3MRKA

Crystal structure of mhc class i hla-a2 molecule complexed with afp137 nonapeptide
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
274
structure length
273
Chain Sequence
b'GSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDGETRKVKAHSQTHRVDLGTLRGYYNQSEAGSHTVQRMYGCDVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQTTKHKWEAAHVAEQLRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDEATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWVAVVVPSGQEQRYTCHVQHEGLPKPLTLRW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
publication title Crystal Structure of MHC class I HLA-A2 molecule complexed with AFP137 nonapeptide
rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 82
structure length 273
sequence length 274
ec nomenclature
pdb deposition date 2010-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mrkA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3mrkA01
4QRPB 5D5MB 4X4ZA 3L3HA 4HIIB 4ONGL 1K8DA 2JCCF 3MRHB 1A3LH 1S9YA 1U8IA 3OG4B 4N68A 4CL7A 4G6ML 4F80A 2BSRA 1CVRA 3HNSH 4FNLH 4NQDA 4M1CD 5ILTL 5T5FH 4HPYL 4LEXH 1IGYA 3BKCL 4OD1L 5HY9B 1CGYA 1AGFA 4C57C 1FBIH 3L1OH 5LQBH 3EUUA 4XPTH 1GGUA 1ADQA 1PKQE 4AEIH 2OZ4L 2VDOL 3KPNA 3U9PL 4G6FB 5GS0D 4WI8A 1VFAB 4M02A 1INEH 3HLAA 2ZSWA 1K6QH 1QLRA 1I1AC 4OGYH 1U8MA 3SDDD 1MJ7L 2FWOB 5CJ8A 3PWPD 1RZ7H 3NAAL 2OXGA 5DD6A 3QEQA 3EIFA 3ME0A 4EXPX 2VXUL 3EKCA 1J0IA 2FL5A 2MKLC 2UZXB 4RIRB 4ZFZA 1S9XB 5B39B 1HOCA 4F7TB 3RAJL 3S3SA 3MRLA 3KYMA 1OP5K 3CNKA 3K2UL 3OKDB 2OTUA 2BRQA 1ZLSL 1Y6MR 3ARQA 5MERB 4JCMA 5HYJB 3VCLB 4MA7H 4FQ2L 4XTRC 3U46A 1JGEB 1YYMH 4ZO8A 3TCLB 1MSPA 4MCZA 1ZHLB 5MEOB 1SEBB 1XF5B 4G8EA 3L3DA 4QY8A 3JZ7A 4ZOBA 5H94A 1S9VA 3UTQB 4P49A 5H8DA 3CFDB 2D7NA 3P0GB 4L4VA 1K8DB 5LXGL 1UEYA 3K8MA 4PGDA 2BSSA 1KNOA 2E7MA 2VDQH 2NYYD 3X13A 3FQTB 1A7QL 2DICA 5F8RC 5DJCB 2ZUWA 4OZ4A 4OKDA 2QSVA 3UP1A 1LO4L 5FEBA 3GMPA 4HCRA 1NCNA 3HPLA 4U1MB 5SV3A 3TVMB 1ROWA 4WJ5B 4ERSH 1AR2A 4LARH 5GZNC 1M71A 3E2HA 4MQXC 5TFSL 1WAAE 4I4WA 5CCKL 3FN3A 2B1AL 3VDCA 4Y2DA 5C0JA 1J05A 1X6LA 4RGMC 4X8JB 2IPTH 4GW5A 1WAAF 2IAMB 3M17A 3QDGB 1QLFB 3QEQB 3CDFA 2E3VA 1H5BA 4LASH 4JPVH 4AIZB 5L9DL 3FO1B 1EFXB 2JTDA 2FL5B 3MRRB 3GM8A 5JW3L 1KXVC 4D0BA 5IESH 1NMAL 1B2WH 2V6HA 4NKDA 1CF8H 1YPZB 1DSFL 1NBZA 2VISB 5CUSH 3KJ4B 3U46B 4JREB 4OZHE 3DSFL 1D5MA 3AREC 1BM3H 1U8NA 2EKJA 1R24A 3MJ9H 4GXUN 1I7UB 3E2HC 4GAYB 2X4TA 1CDGA 4KQ4H 4O2CA 2BDNH 1T7YA 5J6GB 4Y2DC 4I0KA 1SBSH 1MNUH 3R8BB 3HZYB 4TPRH 2YWYA 4L4VB 4OZHF 5JHDA 2NX5E 3BGAA 2GJ6D 5FYLH 3CMOL 4AEHL 2WLYA 2IH3A 1H5BC 4RZCA 1F58L 4PLNC 1U6AH 2JKXA 3HPLB 4M7JL 1I8KB 5DEFB 5C08B 1GZPB 3DV6B 5DJ0A 4Z76A 3EYQD 1U3ZA 1J1OL 3T0EE 4PGEB 4IJ3C 1K4DB 4KXZH 2EEAA 1LHZA 4QTIL 4XNUH 1VADB 5FO8B 1HE7A 3LKPB 4N1HB 4L3CB 4R9HA 1YEKL 2HVJA 2HRLA 2IWGA 4J1UB 2MQ0A 3OX8B 4MCYB 4YE4H 1WLHA 4OCLC 5JORA 2JB6A 2OMNA 4M6AA 4NCDA 5FUOL 4RWHA 3ZTJG 1YJDH 5DQJB 5MI0C 2W9LA 1D5MB 2LAGB 1U8NB 1VPOL 3F7YA 2QSCL 3SO3C 4FFVC 3W11D 4D94A 3G6AA 5E8EA 1RIHL 1F4WH 3V0VB 4OZIA 1EMTL 1B0WA 4W68A 3QISA 1OCWL 3AY4A 4OI7A 4XAKE 5HHMD 3MLRL 4PJFA 4ZUSA 2A1WH 1PY9A 1RZJH 4IMLB 1W72L 2UVEA 5E2JA 5ENWB 5IVXA 5GSVA 2HG5B 2F53B 3KYKL 4PBXA 2NZ9C 2J6EH 1J87A 1D9KB 1KGCE 1ETZB 5DLML 2HTKD 4HKXA 3WFEH 1IBGL 4GKZA 5CSBA 2HT3D 4JJHA 5DJYB 4YDIL 1JPFA 3OXSA 5AG9A 5BO1L 4WI5A 4M7ZB 2H1PH 4RA0C 3TT3H 1FZKB 1OAKH 3E1F1 3O3EA 1OAUL 2DRUA 1IM3A 2ICCA 5J11B 5JXED 1Q9KA 4NZUL 2BVEA 4HXAL 4XCCL 4X80H 3V8CA 1NGYB 1KB5B 3PJSA 3ETBF 4Y19E 3CFJB 3L5XH 4DTGL 4DKFL 3MRMA 2EDNA 1RUPH 3NFNB 1NCCL 1G6VK 2HFFB 5ADOL 2EIBA 3C8HA 3IFOB 3EYUH 3BW9A 2X89A 5EFIB 5CEYB 3IXTB 4LDEB 3B5GA 2C5DC 3IAGC 5CBAB 5DWUH 1HHHA 4R8WH 1XCQB 1MCWM 3UCRA 2R69L 4PJGA 3FFCA 2XRAL 4Y2OA 4R7NA 1FIEA 1RU9L 3ZO0A 4PRHE 3GDBA 3EOAB 4OFYD 1JGVH 1BJMA 2EZ0C 2X1PA 2MQ3A 5LGJA 4ZSOA 4X9FA 2H41A 1LDPL 3QDMA 4GRWB 5DMIL 4JM2D 5FM8A 1ODAA 2PYEA 3EFFA 4GSDH 4D0DA 3NPSB 3MV8B 4YHOL 3ZSSA 1RY7B 1QR4A 4LKXB 2Q76A 4U0RB 1I1YB 5HGDA 4ELKA 1CXFA 1KIQA 1MFCL 1YEGH 3GBLA 2XTLA 4M7LH 4I3RH 4OD2B 2X4UA 1KN4L 1KTLA 3WL9B 1PYWA 1N8ZA 2H2PC 2FR4B 5KAQF 3WSQL 1M05B 1ZK9A 5C86A 3S8WA 3RIAK 1KACB 1Y0LB 4U1LB 3QNZB 3QI9A 3PJSB 1F6FB 3N06B 3D3VA 4L8SB 3WNMA 3MRQA 1YY9C 2MTPA 2PN5A 2W07A 1G0XA 4XNXL 1FVEB 4YIQA 4OKVA 3QEUA 2KH2B 4LOUD 4YGAB 1HHHB 2VDKL 5A16A 4LL9A 3QO1B 4MHHG 4Z95L 5K9OA 4KJPC 4OLZL 1QG3A 3G5VA 4ZNEA 4I5BA 4Y16A 1T20A 2NY0B 3C08L 5FGRA 5BV7B 3KPRB 1EFQA 4DKEL 1T1ZA 4PGBA 4HH9A 1QACA 4TULH 1TQCB 5GGQL 1WBXA 5L8JB 1T4KB 3TBYB 3KPQA 2R2EB 1HHIB 4N9GA 2HJLA 4RMRA 1DBJH 2IADB 1MFNA 4WW2F 2VLJA 2FBJL 2PETA 3ULUE 2V2TB 3OTTA 3TIDB 3MRCB 3B4NA 4UOW1 1I7RB 2R9HD 4PRAB 4HEPG 1MCHA 1A6ZB 4CRPA 4L8CB 2BNQE 2GI7A 4IHOB 3GUTB 4KWUA 2ZPKH 3BPLB 4QRQB 4RAVB 4PLJC 4LCYB 4NN5C 3ULUF 3MCLH 1I7TB 2NMSA 3J7HA 1NAKH 1XEDA 3MV9D 3HI1A 1AXTH 1MF2L 3F5WB 5CILL 5EU5A 3MLVL 3CGTA 4TNWF 3U1SH 4X4YA 4LHQB 3QI9B 5A40E 1BZQK 2Z31A 5DTFA 4Y16C 3VG0H 3VMPA 3WFBL 5I8CA 3FQNA 5GGVY 3GEWB 2GK0A 3ARTA 4QGTA 5DUBB 5B38G 4B7LA 2A73A 1FG2A 1NANI 1NFIB 2CLZA 2X6MA 3G6JA 3HS0B 2A6IA 4FABH 4PJCB 4QHMB 5C3TA 1MFEL 2Z8RA 3MGTB 5DD1H 5FA4A 4S1QH 4ONOA 2AV7B 4BFGA 4GBXA 5I1KH 5FK9B 4HUMB 1ZANL 3MLUH 4I5BB 1JF1B 2DMKA 1FVCB 4ZODA 1WIUA 4OZGA 5GJSH 1UWGL 1HXYA 1XGRA 1S7TA 2DWDB 3HE7D 1FRGH 5IB4A 4UINL 3VRLE 5T5NG 3O6ML 4NM8L 4IS6A 1HQRB 4XVSH 4KJYA 4EUPA 1J86A 2NY4D 5FO7A 4POZC 4CU6A 3Q1SL 4QYOB 2GKIA 3O9WD 2OQJA 5CZXD 3WLWD 5LAXB 4IRSC 3VRLF 1ADQL 2LABA 2AEPH 3S35H 4XHQA 1FCCA 3BQUD 3OXRA 3BKJH 4KRPD 5JPMB 2YOCA 1JN6B 2F54E 3LDBB 3D85A 5I66B 4GRLA 5ALCL 4YFLF 4HT1L 4OCSH 3WEXA 4KVNL 3KWWA 4X4YB 4R4ND 3NCJH 4NO0D 3ES6B 2DQHL 5JLZA 1CGVA 1T22A 2ESVE 1BD2D 3VJ6A 1GYAA 3H9ZA 15C8L 4JO1H 4U1JA 4YX2L 2DKUA 1RZ8A 1JBJA 5C8JB 5I17A 4H88H 1C16B 3ALPA 2KUTA 2V2WA 5CLWA 2GTZA 4P57B 3H42L 1BQHG 2MNUA 2VC2H 3FT3A 3BJLA 2PR4H 1T1YB 1ZLWK 5J3HD 3IAPA 1K4CA 3CFEB 3OJVC 1Q72H 4AL8H 2B7DT 4DGYL 5D2NA 3PDOB 3MLSL 4LVOC 1T83A 4OZGB 3RI5K 3DX7A 1MELA 1F02I 1NFDB 1QUNA 1IRAY 5CINL 4X5LA 4LF3A 4LLYA 1P1ZB 2IPUG 4GRLC 2ADIA 5H2BA 4MMXC 2FECL 3ZKSD 5KJRL 2NY6B 1CLCA 3GK8L 3V5KA 5KS9E 1UJ3C 2QKIB 1P7QB 4G43B 3ARGB 4AENA 4NC2B 4RAUB 3CVHL 2HLFD 3UJJL 1L0YA 5C70A 3RVXC 1JNLH 3QQ3A 1OGAE 4GMTH 4P2QA 4M3JA 3QEGH 1CFTA 1BFVL 3REWA 4JFFE 3ARRA 5JO5A 4QNPE 5FUZL 5KS9F 2CKBB 5F1IB 1D5ZB 4JHAL 4CUCA 1MHEB 4G6KL 3I6KA 3TWCL 5JW4N 3LPFA 3DI3B 2PNDA 2WMPA 3HNTL 5IIEB 1IQDB 2XZAH 4ZPTA 5E9DB 3KWWB 1MCIA 5F6HI 1WUNT 2F5AL 4QNPF 3B43A 4OF7A 3BH8B 5D2NC 1BBJB 4WV1A 1HWHB 3NFSL 3VDBA 3RY4A 1IC5H 3LEVL 4LCWE 2X5PA 1L7IL 5CEXA 5EC1A 1R3JA 4IOIA 5D8JL 3CXHJ 1TNNA 4ODXA 2Y6SC 3T0DA 4Q9CA 5IB1B 2VDMH 5DR5L 3SPVB 1QNZH 3L95B 1T04B 1ZHKA 4RQQB 5IMLB 4L4TD 2KQMA 4JAMB 2ZCLH 5IROA 3UTSB 4WUKH 4X9IA 2X70B 4LPXA 4WHCA 2V17H 3CPLA 3T8XB 3ZHDA 5GS1A 5JIPA 5DO2C 3SHSA 4W6YB 1F3DH 1BZ9A 4PGZA 1F4YH 5IM7B 1AXSA 2ITDA 5DJDB 1J8KA 2IGFL 3BP6A 1QTYT 1KCRL 2IANB 3O81A 1A7RL 4LSDA 2V7NA 4XNQB 4I8DA 1NCDL 2FJHB 2Q86A 2GSIA 2IPUK 3JSSA 4NO5A 4R4FL 3VG9C 3S37L 4LDOB 4LNRB 5JO5B 3UDWA 5JW4Q 2MFNA 2APBA 1N0LA 5DRWB 1CIUA 4ORGB 1VFOA 2APXA 4BZ2L 4D0CB 2WINA 5JOPE 1IC1A 4UV7H 1FV1A 1V05A 1I7ZA 1T66D 4IDJH 3S5LG 3WFDL 4RGNB 5IROC 4YAQA 2FX9H 4OIBA 2DF3A 3S4SG 5DMKA 3ROOA 3CCHA 4TSBH 4WV1B 5GS1C 2Q7YB 5ID1A 3OKMA 2DQJL 1R3KB 1BZ7A 4LHUG 5CEXB 3ORJA 4MAYB 5CJBA 4OCRL 4S2SB 2P24A 5KBNC 4EQ2A 2WK2A 5K9QI 4TUOB 4PTUA 4HPOL 2R1XA 3RY6A 4NWTH 1JGUH 1HQ4A 3OKLA 3IDXH 1TJGL 1CT8B 5KW9L 5MEPB 5MP6H 2D03H 2CIIB 3VFOB 3FJTA 5BS0A 1BAFL 2YD9A 1VEPA 3UDWC 3MFFB 2FLRT 1U8KA 4QOKA 1G7QB 3LEYL 4LCCA 3QCVL 4JPIA 2HFEA 4PJ5E 1IILE 3BH9B 4WNQA 3UROR 5D7JA 1PX3A 5ANME 5L2KE 4XMLH 5J9PB 2EYTA 4Z7VA 2I24N 2O5ZL 2V7NB 5D7IE 5KN5B 4P2YA 4NT6B 2R56L 1T0PB 3VXQA 3Q3GA 1FH5H 3F58L 2CDFA 4BYHA 1A1NB 3ARZA 3IS0X 2X4SA 3RL1A 1JCKA 5D7IF 2QQNL 3RY6C 1DLHB 2WINB 3NOIA 1JRHH 2X1OA 1Q1JH 3QPXL 2ZNXA 4TYUA 3G5YA 5EUOA 3W9EB 3ZYJA 5BRZD 5CD3A 4NP4H 5CZVL 2VL5B 5GS2H 4Q6YA 1XIWA 5CJXA 2KBGA 4LCCC 2ZJSL 4U7SA 4HUVA 5T3XD 1YMHA 4G8GE 3BI9X 5D7JC 4FFZL 1B4JL 4QO1A 5I1GH 2EIEA 3CDGA 5EU6D 1RMFH 1GHFL 3C6SB 1DQTA 1W8OA 3SGJC 4NQSB 3CFBB 3BSZH 3IS1X 3VA6A 3V2AR 3P11L 3BPCA 4V3EB 5BS0B 3B8SA 5JMOC 3OAZH 1JZ4A 3STZB 4JFDE 4WGWB 4UT7H 3BUTA 1MJJA 5HHNB 3UMTA 4ZAKA 4R97B 3QFJB 3VXMA 4MJ4A 4Y4KD 1FFOA 3RY5A 5SWZE 3SQOH 2HN7B 1NJ9B 3EOYG 4FA8A 2B20A 3V4VH 1XIWC 1BOGA 4H26B 5E5MB 5E94A 5D2LB 1DQJB 2RBLA 5HHQA 4R3SA 3D39A 3IDNA 4PDCE 1IZJA 3IFPA 1MWAL 2P46B 1VKXA 5LBSH 4TVPL 1A7NL 4JDTH 3VU2A 4HLZG 2AW2A 4PB9H 3O2WH 3TN0A 1OTTD 3BRGC 3VFWA 3ARBA 5DJ2B 4NSKA 4MDIB 4GW4B 4KROC 3ARFC 4OT1H 2DB8A 4U1GC 4KZEH 1B0RB 1FGVL 4JY5H 2R1YA 3O8XA 4WFFD 1MCKA 2GJZB 4S1SH 1AO7D 3X14A 3H7BA 4ZAKC 1Z3GH 4P2OB 4OBRA 1FO0H 4Y1AD 1J0ZA 3BZFA 5GZOC 4NQEA 1LNUB 3BKYL 1PZUB 3O0RH 3ARYA 4AEFA 2F8XC 3DIFB 2E9JA 2R0ZL 2M2DA 4H20L 3HMXL 4NKOB 4X6BA 2ILLA 3IJSA 3V4PH 2OCFD 3VXPA 1A3QA 4N90D 5B38B 1NC4A 3TZVB 4PUBH 2VXTH 1YMMD 3OSKA 1C5DB 3DSNA 2XTJE 4WEBH 3TN0C 2W65B 5I16B 2OTWB 1BQHA 4P5MB 2FIKA 3CH1A 3MUJA 3QUKB 4PJXE 3R0MA 1RZKC 3ARBC 4Q0XL 4RFOH 4XXCA 4QCIA 3ARVA 2FHFA 2DN7A 1DVFD 4X8XA 1XR8B 3IDMA 3DLQR 4P2CG 3HG1B 1KFAH 2IG2H 1QBMH 1WT5A 3NIFE 4NHUB 1F8TH 1KJMB 4GKSB 5JNYA 1R5WB 4Y5XA 4LSTL 1FLRH 1T7WA 1MJ8H 3MXVH 3NGBC 3RTQD 4WWKD 4X7TA 3S37X 1AIFB 3ZSTA 2EC9U 2AQ3A 2E5EA 3VW3H 1SMAA 2ERJC 2R1WA 3VI4E 3NIFF 5FA3A 2AJUH 4ETYA 1AKJB 1SHMA 2Z0BA 3GKWL 1BQUA 4M6MH 1FNAA 5KG9B 4YNYB 5B21A 4PRBA 3LKRB 3O8XB 1CK0L 1DBMH 3ULVC 3AS3A 5EIIB 3PL6D 3C5JA 3K2MC 1W72B 4GOSA 5AD0B 2DQEL 5C0BD 3VI4F 1ZTXH 2MWCA 2NW3B 5HDLA 2E9IA 2AJXH 2R4SL 4XXCC 2AJSL 5CEZE 5DK2A 1HEZA 1UM5H 2Y25A 4KAQL 4G9FA 2MKWA 3SDYL 2ARJA 5D1QD 5KVGH 1WT5C 3VD5A 1LP9A 4Y5XC 4WTWA 2QJDA 1NC4B 3UAJD 4JFZL 4RWYL 2Z91A 1ONQA 3H9SA 2P5WB 3HMWL 1MVUB 4QHKI 5D1ZD 1LO5A 1QBBA 4AT6A 1OWRM 3WIIL 2B4CH 1M6OA 5ACZB 4QRRD 5F3BB 4PS4L 4YBLC 1KPUA 3ARDD 5AZEH 5C0CA 3D69B 4PJIA 3LZFH 1K9TA 1FFPB 1VCAA 1WWCA 5E6IB 5BQ7A 1EBPA 2AABL 4RMWA 1UKSA 2VDRL 3GJEB 5FHBH 1BX2A 2NR6D 3HI5H 3C6LB 3RWCB 3EO1A 2CJUL 2AK4E 1P9MC 3IVKB 1G9NL 3WN5C 1N64L 2VLKA 1F90H 2CDEB 1A64A 1WCBA 4HAFA 3TJHD 3WXWH 2BVUA 1OSPH 1KTRL 4PG2A 5HHOE 3KYNB 1JZ7A 3LS5H 2GUOB 4IOSD 1ZGLB 1S7UA 4QRSA 4NJAH 4JZJA 4L3EB 1BECA 1WFOA 2PO6D 1NAMH 2CRIA 1RV6X 4WU5B 1OARH 2HJFB 1R3LA 2IH1B 4M7LT 5C07E 5JPNA 5IW1A 3HN3A 4WUUA 3U30C 1L8JA 5ALBL 1NCAH 3JTTB 3S5LA 4DKAA 5DK2B 3RDTD 5IBTL 3LKQA 5E2WL 1KELL 1KF9B 2CUMA 5DFVD 5KSAB 1F4AA 1IGTB 2YUVA 4Z0BH 4CNIB 3RVUD 1AFVL 3MTRA 4HWEL 2I5YL 2IBGA 4HK3J 4YO0B 1NBVH 5BMFH 1T0NB 2O5YH 5TDNA 5HI4C 5I75C 4HMDA 4UDTB 3W0WE 3DUUA 5E08L 1NGQL 4BSWB 1RUMH 2CRZA 3FQXB 3D25A 4PG2C 4YXLL 4QRPD 1M6OB 2R4RL 3MXWL 1IGCH 1OTUD 4UT6H 1AI1L 4CDHA 4DQOL 1JL8A 4JZJC 1L7TL 1N5AA 1P4BL 4FQ1L 4FTVB 4NBZB 1LD9B 3RWFA 3MOBL 3UZQA 1HXMA 5HI5C 2EEDA 4DN4L 1A1MA 5GS0L 3HE6D 3QUZB 1LO0H 2YD8A 2VE6A 3B9DA 1NC2A 4PJEB 4YDKH 4J6RH 3LKNA 4RDQG 2OX5A 3HTLX 2Q8AL 4G6FD 1I9EA 3ZKND 4QTHB 4YK4B 3UC0L 5C7XL 3DGGB 3HC0A 1HINL 3TV3H 5DUMH 5DS8A 3LMJH 4PY7B 4H25B 4D3CL 4HF5L 5TQ2L 3UPCA 1DL7H 5AWNH 1EV2E 3P77B 1K3IA 3SBWC 3UJIH 1HI6B 2ICWB 3O3BA 2FDBP 3DURB 3SDXE 3C60B 2G5BA 1ZLUH 2ZCKH 1A6PA 1M7IB 1GAFH 1W2KT 2AXJA 5HGGS 2QHRL 1PEZA 3S4SB 3QR2A 1CZ8H 4MNQA 5HYJD 1A6UL 3SDXF 1DN0B 4GAGL 2ZUSA 3T3PE 4MA8L 1SJEA 3QUXA 5AAMA 4LHUB 4URTB 3GIZL 3NZHL 4PJ8B 1UVQB 4JO3H 4P4RB 3P3YA 2APWA 2BNUA 2HFGL 2OJZH 2QBWA 4PJ7A 2DI7A 2C3VB 1ND0A 3PGCA 1FFNA 5HDQH 3T3PF 4NQDE 1MJUH 3KG5A 3HC3L 4FQCL 1LWRA 4MD4A 2ORBL 4M43H 4OLVL 1HKLH 4IRZL 1U8LB 4C58B 4YHLL 1CDCA 5HHPB 4K9EC 1OHQA 1D7FA 2RR3A 4NKQB 1L0XA 3KPLB 4JKPL 4P2RA 1FNHA 2ZCHL 1I9JL 5IQ9A 4TOYH 3EZJB 2XZQH 1Z5LB 3TPUE 2ITCA 4AY0A 1LO2L 1G6RH 1Q0YH 1U8QB 3TJEH 2JELL 1D5IH 4NKMB 5FOBA 3P9LB 5SWQA 1X44A 2FHBA 1F3JA 5E00B 3WKML 4I18C 3KXFB 4YPJA 2JE8A 4PTTA 2BMKA 2YXMA 3S36H 4NQCA 3NA9H 4M7KH 2VSDA 1S3KL 4NGHL 2EYRA 1QSFA 1Q94B 1VDGA 4HIXH 1RUKL 2R2BA 3H8NA 3WHXA 1KEGH 1UB6B 3BVNA 3TEUA 1CLOL 3MYJB 4FMKA 4WTXA 3CX5J 5J12B 4MMZC 1GC1H 3WFCL 4OF8A 1R3HA 5E5RB 4LPVA 4XMKH 5EWIL 4X83A 3IDUA 4PJ7B 4R2GC 1JGLL 1JHLL 4XPBL 1KJ2L 1SYSB 1IGIL 1MAML 1MCPH 1G7MA 1K8IB 2XA8L 1JMZA 4OLUL 4KTEL 3HI6H 5CGYC 3GHBL 4MNHA 2AJ3A 1YECH 1DQQB 4WDIB 3K1DA 1G9MC 1M7DA 4L5FH 1AR1C 1GGCL 3QWOA 3B6SA 4NJ9H 5KANI 2UUDK 3MUGA 4AG4H 5HPMA 4P4KA 4LSPH 2DBLL 4JG0L 2AXGB 2IC2A 5IK3B 3JUYA 2HKHH 2VR5A 3B5TA 3GMQA 1OM3L 4XP4H 5CJQH 1QQDB 4YR6B 4XPGH 4RGMB 3GB7B 3TNNA 1X5GA 4TNVF 1TMCB 5C0DB 2Y07L 4TRPL 4YUEH 1NEZA 3RZWA 1KIRA 1ACYL 3O2VH 4ZPVB 4XCNB 1SMOA 3U6RB 2VOTA 4PRDB 3BPOC 5F7DA 1A6AA 1E27A 4LSRL 3I02B 2BJMH 3CJJA 2DWEA 3QUMH 4YJZL 2VQUA 1PD6A 2EYRB 4W6XB 1JK8A 3MOAL 2QQQA 1PZ5A 2NX5D 1TNMA 3PWUA 4UAOC 5SWSA 1JYXA 2ADFH 3CVHB 4WFGE 4EDXA 5IJVA 3BIKB 3W81A 5K9KB 1V3JA 3BP7A 3GSNA 5I1EH 1U91B 5KSBB 1SEQH 2Y1VA 4U6YB 3M07A 3WHE1 1AQDB 5JHDE 3GSOB 3FRUB 5F7KC 5FYJH 1JYWA 2C7UA 4OUUA 1DDHA 3EHBD 4FQHB 4KI5C 3PWNB 3EFDL 1REIA 5ESAA 2A77H 5I0ZA 5F93C 1JNNL 5TQ0L 3NPZB 4M48H 1CGUA 3GSRB 3MMEA 3F62A 4KKNA 1CLZH 4NQXB 1DBKL 4XCYB 2KPNA 4P4KB 6FABH 2F53D 4X6CB 2YKLL 4OB5H 4EI6A 1D9KD 5TE4L 4IJ3B 4X9HA 1JFMA 2EDHA 4PYGA 4QXUL 3X12B 4JN1H 3EO9L 1MCOL 1RPQA 1UXWB 2XKUA 3V5DB 1UCTA 4XP9L 4TSCL 1OB1A 1IM9D 1ZHNB 2UV3A 5JA9A 4XZUB 2CRMA 1K5NA 4LSQH 2UWEA 2DMCA 4JB9H 1U93A 3PWUB 1WFTA 4XAKD 5JUEH 1FYTA 3VXRA 1KEMH 3RHWK 4K7PY 4J3SA 5GISL 3U4BH 3DECA 4OZIE 1WEJL 3VGFA 2YRPA 3HZVB 5JZ7D 4WFHE 4OD3L 1F3DJ 4MGXA 4HKZA 4S1DD 4O2EA 3IF1A 3K74B 3CLFL 1OAQH 4PJFE 4KDVA 43C9A 4YHZL 5JIIA 3U48A 4KQ3L 4OZIF 2XXMB 5EBMA 4WO4D 5IVXE 4TUJB 5CJOH 1EVTC 5KVEL 1A1OB 3DMMB 5TDOB 2E7LA 4O4YL 5F6HJ 3AFLA 3VXSA 1MHPH 4PJFF 5HHXL 1JUFA 5DHVB 3RWIB 1CU4H 3OHXA 5HJ3A 3O4LA 5IVXF 2W60B 4PGCB 5L7XL 3TBVA 4KKLC 4APQA 1NMCB 4OCYH 4QHNA 1RSFA 3QFDA 1FE8L 4PJDA 3O6KH 3QT2A 1FORH 3SE8L 4LQ1A 5T3ZL 3BYYA 1F11A 3F65A 1SJHB 3STLA 4B53A 1YZZA 2AEQL 1Q9WB 5HYFA 4KKAD 3JTCA 4C56B 4G8FB 3L3IA 3NCFB 4LKCB 1CBVH 2V5YA 5F9AC 1QFWI 1YYLL 3DXAA 3BP4A 5JR1H 3C5SB 5T1LB 3JWOC 4KZDH 2HMID 1PBYA 1EJOH 2EC9T 3Q0HA 3MA9H 2ATKA 2R0WH 4XNYL 2E7LC 4G5ZL 1CXKA 3U36B 4U1KA 4LLMB 1ZVHA 3F7VB 4PRHD 5FYJU 3IXAA 5EO0A 2GW5A 4DEPB 2XWJB 1UWEL 4M6NH 3UBXG 4PJGE 4APQC 3FFCE 3I2CL 5A2LH 2IMMA 4Y7MA 4HCRH 2VN7A 3GI9L 1RK0B 4H0HB 2V7HB 5HTSA 1RUAH 3LD8B 4PJGF 4YHYC 2NY0D 4MD5B 4ZSOE 1UGNA 2W0KA 3MRFB 3QDME 4BM7A 3QNYB 3A6BL 3SKJH 2PYEE 3RP1A 4KRNA 2Z93A 4HG4J 5I1JL 4TVPE 3OKYA 5J6HA 1F4XH 3RPIB 3UTTE 1KTDA 5GIRB 4ZTPH 3I85A 3LKOB 3TO2A 5K93A 4G7VH 3U0WL 1KPRA 1FAIH 5KTEH 1WF5A 4YDJB 4YHIA 4MJ6B 1AJ7H 2OSLA 2NY1B 2VH5L 2Z92B 4O02L 4XCFH 1W8NA 4ONFL 2BHYA 4Z7QE 3T2OA 1H3XA 3O3AA 4F7PB 3WO4C 1UQSB 1P4IL 3D3VE 3WDJA 3CSPA 5MENB 2OJEB 4BH7A 3MBEA 1JVKA 3MFGB 3JV6A 4PB0H 2ATKB 3ROLA 3BAEL 1IL1B 5DDHB 1FSKC 1ZT1A 5T33H 3LKSB 4JFEA 1IAKA 3LN5B 1E4XL 2AKRA 1DFBL 5GRUH 4EIGB 2MMXA 3FB5A 4MJ2A 2W9EH 1EDQA 1MEXH 2FLBT 1LEKA 3X11B 4XP5L 4ZNEE 2CK0L 2I60H 5EBLB 4KK6C 4JANB 2EDTA 5DD0L 5DJ6A 4RSVA 2BNQD 3IRZA 1FVDA 4KUZH 1DBAH 5FECA 4JO2H 3CH8A 1UCBH 5EH1A 4HGWA 2IQ9H 3QWRD 2YBRA 3KPPB 4NPYB 32C2B 4FQIL 2FD6L 5TJWK 3GNMH 3EGSA 3PABA 2VLJE 3ALWA 3U83A 3MBEC 3QQNA 2W0PA 3REVA 3OJDB 3GHEH 1RD6A 1N59A 2K9UA 4HJJL 4H1LG 5D7LB 3ZLQC 5GGRB 1CGWA 5HYIA 2MHAB 1NCWL 1KB5H 5KSVA 1JP5A 3KAAA 2WQRA 3MJ9A 2O61A 3QAZC 3MREB 4UTAL 1IT9L 1CFVH 4K07A 3TC9A 1NDGB 3PV6B 1EUTA 3TH4T 2CMRH 2I27N 3MJ7A 3SJVB 2WLZA 4X7SH 4B50A 3B3IA 3DX9B 5L2JA 5FM5O 3G6JE 1ZT1B 4GG6E 4HS3B 2YEZB 4KTYA 4GW1B 5ADPH 3PWVA 1DQDH 4NZTH 4XMPH 2J8UA 2XN9A 5CLTA 3QHFH 4F2MA 3VGHA 3QCTL 3G6JF 2W92A 3QULA 4GG6F 2GFBA 5I71B 4GRWH 4WHTB 5CIPB 1XGQB 3RU8H 3P9WB 2FATH 1JPGB 1U2CA 4H0GA 4X6FB 3OMZA 2HTLC 2P47B 1MI5E 3MUZ1 2WUCH 1VB9A 1I4FB 5GGVH 1CFSB 4OSUL 2DQCL 1BWWA 1HIMH 4G8IA 3U7WL 2NY6D 1X9QA 4PJHB 5IB5A 4MXQA 1NUDA 4MNGA 5GRYA 1P7QD 2EKSA 4YC2C 3O45B 4HWBL 5EUKB 4IRSB 4PFEA 5F89A 2ESVD 4KK8D 1TVBA 3S96A 3WDIA 3LAFA 3BXNB 1QLEH 4UOW0 5KSVB 4JHWL 5JQ6H 4PBVC 1OP5H 1C7SA 3SGKA 3UO1H 5EDXA 4LHJB 2PKDA 2EDRA 4KV5E 3IDGB 4K3HA 4BSVA 3VE0A 2ZSVB 4UOJA 5FF6A 2DQIH 1MQKL 5T1DH 3GMLB 4D2NA 2DS4A 4M4PA 5E9DD 4LQFL 4XPHL 3C8KA 3W2DH 3MCKA 3VRIA 5GGRY 4KV5F 5BVPH 1T5WA 1UZ8A 4F7EA 5ETUB 2A83A 3ZHKA 1VENA 1IGJA 2BFVH 5CGMA 5CKGA 3QA3B 3VXUB 2E9WA 1YEJH 3IJYA 5BV7H 2G9HA 3HAEG 1C5CH 1AXIB 2VERN 3CUPB 4R90L 2ZG2A 3BT2H 3G08A 3ARPA 5C0ND 1U9KA 3SDDA 3WFHA 1KN2H 5FHAL 3PWPA 1HH6B 1MAJA 5ITFA 5D2NE 4XRCB 5I15H 2J6EA 3MRPA 1KB9J 1OGAD 5BZDA 2UY6A 4Z7UB 1AD0B 2V5MA 2F5BL 4P0DA 3SGKC 5HVFB 1YJDC 4K23H 2VAAB 3GSVB 1I8MB 2C3XA 4M61A 1LE9A 4M1CC 2YZ8A 2NQCA 3QXAA 4MNGB 3QUYA 5IFHL 3E6HA 1FJ1A 1KC5L 4P2QE 3MNZA 3R1GL 3WNLA 1GVIA 5I73C 1NCUA 4EDWH 4HFUL 4I3SH 4KI1A 4XPAH 4N8CL 3MLXL 5J1SC 2I25N 2IBZX 2NY3D 4MQ7A 3IU4L 5D7SH 4OF5A 3CK0L 5ESQB 5D72H 1RZJC 2VQ1B 3SGDI 3PP4L 1PQZA 3SDDC 5IF0B 1FZMA 5EN2B 4DW2L 5HDOA 5ICZB 4RGND 3O4OB 5I1HH 4N0UA 5HYSA 5F96H 1HDMA 3TFKD 1FLTX 2R23A 5CP7B 3RQ3A 1KJ3H 2W9DH 1L4IA 1QP1A 4P48A 1D6VH 3GSQB 3KPOB 5C0AE 4KJWC 1C08A 4CMHB 4J4PD 3IGAA 3VXTA 2PW2B 4JQVA 2DLGA 3QUYC 5DD5L 1ES0A 4MXWH 5I19L 1GL4B 4O2FB 3WFHB 3GSNL 4N0CD 3O6LH 1RURL 3PWPB 4JY4B 5EA0L 4PJ9A 5BZDB 3MRPB 3GBNH 4K94H 5HD8C 3EAKA 4FZ8H 3RVVD 1QR1B 1LILA 3QIWA 4MVBC 4P59H 1LK2B 2JK5A 3FOLA 5FYKE 5F1OB 3Q6GH 2LTQB 2QQKH 3ESVF 1OAXL 1RJLB 2B5IC 1DP0A 3DX8B 3NABL 4HS6B 3WBDA 5JOPD 4EKXA 1N0XH 3QYCA 2NYYC 3SGDH 2AJZB 4L9LA 1L9NA 5LWYH 1LK3L 1WJ3A 3ZDZE 1FJ1B 2FZ3A 3DVIA 5LKNA 4NZDA 1XF4A 3H6JA 5DURB 5ECJE 4ZTOH 4D8PA 5I74C 2BOBB 1JI2A 4X98B 5IBLC 1DBBH 2IALB 3QBTB 2I9TB 2HVKA 2BVTA 1ORSB 1RFDH 4BZYA 5TGBB 4JQVC 4GXVL 3ZDZF 5AUMA 4DCQA 1N3NB 4R26L 3F8UB 35C8H 3N1FC 5C3LD 2GTWB 4ELMA 2GJ6A 4FFYH 5EZOL 1MFBL 3FQRB 25C8H 4ZUUA 1RUQL 4PJ9C 5T3XL 3DRQA 4HWUA 5DSCA 3K7UA 4K2UH 1YEFL 2VDLH 4LBEA 4E5XA 3DBXB 3QIWC 2C9AA 2R23B 1A7OH 1IKNA 4JLRA 1AGBA 4PJ5D 2JIXB 4MQSB 3VH8A 2DD8L 5L2KD 5AYUH 4P5TB 5LGHH 4L9LC 1GPOH 3VFSA 3D2UB 2DQDL 4UDUB 2W91A 3A67H 4O58H 1S7XA 4MZ3A 3T77B 4QOKE 3TNMB 5E1AB 4EEEA 2EIZB 1IQWL 3NACL 2Q1EA 2B39A 3UBXB 5D71H 4Z7VE 5L88L 2W0FA 4ZUVB 3BKMH 5EZIL 1XF3B 3EOBA 2CKBH 4XVUD 1E6JH 4XVJL 3AGVA 5F9JA 5EPMB 3M1BB 3MNVB 1IKNC 4HZLB 3JWDH 1QSEB 4Z7VF 2PTTA 3VFRB 4G8GD 4M1GL 1N5YH 2DTSA 5F7EH 3EYQC 4LU5L 4EN3D 2HKFH 4EZMA 2HVKB 1LO3H 2MQCA 3SKMA 2BY3A 3MRIB 4WCYL 4Y4FD 5BVJB 3ARWA 2YPVL 3DETD 5EUOE 3U0PA 4U1SA 4K8RH 2ICEA 4F58H 4OLYL 5HHMA 1QBLH 4P9HH 2B2XH 1KJ2B 1VGEL 2EH7L 3CDYA 5B3NA 3BZ4A 4H1LA 2DM3A 3GM0A 4E9LA 4R4BB 3L5WB 1UYWH 2FIRT 1UACL 2VZSA 3KGRA 4JFDD 1RHFA 5EUOF 4JLRB 3TBWB 3ZTJH 5BXFA 5L6YL 3RGVD 5GHWH 2LV4A 2NNAB 1NLBL 4P2OD 5I1AA 2EIDA 4RFNC 4IRJB 1JGDB 3VFSB 4J7RA 1ZOXA 2MPAL 5FKAA 5GGUA 3W11C 4MJIB 2AK1L 1DUZB 4OAWB 1GOHA 3HNSL 2AXHA 4LEXL 4XHJD 4P3WA 5F88B 3VXME 4XBPA 2OK0H 4K3GA 3NTCL 1FBIL 1N7ML 3L1OL 4DOHB 2NY7L 3LEXA 3I6GA 1XH3A 4YPGB 4LVEA 3L3GB 2AJVH 1ZE3C 3RVWD 1BJ8A 1NLDL 3EOBB 4HKBA 3RI5F 4QXGL 4Q9RH 1RJCA 3K4DA 3FQUB 4M62L 3HG1D 3D39E 5K9JL 3SDAA 4BUHA 4CADB 2AEWA 1A5FH 5HXMA 5CHNB 4X6DA 2Y7QB 2HTKC 4M9PA 3FT2A 4P5KB 3AROA 4G6MH 3OKNA 3AMKA 3MQIA 2N1KA 2IEPA 1T3FA 4HPYH 2HT3C 3BKCH 2J88H 4LPWA 2H9GB 2AERT 4OD1H 1QBAA 3ARFB 3ET9F 3QIBB 1P53A 4H1LB 3U9UB 3SE4A 2FX8H 5C0IB 2OZ4H 2VDOH 3V0WL 4MDJA 1TCRB 3U9PH 4MA7L 1QEWB 3TBSB 1Y18A 4JRXB 4J3XA 3FOMB 4NQEE 4J23A 4NBYB 3SCMD 4PRPB 5J7CC 3M8OL 4X5XB 1MJ7H 1CICB 1J0JA 5DVKA 1U58B 3Q6FB 2VXUH 5JOFA 1YC7A 5FDWB 3S6CA 3SDAC 3ULVE 5DRXA 1EEUA 3EYFB 2BNRB 3GMMB 3K2UH 1OW0A 1ZLSH 3EYVB 5ICYB 2FJFB 2P5WD 2VITB 1JWSB 4KUCF 4JZOB 3I6GB 4FQ2H 4JKKA 2EDWA 3ULVF 3P73A 5ACLA 1S5HB 4QHUB 1QFOA 1MH5A 3SE4C 5FAAA 2NW2B 2QADC 5E6ID 4MHHI 4HV8B 4XXDA 3T65B 1FCGA 2H6PA 2I07B 2X4QB 4EQ3A 1IARB 5LXGH 3PIQB 3C6LD 1YNTB 3L6FA 4PJAB 4LASL 4JPVL 2NXYB 3FT2B 1J8HA 5EG6C 3KS0H 2ERJB 4QHLB 3MRNB 3TA3A 1A02N 4UUJA 1A7QH 5CEZD 3MRGA 5EZJB 5FKPB 4C54A 2EH8L 3QO0A 1LO4H 2VL4A 1B2WL 2G2RB 2WIMA 1QPXA 2DM4A 5TFSH 5CCKH 4FP8L 1I85A 2B1AH 1T2JA 4MX7A 1OW0C 4L3ED 3VA2C 3MJ9L 3MV7E 1G7HB 1I8IB 1A4KB 1FN4A 4JRYA 3WS6A 4JM2B 4PJBA 4O51A 2Y5TB 4PP1C 3UYOD 4IIQC 4GRMA 4G9FE 4B41A 1M4KA 3EDKA 1SBSL 3ZKMD 5DEGB 2H26A 4YXKL 5J56B 1LP9E 2EO1A 4E0RA 4PREB 1B6UA 3RWHA 5DHYB 2WANA 5KSAD 1FGNL 1YUHA 2OR8A 5JW3H 3BZEB 1R5VA 3H9SE 1CG9A 1FC2D 2AXFA 4LOUC 4K7FA 1NMAH 1V7ML 3R06B 1BHGA 1HN1A 3FO9A 2VWEC 1T0MB 1HH9B 1DSFH 5L0QB 1Q9LA 3TA3C 1AHWC 1LP9F 1T1XB 3HAEB 2WWKO 1TCMA 4F57H 5C0CE 4PJIE 5EC2B 3DSFH 3WNPA 5HHOD 4Z6AT 2EDYA 4OGAC 4RA3A 3ZT6A 1VFUA 1I85C 4YDLC 4FTVD 1NGZA 2D7PA 2R0LH 2VLKE 4XNUL 4YEEA 3QB7C 3MNWB 4PJIF 1GXEA 3WS6C 3O6FD 5C07D 4G3YH 4DN3L 3KLDA 1IEHA 1WBYA 1RZFL 2GCYB 4F7MA 3ERYA 3MACH 4AEHH 4HUWA 5E8DH 4Y8DC 2GITB 1T21A 3FKUS 1F58H 4ENED 2XFXA 5F1SA 5CWSA 4NM4L 4PV9B 3TIEA 3GSUA 1XZ0A 3VRJB 2GHWB 3U4AA 4N8VA 4CVZB 2ZUXA 1HHJB 3RA7L 3UTOA 1AGCA 1A9BA 2YC1A 3HE7A 3AS0A 1EPFA 4WUUE 5C9JA 4HWZA 3U4EB 3W0WD 4ZFFA 5D96B 1A3RL 4QXWA 4QTIH 4DZBA 4U7MA 2AQ2A 3SY0B 1ZLWH 1W0YT 5GRJL 1F4WL 4GLRH 3C60D 1W0WA 9CGTA 3P4MA 3JTSB 2VIRB 1MCBA 3FMGL 4R96A 3O9WA 1PGRB 2ZUQB 4HFWA 1YEKH 3MV11 4P9ML 3DVFA 3BQUA 2OLDA 5TH2A 5I75B 1JWMB 3JUZA 3P4OA 3FTGA 3BHBB 1JHTA 3HUJB 3MV9B 4GUPA 3H9HA 1JZ3A 3RFZC 3BZDA 5ISZE 4ZFOL 1S7VA 3G5XA 1VPOH 2QSCH 1FAKT 3BE1L 3WFEL 5HGHA 1BD2A 1RIHH 3QDJB 4XNMA 3WS3A 4I9WE 1EMTH 3W5NA 3HE7C 1WFNA 1CGSH 1CDUA 1NGZB 1QVOA 3IKCA 1FNGA 1BVKA 3IT8D 3QH3A 2L7JA 1U8PA 1OCWH 4HJ0C 2H1PL 5LJYH 3QDHA 3MLRH 4NN7C 2NY4C 3ARSA 3AB0C 1P2CA 3GBML 1W72H 3O9WC 4WU7B 4EVNB 4XC1L 4X80L 3VMOA 3DUSA 2WP3O 1I1AD 3DO7B 1WC7A 3BQUC 3GSUB 5F7UA 1CD1A 3KYKH 1TETL 1ORQA 2OI9B 3CFCH 1FQ9C 1VSCA 3PWJA 4ZFFB 4U1NB 4UQ3B 3LRSB 3KXFD 4Z7NE 1OLZA 3EYUL 4OLXH 2WNGA 2NZIA 5KSUA 4ZOCA 4JGJA 4AQ1B 1DCLA 1SJXA 4NQDD 1MY7A 4MNQE 3BGMB 4WW1A 1OAUH 1RIUH 3ZL4L 2YD5A 3GMNB 4Z7NF 4Z9KB 1T5XB 4NZUH 1FZJA 4HXAH 1ZKAA 3SKOA 4LIQE 4PGJA 1D6EB 5DJXA 4DTGH 3GJFK 4C83B 4DKFH 4CVXA 5J3HC 3P0VL 4TSAL 3MOQA 4NO0B 5ADOH 2CKNA 5EU4A 3V95A 3N50A 3RWDA 4QT5B 1KCSL 4WI3A 4KY1H 2C26A 3IKCB 1HHGA 2HLAA 4HUKB 3LRHA 4HZAA 5H37G 3V6BR 2R69H 1S7RB 1OSZB 2XRAH 4MQXD 4P2RE 5IV2A 3BIBX 4ZS6D 3IJHB 4I3RL 5INDB 1CFQB 3QG6A 2HLFC 4BZ1L 4KDTC 5D1XC 3RUGA 4L4TA 1FL5B 4ZOEA 5C0EB 1FO0A 4Y5YB 1ZLUK 2BSTA 1WCQA 4L3AA 3QNXA 3L5IA 5DK0B 1KJVA 1LDPH 3J8F7 4D9RE 2AI0L 2V5RA 3UYRH 4I18B 5C6TL 1HSBB 3FAXA 5H35A 2DQFA 4NQCE 4HS8L 2WIIB 3LIZL 1E4KA 3CMGA 4Z78B 2QR0A 2DLEA 2XQBL 4PD4K 4CW1A 4YHOH 4X4XB 4G9DA 1QSFE 3OR7A 1JNHA 3U7YH 4AH2A 4ZMAT 5C0FA 3V4UH 3TF7A 1KPVA 1XGTA 5HGAA 3UPRA 4HJGB 4G6JH 1KN4H 2NY2B 2XKSA 3WMSA 3A6CH 2YPLB 3WDHA 3ARED 3WSQH 5FXCH 3O3UN 3FL7A 4YGVA 5JXAL 5TDPB 3EO0A 3FZUC 4ZXBA 2FJGA 5IVZA 2VABB 4TULL 5J0BA 3WIFB 5E8OA 5F21B 3MZTA 4DGIL 1XF2B 1NKOA 3KYOB 5C1MB 4XNXH 4RX4D 5IB2A 4MAUL 4ZNCD 1E4KC 3AAZB 3CFKA 2R0KL 1VERA 2A6JA 1KG0A 4W4OA 1XR9A 2P7TB 5ACMA 1FP5A 4BKLA 4Z95H 3H3KA 1KCVL 5E8NA 1JZ8A 2PW1A 5C09A 1KXTB 1XT5A 2X9YA 3C08H 3L3KB 2A6KA 1AXTL 2GEEA 1H0DB 4DKEH 5D9SB 3QHZL 4KI5E 3U1SL 3DWTA 1C12B 5GGQH 4WFGD 1U42A 3VG0L 1OGTA 3GIVA 4BQCA 2A38A 3DVNA 3FB6A 4GT7A 4ZXBC 4HUUA 4XCEB 4LMQE 4NDMB 3LS4H 4W4NA 2X4OB 4TUKH 4KI5F 3V5HA 5JHDD 4Z77B 3HKFA 4NUJA 5SWSE 5DQ9A 3VXOB 4HSQA 5HGAB 1JTOA 5DD1L 5I76B 3RNKA 1MLCB 4W4OC 2XNAB 3SOBL 2SEBA 3NCEB 4FFVD 1MF2H 4Z0XB 5CILH 4ZQKB 3MLVH 4YGVB 1EA9C 2WUBL 2PXYC 1UH3A 3C2SA 2ADGB 4O9HL 2P44B 5IHZA 5B39G 2GT9B 1KBGL 1G7PA 4RRPG 5BRZA 2C1PB 2VUYA 5JDJA 3GMOB 1I1FA 2OL3L 4WEUD 4M5ZL 2BVOA 3DMMD 3BO8A 2W38A 1RHHA 4BK4A 3IDIB 1MREL 4LRNH 5EU6A 1PKOA 2NZ9D 1ZANH 4LFHG 1LEIB 1NAMA 4K3DL 1SJVA 4U6XB 1JV5A 3NCMA 1CR9L 3MGOA 1FL6B 2B4CC 1UWGH 4YWGL 3W82A 4YBHA 5DK3A 4Z7WB 4UINH 1U8JB 3D9AH 3SE3C 1ZHBA 4NM8H 2NLJB 4OF3A 5J1AB 4N0FB 3Q1SH 4WFHD 4C56D 5DGRA 2UWEE 4I0PC 1Y6KR 2D0FA 3V5HB 4N5UA 2XWTB 1ZT7B 2NTFA 1H9VA 1FYTE 5E99L 3VXRE 5B3JE 1HHKA 2DLIA 4HUXA 4HAGA 4NC1C 4WI9A 4V3DB 5T1LD 1RJZA 2OS7A 3OB0K 3RNKB 5A3IC 1Q72L 5F1NB 2UWEF 5DRNA 1YDPB 1RULL 4NHCH 3DHMA 1CDHA 4P3DB 3S34H 1U8HB 4JDZA 4KVNH 4OUOA 2AJYL 2CDGB 5JDSA 2VAJA 5B3JF 4HK0A 2FGWL 4X0KA 1J0YA 1UH4A 4XBGB 15C8H 4YX2H 3AXLA 1II4E 4MB4A 4XGZA 3AU1A 3W9DB 1CL7I 4HGMA 3H0TB 1A6TA 2XPGB 3MRDA 1UB5B 4RMTA 3CVIL 2E7LE 3H42H 4M5YH 3VXSE 2ARJQ 4GMTL 4RNRA 2JJTA 1TVHB 3O4LE 4LLWA 1VACB 4MA3A 2WWKT 5IQ7H 3BPNC 4DGYH 4LLQB 4MB5A 4PJDE 4UILH 4J12A 4HLZH 2XZAL 5CINH 3M45A 5F3HB 2A9NL 3L5HA 2VDPL 3MLTB 4NNPL 1YMMA 4LVHB 4LPUA 3FO0L 1YNKH 3UZVB 4X6EA 4PJDF 4Y4KB 1KIPA 3RX7A 3DXAE 3CVHH 2H2PD 3UJJH 1PFCA 3RJDA 2ZOLA 3QXVA 1DVFA 1TJIL 3RZCC 1BFVH 2E6PA 3HZKB 5IWLA 4V1DA 5FUZH 4J8RB 3HRZB 1NUNB 3VFVA 43CAB 5MEND 4KK5C 4OGXH 2NXZC 4JHAH 4PRIB 1KXQE 4G6KH 3TWCH 5I1DA 3RTQA 4WWKA 3ALXA 2GIYA 3HNTH 1T03L 1F6AB 3QDMD 1UA6L 5GSRB 2F5AH 5DJ8B 1EEYA 5JW4R 2PYED 4JY6A 4U6HA 4F7CB 1W0VA 4TVPD 3ULUL 1SVCP 3GJFB 3P30L 3PNWA 4Q58C 4KKBC 1IAOA 3UTTD 3LEVH 1KLUB 2R2HA 1JPTL 2P8MB 1L7IH 5BZWA 4L8BB 4MD0A 3PL6A 1T6VN 5D8JH 3X17A 5CBEA 1AO7B 1A4JA 3T1FB 4UNVA 4AM0A 4Y1AB 2QQLL 5DR5H 1G6RA 2BVQB 3DVGA 4V2CB 1CFNB 3GSWA 1O7SA 3R8QA 3LV3B 5IWLC 1OQXA 5D1QA 1CDBA 3CSBA 1A7BA 4UV7L 3SN6N 3ZTNL 4XI5C 3QPQD 4NOBA 4QRUB 4XH2B 4XWOD 4ZD3L 2RJMA 2FX9L 4WWKC 3X3GL 4OTXL 2XACC 1IC4H 1YMMB 2FYYB 1KCRH 5D1ZA 3CZFA 1EEQA 2XQYG 4PLJD 4QRRA 1GZQB 3TYGL 4Q2ZA 2D0GA 3O11B 4R4FH 1DVFB 4LSVH 4L29B 1D5XB 1I8LA 5E5UB 3MO1A 1JGUL 3O3DB 3HC4L 2WP3T 2P5EB 4HD9A 4NRYA 4BK5A 1I3UA 2EICA 4RGOH 2PYFA 2VR4A 3RTQB 3SJVD 4JFEE 3RGHA 3UJTH 4OLWL 1FL3A 4OFKA 4E41B 3TJHA 3F12B 3WFDH 1QRNB 4UV4L 5K59F 1S9WB 4LLDA 3DPBA 5D1QC 2VLJD 3VWJB 1OAYH 2DQJH 4HXBL 3FB8A 1TPXC 5KVFL 5JW5A 5DHVH 3UAJC 2DYPB 1G7JA 1RJYA 4OCRH 4LVNB 5D1ZC 3CD4A 5C0BB 1AGDB 1F3RB 4HPOH 2C4FT 3FN0H 3QJHB 3MJ8A 1TJGH 3FHQA 5KW9H 4YHNA 2BOCB 3WD5L 2LU7A 3RDTA 1P5VA 1JHKL 4GS7B 1MCRA 1BAFH 1GC1C 1I8LC 5DFWH 3QCVH 2A74B 1Q1JL 4I2XB 1UFUA 4JFXB 2VLRE 3EDDA 3WIHL 1DUYB 3QUMA 4IRSD 4RMQA 1BFOB 5DMGD 3VMNA 2BCKB 1YEIL 1T2QL 3FO2B 3T4AB 1U3HA 4IDLA 4QF1B 2Q6WB 2O5ZH 4QRPA 5D5MA 3V6FB 5J4MA 3QAZB 2CO6B 4HIIA 4HX1B 3ARDB 1S7WB 3MRHA 2R56H 1F13A 2E8ZA 4I1NB 5I1GL 3F58H 1YQ2A 3KPMB 1T2XA 4WFEE 2XQYK 2E9BA 5HYEA 3BSZL 2QQNH 3I75B 5HY9A 3NA4A 3SQBA 3PGDB 5FYLE 1A2YB 3VGAB 1MI5D 4WENB 4J3OC 2J8UE 3OF6A 5CZVH 1L9MA 1N6QL 2XN9E 4OQTL 4UIMB 1NL0L 1VFAA 2ZJSH 3RVUC 3SQOL 1FIGL 4N0YL 3V4VL 2FWOA 1B4JH 2J8UF 2PO6B 4F15B 3T3ME 1U3HC 1R3IL 3NFPB 1VEMA 2MSPA 1XMWA 1GHFH 4JM4H 2X42A 2PF6A 4GRLD 1S9XA 5B39A 5INCB 1INQB 4F7TA 5IMKA 3RDTB 1GIGL 2C4XA 3P11H 5F9OH 3KS0J 3T3MF 3OKDA 5EOCL 4HW6A 5MERA 5KAQG 2X4NA 5HYJA 1U8OB 3VCLA 4NO3A 1JGEA 2XXCB 3TCLA 3MGAA 1ZHLA 1WZ1L 5MEOA 4WTZA 1SEBA 1X5LA 1XF5A 1FFRA 1NMBL 1JFQH 3MLWL 3ZKNC 3UTQA 3CFDA 3LH2L 2IPKB 2J5LB 3CIQA 3OZ9H 1TENA 3BGFB 2WBJB 4NQTA 3FQTA 1A7NH 5ID0B 8FABB 5DJCA 5FGCB 4HWNA 3B9AA 3HPJA 5AYQA 2X41A 4BFBD 3TVMA 4U1MA 3HE6B 1A6VL 4HHAA 4WJ5A 3Q48A 2N7BA 2RAMA 3FRPA 4UZGA 4F33A 1FGVH 1T7ZA 3WV0A 1AE6L 1WWWX 3QQ4B 1TJHL 4RMVA 4WI2A 4X7EC 1KENL 4X8JA 2JCCB 3QCUL 1JZ2A 2IAMA 3QDGA 2UUDH 5SV4A 1QLFA 2CPCA 3BKYH 1KFAL 2G60L 5DO2D 4AIZA 3FO1A 1SBBA 1EFXA 2R0ZH 3HMXH 1FLRL 4W81A 1MJ8L 3MRRA 4JE4B 3RIFF 3KYAA 5IMKB 4ODUB 5DC9B 2WY3A 4ZDHB 3I3EA 3PP3H 1YPZA 3RKDC 3VW3L 1TZGL 1IEBA 2VISA 4ZO6A 4R0LB 4ZS7H 2X4NB 5J57B 4NO3B 5DURD 4CJ1A 4M6ML 3TVMC 1I7UA 4GAYA 5EB9A 1I3RB 1KLGB 1PKQB 5DJZB 4WY7L 5J6GA 5C0AD 1E4WL 4S11A 1ZT4B 5F9WB 3HZYA 2AJXL 4ZFOB 2UZIL 3B9KB 4LSTH 4N0UE 1MRFH 3SO5A 2IAMC 3RWEA 4M1DH 1EJ6A 5A43C 1YEHH 5DRZB 1L0QA 4D9QE 3VFGL 4DJMA 5EULV 3HPJB 3WLBB 1RAMA 1T7XA 4HHAB 1I8KA 5DEFA 5C08A 1GZPA 3DV6A 2JIXD 4U0QB 5ITBH 1ZVYA 1YY8B 5CIPH 4F33B 4Q6IB 1BLNB 3B2VL 1CK0H 2WSKA 4P5TD 1S8DB 5EBWA 2O5XL 4PGEA 1HNGA 3D2UD 3O41B 1K4DA 5ESVA 1SVZA 2DQEH 3KJ4C 4JREC 4KVCL 5F7NC 3LZFL 1VADA 5FO8A 1QA9A 2R4SH 3QRFM 1UJTA 2AJSH 3LKPA 3HI5L 4L3CA 4KAQH 4RFEB 3SDYH 1F90L 4J1UA 3OX8A 3GRWL 4MCYA 4DAGL 2PTUA 3QEHA 3RL2B 5HPOA 4KXZI 4ODHL 2NX5A 1A0QL 5EZLB 3TO4B 4LPYA 3T0AA 2CLVB 4Q97A 4JFZH 1VFBB 1IEBB 3I3DA 1ZXQA 3HMWH 5DQJA 2ICES 2E8YA 3E6FB 3WIIH 1WWBX 4PS4H 2DQGL 1BVZA 1K2DB 1QSED 1NAML 1OARL 2D0HA 3MRKB 3V0VA 4U1HB 3IDJB 5I9QB 5DI8B 4ELME 2GJ6E 5FDYA 5IW3A 1BREA 2N7AA 2CJUH 1G9NH 4E42B 4TNWK 3NBNA 1N64H 4I77L 3RWEB 4JQXA 1DE4B 4IMLA 5E6ZA 5BJTB 5ENWA 4ELMF 1NBVL 2EYSB 4ESKA 2HG5A 3VD4A 3VXNB 2F53A 1D9KA 1FDLH 1ETZA 1F2QA 1EZVX 4IRJD 5IMOB 5EBWB 5ESVB 5DJYA 4OZHB 2P8PA 4MJID 3OQ3B 1QA9B 5ALBH 1QYGL 1PG7H 5IBTH 1FZKA 1ZA6B 3FB7B 5E2WH 3RJQB 1Q9OB 2QV2A 1KELH 1HYRC 5IHUL 5JHLL 3QEHB 1AFVH 3EJJX 1LO0L 4HWEH 2NX5B 1C7TA 5I0DA 4J6RL 2XKNB 3MA7B 1NGYA 1KB5A 4JQXC 1ZSDB 1XIWD 3CFJA 5CSZB 4K71B 3PG2A 5E08H 1NGQH 3NCYS 3NFNA 1M7XA 1DEEB 4YXLH 3VGBA 3MLZL 4JQIL 3MXWH 2HFFA 3EJYD 3IFOA 2YD6A 1AI1H 2DKMA 4DQOH 5EFIA 5CEYA 3IXTA 2R15A 5AWNL 5CBAA 4FQ1H 1B4RA 1KV3A 1XCQA 5HHME 3T0EB 5T1KB 4KROD 3ARFD 5GS0H 3QIBD 2B0SH 4IOFC 3KLSA 1PLGL 1AY1H 1HILB 4M7ZC 4PBWD 3HCVA 3MRJB 4UTBL 1CZ8L 1DR9A 4KC3B 1AQKL 3V79C 2Q8AH 3EOAA 5J11C 2NPLX 3EYSH 3H3PH 4ZAKD 4HBQA 1DJSA 4LEOB 3UC0H 4JRXD 4KTDH 5C0GB 5FB8B 3LQAL 4R7DB 4PRNB 5C7XH 2X44D 4PRPD 1HINH 3SDCB 1G7IB 1CICD 2Z4QB 4D3CH 4HF5H 3MV8A 1KLFA 1MCLA 1OQOA 5HDQL 2P8PB 1U95A 3BYTA 3U0TB 4LKXA 3QDAA 2BVYA 1I1YA 1I3VA 5I8KH 1H8SA 4WI4A 5MHSD 2HFTA 1HKLL 4OD2A 1JE6A 1IM9B 2BNRD 2QHRH 3WL9A 4NNYB 3TN0D 2FR4A 2Q7NA 1M05A 3ARBD 2XG4A 2OYPA 1Y0LA 4U1LA 3AY4C 1A6UH 1EHAA 4GAGH 3QNZA 2FH6A 4MA8H 4OFIA 3GIZH 3NZHH 3K80A 1JJUA 4L8SA 4GMSL 1G6RL 3G5ZB 5IG7B 2ICWJ 3TJEL 4X6DE 1D5BB 4FZEL 5IBUG 5EO9B 1FVEA 1QFHA 4NQED 4ZYKB 5CEZL 4WI7A 4B7IA 3HC3H 2NXYD 4FQCH 2ED7A 4XPFL 2ORBH 4OLVH 1V3MA 3NPSC 3QO1A 4JJ5B 4IRZH 4YHLH 4A6YB 4X6DF 4Y5VB 1P7KB 4WO4B 2RQ8A 4KUCD 4HGKC 4KKAC 4U0RC 1SY6L 3HCVB 3KPRA 2OL3B 2F9BT 2A9ML 4JKPH 1KEGL 2ZCHH 1X5YA 3MC0A 1I9JH 2BX5A 4FXKB 4C55A 3NN8B 2YS4A 1S7SB 1T4KA 3RVTC 1LO2H 1GC1L 1UENA 3TBYA 2R2EA 1HHIA 1YEEH 2BY1A 2DLTA 2JELH 3O2DA 4LRIA 2IADA 1IGFL 4ODTL 4OM1H 4Y19B 4LCUB 1EGJL 1H15B 3WKMH 2LQRA 1GOFA 2V2TA 3TIDA 3MRCA 2V9RA 4I48B 1CWVA 5EU3B 1U95B 2AS5M 1I7RA 4PRAA 1BEYL 3D87B 1A6ZA 5F71A 4L8CA 4NGHH 4IHOA 3GUTA 5T3ZD 3MROB 1RUKH 4QRQA 4RAVA 4BELD 4LCYA 3KPSE 1MQ8A 2ZNWA 4NJ9L 1GGIL 1I7TA 1N2RB 1VGKB 4WHYH 3MBXL 1GGYA 3WNNA 1CLOH 3F5WA 4LSPL 1CQYA 2HKHL 1NCBL 1NSNL 5FOJA 4X99B 5BV7C 2NY0C 4U6VL 3WFCH 5EWIH 2JJWA 4PRHB 5HVGB 1EHLL 1TQCC 5DUBA 1EXUB 1JHLH 4XPBH 1J8HE 1KJ2H 5F6IB 1IGIH 1NFIA 2VWEE 1MAMH 3MV7D 4LRIC 3HS0A 2EDBA 2XA8H 2YK1L 4KTEH 2H3NB 4OLUH 5IJKA 4PJCA 4LPCA 4QHMA 4G9FD 4X7FC 3OR6B 3ILQD 3MGTA 1ZA3B 5DC0A 4GQ9H 4K3EL 1GGCH 3KJ6H 4YBQC 2AV7A 3IU3B 1E4JA 4HC1L 5FK9A 5EORL 3U82B 1JF1A 1FVCA 4JG0H 3DX6A 3H9SD 1OM3H 5CFHA 4JRYE 2DWDA 3QWRA 4PJBE 4HLJA 3PV7A 2Y07H 4TRPH 1X5HA 1JPSL 1HQRA 3QI9C 1ACYH 2OBGA 5BCAA 5GRXG 4NBXB 4LSRH 4QYOA 4PJBF 5LAXA 1C1EL 3P9MB 4JG1L 2VLKD 2A77L 3H7LA 5HI4D 5JPMA 3OGCB 5IJKC 1JN6A 2YA1A 5E24E 1MCCA 5I66A 5E2UL 1CLZL 3K4ZA 1P84K 1PJ9A 6FABL 4JRWA 4JCLA 4DZ8B 2ZUVA 5KVDH 3ES6A 3P0YL 5F9DC 7FABL 2E7BA 4HK3N 4XVTL 2YA0A 5IR1B 4WW2B 5IKCB 3QDJD 5HI5D 1KT2B 3FFDB 4GG8B 2X4RB 4WUUD 5C8JA 1ZGLM 1NGPL 1C16A 4H1LH 4BQ8A 4CN6A 4K94C 2F19L 1X4YA 2L4OA 4LAJH 3EFDH 4P57A 4AYFA 3WUWG 5JQHC 5TQ0H 1JNNH 5B4MC 1IEAB 1J1XL 4NUGL 1T1YA 3CFEA 4JGUA 4JB9L 5ERWB 5JMRA 3BRFA 4NO2B 2FB4L 4S1RL 5JUEL 1IC7L 2BNQB 3PDOA 5EBGA 3DX6B 3H3BC 1NFDA 3UEZA 5TE4H 4N5EA 3LDBC 1G7LB 1P1ZA 4FQLL 1O5DT 4U4BA 5DVMA 1V3KA 4QXUH 1P4LB 5ISZD 3WE6B 2Z31C 2QKIA 1P7QA 1J1PL 5HVHB 3EO9H 1MCOH 4G43A 3ARGA 1DQML 4M03A 4RAUA 2ZG3A 1OAQL 3I50H 4XP9H 1J18A 1MCSA 4GKNB 4I9WD 4J3TA 4UB0L 2R39A 3HNVL 1HYSD 2CKBA 5F1IA 1B0GA 1JYNA 2KZWA 1D5ZA 2CXKA 3I3BA 1UM4H 4BQBA 1MHEA 4MS8D 5F7LB 5IIEA 2CLRB 1IQDA 5E9DA 3VD9A 4GBXC 2WWMC 1FNLA 1WBZA 3K8KA 1BD2E 1BOYA 2XY1A 4TTDD 3DYPA 3BH8A 4ISVB 1BBJA 3OWEA 5DZLA 3T2QA 3O6KL 2ZKHL 4N5EC 1YEDB 1CE6B 4YHZH 5B8CB 2NY6C 1MIEL 2X9XA 1N4XH 3ARGC 5IB1A 5KVEH 3S36X 3SPVA 3L95A 1T04A 4O4YH 1CLYL 3D0LB 4RQQA 5GGTH 5IMLA 1LEGB 4MNQD 4JAMA 5HHXH 3UTSA 1YN7B 4F37F 2X70A 1X5ZA 3MA9L 1DLFL 4JFQB 4YQXH 3T8XA 2X4PB 1ZLVK 3C2AL 5L7XH 2F54B 5IM7A 5DJDA 3MLYH 3JWDC 3MODL 4JO4L 5DVLA 3SE8H 5T3ZH 2IANA 4PP2B 4HKJB 4OZFB 2D9QB 4XNQA 1Z9SA 4HCRL 2ESVB 3EYOB 3HAEH 4K8RC 1P6AB 2FJHA 1GOGA 3MYZA 1CXHA 1YYLH 2NY2D 4P9HC 1F00I 2YPLD 1ZWIB 2DM2A 4LNRA 5D6CB 1U3YA 1NGXB 3ULSB 5DRWA 3AC0A 1B0GB 4ORGA 4P2RD 2GAZB 1QO3B 4D0CA 4G42B 4HMEA 4XNYH 3SKJL 4R2GD 4FXGB 5DQDL 3VFPB 4LLUB 3U7AA 4PPTA 4JPKL 1WBZB 2CGRL 4G80A 1QFWL 1OAZL 3MRBB 2RIKA 3UTZB 1UWEH 2YD1A 5CGYD 4D9RD 1T83C 1T7VA 4ZTPL 2Q7YA 3D18B 2D7OA 1J9CT 3I2CH 1PW3A 5HDBE 1R3KA 4NQCD 1AR1D 5GJTL 5KTEL 4J4PA 4S10A 4MAYA 2H8PB 4S2SA 5TE7L 3IFNL 3HR5B 2OZ4A 3RUGE 5KS9B 5D1XB 4L4TE 4TUOA 3WO3B 4N0CA 5HDBF 2VXVL 1CT8A 3L3OB 5MEPA 1OGAB 3A6BH 2X1QA 4PLOB 2CIIA 3VFOA 4WEMB 4JFYB 4JFFB 3G04B 5DC4B 3MFFA 4PB0L 1EHXA 3RUGF 1G7QA 3X3FH 3BH9A 3GGWB 2VZUA 4XNZB 3U0WH 4RGNC 5J9PA 1D3CA 5LVEA 5GRUL 3IETB 4WV1C 3U79A 5KN5A 4NT6A 3NIDE 3K8LA 4C59B 2VH5H 4O02H 4LCWB 2NY3B 4NRXA 1MHCB 1MLBA 4L4JA 4ONFH 1A1NA 4J4PC 2UYLB 4MAYC 4UT9L 4YDVA 3D0VB 1DLHA 2D31B 3NIDF 4N0CC 4ZUWB 2FEDD 2DIBA 2X10A 2E27L 3PQYE 3W9EA 2FEEI 4G80B 4KI5D 2VL5A 3ZMRA 3RVVC 2EDJA 1E4XH 2YPKB 3GHEL 4QWWC 4L8DB 3T0VA 2D7MA 2XZZA 5IVOA 1ZEAL 1JRHI 2V2XB 4XP5H 5C09E 3W39B 5FIEA 4HIHB 1LGVA 2JB5L 1C5BL 1SYVB 3C6SA 3CU7A 5DD0H 4NWUH 1I3GH 4NYLB 4NQSA 3CFBA 1ZS8B 2YUWA 3STZA 2FBOJ 4FQIH 1JWUB 2FD6H 2DJ4A 3E8UH 5IBUB 3SEPA 1H3VA 1BJ1H 3BP5B 5HHNA 3QFJA 3E3QA 5I2IB 2W59A 2ARWA 3LSOB 3CC5B 1IGML 2HN7A 1NJ9A 3QZWG 3QWQB 3P4LA 4X9GA 4H26A 1FG9C 3QHFL 5E5MA 4JFPB 3STBA 4JR9H 5D2LA 1DQJA 1RVFL 4NRXB 1A6WL 4EN3A 4P23B 1MLBB 5DVOA 4XWGL 4UTAH 4YDVB 3TBTB 2DL9A 2DLHA 5KOMC 3RWGB 5BRZE 1SQ2N 5GGVL 3FQWB 5DJ2A 4MDIA 1E6OL 4GW4A 3TP4A 3OAUL 4NC1E 1B0RA 1A9EB 2GJZA 3RGVA 1IMHC 4PJ5B 1R5IB 4XX1E 4R97C 4P2OA 3V7AE 2D7TH 5EU6E 5ANMB 3WXVL 3E3QC 5L2KB 1LNUA 1QLEL 3QCTH 4HMCA 1HKFA 1J7VR 1A7PL 3UO1L 2FCBA 2FGZA 3L7EB 4OM0L 3DIFA 5D7IB 3BUYA 4HDIB 1MUJB 4NKOA 2DQIL 5E6YA 2VLLB 1F45A 4OSUH 5B38A 3U7WH 3TZVA 5L8KB 2XYCA 1C5DA 4HIJB 3BMVA 2W65A 5I16A 2OTWA 4P5MA 4P99A 3QUKA 1INDH 4HWBH 3ZKXB 4FG6D 4UIKL 1NCTA 1AD9B 1YNLL 1DQLH 1C5CL 2YD3A 3BT2L 5CJXC 1XR8A 4JHWH 2OMBA 2F74B 3BIAX 3HG1A 1WISA 3W5MA 1X6NA 3VWKB 1KCKA 1KN2L 2YZ1A 4M93B 4G8GB 4NHUA 4P2OC 1KJMA 4GKSA 3VXSD 1R5WA 3L3JB 4PRID 4EN3B 3I6LE 3OKOB 4NOFA 1MQKH 1AIFA 4M8VA 4Y4FB 4K23L 4XPHH 3O4LD 4KHTL 2P8LB 3IAQA 2G75B 4FQQB 3V6ZB 2D4FA 2GSGB 4GFTB 1X7QB 4WFFE 4M8QB 1AKJA 1FNFA 1YC8A 5HHVL 4XHJC 5KG9A 1KYOK 4YNYA 4AMKL 1NGWA 4JFDB 3LKRA 4UU9B 3PHQB 5HYQB 3TZVC 5EIIA 3RGVB 1W72A 3C09B 5I8EB 1QHPA 5AD0A 4R90H 1BIIA 2DQUL 1MFDH 4HIEB 4ZFGL 3VGGA 2NW3A 2VXQL 3DXAD 2M1KA 5FHAH 5SWZB 2Z8WC 2F5BH 3HHRB 5GGSB 3BUYB 4IEFB 2DAVA 3TM6A 2A0LC 3V9FA 2HH0L 3DROB 1ZGLP 2HRPL 3HB3C 2P5WA 1MVUA 5LGKA 5IFHH 2VZ3A 1KC5H 3WUWB 5ACZA 5F3BA 4V1DE 3MLXH 3D69A 3C9NB 4LLAA 1FFPA 5E6IA 3IU4H 2ATPB 3O8XC 5GS3A 3GJEA 3RWCA 3C6LA 2P5ED 3O6LL 4PJXF 3IVKA 4K94L 2CDEA 1EAPB 4DW2H 1PVHA 5CGTA 4E41D 2IFGA 1QRND 2C3GA 2C3WA 2QQKL 3KYNA 4NQUA 2GUOA 3VWJD 1B9ZA 2Y36L 1ZGLA 5LWYL 3BWUC 4R6UA 2ADJB 1NGWB 4L3EA 4B0MM 4ODBD 2PCPB 5BW7A 2DYPD 4KK6D 3P4NB 4XB7A 5IEHB 5IP4A 4ZTOL 1WTGT 4WU5A 5DD5H 2HJFA 2XTJB 2IH1A 1BIIB 3SCMB 4XAWL 5BOZG 4PJXB 3BFOA 1XGUB 2J4WL 2K1MA 3D48R 1RURH 3JTTA 5E6IC 4ONHB 2R8SH 4U3CA 3MBED 1QHOA 2X2YA 4YHPA 4FFYL 4Y4HB 4TNVK 3C6LC 5KSAA 1IGTA 1FNSL 4CNIA 1UT9A 2X7LB 4YO0A 4LSSL 1T0NA 3DARA 4PG9B 4M9OA 3NABH 3QXDB 2VDLL 2F8OA 4JFED 2VNCA 4UDTA 5D4QA 4QRRE 4UQ2B 4BSWA 3C5ZB 3FQXA 5DA0B 3QIUB 3NCBB 1MPAL 1OTSC 4RISL 4KJQD 5GGSY 1GPOL 5BW7C 4FTVA 1LD9A 1MRDL 5I18L 2Y5EA 4MA1B 5CS7A 4R26H 3LB6C 1BPVA 2APVA 2HT2C 2ZUYA 3SGEH 5EZOH 1MFBH 1RUQH 3QUZA 1RZIB 5DMYA 5T3XH 2M8XA 3FONB 4PJEA 3ILPB 1URLA 2BK8A 1YEFH 2HT4C 5J8OA 4Z18A 4QTHA 5KSAC 2RCSL 1HCFX 5TE6L 3PGFH 3BKML 4DVRL 2VLRD 2CKBL 3DGGA 2DD8H 1FZOB 4FQXB 1FPTL 5CMAB 2UZYB 4JN2B 2RFXB 4H25A 4PY7A 1OF2A 4U1IB 4Z5RB 2D7QA 2HTLD 3P77A 1ED3B 2VYRE 1HI6A 5F7HA 2ICWA 1N5YL 3DURA 4YXHL 3C60A 1LO3L 4Q7DA 1IAII 1M7IA 2GY7B 4OJFH 4P46B 5A2FA 1S5IL 4XC3H 1DZBA 4K8RL 4ACPA 1IQWH 4F58L 4YHPB 5EO1B 3S4SA 5I1IH 4GQPH 1Y6NR 4BH8B 1J5OL 1AC6A 2AK4B 4H0IA 1DN0A 5L88H 4CMMA 1DTUA 4QRPE 3QUZC 2C1OB 4LHUA 5D5ME 5D70H 5KZCB 4PJ8A 1UVQA 4P4RA 2BC4B 4ENEC 5HHOB 4XP1L 4PR5B 2CIKB 4JEGB 7CGTA 1QFUL 2X09A 4YK4C 1KIUA 5J13B 2C3VA 2B1HL 4M1GH 1RQ5A 12E8L 2FO4B 5D5MF 4LU5H 4UBDD 3DTXA 2WBJD 5FYJE 1SM3L 4H8WH 3GI8L 5C2BH 1U8LA 3O6FB 5C07B 3GJFH 4KGJA 1F4HA 5HHPA 2OM5A 2P48B 1JI1A 1U92B 1BVLB 1EEZB 1VGEH 4KKCC 3KPLA 4Y89A 2FHCA 1FNEB 1MOEA 1B6DA 1AP2B 1Z5LA 5L6YH 4Q9BA 1IAIH 2VZVA 1U8QA 4MYWB 1NLBH 4NKMA 3JBG7 3P9LA 4OCWH 3L7FB 5TPWL 4DVBB 3W0WB 5E00A 4PJ8C 1OF2B 3KXFA 4X4MA 5IEKB 3AVEA 1A5FL 2MPAH 4ZUTB 4ETQB 2AK1H 1OWWA 3FT4B 4X5WB 1Q94A 1A14L 2OP4H 5DA4A 5CP3H 4EI5B 5FO9B 2J88L 5HYJE 1Q0XL 3KVQA 2XWBB 1CDIA 4PY8I 4CVWA 3PWLB 3NTCH 1UB6A 1N7MH 4X7CC 3MYJA 2NY7H 4QEGA 2FX8L 4CMMB 5LCVL 2IQAB 1MHHB 1NLDH 2DDQL 2AGJH 3MV01 3CAFA 3D5OF 1RK1B 4QXGH 2YUZA 4LFHD 4M62H 4QXTB 3LN9A 3DV4B 3TPUA 5K9JH 1SYSA 1K8IA 4G6AC 3B9KD 3DTXB 3WJLA 3NZ8B 1DQQA 1H3PL 3PHOB 5T1MB 3NVQA 4XP6L 4WDIA 5IFJB 4FQJL 4JDVB 4BFIB 3BN9C 5TF1L 5FYKL 4YFEA 3HZMB 4NQVB 3SDXB 3T2NH 4KJWD 5IVNA 2EXWD 1UC6A 1BP3B 3BEWA 2AXGA 5IK3A 3QZWB 3QRGL 3QUYD 1QQDA 2OXHA 4MWFB 4YR6A 3V0WH 3U2SB 5EOTB 1I1AB 3GB7A 1TMCA 5C0DA 3QDGE 5I1CL 2DQTL 3QEQE 5E2TL 3M8OH 5J12C 2DI9A 5HD8D 3QUXC 4ZPVA 1LMKA 4XCNA 3U6RA 4PRDA 4OIIH 1I1CA 3L3HB 3I02A 4MVBD 5C0RL 1U8IB 1S9YB 4JFOA 3F6LA 5IFAH 3VD3A 4YHKH 1YPZE 5H37H 1LQSR 2BSRB 5E2VL 4BFEA 4NQDB 3TO4D 2YUXA 4WWID 4X9BA 1IGYB 3LHPH 4G7YL 5SX5K 3WJLC 1VHPA 3CVHA 1AGFB 3AREA 4OCXL 1I9IL 3BIKA 3T2PA 4D9QD 4DWHA 3BN3B 5K9KA 5IBLD 4ZS6C 1YPZF 3C8DA 3KPNB 5D6DA 1U91A 3WNOA 3DJ9A 1ULVA 5KSBA 3EDEA 4WHDA 3I9GL 3HLAB 4L4VE 4U6YA 2P4AB 2ZSWB 1AQDA 3GSOA 1QLRB 3FRUA 1U8MB 3TPUB 2XZCL 2BY0A 5E8PA 4FQHA 4PLKD 4U2ZA 3PWNA 4RX4A 4PJ9D 4IMKA 5DD6B 4ODSL 4JKLA 3EOTL 3QIWD 3GSRA 2OR7A 4ZFZB 5C08E 1HOCB 4TN9A 3OJMB 2EH8H 3MRLB 4NQXA 3KYMB 4XCYA 2OTUB 4X6CA 3BEWB 4FP8H 4KU1A 4XBEL 4F57L 1MRCL 4U3XA 5EOQH 2ID5A 1EO5A 5JOEA 2IFFH 4MCZB 1HK6A 4ODVH 2J12B 3PP3K 1WZKA 4G8EB 3L3DB 4QY8B 5HI3C 3X12A 5D6DC 3PXJA 1ERNA 3LQMA 5H94B 2EXYD 1UXWA 1S9VB 3V5DA 2R0LL 4K3JH 4YXKH 4JFOB 4PGDB 2BSSB 2EDFA 1KTKE 2COQA 1KNOB 4G3YL 1ZHNA 4KPHL 4EUPG 4XZUA 1Z9MA 1FGNH 3MACL 5E8DL 1MIMH 4IMKC 3X13B 1V7MH 4OZ4B 1OPGL 3AREB 3GMPB 3E2HB 1M71B 1EO8L 4I4WB 2CR3A 1H8OA 4Y2DB 4P4KC 4DGVH 3HZVA 1OD9A 5C0JB 5HVWA 1J05B 4I3GA 4GW5B 3OB0H 3OKEA 3T0ED 5E8PB 3M17B 5T1KD 4DN3H 1H5BB 1RZFH 5GQBA 4TUJA 4AEEA 1A1OA 3DMMA 5TDOA 1TXKA 2F53E 4D0BB 1R0AL 2KKQA 4NM4H 4PYHA 1J0HA 5DHVA 4NKDB 3RWIA 1S78C 1NBZB 4U2YA 2W60A 4PGCA 2L0DA 3RA7H 3SDCD 2QSQA 4EIZC 5IB3A 1R24B 1DEDA 2X4TB 1A3RH 4O2CB 4MLSA 2V9QA 1SJHA 5GRJH 1Q9WA 1OLLA 1CGSL 5I30L 4C56A 2H45A 1RZKL 4G8FA 4LKCA 3FMGH 5JHDB 2NY5H 4P9MH 2IH3B 3C5SA 5CD5D 5T1LA 3B2UD 5DZOA 4RZCB 2OR9H 5MI0B 2LAAA 4FFWD 3IFLL 3DMMC 3SO3B 3RWJA 3U36A 4LLMA 3F7VA 5DJ0B 4Z76B 1T89A 3CFCL 4KMLB 2XWJA 3K0WA 2VZ1A 3BE1H 1NMCC 4OLXL 1KGCD 2K3TA 2DJSA 3OKEB 5JIHA 4CBPA 3ULVL 4RBPK 1TTUA 4ALAL 1RK0A 4HEME 3MUHL 2V7HA 4JVWA 4BJLA 1RIUL 4KHXL 2HVJB 4GAJL 4MD5A 3GBMH 3MRFA 3GKZA 3QNYA 5JORB 4XC1H 4GRWE 5IHBA 1H3GA 3INUH 2JB6B 1CGTA 1TETH 1VFMA 3MV8E 5AG8A 3RPIA 5GIRA 5IB3B 3F7YB 4Y19D 3NH7L 2QEJA 3AS1A 4N0RA 3LKOA 4GRWF 4M3KB 3SDAD 3G6AB 5E8EB 1T89C 4GKOA 4OZIB 4DFIA 4DEPC 4KY1L 4JGMA 4YDJA 4MJ6A 2JF1A 2Z92A 3ZL4H 1BFSA 4PJFB 4NKIL 4ZUSB 5AZ2L 4F7PA 1LVEA 1UQSA 2VXSL 5MENA 2OJEA 5IVXB 3CSYA 2QADD 3LD8C 5GSVB 1IL1A 3RWJB 3P0VH 4TSAH 1X5JA 3G6DL 5DDHA 2F15A 5I8OH 1KOAA 3N85H 3LKSA 3UYRL 3LN5A 1MWAA 2HAZA 3EJZC 4HKXB 2YHGA 2P45B 4GKZB 1JTPA 1BJ1J 1KCSH 5F72S 3UTTA 3VFMA 1JPFB 1WICA 2PTVA 3OXSB 3T4YA 3U7YL 3X11A 5F7WC 3KPRE 4N9OB 3V4UL 3OAYK 4UI2A 3O3EB 5EBLA 1IM3B 4JANA 4G6JL 3EDJA 4WHYG 1MFAL 3A6CL 4BZ1H 1EH9A 1Q9KB 3CSGA 2NY1C 5D7KE 3KPSD 3KPPA 4NPYA 32C2A 4PP1D 2AI0H 3MRMB 5C6TH 1CN4A 4HS8H 3LIZH 3OJDA 3MR9A 3V7MA 3HMXA 3ESUF 2XQBH 5D7LA 1PSKH 3BW9B 3NCCB 5C71A 2R29L 5GGRA 2MHAA 3GZKA 1JF5A 1J8HD 1ITCA 1KCUL 4PJGB 3TA3D 3FFCB 4NCC1 2BVPA 4HQQL 4N1CA 4LAQL 2E7HA 4LSUL 4R7NB 3MREA 1O0VA 3TPKA 2N4IA 4OGAD 1NDGA 2FH8A 3PV6A 5JXAH 3CSYB 2XA3A 2YA2A 4Q9QL 3MZGB 3FN9A 1ZVSA 5LGJB 4ZSOB 3SJVA 1BQLL 4DK6A 3QDMB 3DX9A 4Z7QF 4DGIH 4JRYD 5IGXL 4HS3A 2YEZA 4GW1A 2HYMA 2PYEB 1MWAB 4PJCE 2DL2A 4D9LH 3EFFB 3Q5OA 4D0DB 3LS4L 4MAUH 4TUKL 3VFNA 3QPQC 3BD3A 3UTTB 4XWOC 3VFMB 2R0KH 3T4YB 2QTEA 3NIGE 3ULUD 1U2HA 2Q76B 4ELKB 5HGDB 3E0GA 1KIQB 4PIRF 4PJCF 4WHTA 4A2LA 5CIPA 1XGQA 1KCVH 2X4UB 1KTLB 3HFML 1JPGA 4X6FA 1PYWB 1N8ZB 2CUIA 2HA1A 1XGYH 3QHZH 1IZKA 3NIGF 1I4FA 2BP3A 1CFSA 3BDYL 1NBYA 4FQPA 5DD3L 3D3VB 4PJHA 3MRQB 2Y23A 3BESR 2LU3A 2G5RA 3MR9B 5EUKA 3O45A 3KHQA 4IRSA 5F70A 1TTGA 4YIQB 5C92A 4GG6A 4OKVB 3QEUB 2BXZA 3BXNA 1UM6H 4NN5B 2VB5A 5A16B 1BBDL 3IDGA 2BVPB 3R0NA 2FNBA 4LRNL 5K9OB 2ZSVA 3SOBH 3G5VB 4Y16B 3GMLA 1T20B 5I71C 3OV6A 2WUBH 1T1ZB 4PGBB 4YHML 4HH9B 4O9HH 1ZVSB 4K9EL 1WBXB 2I9LA