3MRKA

Crystal structure of mhc class i hla-a2 molecule complexed with afp137 nonapeptide
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
274
structure length
273
Chain Sequence
GSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDGETRKVKAHSQTHRVDLGTLRGYYNQSEAGSHTVQRMYGCDVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQTTKHKWEAAHVAEQLRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDEATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWVAVVVPSGQEQRYTCHVQHEGLPKPLTLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of MHC class I HLA-A2 molecule complexed with AFP137 nonapeptide
rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
total genus 82
structure length 273
sequence length 274
ec nomenclature
pdb deposition date 2010-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mrkA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3mrkA01
2EEBA 3O6MH 4FG6C 4MZ2A 5H37H 1YYML 3QWOB 2AKRB 3FT4B 4GRWB 4PJ9D 1LGVA 3Q1SH 4XCFL 2NY6C 3GBMH 3MJ8B 1QR4A 1LEGA 4K71C 3WLWC 4OZHA 4YK4B 3SO3C 4Z76B 1HHJB 4JDVA 3NCMA 4HXAH 1WTLA 3WL9B 1YECL 2C3VB 3KNBA 2V5YA 3CVHL 1D5XA 3QZWB 4PD4J 4JFEB 5AYUH 1GC1L 4X7SL 1FIEA 4PB0L 1KYOJ 4EI5D 4UILH 3RRQA 3G6AA 1HK6A 1CYGA 2AXGB 2V7HA 2H1PL 5HHME 1T2JA 2EYRB 2R9HD 2E7BA 4M5YL 1BJ1J 2HN7B 5D1XC 2X44D 4BSWA 2Y1VA 1PQZA 2CLZB 3MRDA 1WZ1L 1S8DA 2A0LC 1NC2B 4PREA 4K7FA 4Y8AA 1CICD 1L6XA 1JN6A 1I3RB 1A3RH 2R23A 3DYOA 3QXVA 4G6FD 1HILB 3IU4H 2DM3A 2HLFC 4UOJA 2QL1A 2JJSA 2XFXB 1S9YB 3QA3B 4JN2B 5IJKA 5IHUL 5JTWA 1SY6A 5K9QI 4QXGL 2E27H 2IEPA 1BVKB 4APQA 1JRHL 1JPSH 4LLDB 4R0LB 5BVPH 2V9TA 4UIMA 2DI8A 2GKIA 2V5SA 3QT2A 4PY8I 1GC1C 4WV1B 1GIGL 3STLB 4Z78A 4EI5B 1UB6B 4OD1L 2GY5A 5IMLB 3KPSB 2R1YA 1JHKL 2MKLC 2ITDB 5D2LB 3VGDA 1FC2D 4ORGB 2Q7YA 2ESVD 1KBGL 4HZLA 1U8KA 4LF3A 1S7RA 5F9JB 4XRCA 1UA6L 5E8PB 4LCCB 3VWKC 4YHYB 4QRQB 4P4KB 5EA0H 4BH8B 3NCFB 3R06B 1NC2D 4YUEL 2DLFL 2HYMA 4M62L 3S37X 3N9GL 1HNFA 2B1HH 2Z93A 32C2A 4I9WE 4G9FD 1FVDA 5TPWL 1EJ6A 4AEHH 3U7AA 1N4XL 4HC1A 2VITB 3QO1A 4C4KT 1L9NA 5B4MC 1NMCB 5EZJB 3MV7D 3P0VL 1ZTXH 5D71H 1CTNA 3FB8A 3AXLA 3TCXA 5JIIA 1ZLUK 2EH8L 2GTZB 3K80A 5KG9A 4M00A 4NO3A 1MFBH 3U6RB 1G9ML 3BWAB 3RHWF 4HJ0C 4B7IA 3QDJE 3TESA 3TJEH 3JTSA 1OLZA 1GGIH 3B9AA 4J3UA 4PJGE 4C55A 3MBED 2Z35A 4LPUA 4L29A 5CBAA 2WMPA 1WFNA 3IKKA 4KK6D 2LAAA 3KXFE 4NQEE 4BFBD 3HC4L 3GJFA 1FFNA 1DBKH 2D4FA 3BKCL 3GIVB 2JB5H 3UTZB 4OLEA 4FOMA 1MIEH 1ADQL 3UTOA 5J13B 3TNMB 3RWDA 3VXRB 1ONQB 5C6WH 2O5XL 5I1EL 4V2BA 1IJ9A 3O8XA 2G75B 3KPQA 3OKLA 3ZSSA 4HIHB 5BS0A 4D0BA 1QRNE 3D0LA 1MI5A 2XG5A 3G6AB 3T0AA 1ZGLB 5HYIA 4RBPK 2ARJQ 2UY6A 1J12A 3MC0A 1A1OB 4JR9L 2BNRA 4PRDA 5AAWA 1NGXB 2ZJSL 3FZUD 4D9RD 3C2AH 4MAYD 4UMGA 5CZKA 4QTIH 1AFVL 1YJDC 4XCFH 1ZA3B 3QEUB 3LPWA 3LN4A 3FO2A 4Z95H 3UTSB 5FO9B 5E8EB 5IFHH 5KVEH 2UYLB 3RZCB 1Q9LB 4QXTB 4MA8L 3OPZH 1S8DB 4F15C 4XB8A 4LCIL 1T2QH 2Z31B 1INEH 3V0WL 3QQ4A 1L7TL 2CJUL 3MODL 4GFTB 1LO5A 3U9UB 3RY4A 4LK4A 4UDTA 2ZCHH 3OX8A 2WZPD 2VXSH 4OSUL 3VJ6A 1JYVA 3L7FB 3AMLA 2LABA 3V7AE 4PRIB 2DDQH 4HK3J 1B0RA 3C8DA 3TYFA 4P2YA 1IAOA 4I8DA 4DKAA 3RVXC 5K9JL 4OM0L 1A7PH 1UB6A 2DLHA 1BVLB 1ZS8B 1U3JA 3K74B 3WS6A 1J5OH 3S34L 4QF1B 1RUKL 2P5WB 1AY1H 2VXVH 4RGND 1QHOA 4RMSA 1AQKH 1VKXA 4YJZL 2DQGH 4Q9BA 1QLEL 1ZHBA 4M7JH 2J4WH 3BYTA 3I50L 1MJ7L 3H9ZA 1NFDE 4OLYL 2DL2A 3OKDB 2HTKC 2NW2A 1ED3A 5E9DA 1UKTA 3AC0A 1XIWA 2OMBA 3VFVB 1EO7A 3OKOB 3JSSA 1JMXA 3P0VH 5DVOA 1U92B 3FCTB 1EVUA 5EZJA 4AZ8A 4M8QB 4MLIA 5L8JB 2OL3H 2HAZA 3AREB 1PG7X 1MFEL 1XGTB 1IGMH 5JDSA 3B2VH 4XAKE 2JJTA 3ECBA 4YPJA 4NT6B 4GS7B 3MBEB 5I66B 1T0NB 1RJYA 1MWAH 1I1FA 2G2RB 3DV6A 5HYJE 1OP3H 3OB0K 2AV1A 3G5XA 4FQJL 2VR9A 2A6DA 5BV7B 1D5ZA 3CIQA 4PJDA 4XVTL 3RNQA 5CJQH 3B9VA 1QSFE 5IOPB 4NHUB 2BC4A 3CVHA 4MNGE 1P7HL 5IQ9B 4XXDA 3KPRA 1R5WA 3RQ3A 3PHQA 4LP5A 4I48B 4NKOA 1VSCA 3ES6B 2C1PA 4L4TD 3RL1B 3U0TB 1IE5A 3ARTA 1VGEH 3NCEB 3RWHB 5HHMD 4XBPA 1MH5A 1P6AB 1IGIL 1S5IH 2A6IB 1ZAGA 4A6YB 4NQCD 4HK0A 5IG7A 1ROWA 2AXFA 1J87A 3QB7C 4P2OC 4K07A 4CJ1A 3T8XA 3RWDB 4KTYA 4GBXB 2IJ0C 2WIIA 4FFZH 3ULVH 2ILLA 1SYSA 5ECJE 3DHJA 4QCIA 3CCHA 5DUBB 1AQDB 3WKNA 3ARRA 2DQFA 3D0LB 4JQVC 3IFPA 4MD0A 2VJXA 2Y7QA 4RX4A 5KTEH 5HHNA 3SGEH 5LBSL 3ARFB 4Y4FB 4OM1H 5F7FA 3RWEB 1GOGA 1U8HB 4I0CC 5DGQA 3STBA 4KI5E 4FXGB 1I4FA 3Q3GB 3QRGH 2BNRB 4NQCE 4V3DB 2YD7A 4P9HC 2I60L 2R1XA 4XNUL 1QSEE 1W0WB 5J3HC 3WXWL 1IL1B 1BOYA 4OKDA 2D0HA 3VXQA 1RJLB 1CXHA 1WCQA 5HHMB 2FLBT 3BDXA 1U36A 1PG7H 1QFWI 1Y0LA 1OD9A 3U9UA 4ZOAA 4TOYH 3OX8B 5DS8A 4TUOA 5IF0A 1U8PA 4ZS7L 4LPXA 3TBWA 2X4OA 3U0PA 4G8IA 4NO0D 3GO1L 5BS0D 3EYVB 3P4MA 5H8DA 4JHAH 3IFLL 2LV4A 1BQLH 1JZ3A 1T1XA 1RZ8A 1E4XL 1KPUA 1N59A 3QNYB 4FZEH 4MS8C 3VRLE 5F88B 4LLUA 1U2HA 2DQDH 1VKXB 4MNQE 2B5IC 3NAAH 1ZHBB 3QUYB 5DD5L 4GMSH 5D2LE 3V6ZA 3KLHC 3ZSTA 3RA7L 3ULSA 4HMDA 4IJ3C 4NKDA 3SE8H 3VFVA 4MD5A 4LRNH 2ADFL 3BKMH 3ULVC 3O3DA 5EU6E 4PR5B 4PJCA 4OLUL 1IGYB 4M9OA 5BQ7B 4WO4B 3IDGA 3CXHJ 3UTTE 4HPOL 5E6IB 2EDTA 4KTDH 2E6PA 4NT6A 2KDGA 5C0JA 1HKLH 2G5BB 4L8DA 1YNKL 3ZDXE 1C5BL 1FBIH 3S5LB 1MPAL 4MXWL 2YD5A 4Y1AB 1UJ3B 1EEYA 2VQUA 3FQUB 5T5NF 4NZTL 2A6DB 4GXVH 4RISH 4HAFA 2OCFD 4GW4A 3P30H 1VFAA 2MCG1 3CFDB 4TQEL 1JV5B 1P7KB 1YEFL 2E9WA 2Y25A 2VE6B 4ZO9A 5IEHB 4KU1A 5IBTH 5BW7C 3P4NB 4O4YL 4I48A 3U30B 1ZK9A 4UT7L 5JO5B 3RL1A 3U0TA 2J3SA 4FABL 3E6HA 1IC4H 1EXUB 1A7NH 5IB1B 3A6OA 4H1LG 4AQ1B 1QUNA 1MFNA 5IG7B 2AXFB 3UTTD 1JGDA 4FFZL 3ULVL 2EDRA 4M43L 4YDVA 4S0UC 3FRPA 3I6GA 2ZCLH 4HIEB 2NX5E 3NN8A 1KT2B 2EKSB 3BI9X 1HKLL 4GSDH 4QCIB 3VCLA 2ZUUA 5C3TA 4MD0B 1FCCA 2P5ED 4PB9L 3VG9B 5DWUH 4Y4FA 2BOBB 3FKUS 1MI5D 3T77B 5I1IH 1SMAA 3HZVA 4Q0XH 1C5DA 4FXGA 4R97C 3LPGA 4MA3B 3G6JA 4HUKB 5I1JH 3VXSB 3UPRA 1AR1C 1I1AC 3H2WA 3UTPD 2A1WL 1JP5A 4MJ6B 1UFUA 2VQ1B 4HBCH 3U7WL 1AR2A 4DGVL 2FZ3B 4F58H 4I5BA 4ONOA 3ESUF 3GIZH 3SDCA 1A2YB 3CFCH 1DANU 3VGAB 5GGUA 1JFQH 1Y0LB 3H3PL 4OAWB 1EEQA 1L9MA 4OFKA 1U91A 5KVDH 3U4EA 4TUOB 4LFHD 4ZPTB 5IF0B 4LARL 1T89C 1CTOA 4PRPA 4LNRB 3UP1A 4KY1H 4X8JB 5B8CB 1F42A 5EFIB 2ZPKL 3EJJX 3EYVA 5I73C 1LNUA 3X13A 5CBEB 1OF2A 2FR4B 4UTAH 1EJOL 4D94A 5D1QD 4ERSL 4WI5A 4ONGH 2DTSA 4I1NB 5DMIH 2E7HA 4M7LL 2GEEA 3SEPA 3D48R 4K7PX 2EYSA 3BN9D 2EDFA 1IEAA 15C8L 1BQSA 3PV6A 2I9TB 1E4KA 4DKEH 1ZGLP 4JFXB 5C0IA 1OTUC 4PB0H 4OBRA 1KJ2H 1QEWA 5I1HL 2EC9T 4X5XA 5BRZD 4GAJH 5MP6H 3LVEA 1G9MH 2DJUA 3FAWA 3FQNA 2HJKB 3P40A 1IGYA 5EIIA 1JNHA 4WO4A 2JK5B 1IAIL 5C0CE 4ZNEE 3C2AL 3HAEH 4O5LH 2HVKA 5D71L 1BGXH 5DJZA 3K4ZA 1ZHLB 1R3KA 1YMMD 2IAMA 5HPMB 2BHYA 3CFCL 5FUCE 1JGLH 1TQBB 1YZZA 3OBAA 3P9MA 1QZ1A 5CD5C 3WFCL 3I02A 4ODHH 4RQQB 4Y1AA 1UJ3A 4NRYA 3B2VL 2OTWA 4OFIA 5FUCC 4C57C 3ULUE 4CN4A 1VFUA 3MUGB 4GW4B 1FNEA 5TE6L 1XGYL 2Q8AL 1S9VA 1I75A 1NCWL 3C6LB 3O41A 1T22B 5HVWA 5BO1L 2FBJL 5BOZG 3ULVF 3QP3A 1WAAA 2EEDA 5BZDB 3FTGA 1MREH 3L3GA 1BZ9B 3TA3B 2XWJB 1IRAY 3QIUB 4LHUB 5HYEA 2FATH 5CGTA 3HUJB 3I6GB 4GSDL 4DOHB 2XXCB 1RZGB 3B5TA 3V9FA 4YFLI 5DQ9B 2YRPA 1U0QA 1JI2A 1ZGLM 1IC5H 3VCLB 4EBQH 4AL8H 1RZJH 4HQQL 1ZWIA 4MQXC 2BOBA 3T77A 5DJ2B 5CD3B 5FEBA 1C5DB 2W07A 4GXUM 3REWA 4MA1B 5EU3A 4P5KA 3BSZL 5TQ2H 3IDUA 1QRNA 3VW3L 4JHAL 5ICZB 4YHZL 1T03L 5CEZE 3T4AA 4LQFH 4NSKB 1KJMA 3Q1SL 4HUUB 4KRPC 4EUPG 3LDBC 5T1LD 3OB8A 4IMLA 4PJ5E 3SDCB 4PD4K 1DBJH 1FNHA 5D7SH 3OJ2C 3MLUH 4GMTL 4AEIH 1L4IA 2AQ2A 3MRMA 4HKZB 4M6OH 4PS4L 4PJ8D 1FO0A 5DJ8A 5A2KH 2QADC 3L7EA 5SV4A 1MELA 1QBBA 4P4RB 3VD3A 5D9SA 3U4EB 3DX6B 3UBXI 3IDMA 4URTB 1Q8MA 2GI7A 3V8CA 3B83A 5EFIA 1J1OH 3V0VB 1KCUH 4OLUH 1HHGA 1BOGB 2WWMC 3HN3A 4NCDA 3KJ4B 2JIXA 1E27A 2EYTB 5KSBA 1KG0A 4YH6A 2KQNA 2VZUA 3S98A 2H8PA 1MFAH 1UM5H 3HUJF 1NQBA 3JWNC 3OSKA 1U3ZA 4L4VA 3FONA 5TFSL 2A83A 3TZVA 2K1MA 3ALWA 3VH8G 3GI9H 5T3ZD 2AABH 2OP4H 4QY8A 4V2CB 2Z4QA 1L0QA 1C08B 3MUZ1 4R4BB 4WFHD 5CJ8A 3NTCH 4HWBH 1TVDA 3TJHC 3SDCD 4LLWA 2W92A 1HHHB 2W0LA 3PHOB 4KMTH 1VB9A 2E6JA 1N64L 2R4RL 2X41A 4OLZH 3T1FB 2ICWB 3BP7B 4APQC 4PRNA 3O3BA 3MCG1 5EIIB 4ELMB 1NFDA 4FABH 1M71B 3CMGA 2I25N 7FABH 3BH9A 4LCWE 1F4XL 5C2BH 4L8SA 5F7HA 3L3HA 5E8DH 3TBVA 2PYEB 5HVFB 1G84A 5L7XH 1K2DA 3A67L 1OSZA 4K2UL 2YZ1A 1UACL 4W4OA 5FOBB 4YE4L 1CFVL 3QYCA 1GVIA 2DM2A 1FG9C 3QDMB 1I8LA 3QULA 3S5LG 1KIRA 4R8WH 3PWUB 2R69L 1M05A 4H20L 3UJIH 2M26A 3C6LA 5T33H 1J1XL 4JFZH 2ZUXA 3QUMB 3SE9H 4QRPD 2NY1C 4ZOCA 2L7UA 4P2RE 3T3MF 3GSXA 1OAXL 3VGHA 1KELH 4ODUB 4NQCB 2GW5A 3CFKB 2H6PB 3FZUC 1B4JH 4LQ1A 2WM0A 4M3JA 1KJ2A 2IBZX 4JCMA 5J56B 3FB5B 3BESR 2XWJA 4LL9A 1I85A 3FFDB 2XTJB 3FT2B 4Q9RL 4NN6B 1T5WA 2MMXA 3V52L 4P3DA 1LO3H 4WUUB 5D7IA 2YPKA 1CDGA 3ZYOA 3WFCH 4TVPL 1NFIB 4MA7H 1DEEA 2H2SD 4FXLA 4LDLB 4GAYA 3BEWB 5E95B 4Y16C 4LSRL 4HEPG 1L7IH 1ZWIB 1CFVH 1X5XA 3AGVA 2I5YL 2CLVA 3OR7B 4HDIA 4XC3H 1JPSL 3WBDA 1NSNH 3MOAH 1XH3A 4U1GC 3J7HA 3C2SA 3RY5A 3UMTA 1FO0L 1V7MH 2XY1A 4RA0C 3IDNB 4IRSB 2P8PB 3AS2A 3WIIH 4YEFA 3TVMC 2AI0L 3BKJL 2MNUA 4PGEB 4WFFD 2Z8SA 1NMAH 1ADQH 1AXTH 1YN7B 4XWOD 5TDOB 1MCPH 3CX5K 2BK8A 5D93C 2VDMH 4M1DL 5CKGA 1CE6B 4HZAA 4FZEL 2G9HB 4CU7A 4XAKD 1IGFH 4PRPE 1SEBB 2ORBH 2HFEB 5E1AA 3GUTB 4KK9C 1NAMH 3QI9A 1T04B 5GGSA 4O9HH 2NZIA 2CKBA 5ITBL 1UM5L 3CH1A 1ODAA 3OHXA 5DHVB 5CEYB 3UTSE 2VDOH 3S35L 1QP1A 2BSRB 1WT5C 5FYJE 3ZDZE 4LOUC 4OUOA 4RGNE 4EDXB 3EHBD 1CFQA 4OV5A 5JOEA 3TZVB 1LP9E 1PKQA 5T1DL 5BMFH 1G0YR 1P1ZA 1XF3B 1XIWD 4DGYH 1C08A 3X3FH 4R4BA 1P69B 4LLWB 1J05A 3WN5C 2ZSVA 3FB7B 3W0WE 4CL7A 4HV8A 5E2UH 4QHNB 5DVNA 3J8F7 4NPYA 3LH2L 4Q2ZB 3MJ7A 3BUYB 4NUJB 2KZWA 2CDGA 1NAML 2EECA 3JXAA 4WENB 3NACL 4JAMA 3H42H 4NN5C 1UZ6E 4QOKB 3LRSA 4RGOH 3VRJA 4MXWH 5MI0C 1J9CT 2DQJL 2E8ZA 3S4SG 3QULB 4GAGL 1DCLA 4Z0XA 3QR2A 3ARED 1D9KA 3VMOA 1GZPA 5C07E 1NC4A 1GOHA 2R2HA 5J8OA 5L9DH 4UNTA 1ACYH 2Q3ZA 4ODUA 1N64H 2FHFA 5HGBB 3VG9C 4OCWL 4OF6A 2FB4H 4Y5VA 3S3PA 2O93L 3HC0A 4WEBL 4LHQB 5HI3C 5KW9L 1KJ2B 2HWZH 2YKLH 1CVRA 1HN1A 4POZC 1YEKL 1KB5A 1RSFA 1U3YA 2P44B 4LSPL 5LWYH 4NM4L 5T3XL 3TGXA 3FFCA 3K2UH 5D1ZD 2Z9TA 4WUUA 3BO8B 1NFIA 3MLSH 5HHPB 1MWAL 3PWNB 1S7WA 3BEWA 1G6RB 5K59E 3AB0C 5FYKD 1PEZA 3FFCE 5JNYB 1INDL 3PP4L 4XX1E 3MRCB 2X1WL 4OZHF 3B9KB 3VXUD 2FCBA 5JHDA 5DEGB 4FTVD 1H0DA 5D7JA 1IC1A 3L6FB 3QH3A 3SOBH 1QO3B 1YUHA 5E2TH 5GZNC 2YD3A 5EU4A 4U0QB 5D2NB 3BHBB 5KSUB 1KJVB 1PZ5A 5L9DL 1DZBA 4IRSA 5JPMB 4HH8A 1M1SA 5EUOE 3FOMB 3PGCA 4G42B 5LG1A 3QXTA 1MFBL 4LGSB 1FYTD 2ATKA 3DRQA 1MFDL 4TQEH 1JNLH 2XA8H 4JY4A 3H0TB 2Y4SA 5FGSA 4L3CA 4K7PL 3MRJB 1A7QH 4OZ4A 3ILPA 4TUJA 2DYPA 5IHZA 3TPUA 1T04A 1RU9H 3BXNB 1NCDL 4EUPA 4K3EL 4X80H 4KKLD 2R2BA 1LK2B 5EZOH 4GKOA 3HC4H 3SKMB 3QUYC 4HWZB 4NN5B 2B5IB 1FAKT 3ZHLA 2CK0H 2R1WB 1CFQB 2Y07L 4MQ7B 1FYTE 3DYPA 4TUKL 3STZB 3SJVD 3ARYA 4I4WB 4MS8D 4IEFB 4LSTL 2XZCL 1WCBA 4AMKH 3EO9L 4LIQH 4NC0B 1CLOH 2ICEB 3C5JB 1SJHB 4FZ8H 4JFDB 1KULA 3JWDL 1BX2B 1X4XA 4ONFH 3CXHK 1A6PA 1IGTA 4L8SC 4LCUA 3OF6A 4QRPA 5E2JA 4CVXB 2RHEA 4LFHG 3MJ7B 2DWDB 5DRNA 4AENA 1CDJA 5LGJA 5B22A 4Z7VB 3P0YH 3BYYA 4N8CH 2OX5A 5I17B 5CAYB 1RZJC 4JY5L 2DIBA 4XXCC 5F6IB 4F8TA 1HOCB 1G7IB 3RP1A 1QACA 2BNUA 4DOHE 1QSED 3LEXA 1JNNL 1LEGB 3FO1B 2IFGA 4OIIH 1HYRC 3CU1A 5BJTB 4TSAH 4PS4H 3EYOA 1QA9B 1UEMA 5ESAA 2HFGH 4IDJL 4LAJH 4U2ZA 5DHYA 1BM3L 5SX5K 4JG1H 1A6VH 5CUSH 4NQEB 4QRSB 4RMTA 3SDXE 1DUZA 5ALBL 5JOPD 5L2KA 4K55A 2CDFA 3LMJH 1J8KA 3BQUA 1OCWH 2WUBH 4MX7A 4JFPA 4LRNL 3S4SB 4OF7A 4Y5VB 4NN6C 4EOWL 4PDCE 4M93C 4XVJH 3MV8D 1ZVYA 2Y6SD 5GGQL 2B1HL 3DROB 4RAUA 4XT1C 1RUPH 1BREA 3QJHA 5I0ZA 5LQBL 4O58H 5C6TL 4U1GB 4P2OB 3U1SH 4QRTA 1DQLH 1CZ8H 4H8WH 3O2WH 5DHVH 3B2UC 3IF1A 1J0HA 4BSWB 4NO2A 4U0RB 1I9EA 4Q9RH 1R6VA 3O6FD 1T6WA 4A6YL 3QIWA 3MRCA 4I18C 3UCRA 1K85A 3VA6A 4MA8H 5DK2A 2BY1A 2ADJB 2EDHA 5E4EB 2VWEE 1QLFA 5F44A 3MZTA 1YUHB 2B4CL 3FN0H 5F3BB 5EU4B 3E2HA 3NFNA 4Y4FD 1J0KA 3QNXA 4GKZB 3SKNB 4WRLA 4O2EA 3WSQH 4GLRH 2OJEA 5T1KB 1AKJD 4JB9H 5BO1H 4LCWD 4YHIB 4U6HA 2MPAH 4UILL 5I1IL 4HWEL 4TSCL 3L3KB 5I75B 1TPXC 5CHNB 1DBAH 2M1KA 2PETA 4X4ME 1I9JL 1YNTA 3LHPL 1RVFH 5IMLA 1KBGH 2PXYA 2E7LA 3EDKA 3EHBC 1RY7B 4PBWD 4ZFOB 1SY6H 1AO7D 2FGWL 4F9PC 2H9GA 3MRJA 1H3TA 3PL6B 2WBJC 4OFYA 2LVCA 2GJ6D 3TPUB 2VXQL 2YS4A 1DSFH 3O6FB 4BH8A 3LV3B 2W65A 3TN0C 2R2BB 2KZ1B 4XP9L 4MAUL 1NCBH 3GSNH 2IBBA 1ORSA 3GMQA 4X5WA 1CGWA 3TT1H 3U0WH 2XA3A 1OAZL 2JE8A 4MQ7A 4PLKD 2NZ9C 4F57H 2R4SL 2J7LA 4NGHL 2DWEA 4PJ8A 3LZFH 1AKJB 1T5XB 2CUHA 4S1RH 3TIDB 5AG9A 3OPZL 2BNQD 4UBDC 3F5WB 3C5JA 5HHOA 2VH5H 4JFDA 4YC2B 1BMGA 4LKCB 2A73A 3HFMH 4M4RA 2VLKB 1BX2A 2QQKH 5JXAL 2FJHB 4CVXA 1A4KA 4HIIB 3NCCB 1XF2A 1UG9A 3WHE1 3DMMD 3WS3A 4JHWH 2DWDA 2VLJD 2XRAH 1F90H 4Y5YB 1G7PB 3BIKA 4Z7VA 4KQ3L 2X4SA 4LDEB 1VGKB 4HW6A 4R4FH 5LCVH 4J1UB 4P2QB 5HGDA 4OI8A 3HAEA 1KCVL 4G7YH 5DD6A 4Q7DA 3MLSL 1PAMA 4M6OL 5C0RH 1Z9LA 2RR3A 4Q6IC 1R24A 4YFDB 3O2DH 3UTZA 2EIZA 3EYOB 5ESAB 2YA2A 1IM9D 1EO8L 5DHYB 3BZFA 1A7OL 4AIZB 4Z8FL 2R39A 1TPXB 4R7DB 3W81A 4OCSH 3RFZC 5EUOB 1K8IB 3ILQD 3TN0A 2VLLA 3RKPA 2G75A 5IQ7L 1UXWB 4WVRA 5D72H 3RU8H 4JFPB 5D7JD 1RK1A 3QEQE 2V6HA 4MAUH 5I1JL 5J1AB 3QXDB 4X7EC 2EEAA 5A1AA 3OKMA 5I8OL 2WP3O 1HZHH 3DO3A 2ZJSH 1N26A 4JZJA 4OKVA 5DSCA 1ZGLA 1TJHL 5HHQB 1CZ8L 4H8WL 5TE4L 3DO7B 5E4EC 5DMKA 2R56L 4PRDB 2PKDA 4P2OA 4JQIL 1T66C 3V4PL 4MXVE 5MEQA 3INUL 5LCVL 1ZA3A 3QEUA 4KJPD 2C4XA 3MFGB 3A67H 1KCVH 2UYLA 4P2QD 1Q9LA 4QXTA 4R26H 3RWFB 5DDHA 4PJ5B 3TCLB 1YN6A 1LD9A 3HR6A 3V0AC 3QNZB 1W72L 1CCZA 5HJ3B 3OGOE 1M7IA 1VADB 5DLMH 1CL7L 3RDTA 2AJXH 4MD4A 3E2HB 4UDTB 4O2EB 4ZAKD 2PW1B 1LEKB 3W9EA 1KV3A 1CG9A 4KRNA 5E8NB 1N6QH 3AROA 4GLRI 3TYFB 1AHWC 4JM4L 1ZLSL 3PF2A 5E03A 5D7KE 1BVLA 1ZS8A 43CAB 3WNMA 4YHZH 3EOTL 2EH7H 2A77L 3QQ9C 4ZFOA 4J4PD 1INQA 4I2XE 2DQGL 5FDYA 4UQ3B 3LKSA 3LN5A 4JFED 2DMBA 4C56B 3QG7L 2PCPA 1WBYA 5K9QG 3GMPA 4XP9H 2ESVE 4NQVB 3HMXL 1IGJA 3VFTA 4ZXBA 3O3UN 1NL0H 4DZBA 2V5RA 4KDTA 1G6RH 2E27L 2BNQB 1ED3B 3TIEA 4Z18A 4P4KC 35C8L 1BD2D 5I0DA 4LCCC 3VWKB 3OKOA 1F13A 5ACLA 3GMNA 3MLYH 4K94L 1WV7T 1F58H 1VCAA 2AEWA 1MRFL 4M8QA 1A6ZB 1BFTA 5IKCB 4RAVB 4EN3D 2N7AA 4OF8A 4TSAL 3MNWA 3SKOA 4L9LA 5EO1B 5I66A 4CBPA 2HT2D 3KHOA 4QNPE 4GRWE 3OKNB 1ZANH 1NCWH 3DV6B 4PJIE 5GJSH 2AV1B 1MCLA 2VLKA 3G5XB 3OAYK 5FM4A 5JORB 1SQ2N 4S1QL 4XMPL 3EDFA 3GSVB 1UM4L 3CVIL 5I8EB 2D7PA 4Y4KB 1FL5B 3L3OA 4NHUA 3V2AR 4R7NB 2F54D 3FO0H 1NGPL 2CPCA 4NZUH 1ACYL 1V5JA 4LPTA 5LXGH 5HGDB 4M8VA 5SX4I 1DQQB 1SHMA 1A3LH 4Y1AE 5D1ZC 4G80B 3QRFM 5A3IC 4KHXL 5K93A 2BXZA 1PVHA 4N0RA 2X4RB 2C3HA 4IDLA 5HYQA 2VDRH 2XT1B 4Y2DA 2FDBP 2O5YL 3BZFB 4AIZA 4RMQA 4K94C 3M8OL 4Z7WF 1B4RA 3FJTA 4DEPC 4Y89A 2JLLA 3JTCA 1TZGL 2J88L 1UXWA 5AAMA 3BVNB 2QHLA 1MHEB 1AQDA 5HYFA 3MRIA 3PDDA 4JRYA 3LKPA 3HNSL 4U1NB 3WHXB 1XGRB 1F4YL 3ELAT 4G5ZH 4HK3N 4OLWL 3RWEA 3OZ9H 5DWUL 4RFNB 3G5VB 3LKRA 5HHQA 1ACZA 1I4FB 3Q3GA 3DMMA 1KCSL 2XWTA 2OK0L 3QCVH 3BUTA 3B9KD 2R1XB 2XTLA 1WBZB 5K33A 1W0WA 1ZVSB 2WUCH 1WITA 3RWFA 3RX7A 2NY6B 3ZTNL 1XGQB 4Q6IA 3OAZH 4OFPA 2YEZB 2IQ9H 5HJ3A 3HE7A 5CJOH 1BIIA 3IDYB 1FJ1B 4HGWA 3RDTB 2D7NA 3M1BB 2AK4B 3F6LA 4PJBA 2PW1A 5EU7C 2QR0B 3O11B 3KDMB 1LEKA 5DVMA 1NGPH 3U0PB 4G8IB 1PKOA 1IKNA 4RFNC 3RTQB 2XZAL 5L8KB 3AU1A 4GRLB 1WJ3A 2EIDA 5D1ZA 1DJSA 4POYA 2H32H 2AQ1A 2BSSA 3BRGC 3MPCA 3DSFH 4CN1A 2I27N 43CAA 4BK4A 3O4LD 2C4FT 1T1XB 1I8LC 2D31A 4Z95L 3BP6A 4F7MA 1N59B 2PYFB 3QNYA 1UWEH 4OIIL 1I8MB 2VAJA 1INQB 5MI0B 4CMMB 4E5XA 1UH2A 4ERSH 2VLRD 4C56A 4N0CA 4TPRL 3UDWC 3QEHB 4UQ2A 2VZVA 4LMQI 5I19L 4I2XB 3V6ZB 4ZSOA 1KTRL 1KENH 3NABL 2VDKH 4M7ZB 2FJGA 5IBLC 5BZWB 3RIAF 2NNAA 4K94H 4PJEA 1QVOB 4MDIA 3G6JF 4CN6A 1VFMA 3C5SB 2NQCA 5EC2B 4WO4C 2JELL 3PGFH 4GOSA 3SQOH 3IDGB 1NBQA 1MIEL 3C5ZB 3WDJA 2NXZD 3CUPB 3U1SL 3TVMD 4LSTH 2RFXA 3R1GH 4O5LL 4IRZH 2G5BA 3TZVC 3OKNA 3S5LA 1BFVH 1EEYB 3P11H 3Q6FA 3G9AB 5D72L 1VFAB 3RVWC 3BX7C 1IAIM 1VPOL 4TRPL 4R3SB 1UZ8B 1MWAA 4W6WB 4Y16D 5GGVL 4QRRB 3W2DL 5F7DB 1MCNA 1ZT7B 2AJ3A 2W9DH 1MSPA 1LP9B 2VDPL 1YPZB 5IVNA 5F96L 3TT3H 3KVQA 1QFPA 1HH9A 5FGCE 3FN9A 1WTGT 3E6HB 2NY2B 4WI9A 2MJWA 1JWMA 4KK5C 4G6FB 2VABA 4N90D 4MAYC 3EO1B 2X4RA 5C08B 3V0WH 1MAML 3GRWL 3SHSA 4KV5E 4ODWA 2FGWH 4HIEA 5ALBH 1KT2A 2EKSA 3TVMB 4LEOA 3QHFL 3D18B 5ACZA 5DI8A 1HXMB 2GSGA 2XQBH 3MGOA 4KQ4L 4Y19B 4PJXA 4PGDB 5FKAB 4E41D 3CH8A 3JV4B 3LKPB 4U1NA 4LASL 3ARSA 3I9GH 5L2KE 5D1XA 4D9LH 2NY6D 5I8CB 4NZJA 4DVBB 3LKRB 1NJ9A 4D3CH 4MA3A 1CFTA 4M1GH 4D8PA 3P0YL 3WV0A 1CD1B 3X12A 1BQLL 4Y16B 1CGYA 2R4SH 4MJ6A 1Z3GL 4JVUA 2QLVB 1UADC 3BW9B 5ID1A 3MGTB 2HRPH 3KPLA 4PJ7E 1G7MA 3HI6H 3O3EB 2A74A 3Q2CA 1AJ7L 1BIIB 3RX5A 3E6FB 3HC3L 2YD8A 4OLYH 1U91B 4L8CB 3M1BA 1Q94A 4V3EB 1OW0A 4JHBA 4U1KB 1G7QB 3V6FB 2QR0A 3O11A 4LCYA 1HH6B 1FZMB 4PP1C 4PRPB 3RGVA 1VACB 3LEYH 3T2PA 3WFHB 3EYUH 1OTTD 3OGCA 5CIPA 3D85A 1JVKA 2UUDH 2P8MB 3X13B 4NN7C 3QUMH 4XPAL 2D31B 5FO7A 3BP6B 3KLDA 4DN4L 1WSST 1CDYA 4WTZG 5KVGL 1FG2A 1K4DB 1X6LA 2DKUA 5HI4D 4E5XB 1JUFA 1OAYH 5BXFA 4KUZH 2MQCA 3VMNA 5HYJB 2IQ9L 5BV7C 4YGVB 4A6YH 3S96A 2FECL 4ZSOB 1IGFL 4UV4H 4X98A 1FFOB 4YLQT 1T1YB 4KJPC 5DMGC 3DTXB 4BELD 4N5EC 2HJKA 3WFBL 1J8HA 3B6SA 4GW1A 5IR1A 2JK5A 2NTFA 1EO5A 5I1CH 1TVHA 2EO9A 4QTIL 3P4OB 4ZG1A 3C8KB 5CSGA 3F65A 2VXUH 3QHTC 5FYJL 1R3KB 3CGTA 5FM8A 4YAQA 4JDTH 3VGFA 4I0PB 4NRYB 3Q6FB 4P5MA 3CPLB 4I3GA 2QQKL 2X70A 1FIGH 2YK1H 3H9HA 3TFKD 2O26U 1TNNA 2V2XB 4FQ2H 4KC3B 2DDQL 5FK9A 4QRRA 3WJJA 5F7DA 1RFDL 3SGJC 3MNVB 3MV9E 4I3RL 3EYQD 2FHBA 3O45A 3QHZL 4JM4H 1CIDA 3ZE2F 5JW5A 4E41B 3FTGB 3LD8B 3QWQB 3NCBB 5EH1A 3L3GB 3RVWD 1RULL 3GI9L 4ODWB 2OTUB 4KRMB 1JK8B 1S7XA 3IJHA 3LDBB 1P5VA 3TM6A 3EOBA 1JGVH 4PJXB 5FKAA 1YMMA 2XKUA 3U36A 4BKLB 3HMXA 3JV4A 3CX2A 1YYLH 4RWYH 5B39A 5IHUH 4JPWH 1EHLL 5DJ2A 1BZ7B 5CD3A 4Z7OE 3MSPA 3CDYA 5I75C 1E4KC 3CDFA 4KK6C 4Z7QE 2BCKA 3PDOA 3BN3B 5DJCB 3LKOB 2ESVA 1EEZB 4Y16A 1NKOA 1HXYA 4FFEX 2DLGA 4NSKA 5T1DH 5BMFL 1KB9J 4V1DB 1DL7L 2IANA 1I7RB 4PRBB 4IMLB 4NN7B 2ARJA 3ORJA 4TPRH 5FM5O 4PTUB 2VUOA 3TA3C 4NJAL 2CIKA 1REIA 2NXYC 1UC6A 5DJ8B 2A9NH 1MQKH 3L9RA 4NCC1 3TF7A 3MRPB 5D9SB 4MB3A 1KLFA 1G7QA 4JM2A 4PP8C 3RHWK 3RGVB 2EIEA 1KELL 4RFEA 3T2QA 2MQ3A 1RURH 3WFHA 1FFQA 3ETBF 1CICA 3IAQA 25C8H 3OGCB 4OTXL 2JIXB 4LLQA 3UTSD 2H8PB 3UTTB 8CGTA 5FO7B 3O4LA 1VESA 1FG2B 1K4DA 4O2CB 1NCCH 1KN2H 4JFOA 4UV7L 2Z31D 3NGBB 1KC5L 2JJVA 3BAEL 4HLZG 4LPVA 1KF9B 2X4QB 4FFVC 1OQXA 4L5FH 3ARZA 4QKXB 4QY8B 1FYTB 4KXZH 2W9EL 4YPGB 3SDXA 3CMOH 5F7MC 1S78D 4WTWA 5IQ7H 3MA7B 4ZAKA 3S37L 4OT1H 4NCC2 2EC9U 4GG6E 5IESL 4OIAA 4XC3L 3C09C 2P5EE 1OGAB 1MEXL 4MJID 4X6CA 2VXSL 4OSUH 3PXJA 3VXSD 5F96H 3TT3L 3T0VA 3O3BB 3ARVA 5IR1B 4TSCH 4HWEH 3DNKA 1FLTX 3AFLA 3VDBA 5JHLH 4QHMB 1ZT4B 4L8SB 4M61B 2HFFA 1KFAL 3PQYB 2JIXD 4ODVL 3VFOA 2XNAB 4YXKL 3T1WA 3G5ZB 2CMRH 1WICA 3QFDB 4U1SA 5L6YL 1KN2L 1T3FA 1MQKL 2IFFL 3VH8B 2PYEE 3O6KH 4JFDD 2VDRL 4L4JA 3PJSA 4WY7L 3O4OB 3IFOB 4N0FA 3NIDE 1X5ZA 4PGCA 2LTQB 3EBAA 1JHLL 1GYAA 5MEOB 3MNVA 3P0GB 4NQCA 4DGIH 5IBTL 4EI5C 1ZVHA 4N9GB 3R8BB 2H6PA 3O45B 4M5ZH 2C3WA 4TNWF 3QO0A 3L5XL 3HI5L 3H9SB 4YXHL 5GGRY 4FMFA 4U6XB 5E6YA 3QWRA 4U1MA 1UM6L 3FT2A 5DMGD 5I71C 1T5WB 2B4CC 4P3DB 4AYFA 1A9EB 1FZKB 3BKCH 3CXDL 5K9KA 1MCHA 3MV7A 3VFUA 4CVZA 3M17A 3BZ4B 2XZZA 4RNRA 4M7ZC 3N1FC 3RBSA 5KS9F 5DYOB 5IMKB 4EN3C 2EDNA 2VN7A 5D6DA 4R97B 5CJQL 1AC6A 2ADFH 5CEZD 5F7YC 2BY2A 5DJCA 1EEZA 1D6VL 2H2PC 5DK0B 5AEAA 4JQVA 3FB6B 1HXYB 2CXKA 3OR6A 2DBJA 1NEZG 1A7RL 3IXAA 1J86A 1OAUH 2MSPA 4ZO7A 4V1DA 4FFVD 5SWQB 1U3HA 2IANB 1I7RA 4N68A 4PRBA 1CIUA 5JHDD 4HUXB 3S88L 2QBWA 1RULH 1YN7A 5JPNB 3GIZL 1CGSH 4WTXA 2CIKB 4IMKC 1CLZH 4FZ8L 3FMGH 4OCSL 3U4AA 4TVPH 6FABL 1UQSA 2IADB 2FX9H 4ZPVB 1JPST 4I13B 4D0CA 1LQSR 4GKSA 3U30C 1T21A 4YK4C 3ZL4L 3CK0H 5E6ID 2ADGA 5ISZE 4G6KL 2BVQA 1BQHB 1X5YA 3CX5J 3EIFA 4K3EH 2H2PD 4Y4HD 3TWCH 4HMEA 3UTTA 3NIFF 1AGFB 1ZSDA 4NFCA 2GYSA 1F97A 1CU4L 4QTHB 2BSRA 2ITCA 4FQHB 1JHTA 2ZCLL 3DX7B 4HFWA 4M4PA 1J5OL 1VENA 4MVBC 3VXRE 1IEBB 4KZEH 3AAZA 4K3HA 2GJ6B 1N0XL 4LLYA 5I1AA 4HLZH 4N0UE 2EDJA 3ARGA 4HV8B 4QHNA 2YWYA 5MEPB 1QLEH 4M7JL 4HMCA 1GXEA 2Z8WC 2BOCB 5EZLA 4Q9QL 3RKDC 4GRMA 4NNPH 1DR9A 4PJXE 1QG3A 3BUYA 3L3JA 3ZL4H 4KK5D 2DI9A 2AJVH 2GT9A 3O6ML 3PQYA 4N8CL 3WJJC 5C0BD 4CW1B 4LGRB 5F9WB 3WE6B 1U95B 3G04A 2DQUL 3OF6D 5EO9A 3NIGF 4KH2A 2AJZA 3PWLA 4U1SB 2Q86B 3CNKA 3VH8A 5ETUB 5EBMA 5J06A 2IG2H 1SYVB 4PJFF 4QO1A 4JFFE 1G1CA 4ZUUA 1TVBA 5ADOL 2QEJA 5FHBL 5TF0A 1U8LB 2XACC 4K7PH 2VLKD 1NC4B 1KXTB 1MCWW 2HLAB 4M5ZL 3HLAB 1UA6H 2EE9A 4XVTH 4WJ5A 5HGBA 1YMHA 3TH2T 3DX9A 3P77B 3BH8A 2RCSL 3ARBD 3N85L 3VGGA 3HNTL 4WHYH 3QI9D 1F3JA 3T0BA 3JWOC 2EIBA 3HMWL 1A14H 4HKBA 4ZQKA 1IM3A 2Q3AA 4J3XA 1A9EA 2VDLH 1A22B 4XWGL 5DD0H 4X7CC 2AK1H 2QQNL 5HHPA 1IM9B 1G7JB 4PY7A 2A6JA 2XQBL 2YSSA 4U3XA 3D3VB 3VDCA 1H3UA 2PW2A 2E7CA 5JNYA 3MJ9A 4NBYB 5IB4A 4M02A 4X6DF 5FUZL 3MBXL 2GTWA 5DYOA 1O7SA 4GAJL 1Z9OA 3DUUB 3OL2A 5C0AE 3NGBC 3V4VH 5A40E 5I1HH 1JL8A 5D7JB 3D87B 4FQLH 4BSVA 1L7TH 2CJUH 5EU5B 2D7QA 5CSBA 4BA8A 1B4JL 5D2NA 4DGIL 3BHBA 3AY4A 4OD3H 1IBGL 4E0RB 1E28A 5FOJA 5TQ2L 3FL7A 4HCRL 4PV8B 5DRWB 1IGCH 1MVFA 2I07B 1I8KA 5HDBF 1E4WL 3SDYL 3T3PF 1HIML 1V7ML 1DBKL 4G42A 1KGCE 3C08L 1AP2B 5F1OB 4UTAL 4PRPD 4KUCD 4B53A 2NXYB 4E42A 4U05A 4R26L 4EIZC 2NW3B 1T83A 1OWWA 3IT8D 3H0TA 2IADA 4ZPVA 4JG1L 4PG9A 5A16A 4ODTH 3JTTA 3L3DB 4X7SH 1U93A 2MOVA 5JXEC 4ZODA 4KROD 1NUFA 2WP3T 2BJMH 3TNNB 3ZDYF 3K3QA 4HXBH 4N0YH 1M4KA 1BLNA 1QBLH 4FTVA 1ZSDB 3EDDA 4CNIB 3UBXA 4XPTL 2R0LH 3GHBL 4OCYH 1B0WA 3G6DH 3SPVA 2R1WA 4JN1L 4FQHA 1FRGL 2OTPA 3T2OA 1UWGH 3Q5TA 1JTOA 1W8OA 1CI5A 4KKCD 3W5NA 3UAJC 3VI3F 4X6DB 5EPMA 5ESQA 5CGYD 4CMHB 1I3GL 3SDDD 2VISB 5I1AB 2OL3B 3IJYB 2DLIA 4Y5YC 3KPMB 3KNBB 5J11C 5D8JH 3F12A 5IVXE 2VLRB 1U58A 3GBNL 5F21B 4ACPA 2AEPL 5LGJB 2BHZA 2AEIT 3ABZA 2XIDA 4XMLH 5I17A 3V4PH 3DETC 2JCCE 5LAXA 2AXGA 2V7HB 5IVXA 4JDZB 3NOIA 3RUGE 3C08H 3LEXB 3C9NB 3VG0H 4R4ND 2EYRA 1ZA6B 1S7TA 4KMQA 1CXLA 2YPVH 5BJTA 2HJLA 5ETUA 5FXCH 4MNQD 3U9PL 1J88A 4OI7A 4D2NA 4YX2H 1QA9A 2NY5L 3MA9H 3RKDD 4PJEF 2ZCHL 1IFHH 4K7FB 1P7QA 1JN6B 1I3RA 4HCRA 1UXSB 4U1HB 1MQ8A 3HLAA 3MLRL 2XPGA 5IK3B 5T1LB 5KSBF 5ILTH 3SBWC 3WNPA 2QJDA 3S4SA 4YC2C 3DX9B 1BWWA 4LVHB 4ZUWA 4FS0A 3QCVL 4N9OB 2QKIA 3H7BB 5C0CD 1F3JB 4M7LT 2A38A 5C09E 4UIMB 1AGEB 2BSED 3MV9A 4FQQA 1URLA 1XAUA 3STLA 3K8LA 4Z78B 3L3IA 3V5HB 4F15B 3MV7E 4GQPH 3ZE0E 2X89A 5DO2D 3KHQA 3IF1B 3H9SE 2YSSB 1S9WB 2E7MA 5GS0D 4HF5L 3H3PH 4NOBA 5CILL 5DFTA 4ORGA 3GM8A 5IB3B 4KVCL 1TQCC 1TTFA 2CLRA 4LF3B 3HPLA 2ADJA 3GI8L 1A7BA 1KCRL 1DQJB 4MNQB 5CUSL 5EUKB 2APBA 2ZUQC 3C6SB 4MCZA 4XP4H 4JPIA 4H26B 5KSAA 4XPGH 5IVZB 4GH7B 2DI7A 1NPUA 1YEKH 4U6HB 3LQAL 3PDGA 3ZKND 4Q0XL 2RQ8A 4UIKH 4PP1D 3QAZB 4Y19E 5HYSG 5IB5A 4WU5B 4JQXC 3GMMB 3FB8B 5DUMH 4EJ1C 2GTZA 4P23C 4ZTOL 5F1NB 5A16B 5GGTH 5GISH 1R3JB 4Y5VC 3U6RA 5GJTL 2QQQA 1U93B 3BWAA 1JYNA 3FQRA 3BD3A 2WNGA 3K2MC 2MKWA 3FRUB 3O6FA 3LV3A 3UTQA 3VFNA 2FX7L 1AD9A 2BNRD 4QXGH 4I18B 4ZO8A 1OT1A 2D0FA 3KYKH 5KAQG 5CBAB 3TP4A 2BVUA 3UBXB 3GMQB 4NHCL 3E3QA 3PABA 2WBKA 2OYPA 4LPCA 5IFAL 5F1IB 4PJ8B 4IIQB 3GIVA 1I3GH 1N6VA 3I2CL 4PRHD 3REVA 3HI6L 4X6DA 5EPMB 2IG2L 5ESQB 4AEIL 4PV9B 3B2UD 2AQ3A 4KJYB 1S3KH 1RIUL 2VISA 3D9AH 4M7LH 3TNMA 3T0EE 5GZOD 3KPMA 4ODXB 4YHOL 4HT1H 3LB6D 2HLFD 2Z8VC 3H9YA 3EYSH 3OKLB 1HWGB 1RIVH 5F7EH 4NQXA 4OCRH 4OCXH 5BS0B 4XP1H 4DUVA 2IPUK 1NAMA 2VMFA 2X4SB 3F7PC 3HE6D 3DBXB 3B5HA 1C8PA 2BMKB 2ZUWA 3HAEB 1F3RB 3KPPA 4PJIB 4PJ7A 4KK8C 4KUZL 1MJUH 1YYMH 3FO2B 5FO9A 5EOQH 1RHHA 1RZJL 2P24A 4MJIA 4IRJA 5TQ0H 4RAHA 1XGUB 3BZEA 3BE1L 3T0ED 1T0PB 4NJ9L 4F7PA 1RIUH 3D9AL 2ZUSA 4D3CL 1C16B 4YEEA 4QRRD 1CBVL 5JW4Q 4PRIA 3LKNA 5I73B 4LSSH 3OKMB 1CR9L 5DSCB 4DWHA 4NKMA 4FQQB 3BKML 1IAOB 4KZDL 4MVBD 2GSIB 2EDBA 2W9EH 3FQTB 2JB5L 1P5UA 1S9WA 4PJGF 4QF1A 2J8UE 4K9EL 1RJCA 4PJ5A 4HFUL 4ETYA 2XQYG 2IAMD 4FQJH 1U8QB 1YY8B 3QNZA 5D2NC 5J6GB 4HPYH 1C5CH 2ZKHL 3VXUB 1VADA 5JXEA 1UVQA 3D3VE 3EYFA 4MD4B 4K3JL 4HUNB 4EVNB 3OKDA 1EA9C 5IVZA 1X9QA 1LO0H 5E9DB 5A2LH 2IAMC 1XIWB 3KLAB 5C0AB 5AZ2L 1SVZA 3L5WB 2B4CH 2CIIB 1A0QH 5HDOA 1K4CA 2ICWI 1IAIH 3NVQA 3FT3A 4O9HL 1J10A 2UWEA 3DX8B 4RGOL 2ZNWA 3V7MA 4WGVB 4JM2D 2DRUA 3PWJB 2A77H 3CFIC 4OZFA 2VIRB 3AREA 4XAWH 1MCQA 1XR8B 3RGHA 1Q9OB 2FIRT 3ECBB 1RUML 3MBEA 1NKRA 3GMRB 5D5MB 4DKFH 2VH5L 1R3JA 4NFDA 1QBMH 5IT2H 4NWUH 1DLFL 4MYWB 2PCPB 1X44A 4HD9A 4NQVA 2GFBB 4QOKD 1NCAL 5HYSB 3UTQB 3RNQB 5GGVH 2P47B 3IDJB 1GGYA 2XRAL 5C71A 1KPVA 3RL2B 1AD0B 1HQ4B 4P5TB 4GO6B 4LPWA 4OCMC 4XNUH 1QQDA 4PJFB 4XNZC 4QHLA 2V2TB 1A0QL 4RAVA 2VC2H 5HDQL 1MLBB 1T66D 2A6IA 5CGMA 4DAGH 4C4KO 4KJYA 1ZTXL 4L9LB 5EO1A 5HYJD 3HE6C 5HHVL 4ZFGL 6CGTA 4G6AD 2DM4A 5C0DA 4GBXA 2XN9B 4JREB 1XF4B 1OM3L 2ORBL 2OI9C 4NQXB 5C2UB 5ELIA 3JV6A 4EQ3A 1J1PH 1FVCA 2H32A 3DURA 4LCWB 4Y4KA 3TFKC 5I71B 3WN5B 2BX5A 2NCMA 5CZVH 3DBXA 3EGSB 4EN3A 1NBZB 4J7RA 1FP5A 5F9DC 5JQHC 3MOBL 4X9IA 4DZ8A 1NAKH 4H5SA 3RY6A 2HVJB 2FBJH 4LEXL 2GCYB 4BH7B 3U2SB 2BY3A 3ZYJA 2GAZB 1BD2A 1NFDF 3A6CL 1RHHB 2ERJB 3HG1D 2H1PH 3WIHL 4BZ1H 2WANA 4GG8B 2P24B 3NCYS 3VXQB 2AJSH 3RVVD 2HA1A 5MENE 5DHXB 1NCAH 2WLZA 5DEZA 1NGZA 4NRZB 3MRIB 4K8RH 1BZQK 3WHXA 4FQ1L 4XBGB 4LASH 5DEFA 4P59H 2X4OB 3DXAB 3FO9B 4NKMB 4OZGA 2GSIA 5KBNC 2P7TB 1H8OA 3LKQB 4OD3L 4KZEL 1G0DA 4JFHE 1A1NA 2J2ZA 2A9NL 2F74A 5DQDH 2P42B 3VXNB 4JEGB 2PTVA 2YEZA 1YY8A 2PNDA 5J6GA 2YRZA 2BSTB 3WKMH 4Z7NE 1CGXA 3HE7B 3MACL 2F5AL 5D96C 1DVFC 1FJ1A 2Q20A 4HGWB 1UVQB 3EYFB 1JZ4A 3IVKA 1NBYA 3T0DA 4QYOB 4JLRB 3DV4B 1GC1H 1S7VB 1FORL 4N5UA 2CIIA 2Y06L 5D7KD 1UT9A 3ET9F 3O3DB 1NSNL 4JRXA 2AXHA 4HGKC 4Y4FC 2HWZL 5BQ7A 2BSSB 3PWJA 1I7ZA 4F7TA 3MRHA 4H1LB 4JFQA 4WW1A 4OZFB 2YC1A 1YY9C 3CMOL 1I9JH 3BP5A 4L4TB 4F7MB 2PYFA 5HDLA 3RPIA 3F6IA 3JVGC 3GMRA 5INDB 4L8DB 1KEML 1C12A 3UX9B 4MWFB 5EZIL 3FQUA 5IIEA 1E4XI 5F7EL 4HPYL 5J6HA 2GFBA 4FQXC 3QEHA 4UQ2B 5CMAA 5FB8A 1KB5L 3IU3B 1JV5A 1P7KA 2A9ML 4NKIH 4PGJA 4KKBC 1EHXA 4H0IA 2VE6A 4UV4L 5KN5A 5IEHA 4X4XA 1AD0A 5GRJH 4JKWA 4ZD3L 1NL0L 3CSBA 2X4PB 2MHAB 1MHHA 2VDLL 5BV7H 2BXYA 1MI5E 3ROLB 2RFXB 4XP5L 5GRVK 1YEEL 2YD9A 3QUZA 5F7NC 2YBRB 4GT7A 5C0DB 3I84A 3T08A 3SGJA 2UV3A 2FJFB 3S36L 5EWIH 2Q6WB 3WMSA 2ICES 1CDHA 1U8NB 4IS6A 1RHFA 5IFJA 3MLXL 1C7SA 4QEGA 1G6RL 1HZHL 1DFBL 3VRLF 1RU9L 4F7CB 4QHUB 4XHJD 4JB9L 3WS6C 3QDJA 1E4WH 1NBZA 5GS1C 1UCBH 2DL9A 5ADPL 2R8SH 5T5FH 1QFOA 3PIQA 1BJ1H 4PJGA 1JWUA 1CT8A 2DD8L 5D2LF 2NXZC 3EO1A 2GIYA 2VDNL 3F7YB 3G6DL 4OQ1A 2AEQH 3HCVB 4S1SH 1U8OB 3QDJD 3DXAD 3QISA 5J4MA 2K7QA 3I6LD 5IBUG 1CLYL 3TVMA 4GJTB 1ZMYA 1HXMA 3PWPA 4Y19A 5C0ND 4HQQH 2H41A 4I0PC 1X7QA 2NY3D 1EFXA 1CXIA 4PLKC 4UTBH 1RK0A 3QUYD 4LNRA 3DXAA 1MCWM 2WW8A 2P43B 3FO9A 4U7SA 3ZDXF 3HRZB 2F5BH 1NJ9B 2FEEI 4C83B 1NC4D 4YDKH 5IMMB 5FDWB 2K3TA 1FHGA 2P7TA 3O9WC 2FB4L 1OF2B 4XNMA 3MCKB 1KPRA 5GRYA 3SDCC 1VERA 5IROA 7FABL 2E7LE 2V7NB 2BDNL 3OKKA 5ID0B 1WIOA 2F74B 4L5FL 3MROB 3WNLA 3O2VL 5ID1B 1QOKA 1F3DH 4JDTL 1MF2H 2WBJB 3QQ9D 4NWTH 1G7MB 3ZT7A 5I30L 2PXYC 1YEJL 3I3EA 3PV6B 2I9TA 3IVKB 1KIUA 1IQDB 1NCDH 1ETZA 2RB8A 1F4YH 1BHGA 4LCYB 4X5XB 2YD1A 1KXVC 1EMTL 2EDKA 5C9JB 1VACA 4KQ3H 2B8OT 4RRPA 4JO1L 5E2VH 3SCMD 4KDVA 1RJZA 3SGKA 3TO2B 4DVRH 3EFFA 1AGCA 4HAGA 4UOW1 4N8VA 1CE1H 3GO1H 3MRHB 2P8MA 3LSOA 1B0GB 4ETQA 1A7RH 3LQMA 4L4TE 4LLVB 1AIFA 4KHTL 1KIQA 4NC2B 3ROOA 5BVPL 5HSFA 4G8EB 1QFHA 5BXFB 3ARBC 3I02B 5DJDA 2EE2A 5GRXG 3UZQA 4O51A 4Y5XB 4MXQC 1A6TB 3ZHKA 5ILTL 1QSVA 1KXQE 5CMAB 3VGBA 5FB8B 4X5LA 1FE8H 3FHAA 1XF5B 3WUZA 2EO1A 2IMNA 1DTUA 1OP9A 5KN5B 1AI1H 1XGPA 1LE9A 4LAQL 4XCYA 3OXRB 4CRPA 4PRHB 4ONHB 5L0QC 1F3DJ 3GSNA 1NDMB 2Q76A 4YGAB 5E2UL 4DFIA 5D7JC 3VMPA 2X4PA 5I8KL 1J8HB 3B6SB 4GW1B 2EXWD 2DQUH 4YHLL 1TVHB 1AH1A 1TQBC 5L2KD 1I3UA 1UWEL 5A3ID 1BZ9A 3IJSB 4CDGC 5F9AC 2YUWA 1OLLA 1PDKA 4PLJD 5I9QB 5DQJB 5F71A 4X6BA 2CKBH 4MMZC 4L3AA 4F7EA 3QPQD 4X4YB 2XOTA 2NY1D 2DKMA 4PJAF 2AP2A 2VDML 5HHVH 4ZFGH 3MCLH 1ZHNA 1IC5L 1OM3H 1C1EL 2J8UA 2B20A 4U6YB 5FK9B 4WY7H 3QDJB 1TJGL 3G08A 3PIQB 2HT2C 2EDDA 4JPVH 4WI6A 2VZOA 3TZVD 4X7DC 1CT8B 4PIRF 3V4UH 1IC7H 4FA8A 4BK5A 4JZJC 1Z3GH 1KJMB 1L0XA 3T2NL 4JFFA 2ZG2A 1AC0A 5EOTB 5TDNA 3BT2H 4GQ9H 5INCB 1U8OA 2Y5EA 4YFEA 5JUEL 1J8HD 2ZOKB 5E2WH 2JJWA 3PGDB 1MCSA 5J7CC 1QBML 3CSPA 1FO0B 4X4ZA 5FKPB 2FO4A 1ZOXA 4JZOB 2NZ9D 3CXDH 2Q8AH 3TJHD 3VA2C 4NQUA 4WHDA 5B39B 5DRXA 4M6NL 4RFOH 3W2DH 4OGXH 4OZGE 2AJXL 5GS3A 1F90L 3F7QA 4WFHE 1U8JA 1F8TL 2M2DA 1EAPB 3Q6GL 3LKOA 1Q72H 3VDAA 1FV1A 5B4MD 1HYSC 5EC1A 1JF1A 4PGBA 4RGMB 1TJGH 3M07A 2V7NA 3OKKB 5I18L 5ID0A 4YXLH 1H5BC 4OFDA 4X9HA 1K8DA 5C0RL 4UOW0 3RX8A 1BECA 2XZCH 1JGUL 1QSEA 2CUMA 2P8LB 2Z4QB 2IFFH 3C60D 1NFKA 2OMNA 1LO2L 3GMOA 5DUPL 1IQDA 2WINA 1A21A 1BBJB 3HPJA 1J0YA 4KK9D 2UZIL 2IQAA 2AAVA 2A6KA 1DLFH 1BFOA 3OKEB 4DUWA 4KKBD 4LHUG 4P46A 4IOIA 5E8OB 4XCCL 4ELMA 5JW4R 5AYQA 1AE6L 3OB0H 4M3KB 5BV7L 3LSOB 1YEGH 4LLVA 5JMOC 3BH9B 4LEXH 5DA0B 4K3GA 4XAWL 4EXKA 1E4JA 1KIQB 3O4LB 4U6VL 4J8RA 4PJ5D 4JFOB 1OB1A 1D5BA 4LSPH 4UI2A 5T3XD 3ZTJG 5JA8B 3B9KC 1IEHA 3NA9L 3DVFA 3O2VH 2X4QA 3M8OH 3QUZD 3GSWA 3WUWA 5E00A 5L7XL 4DGYL 4YPGA 3SDXB 4FHBD 3SO3B 2QHRH 3F58L 4ZAKB 4FQIL 3QIBC 3CJJA 5C8JA 3PWUA 3DI3B 1EPFA 1A9BA 1M05B 4MB4A 5DJAA 1T7WA 3PP3H 2IPTL 3SDAB 2VQTA 3FN3A 2CRMA 2Y6SC 3QUMA 3ILQC 1T80A 2XY2A 3OXRA 5E08H 4BFIB 1GPOL 1DSFL 1A6WH 3DHMA 1QYGH 2Q76B 5AUMA 3A6BL 2R9HC 4F37F 3E0GA 4IHOB 4NDMB 2YOCA 5KANI 3FB5A 1HHIB 5DK3A 5DJ6A 2CKBL 3HB3C 1W0VB 4K8RC 3FFDA 4TSBH 4U7MA 3RI5K 2RGSA 5T3ZE 5DQJA 3BFOA 3QIBA 3VXPA 5JOPE 3QFDA 4BUGA 4JKLA 1A3RL 4S0SD 1DEDA 3I9GL 2Z92A 2RBLA 5C86A 2IPUG 4OZFH 4HUWB 4W4OC 1VEOA 3HUJE 4LPYA 4DK6A 4U6YA 1MUJA 2JCCA 1AI1L 5CD5D 5MEOA 1F5WA 1T89A 3R0NA 4NO0A 2XZQL 4N9GA 5ICYA 5KSVA 1CD8A 4ZUTA 2NY2D 1KOAA 2R29H 4WDIB 4YBLB 1FC1A 5DFVC 4JFFB 5EOTA 2VLJA 3RDTD 4F3FA 1CU4H 5INCA 1H5BB 3MLVH 5C08D 2OK0H 4UUJB 3LHPH 2NY4B 4MSWA 2ERJC 1OTSC 3GB7A 3NZHL 3PWPE 3SKJH 5FKPA 2F58H 3MV7B 4J4PC 3W39A 1T7VA 3SE4C 4HIJB 3LCYA 4CVZB 2NY0D 1SEBA 2ED9A 1F02I 5DJYB 5MENA 4Z5RA 2BNRE 2ENSA 1ND0A 3SOBL 1U8JB 1A1MA 3MREB 1CQYA 4UIKL 5IUSA 2ZWLT 5ALCL 3OHXB 5MERA 5EC1B 3FB6A 3OR6B 4D9QD 2WWKO 1U8MA 5IP4A 2CR6A 3HG1A 3S88H 3OJVC 3CFBA 1RZKL 4FQCH 4AMKL 3T3ME 2B0SL 1JTPA 1YPZF 2ZSWA 1XF1A 3BP4B 1DN0B 5GHWL 5JPNA 2O5YH 5E2WL 5SX5H 4ELKA 2PYED 2AVGA 4EI6A 3GMOB 3WCYA 3HPJB 4N0CC 1UQSB 4NJ9H 1QSFA 4KTEL 1OPGL 1KCRH 2NY7L 2I5YH 4D0CB 1T21B 35C8H 1YEGL 4NPYB 3O0RH 4X80L 1T20A 1BQHA 3MUJA 4XI5D 3RGVC 5MHSD 5KVMC 4JO1H 2Y9RT 4J8RB 2YHGA 4QOKA 2BRRH 3DGCR 3HZYB 4P2QE 2FRGP 1DQLL 1R5IB 2H2SC 4QOKE 4EUPH 5FYKE 3T65A 3AAZB 5HVHC 4Z0XB 1K9TA 4JDVB 5DJAB 1A9BB 2NYYD 2EH8H 3X3GL 1WVZA 3QCUH 5MHSE 1GZPB 1D5XB 1PSKH 1EHNA 2UWEF 4ONFL 3RIAK 2UZXB 5AUMB 1NGQH 4JFEA 5EZLB 1MCEA 4YHKH 3W0WD 3MV8A 1R3IH 3L3JB 4NDMA 3EOAB 4JHWL 2Y06H 4RA3A 1NCCL 1W0VA 3D6GA 1IAII 2GT9B 3AREC 2O5ZL 3CLFL 3FQXB 4RBPH 3IS1X 3Q0HA 3WE6A 5C2BL 5C9KA 5CWSA 3RWJB 2AJZB 2XWBB 3PWLB 2DJ4A 1DQDL 5EBMB 3OXSB 4XNYL 3GSQB 1PQZB 3NAAL 4XMKL 3MRDB 2CLZA 1TVBB 3LD8C 3RGVD 1NC2A 3MX0A 2LVEA 1U6AH 3ZDZF 4WCYH 2R23B 1YY9D 3IYLW 1LP9F 4PJCF 3PWVA 4NFBA 1YMHB 5J9PB 5KSUA 4WFGE 3AVEA 1LO4H 3F8UB 5JOFB 3MBEC 5HBBA 5DVKA 2DJSA 1BVKA 4APQB 1S5HB 1H5BA 4JN1H 5JPMA 4EKXA 1ERNA 4UT6H 3SKJL 4JR9H 1OD7A 4WV1A 1TJHH 3DVNA 3SGDI 1G7HB 1JGUH 4FXKB 2DQJH 3MO1A 5IJVA 2GITA 2W38A 3DRQB 5D2LA 1OGAD 2F53E 1UZ6F 4WFEE 4M43H 5MP6L 5I76B 1U8KB 2ENYA 1H3VA 4TNVK 5D8JL 4KVCH 3WIFA 3BPLB 4TUJB 4Z5RB 2EDXA 3I3BA 4U3CA 1OTUD 1A1MB 3MREA 4LP4A 1VFBA 4XCCH 2DBLL 1S7SA 1U41A 1LK2A 4X4MA 1JJUA 3JV5A 4KDTC 4M6NH 5C0FB 1JCKA 4K9EC 1CD9B 4LRIA 1HQRB 3ARWA 3NZ8A 2FEDD 2BVYA 2DLFH 2I07A 3VXME 3CFBB 5DTFA 1F4WL 5FCUH 5DJ0B 3QO1B 1H3GA 4KUCF 4I4WA 4RGNC 3K2UL 4LBEB 4Y19D 5CJXC 4XPHH 3O6FC 4EI6B 3CVHH 4G3YH 1N3NA 2OR8A 1SBSH 1SJHA 3RVXD 1B90A 1OY3B 3S97C 3L3DA 5FUZH 4NBZB 4KRPB 1QYGL 1AR1D 4LCUB 4MDJB 5E9DD 3JTSB 2Z31C 4AENB 3PGFL 3SQOL 2WIMA 1OAUL 4HHAB 2R4RH 4M48L 2HT3C 1BD2E 1DQMH 4XTRC 4U1LA 4BQ6A 1J0ZA 4OZHE 4D9QE 1HOCA 4UNUA 4NQED 4HG4J 3SDYH 5HGHA 4K8RD 1AO7A 2FX8L 1DANT 4YNYB 3ALPA 5KVFL 3WKML 5E8DL 5D7SL 2X4UA 1TLKA 1YYLL 2APXA 5I15L 3B43A 3IJYA 1NGYB 3RWGB 1ONQA 5L2KB 5D7IE 3I6LE 1GGUA 5JW4M 2CDFB 2N7BA 1II4E 3F12B 2APTA 3VW3H 4FQXB 4AY0A 4XMLL 4D0BB 4HS8L 4RMRA 4AQOA 1Q0YH 3NH7L 4Y8DC 4PFEA 4U2YA 4X0KA 4PLOB 3W9DA 2NR6D 2DTMH 3AY4C 3QJHB 1TZIA 1F6FB 3PQYD 5C6PB 5I30H 1NGXA 3SDDA 4QRTB 5I1DA 1A3LL 1CFSA 3LN4B 3GSQA 2VNCA 3QEQA 3WD5L 5CJOL 4WWID 5DK2B 5IW1B 1LVEA 1CF8H 1UXSA 4U1HA 1QLFB 2EDEA 1UKQA 5CP3A 4Y4HB 4OZIF 5DFWH 2GUOB 1GGCL 5TPWH 3GJEB 3GSOA 3BPNC 2ATPA 4XH2B 5FYLH 3HE7C 2OJEB 3G9VA 2QKIB 5ITFB 3U46B 5T1KA 1JF6A 4YZFF 4TN9A 4K3DH 4MJ4A 5HPOA 1S5HA 3PWPD 1B0RB 5F6IC 2CRIA 4GKNB 5GGRB 1HINL 1G7HA 2CSPA 3L3IB 4J12A 5IB2A 4DCQB 2X7LA 1YNTB 5T3XH 3I2CH 2GITB 4DKFL 4O2FA 1RZ7L 2VDNH 2FATL 4HWNA 5KS9A 5DGRA 2EKJA 4P9ML 3WIFB 4OJFH 4MNQA 5KOMC 4HH9A 2CGRL 1S7SB 2L4OA 4JPIB 5DMYA 3SGEI 5DJXA 3O4LE 3CLEL 1JZ5A 3CFEA 2IH3B 4LHJB 5F3HB 3SDXF 1U92A 3FCTA 4GRWH 3P73A 5HHXL 4Z7WA 4CMHC 5D1QB 1X5IA 1U3HC 2KL6A 1WZMA 3VFSA 1BFSA 1JNJA 4RIRB 5B3JF 5IB5B 3TIDA 2NLJB 1P84J 2R2EB 3TO4A 2VKXA 5HHOB 3NA9H 4OBSA 3MXVL 2D0GA 4Y88A 1I1FB 1RV6X 4JO3L 4AJ0A 3V5KA 2A73B 3PNWA 4YHNB 4ODSH 1EGJA 4JRXE 1D5ZB 3KXFA 2X05A 2FJHA 1O5DT 4DJMA 2IBGA 3D69A 3RTQC 4KTEH 1YQVH 4X6EA 1I1AB 5CZVL 1AD9B 3WNKA 1PG7W 1G7PA 3BIKB 5TDPA 3HI5H 5DRZB 3SE8L 3LY6A 1R5WB 4U1LB 2NY5C 5I6XB 3PABB 4P2QA 3IDYC 4PLJC 2AXJA 1DE4A 1OAQH 4HC1H 3RVUC 4U33A 3RWHA 3TO4C 3UEZA 4UT9H 2GY7B 2OLDA 4POZD 2EXWC 4PV9A 5HD8C 1JWSA 2F19H 3CDGB 4U31A 4WW2A 2YPLE 1PLGH 4NZRH 3NCJL 3WL9A 4R7DA 3JUYA 5D96B 4HS8H 1ZT1A 1SYSB 4JRYD 3RTQD 4Z77B 4FQXA 1J1OL 1QNZL 1RK1B 3P30L 3WDHA 2DQEH 2FNBA 4HXBL 5B38B 2Y7QB 3UJTL 1L8JA 2Q8BL 1KCGC 5AZ2H 1U8HA 1H3WM 5LQBH 4K71B 3W9DB 3DO7A 5EO0A 2W9DL 4X6FA 4DW2H 2GJZB 4AEFA 4LGPB 1CFSB 2AGJH 3LS4H 2NMSA 1ZLWH 3ULUD 3V4VL 1AGDB 1LD9B 4MJIB 3EOYG 5SWZA 3WXWH 4FG6D 1K5NA 3H3BC 3RY6C 5IESH 3BZEB 3QDME 4WIQA 3PP4H 4M1CD 4OLZL 1C16A 3PL6D 4XH2A 5DS8B 2VZTA 5HGAB 5C07A 3W9EB 3LKNB 1U8PB 3WFDH 1CG9B 5E8NA 2DB8A 4LLDA 5C0BA 5BRZB 3T0XA 1WEJH 2O61B 3RNKB 1H15B 2BRRL 4EI5A 1CDCA 5IB2B 2DTML 3OKYA 3QFJB 3FQTA 4LOUD 3NBNA 5GSVB 3KPSA 1KPUB 2AEQL 4L1DA 2X89D 5C07D 2ITDA 2AK1L 3X14A 2Q7YB 4LVNB 3KYNA 1OAKH 4XPFH 4R2GD 4Z8FH 1U8QA 3TC9A 1DUYB 1S7RB 4XC1H 4KI5D 4ZS6D 3GMPB 4QGYA 4P2RD 2PTUA 4ZXBB 3R06A 4LU5L 2PO6B 3VFTB 1JZ7A 3C8HA 4WI7A 4EZMA 5CLWA 4G8GA 5T1MB 3ULSB 3TIEB 2OZ4A 3GK8L 3D1MC 4NKDB 3VWKA 2Z93B 3L5WA 5L88L 1I3VA 4JM2F 1K4CB 2AJVL 4G9FB 3L5HA 4KHXH 5D1QA 5E4IA 4PJAA 1IAKB 2VIRA 4GAGH 2Z91B 4PUBH 3VE0B 3MNWB 2K9UA 5E6IA 4MVBA 1CXEA 1S3KL 4Y1AD 3CD4A 5MEND 4YWGL 2MTPA 3EUUA 1BM3H 3UZVB 3GGWB 2R0ZL 3V5KB 3PNWB 4YHNA 4XHJC 3B3IB 3UXFA 3UZEA 1DP0A 5ENWA 4MXVF 5HYSA 5T3ZH 1I9RH 1I1AA 3CFDA 2EDQA 2VL5B 5KSAC 5DUPH 4C58B 5TDPB 3T0EA 4XP1L 4L29B 4HGMA 2YMXL 5DD1L 4R7NA 3LRHA 5M95B 1HQ4A 4P5TA 4GUPB 4U1JA 1MNUH 4N0YL 3RWIB 3MRLA 4IRSC 1NCBL 1ZLSH 3ZMRA 2J6EL 4X6CF 4QHLB 2DN7A 2QQNH 2X1XR 4JQXA 1MLBA 5HYQB 3N50A 5EOCH 1RMFH 1JGDB 4XTRD 3W0WB 4OGZA 4UAOB 2RIKA 5EULV 4OZFG 4KKCC 5HXMA 3GSUA 4DUXA 3KYOB 3DUSB 4HWBA 1CGTA 3DURB 4HUVB 3VGEA 4LCWA 5B38A 1MI5B 3WN5A 3NA4A 3QUXB 4Y2DC 4P23B 4G6KH 2VAAA 4KJQC 3UPAA 3BDBA 3EGSA 4QRPE 4EN3B 1N8ZA 3D3VD 2E7LC 4GAFB 4H88H 1A1OA 1WGOA 3AS1A 4H5SB 1I9IH 3G6JB 2BFVL 2DQIH 3VXSA 4FFYH 4BH7A 3QAZC 3G5YB 3ZLQC 1MRFH 2GJZA 1NEZA 2GAZA 3CFJB 4YDIL 4ONGL 1ZVSA 1KCLA 4JFYB 1INEL 4F9LA 1K6QL 3B8SA 4I5BB 2FL5A 1XGQA 4Q6IB 1A64A 2NY1B 3LAFA 3WXVL 1L6ZA 1T1ZB 2VOTA 4Y4KD 4QWWC 1SBBA 3CC5B 4OAWA 1CLOL 2H45A 2ZUQB 2VXQH 3QFJD 4NRZA 2AK4A 3LH2H 5HGAA 1FO0H 3L7FA 5JDJA 5C07B 1MY5A 3VXMB 5C0BB 1P4BH 4PRID 4X8JA 5B8CA 1FL3A 2Y07H 4TUKH 4OZGB 4PJIF 2B2XL 3LEVL 3ZKMC 4OGAC 4X83A 1E6JL 3OV6A 2AJUH 2VTFA 5TE4H 5IROC 1JE6A 1FNSH 2QADD 4YDLC 2WQRA 3EKCA 4IRJC 1SJEB 4GMTH 2EYSB 5IT2L 1F6AB 2KPNA 5CSZB 3WLBA 4ZTPL 4ODSL 1PSKL 4WI8A 1CGUA 1DQTA 1F4AA 1X5HA 1VPOH 4TRPH 1FH5H 2PO6A 3C5ZD 1IVLA 3MLXH 2NXZB 1QEWB 4LSUL 1XCTB 4WEUD 5BZWA 2NY0B 4PJEB 1MJ8L 1TCMA 1KN4L 1QVOA 4JFDE 2CKNA 3C5SA 2VSDA 2W0PA 1Q9KB 4Z7WE 3GKWH 3FQNB 1CK0H 2BJML 5EC2A 3L1OH 1EGJH 5FCSH 1OSPL 4H1LA 4JFQB 4Y4HC 3QHZH 4J6RL 1QTYT 3ZKSD 2HVKB 5DJZB 5HPMA 1OP5K 1RJYB 5TFSH 5J3HD 1UWXH 3GGWA 5FECA 1FFRA 3B3IA 2OTWB 4WUUD 5EORL 4XGZA 2QADB 3MUGA 5KJRH 5I15H 2V9RA 3O3AA 2FX7H 4R9HA 2J6EA 4GUPA 4U1JB 4NKOB 2X1OA 1LP9A 4NO5B 3MRLB 4MXQA 4P2CG 1L0YA 5C09D 2Y23A 1MHHB 3BT2L 3ZE1F 5D1XD 3VRIB 4FQCL 1EX0A 2XYCA 1JWMB 1MH5B 3TF7C 3MLYL 4JANB 3LQZA 4MAYA 4A6YA 4U0RC 5DD3L 2FH8A 3QUZB 4N0UB 2HMID 3W0WA 5TGBA 2F53D 2ZCKH 1AO7E 1RZGA 5FUOH 3WLWD 3D18A 5ACZB 3GSUB 5JR1H 4P48A 1KEGL 3MGOB 4Y2OA 3CCHB 5DUBA 1TQCB 1PLGL 2DQFB 1EO8H 1CFBA 2X1QA 4HUVA 3MGAA 2B7DT 3TBSA 1EDQA 3QUXA 4X9FA 2VAAB 4L3EA 4QHUA 4DVBA 3Q48A 4P5KB 1BVZA 1ULVA 2FSEB 4PJGB 4G6ML 5DZNA 1NDGB 4NZUL 1BQUA 3CFJA 3MV01 2VLME 5IHLB 3F7YA 4HJ0D 3BW9A 15C8H 3MGTA 4L3ED 5SWZE 3G6JE 2OXHA 1JF5A 1RJLA 4XHQA 5HHMA 4PJHE 3BOVA 1IKFL 5TE7H 2OI9A 4KKLC 4L8CA 1Q94B 4WFGD 1JTTA 1X7QB 4PJHA 1HH6A 4S2SA 4LAQH 1D6EA 1TZGH 2J88H 2P1YA 3MJ9L 2OXGA 4NGHH 4C83A 1HHGB 4U6TA 5FDWA 1ITBB 3K1DA 3CLFH 1OT2A 1KG0B 1PD6A 4DN3L 2BFVH 2DQIL 3BPLC 1UYWH 4MZ3A 1G9NH 5FIEA 3MROA 4PYGA 2YR3A 4LLUB 2YPVL 4R96B 5DFVD 5FHAH 5GS2H 2CK2A 4O02H 1YNLH 4OJFL 3ALXA 4YGVA 3QUYA 1FNLA 3IKCA 1JFMA 3WO4C 4KQ4H 3ZT5A 1KB5H 1HHHA 1FFOA 1RZKC 1XCTA 3PHOA 4WV1C 1T1YA 1MNUL 1QBLL 4FN0A 1Q9KA 4KV5F 2DQTH 3BP7A 1JPTL 3EFFB 4N8VB 4DTGH 4M5YH 3W11C 5E0QA 4G9DB 1LDPH 3IFNH 4JY5H 2AJYL 2X42A 1UB5B 3L3HB 1N5YL 1A4JB 2BDNH 4GG6A 2HP4A 1J0IA 5HI3D 1PY4A 5TQ0L 4PJDE 3HE6B 1A6TA 2AERT 4XGZB 3VXRD 3BIAX 4O02L 3IGAB 1OTTC 3WFEL 2BVPB 1FSKB 5FYKL 1XGPB 1LE9B 1JRHH 4FP8H 4HLJA 4PRHA 1G1YA 2R15A 5JO5A 1NDMA 4NO5A 5GZOC 4YUEH 1HHKA 3ARDC 4P5TC 1E6OL 4Z0BH 1EUTA 3VRIA 1EXUA 1X5AA 3MLVL 2Z8RA 3UJTH 5IB1A 5I18H 1MCJA 4WEMB 4WNQA 1UJTA 5C0BE 3WXVH 4M6MH 4YX2L 5GS0C 1F4HA 5TF1L 5TGBB 1ZE3C 3NN8B 3KPNB 1AFVH 5E7FA 5EIQA 1MCOL 5DT1H 3ULUL 3N9GH 4FQPA 1BZ7A 1GGBL 4L3EB 1FNGA 2R0KH 4WW2F 2FGZA 4NUGH 1H3PH 5AG8A 2CD0A 3PDOB 3ARDD 3G08B 5GIRA 4QXUH 2H26A 1NGWB 3RPKA 5JLZA 1CBVH 1XH3B 4Q97A 1XIWC 3KWWB 4F58L 2IPKA 4Z7UE 2VQ1A 3U7YL 3LPFA 1GL4B 5T3XE 2YKLL 1F58L 5IFHL 3EJZC 5J12B 5FO8B 1MCRA 4GBXD 1AJ7H 5KSAD 5GGUB 2Y5TA 1HYSD 1LK3L 2IH1A 2FO4B 4TTDC 2G9HA 2IPTH 4Z7VF 4JM2B 3ZYZA 5DRXB 4PJHB 4OUUA 1D6EB 4OV6F 3VI4E 1GSMA 4V1DE 5IV2A 4XCEA 2J5LB 3I50H 5GGSB 4D9LL 1EAPA 4J4PA 3MUY1 4I3RH 4Q9QH 2CKBB 2R0KL 5DHVA 4LLQB 3VFPB 2FR4A 2DQCL 1G7LA 1UCTA 5GRUH 3BSZH 1KEMH 2HKFH 3U79A 5L2JA 1FBIL 1K8DB 3DVIA 4R96A 3NCJH 4YHMH 4FMKA 4N1HB 1FYTA 3BKYL 2LAGB 1XF3A 4G7VL 2P8LA 3IXTB 1XCQA 1YEHH 4F33B 1QNZH 2IALB 5ISZA 4BFGA 3QXUA 2UY7A 5C0IB 3L95B 1JNLL 2XA8L 3ARGD 2YD2A 3FB7A 2WV3A 2WLYA 3V8OA 2DAVA 4P46B 5E8OA 5I1CL 4PJBE 4Q2ZA 3SCMA 5EA0L 4OLWH 1KTDB 2YXFA 4NUJA 1DBBH 3R0MA 4JQIH 4S1RL 2X6MA 1FL6B 4TTDD 5HGGS 4WU7B 3D0VA 4Z7OF 3IRPX 3LB6C 1K3IA 1Q38A 4CADB 3P9MB 1JHKH 3VRJB 4Z7QF 3RUGB 1Z9MA 3GSWB 3WUWB 1FRGH 4N8VG 4XWGH 5DD0L 4P2RA 3HE6A 4P2OD 4HX1B 3PP3K 5D4QA 3DOSA 3IGAA 2BVPA 1EV2E 4NZDA 4E9LA 3MXVH 1E0OB 1V3KA 2R2HB 3TJHA 1A6AB 2DIAA 3ISWA 3CLEH 1HHKB 5H94B 2OSLB 2PF6A 4N5ED 4MXQD 3BKJH 4MNGA 4IHOA 3U7WH 4DFHA 3O8XD 1IZKA 3ESVF 1MFCH 2W60B 2ZG3A 1KB5B 4XVUC 1NAKL 2YUZA 2NX5A 3KYAA 4G7VH 2HTLC 3QIBB 2ZUVA 1JGVL 2KH2B 3KPNA 5HTSA 4P23D 2HJFA 2P48B 3VFUB 5A2IH 4MCYB 3P4LA 1TCRB 4L3EE 4P5TD 4MJIE 2X4TB 2IAND 1FZOB 1MUJB 4QT5A 5JHDB 1OW0C 1R3LA 3REWB 5F97E 2VLMD 3D2UA 4WCYL 2EE3A 2OR9H 2FHCA 1QO3A 4NO0B 1QRNB 1I9IL 5ICYB 2IPKB 2EE6A 3T4AB 3HB3D 1KLGB 3QDGA 3IXAB 4JGJA 4MS8A 4HUUA 3NPSC 1OGTB 3BWUC 3D39E 4F3FB 1U3HB 1ES0B 1S7UA 3NFPB 4HKXB 2HH0L 4MSWB 2F19L 4IBLT 4BSJA 2A2QT 2WWMD 5L6YH 2D7TH 3W39B 3L7EB 1FNSL 3FHQA 4U4BA 4ZFZA 1JFQL 3QIBD 4XCNA 4BQ9A 3KAAA 3QEQD 1U2CA 4OZ4B 3MRBB 2E3VA 1SEQL 1HSBB 5EOCJ 2ADGB 4G9FE 4NRXA 2J6EH 5LBSH 1E27B 2EYTA 3VFMB 4J3TA 4WO4D 4HWZA 3DECA 4MGXA 5L2JB 1DLHB 2D4DA 3QG6B 1Y6NR 1ORQA 2F54A 4PRAB 3NIDF 3JV0A 4ELME 3UYOD 4HFWB 2XN9E 3HNVL 5TE6H 3EAKA 5ISZB 1X5LA 4PG2A 3L95A 3MLZH 1OAYL 1N6UA 3OJDB 2GJ6A 1FGVL 2GK2A 2ICEA 1Y6MR 4MQXD 5HHOE 2VZ1A 4L9DA 1GPOH 3T1FA 2D03L 1WAAF 1I7UB 5CJXA 1XFPA 1DBBL 3SCMB 1KTDA 5GGSY 1YEIH 1RZIB 1OAQL 1MJ7H 4ENED 1LO4L 9CGTA 1FVEB 3WIIL 5FYKU 4HS3A 4WU7A 4QRRE 1MFAL 3JUZA 5D5ME 1B3JA 1A3QA 1N5AB 1RQ5A 12E8H 1K2DB 3L5IA 4RDQG 1G7IA 4P57B 3HZYA 3MMEA 1LE5A 5FOBA 3KPRD 5FV2A 4HX1A 3QDMA 1SYVA 5J1SC 5DD3H 3S6CA 5KVFH 1T1WB 2E5EA 4NQEA 4QRSA 1DUZB 3GSXB 5LGHH 2HFGL 4IDJH 5ISZD 1EVTC 2D9QB 5I74C 4M1GL 4K23L 3CFKA 2OSLA 3IETA 3MQIA 2ICCA 3E2HC 1MEXH 1I1RA 4YXHH 3P77A 3MV8B 1D5MA 4HBQA 1PW3A 2DOCA 4IOSD 1HI6B 4AIXA 3EZ8A 1B88A 3HS0A 3DVGB 2N56A 3QQNA 3HZKA 2UUDK 1RIHL 4OD1H 4ZQKB 1CL7I 3FQXA 2F8XC 1IM3B 2NX5B 4C54A 1MCFA 2IWGA 2HKHL 3MYZA 3NFSL 5D7IB 3RWJA 5FHAL 1NCNA 1IM9A 4YWGH 4Y5XC 2MWCA 4PY7B 1LDSA 4DK3A 3U4BH 4JE4B 4MCYA 3WDIA 5DLML 4P9MH 3R1GL 4RZCA 1BBDH 3QIWB 4W4NA 3EO0B 4K8RL 2GTWB 3MCLL 1JI1A 4NZTH 1FZOA 4QT5B 3B8YA 2A9MH 5F7LB 1R3LB 2C1OA 3D2UB 1QHPA 3EYUL 5B21A 1YJDL 3PWVB 4XZUA 1QSFD 3IU4L 1RURL 3K81A