1KPVA

High resolution crystal structure of the mhc class i complex h-2kb/sev9
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
274
structure length
274
Chain Sequence
b'GPHSLRYFVTAVSRPGLGEPRYMEVGYVDDTEFVRFDSDAENPRYEPRARWMEQEGPEYWERETQKAKGNEQSFRVDLRTLLGYYNQSKGGSHTIQVISGCEVGSDGRLLRGYQQYAYDGCDYIALNEDLKTWTAADMAALITKHKWEQAGEAERLRAYLEGTCVEWLRRYLKNGNATLLRTDSPKAHVTHHSRPEDKVTLRCWALGFYPADITLTWQLNGEELIQDMELVETRPAGDGTFQKWASVVVPLGKEQYYTCHVYHQGLPEPLTLRW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, K-B alpha chain
publication title High Resolution Crystal Structure of H-2Kb/VSV8
rcsb
source organism Mus musculus
molecule tags Immune system
total genus 77
structure length 274
sequence length 274
ec nomenclature
pdb deposition date 2002-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1kpvA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1kpvA01
4MXQD 4JPIA 3TESA 2FIKA 4PJ7B 4WU5A 2F8XC 2EECA 2FSEB 3G6JF 5C0GA 4M7JH 3IFPA 1U8LB 1QSFA 4ZO6A 3SBWA 5E1HB 1QPPA 3OQ3B 5I75C 1ND0A 3B9KC 3DUHA 5CP7B 1FIGL 1JGUH 1TPXB 3QIWC 4LLQB 5FCUL 4MDIA 2HVKA 4LVOC 1FVCB 4ZDHA 3VWJB 1TJGH 1TZHA 2CLZA 5CEZH 4X80H 4YBQD 4KDTC 3MA7B 1FL6B 1XGTB 5HI5C 1I4FA 3OGCB 4GOSA 5KVEL 1W0WB 5JXED 3MFFB 1DUYB 2P7TB 5CMAB 3H42H 2EEAA 1UYWH 3QUXB 1CTNA 1AXSB 3WYRA 3EYQD 3QEUA 5EO0A 1JF1B 4HD9A 1RFDH 1FNLA 1UKQA 5ENWA 5D1QD 1XF2B 1S5HA 1RZGA 2ED9A 2P5WA 2YD6A 3MA9H 2IPUG 3P9WB 3ZTJH 3AC0A 3RBSA 3RUGF 5ESVA 3DVGA 2K1MA 2VXSH 2X42A 3MBXL 4D9LL 4KV5F 4OQTL 1LNUB 3K8LA 1NGWA 3UTPD 4YHLH 4FFEX 2QADB 1SJHA 1C7SA 3EO0B 1CS6A 4LGRB 4IOIB 1FFNA 2KZ1B 4Y5VB 2NY1D 5KS9B 3QNXA 4JRXE 1VFMA 5F7WC 3EFFB 5I73C 3UROR 3LSOB 3EOAB 2GJJA 3F7VA 1VADA 3MNVB 4S10A 3X3GL 5IWLA 4EI5C 2CRIA 3H3PH 4I9WD 2E9BA 5A2KH 4OCRL 4NOFA 4BFBD 1DQML 3QJHA 5FYLE 1MIML 3HC4H 4TQEH 4WWKB 4ZFOA 1QLEH 2ZJSL 4L3CA 3SDDB 5L7XL 4HPOL 1WCQA 3RWJB 4CJ0A 1OWRM 3DUUB 2MWCA 3MOAH 1C5DA 3G9AB 3IU4H 5GRJL 5HGBA 2XWJB 2CDEB 2R8SH 3FFDA 3RGVB 5ICXB 2R4SL 3FQRB 4PDCE 3PXHA 4LARL 1KCSL 4RMQA 4XP5L 3HG1B 4UUJB 1FRGH 3U7WH 3I9GL 5F7FA 1G7PB 3HPJB 4DKFH 3T3ME 3CD4A 1G7IA 2V2TA 4D8PB 1OGAA 2E7LE 5H2BB 3LRSB 3FRPA 1I7TB 4WDIA 2DLEA 3NH7L 4XPTL 1SYSB 2Q3AA 3HNTH 5ICZB 4AIZA 3CGTA 4LF3A 3KPOA 3GMNB 3TO4D 3S9DB 1QFWL 5I1HL 1Q72H 1ZMYA 4G8IB 5DJZB 3BT2L 2BNRB 2CDGB 1CFNB 2NW3B 3QIBC 5I2IA 5E8DH 1UGNA 2DJ4A 5HHMA 3D2UB 3OKLA 5DQ9B 4U6VH 2EDNA 3T3PE 4U1JA 4XNUH 3IB4A 1MI5B 4U3XA 5FYKU 4F3FA 2E8ZA 1WITA 1FPTH 3D69A 3OPZH 3RA7H 3QULA 4EI6B 5I6XB 3IKCB 3P4MB 1AJ7H 3RNQB 2O61A 4O9HH 1I7UA 1DUZB 1N6QH 3BPCB 1ZOXA 3MLUL 5F21B 4K71B 2X70B 3M17A 3W5MA 1EJOL 2XPGB 3DOSA 1UM5H 4ONHB 1ZHBA 2EYRA 1R24B 5D7LD 2HT4C 1II4E 1C12A 1TVHB 2HJLB 4UZGA 4I0CC 3KJ6H 2BVPB 3STZA 1I8LA 1IILE 2Z9TA 1P4BH 1ED3B 1LO5B 4UT7L 5DMKA 1SY6H 4TPRH 4BFEA 2ITCB 3O3AB 3IDJA 4QLRA 2GFBB 25C8H 1VHPA 1NGXB 1WWCA 2DDQL 4JFZL 4M7LH 4KK9D 1X5KA 3ARGA 3VFPB 5ELIA 1N6VA 1YZZA 5DO2D 5F88A 4R26L 1HSBB 4OLXH 5DD1L 1HINH 1TLKA 4HIHB 3LS4H 4PRNB 3BZ4B 2B0SL 1FSKC 3VXOB 4HIIA 4HGMA 2VIRA 1RIUL 2NY2D 2E9JA 3PGDB 3D1MC 4ZSOB 3EYSH 5B8CC 4XH2B 3RWIA 4F9PC 1W72L 1GC1H 1ZHNB 4XHJD 2NY6D 1TMCB 2F54B 1A6VH 4X6BA 1RQ5A 5DYOB 2Y36H 4F33B 4ZODA 4D2NA 3H0TA 5IB4A 3L3JA 4OTXH 4OLWL 3WSQH 3HE7D 3MV8B 1PKOA 3TWCH 5IMLB 3VGAB 3BKCH 3BDXA 4JFDB 2GJ6A 1ZLSH 3SY0A 1SJXA 1H0DA 1Z3GH 2C3GA 1QSFE 3U9PL 3GSNA 5F9JA 2R2BB 3QH3B 1BQHG 4QRRB 2HLAB 3GJEA 1ONQA 1NLDL 3PP3H 3IDIB 4IJ3C 4LPVA 4RDQF 4OGXH 1WCBB 1YNTB 4Q9QH 1M6OB 2AGJH 3SO3B 3VH8B 3LKSA 3P4LA 3NACH 1L9MA 4P2QB 3FAWA 3IFOB 3S36L 4HZLB 3BH9A 4MD5A 1X5YA 1G6RL 3ZDXE 3KXFA 1A7OL 3H3BC 5H35B 5HVGB 2DQJH 3GSVA 5LGJA 1KF9B 2P5WE 4Z8FL 3GMRB 4NBYB 1QBLH 4GAGL 4G43B 1S9XA 1E6JL 1H8NA 2IMNA 4NQDB 1T7ZA 3EOTH 3V5HA 5SV3A 4KK5C 1DVFD 5DK0A 3QEQB 1ZSDB 1HSAA 1F3JB 2HJKB 3PIQB 4ETYA 2JB6A 2WNGA 3MTRA 1ERNA 1QFPA 3OXRA 1DL7L 2X1XR 4PJFB 1MLCB 2BSTB 1KPVA 5EOQL 5T3ZL 3S35X 2WQRA 3VMOA 2AJUL 3K74B 1NAMH 3Q1SH 4W68A 4JRXD 5TDNB 1ZV5A 1LP9F 2ORBH 3NIGE 5DHVB 3SO5A 3MNWA 3O45A 5IVZB 3GRWA 2FBJH 1ORQB 4MXQC 1OL0A 4F7TA 2IG2H 2P42B 2ICWJ 1A6WH 4MA3B 2VDKL 5HPOA 5FYLD 1XGPB 1G9NH 3VGGA 1CK0L 2O5ZL 1F6FB 4OI8A 5FO7A 1NFKA 4TNWF 3T8XB 1CR9H 1PEWA 4XMKH 3NCYS 2DOCA 1TENA 2A9NL 2R9HD 4JO1L 5HGGS 4EIGB 1NANH 3N50A 1ZVYA 2UY6A 1A1NA 5CEXA 5JXEC 2Y5TA 4YHZH 1J5OL 2OXHA 5GSVB 4OSUH 1PX3A 3DX8A 1OGAE 1QO3A 2DBLL 4XPGL 3EYQC 4YXHL 1VACB 2MHAA 4DN3L 3OF6A 4MAYD 4ZUTB 4RAUA 2HRPH 1A6UH 2D2OA 5D1QC 4PR5A 5GRYA 2DYPB 3MRGA 3FB6B 4DVBA 4PJCA 3SKUD 2VB5A 5GS0C 2FJGA 4PRIB 5HHME 3MXVH 1DSFH 2B1HH 4J4PD 4O02H 1SHMA 3S88L 5LGKA 4XXDB 1OP3H 2O5XH 9CGTA 2F5BL 2PETA 3BZEA 5IQ9B 2W0FA 5F9OL 4N0RA 4GRLA 2ED8A 3DHJA 4HFWB 4U31A 2BFVH 1T7VA 1CGSL 3BWAA 1EO7A 3DWTA 1JUFA 2BJML 3UBXA 4APQC 5EB9A 4R90L 5BW7C 4JCLA 5DZLA 2NY3C 4MXWH 4OZHA 4F9LA 3ARDB 5DD6B 2HTKC 5DGQA 1WBYA 5ETUA 1VEOA 4NCC1 5GGVY 3UTSA 3QAZB 5CGYD 3VFOB 5IW6B 1RZ7L 3D25B 3K4DA 3VXRB 1XGUB 2VXTL 2E27H 1FGVL 3DBXB 3TLRA 1D5BB 1BLNB 4ZFFA 1WIPA 1TZGH 1F45A 3WUWB 3X11A 2M1KA 5KSBB 4GBXD 4RMSA 5J6HA 1HXYB 3IKKA 4JM2F 4NRYA 1CFQB 4PG9B 1M71A 5GRWA 4XCFL 4OF5A 3W11D 2VH5L 1WWWX 2DQCH 3PHOB 4PJ7A 2FSEA 3TO4C 1A9EA 1U8LA 4N5ED 4XNYH 1OAKH 4I0KA 4KPHL 5CP7A 4U49A 1DLFL 1PLGL 4G6ML 4XBEL 4MD0B 3A0OA 1FVCA 1P2CB 4LCYA 4LPYA 3FO1B 3V7AG 3VWJA 3N1MC 1MRCH 3PGCB 1GGUA 3MA7A 1FL6A 1RJLB 2IJ0C 3OGCA 3ARVA 1W0WA 3MFFA 4KWUA 5TF1L 1CXKA 1DUYA 2P7TA 5CMAA 1AXSA 5CGMA 4U3CA 4ZS7H 5TQ0L 1JF1A 3C8DA 3DMMB 4PJXF 4LSPH 4Q6YA 3LN5B 1BOYA 2GJ6E 1NMBH 3H9YA 1XF2A 1ZA6B 1CZ8H 3QEGH 1R6VA 2VLRE 3HB3D 5E70A 2ZCKH 1ZT4B 4K94C 4KJYB 3VD3A 1TQBC 2E6QA 3UYRL 1GIGL 2IPUK 1LNUA 1QSFD 2CRYA 4L4JA 5AYUH 3SE4C 2EDRA 5F9WC 1QNZL 1KCRH 4IOIA 4OM0L 5K59F 3TEUA 1QFWI 2ATKB 4Y5VA 3SDYL 4BZYA 5KS9A 3P3YA 1F4WL 3GBNH 4WV1B 4ESKA 1PY4A 3EFFA 5DJYB 4X6CF 3IF1B 3LSOA 5DLMH 3MNVA 3R1GH 4DZ8A 4LHUB 4YDLC 2RCSH 3RWEB 1I8MB 3V8OA 3KXFE 4KK9C 4Y5XB 4XAWH 1N3NB 2NY0B 1JNLL 2MCG1 4BYHA 4O58H 4AL8L 1CICB 4XWGL 5DO2C 3CU7A 3UPAA 4ISVB 2H1PH 4NQCB 4OIBA 4QXTB 2P5WD 4OM1L 4WWKA 4KC3B 4ODSH 5GS1B 4LRIC 3SDDA 3IVKB 1BX2B 4QRPB 3RWJA 2NY2C 3DUUA 3SKNB 4MMXC 3PWUB 4HIEB 1YYLH 3IFLH 4LLUB 1WAAE 2XWJA 2X9WA 5FGRA 2CDEA 3RGVA 5ICXA 3FQRA 2NX5B 2APFA 3O6KH 1UKTA 2NY6C 4XHJC 1MJUL 3HG1A 4UUJA 1G7PA 3HPJA 4D8PA 3ZTNL 1E28B 2CIKB 3F8UB 5H2BA 2B1AH 5F96L 3QP3A 1BJ1H 1GOFA 2NY7L 5IBTH 4XCCH 1DE4B 3ARFB 1DN0B 1SYSA 2FLRT 5ICZA 3GMNA 1U41A 4G8IA 3O6LL 1I8IB 5DJZA 2BNRA 2CDGA 1CFNA 2NW3A 2EXYD 1BJ1J 4BH7A 3WDHA 5DQ9A 1RHFA 1LK3H 2XG4A 5KZCD 2UVEA 5DVNA 3FRUB 1NC2A 1MI5A 1AP2B 2ENSA 5DT1L 1UXWB 4F37K 2ZUUA 1FCGA 2XIDA 1YECH 4P9HH 4KROD 2VDOH 1JFQH 1IAKB 3IKCA 3M8OH 3P4MA 4LHQB 3BUYB 1OGAD 5C2BL 1DUZA 3BP6B 3BPCA 2OYPA 1UCBL 1KGCE 5FO9B 4JDZB 2X70A 3MREB 2XPGA 5F9AC 1SYVB 2ZCHH 1BQLH 4PJCE 4PRPB 3ZE0E 5AWNL 4ONHA 4BK4A 3MXWH 1B9ZA 1R24A 3LKOB 5FOBB 3VU2A 5F6IB 1TVHA 2HJLA 1X6LA 3IJYA 2BVPA 4LMQI 3WD5L 4U6XA 5I71B 1ED3A 5HHMD 4Y88A 1LO5A 2NPLX 2VDQH 3JWDC 2ITCA 3O3AA 5IBUB 2A38A 2GFBA 3WLWD 3PWLB 1HWHB 3NAAL 1NGXA 4KRPB 3W39B 3VFPA 4NQTA 3BD5A 3THML 1KUMA 5B3NA 1RUMH 3GSXB 4OZHE 3P77B 4X7CC 4Z7NF 1HSBA 4FABH 1F90H 3MLWH 3UTSE 4HIHA 4PRNA 3BZ4A 3RU8L 5SWQB 3SE8L 5DSCB 4ODWB 4U1GC 1WJ3A 3U7AA 4ZSOA 1PGRB 4XH2A 4ODVL 2R9HC 2CXGA 1T2XA 3MCLH 5EIQA 5C3TA 1ZHNA 3EFDH 2VERN 1TMCA 2F54A 2VSDA 1EXUB 5DYOA 2PO6B 1FAIH 3PNWB 4ZQKB 1NCUA 4F33A 2H9GB 4EUPH 5I15L 5LBSL 1SEBB 2FATL 1K8IB 3MV8A 4P2OB 1KJ2H 4MAYC 2YKLH 3PL6C 4YGAB 5KOMC 5IMLA 3ARGD 4PJ7E 4EUPA 4JFDA 1Z0NA 1CL7L 2ZCLL 4JVPA 5KSVB 4R9HA 4OCSL 1NLBL 2R2BA 3QH3A 3EAKA 4QRRA 2HLAA 5IROC 3TJHC 4XVSL 4PJAF 3IDIA 1IEAB 1WCBA 1LO2L 1YNTA 1M6OA 4PP1C 4LPCA 3O9WC 2W60B 4L8BB 3VH8A 3NCJL 3D48R 4P2QA 3UC0L 4GMSL 3IFOA 3LRHA 4DAGH 1T7WA 4HZLA 2EYSB 5E08L 4LIQE 5D2NB 3RY5A 4P2YA 1U2CA 1I3GH 5GGRB 1E4XH 4U1SB 5H35A 4YC2B 3GMRA 1DQLL 2O5YL 4BM7A 4G43A 3WFDH 5JA9A 1FLRL 4NQDA 2GJ6D 3MJ9L 1RUQL 3PWNB 1GPOH 3EHBC 5MI0B 1IGJB 3PG2A 3GIVB 3FO0H 2VLRD 1ZSDA 1F3JA 4F37F 2HJKA 3G5ZA 4ZPVB 3PIQA 1QVOB 3LEVH 3ZLQC 1VEMA 3UTQB 3BDBA 5KS9E 1G0XA 4PJFA 1MLCA 5GZOD 1JGLH 1VGKB 4R6UA 4U1LB 1CIDA 4GBXC 3E2HC 3MLSL 3TM6A 4CVXB 2OMNA 1RIVL 3ARWA 5DHVH 5TDNA 1YN6B 4Y8AA 2YXFA 5I0DA 5JW5B 5JIIA 2NZ9C 5B39G 5DHVA 2ZPKL 2WWMD 5IVZA 3PHSA 3T65B 3KXFD 1ZVSB 1ORQA 3IU3B 3BSZL 5DMGD 3DRQB 1FNSL 2ZG1A 4MA3A 4JZNB 2W9EL 3WFEH 5DUPH 1XGPA 4LASL 1XF5B 5EC1B 1MFCL 3N1PC 2IQ9L 3DURB 1QSEB 3TBWB 3BAEH 3HC3L 4HS3A 3OB0H 3P0GB 5F7EH 3T8XA 3RX5A 3KPPB 4M02A 5IUSA 5L2JB 2P48B 2DD8H 1PYWB 1GGIL 4JKPL 5JW3L 2FHBA 3HG1E 5GSVA 2YOCA 1Q0XH 4JREC 4I3RL 2VKXA 4XWOD 5C92A 1EJ6A 1RUKH 4RGNE 3CUPB 1VACA 4JZJB 4WY7L 3DYMA 1H3WM 1A4KB 4JPWL 4OD2B 4ZUTA 4U2YA 3DUSB 4HWBL 1IGIL 1YJDC 2DQIL 3RUGB 2FEDD 2PUQT 2V5MA 2DYPA 3FQWB 3FB6A 2BNRE 3ALXA 4Z7WB 1P7QB 1MCHA 4L5FH 1KCKA 1PQZB 3FZUD 1IGTB 4EEEA 1FZOB 3U1SH 2X5PA 2OMBA 3HR6A 1U8OB 3S5LB 4Z0BH 5I19L 4UTAL 1MI5E 5MEOB 4OBSA 5IQ9A 5AG9A 4XVUD 2WQ8A 5DUML 1AI1H 4F80A 4OF3A 4LLAA 3VGHA 5DEGB 4HFWA 3SGJC 3GO1L 5JQHC 4KRNA 1Q0YH 3LMJL 3TZVB 4I5BB 3N1GC 2LU7A 3QBTB 3ERYA 1U3JA 5DURB 5DS8B 3OF6D 4LU5L 3ARDA 5DD6A 3MNZB 1KGCD 3VFOA 5C0RL 5IW6A 3VXRA 1XGUA 4I0PB 3UCRA 5AZ2H 2EO1A 3DBXA 4C58B 2JJUA 1D5BA 2DQHH 3B2VH 1BLNA 3IDXH 3FQUA 4OIIH 3WUWA 2GUOB 5KSBA 4U4BA 5IIEB 3MLZH 1HXYA 4DW2H 1FAKT 1N8ZB 1CFQA 1BJMA 1KELL 1S3KH 4PG9A 5IF0B 4H0GA 3V6OC 3MODH 4EDWH 4GRLD 5JDSB 1V7ML 1S9YB 2B39A 1RZ8B 1PSKH 1JYVA 1NGPH 3D39E 3PHOA 5J7CC 1H3GA 2NY4B 4MS8A 3RX7A 1CGVA 3HTLX 1T1WB 1MFBH 3Q3GB 3VJ6B 4LVNC 3C60C 4U0RB 4LKCB 2IAMD 3UTSD 2EXYC 3JZ7A 4KQ3L 4IRJB 2D03H 1RV6X 4ZSOE 4HJJH 4GKZB 4FFZH 4MD0A 1P2CA 3FO1A 4J6RH 3CFEB 2CQVA 3PGCA 4WTZG 5F70A 1RJLA 2GK2A 5FYJL 2F54E 4IRZL 2OTWB 2HG5A 3QUYC 4OD3H 1AGBB 2ADGB 4GLRI 3U0WH 3MV8E 2Q8AL 3LN5A 1XF4B 4JFDE 1ZA6A 4NN7C 4BQ6A 3CSYB 3GBLA 2J5LC 2J4WH 3FT4B 3K4AA 3MRPB 5GIRB 1ZT4A 3LHPH 4KJYA 4QRRE 5BV7H 2GT9B 1Z0MA 3GFUA 3O8XB 3HNVL 1ETZB 3WNMA 3MO1B 4CUCA 5KANG 3NPZB 4KTDH 4MD4B 1FE8H 2IADB 1S5IL 1P84K 2CJUL 5I8OH 3L3HB 2ATKA 1J88A 4P2QE 3ZTJG 2VSCA 3VWJD 4WV1A 3UJIL 2QSCL 3IF1A 3WLWC 5DA4A 2FD6L 4W70A 5DUBB 4LHUA 4ODHH 3RWEA 1I8MA 4EIZC 4Y5XA 1N3NA 3QUXD 1OAQL 3ZYJA 1WFOA 4ZFZB 2AJXL 1CICA 3CMOL 4E41B 4ISVA 4NQDE 4NQCA 2P8MB 4WEBH 3S37L 4QXTA 1I3RB 1YNLH 3QEQE 5GS1A 3IVKA 1BX2A 3N9GL 3SKNA 2B7DT 2H8PB 3B2UC 3PWUA 3AS2A 4HIEA 2QV2A 4LLUA 2QADD 1GGCL 4PJFE 3C09C 1B90A 4X98B 1OT2A 5GJTH 2BOBB 2NX5A 2N7AA 4G6KL 2YK1L 2NCMA 3C5ZB 1E28A 5EZIH 1LEKB 2JCCF 2FH6A 1T1YA 1DE4A 4JG1H 4N8CL 3ARFA 5I8CB 4A2MA 4UQ2A 2VO5A 4WHTB 4M93C 4U6YB 3V4VH 4BZ2L 4ELMF 1KCUL 5GPRA 4EJ1C 4GG6F 1I8IA 1MCEA 4PLKC 2Y5EA 3WO4C 3FRPG 4UV4H 3CLEH 4WWKD 1GXEA 5D70L 2BZDA 5J11C 2OI9C 3SDDD 3OHXB 3VFUB 1T2QL 2Z35B 4TSCL 4MYWB 1AP2A 2YD9A 1DLHB 3RGVD 2L7JA 3DSNA 3CIQA 2XFXB 2D7OA 4QXWA 5FM4A 3DTXB 3HG1D 4XNZB 2Z31B 4G6FB 4CVZB 1JWMB 2OJZL 2DI9A 3BUYA 1UZ6F 3BP6A 3CDCA 4RGND 4C83A 1FORH 2DS4A 1YQ2A 5FO9A 4JDZA 4M43H 3MREA 3VW3L 1DBBH 4XBPB 1SYVA 4PRPA 2IC2A 4GUPB 3LKOA 2Q20A 4PRIE 5FOBA 5INDB 2BNRD 2EYTB 4H0HB 4CW1B 5KJRL 5JUEL 1CL7I 3D2UD 1Z9LA 2F53B 3R0MA 3VFGL 4HBCL 5IV2B 1HILB 1FNAA 1QOKA 5GZOC 4JFYA 1JBJA 1UACH 3PWLA 1MI5D 3QXWA 3ZZ1A 4OQ1A 5HGHB 1GAFL 4AENB 3KHQA 5B38G 2IBZX 3VRLF 1CWVA 4MJIA 2YD1A 5IEKB 3LEYH 5EZJA 1WK0A 2OK0H 3P77A 4U05A 3ULUH 2MQ0A 3BKML 2P5EB 2P4AB 3E3QA 1LVEA 5DMGC 3O0RL 5HDBE 4H88L 5JHLL 2H2PC 4NGHH 5SWQA 5DSCA 4ODWA 2AXGB 5FGBC 3VXRE 2IANB 3LAFA 4IMKA 4X4ZA 4XMPL 1KNOB 1YYMH 3RPKA 1F4YL 1F42A 5IHLB 1Q9WB 1KULA 1RJZA 4RMUA 2XACC 5DD3H 1BQSA 1BIIB 4NC0B 5KSBE 5I17B 3TIEB 3I6KB 1MHPH 1EXUA 2VDRL 5HD8D 1YEHH 1A7RL 2PO6A 5T5NG 3PNWA 1OAXH 4ZQKA 3L5HA 2XTJB 4XWOC 1NCBL 1SEBA 1K85A 4B53A 5I1JL 1JFMA 1K8IA 5BXFA 4ERSH 3WJLA 1YEDB 3OZ9L 5KSVA 2FEDC 3HAEG 2QTEA 1KEGL 3D39D 4JG0L 4OI7A 3IDNB 4HF5H 2EDYA 1IEAA 3F7PC 3FZUC 4HIXL 2NLJB 4X8JB 4X9IA 4OLUH 3AROA 2W60A 4L8BA 4QT5B 4G80B 3QXDB 4GMTL 1FBIH 4XVUC 4LHJB 1K3IA 2F54D 2EYSA 3TN0C 4R4FH 1BREA 2Y06H 5GGRA 5MEQB 4U1SA 3QUMB 1OSPL 4K7PH 1X9QA 1MIEL 4K2UL 3MV8D 4WFHE 1F4HA 4JFDD 3ORJA 1DQDL 3PWNA 4Y19A 2QQNL 1IGJA 3GIVA 1OQXA 4KTEL 5GGSB 4D0CB 1WLHA 4QRRD 5M7QA 4ZPVA 1L4IA 3IRPX 3L3KB 4LSVH 5EULV 1YA5A 4YO0B 5JOEA 3F6LA 4LQFH 2AK1L 1J10A 3RWCB 2C1PB 1VGKA 4U1LA 4JM2B 5FOJA 1A2YB 1UT9A 4CVXA 4X9FA 4P2QD 1BFOB 1G7HB 3JWOL 1JWUB 1EAJA 1YN6A 2V2XB 2XICA 5JW5A 4RIRB 4GRLC 3BD3A 3BPOC 4M8QB 4WW2B 4JB9H 1KN4H 3OXSB 1ZVSA 4ZS6D 3IU3A 3QO0A 4OFKA 3QI9C 4NQCE 1YEKL 2YZ1A 2LVCA 4U1IB 4PIRF 4XPHL 3DRQA 3S97C 2V9TA 2EH8H 4JZNA 1FL5B 4NQDD 4QRPE 43C9B 1XF5A 2IAMC 5CS7A 5EC1A 4KVCH 5E9DB 3AY4C 2WUBL 1RMFH 2EH7H 3DURA 1QSEA 3QEQD 3TBWA 5L6YH 5D7SL 3KPPA 3HI1B 5L2JA 3BRGC 1GGBL 2CUHA 3E6HB 4P3CH 1PYWA 3NVQA 4J3TA 3RAJL 3CVHB 1CU4L 1IGFH 3TCLB 3FN0H 1S9KC 4HUXB 3BKJL 4F7EB 3LN4B 2AEQH 3ARUA 3CUPA 4JZJA 4PJXB 2YD2A 4LVHB 1QYGH 2EE3A 3DUSA 4LSDA 5A2FA 3RUGA 3FONB 4FFYH 4ZAKB 3FQWA 1MQKH 1QKZH 2CMRH 2ZG2A 3MV7E 1P7QA 2WUCH 5EH1A 1IQWH 4YFDB 3QDGB 3SPVB 4OZIE 3X3FH 2OR7A 1PQZA 3NFSL 5EZOL 4ZFGL 1IGTA 1YEIH 5LCVL 1FZOA 4PBXA 5EUKB 3QPXL 1U8OA 4TN9A 5GGTL 3S5LA 1I9JL 4ORZC 4A6YL 5MEOA 4X6CB 3HS0B 3SQOL 4YIQB 2UV3A 2UZIH 2FHFA 3TZVA 4M8VA 4I5BA 5JPMB 1YC8A 4DGYH 1A6TB 3QUXC 4N0CA 1F5WA 3CMGA 3FB5B 5DS8A 3VXPB 3U9UB 2KDGA 4JAMB 4XP6L 1I3VA 2KPNA 3UAJC 3MNZA 2VNCA 2DYPD 4WENB 2HWZL 2Y6SD 4I0PA 4PD4J 4UMGA 4X7FC 1UH4A 4PRID 1FNHA 5FUCE 3TH4T 4W6YB 3TVMA 4PJ8B 4IIQB 1K2DB 5D6DC 2GUOA 1ADQH 3E6FB 5D7KE 1N8ZA 4F7PB 2VDML 1ADQA 5IF0A 1DDHB 3GHEL 5JDSA 2ICEB 1S9YA 1EERB 2BY2A 4DUWA 5D96B 2MMXA 3D0VB 5E5MB 4XNQB 4XXCC 4X4MA 3E3QE 5FGSA 1X5AA 3T0XA 1NFDF 1RZJL 1HI6A 2VISB 2X7LB 4P48A 1IAIH 1T1WA 3Q3GA 3BIBX 5I1EH 3VJ6A 3ARDD 1W2KT 3TBYA 4WWKC 3IAPA 3GI8H 1S78C 4IRJA 3VRJB 1YNKH 3VXRD 3SDDC 3JTCA 2OP4L 5JW4Q 3C08L 3CFEA 5BVJB 1XR8B 4FQJH 2E3VA 5FV1L 3HFML 4LP5A 3CXDH 2OTWA 1HH6B 4XP9L 1IKNC 1KENH 4JPKL 5AZEH 3RGVC 2BVOB 1DTUA 2JJSC 1AGBA 2ADGA 4PUBL 4L8SB 1KJ3L 3VWKB 4WNQB 2OJEB 2BOCB 1DBKH 3NIDF 1OQOA 2LQRA 4X4XB 1N5AB 4RGNC 2VL5B 2C1OA 5GIRA 3FT4A 3MRPA 3RKPA 3GI9L 3SKMB 3C8KB 4MS8D 2GT9A 1T89A 2G60L 4X4YB 3O8XA 3KPLB 3CX5K 4X6DF 1ETZA 5LJYH 2VC2H 3MO1A 1J0ZA 4JRWA 1MF2L 4MD4A 4XMLL 5IHUL 2DMBA 2OL3B 2IADA 2CXKA 2LFGA 2RB8A 5DVOA 3L3HA 4MA1B 1JYWA 4L8DB 3S7GA 3V7MA 1YQVH 2D0HA 1XEDA 3QG6B 3WLBB 5JR1H 4RFEB 4M4PA 5D2NE 5EUOF 4CVWA 3ESVF 4KVNH 1MWAB 1QR4A 3LKPB 5DMIH 1EHLL 3DMMD 4ZFZA 5I6XC 4E41A 1IT9H 3V4PH 3QQNA 2DQTL 3IGAB 2GITB 2NR6D 1DBMH 1I3RA 1XIWB 4PJDF 3U7YL 1UA6H 3V6ZB 1XCTB 1BZ7B 3DNKA 4WFHD 4K71C 4KUCF 3WKML 3OX8B 2H8PA 3T1FB 4JQVA 4S11A 4MB4A 3MRBB 2HYMA 4X98A 3EJYD 2BOBA 3JV6B 3DSFL 2H6PA 3K80A 2Z4QB 1IGCL 3C5ZA 4DJMA 3W9EB 4HPYL 4GS7B 1LEKA 1N7ML 4LHUD 4NFDA 5I8CA 4PJEF 2NY0D 4WHTA 4HGWB 5MENB 5EDXA 4U6YA 1CICD 1SEQL 2IPTH 1S7WB 1Z5LB 4HXAL 4NQCD 3MV01 2CKBB 5GS2H 1ZA3B 4PJAB 1QFHA 3EKCA 4QRPD 5TDOB 3OHXA 4KJWD 4QGYA 2Z35A 3ARQA 1A21A 5I16B 5E7FA 3U4BH 3VFRB 1DLHA 4Y4FD 4BSWB 1B4JH 5IB1B 4LLMB 2XFXA 3PE9A 3DTXA 2Z31A 1JWMA 1C5CH 32C2B 3DIFB 1U42A 1F6LL 1QFUL 1A7QH 3RUGE 5D7JD 3WKNA 1WZ1L 1IAMA 3ARFD 4QGTA 1KFAL 2WWKO 3D3VB 4XBPA 4Z7WE 5LQBH 1JHLH 5ALCL 4GUPA 5E7BA 5INDA 5DRWB 3ME0A 3MV7D 1MCWM 3FKUS 4QRUB 3TC9A 4M1DL 4X0KB 12E8H 4CW1A 1TIUA 3T0EB 1INEL 1C08B 3QFJB 4YJZL 4GKNB 3L5IA 2F53A 4RA0C 4LCIL 4PREB 3IDMB 5IV2A 1HILA 1YY9D 1N26A 2D31B 3KJ4C 2EIZB 4PTTA 1F3RB 3SO3C 1BJ8A 5HGHA 1ZGLM 1U2HA 4AENA 1LP9A 1QP1A 3GNML 4F58L 5L8LB 5KVDH 4ZS6C 2P5EA 3JSSA 3BE1L 1FIGH 7FABL 1A1OB 3EYUL 2IANA 1WV7T 1KNOA 4JR9L 4XVTL 1A7NL 3H8NA 4YHIB 1ZVHA 5KVEH 3G5YB 4HUKB 4K3EL 4NPYB 1BIIA 4TUOA 4LNRB 3TIEA 3I6KA 5CUSL 4LOUD 4LPXA 4QF1B 5GJSL 2M8XA 2RBLA 4M3KB 2X1WL 5D7KD 4V3EB 3ES6B 4W4NA 1NMCC 3MBXH 5IG7B 2BY1A 4OQTH 5CINL 1BAFL 1YEDA 3VFTB 3DLQR 4R96B 5JMOC 2MCPH 5D2LB 3VXNB 3IDNA 4Z7VB 3RPIB 2DM7A 4C4KO 1Z9MA 4MX7B 1MFEL 4K3HA 4EUPG 1EZVX 2NLJA 4NZTH 4X8JA 1N4XL 5FEBA 1LEIB 4HH8A 3RJQB 4JY4B 3KR3H 1CLYL 4G80A 3AXLB 1X4YA 3EDJA 5HHQB 1MELA 5BO1H 3K2MC 1MCOL 5IGXH 1K4CB 2YUXA 1JE6A 4OCRH 5IB2B 4I18C 1W8NA 3HI6L 1MIMH 5MEQA 2DJSA 1U3HB 3R8BB 3QUMA 3V8CA 3HI5L 1JHTB 4NNYA 4MB3A 4YDJB 2ZJSH 4P2OD 3MRKB 5L7XH 4HPOH 3D18B 1BQHB 2GTZA 5JXAL 4HGKC 3WXVL 1NMAL 5HJ3A 1Q9OB 1Q9KB 4EDXB 5GGSA 4D0CA 2Y6SC 2PXYB 3WHE0 2I9TB 4HKZB 4UAOB 5HDQH 3RY4A 4LARH 1KCSH 3L3KA 1TNNA 4YO0A 4F7CB 5CD5D 1X5IA 5GRVL 2VXQL 4Y5YC 1G1CA 3PDGA 2C1PA 4UT9L 4JM2A 1A2YA 4FQLL 4FZ8L 5B21A 2BRQA 3NH7H 4XPTH 5DD5L 1BFOA 1G7HA 3OAUH 1JWUA 4JQIL 5ALBL 5JHDE 2V2XA 1DR9A 2BXYA 4RIRA 1RZIB 1NUDA 4WW2A 2DB8A 3OXSA 4OCXL 5C0IB 3BT2H 4E41E 2LU4A 4M7ZB 1OARH 3DHMA 4U1IA 3OG6B 2W9LA 4OUUB 2EDFA 1FL5A 3ARDC 3U83A 3S34H 1RI8A 43C9A 2V5SA 3A67L 3P4NB 5E9DA 2I25N 3CFJB 3A6CL 1ZKAA 2A73B 4NNPH 3U0TB 5IFHL 3MOBL 3HI1A 4TUKH 4L3AA 4Y1AB 2RQ8A 3E6HA 3QPQC 1T04B 5E4EB 1KB5L 4MAUL 4OZGB 3CVHA 3OKOB 3RWFB 2W07A 3V6BR 2WLZA 3O3EA 3TCLA 4GKSB 6FABL 2W9DL 3UTTB 3LN4A 1K6QL 5HYJB 3MLUH 4PJXA 3I6LE 5CZXD 1EJOH 4HX1A 2ICES 2X4SA 4L1HA 3FONA 2F8VA 4KI5F 4ZAKA 3CK0L 1ACZA 1KG0B 1U8PB 4O5LL 3ULVF 3GDBA 1MHEB 3QDGA 4M4RA 3N06B 4MS8C 3SPVA 4UT7H 2YPKB 1SJEB 3RGHA 3W5NA 1PW3A 5EUKA 3AFLA 4P5TB 4QRSB 2DDQH 5JW4R 2VL4A 3GMMB 4U33A 2APVA 2XZZA 4R7NB 3UP1A 1RVFH 4X6CA 5I1IL 3O2DH 3VCLA 4YIQA 5C08B 3NFNB 2Y4SA 3SGKC 1PZ5B 5JA8B 3O2DA 4R26H 1ZK9A 3MV11 5JPMA 1A6TA 3FB5A 3U9UA 3LDBB 3DMMC 4JAMA 1RIUH 3QRGH 2V17H 2RGSA 3VXSB 2NR6C 5HHNA 2WP3T 1OP3K 5ECJE 5E95B 1P7QD 3RQ3A 1W72H 5IVXF 5K93A 3RVUD 1HWGB 3O3DB 2F53E 3WJJC 4NM8L 1XT5A 4M6OL 1NL0L 2WM0A 5EA0L 3X12B 4PJ8A 4IIQA 1K2DA 2YD7A 3E6FA 4RNRB 5M95B 4FZEL 3MLTA 4BQ8A 3V9FA 3KLHD 3MRMB 3IJSB 3GSRB 1DDHA 1OAUL 2ICEA 3NGBC 2DIJA 5CGTA 2JCCB 4NT6B 3D0VA 1RZKC 4XNQA 4OT1L 3U9PH 1I1YB 3TZVD 5ADOL 4NWUL 4Y5XC 4XNXL 2P5EE 4ODBD 1LO4L 4N0CD 5DURD 2VISA 2DQDH 4HKJB 1X3DA 2IANE 4OF8A 2CRMA 5HHOB 3VRJA 3QCTL 2B4CC 3LV3B 4I0PD 1XR9B 3S36H 5BVJA 1XR8A 2VKWA 1KYOJ 1FL3B 3QT2A 3ZMRA 4RMRA 1G6RH 1A7OH 1HH6A 1F8TL 4ZD3H 2WLYA 3JVGC 4Y4FC 2BVOA 4JPVL 3WS3B 1SM3L 2XTJE 4L8SA 4P3WA 4TTDD 3VWKA 2OJEA 1HHHA 2BOCA 4HUWA 1E6JH 4UNUA 2ICCA 1G6VK 1KSRA 1H3UA 3JV0A 3UZQA 4X4XA 1TTUA 1N5AA 3BEVB 5E94B 4D3CH 1XGYL 4PJGF 2VL5A 5D7JC 3ARFC 4YK4B 1V8HA 2BCKB 2A9ML 2XZAL 3C8KA 3SKMA 2NY4D 4KUZH 5A3ID 4X4YA 1OD7A 1KT2B 3KPLA 4PJIF 2OL3H 3GHBL 1P69B 3LQAL 2VXVH 4NNXB 1G0YR 4LAJH 1YMHA 5J3HD 2OL3A 5GRZA 4IRJD 5T3ZH 4YQXL 2AJUH 3CU1A 1CFVL 4BQBA 5LGHL 4L8DA 2AQ1A 4X7SH 1MHCB 3QG6A 5T1LB 3WLBA 5BMFL 1CT8B 4RFEA 3ARBB 1S7SA 4NZJA 4G7VL 1BZ9B 2JF1A 4X6FB 1MWAA 3LKPA 2HT2D 3EJZD 1CE1H 4B7LA 1SVCP 5EU4A 1CK0H 1F58L 1OW0A 2Q87A 1XIWA 2P44B 3V6ZA 2X05A 1XCTA 1BZ7A 4MGXA 1IQDB 3OX8A 3T1FA 4JFHE 4YUEL 3KLDA 4DGIH 1J5OH 3F58L 2OZ4A 2VITB 3QCVL 4QXUL 3MRBA 4JFPB 4TSAH 2HFGL 3RL1B 2R2CA 2AERT 2AABH 4HQQH 4MA7L 2CGRL 4YXHH 3JV6A 5FUCC 4DN3H 2O93L 4NO0A 3MJGX 2Z4QA 5ANMB 3HZMB 1OF2B 2C26A 3W9EA 5D9SB 5GGQL 1RK1B 5JHDD 1C16B 2P24B 5GGVL 3GIZL 4HGWA 5MENA 3HNSL 1CDIA 2CKBH 4FQPA 4JO4H 4E41D 2YC1B 1Y18B 1Z5LA 4Y2DB 4G6JH 3BP7B 2P1YA 1CDJA 2CKBA 4WHDA 3S88H 2AQ2A 1P4IL 1ZA3A 4PJAA 5E9DE 1NCWL 2F5BH 3RIAK 4L3EA 5D6CA 4IMKC 3T0AA 4DQOL 2WANA 5I16A 5F7LB 3VFRA 2BJMH 5IB1A 1MCFA 3BFOA 4LLMA 4K94L 1XMWA 3TGXA 3IRZA 3C5ZD 3FJTA 4YDVB 32C2A 4HEPG 5HHVL 4K7PY 3I6LD 3D9AL 1AGFB 1ITBB 4P2OC 3BUTA 3D3VA 1WT5C 3N85H 5FHBH 2I24N 4PJ9B 1LE5B 3QDGE 1FGVH 3WJLC 4X7TB 5DRWA 4QRUA 4MXVF 4X0KA 2FHCA 2L7UA 4LAQH 1U58B 3T0EA 1C08A 2R29H 3QFJA 4GKNA 1HNGA 1NBYB 2WV3A 4PREA 3PQYE 1YUHB 2AI0L 4X6CE 3AS3A 3IDMA 2D31A 3MGTB 1NSNL 2EIZA 1A4JB 1LWRA 3ZKND 5I9QB 2H41A 1R0AH 4ODUB 1A6PA 3T0VA 1ZTXL 5DJDA 2Z31D 4G6FD 3DPBA 1WTGT 5D2NC 4HUVB 4AJ0A 4KPHH 3DRTB 4YC2C 1JPSH 5DJAB 1FC2D 2AV1B 3SDXF 3X14B 1DLFH 1A1OA 1NKRA 2D7TL 3D0LB 2HJFA 2V6HA 2CPCA 5J8OA 1BBJB 1WVZA 4P59L 4YHIA 2EC9T 5MI0C 1F4AA 3G5YA 1TJIL 1PBYA 4Q9RH 3V52H 4NPYA 4MHHI 4N9OB 1KIQA 4NZUL 2DTML 1D9KB 1TVBB 2F53D 2W0LA 4QF1A 5LXGL 4ONFH 1MCDA 5C1MB 1J9CT 3H2WA 3ES6A 5CZXC 4KMLB 3C2AL 5IG7A 4WI4A 2Q8BL 2E6JA 4WUUB 3RZWA 5IB3B 3VFTA 5C0BE 3SOBH 4R96A 1N5YL 4M7KL 3SDAB 3MLPA 2P5ED 4E0RB 3TBSA 1CTOA 3VXNA 4PJHF 4GAFB 4MX7A 3SDYH 1JGEB 2IAND 1LEIA 5DGRA 4B5EA 3NCBB 2N4IA 1J12A 3AXLA 4TULL 5HHQA 1K4CA 1JNLH 4K07A 1MJ8L 5E99L 4AL8H 2XWTB 4O2CB 5C6TH 4XWGH 5IB2A 5F7DB 1Y0LB 1U3HA 4L9LB 2XTJD 2CIIB 1JHTA 4YDJA 4ZOBA 5E56A 2AAVA 2ZUWA 3D18A 1BQHA 1BVZA 4LCWB 4RMVA 4ONGL 3N1QC 3CZFB 1Q9OA 4RSVA 3JWDL 2DQUH 1Q9KA 1MREH 4GLRH 3SN6N 4EDXA 1EFXB 3ZO0A 2PXYA 3BZFB 2I9TA 4HKZA 4M9OA 3RVUC 1U8NB 1AGDB 3MACL 2H32H 4F7CA 3DX6B 4RWHA 2YPLB 3ZTNH 4JLRB 5F96H 3PGFL 2NY7H 3KLHC 4JHAL 4ALAL 3OAZK 1RZIA 3GUTB 4P4KA 1BFVL 4I4WB 5FYLL 1RIHL 4WHCA 4Z7NE 5C0IA 4LSRH 1NFDB 2VDPL 1MY7A 3AREB 1IZKA 4MVBA 3KPSB 4KAQL 4N0CC 3BDYH 3M1BB 1D5IL 1NH6A 4OUUA 4Q9CA 3PJSB 2VZSA 2QL1A 2DLFH 3P4NA 3RTQD 3QHZL 3CFJA 1RUAL 2A73A 3U0TA 1OTTD 4I0PC 5CZVL 3AGVA 1NDGB 5FM8A 4Y1AA 4JFHD 1E4KC 1T04A 3MRFB 2NW2B 1KTDA 3OKOA 4K7FB 4KHTL 1WBXB 2NY5H 5B39B 3DX9B 4HUUB 3UTTA 5AD0B 2EDEA 1UCBH 2VLJB 4TTDC 5HYJA 4NN5B 1OSZB 1OAYL 3JUZA 5AWNH 5MENE 1ZE3C 5C07B 1BIHA 3OB0K 3MUHL 4AQ1B 4XPAL 1KG0A 5DF0A 1JI2A 3WD5H 1QSZA 1MHEA 4PJAE 1EEZB 1Z9OA 4Y7MA 2YPKA 1SJEA 4FQQA 1AQDB 3UJTH 2CLVB 4K3JL 4IDJL 4U0RC 2G9HB 3I3BA 3W0WB 5E9DD 1J0KA 1QSVA 1NUFA 4P5TA 1FZKB 4GW5B 4QRSA 4C56B 3GMMA 4R7NA 1GHFH 5JOPE 2HFEB 4JDTL 3THMH 3NFNA 1H3XA 1NCCL 1PZ5A 4HLJA 5EUOB 1NQBA 4PJBE 2X44D 1S9VB 3MOQA 3HCVA 1I9IH 1J1PL 1U6AL 2HT2C 3RU8H 3EJZC 3FT2B 1MPAL 3NIFF 1B6DA 3D3VE 3VXSA 3S36X 4ZAKD 4HIJB 3MCG1 4YHMH 3V6FB 4ODVH 3QDGD 4N0FB 4DKAA 4QRTB 1X4ZA 1T89C 2HFFB 3T0EE 3QFJE 3D6GA 3O3DA 5AUMB 3DV4B 2Z8WC 1TCRA 5HGAB 1UENA 2QEJA 3X12A 4N90E 4RNRA 1AIFB 3RVXC 5F71A 5I15H 5LBSH 4P23C 4F15C 2FATH 2ZUTA 3PQYD 5T3XL 2VQ1B 3MRMA 3WNLA 4F8QA 3OJDB 4Z76B 3GSRA 1ULVA 3HZKB 2YA2A 1CL7H 2ZCLH 2JCCA 4NT6A 3VI3F 4OCSH 4PJEB 1NLBH 1I1YA 3UPRB 1UZ8B 3OAYH 4LVEA 4Y4KB 3VFSB 4HKJA 1BFTA 4GG6A 3CSPA 2CK0H 1LO2H 3TJEL 1N0XL 2PYEB 4PB0L 5K9JL 1YEGL 2A77L 3ZL4H 1A7PL 5HHOA 3NCJH 1JHKL 3LV3A 4DUXA 4YE4H 3E0GA 3UC0H 1XR9A 4RISH 2EE6A 2V9RA 1X4XA 1CLOL 1FL3A 5E08H 1EA9C 1YJDL 2KUTA 4PJ8D 4UU9B 3MR9B 4OB5L 3WS3A 4M6AA 5A40E 1DQLH 2O5YH 4WI3A 1YMMB 1FLRH 3C5ZC 1RUQH 2YR3A 3OKNA 5L88L 3T2PA 2A0LD 2DL2A 3BEVA 1FYTB 5E94A 3MRLB 2D0GA 4M7JL 2X4OA 3D87B 3VXUE 1IC1A 3TCXA 5ACZB 4HT1L 3ZT7A 2BCKA 5D2LE 4Z7VE 4QYOA 4JPIB 1NCDL 5C0BD 1KT2A 2Z8SA 3U79A 2FJHB 3QR2A 3BYYA 1HYSC 3OBAA 4NNXA 3ZKXB 1A14L 2V5RA 5A2JH 1P9MA 1WEJL 4X80L 4DOHB 1IL1B 5DMJB 4MA8H 3V79C 1ZLVK 4RFNB 3BGMB 5EC2B 4NC1C 1I1AB 5DFWH 1MHCA 2WK2A 2HVKB 5T1LA 1UYWL 2ZPKH 3BO8A 1TZHB 3ARBA 4XGZB 1RFDL 4X6FA 3VWKD 1FNSH 4NN6B 3UYOD 1MCSA 4RZCB 2W92A 1MFNA 2R1YB 3QEUB 2VXSL 1MUJB 4POZD 5BZWB 1MFCH 1ZLWH 2IQ9H 1JRHL 1J1OL 3HC3H 3MV9B 2X40A 2YD3A 2R0LL 1IQDA 4YHLL 4YGVB 3EJJX 4JDVB 1GGIH 5B22A 4Q6IB 1X6NA 2VITA 4I3RH 4JFPA 2CR6A 3RL1A 3EYOB 4YPGB 4WY7H 4NM4L 4J12A 1VESA 1T7XA 4P49A 3HZMA 1OF2A 1EMTL 4HWBH 1IGIH 2Q3ZA 5D9SA 4NJ9L 1RK1A 4HWEL 4HWBA 1C16A 2EDDA 2P24A 4ZFOL 1QFOA 4TQEL 3KPRB 2DWDB 5LWYL 3ILPA 4WW1A 3LKNB 4ZOEA 1B0WA 5ITBH 2YC1A 1Y18A 1F6AB 3O11B 3WXWL 5I19H 2IGFH 4UTAH 4LFHG 2R8SL 4QWWC 3BVNB 3PDOB 2DRUA 4HAGA 4NFCA 4TUJB 4YBHA 3QDMA 5DUMH 3RVVD 4PP2B 4AMKL 4AH2B 1A02N 1J05B 3KAAA 1FRGL 4K9EC 3GO1H 4OZGE 5DI8B 3LMJH 3NFPB 1QR1A 4RDQG 5HGBB 3UTTE 3V0WH 4HJ0D 3S4SB 4LU5H 4NHUB 4YDVA 1FQ9C 2X10A 3PDDA 2AJ3A 5KVFH 2V5YA 5D1ZB 5C0RH 2V2TB 4JHBA 1Q72L 1AGFA 2UVFA 3V4UL 5MEND 4PJ9A 1LE5A 1YEEH 2YRLA 4G8FB 5IW1A 5ACMA 4OGAD 5F1NB 4U6VL 4KGLA 2QR0B 4XNUL 1AFVH 1U58A 5CWSB 4MJ2A 1UH3A 5T5FH 1NBYA 5I2IB 1YUHA 4ENED 4Y2OA 3MGTA 1A4JA 5C08E 3SGDH 1FHGA 1FPTL 2GW5A 5DHYB 3RA7L 2ARWA 4G6AD 5JOPD 3LRGA 3L3GB 1N6QL 4AEIL 2UZXB 3TBTB 4OLZL 3DRTA 3QULB 4LLDB 5DJAA 1UM5L 3BGFC 3MRJB 3VXSE 3X14A 2VZVA 4QHNB 4OF7A 3D3VD 2R0ZL 1HXMB 1BBJA 3RTQC 3P11L 5FYJH 4IRZH 1OTTC 5CJXA 2BMKB 2IALB 1EUUA 3T0ED 3QFJD 5FYKE 25C8L 1TVBA 2VWEC 4IOFC 5B38B 2Q8AH 1KB9K 3KYNB 2H2SC 5EU5B 4GXVL 4N90D 3FOLB 3LQMA 1R3KB 2R0WH 4V2BA 2EEDA 2JCCE 4I3SH 4OLXL 4FQ1L 1T7YA 4WUUA 5FA4A 5IB3A 4WW2C 3HNVH 1FCCA 3LS4L 3TT3L 4LPWA 3SDAA 4ACPA 4E0RA 3MRHB 5C8JB 2O26U 3PXJA 3T3PF 1U9KA 2CJUH 7CGTA 5HHOE 2A6JB 1JGEA 4JVWA 4YDKL 3EYSL 1QRKA 1OP5K 2QSCH 1U95B 2FD6H 1DFBL 1GC1L 4NC2B 1A6VL 1ORSB 3BHBB 2VZTA 1PD6A 3WUZA 1WSST 5IMKB 2Y36L 1OAQH 4UOJA 3TA3B 2AJXH 4O2CA 4OTXL 3WSQL 4F7MA 5F7DA 1CE6B 3TWCL 1F13A 1Y0LA 1ZHLB 4QOKB 2BNQE 4X6BB 3NOIA 2WBJD 3GSNL 2CIIA 3HAEB 1A3LL 2VN4A 4NUJB 5I8KH 1CGUA 1G9MH 3HMXA 4LCWA 4LVHC 1FGNH 5HTSA 3CZFA 2YBRB 4R97B 4QNPE 2W38A 5IJKA 3GMPB 4ZAKC 1QBMH 1EFXA 4JHWL 4Q9QL 3SY0B 1M7XA 3V7AE 5TPWH 1VFOA 5IVOA 5IMMB 3B43A 1H0DB 2ZSWB 1T03H 5F9JB 3P9LB 8FABB 1LEGB 1U8NA 2AGJL 5H37G 5JQ6H 1AGDA 1JTTA 3QQ9D 2YK1H 3NACL 2FJFB 3DX6A 1ONQB 2YPLA 1H3VA 5DD0L 3OR6B 4B41A 4JLRA 4R0LC 4C57C 4QHUB 4RBPK 4XCNB 4N8CH 5CCKL 4JZOB 5IMOA 1OM3L 3VRLE 2ILLA 3LKSB 1AHWC 3GUTA 3DETD 4I4WA 4FXKB 1HH9B 4BZ2H 1KCUH 4AYFA 3SDCC 2V7HB 1QBLL 1OTUD 1WC7B 2PYFB 4NP4H 1U3HD 1NFDA 3MZTA 3KPSA 3DI2B 3M1BA 1EAPB 5EBGA 5E6ZA 4WO4C 3AB0B 2WINB 3PJSA 4KKCD 4M5YL 2D4FA 1GGTA 1T2QH 1KTKE 4EQ3A 1L0YA 5MP6H 1S9XB 4TSCH 1B3JA 3AMKA 2LTQB 2PXYD 2J8HA 1NDGA 1JYNA 1HSAB 5E2TH 5EWIH 5C0JB 3FCTB 5D72H 4FQXC 1FFQA 1OHQA 3Q1SL 4K7FA 5ANME 4PJ8C 1WBXA 3GRWL 3RWHB 5B39A 2ORBL 3DX9A 4HUUA 5AD0A 4IS6B 5GHWL 2VLJA 3T2OA 2BDNL 1A9BB 2FBJL 4J1UB 1OSZA 2Q1EA 1P5UA 3BI9X 1QHPA 4PJGB 5D96C 5C07A 2ICWB 1A6WL 1NAMB 2AK4B 4OGZA 5JORB 1G9NL 4MVBD 5KJRH 5I73B 4PJIB 1EEZA 3IAGC 1AQDA 1Y6NR 4EI5B 2CLVA 4HBCH 2G9HA 3RDTB 3W0WA 4ZPTA 3RZCD 1RZFL 3B5TA 4O2EB 3WEXB 5IP4A 1FZKA 4GW5A 4Q9BA 4C56A 2WZPD 4LNVA 5EO1B 2DICA 2HFEA 2FZ3B 3EDKA 5EUOA 5FK9B 3QHFL 3BKMH 2HRPL 2NMSA 2Y5TB 3ZE2F 3TV3L 3UTTD 4PP8C 3O0RH 4H88H 3BPLB 3VWKC 3DX8B 1AR1C 3FT2A 2AW2A 3W9DB 1AH1A 3NPSB 4TVSa 2J88H 4POZC 1F4YH 1KIPB 3MXVL 4IMLB 4JGUA 3UX9B 5EIVA 3V6FA 4LDLB 4N0FA 4QRTA 1C1EL 2HFFA 1GH7A 2O5XL 5AUMA 3DV4A 1T20A 1GZPA 4DVRL 3SE9H 1CDBA 2AJSH 1A7RH 3MYZA 5HGAA 1F02I 2IEPA 3SGEI 1AIFA 4JN2A 4P5TD 4QO1A 3MUZ1 4GQPH 1ZGLB 5I1JH 5KVGH 3NIGF 1VFBB 2VQ1A 4Z76A 3OJDA 3HZKA 2HKHH 5C0AB 4YHYB 5C08D 2M2DA 3OZ9H 1D5MB 5D93B 4P9MH 4PJEA 3UPRA 4JG0H 1UZ8A 5E6IC 4Y4KA 4Q0XH 3VFSA 4TTGA 1T21B 5FUZH 4Y89A 1IVLA 1QLRB 2PYEA 4BZ1L 5CJOL 3VXSD 5F3HA 3L9RB 5FHAH 1UB5A 4GMTH 5KSAA 2XYCA 5FDWB 5EU7E 2BRRH 4GJTB 1JRHI 1QG3A 1FFRA 4ZO8A 4N0YH 1MHHB 4XT1C 4UU9A 5FYKD 2XA8H 4DWHA 4FTVB 1EVUA 3MRDB 4HJ0C 1DQDH 2A74A 4G3YL 4WUUE 4OGYL 3MRLA 4H26A 4KTEH 5ACZA 3EOBB 3UZEA 3ELAT 2MKLC 5J1SC 2FJHA 5TH2B 1PDKA 2AK1H 2XKUA 3O6FB 4OGAC 1A9EB 4WTZA 4YNYB 4YEEA 4H20H 1MRCL 4XPFH 5HHOD 5CFHA 1IL1A 3JWOH 5A2LH 2YS4A 3BGMA 4FG6D 4LIQL 1I1AA 5EC2A 4EBQL 2LV4A 4LCYB 2BVTA 3ULSB 1FSKB 1RAMA 4XGZA 4PLJD 1JZ4A 1AXTH 4XPHH 5M94B 3WIFB 1CZ8L 2JJTA 4RZCA 3KS0J 3QEGL 4IDLA 3I85A 4XNMB 4LCWE 4ZNEA 2R1YA 5B8CB 2ZCKL 2BNQD 1MUJA 5BZWA 2WUBH 2ERJC 3MV9A 3T2QA 1UWGL 3CX5J 4ODTH 2JTDA 4YGVA 4UB0H 1GGBH 4XZUB 2ATPB 1KCRL 4JDVA 2ZUSA 1U91B 4Q6IA 1YY8B 2YPLE 1QTYT 3GBNL 4OIAA 4XHQA 3LS5H 4LEXL 3EYOA 3T0EC 4ZXBC 4YPGA 2VDNL 3R1GL 5FF6B 2EDBA 4KJPD 1U3ZA 4JRYE 4Y4HA 3R0NA 5T1LD 4EVNB 4CU6A 4QHMB 2X4QB 3ARBD 4DZBB 1UJ3C 3H9SA 4DZ8B 3BP4A 1NFDE 2H1PL 1S8DB 3KPRA 2DWDA 3ZYIA 3NFSH 5EZOH 4ZFGH 3LKNA 5J1AB 5LCVH 4ODSL 4PJHB 1F6AA 3QPXH 1RJCA 4KQ4H 5GGTH 3VXMB 15C8L 3O11A 1WQVT 1YYLL 5EPMB 5GGTA 4A6YH 1QFWM 4W6XB 4U6HB 1X5FA 4NUGH 3SQOH 3BVNA 3PDOA 3T09A 5F8QC 4KZDH 4TUJA 4PP2A 1H8OA 1AD9B 3NZ8B 4AH2A 2OSLB 1J05A 1MCIA 5DI8A 3NFPA 2JIXB 4PGJA 1DANU 1T6WA 2NTSP 4KKLD 4U1MB 1T0NB 2HH0L 2VLJE 3S4SA 5IBTL 4XCCL 4NHUA 5AAWA 4WWID 2HTLD 1SBSL 2WIIB 4JN1H 2AQ3A 2WBJC 5D1ZA 5C07E 1UM6H 4LQ1A 2HWZH 1VFUA 1CVRA 2FB4H 4NKIH 3QSKB 4G8FA 3H6JA 3QDJB 2F58H 5EOTB 4CAGA 5GSRB 1T66D 3VI4E 2ZUQC 4Y2DD 1LK3L 4HK3N 2IPKB 5F1NA 2QR0A 2BNUB 3W0WE 5CWSA 2VTFA 3ARYA 4JY5H 3Q5YA 3ALWA 3RWGB 5D5MF 4NHCH 2VDMH 3QQ9C 3GHEH 4BH7B 5EZLB 4PRDB 1G7LB 2ZUVA 4QXGH 5DHYA 5EUOE 2VDOL 1JFQL 1NC2B 5LAXB 3VD5A 1RZJH 3L3GA 1PFCA 2ENYA 3UTZB 2LABA 3TBTA 1KEMH 4UNTA 1OTUC 1VEPA 3TYFB 2D9QB 1BQLL 2X4RB 4LLDA 5E2WL 5HDOA 5JLZB 2FO1A 3VG9B 1MRFL 2M26A 3MRJA 3QO1B 5TQ2L 4QHNA 1WAAF 2X9XA 1HXMA 5EU3B 4KKCC 4PJ9D 2CRZA 5BOPA 3QZWB 3VG0H 1C5BL 4I3GA 5GRUL 3LKQB 4POYA 3HFMH 1M1SA 3ZYZA 1KPUB 2PXYC 2BMKA 2IALA 4JPKH 2N56A 2MKWA 4PUBH 3CLFL 3IJYB 1KJ3H 3S37X 1KXTB 4U6XB 5B38A 3KYNA 5EU5A 3B9VA 3U0PB 5TE4L 3QRFM 5C0NC 3FOLA 1R3KA 2HFTA 3MGOB 5GXBB 1SY6A 4PPTA 4PJEE 4TNWK 2EXWD 4Z7QE 3GI9H 1UB6B 3V0AC 3M45A 3ULVH 2G60H 2IBBA 4K8RD 4FABL 5A43C 1F90L 2AKRB 4GXUN 4CMHB 4PFEA 5C0CB 5T3XE 1NDMB 4J3XA 3VXQA 2VUYA 1MF2H 3MRHA 5C8JA 2PYEE 4NDMA 1FV1B 3MJ7B 4MVBC 2R1WB 3KYAA 2A6JA 2OCFD 2UWEF 3OL2A 4J8RB 1U95A 4LDEB 4APQB 3RZCC 4BELD 2NY3B 2B2XH 3BHBA 1ORSA 2BERA 2NYYD 1CQKA 1TETL 2ZUXA 5IMKA 2J6EH 1FAIL 1P1ZB 2W65B 1EGJH 1D9KD 3TA3A 2NZIA 1PZUB 4CRPA 2VLME 2J6EA 3HAEH 1CE6A 1YMME 4OD1H 1EGJA 3P40A 1ZHLA 4QOKA 2E7MA 2DQTH 3ZE0F 4PJCF 2I60H 3HAEA 1FYTE 2CLRA 4NUJA 4UT6L 3V5KB 2VDLH 4JO3L 1T0MB 5IQ7L 2FIRT 2YBRA 4WUUD 3B83A 2Q7NA 1S7XB 4KRMB 3GMPA 4UOW0 4EUPB 3SDAD 1R5IB 1TNMA 3H9HB 3OMZA 1KJ2B 5IMMA 2ZSWA 5ILTH 3P9LA 8FABA 1LEGA 4YHOL 4XI5D 3DSFH 4OZ4A 3TP4A 4DOHE 3GMQA 2FJFA 1IGCH 3OR6A 4PV8B 1ZAGA 1HQRB 2CK2A 4QHUA 2YUVA 4XCNA 1K8DB 4P5TC 2DKMA 3B6SB 2WMPA 4JZOA 1OAZH 5B3JE 1T5XB 2J2ZA 4FXKA 1HH9A 4OCNC 4PLOB 5CEZE 5AYQA 4QEGA 2V7HA 1SEQH 2DM4A 3N1FC 2E7BA 3QIUC 4ZNEE 1WC7A 2PYFA 3WFDL 2W91A 2XQBL 2ZUYA 4U7MA 4HULB 3MV9E 1EAPA 3LDBC 4LCWD 2WINA 1K5NB 1JJUA 3TNNA 4PY8J 3LEVL 1EFXD 3FO9B 4WI9A 1JGLL 3RHWF 5C0JA 3FCTA 3G5ZB 2YPLD 5DRNB 2EDTA 5HYSG 3RWHA 5DWUL 1L6XA 1LILA 4IS6A 4M5ZH 1WZ1H 2EIBA 5TDPB 1A9BA 4JRYD 2Q7YB 4J1UA 5F9WB 5ALCH 3KPRE 5E2VH 4PJGA 3INUL 1HNFA 2ICWA 1NAMA 2AK4A 3UBXI 4M1DH 3ARED 5JORA 3KPSD 3O4LB 4PJIA 3F6IA 4YHPB 1AXIB 4GFTB 4EI5A 2P8PB 1KXQE 3RDTA 4JM4L 2PR4L 3CXHK 2QBWA 4QY8B 4O2EA 2DD8L 4TVPH 3WEXA 1EV2E 5EO1A 1A8JH 1Q0XL 4HS3B 3W2DH 5L0QC 1NEZG 2XZCH 2FZ3A 4D94A 5I1CL 5HPMB 1RUKL 3GNMH 5F97E 3MYJA 4LCCC 4YBQC 5FK9A 2HRLA 4NHUE 4NIKB 5BJTB 1H3PH 7FABH 4POUB 2VLJD 3G5XB 1QBBA 3SE3A 3W9DA 2KH2B 4JR9H 3HRZB 4L5FL 5C07D 5KG9B 2R4RH 1KIPA 4AEFA 2BSED 4K3EH 4IMLA 5F72S 1EO8L 2IBGA 5FCSH 4Z0BL 4M62L 4KKAD 5CUSH 5GJSH 3W0WD 3O4OB 1BF2A 1P9MC 2RIKA 3T4AA 1D3CA 1LO3L 4C56D 1ZGLA 1AI1L 1VFBA 3IDYB 4HXBL 4XB8A 3MLXL 4KJPC 1Q0YL 2VMFA 5K33A 5FYJU 2NY1C 2VABB 5C0AA 1D5MA 1KPRA 4NWTH 3ARBC 1F11B 1IC7L 4FN0A 3LQAC 5D71L 3CJJA 2PCPA 1BBDL 1EH9A 3NZHH 5D8JH 4HKBB 1T21A 3BXNB 1CYGA 1QLRA 2C4FU 2FR4B 1EFQA 4GXUM 2F5AH 4RRPG 1CLYH 4NBXB 3NCCB 3L9RA 3B2VL 3IDXL 4KUCD 1INDL 4X99B 1OB1B 1JZ5A 4MJ6B 5FDWA 4WI7A 4WI8A 4Z7UF 3MLZL 4CDGC 1AQKL 2FNBA 3DVNB 1J8HB 4M3JA 1MHHA 3WHXB 1JGVH 1S3KL 5E0QA 1QRNB 2FRGP 3FQUB 4N68A 4HLZH 1PSKL 1KYOK 4FTVA 3MRDA 3ZSSA 3L5XH 5JXAH 3WXVH 1NGPL 1NMAH 1E4WL 2HTLC 1RPQA 4KI5E 3SJVB 3K46A 3C87A 4Y4KD 3EOBA 3G6DH 5TFSH 3D85B 2D03L 4TOYL 2PKDA 2EIDA 2VQTA 5T3XD 5TH2A 2VXQH 4AEHH 1T66C 4HJJL 4K23H 4Y2DC 2PYED 1DBAH 4FFZL 3O6FA 3UMTA 1NC4A 4J6RL 4YNYA 3VFMB 3VD7A 5JNYB 4PB9L 5DD5H 2W1NA 1VGEH 5BS0B 4JQIH 5ALBH 2IQAB 1A47A 4HFUL 1Q8MA 2I5YL 4AIXA 2HLFD 3PV6B 4OD3L 4OCXH 3ULSA 4HK0B 3EUUA 2XA3A 4QOKE 1TQCC 2JJVA 3WIFA 2RAMA 2HG5B 2VLMD 1YMMD 5B8CA 4XNMA 2J4WL 3A67H 4F9PA 1FYTD 3TO2B 3A6CH 3I2CL 4HH9A 3DO7B 5IFHH 5EU6A 4KTDL 3ZKSD 4XZUA 2ATPA 1FE8L 1U91A 1KB5H 1YY8A 1A0QL 2C9AA 1RZKL 3PL6B 5TE7L 3L6FB 5BV7B 6FABH 4GKOA 3HE6B 2WW8A 3UEZA 5E1AA 5FF6A 1NFIB 1J0YA 2OR9L 1XZ0B 1KJMB 3EO9L 2EZ0D 1I1AD 4WGVB 4JKWA 4EVNA 4QHMA 4WI2A 2X4QA 1FP5A 1NGYB 4DZBA 3CK0H 2J1KA 4XAKE 4O5LH 1BMGA 3AM8C 2B4CL 3O9WB 4OFDA 4Z9KB 1S8DA 4WEBL 3G9VA 5CEZD 4K8RC 5J1AA 3TFKA 4X7DC 4PJHA 5E8EB 2P8LB 3VXMA 1U8QB 1W0YT 1BD2B 3IXTB 5EPMA 3MV9D 3DJ9A 4U6HA 5I1IH 1RURH 2Y9RT 4J3SA 4OLVL 2YA0A 1VPOL 3NABH 3WFBL 4N1CA 2GAZA 1AD9A 3NZ8A 2OSLA 4YWGL 5CJXC 5TGBB 2JIXA 2NYYC 2B5IB 4U1MA 5EU7C 1NPUA 1T0NA 5EZIL 1D9KC 4G9FB 4TRPH 4KH2A 4JG1L 1OCWL 4NKMA 5IHBA 1QACA 3BJLA 2WIIA 3B5HA 4PG2A 3V4VL 5HGDB 4PJGE 4LLWB 4GRWF 2AK4E 1FG2B 4MWFB 1T1YB 3KPRD 3B9AA 3HE7C 3E2HB 4UQ2B 2X2YA 3QDJA 4NM8H 4M6OH 1NL0H 1QA9B 5EOTA 5GSRA 3SDAC 5JTWA 5EA0H 2H3NB 2BVUA 2IPKA 1JF5A 1YEJH 2BNUA 1BZQK 4H8WC 4FZEH 3JUYA 3RWGA 1CF8H 2HT3D 4XI5C 3TF7A 2RJMA 1WFUA 1OAUH 4AG4H 3P0YH 4TVPE 4WI6A 5EZLA 5ESAB 4PRDA 1G7LA 4PGDB 4OT1H 3LH2L 3NCYP 5ADOH 4NWUH 4WVRA 1JPST 3FTGB 3JWNC 4PS4L 4XNXH 4WCYH 5LAXA 3TPKA 2DLHA 3UTZA 1FORL 4M43L 3TYFA 4L9LC 2X4RA 1NCAL 5JLZA 5D1ZD 3QO1A 2ZOLB 3QCTH 1NCNA 2GY7B 5HBBA 4LSSL 5EU3A 3MRIB 4C83B 4L4TB 2C3WA 3QZWA 3LKQA 2NTFB 4R4ND 1KPUA 1F8TH 3GEWB 4FHBD 1DVFC 5DDHB 1SM3H 5D1QA 1ZANH 5GS0H 3U0PA 1J0JA 5C0AE 1IC5H 3MGOA 4N8VG 3LEYL 4JFYB 1WWAX 2WWKT 2OK0L 1CXIA 5FGCB 1AY1L 2A9MH 2XZAH 3LD8C 1UB6A 5A16B 5C3LD 4JFQB 2K7PA 4CGTA 4M1GL 1R3IH 2AKRA 3GHBH 3G08B 2YSSB 5C0CA 5IOPB 1NDMA 4MJIB 2EDKA 2VLKB 3WNPA 1V3JA 5EZJB 1FV1A 2BSRB 3AREC 3MJ7A 2R1WA 2DQGL 1CFVH 5LGHH 1HN1A 4QHKI 1F2XK 2FH8A 1E27B 4J8RA 4P5MB 3AS0A 3HC0B 2DAVA 4OCWL 4APQA 1JK8B 1MHPL 3O2VH 4LP4A 1YEHL 1P1ZA 2W65A 1RJZB 4FQHB 2BHYA 3GSWB 4LEOB 4FTVE 4WEMB 1QLFB 4DKEH 4XBGB 5F1KC 2GK0B 1GYAA 3V5KA 2I9LB 1T0MA 4WEUD 5F1SA 4HF5L 4O00A 4KI5D 1S7XA 5BXFB 1L0XA 3JBG7 2KKQA 2E7LC 1R5IA 3H9HA 1KJ2A 4DGVL 4MA7H 3OJ2C 1T1ZB 4HCRL 4KKAC 3MRRB 4PV8A 4XPBL 2BY0A 1INQB 1HQRA 3BKYL 1K8DA 1U3YA 4J4PC 3TO4A 3B6SA 5T33H 4R4FL 2B8OT 3C60B 2Y06L 3GIZH 4KU1A 1T5XA 3IFNL 1HCFX 2FLBT 3ABZA 3TA3D 5HDBF 2SEBB 4L4VB 1N64H 4WHYH 1T2JA 4QOKD 4C4KT 1T83A 3KLAB 1P4IH 1TJHH 4FNLL 1WBZB 5HVHB 1CD8A 4F57L 2VN7A 3SEPA 4WU7A 5FM5M 4X6EB 1BEYL 1K5NA 5INCB 3QUYB 3OAZH 4LSVL 3TYGH 1R3LA 4Y19B 3HA0A 3PABB 3FO9A 5CGYC 1N2RB 2J12B 3LIZH 4NQEB 4Z7OF 4K94H 1NGQH 4XX1G 5DRNA 4ZUVB 1I8KB 4FQIL 2G5RA 3NCFB 3MJ8B 2X4PB 2IMMA 4WRLA 4XC1L 1KN4L 3D9AH 3SE4A 5ADPH 5TDPA 1QEWB 2Q7YA 1CLCA 3RJDA 2EDLA 4XAKD 4MNQB 3NTCL 4PJHE 3VXME 3W11C 3O4LA 5J0BA 4KVCL 3QO0B 3ZDYE 3G6JB 4YHPA 5L6YL 4OI9A 4U6TA 4TSBH 3V0VB 2P8PA 3SCMB 1LGVA 2AI0H 5EFIB 3L1OH 1NSNH 4MDJB 4QY8A 4N5EC 4FQ2H 4CMMB 3BWUC 1RHHB 1MY5A 3GMLB 4YZFF 4LGPB 1ZTXH 5MEPB 1PG7W 3RBGA 3BZDA 4HKXB 4XP1H 5HHPB 2AEQL 5HPMA 3C6LB 4GSDL 3CVIL 5BJTA 5AEAA 2KZWA 3G5XA 2D7TH 5EBMB 3RI5K 4FFYL 1MQKL 1QKZL 4NOBA 4UINL 5FKPB 4P57B 3HRZA 2E9WA 2DLGA 1TJIH 3LQZB 5KG9A 4V1DB 5JMRA 3GK8H 3UJJH 3QDJE 2AK4D 4JQXA 1A1MB 1J1XL 3T1WA 5LG1A 3CDYA 3HB3C 5E00B 2DTMH 4GW4A 4EXKA 3RDTD 2G75B 3ZKXC 1ZT1B 2YMXH 1W0VB 3WNNA 3SBWC 3KPTA 2YD5A 4M93B 2X1OA 4OFYA 1MFDH 1O0VA 1MCNA 1PG7X 4JY6B 2E7HA 2KQMA 2UZIL 3FHQA 2I27N 4TVPD 1BVLB 4RFNC 3MPCA 1I1AC 2VABA 1F11A 1N5YH 4M7KH 2OI9B 4MNGB 2BHUA 1ZHKB 2XZQH 4HKBA 2WY3A 4NN6C 3BXNA 2PF6A 4OV6F 2BVYA 2FR4A 2R56H 3CH1B 1GJIA 1UVQB 4X99A 1M7IB 1OB1A 4MJ6A 1ADQL 3DVNA 1J8HA 2C3HA 2VZ3A 4Q6IC 3CSBA 3HPLB 3WHXA 4R3SB 3OAYK 1QRNA 2G2RB 3ETBF 4NO5B 4O4YL 3TVMB 1RUPL 2I26N 5HXMA 2ADIB 3QUZB 3UXFA 2GIYA 2HMID 4ONGH 3LVEA 2CUIA 4EOWH 5C0AD 4C59B 3JWDH 3GZKA 1IZJA 1BGXL 4JJHA 1IAIL 1L7IH 4OZIF 5C0CE 3SJVA 2D9CA 1T80A 3HUJF 5IWLC 4UIKL 4KZEL 1MQ8A 3D85A 3GI8L 3MACH 5K9OB 4RFOL 1CGXA 1HI6B 1MNUL 2XQYG 2K3TA 3VFMA 5JNYA 5D5MB 4FQJL 3TBYB 3GJFH 5BS0A 2YHGA 4ALAH 1WISA 1UWEL 1KENL 2IQAA 5AZEL 3GJFA 3PV6A 2R15A 5I30L 1RIHH 4XCYB 4HK0A 3DROB 5J13B 2VDPH 2VUOA 3WCYA 2HT4D 4FTVD 1D5IH 1RU9H 2BX5A 4NKOB 4KROC 2IWGA 3QHZH 1KJVB 4S1RH 3FFCB 1ZLVH 3TO2A 3DO7A 4X9BA 5L2KB 1DN2A 5CZVH 2C1OB 3EDFA 5EG6C 1ZEAH 5IT2H 4P5KB 4R4NC 1T5WB 3O6FD 4KHTH 3PL6A 3L6FA 4KGJA 4S1QH 1I3UA 3HE6A 3MLYL 3ZHDA 4UIMB 1NFIA 1HHKB 3FT3B 1XZ0A 1KJMA 3RI5F 1OAYH 2A6IB 3TJHA 3QJFB 1ZLWK 1BM3H 4N1EA 3VI3E 3DYPA 1NGYA 4KRLB 4ZO9A 2QQKL 3ZKMD 4XPAH 3K8KA 2DKSA 3O9WA 4FFWD 3OGOE 1IT9L 3V4PL 4HS6A 2QSTA 1DBML 1UA6L 2FX8L 3P0VH 3I84A 2K7QA 4K3JH 4IDJH 5E8EA 3PF2A 2P8LA 1U8QA 4CDHA 5I76B 1BD2A 3IXTA 3Q6GL 5E8NB 1IBGH 1Z2KA 2UWEB 1IFHL 3TN0B 1JI1A 1JV5B 1W8OA 4JDTH 4OLYH 5KTEH 5FXCH 4Z95L 5TGBA 2H45A 1J1PH 1U6AH 1I8LC 4G9FA 5I1KL 1CD1B 4LGSB 1CLZL 2H6PB 1L9NA 5HGDA 3QHTC 4LLWA 4AT6B 1IM3B 2J3SA 1FG2A 2IPTL 4LKXB 4MWFA 3HLAB 4OAWB 1BFSA 3O4LE 1CDCA 3S4SG 4H25B 4GBXA 4KI5C 3TFKD 3E2HA 2X4NB 4S1SL 3ARGC 1QA9A 5HHXH 3PP4H 3VGBA 2H3NA 3STBA 3VXMD 2OQJB 5JZ7D 1KBGH 4H1LB 2V7NB 4UV7L 2WBKA 3U4BL 1RULH 3QI9B 5ESAA 3DVFA 4OFPA 4PGDA 5TE6L 2MOVA 4IHOB 2XN9B 2JIXD 4QHLB 3FTGA 5I1GL 1N6UA 1YDPB 3MRQB 3TA3C 4ODXA 1FNEB 3VGDA 1CIUA 1HZHL 1FZJB 4PB0H 1YEGH 2A77H 4PBVC 1BVKA 1GC1C 1TFHA 2ZOLA 1JHKH 3QA3B 2XG5A 1T1XB 5DC9B 1OD9A 3MRIA 4L4TA 3JV4B 12E8L 2DLIA 5I1DB 2QLVB 5K9KB 2NTFA 3QDJD 1JZ3A 1KLFA 1WZMA 1YJDH 3RWDB 2GHWB 1MAJA 5EOCH 5DDHA 5IEHB 2R69L 4Z77B 1EVTC 4QRQB 1ZLUK 3BRFA 5F6HI 5DEZA 4GAJL 2X1PA 5L88H 2CUMA 3KLSA 3D5OF 4PTTB 3R06B 2XXMB 4HT1H 3KYKL 1NC2D 4GQ9L 5KVDL 3SGEH 4Z78B 5EOCJ 4BA8A 5A16A 2Z0BA 4LRNH 4JFQA 1NCDH 3BMWA 1LP9B 4OFVA 1JWSB 1KIRB 2YSSA 3G08A 3X13B 3LPGA 5IOPA 2VLKA 5JO5A 4JANB 4R8WL 1A14H 4NZDA 2WWMC 2BSRA 4GW1B 1WEJH 4K9EL 4KJQD 5GISL 4R2GB 3AB0C 3SGJA 1E27A 4P5MA 3HC0A 1NAKH 2YA1A 3P30L 1JK8A 5IBLD 43CAB 2LTQC 4OF0A 1J8HE 2DI8A 5F93C 1KB9J 1QBAA 4W6WB 1QRNE 3MX0A 4FQHA 2R23B 3GSWA 4LEOA 1CGTA 4TUOB 5F8RC 1QLFA 3B9EA 3ZKQD 4Z7WF 2MFNA 3OJMB 1JRHH 4J3VA 5GS0D 4XBGA 4OCYL 3MFGB 1OP5H 1J1OH 2AXJA 2GK0A 2R0LH 1Q1JL 3SJVE 3TBVB 1ROWA 2DQFB 2MCPL 2I9LA 1FFPB 2VR9A 3AUVA 5IKCB 3H7LA 5C0CD 3K4ZA 2AJZB 3U36B 4NZTL 4J23A 3V6OA 4Q58C 1CXLA 3KR3L 1EIBA 1QUNA 4NM4H 1I9EA 1T1ZA 4J7RA 5IJVA 5BS0E 3MRRA 5BO1L 1EMTH 3RDTC 5IGXL 1INQA 4APQD 1UM4H 3ARZA 4NJ9H 4HWEH 3Q2CA 2NY3D 3QUML 1V7NH 5CBEB 1LDPH 2HTKD 3C60A 1EK3A 4C55A 1IAOB 5IFAL 1G9NC 5LWYH 1IJ9A 1XAUA 2FX7L 2FO4B 2SEBA 4L4VA 1M7DA 4WIQA 2BP3A 2EE9A 4B7IA 2HN7B 3KLAA 3WXWH 1ODAA 5FUOL 1WBZA 3LPFA 3BPLC 2NNAB 5EO9B 5C6PB 5DJ2A 2DWEB 5C9KA 4RBPH 4X6EA 1D6VL 1H3TA 4NNYB 3SE3C 5INCA 3NPSC 3O41B 3QUYA 5HDQL 2GTZB 4AMKH 4U1HB 5HJ3B 4JGJA 3KPMB 2JB5H 3PABA 3T2NH 5L8JB 1N2RA 4ZTPH 4Z7UB 4NQEA 1KN2L 4CNIB 4RGNB 2C5DC 4ZUVA 3OAUL 1I8KA 1JZ8A 3MJ8A 2GEEA 2X4PA 2DM2A 2ARJB 1EBPA 1PJ9A 3V4UH 5IR1B 3AAZA 1QEWA 2HMIC 3WFHB 1OARL 4YHYC 1A22B 5DVMA 5D93C 5KBNC 3MBEB 4MNQA 5SWSB 4RGOL 2R1XB 5D7IF 3QWQB 3S34L 2ZKHH 3NA9L 2YXMA 1BD2E 3G6JA 2QQLH 4JO2H 4DN4L 4IBLT 4NNPL 3V0VA 3SCMA 5EFIA 4TUKL 1IC4H 1PVHA 4MDJA 3CVHL 4F9LC 4JFOB 4CMMA 1RHHA 2QJDA 3GMLA 4PLNC 4BKLB 1VDGA 5MEPA 4AEIH 4HKXA 5HHPA 3MJ6A 3BPNB 4G9FE 3C6LA 2NX5E 4OLZH 4YBLB 5DTFA 1HKLL 5EBMA 3O3EB 1GZQB 2R0ZH 4DTGL 5FKPA 4P57A 5AG8A 3P11H 4HX1B 1CD9B 1QHOA 3LQZA 4V1DA 2X4SB 5I18H 3MLRH 3GGWB 1A1MA 3O4LD 1UWXH 5E00A 2E6PA 3O6MH 3LN9A 1IAII 5MERB 1TTGA 1RVFL 2G75A 4XP4L 3WS6A 3O6FC 1ZT1A 4GXVH 1W0VA 5L9DH 4KKBD 3O2DL 4P99A 3RVTD 2IH3B 3A6BH 4JY6A 1CXEA 1TPXC 4NZRH 3D39B 1BVLA 4FQ1H 1WFTA 4UILL 4NJAH 3VWJC 5KSUB 3TT3H 3DI3B 4MNGA 2OI9A 3VCLB 1IKFH 3ZKMC 5C9JB 1CXHA 4P2RB 5D4QA 1ZHKA 4FFWC 3QRGL 2V17L 1JZ2A 3WBDA 4M48H 4XRCB 4YDKH 4DUVA 4L4TE 4RX4A 1DFBH 3CH1A 3BN3B 2FWOB 4PRPE 3RFZC 1UVQA 5E8PB 3VDCA 1DQJB 2MPAL 5I8EB 5HHNB 1M7IA 1ZXQA 3OV6A 1NJ9B 4KDWA 5A1AA 4NO2B 1N0LA 1U8HB 3HPLA 4R3SA 3QXTA 2G2RA 3GSNH 3G04B 4XTRD 4OFYD 1W72B 2QADC 1MRDH 4NO5A 1A3LH 1WIUA 2ADIA 2VLRA 3QUZA 3MLTB 5FGCE 4Y5VC 1UG9A 4DFIA 3WIIL 5CHNB 2DQDL 5FECB 1ZT7B 4GRWB 3CSGA 3FQTB 4JHWH 2GSIA 1R3HA 4MJIE 2VLKE 4XC3H 3QDAA 2Z92B 5J12B 3KJ4B 4Q2ZB 5CD3B 3TFKC 5K9OA 3HMWL 3LOWA 3IDUA 3L95B 4HLZG 5DD0H 5CSZB 3ULUE 2Y25A 5JZ7C 4MHHG 3CFDB 4QKXB 5D5MA 3QCUH 5CCKH 4WFEE 2COQA 1LO0L 2BVEA 1OM3H 3UZVB 2XQYK 4ZD3L 5CKGA 3TNMB 1J8HD 4XCYA 3I75B 3DROA 5FGBA 4QTHB 3ZE2E 1QRND 4EZMA 1S7UB 1GRWA 4D3CL 3K2UH 4AY0A 5LKNA 4NKOA 1G6RB 4M5YH 3BH8B 1HHHB 4HUWB 4KUZL 1KJVA 3DO3A 3FFCA 1V3LA 4PG2C 1WAAA 2OL3L 3SJVD 1CD0A 1YPZF 2FX9H 5L2KA 2P45B 4G8GB 2VXVL 3GB7A 3V6OE 3VGEA 3D85D 3GKWL 4P5KA 3VRIB 5ACLA 4FMFA 1T5WA 1ZWIB 5F44A 1NMCB 4HJGB 3GRWH 4JCMA 3WFCL 4X7SL 5HYFA 1QPXA 5GHWH 1YMHB 5BS0D 1JZ6A 3TF7C 2BDNH 4UIMA 1HHKA 1MWAL 3FT3A 2A6IA 4UTBH 3QJFA 3VFVB 5E2UH 4ZTOL 3E8UH 3SKJH 3EDEA 1F4XH 1CE1L 2HKFL 4L4VE 4EXPX 2VAJA 4FOMA 4URTB 1TDQA 1FDLH 3QQ3A 5BZDB 1S7SB 2XY2A 5KW9H 4KTYA 3U30B 3FOMB 4F2MB 3MRCB 2OZ4L 5I76A 3VG9C 5EU4B 1RZFH 5E8NA 4KJQC 4FP8H 2UWEA 4P9HC 4PGBA 4DGIL 3TN0A 4Y19E 4I18B 2Y72A 3U46B 2EC8A 1UFUA 4TSAL 1JV5A 4ZYKB 4NQEE 2AABL 2GYSA 1ES0B 2ID5A 4HQQL 1DBJL 5BVPH 5IBLC 3QUKB 1FVDB 3QHFH 3PL6D 3TV3H 3HE6D 2J8UF 4U1KA 3FMGH 5C7XL 2AXFB 1CD1A 1UCTA 3ET9F 4LSUL 1IE5A 3TJHD 1FO0L 4MB5A 4NO0B 3U2SB 3LPWA 4RAHA 5HD8C 1FIEA 2CKBL 1H5BB 4JO4L 4AT6A 1IM3A 4MNQE 4YLQT 5DQDL 4PP1D 2AJVL 4LSTH 4LKXA 3O9WD 4Y5YB 3O3BB 4G6JL 1C1EH 3HLAA 4OAWA 5IESL 1VERA 4H25A 2X4NA 3G6JE 4CMHC 3PHQB 4DVRH 5DVLA 1WUNT 2OQJA 4H1LH 4RWYL 1CN4A 1BD2D 2F8OA 4I77H 2P43B 2X09A 1U8KA 4H1LA 2V7NA 2IBZY 1QSEE 3QI9A 5DA0B 1A5FH 4L3EB 5D6CB 3LZFL 4IHOA 2XN9A 1OVZA 4QHLA 2IAMA 2EICA 2Y07L 4ZUSB 3EHBD 1G7MB 1YDPA 3AY4A 1NUNB 3MRQA 4G9FD 1FNEA 1AKJB 2NX5D 2AEIT 5DR5H 3SQBA 4XCEA 1FZJA 3N85L 5FHBL 4BZ1H 5CJOH 4V1DE 1L0QA 3QA3A 1T1XA 1IGMH 2H26B 1GOHA 1E6OL 3JV4A 5I1DA 4LAQL 5K9KA 2R29L 3VGAC 4KV5E 3VD9A 2YPVH 3RWDA 1TTFA 3WIHH 3ZYOA