WAAF 4H26B 1ZV5A 4KMTH 3DUSA 1JI2A 3RQ3A 5KW9L 4XRCA 3E6FA 1SYSB 1K4DA 1H3WM 5F1IB 1AO7A 1NUGA 3ARBD 3BHBA 2FGZA 1KCLA 4H1LA 4POUB 5I66A 2HLFC 2VXQL 1A3RH 3UBXB 4KKCC 3JTTB 3OJ2C 3H9HB 2WV3A 1IM9B 5CP7B 2DQJH 4KV5F 4TUJB 2IAMB 2VAAB 4BSVB 1G9NH 1PLGH 3X12B 4OZGE 1A6WL 4JFXA 5CKGA 4QRUB 4ETQB 4K23H 3RPIB 1ZSDA 4P2RE 4H1LG 3FQXB 5E8PB 1IJ9A 1N5AA 2YPLA 3LH2L 3R0MA 5GS3A 3MXVL 3QNYB 4LRNL 5T33L 3WO4C 4OLUL 5C09E 3W39A 3CX5J 4PJ5D 3V0VA 1X6NA 4S11A 4K94L 1HEZB 4ZAKA 2ICEB 4KMLB 3C5ZC 2V5TA 4MJ6A 2Z91A 2XQYG 1F2QA 1GL4B 3AM8C 4HF5H 1QO3B 1UWGL 1JHKH 3G6JE 2A6JB 5A2IH 1UCBH 1HIMH 2A74A 3BH8B 5TE7H 5IF0A 5LG1A 5FUOL 3WJJA 3DVNB 3GO1L 3MGOA 4PBVC 1DN2A 1XGTB 5T1KD 1KPRA 4N1HB 4QXUL 3LEYL 5C8JB 3BW9A 1I1FA 1DE4B 5FCUL 3U0TB 4HBQA 1N6QH 1SMOA 5I1JL 2NY6B 4G8GD 5DRNB 4CDGC 3QDGE 3MBEA 2FIKA 4HGMA 4AH2B 5TQ2H 4F7EA 3ABZA 4HPOL 3TO4B 3UYOD 4QOKE 5IV2B 4QHNB 2YXMA 3MLWL 4UNTA 3FQTA 5IOPA 1A6TB 5DYOA 5DF0A 5DJYA 3I6LE 1A1NA 1I7ZA 4OQ1A 4RSVA 4DAGH 3VGBA 1F58L 3I50H 3FB6A 4G6JH 3RNQB 5DZNA 1WTGT 2VC2H 4GKZB 3RX8A 1A7RH 1CLZH 1T1WB 3N50A 4HCRL 2V5MA 2X5PA 2E7MA 4ZUVB 4JFFE 4GG6F 1UACH 4GRWF 2UZIL 1INEL 5CAYB 1NCCH 1N64L 5IWLA 4OIIL 1FG9C 1U36A 3GI8L 4LP4A 4OAWB 1KJ3L 2D0HA 1MEXL 3F7QA 5ISZA 2QQKL 3DROB 3IGAA 4HQQH 43C9B 1U8HB 5DUMH 4N0CD 5DSCA 1H3TA 5A2FA 1CFVH 5HDQH 3VWJA 5I1AB 3MLZL 3MGAA 1D5IH 4Z5RB 2GJJA 3NN8B 4J3WA 3KLHC 1JTPA 3WL9A 1XF4A 3QUML 2RFXA 5GGVL 2NTFB 3CMOL 4IIQA 2BFVH 1CS6A 4H1LH 1F2XK 3WHXB 1BVLA 4XPHL 1Z5LB 2APTA 3IFOA 3MLVH 5TH2B 5ABDE 4QTHA 4YDJA 1I3RB 4M7ZB 3ARDC 5KSUA 1WAAA 3RWEA 4HV8A 4Y4KC 5SV3A 1Q9LA 4NBXB 3CH1A 2GSGA 4C4KO 1YQ2A 4GRLA 3WN5C 4HW6A 3MLPA 4YXKH 4YHOL 2F53D 4R4NC 5IHZA 3LZFL 5EORH 1VFAB 4AMKH 3LKNA 4RGMC 3RKPA 3SO3C 4QRSB 4KY1H 4LEOA 3GB7B 3QR2A 4LSUH 2ZUXA 4EEEA 5AG9A 2NX5E 2RJMA 2WUBH 1JGLH 3S37L 5CMAB 2HKFL 3STLB 1XR8A 4LPYA 3TNNA 3ULVF 2XQYK 3GRWA 3L5XH 3QUYB 4KAQH 4G8IB 4DN4L 4IHOA 4ZFOA 3KLDA 4X8JB 3VXSB 2BRRL 2CLZB 4LPXA 3WLBA 2W9DH 4AL8H 1P4IL 1JJUA 3LPWA 4HUMB 4LAQH 2BZDA 2C9AA 3OF6D 3UTTD 3D39B 5EWIL 3MACL 2GTZB 1MLBA 1CGYA 2VN7A 2B2XL 2OX5A 4MWFB 4NJAH 4PRID 4XPFL 2PXYC 3VFMB 1QYGL 4NQDB 4U05A 3GHBL 1KLUB 3HE6A 3IFPA 5HHPA 2DLFH 4MA8L 3TEUA 4W81A 4EJ1C 4P5TD 1CGXA 2LU7A 4WFHD 2NXZB 1T2JA 2BVOB 3QUXD 5GRYA 5C0AE 1NCDL 5CZXD 3Q6GH 5C86A 3ZL4H 1VEOA 3QDJE 3S36H 2BHZA 5EU6D 2H2SD 3GSVA 2UWEF 4LSPH 1AR1D 5EU4A 3FT2B 2CLVA 3CFIC 4MJIA 5BRZA 3REWB 4V3DB 1F90L 1YMMA 1CDJA 2NY2D 4FQCH 1FE8L 4MB4A 1I1AC 1NDGB 4LVOB 1RFDH 2B39A 4S0UC 3HS0B 4G8EB 4JQVC 4WFGE 4JRXE 3VXTA 1FO0H 1FV1A 4ZPVA 1CE6B 3VA6A 5D71L 4NUGL 5EOQH 2P43B 1N7MH 5FO7B 5FHBL 3I3DA 5D1ZC 2VDOL 3IDMA 2V5SA 2X4QB 4HJJL 1AXTL 1P4BL 3FO1A 2GTWA 2ZOKA 5CCKH 3T0VA 4LPCA 1VDGA 3P0YL 5TE4H 4D9LH 4YDVA 1H8NA 1Z0NA 4QRTA 3K2UL 1ED3B 5DFVC 1JPSH 2DQHH 3G5VB 3ULUH 1TMCB 1HK6A 3KR3H 1QVOA 4PJ7E 1AJ7L 3CZFB 4NCC2 2DM2A 3E6HB 5E2TL 3KJ6H 4GLRI 1TJIH 4J2XA 3RWJA 5FYKH 4FG6C 3LKQB 1T6VN 3QFDB 4A6YB 1EO5A 4GMSH 4FS0A 1RUQL 1MVUA 3V6OA 5BS0E 1IGCL 3GMMB 2W0LA 4HUXB 1U8JA 4M7JH 1MLCA 3PXHA 2AP2A 4U0RC 3PHQB 3X3GH 1MNUH 4MXQD 2FCBA 4U4BA 4CMMB 4NZUH 4OCRH 4JFPA 4YFEA 1PZ5B 2APVA 3NCYP