1KPVA

High resolution crystal structure of the mhc class i complex h-2kb/sev9
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
274
structure length
274
Chain Sequence
GPHSLRYFVTAVSRPGLGEPRYMEVGYVDDTEFVRFDSDAENPRYEPRARWMEQEGPEYWERETQKAKGNEQSFRVDLRTLLGYYNQSKGGSHTIQVISGCEVGSDGRLLRGYQQYAYDGCDYIALNEDLKTWTAADMAALITKHKWEQAGEAERLRAYLEGTCVEWLRRYLKNGNATLLRTDSPKAHVTHHSRPEDKVTLRCWALGFYPADITLTWQLNGEELIQDMELVETRPAGDGTFQKWASVVVPLGKEQYYTCHVYHQGLPEPLTLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords H-2 class I histocompatibility antigen, K-B alpha chain
publication title High Resolution Crystal Structure of H-2Kb/VSV8
rcsb
source organism Mus musculus
total genus 77
structure length 274
sequence length 274
ec nomenclature
pdb deposition date 2002-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1kpvA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1kpvA01
3CSYA 1FAIL 4IIQC 1BFOB 4HGWB 4TVPH 1UA6L 5BMFH 1ES0A 3CZFA 2D9QB 4L8SA 4FZ8H 1YC8A 4O2CB 1F90H 4GAJL 4PJIE 3O6LL 2ZUTA 5ALBH 1BEYH 3MNWA 4AEHH 1R3LA 5B39A 5LGJB 3QO0B 4XPFL 3VFTA 4NJ9H 2X4UA 1J1OH 1G6RB 1NBZB 3PWLB 4P4KD 1R3HA 2R0LL 2DDQL 4NN7C 1G7MA 4QXUH 1Z0MA 3P0YL 5D2LF 3RL2B 2FD6H 5FGBC 2BCKB 2GHWB 3LKOB 3NCJH 2D31A 2X7LA 2HFTA 3RWFA 5IQ9B 5C0ND 4PJBE 5CSBA 1RZKL 3ZMRA 1JWMA 2P5WB 5TQ2L 3GSQB 5CEZL 3C60A 4Z7NF 2G5BB 4L3AA 4U31A 3VD5A 3C2AL 2DMBA 2NYYD 2E8ZA 4YQXH 3LY6A 4NQEE 4Y4HA 2AXGB 3MJ7A 5DJ2B 4N5EA 2YUZA 5DUBA 1ZT7A 3TESA 3BUYA 4KC3B 5LXGL 3HG1E 3WS6C 3PP3K 5I1CH 2CIIB 5FHBL 2FX8L 3WIFB 5C1MB 4NPYB 3G5ZB 1JGDA 5CS7A 2OS7A 4DZBB 2B8OT 4X8XA 3FO9A 3L9RB 4I0KA 1KPVA 3B83A 1FVDA 3L3KA 5EOQH 4LRIA 3PWVA 4XP6H 1WVZA 3FB8A 4MQXD 3I3EA 43CAB 3MRPA 5JA8B 5KAQF 3IGAA 4KJQD 1T1XB 3MCKA 3OJMB 1F4HA 3ZYZA 3V6OA 3LRGA 3LCYA 3HPLB 2NY2D 4N1EA 3BWAB 3QEQE 1TITA 3CLFL 2WWMC 3VG9C 1OQXA 3HE7B 1ZANH 3IKKA 1A7RH 2G60H 3H9SB 3MCG1 2MQ0A 1T0MB 3OAUH 2AI0H 5T1DH 1K3ZA 1AO7D 4X6FB 4JFFB 1YPZB 1LMKA 2WUBL 1OGAB 3CC5B 1FLTX 2QADD 4U1LB 1GPOH 4I48A 5C0BD 4HCRA 2DQJL 1QBMH 1UJ3A 3LN9A 3U4EB 1CICD 3LPWA 4P9HC 2NY6D 5GPRA 4RGNB 4P4KC 2IH1B 2DQDL 4PP8C 1E27A 4JQIL 3G5VB 4O5LH 1IAKB 1AHWA 2P47B 3DECA 5ETUB 3MODH 2FR4A 3Q2CA 2V5TA 1RMFL 1N5YH 5CFHA 4JCMA 4R97C 4YDKL 1P4BL 3DX8B 3DO7B 2Y7QB 3JV4B 3WDIA 4KGLA 3OG6B 4GXVH 1KCLA 4WU5B 1Q0XL 5C0NC 1NGXA 4XCFH 1IGML 3WXVH 4GW4B 4XCCL 3RVUD 3WD5L 1FGNH 3HUJF 4MDJB 5HY9B 3VRLE 2NYYC 2WINB 4X6DA 1BJ1J 3HC3H 3CDGB 1T1YB 3HAEH 3ZTNL 2HRLA 3TO2A 2SEBA 1IL1B 2PYEB 5EC1B 3FMGL 1VFUA 2A77H 1DQJA 2QQNL 4P3CH 1MHCB 2X4SA 4MAYD 4FQIH 2HVKA 2ICEB 4UQ3A 4F3FB 4LVHB 5E2UL 1CDIA 4B7IA 2HAZA 4FQQA 1OAUL 1A3LL 3O4LA 2IQAA 4J1UA 4YBQD 4PGJA 5BV7H 3ULUL 1EMTH 1IT9H 1BFSA 3KXFB 3IDMA 1D5MA 5L9DL 5F8QC 4XPGL 1ZWIB 3IXTA 4M62H 5DD5H 3MREA 3BESR 2ILLA 1TPXB 4MQXC 4JM4H 4PRID 4KJQC 5CD5D 2NY0B 3FZUD 3E2HA 4S1QL 4WFHE 2JLLA 5CILH 2DQIH 2NY2C 4LU5H 3VI3E 5I1KL 5FYJH 4D9RE 3DROB 3NCYP 5EU4B 3U6RB 5IIEB 4PV8B 5KSUA 1JUFA 1U8PA 1QTYT 3E8UH 4PRBA 2MCPH 3HAEG 3LN4B 3PABB 5FCUL 1C08A 1DQQA 4IRJD 4WW2F 5BXFA 3GHEH 4R4ND 3PNWA 3UJTH 2EO1A 4JO1L 1UB5A 5SWZE 5GJSL 4WJ5B 2WBWB 5MEOA 2GUOB 4U3HA 4LSRL 2RFXB 4ETQB 3DTXA 4F37K 5IJKA 3CVHH 1MCSA 4BQ9A 2QQKH 5CSZA 2QADC 2A6KB 4Z6AT 2R0WL 4XX1G 2CIKB 5I0DA 5EFIA 1T6VN 4NQVB 4TYUA 1YA5A 3QCVL 1Q72H 3MOAH 5FHAL 1RIVH 2WUCH 2WQRA 5EN2A 5C07E 5HYJB 1JPSL 3PHOA 5C0CB 1G7PB 3SDAA 4X5XB 2N7BA 1CICC 3ZYJA 4JKMA 2J88L 2NY6C 3L3HA 3QWOA 1DBAH 5EWIL 4RGOH 5C0GA 2GKIA 3IS0X 5GIRB 3U36B 4U1SB 4MJ5B 5IGXH 3NIFF 2VDNH 1ZGLB 3C5ZB 4OTXH 2NXZD 4PRHB 4WCYH 4X5WA 4L8CA 1QP1A 5EBMA 4HIJA 3RPIB 2QKIA 4XP9H 3W39B 1FAIH 1WFTA 4JZOA 1RZ7L 1UA6H 4YDLC 5SWSE 1F3RB 2JIXB 4NO0B 3RVUC 4QOKA 3KNBA 2ESVE 2ITDA 2E7LC 4UTAL 4PBWD 1DEEB 4U0QB 4S1SL 4EI5A 4GAJH 4CAGA 5DMGD 1RZ8A 3IETA 3GMQA 2XOTA 3O6LH 1Z5LA 4F7CB 1KNOB 1I7UB 5CP7B 4N0FA 3NBNA 3R06B 3HFMH 5MEPB 3ULUF 4XPFH 4MAYC 2HT2D 2VXVL 1U8OB 4QT5A 1FCCA 3ELAT 4P57A 1D5XA 1XFPA 4XTRD 4OZFG 5CHNA 4AIZB 5K9OA 3RDTB 1JRHL 1UM6L 2R0LH 4LVNC 4YBQC 5KAQG 5EUOA 3SDYL 3QXVA 2W0PA 3UEZA 3C2SA 1KT2B 4ONHA 3TC9A 4AZ8A 2AP2A 4PGBA 3P0YH 4U3XA 3QFJB 1A9BB 3VFPA 3V6FB 4CN4A 5F7FA 3RGVD 4P2YA 1QO3B 1ONQB 3LQZA 3U7YL 2DLGA 3T77A 1HSBB 2B1HL 4ZFZB 3QXDA 3K2MC 4EBQL 3FZUC 5CD5C 2BSTA 1RZKH 2NY5C 5HYSB 5TQ2H 5CEZH 2EECA 3C2AH 5GRYA 4U6YA 3HAEA 5FOBA 5KSVB 4RNRB 4GW5B 3OXRB 2HG5A 1X5YA 4Z9KB 1ZAGA 5SX4H 1NDGB 1WBYB 3AB0B 3VFVA 5DSCB 2N56A 1U91A 3MV8B 5LXGH 1T89A 3HRPA 2BY0A 4Y5YC 5KZCD 1LDSA 4IRJC 4S2SB 4X9FA 4R4NC 1NUNB 4OFKA 1K8IA 5FHBH 2FX8H 1TJHL 4E41B 4LCUA 1KB5L 2BNQD 3DVIA 1SM3L 5J13B 1ETZB 4JKWA 3LD8C 1FNEA 1BIIB 3QXAB 3V95A 5F3BA 1A6UL 4Z7VF 3DSFL 1WSST 3QSKB 2R2HB 5ENWB 4X6CA 5HDBE 1OVZA 3JVGA 1A4JA 2VE6B 4XZUA 3GSXA 4HV8B 1C5CL 4O2EB 4MHHG 4P2RB 4L4TE 4LCCC 2OX5A 5T1LA 1WT5C 3CLFH 3MXWL 5ICYA 4U4BA 3IDNB 2V7NA 3GBML 2CLVA 2NXZC 4F8TA 4LLWA 2P8PA 1JPTL 3RBGA 3QQ4B 1BF2A 2NX5B 3RRQA 3C08L 4L8BB 3BP6A 5E9DD 3VFSA 1U8IB 3FTGB 1UH4A 1AC0A 5I30L 4TSAL 5GGUA 3AS3A 5DMGC 2DQJH 1KJ3L 1VADA 1FV1B 2COQA 4ZMAT 3C6SB 3BIBX 4RFNB 1QSEB 3O9WA 2HT2C 4MJ6B 4BZ1L 4XTRC 3I85A 4OJFL 4PJGB 2QR0B 1VERA 2NCMA 2DQDH 4M1GL 5SX5K 4Z5RB 1RJLB 1IM3B 4JQIH 4EXPX 3KJ6L 4KHXL 4YR6A 25C8L 2OK0L 3W81A 3NN8A 4Q6IB 1RMFH 2EXWD 4OIBA 4UAOC 5HHMD 3RGVC 1P4BH 3SO3B 4YDKH 1KEGL 4PTTB 4CN1A 4J8RB 4QHUB 2P48B 4S0TD 4NQCA 1FLRL 1XGTB 4LDLB 1Q0XH 1B0GA 5FFLA 2YD5A 2X4QA 5I73B 1IGMH 5CWSB 4XCCH 3F7PC 4Z7QE 4X4YA 1CFQA 4K8RD 1NCWL 1S78D 1TZHA 3PQYD 1IGIH 4KMLB 3ZTNH 4PPTA 4F7PA 4U0RB 3FMGH 4ZQKA 2PR4L 2ZOKB 2QQNH 4P5TB 3U0TB 5E2UH 5I1GL 3NCMA 4H1LB 4U1NA 2C4XA 5IB3B 1OAUH 1A3LH 5D8JL 5GRWA 3ULUH 4PY7B 1TETL 2PXYB 3FT3A 3B43A 1YNLL 5L9DH 1TTFA 5LJYH 3VD3A 1NGWB 4PJFA 2J1KA 5KVDL 3IJHB 3KPRD 5I76A 3KPOB 5SWQB 1M7DB 1B4RA 4OI9A 4HUNB 1L9NA 2ADIB 3MRLA 1EV2E 3QIUA 2E7CA 4S1QH 4W81A 1BF8A 1CDJA 3WJLA 5DHVH 4PJ8D 5I1KH 3HUJA 2XIDA 4XC3L 4PRAA 4L3EB 3ORJA 7CGTA 4LFHD 1WZKA 3WLBB 5FA4A 3OAZK 5FCUH 1L4IA 4L9LC 3LEVL 5EC2B 4LHUA 3H8NA 4JO1H 2H32A 5I1JL 2KBGA 1FNFA 4XT1C 5GJSH 5T1KD 3WV0A 3DX7A 3QRFM 4LSRH 4OIAA 2FWOB 5J6GA 4JVUA 3NPSB 3GRWA 3EFFB 4KK5C 3VFNA 4FG6D 1YNKL 3PWNB 4KWUA 5DJCA 4YHZL 2R0WH 5HI4D 1ZVSB 1MRCL 4PTUB 1J0KA 3MGAA 4CMHB 1RZGA 3ZLQC 3QCVH 3UTQA 5FHAH 3BZEA 1ZHNA 1JPFA 2JELL 2VLKD 1JPSH 4ZODA 1WBXA 1NCDL 2PO6B 4OCWL 4IOIA 3RVTD 5EZOL 5D7KE 2BVYA 3I02A 2J88H 4MNQE 4OLVL 1Y0LA 5EWIH 5C09A 1GZQA 5HYFA 4D0DA 3DXAE 3KJ4C 3FQUA 1RUML 1KN4L 1R3JA 3QI9B 2LU7A 4GAYA 1GHFH 1D6VL 2UYLB 2EXWC 2Q7NA 2UWEF 2RR3A 3H9HB 2PNDA 1DQDL 4XPHL 4F7EB 5DLML 1NAMA 1FN4B 1R24B 1N26A 3I75A 1A6AB 5HSFA 1MF2L 3V0WH 3L6FB 3ARDA 1T04B 4HJGB 1H3VA 4JQVA 4YDVB 4R4BB 1GIGL 4UTAH 4K8RC 1RULL 3X11B 4S1SH 1S78C 4Y89A 4FXGA 5IVZB 3RUGE 2W0FA 1RURL 1XGQB 4YLQT 4HWNA 2FLRT 3U0PB 1GOFA 2NY1B 5SX4I 3PIQA 2VXVH 3MFFA 5F88A 5E1AB 1VFBB 3B4NA 1YJDL 1OP9A 3MV9D 1EHNA 5BW7C 2KKQA 1JRHH 3LKRB 3EKCA 1UM6H 1GH7A 3UTOA 5IB2A 4UI2A 1JHLL 1VB9A 4GBXA 4MZ3A 3SDYH 4NNXA 4YDJA 2YMXL 5MI0C 3HNVL 2O26U 2JCCF 1MOEA 3RTQB 1T2XA 4JFHD 3ZO0A 1U3HA 1INQB 4Y19B 3U7YH 2XTJD 1CZ8L 4LKXA 2B1HH 1KPRB 1TVBB 1CDHA 3EDFA 4EBQH 1YEHL 4XNQA 3C5JA 4GRLD 4U1KA 1LO5B 3K7UA 5F9WB 3LPFA 1GGUA 3STBA 4ZPVB 2GFBB 3ULVD 2P43B 4PJ8C 3RWEA 5BS0E 4ZUSB 1S7VB 5MHSE 5K9QG 5D93B 4PJEF 1FNGA 4POZD 2DB8A 1I1AA 3RWDB 5HGHB 1K5NA 4QHNB 4XNMA 4PB0L 1NBQA 3VD4A 2AJVH 1HXYB 1E28B 1TJHH 3MLTB 3T0BA 1KB5H 1SM3H 1YN7B 4P2OB 1S7XA 3QB7C 1LP9F 4JHAL 5H35B 1IC5L 4AMKL 4W4NA 2Y6SD 4LSTL 3KR3L 4ZFFA 5D5MB 3V5DA 4FG6C 2V9TA 1CGSL 2FX7L 1A6UH 3CFEB 3IFPB 3DSFH 5HI4C 3U79A 3NH7L 1HILB 3C6LB 4ERSL 2V2XB 4G8EB 3GMNA 3RVTC 1C5CH 3W0WA 5E9DE 5DHVA 3VXSA 2DLEA 5F1IA 3MXWH 5D1QA 3C9NB 5T3ZL 3AM8A 1F00I 1I3RB 2OR9L 5FYLD 3QEHA 3GBMH 4MXQA 4WTWA 4ZUWB 1FNSL 3DIFA 2EYRA 1EEZB 5H2BB 3RKDD 3X17A 3BP5A 4NN5B 1JPTH 4LSUL 2OZ4L 1MY7A 4RRPA 2H45A 1FO0A 5ID1B 1E4WL 5FECA 3C08H 3R0MA 4PJ7B 2DLHA 5KN5B 4LSDA 2X6MA 5I30H 4TSAH 4RAVB 1JI2A 5DJAA 4IIQB 1KJ3H 1KTKE 5LGJA 2ADFL 3QO0A 3BW9A 5HGBB 4N0CA 3TWCL 3VWKD 1G6RA 1BQLL 1NBZA 2X9XA 4BZ1H 3PWLA 1BGXL 4OJFH 4O51B 1MHEA 4M1GH 1JK8A 2WIMA 4RMWA 1TCMA 4F7TA 2EIZB 3KJ6H 4KHXH 3RL2A 25C8H 2OK0H 1EK3A 2Q76B 2NTFA 3ZT6A 2BCKA 3LKOA 1Q9LA 1KEGH 1MCWM 3S3PA 1OSZB 2XTJC 4NN7B 4ZOCA 1A22B 3T2OA 1FAKT 1FLRH 5IMKA 2GTWA 2P5WA 4JN2B 4GRLC 3VXNA 4I5BB 4WDIB 2DD8L 3PV7A 1NCWH 2BVQB 5DJ2A 4MD4B 2BOCB 3SPVB 3ULVC 5HDQL 1ADQL 4JPWL 1J05B 3KPPB 1T4KB 4KZEL 2ARJB 1RZJC 3NFNB 2PR4H 4POZC 4OF0A 3CFDB 2EE9A 1BX2B 5F6HJ 1BD2A 2EO9A 3RX5A 2L0DA 5FA3B 5ISZB 4JFDA 2AABL 3JWDC 4V2BA 5I1GH 3MRBB 2C3GA 3WIFA 5D8JH 1TETH 3HZMB 1MCHA 3DUHA 1PSKL 5FGCB 4DZBA 3GM8A 2J12B 5E6ID 5IBUG 2PF6A 1N7ML 1YNLH 2Y6SC 4OD3L 5GSVA 3K1KC 2DOCA 5KVDH 1WIUA 1MCOL 4LLYA 5J3HD 4QTHA 3BRGC 1N3NB 5E8EB 4JKPL 3JUZA 3O0RL 3SOBL 4GG6F 3IKCB 1V3MA 2BHYA 2NQCA 1BJ8A 2J6EL 4HWBA 3BWAA 2Z35B 3ALWA 4FNLL 4ODHL 3PWPD 2Y9RT 1RJZB 5I8EA 3R1GL 2O61A 4XC3H 1UFUA 2YPLE 4JVPA 5C3TA 2X1QA 3H9SA 1W0WB 2Z93B 4FTVA 5DA0B 2PUQT 1T0MA 2Z91A 4X7CC 1MCFA 3LEVH 5J57B 3RKDC 3HI5L 5I1JH 3N1GC 2Z0BA 2R2EB 3VG9B 1U3ZA 1KB5A 3MACL 3HMWH 5DQ9B 4LKCA 4LLVB 4NOFA 3QDGB 1X5GA 3CC5A 2GJJA 5K59F 4U1LA 1YNKH 3MV01 2GAZB 1CIDA 4HUXB 5ELIA 4YHZH 1MRCH 1HYRC 4NO5B 2Y1VA 1P4LA 5K9QI 1GRWA 3C09C 5BRZA 1WJ3A 2JELH 5DC4B 1KB9J 4F37F 3QUYA 4P9MH 1NCDH 1CD1B 4F9PC 3K8LA 4OCWH 3U4EA 3VWKC 5EZOH 1KPUB 4EXKA 5F89B 3TNNB 2IH1A 1ZLSL 5M95B 5D7LE 4OLVH 2EC9T 3SKUD 3FB5A 1MEXL 1WIPA 3G5VA 5AG9A 5TJWK 5ETUA 3EO1B 1JRHI 4MWFB 5DRWB 5DEFA 1KN4H 4K3GA 3FFCD 4M61A 1D6VH 1QSZA 4LCYB 4PV9B 3OKDA 5IF0A 1DQDH 4XPHH 5DLMH 3JV4A 3CXHJ 2R1YA 4P4KB 5J06A 3SKNB 3HRZB 4XVTL 4WU5A 5I15L 1YYLL 1MF2H 1CR9L 4XAKD 4KUCD 3RY4A 4JRYE 4R97B 1GIGH 1A9EB 3CDGA 1RULH 1T1YA 1FL5B 3F7RA 4I18C 3TCLB 3L5WB 1BBDL 4HMEA 1RURH 1MHCA 5LQBL 3QH3A 2ICEA 3HR5B 4ZFOB 2ITCB 3MNVA 1YJDH 5EA0L 5T3XD 3LVEA 2WP3T 3X12B 3M1BA 2D9CA 3OR6B 3KXFA 4AQOA 1MH5B 1QSFD 4KRPB 4MAUL 1IAOB 5E6IC 5D1XA 4C54A 1ZWIA 3O45B 4P99A 1VGEL 1HZHL 1RI8A 2WWKT 3ZE2F 4FZEL 4Z8FL 4P23D 5I75C 2CDFB 5J3HC 1S7TB 3RQ3A 1CZ8H 5I1DA 3KLAB 1T20B 4YFEA 1H3PL 1VHPA 3ZT7A 1NSNL 4HHAB 1JYVA 3TP4A 1YEHH 3W82A 3PL6A 1IGTA 2C3HA 1DTUA 1PEZA 3NIDE 4WHYH 3VG0L 1SY6L 5EU4A 4G9FA 3U6RA 4BZYA 5KSBF 4ZXBD 5CJ8A 3PABA 1PAMA 4QF1A 3H2WA 4P5MB 4G8GE 4BFBD 4ENED 1BZ9B 1LEIB 2NY2B 3P30L 2APBA 4PB0H 3EW3B 4DW2L 4TUOB 3EJJX 5DR5L 4JHAH 1IC5H 4LSTH 3KR3H 4KDTA 2HN7B 2DTMH 2IANE 4NKOB 4X6BB 1CGSH 2FX7H 4X83A 1AXTL 2D4FA 1JYNA 1AO7B 3O3AB 4BA8A 3NH7H 1A5FL 1NLBL 1G7PA 1IGYB 4ERSH 3DVNB 3WUWG 1X6NA 2QADB 3GI9L 4EI6B 5C0BB 3B5HA 4N8VB 5F71A 3X13B 3WLWD 3KPQB 2AK4D 4WHYG 4PLNC 5T3ZH 1M71A 5LCVL 3BRDA 1EAPB 4K07A 1M1SA 2OR9H 1ZGLA 4JY6B 1CICB 3BN3B 1FNSH 4G80A 5KANI 2NY6B 3W39A 4JFEA 1Q1JL 5GGRA 4M4PA 1BOGA 3GNML 1NCNA 5FUOL 1CQKA 2BVEA 4LSUH 2OZ4H 2DICA 1JWSB 1DEEA 2AERT 4W68A 3DRQB 1E4WH 3PP4L 1HH6B 3UC0L 2GITA 4Q9RL 1T7YA 4F7CA 2YRZA 3JTSB 3SQBA 5HI5D 5CP7A 2ADFH 4YDLB 1A6PA 4PJAA 4Y5XC 3TWCH 3GBLA 3OKEA 2NLJB 1BQLH 1IAIL 4PBXA 4AIZA 4QCIB 3ZZ1A 2KPNA 1BGXH 1P7HL 2VLJA 4M7LT 2H2SD 1KT2A 3REVB 1IEAB 4MZ2A 1A1MB 2I5YL 2EIBA 3GMPA 4ZSOB 5GS1C 1Q9WB 4MAYB 4G59A 1RHHB 1T1WB 2YN5A 4QHKI 4N5UA 2APWA 4PLKD 4LVNB 4P23C 3QO1B 4TSCL 5C3LD 3OKYA 3FHQA 2Y72A 5TGBB 4OAWB 1R0AL 4Y8DC 3C60D 4FXKA 3MRRB 2XZQL 2X4OB 4WIQA 4XXCC 1HK6A 2DD8H 2VLRE 5KSVA 1LNUB 4RNRA 1T3FA 4Y4HD 4GW5A 1D3CA 3OXRA 4QRTA 1Z9OA 5HDQH 1ZS8A 1ADQH 2C1PB 5DSCA 4JPWH 5D4QA 4ZXBC 4KZEH 3MV8A 2YXMA 4PJDA 4S2SA 4ENEC 4JKLA 3FJTA 1OT2A 2AABH 3K74B 1J18A 3T3PE 3VFGL 3BPLC 2GJ6D 1EUTA 5EG6C 1U8LB 4NC2B 1PSKH 4NDMA 1BFTA 2QBWA 3F7VA 2EYTA 2NY3D 2UVEA 4Q2ZB 3TBYB 1AI1L 1TDQA 4Y5YB 1N7MH 2DIBA 4OD3H 1T5WB 4IRJB 1A6TB 4GXUN 1RK0B 4FQ2L 4YX2L 3UZVB 2R2HA 4GMTL 1MCOH 3EYQD 4LGSB 2VE6A 4JKPH 2DQCL 5JNYB 3O0RH 5GS0L 3SOBH 4HV8A 1X9QA 3LD8B 4CNIB 4EQ2A 4O2EA 5JHDE 2VLMD 2IADB 1G0DA 4OKVA 3TJHA 4FNLH 4ODHH 4PFEA 3BMVA 1T5XB 3R1GH 5ERWA 4M5ZL 5E4EC 1MCBA 3WLWC 4RWYL 5DJ6B 3IDNA 5F1OB 2VERN 1P7QB 4D0BA 2XKSA 5JW4N 2HTLD 3OB8A 3SKOA 4LCCB 3CFBB 3HI5H 1HHJB 3VE0B 3O3DB 3MACH 3VGHA 4WFGD 4MMXC 2DKSA 2Q8AL 1EIBA 2NX5A 2DS4A 4L8BA 5FV1L 1U8IA 3FTGA 3QNZB 2BERA 5T5NF 1RU9L 1U8QA 3CVIL 1FV1A 4JKKA 1G7HA 5INCB 1MCKA 5HI5C 4OT1L 3I6LE 1ED3A 3C6SA 3VW3L 1KENL 3DUUA 1KSRA 4UIKL 1G9ML 1HHKA 1FQ9C 2QR0A 1ZLSH 3PDOB 4Z5RA 1RJLA 4BUHA 2H2SC 1MEXH 2AV7A 5CKAA 4HIHA 4DN4L 3SE3A 4AM0B 4DGVL 2FJFA 3TLRA 2X09A 4YEFA 2HJLA 3RWJB 2JE8A 4YFDB 1P5VA 3U9UA 1QLEL 4PTTA 4QHUA 4ODUA 3JWNC 3QNXB 4PLKC 1SHMA 4G9DA 4TVPD 4XVTH 3MCLL 4NRXB 3ES6A 5I15H 1YYLH 4BSWA 5CWSA 1CR9H 1RVFL 1AKJD 1S9XB 3C60C 3RGVB 4KRMB 1XGUB 4Y4HC 1OGTB 4M9OA 5DTFB 4FFEX 1FZJB 5DC0A 2R39A 4PJHE 1BBDH 4TQEL 4U6TA 5CGYD 3WEXA 5LQBH 5DQJB 4P5TA 4OLEA 4U1JB 3U0TA 5HPOA 4JVWA 5EZLA 3O4LD 1CU4L 2CKBL 5EA0H 4PY7A 1MFEL 5L8JB 4XCYA 5F6IC 4MAUH 1FZMA 1LHZA 2NY3C 3OGOE 4KROD 4RAUB 3VGAC 5KZCB 4LRIC 1KG0B 4K7FA 5L2KE 1VGEH 1HZHH 4IMKA 5SWQA 1J11A 4FZEH 4Z8FH 4KGJA 3EYQC 3DV6B 2BNQB 3BX7C 3QUKA 1SEBB 1NSNH 1MWAL 5DVOA 1HOCB 1OT1A 2K1MA 1B6DA 5SX5H 5IFJA 4D2NA 2KH2B 4OZHA 3ARGA 1SY6H 1ZV5A 5GSRB 4L3EA 3WLBA 5CGTA 1F45A 4DVBA 4UT6L 3OF6D 4ODBD 2H2PD 3HPJB 3EOAB 3N50A 4PG9A 1MJ8L 1CDBA 3WSQL 4ORZC 3T8XB 1SJHB 3KYAA 1MCCA 3QJHA 5JHLL 4OI8A 3P30H 4NQDA 1JZ4A 1CGTA 2HTLC 4LF3A 3MRHA 4DW2H 3WIIL 5GZND 1PKQE 2FWOA 5JORB 3ET9F 1QFHA 5DR5H 2VKXA 4L9LB 3EFFA 3MRIB 3PWNA 1HEZB 4CU6A 5I9QB 1EUUA 3VRJA 4PTUA 4QRRD 4KY1L 4Z7UB 3CUPB 4JZJC 1AXTH 1UJ3C 4MA3A 1KELL 1A5FH 1NLBH 2FH8A 1BQUA 1I7ZB 2VTFA 4O2FB 2PO6A 3SDAD 1WAAF 5E9DB 3GI9H 3U7AA 5JIIA 3C8HA 3RPKA 3TYFB 1AHWC 2BNUB 1KCGC 4RX4A 2BXZA 4G42B 3CFKB 3H9HA 4WENB 4M8QB 1R24A 3JSSA 2VXTL 1TNNA 1Q1JH 4JRXE 3D18B 1A6AA 3G6JE 2UUDK 3GNMH 3TBSA 5FUOH 3KJ4B 1LE5B 3JBG7 4QOKD 1INDH 3X11A 5HHMB 4EI5D 1J9CT 1QBLL 5LGHL 1BWWA 3PP4H 4PJIA 2F53E 3UC0H 5IVZA 4Q9RH 4ODTL 4OCSL 1XGQA 5CGYC 3U0PA 1PX4A 4BQCA 1SYVB 1Y6MR 1IAIH 3KYMA 2XQYG 4QGYA 4KTEL 2IALA 4JG1L 5TDPB 3RU8L 4WI8A 1AR2A 2VQUA 3LKRA 1IM9D 3PQYB 4W70A 3ULSB 5IVXB 1C5DB 1HCFX 3E0GA 3UX9B 4ODXB 2DM7A 2I5YH 3UCRA 3RTQA 5E5MA 5HDBF 3MMEB 1YEDA 4KROC 2XZCL 2X44D 3T2NL 1INQA 5EO1B 4WFFD 3ESVF 4TSCH 1KPRA 4PJBA 5FCSH 2EZ0D 1TVBA 5MI0B 2DLTA 3E2HC 1XGRB 4K23L 1AGCB 1R0AH 5F7EL 3NA9L 4O58L 4ZNEA 2XZQH 3BHBA 2BMKB 3JWOL 4NQEA 2EDQA 3IB4A 5FKPB 1RZIA 2APVA 3KPRB 3P4LA 4MD0B 2GFBA 1S7VA 5GGTL 1GZPB 2N7AA 4MJ2A 4QWWD 2HFEB 3DGCR 4NUJA 4UDUB 2W9LA 2H2PC 5C0RL 5FM5O 3RWDA 1YQ2A 5T5NG 1U95A 1HXYA 3VFGH 4MJID 1FBIL 2D3VA 4PJ8B 5GRZA 1YYML 1YN7A 5GZNC 3FT4B 3OX8A 3DVFA 1DBBL 5C0AE 5IJKC 5DXWA 1AI1H 2VISA 4FQ2H 5EBLB 4YX2H 3IFPA 1ZLUH 1G7JB 1NMCB 3EYOA 1HILA 4NC0B 3FRPA 3MSPA 2FJGA 5T1KB 2JJWA 1KN2H 3QZWB 2DQCH 5GS0H 4G8EA 1KYOK 3SDAC 5KVEL 2OTPA 2OQJB 5FYJD 3SE4A 4HXBL 1P84J 1UEYA 4M5ZH 5EBWB 3C9NA 3QDJE 1HHGB 4RWYH 1I3RA 1X7QB 5GRVL 1F4WL 4ZUWA 5KVGH 2DJSA 3O81A 3EJYD 3WYRA 1YEIL 1EEZA 1NBYB 1SMOA 2BFVL 5EU6E 5H2BA 1UH2A 3G04B 4OZGB 3G6DL 1S3KL 4D9QE 5CP3A 3MRFB 2LTQC 3CDYA 3IDIB 5F9OL 2Q8AH 1MRDL 5KN5A 1TCRA 4EI5C 4LCIL 1NJ9B 3ESUF 4IIQA 3CVIH 5A16B 3CXDL 1I9IL 1Q9KB 4OT1H 5SV4A 3VW3H 1A4KB 1KENH 3O9WD 1P9MA 3MROB 2IJ0C 4UIKH 3W2DL 3EYVA 4XCNA 1HHIB 4BSVB 2VLLB 1H5BA 3UXFA 2H1PL 3AXLA 1CWVA 4O51A 3K3QA 1EPFA 2EIZA 3OXSB 4S11A 1KYOJ 4DN4H 3OKLB 5C0DB 3OZ9L 4DGVH 2XG4A 4LSSL 4FFWD 1QLEH 2X9WA 1A3RL 4YHKH 3MV9B 4NQCD 3MCLH 2EZ0C 4I0PA 4I5BA 1EDQA 4QRUB 3PF2A 1GGIL 3VA2C 2EKSB 1EH9A 3MLZL 4WV1C 1HHHB 2BOCA 3SPVA 3GSOA 1F3JB 5ESAB 2XTJB 1J05A 4Y5VA 2ARJA 4TQEH 1CDYA 1WTGT 5JPNA 4QWWC 1T89C 3MJ9A 4GRLB 3VGEA 1EZVX 2XN9E 4TRPL 1S5HB 5E6ZA 4ZYKB 3MRBA 3IAGC 1NDMA 2F5BL 3FQXB 4HPOL 5D70L 3F8UB 1CU4H 1YPZF 2CKBH 5BV7C 4X80L 1OD7A 1MFEH 3HZMA 3TYGL 2FEEL 5F7KC 5B21A 3WS6A 3BEWA 1V05A 2J8UE 1NAKL 3QG6A 3FONA 1N3NA 1SBSL 1C16B 3IKCA 5CEZD 1MWAH 3QIUD 3V6ZB 1UADC 2RCSL 2X70B 2Z35A 3O3BB 1RJZA 2RHEA 1HINL 2DJ4A 3JTTB 1XIWD 4D9LL 4OZIE 5J6HB 1A1OB 5E95B 4UT6H 2DRUA 3QUXA 1MCLA 3QJFB 1MJ8H 2K7QA 3WSQH 4HLJA 3EJYC 3T0EE 5SWZA 4LHUD 5JHLH 2W59A 2R2EA 5KS9F 3RIFF 1E6JL 4BH7B 3MLYL 3WIIH 4LLVA 3QDGA 2YKLL 3T04D 2OYPA 2WY3A 2H9GA 5L7XL 3RUGF 4JM2F 4JPIB 2GAZA 3S5LG 1NFDE 3K2UL 4LBEB 1A0QL 3OG4B 1BQHG 3CMOH 5C07A 3VJ6A 3BPNB 3O6ML 2W65B 1KELH 3CJJA 3D1MC 5HPMA 4YE4L 1CD1A 1QLFA 2DIJA 2HJFA 3O9WC 1UYWL 2BSRA 4W4OA 4OF8A 4R7NB 3D0VA 5F89A 3TNNA 3OKOA 1IAII 2GY7B 1JNHA 2YRPA 3C09B 4FS0A 4MWFA 1MRFL 2AEQL 3WN5A 1KTDB 2JF1A 2A6IA 4S0SD 1T22B 4G8FB 3VWKB 3T3MF 1ZLWK 2Q20A 4FFWC 5HBBA 1AGEB 1AD9B 1TJIL 4BFEA 2VXTH 2UY7A 2EH8L 4GKSB 1VGKB 5SWSA 1U92B 3H9YA 3L5HA 2ESVA 4EN3D 5GRUL 4M02A 4ELME 5FB8A 1CIUA 3D85A 3S36X 1QBLH 5LGHH 3TCLA 2H41A 1MJ7L 1OCWL 4ODTH 2A73B 3FAWA 4OCSH 1FVCB 3V7MA 4ZFOA 4PUBL 2R0KL 3WJJA 4N68A 4KTEH 1ZHKA 4JG1H 3RU8H 3X12A 3L3DB 3OR6A 4I18B 3KYKL 4NNPL 1IAOA 1N2RA 3THML 1NGZA 1WC7B 3RHWK 1SVZA 1WZMA 2XZCH 1U3HD 3VXQB 3T2NH 2CDFA 4XPTL 1S7TA 5IBLD 2WBJA 3UBXG 4Z78B 3KLAA 4MJIE 1T20A 3QDME 4C4KO 1RZKC 1IQDB 4FOMA 1F13A 4K23H 2YBRB 5E6IB 2IBZX 3QIUC 5F7EH 3MRQB 4HS3B 3NA9H 1NCUA 4O58H 4ZUUA 2R56L 3BP7B 3JWOH 1AGDB 5BQ7A 3WJLC 4B0MM 3SGKA 1XIWC 2X4NB 2DQTL 1BECA 2DM3A 5GGTH 4P5MA 2FO1A 1QQDA 4W6YB 3QEUB 5C0RH 1LEIA 1JZ8A 4KVCL 5HHVL 3PWPB 3ULUD 5FYJE 1WLHA 1FBIH 1OF2A 5JW4Q 4TUOA 1DCLA 1YYMH 2VR9A 4Q97A 5ANME 2VITA 3GJEA 1OQOA 1DBBH 5MENE 3FQNB 1L0XA 5D9SA 4X6BA 4LNRB 1VPOL 4H8WL 3E1F1 4TOYL 1JCKA 4FFVD 1VFOA 1TZIA 2BNRE 3S98A 5DF0A 2CQVA 3GIZL 1JN6B 3ZDYF 1IGYA 4HWZB 4PBVC 3CDFA 4FN0A 4K9EL 5KVEH 4L4TA 4BQ8A 3QDHA 4DCQB 1OB1B 3W0WD 1QYGL 3LQAL 3CX5K 5C0BA 3VXSD 1A6ZB 2EH7L 4HXBH 4N8VA 4GRWF 3KPQA 5ECJE 4XAWL 4OCRH 2YD8A 5I17B 1JBJA 1A7QL 1F4WH 2VMFA 4JY6A 1CICA 1YEIH 2BFVH 3DI3B 4N0UE 1CVSC 5E8OA 4WW2C 1X5AA 3G6DH 4U3CA 1S3KH 4YGVA 1W72H 4KMTL 4EN3C 4PLJD 5KOVC 5F9OH 2J3SA 1N6QL 1OSPL 1MRDH 1U2CA 1HH6A 3ROOB 4KDVA 4MB4A 3MRCB 3TIDB 4LCIH 4JG0L 4D94A 1D5IL 5HHOE 4DTGL 3CXDH 5HYQA 1I9IH 2VXQL 3LKQB 2VNCA 3DX9A 1UQSB 4HBCL 1N8ZA 3M8OL 3RA7L 3W2DH 1IJ9A 3O2DA 4XNZC 1K2DB 5DGRA 2H1PH 1AGFB 2KQNA 1IEHA 2WK2A 3MRMA 5TFSL 2VYRE 3I50L 3REVA 1IEAA 4KJYA 4BK5A 2HA1A 2O5ZL 1LE9B 4ZSOA 1Q9WA 4MAYA 1I4FB 3OZ9H 4Y5XB 3WL9B 1VCAA 2NW3B 3CX5J 4P2QE 4EIGB 4LSSH 1U3HC 4H5SB 1A3RH 4FQXA 5IBLC 3BVNB 2DTSA 1QSFB 1R5VA 2ZCKL 3V4PL 4OAWA 3V7AE 1I7RA 5GS1B 3MRRA 2X4OA 4BJLA 4HF5L 3VWJA 1LNUA 1GGIH 1OP5K 1CXLA 5F7YC 3MLZH 12E8L 4R96B 3DI2B 4Z95L 4QRPE 3X14B 5CIPA 4P23B 4JFOB 3ZDZF 1LEKA 5F1KC 2DF3A 2P24B 3TPUE 3FCTB 1BD2D 4TRPH 4JFDD 1FL3B 3B8YA 2F5BH 5D70H 4HPOH 3ULUC 1T7WA 1D9KA 4X80H 3FOLA 1U8LA 3D3VD 3Q3GB 4ZXBB 3TYGH 5L8LB 2GQHA 3WNMA 1DANU 3WNOA 1DFBL 2BSSB 3PXHA 5JW5B 2A6DA 1NAKH 4RGMC 4OKDA 1WBZA 3BPLB 4FFVC 4JDVA 4ONFL 2DI8A 5ITFA 3UTTD 4R6UA 1SBSH 2OJZL 4M6AA 4Z0XB 2MCG1 4OD2B 2RCSH 2IADA 4PJGF 2GSIA 3GB7B 2F8VA 1HINH 1T5XA 5IMMB 2AJUL 2DIAA 3I3BA 3STZA 3VH8B 4D9LH 1WICA 3AREA 3LSOB 1PG7W 4LAQL 5DJ6A 2Q7YA 4FTVD 4NQSB 1NUGA 3QCUL 4LPCA 1P7QA 4UINL 4AEEA 5DUPL 4C56E 2VABA 1KTLA 1JPGB 2NY7L 3CFBA 1G7IB 3UBXI 1HHJA 3P4OB 1WCBA 3VE0A 3O3DA 5E4EB 4I77L 1E6JH 1OOAA 1PKQB 3MLYH 4UQ2B 2AK4B 3W11D 5I1AB 1JNNL 5FUCC 5A2IH 4PLJC 5L7XH 1U8NA 3T0VA 3QNZA 1BLNB 5J7CC 4GAGL 1DBKH 3K2UH 1J88A 1A0QH 3CSYB 3UPRA 1WGOA 1JZ2A 5BRZD 2EDKA 5INCA 2BXYA 4LAJH 3O6MH 3CGTA 3QUYD 4YE4H 3QXUA 4K3JL 4PYHA 1FVEB 1FZKB 1UYWH 3CIQA 1JFMA 3UAJD 4NWTL 1L7TL 1OAYL 2F8OA 3KS0J 4GRMA 3MRDB 1K9TA 5IHZA 3RJDA 3MNWB 5TDNB 2GK0A 1MRFH 2AEQH 5B39B 5DMIL 4NHUB 3VFTB 3RWJA 1N6VA 4E5XA 4FQPA 4GRWH 5HGDA 1H3GA 1PVHA 1C7TA 3WIHL 2VXSL 3G6JB 2EH8H 3NIDF 1W72A 4W6XB 3GHBL 1Z0NA 3ILPB 3KG5A 5GRUH 3RI5K 4OCXL 3WNPA 1XGUA 5ADPL 1CGXA 1OGTA 4JY5L 1EFQA 5I8CA 2D31B 4BFIA 5F96L 1FZJA 1MJ7H 3L3OB 3AROA 3NIFE 3RWFB 2O5XH 5INDA 1JWMB 5DQJA 4U1JA 4PS4L 3C60B 5F7MC 4PUBH 2R0KH 2XRAL 3IVKB 3KXFD 2ENSA 3BZ4B 5DUBB 1BWMA 1ZT7B 4CJ0A 4KKLD 3THMH 3BUYB 2D0HA 5D1XD 4RAUA 1FFNB 3TH3T 3IU4L 2VN4A 1AH1A 4XPTH 1JGDB 4Y8AA 5F6IB 2GJ6B 5DURD 5EORL 1SEBA 1HOCA 3BOVA 1QR4A 2OR8A 2KZWA 2EDYA 1ZHLA 2NY3B 3PL6D 3VGAB 1FVDB 3PWVB 4FQCL 3U2SA 2R56H 2VDPL 3QPXL 3LEYL 1TLKA 4G9FD 5GSRA 3UROR 1I8MA 1S9YA 2DQTH 1BPVA 2X4PB 5DJDB 3VXUE 3O3EA 3HPJA 1U8KA 1N4XL 1I85C 2ADGB 5DEZA 5CJBA 3T8XA 1SJHA 4B50A 3CCHB 4KVCH 5HHVH 1XH3A 1GGBL 3NACL 4J12A 2N1KA 1F3DH 5FYKD 2D7OA 2G75B 4JCLA 1Q9OB 3W11C 4X9HA 3MRIA 3JTCA 4D8PB 4KMQA 2PW2A 4UOJA 1VPOH 4H8WH 3D39D 4TSBH 3L3IA 5JOPE 4XGZA 4TOYH 3CUPA 2K3TA 4LLDB 3H3KA 3U9PL 3EZ8A 4UOW1 1P5UA 3MOBL 3GIZH 3MV7E 5D71L 3QUYC 4W6WB 3CPLA 2I9TA 4K9EH 5FOJA 4JFPB 1Q8MA 4DVRL 1HDMA 5E9DA 3T1WA 1QYGH 3LQAH 3UAJC 5KVFL 2FO4A 2CRMA 2VL5A 3P2TA 4JZJB 2EH7H 1F6FB 1OTTD 1UJ3B 1G1YA 2BNUA 4Z7VE 4XAWH 4G42A 3CFKA 3LRHA 1A7QH 2AJ3A 4M8QA 3UYPA 4LGPB 4U1HA 4JFED 2GCYA 2JJSC 5AAWA 5E70A 3D18A 4UZGA 1LE5A 1AHWB 1DQTA 3DPBA 1NBVL 2FR4B 5D6DC 4R2GD 4PJCF 4KMTH 1GOHA 3MRNA 1N6QH 1TMCA 2DJUA 5HHMA 3KPMA 1OSPH 2DKMA 2OL3A 2PTVA 5DD3L 4JG0H 2R1WB 1X44A 1D5IH 2FBJL 5HYEA 3O8XA 3ZKXC 4DTGH 4HDIA 2GT9B 5L6YL 1NGXB 1GAFL 2VXQH 2MSPA 1WQVT 1AKJB 4HBCH 4PP2B 3M8OH 3RA7H 3IFLL 3WFCL 5TDPA 3SDXB 4X6DB 1ZHBA 3PQYA 4NO3A 3ULSA 5CZKA 3MRKA 4NBXB 1C5DA 2VLJD 3TO2B 5ICXB 1L9MA 3E6FA 3I50H 1DQJB 4ODXA 4TN9A 5I16A 3CU1A 3S37X 4KKLC 2O5ZH 5D5MF 5D1XC 3BQUA 1LGVA 3MMEA 4S10A 1OAXL 2EEDA 2HVKB 2FEEI 2UZXB 3LEXA 4FQQB 5BW7A 1NKOA 3ARXA 3O4LB 4PRDB 4J1UB 4M7JL 5CUSL 4POYA 1FHGA 4LCWE 2ZCKH 3V4PH 5C0EA 4OFIA 4KROB 3M45A 1AQDB 3PL6C 3VFOB 3IXTB 4HF5H 3N9GL 4LSVL 3MREB 4MD0A 12E8H 4Z95H 4MVBD 1IQWL 2LV4A 1GZPA 3UTTE 5HVGB 2HLFD 2FGZA 4X7TA 3E2HB 4UDUA 1FPTL 2BDNL 1YEGL 3UO1L 3KPSE 3UP1A 3FT4A 4Y4FA 5KSUB 3F6LA 4PRPE 3IFNL 4PRBB 3TA3C 3HC4H 1ZGLP 4H0HB 1C08B 1DQQB 4PJ7F 4F57L 1DFBH 5EBLA 1T03L 1FYTD 1G7JA 1EJOL 3RVWD 4ONFH 5SV3A 3ETBF 5MEOB 2MPAL 2ATKB 5T5FL 4NBZB 2R2BA 3QZWA 4Z0BL 2OJZH 3DTXB 5FM4A 4YJZL 1XCQB 3B5TA 5CSZB 5D96C 4KQ3L 2OQJA 4LHJB 5EFIB 4QRRB 2M8XA 5EBWA 2AJUH 1WITA 1OTTC 1P2CA 4HIXL 2A83A 5DMJB 1HHGA 5EOTB 4F8QA 1ERNA 3BKYL 4ORGA 3PHOB 4LAQH 1X7QA 3QCUH 4UINH 3SDAB 4BQ6A 4NGHL 4XNYL 3EBAA 5DUPH 3NPZB 4QRQB 1TTUA 1VACA 5I1LA 3L3HB 3X3FL 2NY7H 2AV1B 1X4YA 4YDIL 4P9HL 5I8KL 1ZVYA 3EFDL 2D7MA 4I77H 4NFCA 5C0GB 3MRFA 4RWHA 4AIOA 4NUGL 2ZCLL 4R2GC 1JNNH 1S5IH 3I6GB 2ZP0T 4L8CB 4X5WB 5DEGB 1NFDB 4U6XA 5EBMB 4HIJB 4GAGH 1KXTB 1NJ9A 2QKIB 4M00A 5A16A 5IM7B 1PY9A 1Q9KA 5IMLA 4P2CG 1A4KA 2DL2A 3BXNB 4PY8I 2LTQB 1MVFA 4QOKB 1K8DB 5CJ5A 4K3JH 3CD4A 4WI7A 3WNLA 4EI5B 4NWTH 1L7TH 1OAYH 3L7EA 2MQ3A 3B5GA 5I1HL 2E3VA 1Z5LB 2YD6A 3IJYA 1XMWA 5T3ZD 3OKLA 1PQZB 4N0FB 5GRJL 1PDKA 5DMIH 4RMRA 1PY4A 1INEL 5ALCL 5CMAA 5CHNB 2APFA 5K9OB 3Q5TA 1OWWA 1IM9B 3WIHH 2VXSH 5EUOB 2IBBA 4ONHB 4LEXL 4X0KA 4YK4C 3GHBH 1YDPA 2YXFA 3H9ZA 2ZUUA 3DV4A 4PYGA 3VFPB 2EKSA 1NKRA 4OCXH 3DHMA 4EZMA 5ADPH 1HHHA 4JY5H 4HXAH 1KJ2A 3T77B 5F96H 4HKXB 3DYMA 4MVBC 1LQSR 3T2PA 2MNUA 3QXDB 4OGAD 3V0AC 2UWEE 9CGTA 2HLFC 4OIIL 2D7TH 4PS4H 2VDKL 4WUUD 4ZYKA 3O6FA 2XRAH 1YJDC 3HAEB 5FOBB 3RKPA 4WV1B 2V2TA 3U82B 1MFAH 2PCPA 1UWEL 4KU1A 3VFVB 2HT4D 3Q5YA 2A1WL 3U0WL 4D3CL 5IB5B 1N6UA 3KPTA 1LILA 3IU4H 4BYHA 3UTSD 1CFTA 1NFIB 1K8IB 5BV7B 2IH3A 4MJIB 3E6HA 3RVWC 2VZOA 2VIRB 4PJ5D 2AJYL 2EDXA 4PJXF 3V6ZA 3WDHA 5C6TL 1FNEB 2DAVA 3HI1A 2IPTL 4BUGA 4FQCH 2VDPH 5FO8B 3ARGD 2ICWA 4LDEB 3QPXH 3LEYH 3JTTA 1DEDA 3UPCA 5A2FA 5D2LB 3SY0B 2PTTA 5J6HA 1AIFB 2PETA 3TF7C 4XZUB 4G8GA 4J3WA 3EOTL 4P3WA 1N4XH 3GSXB 2DQUL 5IOPB 5IBTL 4RBPH 1MIML 1HXMB 4NQDD 5DFVD 1FFRA 4BH7A 1GGBH 3NACH 3LN5B 1V8HA 5ICYB 4CVZA 1QFWL 2V7NB 5EDXA 3P0VL 2CLVB 1X4XA 3SO5A 3FQRB 4PJEE 4LBEA 1DQML 2Z8SA 3GMLA 3U9PH 2W65A 4WFED 2ZWLT 3MOBH 1W2KT 3L1OL 4CUCA 3WS3A 3BP6B 4DVRH 1LP9E 5GGUB 2GEEA 2PTUA 1I9JL 5KVFH 2IMNA 3CMGA 3SDCA 1VADB 2J2ZA 4KV5E 2EYSA 3SE3C 1MI5D 2IG2L 4XVUD 5E2VL 2P8MB 3SO3C 2AQ1A 3MLSL 1AGEA 4YO0B 4XWOD 1CDCA 4DOHE 3VMPA 5I71C 4XI5D 1EA9C 1VGKA 3G08A 5KSAD 5AYQA 3MUHL 1NBVH 5DHYA 4JO4L 3WCYA 2HT3D 4DK3A 1VFAA 5DD3H 2FBJH 2A73A 4NQCB 2ICWI 1JGVL 3D2UA 4OGAC 4ZUVA 2X4QB 1FVCA 5L6YH 2XNAA 4ZS7L 3P9MA 2MOVA 4X4YB 1CFQB 4I1NB 1AGBA 3GSNL 3IFLH 3WFCH 3L3DA 5DWUL 3O11A 4I18A 2LAAA 2ZSWB 2H26A 1AY1L 1WC7A 4AY0A 2HT4C 1IC7L 4R0LA 4APQA 1OAXH 3VXQA 1JMZA 3DVGA 4Z78A 1FSKC 3NABL 1W0YT 1IQDA 4M7JH 3ZT5A 1F4XL 5CUSH 3FT3B 5E6IA 3BIKB 3ABZA 4HS3A 3LV3A 3TPKA 3BP7A 4NQED 5D7IE 3N9GH 1AGDA 4LSVH 5I76B 3ARGC 4PB9L 1B90A 1FYTE 1L6ZA 5BZWA 3BH8A 2Z4QA 1JV5B 3CFIC 1IQWH 1ZLWH 4R26L 1RUQH 3HG1D 5KTEL 3MRLB 3S7GA 2O5YL 4J3UA 5FF6A 1BHGA 3QIUB 5TQ0L 2BDNH 1L8JA 3SEPA 3GJFK 3GM0A 3V6OE 3UO1H 5DFVC 4I2XE 3HUJB 4YHNA 1XIWB 4HUMB 3ALXA 5E8NB 4OCLC 3IFNH 1L7IL 5FA4B 5D7JC 6FABL 4F2MB 4LNRA 5EZIL 4GQPH 4F57H 4F7MA 2HKFL 4LHUB 1T03H 4ODVL 2IC2A 1EJOH 3KDMA 2MPAH 2O93L 1F6AB 1JN6A 5T5FH 4Z0BH 1UZ6F 4IRZL 5ESQA 4A6YH 4DCQA 1OB1A 4GXUM 3K4ZA 4KQ3H 3QEQD 4LLUB 5DJCB 4OFDA 3TV3L 5D2NE 1YY9D 1M05A 4K7PL 1A1NA 1RZGB 3ARVA 1KBGL 3UTQB 4U33A 1JPFB 4L5FL 5K9JL 5GGSB 4EEEA 1EO8H 2LQRA 4XVUC 4NGHH 4XNYH 2RGSA 3QUMA 5IESL 4XWOC 4DFHA 5IQ7L 1FGVH 2C7UA 1Y0LB 4OUOA 4YDIH 5FKAB 4XI5C 3X3FH 5HXMA 1S7WA 4P9HH 5I8KH 2LU4A 3EFDH 4OF3A 2DI7A 3FQUB 5KSAC 1R3JB 1J12A 4NUGH 4GAYB 3VRIA 1X5XA 2HT3C 4F33B 3ROOA 1SQ2N 3MRCA 4Q9CA 3TIDA 5JW4M 1GYAA 4WW2B 4AL8L 2XQBL 3LKQA 5BVJB 1BREA 5EZJA 3MJ8A 1UQSA 4OLUL 5CAYB 4EN3B 3QNYB 2WMPA 1K2DA 1AGFA 4DEPC 4FXGB 5K59E 4MS8D 5I1HH 4XP1L 2IPUG 2J8UF 4OD1L 1J7VR 1LE9A 1J86A 4Y5XA 5GRJH 1RUKH 2R4SL 3RNKA 5J1AB 3MFFB 1INEH 4JLRA 5ALCH 2IFGA 4H5SA 5F88B 4XNZB 3IDYC 3OR7A 3TNMB 3BVNA 5IB2B 1WV7T 1P69B 5DZNA 4NNXB 4I0PD 4YDJB 2R9HD 4KI5E 3P77A 4LEXH 1J0IA 3QIBD 3QQNA 5F72S 4P49A 4XXDA 1T0NB 1JIBA 1U3HB 4R96A 3CX2A 1HKFA 5DHXB 1ZK9A 4PJHA 2X1WL 4LKXB 4WEMB 4PJ5E 3FCTA 1RV6X 4OIIH 4ZD3L 4XXCA 4N0YL 1F6LL 1BVLA 4MLSA 2VDKH 1FL3A 1HE7A 2CUIA 3TVMA 4MNGE 1BP3B 5JIPA 2BVUA 3RWEB 3GMMB 1AR1D 2A1WH 3U0WH 5L2KA 1T2QL 4D3CH 2BSSA 3QQ9D 1TVHA 1K5NB 5JW5A 4JR9L 3BMWA 4XNMB 4X7FC 3OB0K 2BJML 1KC5L 5C8JB 1W8OA 5JUEL 5TF1L 3VCLA 2WP3O 3MQIA 2AJYH 4WFHD 4HUVB 4Z0XA 5C6TH 4M8VA 4ZFFB 2VRAA 2IPTH 3GB7A 1ZE3C 4D9RD 4RGMB 2EDJA 1YY9C 3D48R 2VQTA 3VH8A 2WWKO 2FGWL 4NQSA 3QUXD 4N0RA 3ZE2E 1OWRM 3EOTH 2DQUH 5IBTH 5SWZD 3MGTA 1JPGA 2D7PA 3ROLB 3SKJH 1G7IA 5DHVB 3P4OA 3VXSB 4Z77A 5KJRL 5T33L 1PKQA 5HDOA 1S9VA 1KGCE 4ODSL 5F1IB 2CXGA 2AW2A 1DUZA 1OL0A 5I1AA 3RWHA 5CZXD 1QFWH 3VGBA 3QEHB 2P49B 3P0VH 3EDJA 2E27L 4QGTA 1DQMH 3BP5B 1VSCA 3GSRB 4HLZH 4TNWF 2Y5EA 5C07D 4UUJB 4HC1A 5GS0D 3LKPA 5DK2B 2XKUA 3L1OH 4A6YA 1P9MC 1J1XL 1EO7A 1FO0B 1FVEA 1FZKA 1LO4L 2E6QA 4QXWA 5FECB 1WFUA 2R29L 1H5BC 1L0YA 4OLWL 5EO9B 3HHRB 3MRDA 1I9JH 2EEAA 4K8RL 2OXGA 4M7KL 5DJAB 4MS8C 5TDNA 2YC1B 3BW9B 4NHUA 3GMRB 2IG2H 1QR1A 5E2VH 4MB3A 4DGIL 5I0ZA 4XP5L 3MLSH 3TN0A 1MIEL 4GH7B 4C4KT 4XNXL 4JRXA 35C8L 1MHEB 3G6JA 1JK8B 5SWSD 4F7TB 4NZRL 1KCSL 4HQQL 4I0PC 4XMPL 4DKAA 2R9HC 2ESVD 3ILPA 3QIBC 1GOGA 2YA2A 2NTFB 4KRNA 1Q9LB 1WF5A 3D85D 2F53A 3AMLA 3CDCA 2OR7A 3OWEA 1A02N 3L3OA 3SJVE 1HQRA 4Y5VC 3BI9X 1JGVH 5IMKB 2GTWB 1ZSDA 4G6ML 4LP5A 3VXNB 4HLZG 4ZS7H 3LRSB 5AYUL 4NQTA 1N0XL 1JWUB 3GSNH 3UJJL 3IVKA 3GUTA 1T21B 3W5NA 1I75A 2F54E 4IS6B 3D25B 5DWUH 1P1ZA 4KRPD 3BZ4A 1P4IL 2CGRL 4OV5A 3VFUA 1AY1H 1ZMYA 1D5ZB 5KW9L 1G6VK 1AR1C 3Q48A 1ZLVK 1FFNA 1BD2B 4QHKJ 3QQ9C 1WZ1L 1VEPA 4JFDB 4RMTA 4Z7UF 5D7SL 5DJXB 2HVJA 3CFJB 3PGDB 1A2YB 1CL7L 2WBJD 2GJ6A 3NABH 3D3VB 4JRWA 1F4XH 1ITBB 4HK3J 5GSVB 2C5DC 3VI4E 3D6GA 3QHTC 4PB9H 4ZO8A 4LLYB 4I9WE 5KOMC 4QTHB 4B7LA 1O5DT 2X4PA 3UTTB 5DJDA 4R26H 5KTEH 3QUXC 1E4KC 2ADGA 2O5YH 4MXVE 3NVQA 1CXHA 1I8KA 4NC1E 3CCHA 3AS2A 4FQLL 5I8EB 5IFAL 2EE3A 1YMME 1DE4A 2O61B 2Y06L 1R3KB 2G75A 1ND0B 1UZ8A 2DQFB 1Q9OA 3OQ3B 4J3OC 1L7IH 5C0AA 4FTVB 2GK2A 5CZXC 4D8PA 3HMXL 1CCZA 2Z91B 2X2YA 6FABH 5EZIH 1ZTXL 4WW1B 5CJOL 2HKFH 4LLDA 1RFDL 4RCAA 3TH4T 1SYSA 1C1EL 1G7LA 1KB5B 3E3QE 2FDBP 4LKCB 4NCC1 4G3YL 2BRRL 1WUNT 5GS0C 4IRZH 1CE6B 1K4CB 4L4TD 3O2WL 4W4OC 4JFPA 4OFVA 4EOWL 3P9LA 5IVXF 5DVMA 2JJVA 4JZJA 3BFOA 4K7PH 1LK2A 1P4LB 3B9DA 3QDJA 5BRZB 1KBGH 1TENA 2C4FT 3WN5C 4L5FH 3ZL4H 4U1MA 5K9JH 3ZDXE 4U05A 3QUYB 1QZ1A 1W0VA 3QRGL 5EU6A 5GISH 1BIHA 1PGRB 5A2LH 4K3HA 1DLHB 4NZUL 3V4VL 4LPXA 5IESH 4G43B 5GS2D 5IQ7H 2EXYD 3HI6L 3FB5B 2OXHA 5DEFB 4BELD 4IBLT 4M61B 1A7BA 3OKDB 1KV3A 5IF0B 5FO9B 4RSVA 3RIAF 2R1WA 2R1YB 2OMNA 4K3DL 4AL8H 2GT9A 2XQBH 3VXME 4NOBA 4JJHA 3FO1B 5C2BL 1AKJA 4OLUH 4PP2A 4RMVA 1LVEA 2OI9C 3WJJC 3SDXA 5I18L 5ICXA 1QRNE 4OQ1A 4QXGL 1F2QA 3RWCA 4KRPC 3ZKXB 4XP1H 4OD1H 3PE9A 3FN9A 3ULVL 3QH3B 4NM8L 1X5ZA 3ZE1E 2R4SH 1OP3K 4IMLA 3MNVB 1WZLA 2HP4A 3IXAB 4KXZH 4IDLA 4HK0B 4PRDA 4FQXD 5IBUB 2WBJC 2X4RB 3M1BB 3TFKD 1ITCA 4L4VD 4GFTB 4YEEA 5D1XB 1AQDA 3VFOA 3VWJD 4DKFL 1Q94B 3BGMA 2YUWA 4I0CC 4KTYA 3SGKC 5HVHC 4Q7DA 3DLQR 4LSQH 5I1DB 5DURB 3GI8L 4ZTPL 3BP4A 3D69B 1AP2A 43C9A 4ZD3H 3PL6B 1IGTB 1MREL 4KK9D 4MA8L 4OZGF 2R1XA 2VSDA 1EFXD 1D9KD 4G9FB 4H0GA 3N0PB 3FO2B 4QF1B 3OF6A 3QFDA 5AEAA 1CXFA 1Y6KR 1T2QH 3VXPA 4JR9H 1QFWI 3GEWB 5L0QC 5FYLL 5C0JB 1LO0L 4EUPH 2BJMH 1KC5H 5CBAB 2ATKA 5TF1H 4ZO6A 4MQSB 1HH9A 3TA3B 2DYPA 3WUZA 2X40A 1XCQA 5EOCL 5FK9A 4QRRA 3D39B 2JCCB 4JPKL 4OZIA 5EOTA 3ARED 4OZFH 2FGWH 5CCKL 1P7QD 2E9JA 3WKNA 3T0EA 2H6PB 4QRQA 5D96B 3HCVA 5LBSL 2AV1A 4HGKC 2EXYC 4FA8A 4HH9B 5T33H 5KJRH 2VKWA 4YWGL 4ODSH 2E7MA 4P46A 1JYXA 1M71B 5C09E 1FRGH 4ZDHA 3I6GA 2BRQA 5DEGA 3WFBL 4G80B 1NFDA 2XZAL 3OJDB 4PJEB 2E27H 4JFEB 1MELA 3UTZA 5IM7A 5GGRB 5F44A 3DHJA 1BOGB 3BXNA 4EUPG 2KQMA 3HA0A 3S88L 3VD7A 1K8DA 5D7KD 5IB1A 1MFNA 4R2GB 1J1XH 1LO4H 4HUUB 4MNQD 2R29H 2YUXA 3ULVF 4OLWH 4X98B 2GITB 5B3JF 4K8RH 1YEKL 3HS0B 3DXAD 4M7KH 3M17A 5ID0B 1PQZA 3CLEL 1UKTA 1X3DA 4PJAB 3OKEB 5FYKU 1NANH 2XICA 4DGIH 4XP5H 3T0DA 4AT6B 3ZKND 3AY4C 1GJIA 4CL7A 1QFUL 1MIEH 1IM9A 2DDQH 4FQXC 2VLJB 4XNXH 35C8H 3TFKC 1WAAE 1II4E 4J4PD 4NZRH 1KCSH 4XMPH 3DOSA 1BBJB 4NKDB 4RA0C 3GMPB 1EJ6A 1Q38A 3VWJC 4ELMA 2YD4A 3HE6D 1NGYB 4HKXA 1QPPA 4JM2D 1KJMA 2X1OA 1FE8L 4YK4B 4G6MH 8FABA 4FXKB 4LLAA 1MCIA 5JOFA 5AYUH 1N0XH 4FP8L 4KK9C 1T3FB 4WV1A 3UJJH 4QRTB 1D9KC 2MFNA 3L3JB 32C2B 1ZS8B 1P4IH 5E00B 2CGRH 3NZ8B 3VXRE 2IWGA 2PYFB 4JY4B 5JW3L 4X4ZA 4PJDB 1AXSB 5KW9H 4L3CA 5IB5A 2EC9U 3MLPA 3HLAA 1WZ1H 1NFIA 1JYWA 4ZTOL 1CL7H 4MJIA 4RQQB 2VIRA 1MFBL 1GVIA 4NDMB 3F7VB 4X7SL 2EYTB 3I84A 2BVTA 2GTZA 4Z7WF 2Y5TB 1EEYB 3FN0L 4BH8B 3V7AG 5FO8A 3K4AA 4WY7L 2FZ3A 5BS0D 1CBVL 5D2LA 1FYTB 3MV11 3SY0A 5MHSD 4V1DE 1AIFA 3AREC 5DRNB 5CD3B 1J0JA 5IOPA 2RBLA 1HXMA 4OKVB 5JQHC 2KDGA 4FQLH 5IFAH 1S7QB 2P4AB 5ERWB 3LN5A 2Y06H 5E7BA 5ANMA 3ZKSD 3N1QC 1A64A 4R4FL 4HG4K 5MENA 3DX6B 4D0BB 3HMXH 2CLZA 3Q1SL 3FQRA 4QHMB 1ZTXH 5CJOH 3SKOB 1RFDH 2BNRA 1C1EH 2A74A 3D87B 2X05A 2C3XA 5GZOD 3B6SB 4G3YH 2BRRH 3CVHA 4KK5D 4Y16A 4X9GA 2WUBH 4LVOC 4EOWH 1U8QB 4HMDA 2KL6A 4MX7A 1G7HB 4OZFA 1ED3B 4OZ4A 3DUUB 3L95B 4NKMB 4PDCE 2P8MA 1TQBC 2AEIT 4YO0A 4ZG1A 3QRGH 4JFXA 5GGVY 3ZKNC 1HHKB 4WEBL 4NZUH 4X9BA 3V4VH 4GG6B 3T09A 4WVRA 3V4UL 3S6CA 2V5YA 3HI6H 4KXZI 2AV7B 4HIHB 4J4PC 2K9UA 2W07A 5DVNA 2FJFB 1M7IA 2CDEA 2HJLB 3ARQA 3U9UB 4KRLB 2FECL 4ODUB 3GKZA 3HE6C 3AU1A 3I3DA 3OKNB 5E94A 5I71B 5HHOA 3J8F7 1KACB 3O8XD 4G9DB 4GKOA 4JM2C 4K3DH 4DKEL 3ES6B 4L4VE 4BSWB 3WD5H 3FRUA 5C2BH 4MXWL 3L5JA 1SJXA 3S4SG 4P3DB 2P5WE 1CXKA 1CYGA 3KAAA 2ID5A 5DRZA 3ERYA 1S7UB 2ZSWA 4ZOAA 3QIWD 5I18H 4M5YL 4TTDD 4QXGH 4HIEB 3SGDH 1HI6B 1IKNC 3WEXB 4G7YL 3ZTJH 3BQUD 2CO7B 1MHHB 4ODWA 4P2QA 4IOFD 2OJEA 4ACPA 4WUUB 5AD0A 5EZLB 2XQYK 1QUNA 4XCYB 5FGSA 2OBGA 2EIEA 3BIKA 5J56B 1FZMB 2W0KA 4NM4L 4XPGH 2YUVA 4K7FB 3MYZA 4DKFH 1NLDL 3UTSB 5C0IB 4EKXA 4NO2A 1FSKB 1EX0A 2A9NL 1JV5A 2MWCA 1H8OA 1UXWB 4HJJL 3QUKB 4PJ5B 3TPUA 3GI8H 4ZTPH 1S9WB 2J4WL 1RUPL 3ARUA 4N9OB 2V7HB 4YBLC 5IFJB 1DR9A 1MSPA 5JR1L 1MREH 4MA8H 2BK8A 3T2QA 4OZHB 3ARGB 5B38G 1XIWA 1M6OB 4Y4FD 5E8NA 3OMZA 1PD6A 4DVBB 3VDBA 3DSNA 2DQHL 4ELKA 4PG9B 4F2MA 3I6KA 5I9QC 4PRNA 3ZTJG 3H9SE 3QJHB 1S8DA 2BHZA 4NKQB 4NQDB 5FYLH 1LO0H 4LF3B 2I26N 1ACYL 3MRHB 2CSPA 4KVNL 1F6AA 2F5AL 4X6EA 5GZOC 2ZUWA 1I8IA 4JREC 4KUCF 4JFFE 1YPZE 5D7JB 4HKBB 4LLUA 5EOCH 4UDTA 5AG8A 3F7YA 1UB6A 4JHWL 3VRJB 1WEJL 1OGAE 3HKFA 4N8CL 5IVNA 4X99B 4JPKH 2YPLD 2VZVA 4MA3B 3P9WB 2FHFA 5GGSA 1J8HE 5CCKH 3MC0A 3KWWA 1HWGB 2IQ9L 4L1HA 5CEYB 4RA3A 5FKAA 1NANI 2AGJL 4YFLF 1UEMA 2Y07L 2J7LA 4RGNE 4YWGH 4RFOL 1MLCA 1MI5B 4YIQA 5KSBB 5C08E 4F33A 3WFBH 2XZAH 3ARRA 1JPST 4NZTL 4WW2A 1H3UA 4JFQB 1VEOA 3MA7B 3O8XC 4XH2A 3S4SA 3TBSB 1RZ7H 4GG8B 3GJFH 5BVJA 5BO1L 5KSAB 1IZKA 3S88H 1L6XA 4EN3A 3QNYA 4MHHI 3WMSA 5KS9E 1T6WA 3KLDA 2FX9L 3SCMD 5D7LD 2F74A 4NHCL 5JPMA 4PJIB 4OB5L 1I1RA 3QIWC 4TTDC 1YEKH 1PYWA 3RY5A 1IC1A 2PYEE 3CLEH 2BVPB 1ZLUK 1VDGA 3BQUC 5J1AA 4IOFC 3KYMB 1OAKL 2DWEB 5LVEA 2IALB 3TNMA 4KI1A 4DEPB 3IJSA 1FNLA 1QFUH 3P11L 1CE1L 1CF8L 2WV3A 3FKUS 4LQFL 1CL7I 4AIXA 4JRYD 4M4RA 1NL0L 5E5MB 1IGCL 4I3SL 4YUEL 1YEDB 3J7HA 5FM5M 1T0NA 3IDYB 1IKFL 4PJBB 3SGEH 3MRGB 3T3ME 3IAQA 1FE8H 1T1ZA 1JTOA 2VUOA 3BHBB 3O6FD 4NQEB 4Y2DD 5BCAA 4FP8H 1RZIB 4JO3L 2DI9A 4PR5A 4CKVX 3T0XA 4Y0GA 5MERB 4Y4FC 3GMMA 2I07A 4XPAL 3HG1B 1NCCL 3TBTB 4NUJB 5JW3H 1DLFL 1WWAX 1Z9LA 3C8KA 1K4DA 5TE7L 2LABA 1U95B 3QG7L 1NMCC 5C8JA 3BT2L 4ZTOH 3RL1B 4O00A 4ALAL 1MFBH 1UJTA 4HUVA 3OX8B 4X7SH 1XF1A 2AEPL 3NFPA 4KV5F 5IMOA 15C8L 3FN0H 2VISB 1ZA3A 4N1CA 5ILTL 4M43L 4WY7H 3OJVC 1CBVH 4ZAKA 3EYOB 5HGAA 3AGVA 1NEZG 2FJGB 3VXUA 4HCRL 4G8GD 3NGBC 3OPZL 2RJMA 2G2RB 4J6RL 5HYJE 5C0CE 3CNKA 5E0QA 3ROLA 1VA9A 3QEQB 1H15A 4R4FH 5DO2D 2IAND 2WNGA 2MKWA 5E8DL 5F9AC 3Q1SH 3LDBC 4PIRF 4M9PA 3NOIA 4PRHE 3GSRA 3OSKA 4UUJA 2A38A 1N0LA 3T0AA 3MV7A 3F7QA 5J1TC 5DK2A 3F12A 1NCTA 5EO9A 1MCDA 3LQAC 1TCRB 4FZ8L 3SCMC 3UTPE 5A40E 2E6PA 3ARFA 5IROA 3SDCD 3WDJA 2YC1A 4Z7VA 3OB0H 3GMRA 4LASL 3SGDI 5LG1A 3RGHA 2WLZA 3EYVB 4XCNB 1H5BB 3ZDYE 3AXLB 4WEBH 3V4UH 5D7IF 1FFOA 3SDDD 3VGFA 4QXUL 5DT1L 2E9BA 4GRWE 3TCXA 2Y4SA 1CVRA 3VD9A 1Z6JT 3QFJE 4OBRA 4OLYL 4ISVB 4YAQB 3D2UD 4DKEH 4I0PB 3MGOB 1FIEA 3LRSA 4MXWH 3QIBB 1JWUA 4CVWA 1N5AB 3U1SL 1UVQA 1WIOA 3O6FC 1U2HA 1T21A 4H26A 4P0DA 1B4JL 4IS6A 4Y2DC 5GJTL 3D25A 1CGVA 3CH8A 1XF5A 3GSOB 4NIKB 4M5YH 4Y5VB 5ACMA 1O7VA 3MFGB 1D5ZA 1F42A 2C1OB 1KFAL 4G7YH 5JPNB 3MNZA 1MLBB 4APQD 4BK4A 4HPYL 4WWID 5DJXA 3CFJA 3PGDA 1A2YA 1NDMB 5I1CL 1F8TL 4NT6A 1B6UA 3SGJA 3RWIB 1JZ3A 3D3VA 4LCWA 3SE8L 1OW0A 4E41E 2AK1L 4QYOA 3BPOC 3BEWB 2VLRD 2W0LA 4U7KA 1NEZA 4LLQA 2DBJA 1NLDH 3QG6B 1NUFA 5F7HA 2ED9A 3FONB 2A9NH 5EU7E 3UTTA 4Y2OA 1X5JA 2ZCHL 4HJJH 3B9EA 2J4WH 1RUPH 1KTRL 2P44B 1DDHA 2ED7A 4B5EA 3S8WA 4HWUA 2RQ8A 4FHBD 3KPSA 2CRYA 5JR1H 1Y18B 3MUGB 4P2RE 1R3KA 4XB7A 3ZKMD 4PRPA 1ND0A 2DQFA 1C5BL 5C86A 3QUXB 1I85A 2DQHH 2CK0L 1ZT1B 3UZEA 5DO2C 1PZUB 1NGQL 2ORBL 2QLVB 4WW1A 3ZDZE 5SWZB 5IEKA 4WTXA 4DQOL 4GSDL 2APXA 1ACYH 1X5KA 3BPNC 4KVNH 2L7JA 2F5AH 2OTUA 1H3WM 1CE6A 5JHDD 1K4CA 2H9GB 4X6DF 5BJTB 1MHPL 1KIRB 4JHWH 1WEJH 2NX5E 4N8CH 1ZLVH 3SDCC 4JZNA 3VJ6B 5C07B 2AJZB 1QBML 5HPMB 1QLFB 2HJFB 1UKQA 3EO9L 2BSRB 2Y25A 5I66B 2IQ9H 3D0VB 1DLHA 4KI5F 1EZVY 1QSEE 4G43A 3TBVB 3U46A 3OKOB 1E4XL 3OKMA 3MJ6A 2Y07H 5FV2A 3EYFB 1JNHB 1JTPA 4PJGE 3SDDC 1RUMH 2XZZA 3WN5B 1T0PB 2RAMA 3HNTL 4QHLA 1CD8A 2A6IB 4K71C 5C0FB 3VFMB 5FO9A 5DJYB 1KLGB 2JJSA 3PXJA 4XRCA 2YRLA 1BMGA 4NZTH 5C2UB 5EU5A 4EVNB 3I6LD 1MNUL 2IAMA 5SWSB 2YEZB 3FO1A 1OLZA 5D6DA 5BO1H 1GC1L 3QCTL 2ESVB 3SGEI 1ULVA 4UNVA 3QYCA 4MCYA 1DBML 3FB6B 4GKNA 3STLB 4HEPG 1FGNL 2FX9H 5FB8B 3T4AA 1N59A 3D85B 4NHCH 1U42A 2R8SL 4OB5H 5GGVL 3U7WL 1ORSA 4OLXL 4QRSB 2VZSA 3FAXA 4XPBL 4R0LC 3DO3A 2BY3A 4HX1B 4APQC 4X5LA 2OI9B 4YPGB 1XR9B 3IXAA 1OAKH 5KVMC 4HK0A 1E6OL 1ZHKB 4WHCA 1HSAA 3TBWB 2X4RA 3P11H 1CE1H 1QHOA 3T65B 1CF8H 1JHLH 1QA9A 2YMXH 1N2RB 2CD0A 4CVXA 1K6QL 3HNVH 4LQFH 1NGZB 2XY2A 4GLRH 3CSPA 2NW2B 1NL0H 3GSVB 4V3DB 1IGCH 4I3SH 4YUEH 2E7HA 1Q94A 3G5XA 1M7XA 3ZHKA 2C3VA 5GRVK 4OFYA 2WBJB 4F15C 1IKFH 1IVLA 2UWEA 4JPVL 3D69A 4ESKA 1YN6A 2NNAA 4ZUUB 2G9HB 3EO0B 3TVMD 5BQ7B 5CEXA 4JO3H 5FO7B 1CGWA 1G1CA 5HVHB 1SVCP 1MCNA 3RIFK 3QXTA 3ZKMC 2OTWB 3FO2A 1XZ0B 5EIVA 4XPAH 5DS8A 1QQDB 4L3EE 5L2KD 3MXVL 1DLFH 5ACLA 5KG9B 1HQ4A 5TE7H 2CKBB 3QG7H 4CW1B 1URLA 2NZ9D 5CBAA 1OF2B 3U83A 4ALAH 3OHXB 1JP5A 3TA3A 2VITB 3GJEB 3S5LB 1KF9B 4AMKH 1XF3A 1WTLA 4WWKD 3IFOA 1F4YL 3VXTA 15C8H 1BQHB 5D9SB 4WO4C 3D39A 5ILTH 4J3VA 2JCCA 3P73B 3Q0HA 4M43H 5L0QB 3DBXB 1TZIB 1OP3H 1TJGL 1DN0B 2FHCA 4HCRH 1MWAB 3RWGB 3OPZH 2YS4A 2H6PA 4J6RH 4L4TB 4K94C 1UENA 4HH9A 4C57C 2OSLA 5BVPL 4RGOL 4NSKB 1U8MB 3LHPL 5E8DH 3OJDA 4PJEA 5DUML 5MEQA 1X5FA 2VDNL 4YFLI 5E8OB 3RZWA 3V0VA 1WWBX 2P5EE 3ZSSA 1KULA 2FECI 2NZIA 4YGVB 1X5HA 1PG7L 1RY7B 2FEDD 1FC2D 2ADJA 2L7UA 4HUUA 4UNTA 2CKNA 1LP9A 2IBZY 1R5WB 4IHOA 4X98A 3HS0A 4LEOA 5ID0A 3L7FB 5HYQB 4PGCA 2ZUYA 2QHLA 3DX9B 1FG2B 4LASH 3T08A 1N8ZB 4K7PX 3HFML 2R4RL 2HLAA 4AT6A 3TN0D 4WI9A 3WO3B 1MCJA 3KS0H 1F4AA 4LPWA 4XB8A 3BYTA 4JRXD 1G9EA 4RFEA 3L5IA 3MRMB 3VI4F 4U7SA 5CJXC 2BZDA 4KJYB 4D0CA 1BBJA 4NKDA 2HKHL 5DT1H 4N90E 3UBXB 5E7FA 2V17L 3ZE0F 2F53D 1R5IB 4OLYH 4YBHA 5F3HA 1T2JA 4X6CF 1NGYA 4MXVF 4DKDC 3NCFB 4FQXB 1R5VB 4L4VB 4Y19E 1FZOA 2VR5A 2VUYA 1I7RB 3B3IA 5B8CA 1EO5A 5F7UA 3VWJB 3U1SH 3TVMC 1B4JH 5GJTH 4LNVA 4ZNEE 3L3JA 4PJCE 1CN4A 32C2A 5CIPB 4MVBA 5E00A 2Q6WB 3NZ8A 4IEFB 1JGEB 1T7ZA 1LEKB 2PYFA 4JY4A 1AXSA 1KFAH 2CJUL 2FLBT 3QULA 4K2UL 4HPYH 3S96B 5J11C 4XBPB 5DK0A 1V3JA 1F8TH 3QHFL 2NXYD 2NZ9C 4RQQA 1EFXB 1D9KB 2E6JA 1WFNA 3FOLB 3SE8H 5L8KB 2AK1H 2AXHA 2Y5TA 4LDOB 1EEYA 4WWKC 4BH8A 5D7IA 2IFFL 4FMKA 2A6DB 3GRWL 3H3PL 3LQMA 1FYTA 3ZDXF 1SJVA 1FIGL 5D5ME 3WUWA 1WBZB 4JDVB 5GGRY 5ITFB 1U58A 4NQUA 4UBDD 1UM4L 5DRNA 2ZCHH 5IHLB 2CO6B 4OLZL 5CD3A 3IAPA 2J6EH 2GSIB 5F97E 3RJQB 1BZQK 4I2XA 4MSWB 1S7QA 3RY6C 1XF2B 3KHQA 2AXFB 3STZB 3TF7A 3AREB 1C5BH 5C0AD 2Q7YB 3DX6A 5JTWA 2CK0H 1CTOA 5CSGA 4CRPA 1NGQH 1KTLB 2ORBH 2VABB 4QHMA 1EAJA 4YPJA 4DQOH 1T80A 4GSDH 1DSFL 1WCBB 1NAML 3B6SA 4HEME 1KIPB 4TTGA 4LPUA 3V5HA 3WXWL 2FEDC 3K81A 1U8NB 1B9ZA 1IGFL 4XMKL 5BZDB 1RPQA 5D2NA 3BKJL 1MHPH 3C5SA 3DRTA 1GL4B 3ZE1F 1OAZL 3UPRB 3QDJD 4PJ7E 4AG4L 1MFDL 4KQ4L 2FIRT 2AKRB 1J8HB 3L95A 3INUL 4NKMA 3O41A 5TH2A 3EO9H 5EU6D 1U41A 2VR4A 1QRKA 4LVOB 1JF1A 3TN0C 4MNQB 4GG6A 4WU7A 5HGGS 4GRMB 3G5YA 1E4XH 3B9KA 5IHZB 1LEGB 1R6VA 1N64L 4D9QD 3DXAB 1LDPL 2GK0B 3VGGA 4PJFF 2D03L 3HNTH 2VDRL 3SE9L 1CFSB 5C08B 1TQBB 4E5XB 1IBGL 5HGDB 2WIIA 4GLRI 5F7DB 3OKNA 5ICZA 1RUAL 2WZPD 4OQTL 4FQHA 3N06B 1MNUH 4Y1AE 1W72B 2OZ4A 4PY8J 1FNHA 1GC1H 3QCTH 1MUJB 3MLVL 2Z31D 1JVKA 4HKJA 4LPTA 3EGSB 4P3DA 5J8OA 1DBMH 5KS9B 5TE6L 4M6ML 5I8CB 1S7UA 3G9AB 3HE6B 4BFIB 3KYOA 1CFNA 5JMOC 2R8SH 3RUGB 4HIEA 2VDOL 4HJ0D 5GGVH 3TJEL 4JM2B 1IGIL 4OLXH 1HI6A 3AUVA 5D1ZA 3U7WH 4G8IA 2E8YA 4NN6C 2F8XC 5INDB 1MHHA 4XPBH 2XPGA 5L2JA 4WUUA 2QQLL 1E6OH 5ISZE 2YPVL 4M3KB 1CFVL 2NXYC 3MX0A 2JJUA 4PG2C 1K6QH 1YZZA 2I9LB 2WBKA 2XWJA 5FGCE 2YR3A 4YHYC 1AC6A 1L0QA 4R90L 2M1KA 5DD0L 5GHWL 3UTSA 4OSUL 4YHOL 1A7NL 3U4AA 5C0IA 1B2WL 4XCEA 1KJVA 1UXWA 2A0LD 1QOKA 4PJ5A 1H3PH 4UBDC 1S9WA 4JPVH 2XN9D 5IW1B 2V7HA 1ZHLB 4YHPA 5K33A 4IM8A 3U2SB 4Q6YA 4MNGA 4P59L 3BKML 3VG0H 5BS0B 1ADQA 1I8MB 1M6OA 1J1PL 1S9YB 4X9IA 1F3DJ 2X41A 3O3EB 1U8KB 5FDYA 3OV6A 4YBLB 3BGFC 3MXVH 1B3JA 4NFDA 2NY4D 2YK1L 1XH3B 2YZ8A 2HFGL 5IG7A 2DYPD 1FJ1B 2XKNA 2Q3ZA 5D7JA 2X4TA 1F4YH 4HKBA 3QDGE 3DMMA 1EHLL 2PW2B 1FO0L 3L3IB 5K93A 1NC2D 4XGZB 4X99A 4Q9QL 4PP1D 3PWJB 2ZOLA 1TJGH 1RJCA 5I2IA 2W9EL 2FCBA 3HR6A 4JREB 1YNTB 4NRZA 3CPLB 2I9TB 3T0ED 2X5PA 2J6EA 5CLTA 1MVUA 1HDMB 5F70A 2F9BT 5CEYA 1G6RL 4PJXE 5HJ3A 2FO4B 1K3IA 2VL5B 2NMSA 1TZGL 3V5KB 1PX3A 4P46D 2Z92A 1MI5A 5LCVH 5BVPH 1IGJB 3L3GB 1IARB 4Q58C 5KSBA 2PW1B 2AJ3B 3LHPH 1BJMA 3WE6A 1GHFL 5DUMH 4U1HB 3MO1A 1D7FA 2GCYB 4JFQA 3EYSL 3MA7A 4BZ2L 4GG8A 3LPGA 1V5JA 5KSAA 3HC0A 4NJAL 1O7SA 1PG7H 3V0WL 3MRNB 3EUUA 1TMCB 2Z31C 3KPMB 3MYJB 4TPRL 2OL3B 1UXSA 3S35L 4DGYL 3O8XB 4HJ0C 4HDIB 2BVPA 2X1XR 3DJ9A 3B9AA 4DFIA 1QLRB 4L29B 2DWEA 2R4RH 2V9QA 1ZHBB 4NO3B 3MRKB 3PGCA 3EHBD 3QIWB 2FATL 4S1RL 3E6FB 5I16B 5EPMA 5AUMB 3BQUB 2HKHH 2DMKA 3GIVB 4GRWB 4GOSA 2V17H 4LK4A 5DRXB 3CK0L 3LEXB 3NZHL 4I4WA 3SJVA 3P4NB 3O4OC 4OM1L 3AS0A 4X7DC 5IK3B 3I9GL 3MRGA 2ICWJ 2V2WA 5EO0B 2A0LC 3SBWA 1SMAA 5C0EB 3TT3L 4X4XA 2XA8L 4HZLB 1XR8B 4CMMA 2F54A 5HHNB 4EDXB 5DVLA 3HZYB 1IEBA 4HWBL 5MERA 3HG1A 2ZUVA 4X7TB 3TBTA 4JN1L 1CLOL 2CJUH 2A2QT 2Z8RA 4K2UH 4CGTA 2NY4C 3WO4C 4HULB 5DA4A 4IRSD 3RL1A 3WFZA 3QHFH 3QDMD 5HI3D 2AJVL 4Y4FB 5C92A 2H32H 1I3UA 4KAQL 4CJ1A 3IDJA 3RP1A 4EDWL 2CUHA 1VFMA 2IFFH 1P53A 3GRWH 1T7XA 3H3PH 4GMTH 1FIGH 4PP1C 3ARWA 2XFXA 1UM4H 5HDLA 4A2LA 5I8OL 2R2BB 2BSED 1AO7E 4OLZH 2IPKB 2G2RA 2ARWA 3T0EC 1T66D 2R23A 3QEQA 1YMMA 1CLZL 1SY6A 3WNNA 3VDCA 1A14L 2HWZL 2CUMA 2YPLB 1P2CB 2A83B 5C0BE 3EOBB 4ORGB 4P46C 1E4XI 2W1NA 3NGBB 5MEND 4NNYA 2EC8A 4U2ZA 2HFFA 3WHXB 1ZOXA 2X10A 3U30C 1VACB 5I1LB 2BNRD 1DSFH 5LGKA 3E3QA 1QFPA 4WI3A 1NAMH 4TUKL 4KH2A 4Y16D 3WXWH 3JZ7A 3S36L 4X4ME 3FQTA 3N1MC 4LHUG 5EUKA 2UZIL 3LS5L 1IGFH 4XMKH 3LDBB 1RU9H 4U6XB 4L8DA 3BKJH 4MMZC 3T4YA 4QNPE 1OAZH 3BISA 4AG4H 1MFDH 4KQ4H 5IMLB 1HKLL 4OGXL 2I60L 3INUH 2ARJQ 1G9MH 3SCMB 5D7LB 3L7EB 1UZ6E 2E7LE 4TVSa 4MS8A 3EHBC