3MRKA

Crystal structure of mhc class i hla-a2 molecule complexed with afp137 nonapeptide
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
274
structure length
273
Chain Sequence
GSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDGETRKVKAHSQTHRVDLGTLRGYYNQSEAGSHTVQRMYGCDVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQTTKHKWEAAHVAEQLRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDEATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWVAVVVPSGQEQRYTCHVQHEGLPKPLTLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
publication title Crystal Structure of MHC class I HLA-A2 molecule complexed with AFP137 nonapeptide
rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 82
structure length 273
sequence length 274
ec nomenclature
pdb deposition date 2010-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mrkA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3mrkA01
1EEYB 1MHEB 4JM4L 4RAHA 4ZOCA 5FCUL 4YC2B 5DWUH 2HA1A 2W59A 1KT2A 4Z95L 1CL7H 1LVEA 3CFCL 4J3VA 4HUWB 3IRZA 1U8LA 3O4OB 2C3HA 5I1KL 1EA9C 3VD9A 1P5UA 3E2HA 2C1OB 2I25N 3QXUA 3C09C 3L5IA 4KMQA 4XNXH 5JDSB 3TJHA 1JE6A 4JFYB 5D7LD 1BVLA 2EH7H 4UB0L 2HFTA 2X4OA 1JNHB 4DGYH 4JFHE 3O3AA 4GMTH 5D7JA 3ESUF 5E8PB 4U1HB 4ETYA 4E5XA 5C0AB 3GM0A 4PJBE 5T1LA 2B4CL 3DX7B 4PJGE 4OZHA 3QIWA 4MLSA 5IFHL 1FNSH 3RTQA 4ZG1A 4GRMB 4L3EA 2AKRB 2NZ9C 4C56E 1J1OL 3IJYB 1U93B 4XP1H 4UQ3A 4KK9D 1I1YA 5C0DA 3QCVH 3KPTA 3LPFA 4P2RD 3N1GC 1IC1A 4I4WA 1IQDA 2VXVL 3Q3GB 4CVWA 1FL6B 4OM1H 3TZVA 5ALBL 1M71B 4GQ9H 3IKCA 4DW2H 3G08A 4Z7NF 1RK1B 2VXSL 5C6WH 5C0NC 1ZTXH 3HS0B 5IVXA 5J6HB 1RZ8A 4B50A 3W0WB 2VL4A 3GK8H 4HKZA 3SJVB 5AYUH 4NCC2 1KG0B 2IANB 5KVEL 5CD5C 3MCLL 4FXKA 3Q48A 3MMEA 4MNGB 4P46D 2EDRA 2AXGA 3EYQC 2VWEE 3IFLL 1F4AA 4ZD3H 5MEOB 4N0CD 4MLIA 4BZ2L 3DBXA 3FQXA 5I1DA 3U2SA 3N1MC 3MLRH 3UJJH 1KT2B 2AJYH 3RQ3A 4WEMB 2YKLL 1U8LB 2AXJA 1PFCA 5J13C 1S8DA 4NUJA 2G2RA 3ZTJG 3N9GL 3T0AA 3E2HB 1INEH 1KLFA 4JM2D 4JLRA 1MLCA 1TQBC 1LEIA 3S4SB 3IXAA 5L8KB 1BZ7A 5D7SH 5EO0A 4F58L 1BVLB 5GGTL 4Z7WA 1MIEL 3ORJA 5DK0A 3QB7C 2X4OB 1Z0MA 3LRGA 1I9IH 5I8OL 5CZXD 5HYSA 4L3AA 5D7KD 5D7JB 1X4XA 1QSEA 4NSKA 2MCG1 1IKFL 4G5ZL 1MAJA 4XNUH 1XFPA 2VKXA 4D0BA 4OLWL 4KRPD 4E5XB 5J1TC 3K2UL 1KTLA 5JZ7D 3BQUC 5T1LB 5LAXA 2MNUA 4QLRA 2FNBA 3C60D 4OZHB 4HK0A 4P23D 3QIWB 1GGIH 3OXRA 4BH7A 3RTQB 4M61A 3O4LD 4L3EB 1FAIH 4UQ3B 1I1YB 5C0DB 4WTXA 4I4WB 1IQDB 1GGCL 1I7UA 3WUWG 3TZVB 4KUZH 3HE6C 4PGEA 3IKCB 1ZT1A 3G08B 3O2WL 1YPZE 5CJXA 1LO0L 1J1XH 2A1WH 3MYJA 4PRHD 5IVXB 2DQJL 5BW7C 1RZ8B 4R4ND 3BW9A 1KELL 4DFHA 2XRAH 2G60L 4HWNA 4NWUL 4HKZB 3GB7A 4UT6H 3FN3A 3S98A 1OGTA 3AAZA 3VXSA 4JFFA 1INQA 4FXKB 2UYLA 4LLDA 1CFVL 4BZ1H 4E9LA 4YDJA 1AGDA 3MMEB 2NY7L 2AXGB 4RISL 2NY2D 1AP2A 3NZ8A 2E7CA 3FQXB 5I1DB 3U2SB 4PJBB 1EGJH 4OFKA 1S8DB 4JKPL 5FKAA 1JRHI 1A9BA 2G2RB 2I5YH 3MRMA 2IGFH 5J11B 3EO0B 1C5BL 3SDDC 4TTGA 4JLRB 1LEIB 1MLCB 3IXAB 3ARFB 4AIZA 2F8VA 4JN1L 3QIBD 5EO0B 4HPYH 4LIQH 1R0AH 5T1KA 4Z7WB 4TVPE 5TE4L 5DK0B 2ICCA 1DQTA 1JTPA 3DYMA 5HYSB 3W9DA 1UACH 5JIKA 4KAQL 4U0QB 1QSEB 4NSKB 1IGYA 1OWWA 2XZCL 4D0BB 5EU4A 2FCBA 2F5BH 4OZIF 1LK3L 4G42A 1KTLB 3SKMA 1SBSH 2ZUWA 5LAXB 5IJKC 3T0EE 4HK0B 2KH2B 1NCTA 5JXEA 3OXRB 4BH7B 1Z9MA 1P1ZA 3H3BC 1DQML 2FIRT 2V2XA 2BVYA 1ACYL 1E28A 2OX5A 4MXVE 4RFOH 4KHTH 1I7UB 1XGQA 4KKLD 1G9NH 4OCYH 3QRFM 3L5JA 3GSXB 1EEUA 1ZT1B 2F54D 4Q9QH 2ADIA 1IT9H 4L1HA 2YD8A 3MYJB 4LAJH 3CK0L 2EDYA 4GSDH 1EMTL 3BW9B 4FQ2L 3L5XH 3GB7B 3H9SD 4NQTA 3KJ6H 1WWWX 4R90H 4HXAH 3AAZB 3VXSB 4JFFB 1INQB 4LLDB 2UYLB 5ITBL 4HGKC 1JPSH 2FO4A 1A3RL 1AGDB 1D5ZA 4XPBH 5DQJA 3TV3H 1CQKA 1R24A 4HIIA 3G6DL 1CF8H 1MRDL 3BWAA 4IIQC 1AP2B 3NZ8B 4P3CL 2W0LA 4YBLC 1LGVA 4X9FA 1OTSD 3SHSA 5E00A 3QHZL 1NGZB 4P9MH 1YEFH 1W2KT 4I0PA 1V05A 1TTGA 1HE7A 3MRGA 5HI4C 4N8CL 4WW2C 2AI0H 1A1OA 3N1PC 5FKAB 3T0EA 3SGDI 3MV8D 1BJMA 3ARZA 4KKAD 3MRMB 2EEDA 2F8OA 4GKOA 3VFPA 3LKOA 1UENA 4WGVB 2CD0A 1QA9B 4PJ7A 2OZ4L 4TOYH 4AIZB 1D5XA 2F53D 1SY6L 5JW4R 5T1KB 3S34H 2NY3D 1YUHA 4AT6B 2OSLA 5SWSA 1BF2A 5I1AA 3DRQB 5AEAA 5JW4Q 4P9HH 3WKNA 4KMLB 2IC2A 2DLTA 1IGYB 4PV8B 5F70A 3GSNH 1NEUA 4NNPH 5EU4B 3WS6C 1MQKL 4JB9H 1KCGC 4G42B 1BP3B 4J2XA 4A6YH 3RGVC 2R0ZL 4BSVA 4EEEA 2QEJA 2JB6A 4RA3A 2WWKT 3DETD 4OIAA 1P1ZB 5GRJH 3VH8B 2JJVA 2V2XB 5DMIL 1KCUL 1EBPA 3RUGE 1QHOA 1AKJD 2DQCL 1E28B 3FFCE 1WICA 3QUMB 4QWWC 5FOBA 5FEBA 2IALA 3E0GA 3Q6GH 1XGQB 3K8KA 3DVNA 3R8QA 2FECI 1CD0A 3O2VL 5FHAL 4TRPL 5DD6A 5F89A 1L7IL 4PJ8B 4HS8H 1OM3L 2ADIB 1JWUA 4NQED 2Q8AH 1J88A 4L5FH 2VZOA 4U1JA 1ZA6A 1JFQL 2DRUA 1OWRM 4UV4H 3ZE2F 4HFWA 5F9OH 1QFPA 3LAFA 3MA7A 4MA8L 2MWCA 2PETA 4PB0L 1DQJA 2Y1VA 2E7LC 3H6JA 2FO4B 1D5ZB 1R24B 4HIIB 4KU1A 3ZTJH 5C0CD 1ZANL 3BWAB 1IRAY 4OV6F 3S6CA 1QRNE 5MI0C 3TM6A 1NCBL 1G6RA 3AS1A 3WD5H 3O11A 4OBRA 4O51A 1MQ8A 5E00B 4I0PB 4Y4KA 5KJRL 1B0RA 3LRSA 3MRGB 1JZ4A 3PABA 1A1OB 3RDTC 1S7WA 3T0EB 4X5XA 2W0PA 4LAQL 1G6VK 5DMGD 5T5NG 3HUJA 2J7LA 3LKOB 5T3ZE 2XQBH 1UQSA 4PJ7B 1DQLH 4JQIL 3WJLA 3G04B 1D5XB 2VDRL 4MHHG 1SJEA 2VUYA 2WBKA 3TP4A 4PJCA 2OSLB 5SWSB 5I1AB 1INDH 1CFTA 1M05B 3NPSB 1JV5A 5CJ8A 1KEGH 4FP8L 3LN4A 4WW2F 4BSVB 2JB6B 2ARWA 1HNGA 4UOW0 5I8KL 4MQ7A 3SE9L 2YK1H 3WYRA 3AB0C 3R0NA 1F58H 1BBJA 3TH2T 5FOBB 2IALB 3EYUH 5DD6B 5IF0A 5F89B 1A14H 2KQNA 1YQVH 1JWUB 3C6SA 4D9LH 4CVXA 4U1JB 1ZA6B 4M1CC 4JKLA 4WO4D 1MVFA 4HFWB 1HEZA 5F7KC 3MJGX 3D25A 3P4MA 3MA7B 5DTFA 2DQFA 4CN6A 2JCCE 5ICYA 2DQHH 1SBBA 4JHWH 4MCYB 1DQJB 5M94B 5JW3H 4P57A 4OSUH 2PO6C 1Y6KR 3WFCL 1GGUA 4R96A 1G6RB 3UTSD 5FKPA 3O11B 2DYPB 4O51B 4UDUA 2Y5EA 5DEZA 2FEDD 4EQ3A 1CLYL 2ERJB 4N0YL 1VEMA 4Y4KB 1B0RB 3LRSB 3PABB 5K9JH 3DXAD 4YR6A 1S7WB 4X5XB 4DZBA 3E2HC 1ZT7A 4Q6YA 3S3JA 4LSVH 2ED7A 3A6BL 2ZUYA 4FQLH 3ARDA 1LHZA 2FGWH 1T04A 1UQSB 3VG9B 2FX9H 1YNTB 3MUZ1 3LEYH 1PZUB 5J9PA 3U9UA 4PJCB 3ZYIA 4AQOA 4H8WC 3QEQD 3WN5A 5DQDH 1CFTB 1V7MH 1I9JH 3QHFH 2VZ3A 1JV5B 4JHAL 2B0SL 2MKWA 2YXFA 4R97B 1FDLL 3P77B 3ARXA 3NGBC 1KACB 1P7KA 2IPTL 1OAYL 3TWCH 1MRFH 2RCSH 2ZCHH 3LN4B 3SDXA 1HOCA 1ZA3A 1T22B 3S7GA 4HUXB 1AR1D 4ERSH 3L95A 3L9RA 4DKDC 4IJ3B 1A02N 2GT9A 3P0GB 2A9ML 1X4YA 5C7XH 7FABL 5I71B 1U8OA 1BBJB 3OPZL 2QQNL 2PYFA 4PGDA 1DSFL 1N2RA 5ACZA 5I1CH 5HVFB 3QPXL 5IF0B 2ZUUA 1OP9A 4BQ9A 5LKNA 3C6SB 3THMH 4NT6A 5C09E 1JI2A 5F93C 2DL2A 1HEZB 5ADOL 4M1DL 3D25B 3P4MB 2XTJE 5DTFB 4TSAL 5ICYB 4FABH 1U9KA 2AERT 2VQUA 4LCCA 4P57B 4FTVE 1WF5A 5CEXA 3VFUB 1A7OL 3JVGA 4R96B 1S5IH 5FKPB 5CCKL 4XBEL 4UDUB 5E0QA 3JZ7A 2X4SA 1NFDA 1F3DH 4YHIA 4TTDC 5SWZD 4YR6B 1D5MA 3F7VA 2IBGA 4AMKH 4DZBB 1ZT7B 2VLJA 3FQTA 1B90A 5ABDE 5F21B 3ARDB 4U6VH 3ARFC 2N1KA 2YA0A 4S1SL 1E27A 1T04B 2EDOA 5GS0C 3QDJD 3V4UL 3CCHA 2BNRE 5E2JA 5J8OA 1W0VA 4XAKD 1BIIA 5J9PB 2AVGA 1E6OH 2JE8A 3U9UB 1K2DA 4Y4HA 3RGHA 3WN5B 3OBAA 3PL6A 1CFBA 5IESH 3O2DH 1NAKH 4JDTL 1P7KB 5B39G 3LH2L 3HE7C 4Q58C 2EZ0D 2JCCB 4BH8A 2XFXB 3VE0A 3SDXB 1T1ZA 4FQXD 3RKDD 1HOCB 1ZA3B 1GAFH 4JDZA 3L95B 2VWEC 5EBWA 1F90L 4QRPD 1IJ9A 2GT9B 4RGND 1ADQH 3BMVA 3WFBH 4QRQA 1U8OB 2PYFB 5IROC 4PGDB 2N4IA 3WLBA 1N2RB 2Z31C 5ACZB 2IBZY 3D2UD 3DRTA 5CGMA 4HUVA 4DKFL 5D1XD 3GKWL 4JFED 3ALWA 4S2SA 4XPTL 1DEEA 4NT6B 2XZQL 4EOWL 3JWOC 2DKSA 1NBYA 4NKIH 4OJFL 1P7QA 3QQ9D 1N5YH 2AK4A 2IAMD 4JJ5A 2JJSA 3CAFA 5JW4N 4AZ8A 2GJ6E 3UZEA 4DUVA 5EU6E 1A21A 1DBJH 4G7YL 1EO8L 4LF3A 1NCDL 5CEXB 2P43B 1FIGH 4HC1H 2OL3H 4RMVA 4GBXB 1RFDH 1KLGA 2CMRL 3ZE1E 4F57H 2FX8L 5D1ZD 3UYRL 2X4SB 1M6OA 1NFDB 1FNFA 2MQ3A 5DD1L 3SO5A 5DC9B 2YC1B 4YHIB 4E42A 1D5MB 3ISWA 3F7VB 5AZEH 2VLJB 3FQTB 3IJHA 3V6OA 4PGBA 4RDQF 5IVXF 5F7HA 4OLZL 1E4WH 1UA6L 1E27B 4ZODA 4B7IA 1KLUA 2AJVL 4R4BA 3CCHB 3TVMA 3EO9L 4RMUA 3MUGA 1W0VB 2YBRA 3WIFB 2XQYK 1I9RH 1K2DB 4HXBH 3NACH 4MAUL 1JHKH 4Y4HB 4H0HB 4L8CA 4PJ9C 3PL6B 1KENH 1N7MH 5FYJL 2HTKC 3JWDH 1F4YH 4PJBF 5ERWA 3STBA 3MV9A 3IDNA 4PJGF 3VE0B 1NBVH 1T1ZB 4H8WL 4YHZL 2IPUG 1U3HA 1DL7L 3KYMA 4NGHH 4O58L 2AK1L 1F8TL 4JDZB 5EBWB 4HX1A 1RHFA 4I77H 3UPAA 4S0UC 5F1KC 4WFHE 4QRQB 2P5WD 3WLBB 5K59E 4OCRH 3DRTB 4PJ8C 4HUVB 4LCIL 1F45A 3OWEA 4PB9L 3GBNL 1OLLA 4H0IA 2V7NA 4J3WA 1TFHA 1FZMA 5JW5A 3QEHA 5F1SA 1NBYB 1P7QB 1RIVL 5KZCB 1GC1H 4JJ5B 4HGMA 3EJJX 3STZA 3FJTA 2JJUA 1A47A 5HPOA 4XAWL 4AENA 5I1HH 1NAMA 1FYHB 4LF3B 3F6IA 4ZQKA 4EI5A 1FO0B 1NMAH 4GRWB 4OQTA 2WP3T 4U7MA 1PBYA 1KLGB 5K93A 3U0TA 4G8GD 1MREH 4HPOL 1M6OB 1T7VA 1X5AA 3ZYZA 2APTA 3T0EC 2QQQA 4OI8A 4PGBB 1X5FA 3OTTA 5EO9B 2JB5H 3MBED 3EDFA 4XXDA 1P9MC 1HHHA 2D0GA 1PG7H 4R4BB 4OB5H 2BY0A 3TVMB 3IFOA 3U36A 2CK0H 2CLZA 1KN2L 3LS5H 4JFDD 1G0XA 2R56L 4HWBA 4D9RE 3ZKMC 4L8CB 4Y89A 4G6MH 5CUSH 4XPGH 5GS0L 3D1MC 2VDNL 3QWRA 5IMLA 2DOCA 3BMWA 4LPYA 5ERWB 3VWJD 3MV9B 3IDNB 3VD3A 5JHDA 3DOSA 1U3HB 3KYMB 1XAUA 4HX1B 5CEZH 4MNHA 5CJ5A 2FHCA 3HMWL 2XYCA 3ZTNL 5IBTL 1NMCB 2J6EA 4LL9A 5JHLH 3QO0A 4RWYH 5HGHA 1L0QA 2V7NB 2X4PA 1FZMB 1VESA 2DQEL 1P53A 3VXUD 5JW5B 3QEHB 3MGOA 3P9MA 1W72H 3QDGD 4Y5XA 1PDKA 2O5XH 1MCNA 2G9HA 1FAKT 2DLIA 3GIZL 4AENB 3JWOL 1NAMB 2DLEA 2NTFA 2YR3A 3G9AB 4EI5B 3VXPA 3DUHA 2VLRD 4KTYA 2ESVD 4PJHA 2ERJC 3U0TB 4Y4KC 4IRSA 5JA9A 4YEEA 3CNKA 4X5LA 4XMLH 1SVZA 5B38A 4L4TA 3D87B 3OB8A 1SEBA 5D7LE 3QDAA 4XGZA 3O9WC 4H1LG 4UILH 4HWEL 4XXDB 3G5XA 4G8FA 1FNAA 1HHHB 1S7QA 4QHUA 3VG9C 5L9DH 3OR6A 1FFQA 3ARTA 2XOTA 3U36B 2CLZB 1U2HA 3QXDA 2ED8A 4NFDA 4TNWK 2KPNA 3QWQB 3BPCA 4U1GB 2AJZA 5EU3A 4R97C 2UVEA 2FATH 5IMLB 4RQQA 4IDJL 1ZHNA 5JHDB 4I3SH 4JR9H 3LMJL 4P2RE 3N1QC 3D69A 2CXKA 4MNHB 4AL8H 4PJ7F 3DROA 4L4VD 4MD4A 3FAWA 2WUCL 5T3XH 4MXVF 4ODBD 1MHPL 3RVWD 4Y4FD 3VGFA 1CTOA 3IKKA 5F96L 1I1CA 4ODUB 4OLXL 4UDTA 3W5NA 3QO0B 1MCHA 3AU1A 1Q72H 5HGHB 2Y7QA 3KLHC 5GZOC 1IGCL 3E3QE 2D7TH 2X4PB 5GSRA 3KPSA 1U91A 3IFNH 2K7QA 3QUML 2ZG3A 2WK2A 3MGOB 5CILL 3NAAL 4Y5XB 1RUQL 4JHZA 4X6CA 1OP3H 5JDJA 1LO4H 2P5ED 2G9HB 3H2WA 1CGTA 5HTSA 1DN0A 3L7EA 3P9LB 5D93B 3TT1L 1BJ1H 3NA9H 1VADA 2NTFB 3HTLX 1HCFX 4XX1G 3VXPB 2CRZA 1IGFH 5I19L 2YPLA 4LASL 2Q3ZA 4M00A 32C2A 1B2WL 4PJHB 4TVPL 1QP1A 2H2SD 5I66A 3EJZC 4IRSB 1R3HA 3BKML 3DARA 1JGEA 5JXAH 2ENYA 5B38B 4L4TB 1YNKH 3LSOB 1SEBB 4LIQE 4ZS7H 4XGZB 4XCCL 5ITFA 3U79A 4NQCD 3G5XB 4G8FB 3CLEH 1A1MA 1KPUA 1S7QB 4QHUB 4Z78A 1J5OH 1MFCH 3OR6B 5D7KE 3UBXA 3HMXA 1JWMA 5F97E 3QXDB 4QYOA 3NCYP 1WBXB 1MELA 4K3JH 3KAAA 3BPCB 5F9AC 3WN5C 2AJZB 3CSBA 4XXCC 4NKQB 4NFCA 5EU3B 3ZYOA 4H25A 2VZ1A 2V9TA 2V9RA 35C8L 3V6FA 2O61A 4RQQB 3O4LE 5B3JE 4WI5A 4N0CA 1LQVA 1ZHNB 2DD8L 3V8CA 4BQ6A 3D69B 1FG9C 4LSQH 2PW1A 4F3FA 3CD4A 5EWIH 3O6FA 4IMKA 3DROB 4N0RA 3RUGF 2E27H 1I85A 1RIUH 1FHGA 4PLNC 1PKQA 3GNMH 4KVNH 4PRHE 5HGBA 4N5EA 2ZWLT 4UDTB 5DRNA 3WFDH 2DM2A 3UP1A 4LARH 3AU1B 2DM3A 2Y7QB 2ZJSL 3DYPA 3RZCA 4R6UA 4Y5YC 5GSRB 3QZWA 1U91B 1FZOA 2WBJC 2NY0C 5ESAA 4XMKL 5L0QB 2BRRH 2V9QA 4X6CB 1CU4L 2EIEA 3FHQA 3K3QA 4D2NA 2D03L 1RZKC 4R0LA 3U6RB 1ZGLP 1DN0B 3L7EB 2QQKL 4MXQC 4PLKC 4EZMA 1VADB 4JO4H 3JVGC 3I85A 2YPLB 4GBXC 1KXVC 3GHBL 2NR6C 4YAQA 4GAJL 3QPQC 4KPHH 4LSSH 1KJMA 32C2B 4LVOB 5CHNA 5L7XH 3O4LA 5I66B 5KS9A 1R3HB 4K07A 4RZCB 1TETH 1JGEB 1CGVA 4I3GA 4ZS6C 5F7WC 2BY3A 4OLVL 4MS8A 1L6XA 2ZG2A 5D70L 2EXYC 5JQ6L 4EDWL 2CJUL 2M26A 5ITFB 4MVBD 4HIXL 3H7LA 4LQFH 1DVFA 1DLFL 4K71B 4Z78B 1A1MB 1KPUB 4LFHG 4TULL 4JANA 3UBXB 2HJKA 1JWMB 4OD1L 4MAYA 1MY5A 4QYOB 3I6LD 1KN4L 4I5BA 3IJSA 1KPRA 5D4QA 3PL6C 3ALXA 4CU6A 1DBMH 2HKFH 4H25B 2BSSA 3V6FB 2O61B 4MCZA 2EDHA 2XTJC 3GSUA 2VLMD 4RIRA 3TCLA 4ZSOE 4J8RA 3DPBA 2NXYD 5TPWH 5IVNA 5MENA 5F7DA 5ANME 2PW1B 3LOWA 3RVTC 4F3FB 2ZKHL 3L5HA 3O6FB 1ONQA 5DURD 1KB5A 3PGFH 2F54E 4Z76A 1PKQB 3MNVB 5CZKA 5HGBB 2X89A 3WIHL 3PHSA 5DRNB 3H9SE 4DTGH 1BM3L 1A7RL 3P0YH 4MJID 2PR4L 3SKUD 4P59L 3P30L 4WY7L 3RZCB 1E4XL 1A7PH 3QZWB 1IAII 2R23A 2VDMH 1WZLA 2AGJH 5ESAB 5GPRA 1JGLH 4WEUD 2JCCF 4NJAH 3HR5A 3SDXF 5ENWA 3RI5F 2AXFA 5IHBA 3I75A 1EEZA 4R0LB 2VO5A 3KPNA 3QJHA 4GRLA 3REVB 5T3ZL 2HKHL 5DA0B 5GGSY 4YUEL 1NL0L 4DVBA 4O2CA 2EO1A 3R1GH 2YN3A 4OZGE 2F19H 3MV8E 3GSQA 4H1LH 4YAQB 5DSCA 1NC4A 5CHNB 1KJMB 4EN3A 1JMZA 5KSBA 1MJ7L 3MRHA 3O4LB 3MLWL 5KS9B 4KROC 1SQ2N 3O6MH 3SQBA 2F53E 1ZEAH 3UTPD 4DZ8A 5ANMA 2ARJQ 2GJJA 3Q1SL 3BXNA 1TPXC 3IDYC 4LLQA 2F54A 3BOVA 5FCUH 1FNLA 1MCOL 4PRHB 4JANB 4U6XA 4Z95H 2HJKB 5F7FA 1R3KA 5INCA 5E99H 3H9SA 4MAYB 4G43A 5D6DA 4OD3L 3A67L 5E5UB 5I1KH 5DUMH 4I5BB 1ZS8B 3IJSB 2MCPH 1KPRB 3PQYA 4WEBL 3VXTA 2BSSB 4NRZB 4Y5VC 5HYIA 1UCBL 2NY2B 1NFDF 3GSUB 3PP4L 4PUBH 4RIRB 3TCLB 4J8RB 2C3WA 1WTGT 2GKIA 4MB5A 3WKML 1U3HC 3FL7A 4ZUTA 5MENB 1KTRL 2ICWA 4HCRL 5F7EL 4MA7L 3I3DA 1ONQB 4J12A 3MJ9A 4KXZH 1D3CA 1KB5B 1NUFA 3EOYG 1VENA 4NQEE 5E5MB 1PLGL 5E7BA 5F1NA 4Z76B 2YRPA 3MLSH 3MFFA 2O93L 2M2DA 3AFLA 1YEKL 5FUZL 4OKVA 2EXWD 1C5DA 4F37K 3P4OA 3ARQA 3QIBB 3TYFA 3B9KD 2R23B 3D48R 1T7YA 1JPFA 3BFOA 3G5ZA 2DKUA 1L7TH 3RI5K 5C0CE 5C07A 1KNOA 5LVEA 3HR5B 2MKLC 5ENWB 3JWNC 2AXFB 3I75B 5ALBH 1EEZB 3KPNB 3QJHB 4GRLB 4J4PC 1T0PB 4LSUL 1EPFA 2FRGP 2HYMA 1KV3A 2VXSH 2R2CA 4L3CB 2ZUTA 4DVBB 4O2CB 3GBLA 3EOTH 3GSQB 4NQVA 3KR3H 5E2TL 5DSCB 1NC4B 1OAQL 4KK5C 4LNVA 3CMGA 4EN3B 5KSBB 3BKYL 3MRHB 1CR9H 4LFHD 4X9HA 1Q9WA 1F3RB 5C71A 1AKJA 4DOHE 1YEDB 4DZ8B 2I9TB 5ANMB 1X44A 1IZJA 3OAUL 3ALPA 3MFGB 3VFWA 4LLQB 1Q0XH 4HGWA 5KVGL 1WEJH 2F54B 4NQEA 4BZ2H 4GT7A 2DIJA 1T0NA 4U6XB 1VGKA 3FAXA 1AO7D 1R3KB 5INCB 1FGNL 3H9SB 2YKLH 1CK0L 4G43B 4PJXE 5DMKA 1T20A 4YHKL 2DQDL 1KIQB 2CH8A 2NCMA 3FKUS 4YE4H 3N9GH 1CE1H 4GRWF 3PQYB 1J12A 1S7TA 5IMMA 2YN5A 1WT5A 1WFTA 3SN6N 4M3KB 3VXTB 1QFWH 4QXTB 4LMQE 1WZMA 3FN9A 4QRSA 4F58H 4HKXA 5GGTH 1MIEH 4ZUTB 3SE3A 2ICWB 5IB2B 5I8OH 3Q2CA 4TNVF 4OZGB 5SV3A 1MCWW 4R2GD 1IKFH 5B3NA 1G0DA 1HDMA 3MFFB 2N7BA 3FN0H 3DV4A 2H2PC 4JZJA 5JLZA 1R3LA 1BQUA 4APQA 3K2UH 4OKVB 2DBLH 3OKDA 1OQXA 1C5DB 1AQDA 3D3VD 3P4OB 4U0RC 2F53B 3OHXA 1MNUH 5A3IC 1X4ZA 3TYFB 1JZ5A 4RMRA 3F12A 1KCRH 2W1NA 1GOHA 5LXGL 1JPFB 4XVSL 3S9DB 4DQOL 5C07B 2OBGA 4Z0BL 1GGCH 3UTSE 4P5TD 5C0BA 2D31A 5CLTA 1A6TA 5D93C 5GGSA 2DBJA 3A6OA 5DYOA 3HG1A 4YDIH 5B22A 5SWQA 2KKQA 4Q6IC 3DXAE 5IQ9B 5KANI 3RVVC 4NQVB 3TN0A 1KELH 3ZE1F 1CXKA 1OP5K 2YWYA 1Q9WB 1WIPA 4U49A 1A7QL 1MAML 1AKJB 1FO0L 4I18A 3MXVH 1PYWA 2MOVA 3W11C 3SPVA 5JA8B 1QRKA 3IXTB 3VG0L 3VFWB 4PFEA 2HFEA 4HGWB 2Y4SA 3QEQE 4NQEB 4YHML 2HJLA 1JYNA 1T0NB 3T1FA 1VGKB 1OGAD 4XVTL 3G6JE 4RMSA 4R4FL 5DMKB 1T20B 2CSPA 5CSZA 3QXVA 4FXGA 1C5BH 1S7TB 3CXHJ 1LEKA 3CDFA 1OCWH 5T1MA 4JRXD 1NFIA 2YD3A 3BEVB 5C0CB 4G6FB 4QRSB 4HKXB 1WBZA 3CH1A 1XIWD 4OGAD 5E6ZA 1A7BA 3FQWA 1CYGA 4IS6A 5E24E 1SMOA 3TNMA 3VXOA 2XZCH 2ID5A 1HDMB 4XH2A 4JZJB 3DV4B 1R3LB 3LB6D 3GM8A 2EKJA 3OKDB 1YEEL 3T3PE 1AQDB 1S9WA 5AD0A 5F3BA 5L2KA 1AXSB 5FM4A 4KKNA 3OHXB 1CLZL 2ITCA 3F12B 1R6VA 5GJSH 2C1PA 1DQMH 1YEIL 2R0KL 3H0TA 1ACYH 3QEQA 2Y5TA 3TT3H 4PRPD 3SKJL 4UIKL 4PJXB 1A6TB 1UG9A 4B5EA 2GY5A 5DYOB 3HG1B 3IVKB 4OT1L 1X6NA 5SWQB 4QRTA 3V95A 5SWZE 5KVDL 4CU7A 3EHBD 3CK0H 4LVOC 1KUMA 4FQ2H 3TN0B 4CUCA 2XWJA 2EDKA 4KK9C 4S1RL 1WZ1H 3AY4A 5ITBH 4L4JA 3P4LA 3QDJE 3IS1X 4HMDA 4I18B 3SPVB 1CICD 1LWRA 4XAKE 5D2NE 1QSFD 4PGCA 5J89A 2HFEB 2HJLB 3WHXB 3T1FB 4NWTL 1VFBA 3QWOA 3KPRD 5LWYH 1KJ2A 1A4JA 1RVFL 5JPNA 4GXUM 5CSZB 3E3QC 3V5KA 2WW8A 4LSPL 4FXGB 1LEKB 4PG2C 4P46C 5T1MB 1NFIB 4QRPE 1JYVA 2D9CA 4RGNE 5I74B 3GRWH 4N0CC 4ZUWA 1SY6H 4XP9L 2ICEB 1WBZB 1G7LA 4GQPH 3PWJA 1V3JA 4V3EB 2EIBA 3F58L 4ODWA 4U1MA 5DUPH 5L6YL 3VFVB 4JGUA 2R8SL 3FQWB 4IS6B 1OOAA 2WAHA 4XPHL 4LRIA 3TNMB 1IC4L 4JFEE 5FDWA 1X9QA 4N5EC 3VXOB 4JM2C 4JO1L 3BJLA 3M07A 5TF0A 1S9WB 5F3BB 5AD0B 2R0ZH 1RSFA 5L2KB 4MA3A 3VGEA 3DUSA 4PLJD 3B6SA 2ITCB 2P49B 2WNGA 3OF6A 3UPRA 4HK3N 2C1PB 5CZXC 4XC1H 3RKPA 3H0TB 1M7DA 1KCUH 3QEQB 2Y5TB 5FAAA 4Q9BA 2DQCH 4KY1L 1UXWB 1TJGH 1IM9A 3ARED 2EH7L 4KRPC 1P2CA 3O2VH 3QDMD 3BVNA 2H1PH 5JZ7C 1L7IH 5B8CA 2DJUA 1OM3H 4M8QA 3C60C 2X4TA 4QRTB 1FN4A 4P23C 4GMTL 1IVLA 3AS3A 4ETQA 2XWJB 4MA8H 2XG5A 4GAFB 4QXWA 5EUOA 3V79C 1QD0A 2Z35A 5DHVA 1G9NC 4M93B 5GGQL 4YO0A 1XR8A 4Z0XA 1FNSL 1ZANH 4PJFE 4G8IA 4PGCB 3V7MA 4XWGH 4XP1L 1B0GA 2ARJA 2O5ZL 2VDPH 4X6CF 5A2FA 4R4NC 5ALCL 3TEUA 3GGWA 4JQXC 1K4CA 3IDMA 1VFBB 4G7VL 4OM1L 1U95A 1GPOL 4GQ9L 1KJ2B 1A4JB 5JPNB 3V5KB 1P7HL 1ZTXL 4GO6B 5EC2A 1J0IA 2NY2C 4X8XA 4YBHA 2VDRH 4HHAB 4HK3J 3QDHA 3QUXA 4ZUWB 2XTLA 1LE9A 1G7LB 1A2YA 2XQYG 3PWJB 4LPCA 5JO5A 4ODWB 2P5WE 4U1MB 2E3VA 4M62L 1KEML 2DTSA 5CLWA 2I24N 1A7NH 4ZD3L 5FDWB 4QHKJ 4LP5A 5D7IA 3RY5A 3BJ91 3UJJL 3DMMD 4QTIL 4JKMA 4FP8H 3BE1H 3QDJB 1UYWL 3QIBC 4K8RD 5I18H 3DUSB 4JREB 3B6SB 4Q7DA 5I8KH 3SE9H 1INEL 4P9HC 1M7DB 2EEAA 5D7SL 2XACC 4LLUA 5A2LH 1IM9B 5KSAA 3O8XD 2JIXD 3KLSA 1P2CB 1QHPA 3BVNB 4G8GE 5B8CB 3I9GL 1S3KH 1S9YA 3RX5A 3TO4A 2LVCA 1OLZA 4M8QB 2VR4A 1I1AA 2X4TB 5BRZD 1FN4B 3MODH 1Z9OA 4ETQB 4JM2F 5DGQA 1ZVYA 4XNUL 1DUYA 5DJ0A 1T83A 3AUVA 3K0WA 2J8HA 2Z35B 4N9GA 1FNHA 1FLTX 1UWXH 5DHVB 2PTTA 4RFEA 2VDKH 2NY6B 3CUPA 4Z0XB 1GGIL 4JFDE 3D2UB 3HI1A 3TA3D 2YD9A 4ZAKA 4UNVA 4G8IB 3WFCH 1DLHA 5TE7H 2L0DA 1J86A 2ARJB 1LDSA 4NRYB 3QCUH 3GGWB 1CLYH 1K4CB 3IDMB 5D6DC 5FHBL 1U95B 3UJIL 4F7CA 1A3QA 2Y23A 3C6LA 5CINL 2LU7A 4BUHA 1FV1A 1OT2A 5E1AA 3ELAT 3MZTA 1J1XL 3A6BH 5E9DA 1ZVHA 4ELME 1HSAA 3HMXL 2XRAL 4UT6L 5B3JF 5IW3A 4DUXA 2AP2A 4TN9A 2J88L 3QUXB 3VMOA 1OTSC 1T1YA 1LE9B 1A2YB 1H3XA 2Q20A 4Y2DA 5JO5B 4M7LT 4M6MH 4RBPH 4PJEA 4G9FA 4KKAC 3C2SA 3ZLQC 1MCFA 4JHAH 1MHHB 4NYLA 5D7IB 1FDLH 3MLVH 3D0LA 4HWZA 2EYRA 3MBEA 3VXUE 1CXLA 1MWAA 2Y36H 3MLYH 1KTDB 3QDGE 3SE8L 1EGJL 3X11A 3FO9A 2VQ1A 2A6JA 5CP3H 2I5YL 2NY3C 4PREA 1KCKA 1HQ4A 3OAZH 4X9GA 4JO2H 5C0AD 3QCTH 5DRWA 7FABH 5DMJB 3U9PL 1UJ3C 2DLFL 1CS6A 2VLRE 4WIQA 1ZLWK 3WMSA 1DSFH 4LLUB 5HYSG 4HPYL 4LIQL 2KZWA 5KSUA 5KSAB 3QH3A 2W91A 2ESVE 3VI3E 3TO4B 1S9YB 4I2XE 1PKOA 1I1AB 3JUYA 5C0JB 2VAAA 3DETC 1DUYB 5DJ0B 4M1DH 4TSAH 3LQAC 4UAOC 2J8UA 5FK9A 5CEYB 4L8DA 4N9GB 2PTTB 4RFEB 3W0WD 3MUY1 3CUPB 3SJVD 4ZAKB 1IAIM 5EORL 1DLHB 4LQ1A 1A7OH 2IAND 2DQIL 2XPGA 4QGTA 2UVFA 3RIAK 1BFTA 1EEQA 1G9NL 4OCYL 3QDGA 2XICA 1MCPH 4F7CB 4M02A 4L8BA 2BVUA 4C59B 1VCAA 1SVCP 1FV1B 2V2WA 3HZKA 4KWUA 4Z9KB 5E1AB 1O0VA 5E9DB 3QXAA 5EBMB 1PVHA 4GSDL 1HSAB 4S1SH 5KSBF 2VZSA 3V4UH 4TUOA 2UWEE 4L4VE 3DHMA 4R90L 4DN3L 3WL9A 5FGSA 2B5IC 4Y2DB 3TO2A 1P84J 4XPBL 3O45A 4M7ZC 1OAZH 2BNQA 4PJEB 5FO9A 2XWBA 4QHNA 4G9FB 5F3HA 5E6IA 5FB8A 5DMGC 3K7UA 4K9EH 3TJHD 4NYLB 3D0LB 2FX7L 2EYRB 3MBEB 4HWZB 1MWAB 5EIVA 2X9YA 3BIAX 1YEFL 3S5LA 3LKQA 3FO9B 5D7JD 2A6JB 1VDGA 1MAKA 1VKXA 1HN1A 2P5EE 4NKDB 1HQ4B 2X9WA 2OXHA 3VA2C 4N1EA 2CR6A 1QQDA 5DRWB 3L1OL 5T1LD 4TOYL 3ZDZF 1EO7A 4PPTA 1DR9A 3QIWD 1IEHA 5KSUB 3S34L 4KZDL 3QH3B 1J0ZA 4IMLA 3RTQD 2XY1A 2DQGL 1TTFA 3DI2B 4L3ED 3GKWH 2R1WA 4OZGF 4P9HL 2VAAB 2XZQH 5IKCA 4NP4L 4EOWH 2ZUXA 3TZVD 1XGTA 4NNPL 2K7PA 4JB9L 5ELIA 4NQCE 5LGKA 2BXZA 4I8DA 2ADFL 1ACZA 2J8UB 2FSEA 5FK9B 2YHGA 4L8DB 2F5AL 1EO8H 2CDEA 1NCDH 4HJGA 4CVUA 1WJ3A 1MPAL 5GRJL 1IGTA 2XPGB 3EIFA 4FFYH 4UI2A 2CMRH 3S96A 1A4KA 3QFDA 3MPCA 3VU2A 3QDGB 4L8BB 1MJ8H 3HZKB 4HIJA 2FJHA 2Q8AL 5TDNB 3QXAB 3Q5YA 4OLZH 1O7VA 5I0ZA 3CFBA 1UA6H 4PIRF 4UV4L 5I74C 1U36A 3KHQA 2AJVH 2XNAB 1DJSA 1DZBA 1UWEL 4TUOB 3BH8A 2ZPKL 3K4AA 2FEDC 3DHJA 3WL9B 4FFWD 3TO2B 3HAEG 3O45B 3V6ZA 2BNQB 1JGDB 5FO9B 1JMXA 3ROOA 1WUNT 4LLMA 5F3HB 5E6IB 5FB8B 5GRYA 3OGOE 1Q1JH 4BELD 5DR5L 3WD5L 8CGTA 1AGCA 5EU5A 3IFPA 4L8SA 3S5LB 4Z6AT 4O5LH 1DL7H 2AK1H 1F8TH 1QSED 4KRNA 1M7IA 1WITA 1VKXB 1HK6A 2W65A 1BFVL 3FCTA 4F9LC 4XRCA 4JQVC 1X5HA 1NBQA 2XQBL 4X83A 1YMHB 2GW5A 4OCSH 1SMAA 3UJTH 1I75A 2YA1A 3BP7A 4IMLB 4TVSa 4LCIH 4PB9H 2IF7A 2R1WB 1INDL 1YEJL 5HDOA 1AR1C 3IDXH 5FFLA 1KEGL 1XGTB 3AY4C 3B5GA 4JG1L 3VFOA 4P5KA 4M93C 2FSEB 1WCQA 3FQUA 4WTZA 2BCKB 1EX0A 2BVEA 2CDEB 3I6LE 2YK1L 4HJGB 4HEME 1OW0C 1IGTB 4IOFD 4JFFD 3VXSD 3LQAL 3S96B 1BWMA 1A4KB 1H3VA 1KCLA 1I8KA 4PJXF 3EYUL 5C0GA 4NZTH 2NTSP 2VLME 3WXVL 4MDIA 4W6WB 2B7DT 2FJHB 2LFGA 1R3IL 4D9LL 1I8MA 1IILE 3RWEA 3GFUA 1LMKA 2ZCKL 3VDAA 2QJDA 2DQHL 4ZOBA 4GLRH 4OZFA 4G6JH 4YHPA 4UOW1 2LTQC 5I73B 2R56H 3V6ZB 4P2OA 3ROOB 4LLMB 4MJIE 3GKZA 5HHQA 3TH3T 5GS0H 4UMGA 1WWAX 2HT3D 5T1KD 3VGDA 1AGCB 3MROA 5TDOA 4MVBA 3C5ZA 3IFPB 4XX1E 2Y72A 4L8SB 5KW9H 2XA8L 4JREC 2E7MA 4OFDA 1FNGA 5D2NC 1M7IB 2W65B 4LSVL 3FCTB 5C0RL 4XRCB 1PGRB 4U6YA 1A64A 4HH9A 3JWDC 1K4DA 3BP7B 2WUBH 5JXED 2WINB 2EZ0C 3BRFA 1QPPA 3H9HA 4MDJA 4FQXC 4JZNA 3RKDC 5DQDL 1FC1A 1V7ML 4O2FA 1A3LH 4RGNC 3EFDL 3FO2A 2CGRH 1X5GA 1FJ1A 3ZDYF 3TWCL 3VFOB 4P5KB 4C57C 2RCSL 4Z77B 2BXYA 5MEPA 2ZCHL 2C4FT 2X1WL 1X5IA 3FQUB 1NH6A 4ERSL 1OSPL 3JWOH 5D1XC 5C0FA 5DRZA 1MCDA 3H42L 2ZZUT 5C7XL 4RNRA 3QQ9C 1NCWL 3LCYA 3T0XA 3F7PC 1I8KB 1JF5A 5A16A 2LAGB 5C0GB 2IAMC 4ORZC 1GC1C 2EEBA 1MCCA 3L3DA 4MDIB 3OMZA 1GZQA 1Y18A 2WANA 3ETBF 3BKJH 1I8MB 3RWEB 5I76A 4HWEH 1UH2A 4I0PD 4AEIL 1VEOA 1RZJH 4QF1A 4YDLC 3CGTA 4KK8D 4FABL 5FYJU 5C3LD 4OZFB 5D1ZC 3ARUA 4G8EA 5HI3D 4YFEA 1RUPH 4P2OB 4QTHA 2VTFA 5HHQB 3Q6FA 3ULSA 2AEPL 1FL5A 4QY8A 4UNTA 3MROB 5TDOB 3C5ZB 2AJ3A 4IDJH 5F72S 1N6UA 5SWSD 3VGAC 3HFML 2CQVA 2ZUVA 4AMKL 1FNGB 4XCNA 2VC2H 4U6VL 5T5NF 2WUCH 2WWMD 5DC4B 4U6YB 3OQ3B 5F96H 2NZIA 4OLXH 5SX5K 4HH9B 1K4DB 2Q7NA 1H3TA 1LQSR 1E6OL 4Z8FH 3H9HB 3S37X 1G7PB 1I1AC 3MNWA 4MDJB 4JZNB 4PJIA 3UDWC 3QUMH 3DX6A 4M03A 1GHFH 4O2FB 4UQ2A 1N4XL 5CILH 1NAKL 4ZTPL 5DURB 3FO2B 1RUQH 3DURA 1FJ1B 4Y1AA 3BD4A 4UV7L 5CMAA 5MEPB 4RGMC 3BGFC 2FLRT 5DUBA 1QLFA 3PXHA 1AO7E 3TT1H 1UM6L 2NX5A 4U3XA 3T4YA 5C0FB 5DRZB 2P8LA 1ADQL 3SCMA 2DJSA 3WFBL 5FGRA 3VFGH 4RNRB 4TVPH 4FG6D 3MOBH 4X7DC 4LVNB 3EDDA 3BKMH 5A16B 1HXMA 3L3DB 3HI6L 4WWKA 1Y18B 2DQTH 2V5MA 4U1IA 5I76B 1NGQH 1G7IA 1TVHB 4KC3B 4Q2ZB 2VB5A 3TF7C 2LU3A 4QF1B 4NN6C 4YGAB 2NW3A 4PJ5A 1ZLUH 3QUZA 4G8EB 2GAZA 5ACMA 1F2QA 3SKNA 1PG7X 1DANT 1DBJL 3D3VE 4QTHB 3OL2A 1FIGL 3Q6FB 2HFGL 3W2DL 35C8H 3MBEC 4PYHA 2OL3L 3ULSB 1CGSL 1FL5B 4QY8B 4LCWD 1M4KA 3UCRA 3VRIA 2AJ3B 4NN5B 4R8WH 5DZLA 2DD8H 1MOEA 2F8XC 4MX7A 4Z7VE 2NNAA 2A83A 3MLZL 4XCNB 2YUVA 1UZ8A 4X4ME 2UZXB 5TJWK 3L7FA 2LQRA 1FBIH 1CXIA 3U0WH 5DD3L 1UVQA 3BUYA 5LG1A 2I26N 5EB9A 4LLYA 5HD8D 3DSFL 3VWJC 4CDHA 5FOJA 1I9RL 4HXBL 3MNWB 1JHKL 4PJIB 1S78D 2IPKA 4C4KO 3DX6B 3QNZA 1RV6X 1KENL 1N7ML 4G9DA 4XMKH 4UQ2B 1ERNA 5H2BA 1CU4H 2BHZA 3DURB 4Y1AB 2D03H 5CMAB 2OI9A 1NBVL 5DUBB 1GXEA 1QLFB 4NGHL 1B4RA 1OGAE 2NX5B 3ET9F 3P0VL 5ADPL 3T4YB 2P8LB 3SCMB 4RAVA 3MZGB 3S37L 4GAJH 2RR3A 1FFNA 3FT4A 4YHYB 5L2JA 2D3VA 4JRXE 4POUB 5HYQA 2JJTC 4LHUG 1HINL 4OCRL 3EYSH 1S9VA 3K80A 1F4WL 1HXMB 3BDYL 1BJ8A 4Z7VA 1G6RH 4CJ1A 3PV6A 5IVOA 1TQCB 5D70H 1HZHH 4U1IB 5JQ6H 4EDWH 5H94B 5A2IH 1G7IB 5I16A 1JJUA 5DFWH 4FZEH 4I1NB 1ZLVH 1PD6A 1GC1L 2H26A 2NW3B 1BQSA 4PJ5B 3MRJA 3K1DA 3BPLC 2DTML 3QUZB 2GAZB 3ARDD 1IC5H 4U2ZA 3SKNB 4LPUA 4F9PC 5EZIL 4L9LA 2ZSWB 3LD8B 4KDWA 3ARSA 5CKGA 1SYSA 5DS8A 2ICWJ 2F58L 3VRIB 3U46A 3OXSA 3LIZL 1NDMA 2FL5A 4MX7B 4JFOA 2NNAB 2A83B 3HHRB 1CD8A 1KULA 4PRPE 2ZKHH 1UZ8B 1E4KA 1TENA 2WMPA 3L7FB 4PTUA 1PG7L 3QP3A 5T1DL 1UVQB 4NO0A 3BUYB 4ZXBA 2QADB 4K7FA 1KSRA 3QR2A 2QR0A 3WIHH 1BFSA 3QXWA 3LS5L 3BO8B 4LLYB 1BM3H 3QBTB 2EDFA 3P30H 5F88A 1KYOK 5B4MD 1PJ9A 4G6ML 2IPKB 3DECA 4NO2A 3QNZB 3TPUA 4G9DB 4Q9CA 4ONFH 2Q3AA 4Z7UE 1U8HA 1QSFE 5H2BB 2CO6B 3RVWC 4Y4FC 5GGRY 2OI9B 4CRPA 1QFUL 5T3ZH 2VERN 3CC5A 2PXYA 3UTTA 1NL0H 3DWTA 3CIQA 3HA0A 1MF2H 3T0VA 4RAVB 3RNKA 1BZ9A 4CKVX 1FFNB 3FT4B 4NC2B 5L2JB 1T6WA 5HYQB 4FQIH 3MLWH 1YYLH 2GSIA 3H9YA 1S9VB 4F7PB 3LDBB 3QG6A 5BMFH 4Z7VB 1JTTA 5CWSA 3PV6B 4ELMF 4X9BA 1MJJA 1HKLH 1ZKAA 2EDQA 2Y07L 4U4BA 1IQWH 4ODXA 4DCQA 1UB6A 5CD3A 2H26B 4A2MA 4MQXD 2J8UF 2VLJD 3QUKA 1ED3A 2H2SC 5I73C 3MRJB 2R0WH 1DE4A 2A6IA 3A67H 3MRFA 1HKFA 4N0FA 3QT2A 2Y9RT 1Z6JT 1IKNA 4Y19A 4U6HB 3LKSA 5DS8B 1UCBH 4HT1L 3PP4H 3NCCB 4ODHH 2RJMA 2IQAA 1ES0A 3IS0X 4Y4HD 3HN3A 3U46B 4PY8J 4QCIA 3OXSB 3WKMH 1AQKL 2H32A 2IJ0C 1NDMB 1L9NA 1WLHA 2FL5B 4JFOB 3MUJA 3KPRA 3QDME 3B5HA 2ZUQB 4TQEH 1EAPA 4PTUB 5L9DL 2F74A 3U4BH 2V6HA 3QHTC 4NO0B 4ZXBB 4K7FB 3AROA 3ULVD 2QR0B 3BZDA 4DAGH 3VI3F 5E95B 2YSSA 4ZDHA 1F02I 5F88B 5I2IA 5ISZA 4GUPA 3WNPA 3SGEH 5CS7A 1J05B 4BQ8A 1WCBB 1J87A 1XIWB 2CKBA 3EOBA 3TPUB 4PLOB 3NA4A 3FB5A 1AXTL 4I13B 2FATL 1U8HB 2FHBA 4MJ4A 1NMBH 2XXMB 4XNYH 4FQJH 4M7LL 3I2CL 4LSUH 3CC5B 1QFOA 1P7QD 2PXYB 3BX7C 3UTTB 2AK4D 4AL8L 3RFZC 3MSPA 2MHAA 5KZCD 3RNKB 2XT1B 3CLFH 3TBYA 1BZ9B 1OAQH 4X7EC 4MYWB 1QR4A 2HH0H 5JW4M 2GSIB 1HI6A 1C7TA 3QG6B 4ZOAA 1Y6NR 1T7XA 2D7TL 5DJ6B 2DIAA 4NCC1 4XCFH 1PY9A 4CBPA 3ZT5A 5ESVA 3VXNA 4DCQB 1WAAE 2UWEF 1UB6B 5CD3B 4IBLT 1X7QA 1UKSA 1LO4L 1FGNH 3QUKB 4NQXB 1WTLA 4CADA 1ED3B 1NANH 2FH8A 1DE4B 2A6IB 5C08A 3MRFB 4N0FB 5GQBA 1Q9OA 3NA9L 4JKWA 2DB8A 2OMNA 4Y19B 4PS4L 1IGFL 3TVMD 1P69B 4EXKA 5ACLA 3LKSB 3UROR 4YZFE 4GW1A 4MVBC 5B38G 3BIKA 1XF3B 1F3DJ 2CUIA 1JFMA 2IQAB 1ES0B 2R4SH 3OG4B 1WFOA 4NN7B 4WU7A 2H32B 4BJLA 4UINH 1J7VR 4LEOA 1N3NA 1C08A 2Z93A 3KPRB 4ZS7L 1UWGL 3RX7A 3V4PL 1X5LA 3MV9D 1IBGH 1J5OL 3CLEL 4LBEA 2VJXA 2LABA 4YDKL 1MFCL 2F74B 5BRZE 2ZOLA 3ULVH 3IRPX 4XI5D 1H15A 1FNEA 1I8LC 2X41A 1TZIA 1MIMH 2YSSB 3SDAA 2VN7A 2NXYC 5I2IB 5ISZB 4GUPB 1YC8A 1JK8A 1CIUA 5HHMA 5C70A 2X1QA 1QVOA 5GHWH 2VABA 2CKBB 3EOBB 4NDMA 5IG7A 4NPYA 5LXGH 1BECA 4XVSH 1A5FL 4DQOH 3FB5B 3W39A 4Z0BH 4K7PX 1OP5H 4P4KA 1P5VA 4NC0B 1EUTA 4YXHL 1DCLA 5EWIL 1EV2E 1P4IL 4KKCD 3BRGC 1H3WM 2D0HA 2MHAB 5MEQA 3OB0K 2E27L 4YNYA 1RIUL 5LQBH 4LVNC 1FVDA 1RURL 3WFDL 3IDJA 5I8EA 1HI6B 1A7QH 1GJIA 4EI5D 4ONOA 1FO0H 3EDKA 4GRWH 5BOPA 3B2UD 3O8XA 4GKSB 2VOTA 2FBJH 5ESVB 3VXNB 3DI3B 4HC1A 4OFYD 5BZDA 5D8JH 1X7QB 2C5DC 2Z92B 5LGHH 4JKKA 4CADB 4M7JH 3MR9A 5C08B 3Q0HA 4K3GA 1Q9OB 3ZYJA 4UBDD 5D71H 4GW1B 4KMTL 5L7XL 1X5ZA 3R06B 3BIKB 3CFKA 2VZUA 5C0AE 1CFNA 4WU7B 2A74A 3SGJA 4U1NA 3ABZA 4HG4K 4LEOB 1N3NB 3VRLE 1C08B 1L4IA 3QWRD 5CFHA 3TJEH 3UBXG 4F7EB 1N0XL 5EZJA 1RUML 3KYOA 4LBEB 5JHDD 2GCYB 1KB9K 2BMKA 3T0WA 2NYYD 2ZOLB 5F71A 5I1LA 2RGSA 2XIDA 1YEGH 1H15B 1FNEB 1TZIB 3H3PH 3SDAB 1YEHH 2IH3B 2IEPA 5DJXA 1JK8B 5HHMB 5IW1A 1QVOB 3BN9D 1MCQA 5F9WC 5IG7B 1DBML 1E4XI 2HKFL 4NPYB 1YEIH 3W0WE 4G3YL 3SJVE 2F15A 5D2LA 1N64H 3W39B 3BAEH 4UIMA 3IB4A 4KHXL 5ICZA 2IANE 3KYNA 4DJMA 1H3UA 5TPWL 2I07A 4UIKH 2EXWC 2GIYA 3IDGA 1WV7T 4MNGE 4C54A 4FQ1H 2X6MA 5IFJA 5KVDH 3PGFL 5MEQB 3B9KC 3T2OA 3MGTA 4YNYB 4U33A 2JJWA 4ZUVA 3MA9H 1FVDB 2P42B 4J3OC 3QZWG 3ILPA 3IDJB 4QXGL 1NAMH 4DTGL 2GTZA 4XC3H 3P0YL 2O26U 4V2CB 1A7PL 1TQCC 2ZCLL 4OQTH 3O8XB 2JIXB 4K7PL 5I1JH 5EOCL 3VWKA 1J11A 4IRSD 4IDLA 5MP6L 3DUUA 1JGLL 3U4EA 3ZHLA 5BZDB 4NJAL 4L4TD 4WHYG 4X6DA 3SQOL 3MR9B 2YXMA 1RVFH 5CJBA 3RBGA 4LSPH 3R1GL 1UEMA 3SGKA 3BPNB 1G7JB 3LD8C 3EKCA 2V7HA 2F19L 1QNZL 4PD4J 5FGBC 2E9JA 4CU8A 3CFKB 1L0YA 4JO3L 4YK4B 1YMMD 2EKSA 2R0LH 4HWBH 1CFNB 5E08H 2A74B 1U3JA 3FB7A 4OZHE 1ZEAL 4U1NB 5L6YH 5FYKD 2R8SH 5D1QA 1IC4H 4L3EE 3GJEA 5EZJB 3KYOB 2BMKB 4JO1H 5I1LB 1G7HA 4U6TA 5DA4A 5E99L 3VMNA 3G5YB 4KI1A 4XZUA 4QHKI 5A40E 5F8RC 5D5MA 5DUML 3BH9A 2MCPL 5DJXB 5IW1B 1HH9A 2VIRA 1CDJA 5IVXE 1JCKA 3PWNA 4I48B 2J8OA 3SGEI 3RHWK 2J6EH 4KY1H 4R2GC 4PUBL 4UIMB 5ICZB 5J56B 1DDHA 3KYNB 4MB3A 4I0CC 3KPSD 2V17L 5D96C 1FSKB 4ODTL 1GGBH 5DJ8A 3ULUD 3IDGB 4AQ1B 3TPKA 5EU7E 1ZLSL 5FV1L 5IFJB 3ESVF 5E4EC 4JPWL 3OKLB 5SX4I 3AM8A 3CX5K 1W72A 3MLSL 4ZNEA 4ZUVB 4HWUA 3GJFA 3ILPB 4RA0C 4H0GA 2GTZB 4E41A 4P5TC 25C8H 2YPLD 5GGQH 3GI8L 4JN2A 3ARVA 3VWKB 5FYLD 1U0QA 4N8VG 1L7TL 2O5ZH 3D85A 3DUUB 3U4EB 1A6ZA 2XKSA 5LBSL 5ALCH 3RVXD 3WJJA 4OCWH 1WZKA 4JZOA 4TSBL 4G7VH 2HT2C 1GPOH 4Z7WE 1FLRH 1T89A 1K5NA 2XN9D 3EOTL 2V7HB 4KJQD 4PJAA 1QSEE 2F9BT 3KR3L 1K85A 3ARGA 4HLZH 1CR9L 4WUUA 1MI5D 2EKSB 3QYCA 3F7YB 3A6CH 3FRUA 3KJ4C 3FB7B 4G80A 2R69L 3V4VL 1AHWC 1MUJA 5FYKH 1NGXA 4M62H 1KEMH 2BSRA 3HZYA 2ZUQC 2B1AL 3MRQA 1DP0A 1ULVA 1Q0XL 3ME0A 2QSVA 3CZJA 1WEJL 3GJEB 5KOMC 3GUTA 4GKNA 4U1LA 2KBGA 4NKMA 4QTIH 2GJZA 3IAQA 4XZUB 3O6FD 2MJWA 3TFKA 1UYWH 5D5MB 1UZ6E 5K9QI 4YE4L 3BH9B 1CE1L 1XIWC 3IAPA 4OGAC 1HH9B 4N5ED 2VIRB 3KPMA 4RFNC 2V5RA 5IP4A 2W60A 1EFQA 1BF8A 1QFWL 2DDQL 5I1GH 2HVKA 2EDDA 4U7SA 3WSQH 1PSKL 4OI9A 4Y16A 3RZCD 4PR5A 4D94A 1DDHB 3VXSE 4JFFE 1HYSD 2MTPA 1FRGL 3LB6C 4AG4H 1G1YA 1F11A 3ULUH 5DJ8B 3I9GH 1H8SA 4LVHB 1A6UL 4YQXL 3MCG1 1WVZA 1EHAA 3O3AB 3PWVA 4K3DH 1QBLH 4CL7A 4MB4A 4Q97A 4FMKA 3BD3A 3FN0L 2CO7B 3GJFB 3MLPA 2DBLL 5HJ3A 3U7YH 3V0WL 5GJTL 4E41B 4XP5H 1CBVL 1MNUL 1T2JA 3QIUA 4JN2B 4OCXH 3TIDA 2FGZA 4JPIA 5FYLH 1KCRL 1W8NA 1A6ZB 3EHBC 3LS4L 4HMCA 5FHBH 4JZOB 4MS8D 4YXLL 3UJIH 1BJ1J 1YDPA 5CINH 3IU4L 3TBVA 4YDIL 1DVFD 1JPTH 1RZ7L 2X9XA 4PJAB 3WFEH 2FBOJ 3S88H 3HMXH 1CICC 2C4XA 4MSWA 4KVCL 4MAYD 3ARGB 3CVHA 4WUUB 3CFIC 1R5VA 2J88H 4Z7VF 3MRPA 3FRUB 3LN5A 4G80B 1MUJB 3T2QA 4UTBL 1NGXB 1F3JA 2XA3A 3MXVL 3HZYB 1EFXA 4KDVA 3MRQB 4KJPD 5JUEH 1BWWA 3JV4A 3DBXB 3GUTB 5MEND 4GKNB 1BMGA 4U1LB 4X4XA 3RWIA 4KJWD 1MSPA 2GJZB 3SE8H 4M6AA 4V1DA 3H3KA 4NCDA 4OBSA 5ETUA 4NUJB 4S0SD 1QSVA 4CVZA 4C4KT 2R2EA 1OCWL 4BFEA 3KPMB 2W60B 2X89D 5HYEA 2GK0A 3OAYH 5DGRA 3U9PH 1VFMA 2HVKB 1BZ7B 1IGML 2DLFH 2HTLD 3L5WA 4Y16B 4PR5B 4WFFD 3K8LA 3BGAA 1F11B 1XT5A 5EZOH 5IBLD 1KXTB 5IEHA 3PWVB 4PLJC 2BRQA 1OF2A 1QKZL 4NHUE 4EBQL 3TBTA 3DX8A 1OD7A 4GRLD 3UTQA 4BYHA 4IRJA 2CUMA 2MQCA 4LCYA 4WHYH 5GRVK 5E7FA 4YHOL 3AREC 3C5JA 3QIUB 1NC4D 4JPIB 1OY3B 4EN3D 4PRIA 5EORH 5GJSL 4M61B 1UCTA 1IEAA 1NCUA 2DQIH 4PJ7E 1W0WA 4XVJL 2VNCA 3HLAA 5AZ2L 3T2PA 3TT3L 3PP3K 1QTYT 2X1XR 5BV7B 4XHQA 4PGEB 1YDPB 2PCPA 5F7LB 3TBVB 5SWSE 3WHE1 3BWUC 4IEFB 1JGUL 1Z9SA 3B3IA 3P9WB 4DFIA 2BSTA 1A6AA 4GAYA 4MSWB 5E70A 1UJTA 2A2QT 1OGTB 3CVHB 1WZ1L 1R5VB 5MHSD 1E6JL 4DN3H 3MRNA 1B3JA 3PQYD 2DF3A 3P4NA 4WRLA 4YDJB 3LN5B 1IEBA 5EUKA 5F6IB 1ZHKA 1F3JB 1HILA 1TMCA 1TJHH 1EFXB 4FRWA 2EDXA 3JTSA 3HAEA 4NHUA 5E2WH 2FX7H 2GTWA 4PGZA 1G9MH 4MJ2A 3RWIB 4QNPE 5BXFA 5LWYL 4WJ5A 5BS0D 1K8DA 5ETUB 1CL7I 1A9BB 1VHPA 3O0RL 4WV1A 2R2EB 1U6AH 5H37G 2EDJA 5FXCH 2A0LD 4Z7UF 2Y6SD 3CSYA 3L1OH 2GK0B 3E6FA 3QAZC 1MCKA 3GRWL 3L5WB 1NGWA 2EE3A 4C58B 3OSKA 4KZDH 4HZLA 5C6PB 2DQGH 3DMMC 1QLEH 5DUPL 3WXWH 2D9QB 4K8RC 3W9DB 5IEHB 5C07D 4NP4H 3HNTL 3T4AA 3WFZA 4XMPH 3TBTB 3DX8B 3UTQB 2HVJA 1MCRA 4IRJB 3SKMB 3HKFA 5HI5D 2ADFH 4LCYB 3LKNA 4P48A 1H8NA 5EOCJ 3O8XC 2F5AH 3C5JB 3HUJE 2EO9A 4PRIB 4GW5A 1MPAH 3LV3A 1F6AA 1IEAB 4XC1L 4GS7C 1H9VA 1W0WB 3BP4A 1KC5H 4NJ9L 1FG2A 5FUCE 3HLAB 1TJGL 1I7ZA 3PV7A 4X6BA 3RU8L 2K1MA 4LCWE 2H1PL 2YEZA 2PCPB 4PJCE 5DJZA 3B3IB 3SBWA 1VPOL 1SHMA 2BSTB 1A6AB 3TA3C 5C9KA 5FA3A 4GAYB 4X7SH 4ONGL 4YK4C 1UWEH 4R26H 2EH8H 2ZPKH 3MRNB 1S7XA 2A77H 3P4NB 5EUKB 1RU9L 3FZUD 4BFIA 5DQJB 4W4NA 1TMCB 1ZHKB 4POYA 1JZ3A 4NZDA 4G6FD 3S36X 1MLBA 3LEXA 3UPCA 4XWGL 1Q8MA 3JTSB 3HAEB 4NHUB 4YC2C 5DR5H 2VDPL 4XP4H 1U8KA 4F7TA 2XZZA 1JBJA 2UY6A 5K33A 3O4OC 4WJ5B 1LO3H 3MJ9H 5IWLA 1K8DB 1EXUA 4WV1B 2NXZB 1BFVH 4JVPA 2H41A 3VFPB 1DBBH 2I60L 4APQD 1OARH 1M7XA 3CSYB 4FOMA 3DO7A 5I15L 4K9EC 4X7CC 3F65A 1Z5LA 1FFRA 2DKMA 1NGWB 1YYMH 4LEXL 2X1PA 3NTCH 3MC0A 4JJHA 4HZLB 3RX8A 4Q0XL 1YUHB 2CKBL 4LCWA 1LP9E 1CDHA 5I75B 5TQ2H 5DRXA 1YEJH 1A7NL 5AG9A 1BOYA 3NH7H 2BOBA 4M48H 2AXHA 4MNQA 3T4AB 5C0BD 4YBQD 1S5HA 2HVJB 1ZV5A 4JG1H 2VMFA 3HG1D 3S8WA 3BE1L 3C08H 5CBAA 3QQ3A 3LKNB 5I18L 2ZOKA 3TN0D 3KPOA 1N5AA 4GW5B 3S3SA 4YHLL 1WAAF 4JFPA 3LV3B 3FTGA 3PDOA 3BN3B 3LQAH 1FG2B 3EGSA 3QISA 5DJCA 1I7ZB 1NUGA 4WVRA 3DVNB 2J3SA 4X6BB 4XWOD 2YEZB 4LRNL 1S3KL 5H8DA 3WXVH 5DJZB 4KJYA 3SGKC 2A9NH 5C2BH 1R3IH 1J10A 2HAZA 3MODL 4YZFF 4EXPX 4KI5D 3RY6A 2JK5A 3KLDA 4LSTL 4N1HB 5FA3B 4NHCH 4D8PA 2ZCKH 4K2UH 3ARBA 3MYZA 4V2BA 3SDXE 1S7XB 3RWGA 5EA0L 4BFIB 1LP9A 5ID1A 2VDKL 4X5WA 4U31A 1MLBB 1D5IL 3LEXB 5TE7L 1S9KC 1JP5A 3W82A 4F7TB 2VR9A 3QCUL 4WI4A 2XA8H 5A43C 4LLVA 2D2OA 1EXUB 2CIKA 2MFNA 2I27N 3HUJB 5C0RH 5LGJA 3QNYA 1QPXA 1GCFA 4QXUL 3DO7B 3DLQR 5EOQL 5L2KD 3TJHC 4GG6E 3IDIA 1Z5LB 3S36L 1YQ2A 1KIPA 1GYAA 1SJEB 1LO5A 1RIHH 4LCWB 4M6ML 3BP6A 5DRXB 5D7JC 1FPTL 3NBNA 2UUDK 1CDGA 2BOBB 4MNQB 5JNYA 1P6AB 4PP1D 3MLVL 1T21A 5GSVA 3EFDH 1T6VN 2Y36L 3A0OA 3MLYL 3RA7H 1NFDE 4PG9A 4W4OA 5CBAB 3QQ3B 4URTB 3QIWC 3W9EA 1EJ6A 4K8RL 1QACA 2ZOKB 1BEYL 2VLJE 3RTQC 4YIQA 1OSPH 3KPOB 4MQ7B 3QUYA 1N5AB 4JY4A 5D72L 3H42H 2FH6A 2O5YL 4X99A 4JO2L 4JFPB 5GS1A 1I3GL 1YECH 3QCTL 3AMKA 1NKOA 3PDOB 4LDLB 1NCWH 3N0PB 5DJCB 3TZVC 3MOAH 1CI5A 4M1GH 1FL3A 3CXDH 3RVUD 2NY4B 4KJYB 1AIFA 4KDTA 1ZVSA 4CVXB 5ECJE 3QI9A 3SO3B 2JK5B 2EDLA 5DEFA 3RZWA 1UC6A 4AEIH 4ZYKA 4GG6A 3C87A 3ARBB 2DQFB 1U41A 5IB1A 3Q5TA 4NRXA 1CIDA 3T09A 3RWGB 3VRLF 5EU7C 1LP9B 3ULVE 5ID1B 2DAVA 5C0IA 4X5WB 3GHEL 2BNUA 5FDYA 3EBAA 2AABH 1RJLA 4XP6L 2AEPH 4N8PA 1MCPL 3HFMH 5AYQA 4LLVB 5J11C 1VB9A 2CIKB 4AK1A 4FFWC 5J12B 3QNYB 4PJDA 3UC0L 1NCNA 2EC9T 1XR9A 2OS7A 2AK4E 3IDIB 4N90D 1KIPB 4XNMA 1LO5B 3OF6D 1OAZL 3L3JA 5I17A 4EUPA 3BP6B 3ARRA 4GRWE 4K9EL 1GIGL 2OK0L 3ZKXB 1DTUA 3RL2A 1IM9D 1N4XH 5JNYB 4MD5A 1T21B 5GSVB 3OX8A 4ZTPH 4QRRD 4U3HA 1LD9A 1VERA 4PG9B 4UV7H 3W9EB 1XEDA 4JPKH 4WCYH 3L9RB 1UM6H 4YIQB 3QO1A 3V6OE 5FM5O 4ESKA 4UT7L 3QUYB 4JY4B 2KDGA 5GS1B 4X99B 2YZ8A 2X5PA 5KVMC 2VXUL 1V3KA 4OFPA 4WI6A 2NY6D 5J7CC 1FL3B 1NGYA 3MLTA 5CJXC 3V0VA 1CTNA 3HI6H 3MUHL 1AIFB 3ZMRA 1ZVSB 5FF6A 4LHUA 4NZJA 4LU5H 3FOLA 3HNSH 1BFOA 5DEFB 4KFZC 1KJ2H 4YPGA 4ZYKB 4GG6B 4IOFC 2VDLH 2YPVH 3MV9E 3C9NA 4OZHF 5IB1B 3EDJA 4M5ZH 4NRXB 3LHPH 3J7HA 5F6IC 4LCCB 5C0IB 4HIHA 2ITDA 3KPLA 2BNUB 3NIDE 4X4YA 2HFGH 3QUXD 3BSZL 1RJLB 3W2DH 1MVUA 2WLZA 3WIIL 4FFYL 1AGFA 1CGSH 2OZ4A 4YPJA 4P3WA 6FABH 1RZJC 4G6KH 3C8KA 3QG7H 5BVPH 1MJ8L 3I6GA 3D18A 3MLZH 1NDGA 2DL9A 5KOVC 4PJDB 4OAWA 3VXMD 1XR9B 4FS0A 4WUKL 2UY7A 5DD3H 2HMID 2HT3C 4XNMB 2APWA 3O41A 3ROLA 2PYED 2NY1D 3DSFH 1BIIB 1J8HA 4AEFA 2LAAA 3L3JB 4EUPB 2JELL 1HH6A 1T7ZA 1HSBA 3MACL 3S5LG 4WFGD 1Q1JL 3CDCA 2EDEA 3RL2B 5KSAD 4MD5B 3OX8B 3UX9B 3BQUA 3VGHA 1K6QL 1LD9B 3TO4D 1IARB 4BH8B 1I1AD 4O5LL 3EAKA 3ZL4H 1B4JL 2WIMA 5JXEC 1NQBA 3QO1B 2YUWA 3P0VH 5ADPH 5IQ7L 2AJXH 4OCSL 3S37H 1A6PA 5ILTL 2J12B 3UJTL 2OR9L 5DHVH 4Z7WF 1HINH 1MRCL 1NGYB 4ZAKD 1F4WH 3BDYH 5CJOL 3MLTB 3U7WL 3V0VB 4QEGA 4NOBA 4S2SB 3TBSA 5FF6B 1DEEB 2M8XA 2P7TA 4LHUB 3FQRA 1U42A 3GJFK 3PIQA 3IDXL 3CFJA 1BFOB 4AYFA 4EVNA 2VLLA 4UUJA 1BQLL 2AK4B 3C6LD 5AWNH 2OQJA 5HGDA 4ZO6A 3C9NB 5JHDE 5E9DD 2DTMH 3NABL 5C86A 3GMPA 2VXTL 1CD9B 4HIHB 2ITDB 3KPLB 5EZIH 5M95B 4X4YB 4IOIA 1MVUB 2EECA 2C26A 1AGFB 1XF1A 2F58H 3MLUL 4TUKH 4I0PC 4Y2DD 4OF6A 5J13B 4OFYA 1EUUA 1UZ6F 4G9FD 3LIZH 4KK8C 4NZTL 4E42B 3C8KB 3SDDA 3IJHB 5HI3C 1NDGB 4PY8I 4HFUH 4N0UA 2ILLA 3P73A 2RAMA 5GZND 4OAWB 1KLUB 5T1DH 3VFNA 4FN0A 3P3YA 3O41B 3ROLB 3B43A 3MUGB 3W81A 3WEXA 4G6JL 3GMMA 2YBRB 1RUKH 1J8HB 5C9JA 4HJJH 2YA2A 3NPSC 4TNWF 1HH6B 1HSBB 3TNNA 3PUCA 4PJHE 5HVGB 3BQUB 2WWMC 5IJKA 3U30B 3S3PA 5KW9L 1QFUH 3KYAA 4L4TE 2Q7YA 1HHKA 3CDGA 5DZOA 4OZ4A 1KGCD 4LMQI 2UZIL 3KHOA 1H3PL 2FO1A 2WUBL 2B2XH 3VRJA 1EH9A 4ZFFA 1YMME 1PAMA 3TBSB 2Y07H 4K94C 2P7TB 3FQRB 3PIQB 5FYKE 1A3LL 3CFJB 4EVNB 1XGYH 2MMXA 2VLLB 3AS0A 4UUJB 1S7VA 4OGXH 4WTZG 2CGRL 2OQJB 5HGDB 5GS2D 5BCAA 3STZB 4FG6C 3RIFK 2MPAL 5IT2L 4IIQA 1XF2A 3GMPB 4NNYA 4XHJD 4QOKA 1T03H 4ZQKB 4RMTA 2RIKA 4IOIB 3S35X 1NLDH 1V7NL 4LSRL 1BQHA 4OUUA 3GSVA 2NPLX 3L3IA 4HT1H 3X13A 3CVIL 5EG6C 4OF5A 3BDBA 2HT4D 4WW2A 4XPFL 4OIIH 2BNQD 4ZO9A 5IWLC 3E6HA 1AQKH 5E6ID 1J1PH 1TLKA 3G9VA 3SDDB 4W70A 1CLOH 3L3OA 3KPSE 4PY7A 5TQ0H 1MWAH 3BKJL 3ULUE 4N0UB 1HXYA 3P73B 4OZFG 3WJLC 5FUCC 4P0DA 4X6CE 1RZJL 3VFNB 5MERA 3IFOB 4FHBD 3WEXB 3ARPA 2XZAH 3GMMB 4J23A 5C9JB 1RUPL 5DI8A 1YMMA 3WNKA 3HB3D 3MRBA 3RNQA 2YPLE 3OKNA 1T2QH 3TNNB 1AXTH 5FYLE 2R2BA 3RGVA 5E2VH 4LP4A 3EZJB 1I7TA 4XCEA 4M7LH 4IJ3C 3I2CH 4POZD 2Q7YB 5HD8C 2C9AA 2VC2L 3UAJD 1HHKB 3CDGB 5IMOA 4OZ4B 5I71C 5GRXG 1S78C 5F44A 2XN9E 2GI7A 3I84A 2DICA 3KXFA 3VRJB 1A22B 2VR5A 4Z8FL 1MI5E 4H88H 3UMTA 4ZFFB 1AR2A 3PWPA 1LDPL 1GHFL 4XBPA 5HYJA 1FFPA 3P9MB 1S7VB 2H9GA 1YY8A 5GS2H 4Q9RH 3SDYH 5JIIA 4M3JA 1D6VH 2FIKA 1YY9D 1XF2B 1I3RA 4NNYB 4QOKB 3JSSA 1RMFH 1XCTA 2P46B 4BUGA 4PS4H 1JRHH 3VFGL 1PKQE 4OUUB 3GSVB 3L3IB 4QNPF 3EW3B 3X13B 3MOBL 1MCLA 4WW2B 5HVHB 4PRBA 3RDTA 3OKOA 4UT9L 3E6HB 2Q86A 1Z2KA 4NZUL 4HV8A 3V5DA 2YD6A 3L3OB 4PY7B 2V2TA 2DQTL 3ARDC 1AE6L 1UWGH 1D9KD 1HXYB 5JDSA 3V4PH 1NGQL 4M5YL 4MXWH 2VLKA 5E6YA 4YDKH 2XN9A 5MERB 2Q8BL 5DJYA 3X3FH 3S35L 1F6LL 2Z8WC 2X1OA 1MI5A 5DI8B 4KUCD 4MJ5A 1YMMB 2ENSA 4NUGL 5E8PA 1RD6A 3MRBB 3RNQB 3X3GH 4OV5A 4HF5H 1A5FH 3GI9L 1Z0NA 5IEKA 4K3EH 2R2BB 3RGVB 5KS9E 4ODVH 4R8WL 3LY6A 1RJYA 1I7TB 4KQ3L 4XCEB 5I1IL 3RWJA 2Z8SA 3HUJF 4IOSD 1F00I 2AKRA 1KBGH 4YXHH 2C3VA 2AJUH 1P4IH 5B4MC 5IMOB 4MD4B 1FBIL 4JEGB 3U0WL 2EE6A 5CJQH 1RURH 1UB5A 3KXFB 4PJCF 2V5YA 4KDTC 5J6HA 3KPSB 3PWPB 4XBPB 5HYJB 1FFPB 2YPKA 3RAJL 2H9GB 2P24A 4ISVA 5F6HJ 3BRDA 3OKYA 3PDDA 5C8JA 2FIKB 1ND0A 2G5BA 4KV5E 3TGXA 4LCCC 5MENE 4K94L 2PO6A 5MI0B 1I3RB 3B9EA 4QT5A 4FQQA 1K8IA 1XCTB 4X6EA 3SGDH 5CKAA 5FUOL 4KMTH 1QBBA 3MGAA 4BSJA 5IB5A 2GSGA 4M7KL 5KTEL 5FO8A 4P2OD 4WWID 4PRBB 5HHOA 3RDTB 3OKOB 3EYSL 2Q86B 4MQXC 3CZFA 3BP5A 4HV8B 1G6RL 3V2AR 3V5DB 4WFFE 3S4SA 4BKLA 2V2TB 1HZHL 4ZUUA 3C5ZD 1N0XH 4TPRL 2OP4L 1RUMH 2VLKB 4OFVA 1UT9A 1E0OB 2XN9B 4HBCL 4FZEL 5DJYB 3MRDA 4DVRL 1LP9F 4Y4HC 1NBZA 1IC5L 1MI5B 3N1FC 4MJ5B 4AY0A 1ZT4A 3N85H 2VH5L 3D39A 3T08A 3K1KC 3KPPA 4I0KA 3PNWA 3LKRA 4AEHH 4OV5B 5EPMA 4G3YH 4YDVA 5FECA 4IHOA 5IEKB 5KSBE 4TUJA 5HPMA 4KHXH 3EOAA 4NC1E 1RJYB 2APVA 3RWJB 5DLMH 3HRPA 3ULVC 2R15A 4WNQA 5L88L 3HPJA 1D5BA 3GSWA 2OJZH 1N6QH 2C3VB 4H26A 1XZ0A 3AB0B 2EDBA 1SEQL 5HHXL 5KAQG 4GW4A 2IG2L 2JLLA 1Q0YL 3PJSA 3Q5OA 1UB5B 4QXGH 5CSGA 5MHSE 4F37F 2ZCLH 2X4QA 1VA9A 4K7PH 3PQYE 5EOCH 1TDQA 1FZOB 1V3LA 5MP6H 4ONFL 2YPKB 4Y2OA 4GG8A 3NCBB 2P24B 2JJSC 1A8JH 4F33A 3P11L 4ISVB 4N8VA 3ZDZE 1BREA 3BZFA 4R9HA 1DQDH 3SQOH 5C8JB 1ND0B 2G5BB 5E94A 2PO6B 1EJOH 4QT5B 2WQRA 4FQQB 5BS0E 1K8IB 1UXSA 2GQHA 4X6EB 1GH7A 1MF2L 2WP3O 1QNZH 2R1YA 3NCJL 4OZFH 1MFDL 4PJBA 1TZGL 1X5KA 5IB5B 2HRPH 2GSGB 4JO3H 4PJGA 3AGVA 4FQIL 5FO8B 1YYLL 4OF8A 5HHOB 2DLHA 1ODAA 5DHXB 3EO0A 1I3UA 1QLRA 5BMFL 3CZFB 4LCUA 2QSTA 3BP5B 2XI9A 3NFNA 3V6OC 4C56A 4BKLB 3VD4A 1AI1L 1HKLL 3ARFA 4ZUUB 2BVOA 2KL6A 1IQWL 4J7RA 4LVEA 1DVFB 2FLBT 1SJVA 3CMOL 4GG6F 4L1DA 2J4WL 5C07E 3TVMC 4P2CG 1NFKA 1KXQE 3MRDB 2R0WL 5HGGS 2EE9A 1NBZB 3K74B 4PP2A 1ZT4B 3D39B 4Y0GA 1G84A 3CSGA 4Y7MA 3V0AC 3KPPB 3PNWB 3NGBB 3LKRB 4XNQA 3BGMA 5EPMB 4YDVB 5E1HB 3HE7A 4IHOB 4MCZB 4OF0A 5FECB 5J6GA 2R39A 4ODHL 3J8F7 4RAUA 1BAFH 4TUJB 3U30C 5HPMB 1U8MA 4W6YB 3EOAB 1OB1A 4OFIA 2V17H 4ODTH 3ILQD 4XI5C 5BVJA 3M8OL 4WNQB 2QV2A 5F7DB 2DWEA 3HPJB 1D5BB 3GSWB 1ZLSH 1FC2D 5BS0A 4H26B 4PJDF 1XZ0B 3WO4B 4TQEL 4JPWH 2IFFH 4Y1AD 2X70A 4GW4B 1XMWA 5IROA 3U4BL 3WNNA 3GSXA 2Z31A 1NMCC 3PJSB 4DAGL 2NX5D 1YNLH 2ZNWA 4KQ4L 3SCMD 5J0BA 2X4QB 3GI8H 4S1DD 1IAKA 4KKCC 2IADA 1D7FA 5LBSH 4GG8B 3MCKA 4F33B 1NMBL 4N8VB 4TSBH 4XNYL 2QHRL 3BZFB 4WWKD 4X6FA 3ULVF 1RULL 4FQJL 5E94B 3MJ8A 4LOUD 1YN6A 5CGYD 4EI5C 1CZ8L 4U1SA 1UXSB 1WQVT 5CZVH 1YJDL 3B2UC 4OCLC 5T5FL 2R1YB 3CLFL 1NGZA 4XTRD 4PJ5D 2DN7A 5TF1L 3F7RA 3QUZD 2HH0L 3MBXL 4PJGB 3QEGL 1MY7A 1QLRB 2R69H 5D6CA 3V4VH 4LCUB 3NFNB 2CUHA 4WHDA 4C56B 1QA9A 3L3GA 2B1AH 5GIRA 1ZHLA 4XCFL 3BXNB 1Z3GL 2BVOB 4UBDC 1P4BL 1AC6A 1OAXL 4NQDD 3M1BA 4DWHA 3BYTA 5JPMA 4AT6A 1YPZA 5C0BE 5F7MC 4UU9A 1KCSH 1Q94A 3DRQA 2CDGA 2OR8A 3DTXA 4U1GC 3DJ9A 4PJ9A 3HG1E 1U8PA 4PP2B 5IGXL 3E8UL 4PV8A 3LEVL 2ICES 2QADD 4XNQB 3BGMB 3SDCD 1ZSDA 2DDQH 3HE7B 5J6GB 1PSKH 4RAUB 4D0CA 2RFXA 2R4SL 1U8MB 1X3DA 2NYYC 3GBMH 4HUUA 1FRGH 1OB1B 5M7QA 4OM0H 2IBBA 3HRZA 4UINL 5BVJB 3VH8A 2DWEB 1A6UH 3LZFL 4YQXH 5BS0B 4RRPG 3QUMA 1I8IA 1RY7B 1C5CH 1IBGL 3BN9C 2X70B 3CDYA 5F1NB 1B88A 2Z31B 3VI4E 4KI5E 3VFMA 4PJ8A 3ULVL 1LO2L 1X5JA 3V0WH 5GJTH 1MIML 1MHCA 1CBVH 4HZAA 3KYKL 2E6PA 4FFVD 4FXLA 4OLEA 5IR1A 2EE2A 5GHWL 1IAKB 4ZTOH 1UH4A 4Y5XC 3G5ZB 2IADB 2JTDA 2XXCB 2W9DH 3K4ZA 3LS4H 1KNOB 4NBXB 3MCKB 4B7LA 5DZNA 4YXLH 4M9PA 2UZYB 4X6FB 4Z7OE 1H8OA 1T1XA 3IU4H 3MJ8B 1YN6B 3NIDF 5IMKA 3JXAA 4U1SB 5GISH 1RZ7H 3ARYA 3HI5L 4KVCH 3PDGA 5LQBL 4IRSC 2HT2D 1G0YR 5HVHC 4B53A 3ZDYE 5L2KE 2CLVA 5D6CB 2G75A 2B1HH 4UTBH 1MFEH 3L3GB 5GIRB 1ZHLB 1P9MA 3G04A 2FBJL 1MFBL 2FB4H 2W92A 2VDQH 3M1BB 1NGPH 5D8JL 5JPMB 2OM5A 2DM4A 5LGHL 3HNVH 1YPZB 4M7JL 5F7NC 5AUMA 4UU9B 1Q94B 1UM4H 1MJUL 2CDGB 3DTXB 1M05A 4PJ9B 3O6KL 4BK5A 1U8PB 2LE9A 1U3ZA 5L8LB 5IMMB 4NO0D 5J1SC 4ZXBD 2VISA 5D71L 4K23H 1E4JA 1ZSDB 1IGMH 1NPUA 4D0CB 2RFXB 3OZ9L 4HUUB 2IBZX 4W81A 3HRZB 1WIUA 2SEBA 3OV6A 3TJEL 5IB4A 1OTUD 1I8IB 1QKZH 4KRLB 4OLUH 4EBQH 2DMKA 2CR3A 5JLZB 4APQB 3VFMB 1YEGL 2PXYD 3UTTD 1HIML 3PP3H 2NY5C 5EIIA 1RQ5A 4YHOH 3H3PL 1MHCB 3L3KA 1YEHL 1FH5H 3ULUC 2Y06H 5IR1B 2OCFD 2L7UA 5L0QC 4OQ1A 2D4DA 1N64L 4MCYA 4M6OL 4RMQA 4XVJH 2PN5A 2Z8VC 3BAEL 1FVEA 5AZ2H 1JVKA 5C0BB 2D31B 2FWOA 5GGSB 3MXWH 1T1XB 1GRWA 5IMKB 4FQ1L 4RGOH 1JGUH 2DYPA 3QULA 2C4FU 5HSFA 1NCAH 2EDTA 3JUZA 3UYOD 3FMGL 4KK6D 3SOBL 1U2CA 1KFAH 3ECBA 3MA9L 1E6JH 4WHCA 5JOEA 5E03A 1NAML 3RVXC 4XC3L 2CLVB 4Y19D 1A0QH 2G75B 4N90E 3VXQA 4OQTL 1PYWB 2CRYA 5E8EA 3O9WA 5I1JL 3RUGA 4K71C 3FFCA 3GO1L 2D7QA 5DMYA 4RX4A 1URLA 4NQUA 1YNTA 4KJQC 4OGZA 2ORBL 1UEYA 2H8PA 4JG0L 4QRRE 4KGJA 3OKEA 5AUMB 4KH2A 2R9HD 3O0RH 4FQCL 2W9EL 3RWFA 3P77A 2RBLA 1VGEH 2VISB 2N7AA 4PJHF 9CGTA 4KZEH