1JGDA

Hla-b*2709 bound to deca-peptide s10r
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
276
structure length
276
Chain Sequence
GSHSMRYFHTSVSRPGRGEPRFITVGYVDDTLFVRFDSDAASPREEPRAPWIEQEGPEYWDRETQICKAKAQTDREDLRTLLRYYNQSEAGSHTLQNMYGCDVGPDGRLLRGYHQHAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGECVEWLRRYLENGKETLQRADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HUMAN LYMPHOCYTE ANTIGEN HLA-B27
publication title Thermodynamic and structural analysis of peptide- and allele-dependent properties of two HLA-B27 subtypes exhibiting differential disease association
pubmed doi rcsb
source organism Homo sapiens
total genus 80
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2001-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1jgdA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1jgdA01
5JR1L 3QJHA 4OAWA 2C4FU 3JTTB 1IKNA 4DN3H 5EUOB 1IQDA 4NQEB 3NIGF 5DJDA 1HH9B 3NPSC 5EZIH 4QXUL 5L8LB 3FZUC 4LSUL 1IGJA 4HGMA 1L9MA 5FYJL 1FFNA 4OCYL 5J3HC 3B9VA 4CN6A 3KPTA 3CFEB 1G9NL 1X6LA 2A6DB 4TTGA 5DK3A 1CVRA 4P5TC 2H32B 1CGSL 3RWCB 4NQVB 5HJ3B 1OLZA 1MRFH 4NQDB 4EI5A 4X6FB 3C8HA 3MMEA 4LLVA 4YWGL 3I6KA 1IC4L 4EQ2A 2DI9A 2C1OA 3TZVC 4CNIB 3NZ8B 1TETL 4X6BB 2ZSWB 2AEPH 1T5WA 2EH8L 2IEPA 3QUXC 4QY8B 5IESL 4OZIB 5EORH 4ZUWB 5TH2A 3VGAB 2IADA 5A2LH 3S96B 4R4BA 4G8GB 1OGAD 5TDPA 3QQ4A 3U7AA 1VEMA 4XC1L 5DURD 3LB6C 3WHE1 3EFFA 2R0WH 5EZOL 3ZKXB 2EC8A 4OB5L 2A73A 4X6CF 4XC3H 1C7SA 5E8NA 5DFVC 3X12A 5DJ0B 3HE7B 3QUMH 4PLJC 1IILE 3BE1H 3WXWL 4EN3D 5F7EH 4G8EA 4MQSB 1ZHBB 4CADB 3CU7A 1X9QA 5HHXH 5J1SC 4FQ2L 3BKCH 1U8OB 4OCXH 5JOPD 2YKLH 1R5VA 3HI5L 4NRXB 1T20B 3PABA 1AXIB 1XH3B 4JM2A 3QEHA 1D6EB 5K9OA 4G6FD 2IG2H 5E9DA 2YD6A 3OB0K 3MCLL 4JY6A 3RHWK 3TGXA 4PJ7E 2EIEA 1S9XB 4LSQL 3SGJC 1XGQB 4BZ2L 2XQYG 5FM8A 3OBAA 5GS2D 4Y4KA 3ZKQD 3IFNL 1NCTA 3MJGX 5HD8C 2ERJC 1E4KA 1AR1D 4HC1L 4YDIL 5EU3A 4G59A 4DW2H 3PNWA 4CMHB 2X4RA 4UIMB 3K1KC 3MFFB 3B8SA 5D7JA 5D1QB 1TJHL 3BFOA 3C87A 1XR8A 1KCUL 1EZVX 4MHHI 1GH7A 1U91A 3O81A 4NYLB 2FCBA 2EDLA 1CD0A 4RMSA 1OSZB 1MEXH 2A83B 1CE6B 4IRSC 2BC4A 4JDZB 5MEPA 1TNNA 4UTAL 4LCIH 2DB8A 2HT3D 3RVUC 4YUEL 5C07E 5HPMA 5IFHL 5E99L 1JRHH 3DROB 2AQ2A 3W5NA 2DLFL 3KXFE 4JFZH 1OL0A 3QXUA 4WUUA 1BIIA 2NZ9C 1BD2D 3JWOH 4XXDB 4Q58C 5ID1A 1I3GH 3WO3B 3PIQA 1D6VH 4DGVL 2R56L 4X6CB 4I77H 2KL6A 3B5HA 3DETC 2NTFA 1ZVHA 3SDAC 5T3XE 1YA5A 4MXQD 1RIVH 3G5YB 3MXWH 5E00B 1KUMA 4V1DB 3LQZA 5AZEH 1QZ1A 2QQKL 1HYRC 3RNKB 3O9WB 1MCWM 4PJAB 3X3FH 4M7KH 4O2FB 3HZVA 2CQVA 4WCYL 3PP4L 5D71L 2MCPH 3FOMA 4GG6A 2JB6A 1M7XA 1S7SB 4JFDE 5IMKA 5J1AB 1UYWH 3PWJB 4L9LA 4OLUL 4HPOL 4N90D 2DM4A 2CRMA 3MGTA 4PTUA 1LP9F 4K07A 5DS8B 5HGAA 3ROLB 5B8CA 3CDGB 5EDXA 3UC0H 3RWFB 1WCQA 1QSZA 5HYIA 4P2OC 3UJIL 5FYKU 2BZDA 2FIRT 3OR6A 4P3CL 5C0BD 1RZ7L 1LD9A 1S7QA 5IBLC 1XMWA 5CP3A 5FDYA 5I1DB 5FCUL 2BSSA 1QVOA 2IAMC 5IGXH 1CQKA 2YD9A 3SO3C 4XPFH 5BOZG 4XMKL 4X7TB 3WFCH 5K9JL 4I0PC 5TF0A 3TN0C 4KJQD 2MFNA 4NWUH 1BWWA 2EEDA 5AZ2H 2CK2A 3IU4L 5JDJA 2E8ZA 4QOKD 4ZTOH 3JTSA 4XPTL 1UH2A 3VI4F 4F15B 4MA1C 5LGHL 3FT4B 4OZHA 4XCFH 5SX5H 1IZKA 5GISL 5JTWA 3D2UA 3IJHB 4NRYA 1NPUA 4AEFA 4N5EC 1OM3L 1V3MA 4NO3B 4HKBA 1Q94A 3E0GA 5C07A 4U1GC 1F4YL 1JV5A 2APFA 4O9HL 4APQB 1KYOK 3PWVB 4P9HL 3BN9D 3Q5TA 4G80A 1P1ZA 2HMIC 3KXFA 4YDJA 5DC0A 3ZDYE 2JB5L 3MLTB 2GHWB 2QSTA 5K9QI 3UPCA 2CDFB 3QUYB 4YAQB 3V6ZB 3TA3B 5DMGC 4R0LB 3CH8A 5IJKA 1OQXA 3H9SE 2DOCA 5ERWA 3STBA 3QO0A 2VZ1A 5DVLA 5CKAA 3FO2B 1BAFL 4HS3B 4YNYB 1L6ZA 1AY1L 2X10A 3P77A 5F1KC 1GXEA 4JFHD 4KKNA 4OKVB 4L8CB 2N1KA 2ARJB 3QIUD 4NDMB 1A02N 2Z35B 2HT2D 1MELA 3CD4A 1NEUA 3U6RB 3ULUC 1WISA 4L5FH 1LP9B 4U1SB 1ZLUK 4HK0B 1H8NA 2DM3A 1NC2B 2FIKA 4L4TA 3SJVD 4P4RB 4U1IB 3VFPA 1S8DB 5C0JB 5IB5B 2P8PA 1OAKH 4YHLH 3CPLA 5T3ZE 4P59L 4XP9L 1NGQH 3V2AR 1MLBA 5KSUA 4X0KA 3CGTA 1BQSA 4LAQH 1IT9L 4K23H 3VRIA 3I85A 3KPNB 2G75A 3UTPE 4LCCB 1FZKB 1BVLB 1Q9OB 5T5NF 4L29A 5E2WL 5T33H 3BGAA 1CXHA 1I85C 3SDDD 3MV7D 1J1OH 1SMAA 4P0DA 3ZL4L 4PJCA 2XRAH 2OSLA 3CNKA 3C6LC 2R1WA 4XP1L 3U46A 1TJGH 1F90H 1R0AL 2C3HA 4F58H 1NL0L 3PGDB 2PR4L 4OQTA 5IBTL 4YBLC 3CCHA 4K71B 2XTLA 1WZMA 3N9GL 1QSED 2J8HA 1PYWB 5I75B 3FHAA 1AQKL 1NH6A 1U8HA 4PRPB 5CD3A 4AEHL 4D3CL 5D5MF 4J3VA 1CL7I 4LVEA 3BHBA 1ZGLA 1NUGA 4NQCB 4X9GA 4HLZH 1FAIH 5AEAA 1A6UL 1JZ2A 1R5WA 2ZOLA 4UU9A 3I75A 4GAGL 1A3QA 5EC2B 1C5DB 4NP4H 1JNJA 2WWMD 3MRQA 3D85B 4NZUH 1FYTE 1AJ7L 2GUOB 4NGHH 5HHNB 4FA8A 4G6JL 3AC0A 3ARDB 5DA0B 3VDCA 2YUZA 4O51A 1DVFA 2D0HA 4OZGE 2FX7L 4Z7NE 5JW5A 1GGTA 1KELL 4GLRI 4QRPE 4M7LH 4ZUSA 1Y0LA 4LLMB 2EDOA 1D5XB 1MCHA 1ZVSB 1WZLA 4K8RH 5D7LB 5K33A 3O3AB 1VEPA 4Z0BH 1PX4A 4P57B 4FQXD 2R23A 3S37X 3O6ML 5GRVK 1XF5A 2BOBB 1U8PB 3TBWB 3P0GB 4LPXA 2I07A 1UKQA 2OJZH 4HEME 5C3TA 1H8SA 5FM5M 5ITFA 4AL8H 1IEHA 2UZYB 4U1NA 2VR9A 3T3ME 1ZOXA 1JFMA 4XCYB 3Q0HA 1A6PA 4GH7B 3MRHB 4N0YL 5DQJB 2ITCB 1FLRL 5MEND 2X05A 1QRNE 4LSRH 4MWFA 3VI3F 2BNUB 1JK8B 4U2YA 4FABL 4UOJA 1A3LL 3O0RH 4NQUA 3EFDL 2BSRA 3PGFL 3BIKB 1FZMB 5GGTL 3WDIA 3X17A 2IH3B 3QUXB 5CP3H 4ZS6D 4UBDD 4Y2DA 3DVFA 3V52L 4OFYA 1E27B 1Q0XL 3DTXB 4JKKA 3UZEA 3CVHL 3UBXA 1DE4A 4RAUA 4J3UA 1R24A 2VISB 2GKIA 4L1DA 1CR9L 5DHXB 4JJHA 4BSJA 3WIIH 5LGJB 5D5MB 1QFWH 7FABL 4Y4FC 4YC2B 5INCA 4HV8B 1QR1B 3QXAB 1KLGA 4MJ5A 4DZBB 1WBZA 1W0VA 2X1WL 2YN3A 5C0ND 3PHQA 3FKUS 4JQVA 3DUSA 2YS4A 3KLHC 1KFAH 3SOBL 1JGLH 4GXVL 5GRUL 4BFBD 3GUTB 5EU6A 1GGYA 1JPGA 3NAAH 4P3WA 2AJSL 4XPGH 3I6LE 5A2KH 3LPWA 5DHVB 5CJXC 3CVHB 2F5AH 2L7UA 3MBEA 3EDEA 3OWEA 4J3SA 5GGVY 1HINL 4MS8D 1IJ9A 2GY7B 3ARQA 1TJIL 1ZHKB 3LEYL 4KJWD 3RGVC 2NY2C 4LSPH 4NRZB 2GJZA 1AD9B 1L4IA 3HG1E 3DX9A 1LDSA 2VKXA 5T3XH 4JPVH 2Q8AH 2XZQL 4TUKH 2ITDB 2VDOH 2WUBH 5GIRB 3NIDE 5IVXF 3AS2A 3HFML 1YYML 2ICCA 2V5TA 3VXRD 4F7MB 5DJ2A 3T2OA 3RTQC 2FO4A 5SWZE 2EYSA 5J7CC 2M26A 3W5MA 2XNAB 4OGXH 1X3DA 1MH5B 4NNXA 4IRSB 4LARH 2Q1EA 3PQYA 4PUBL 5DJ6B 1T66D 5L9DH 1S5IL 5EO0A 3OSKA 1SYSA 5INDB 1XCQA 3BZFB 4B7IA 5IT2L 2I26N 1VHPA 1QRNA 2OCFD 4HJGB 1BFVL 1J8HD 3LN4A 3MV8A 1K5NB 5BOPA 4JY4A 1ES0A 3P4MA 2Z93A 5DTFA 1JGDB 5HGGS 1FNGB 4B0MM 3BPOC 3L3JA 5JLZA 1K2DA 4N9GB 2DL2A 1I75A 1BBJB 1FHGA 4H0IA 2CRYA 3GBML 5C2UB 4RWYL 5D8JL 4G5ZL 4L4VE 2PYFB 1AC0A 2MHAB 4FQQB 3HPJB 4IIQC 3X3GH 2F58L 3RU8H 3VFUA 3QFDB 3OAZH 4OQTH 1KPVB 2Q86A 1FVEA 4LEXL 5HVHB 3NTCH 4S1SH 2HT4D 5KZCB 4KZDH 3E2HB 3MRIA 4XNYH 3X11A 4O5LL 2IPUK 1AR2A 2EE6A 4LKCA 5EU5B 1KGCE 3MGOB 4X7FC 4X7SL 5CZVL 1B6DA 3GJFB 3GNML 3RWHA 1LK3L 2ED9A 3AY4A 5E1HB 3HNVL 1CL7L 1JCKA 4NKIH 1CFBA 1FBIL 5J9PA 1O0VA 3S37H 2OR8A 3MNVB 3HNTL 4S2SB 2XIDA 5ACZB 3FQRA 4NSKB 4X4YB 1V7NL 2EDTA 2Z4QB 3ULUF 2WQ8A 3VRJB 3C2SA 3LQAH 3FTGB 3V5KB 5IVXB 3VXPA 4NT6A 2FJHB 2AJVH 1DQLH 3BT2H 1HXMB 4YHMH 3MRDA 2WY3A 5C08E 4PJEA 2FGWL 4GMSL 4R3SB 1S7UB 3SGKA 4CMMA 3Q6FA 4HBCH 4Z77B 2AK4B 2IAMB 3EO1B 4C56A 3D0VA 3VFGH 3LV3B 1F8TL 1UB6A 3VXMB 4BFIA 1T22B 1CK0L 4RISL 3WUWG 2DMCA 3N1PC 3TN0B 1ZXQA 3FRUA 4BSWA 4YXKH 5SWZA 3GSNA 4KTEL 1JYVA 4WFFD 5CJQH 3R1GL 1HIML 3ZHLA 3ABZA 1FIGL 4PTTB 3GBLA 3V0WH 2QLVB 4H88L 3BUTA 5F21B 2IH1B 2ZCLH 2QBWA 1YN6A 1FZJB 3KLAA 3BP6A 1N59A 2C4FT 1KSRA 5T3ZH 4V2BA 3QNXA 3VXUE 3QCUH 2I9TA 2CLRB 1EJOH 4ELKA 4YPJA 4YDKL 1D7FA 2DQHL 2R8SL 3LEVH 5D96C 4QHUB 1PBYA 3QEGH 4DVRH 5J1TC 5HI5D 5I18H 1HWGB 2ZZUT 3D18A 5HHVH 1T03H 4JFQA 5H2BA 1BQUA 5HI3D 1FNFA 3QHFL 1F5WA 4RIRA 3VWJD 1Z3GL 4DN4L 2X4NB 2MQCA 3HLAB 3QEQA 1IL1B 4GKZA 2I5YH 1VFBB 3DECA 4GBXC 4Q9CA 1BMGA 4OUOA 1GZQB 1W8OA 3O3BA 2UWEF 5EBLB 3MRRA 1GGIH 2CGRL 5EO1B 3M45A 4P48A 4E42A 3WSQL 2GTWA 2BXZA 2JIXA 4FFEX 1Z5LA 2J8UB 5C0RL 3QJFA 1U95B 4FQJH 2VDRL 1M05A 1KXVC 4G8IA 1WBYB 3OKDA 3DI3B 3GSUA 4XI5C 3FZUD 1PLGL 3SDYL 1TCRA 3MACL 2GIYA 2A9NH 2EE2A 2IALA 1IEBB 2PO6A 2ZOKA 3G5XB 3WN5B 5I19L 4XZUA 3KYAA 4P5TD 2H8PB 3MV9A 4HBQA 3WKMH 5IKCB 2YZ8A 3S5LA 3SKJL 1KTLA 2LU7A 12E8L 4LL9A 1Q1JL 4XXCC 4NC1C 5F97E 2VJXA 3MRNA 5CJOL 5C08A 3WLWD 5DJCA 2BVQB 3GGWB 1HSBA 1RJLA 3TZVD 3UJTH 1KF9B 3KYMB 2E7LC 3I2CL 3FFCB 3MODL 3C6LB 4LFHG 2YEZB 2ATPA 1XZ0B 4HKJB 3DV4A 3MCKA 2OI9A 4CN4A 4DAGH 3MV01 2OQJA 2DI7A 1UT9A 2ZJSL 3F65A 4UOW1 4TSCH 4P2RE 1ZE3C 5GRZA 2AJXL 4YZFE 3QHTC 4D9QD 5HDQL 4XB8A 5TFSL 5C0GA 1UM4H 2D4DA 4I5BA 1A7OH 3WDHA 4HXBL 4XVJL 1G7QB 2IMNA 4FQIH 1WZ1L 5DFVD 1P5VA 4ONFH 3FB7A 4PLJD 2E6JA 3KGRA 2ICWB 4XP4L 3Q1SL 4MXWL 4CDGC 5DQ9B 5GSVB 1U3ZA 1JGEB 1CFTA 4TNVF 3A67H 3UMTA 4G43B 4RDQG 2AJYH 1QBLL 3REWA 4JQIL 4XPBL 4HUUB 3MRPA 2Z0BA 2UWEB 2VDQH 3CDFA 3PP3H 2O5XL 2W07A 3H42H 3IU3A 4MJID 2VLRB 5HY9A 4QCIB 1TZGH 2ZWLT 4MX7A 2Y23A 1J0ZA 1VFAA 3D39A 2J6EL 2V17L 1NFDA 2VDKH 3KYNA 4QRSB 3JUYA 3ALWA 4KK9D 3F7VA 2CK0L 2HRPL 2JJUA 5DURB 3LRSB 2EDQA 2V7NA 1AIFB 2V9QA 4HIXL 3UJJL 1WT5C 5JW4R 5E7FA 5D70L 2X09A 2IANA 4CVXA 4EI5D 2G5BB 1I9JH 2CLVB 2W65B 5LCVH 3MJ6A 4RX4A 1F11A 5HD8D 3MX0A 4HXAL 5DJAA 5E95B 3O6FB 3ZYIA 2EKJA 5TE7H 1KB5L 1PW3A 2R2HA 4KAQH 3GMOB 4F7TA 4FXKB 4NN5B 4YHKH 1YMMB 1Y18B 2AEWA 4HWBL 1YEHH 3HHRB 3V6OE 3T3PE 1NCAL 5EIVA 4U6XA 1R3KB 4YDLC 1AO7D 2HYMA 4C58B 5L2KE 1I9EA 4G3YL 5HYJA 4KFZC 1IM9D 1TVHB 1Q72H 1R5IA 1NJ9A 4G6FB 3FN9A 4NUGL 5DMKB 1G7JB 5FUOL 3UZVB 5TQ0H 1R3JA 2X4PA 4N9OB 3TBYB 5IJVA 2GTZB 3BKML 1EPFA 2EXWC 2AQ1A 1E4WL 3QCVH 1NUDA 4M1DL 3T2NH 4U6VL 4BH8B 3DVGA 4XH2B 1EHLH 4X4ME 2NZ9D 3DRTB 3OJ2C 4HG4J 1KB5B 3P0YL 3VFTB 5DGQA 3AU1A 1XGRA 1MJ8H 1V3LA 3GSNH 2UY6A 4MD4B 3DETD 1QYGL 1RUML 2ZUSA 4POZC 5I66B 3SDAD 3L5HA 2DYPD 4JM2D 4PY8J 4TVPD 2BNQE 3HKFA 1B0RB 3G9AB 1Q9WA 3QDGA 3EOTL 3C9NA 3LS5L 1YPZF 5E9DD 1XGUA 5CSBA 4IHOB 4PJHE 3ULVE 5AWNH 4ETQB 5KSBE 4QHKI 1MUJB 4E41E 3TCXA 1SVZA 3GO1H 2XYCA 4KXZI 4Y5XA 1C8PA 1A4KA 4KKLC 4HKXB 4LSVH 3G04A 3RWDA 1J86A 4YLQT 3NH7H 2KH2B 1MFNA 2APXA 1OF2A 4EOWL 3TV3L 5HYQB 4JKLA 4YO0A 3RGVB 2C3GA 3GSOB 2OM5A 1MFDH 2DQJL 3D3VA 3OX8A 5IW6A 2ED8A 4U0RC 3D69A 1VACA 1UCBL 5KVDL 2GSGA 1KN2L 4JFFE 5FYKL 4Z76B 1JHTA 2CJUH 3SKNA 1EUUA 5IFAH 4YHOH 4ZUVA 3HUJA 3DYPA 4DFHA 5J6HA 5IBLD 4OFKA 2EYRA 5B39B 3MJ9H 5F44A 1XF4B 2X9XA 4BZ1H 4R7NB 3RWGB 3RTQB 5EU4A 2IGFH 1ULVA 4BH7A 4TTDC 1TXKA 4Y1AB 3QXDA 3UEZA 1SJXA 4L3AA 3MRFB 5GS0C 2K7PA 4ODWA 3VJ6A 2FHBA 2R39A 2PYEB 4KGLA 3LMJH 2VLMD 4I0PD 3NGBC 4R4FL 1NFIB 2DQFB 3SE4C 3LSOA 2D7TL 3ALXA 2YRPA 1DN0A 1TQCC 2E9JA 4O2EA 5ENWB 3LAFA 4GKNB 3QDME 2VITA 3U0PB 4LRIC 3V6OA 3MLSH 2YUVA 1A3RH 4J3WA 1RUAH 5L2KA 1AC6A 5E5MB 1CD9B 1HZHL 4WWKC 4AMKL 4OLYH 4QXTB 4K8RD 3D87B 2DJSA 2GK0A 4AIZB 3ILPB 1T0MA 3NBNA 4XAWL 2GFBB 2CKNA 1FRGL 3T65A 1F6FB 2HJKB 4JPKH 4HWEL 3AAZA 4NKMB 1INEH 5GRJH 3VGBA 3GI9L 1YPZB 4QLRA 3VFVB 1X5XA 1W0YT 3QUZA 2GAZB 3GMQB 4QNPE 4MNQA 4P2QB 3VXTA 5IMLB 3MUJA 3LKRA 4F57H 4OF0A 4PRHE 2N7BA 2SEBB 3DLQR 4LHUD 2V9RA 3C6SA 4PJIE 4P5MB 5JDSA 2BNQA 1I4FB 4UQ3B 3UDWA 2VYRE 4QF1A 5GJSH 5AYQA 1CLYH 2GCYA 1HYSC 2G2RA 1ETZB 2VLKA 3EYOA 2VLLA 4JHBA 2LTQB 4HX1B 5BVPH 4JAMB 4KK5C 3ULUD 2B2XL 5BO1H 1S9KC 2YUXA 2EXYC 5IBUG 1UB5A 1SEBA 1FFPA 2AABH 2OMNA 4NPYA 4LPYA 3S35L 43CAA 2YD3A 1HHIB 4KHTH 4CU6A 2YPVH 5E2VH 1CDHA 1X5GA 2UZIL 1MCLA 4N0CA 3W0WA 1RZGB 4WO4C 5ANME 5E24E 1ND0A 1YEFL 2QHRH 5ILTL 4OLEA 5CEYA 2AQ3A 4RBPH 4QXGH 5L88L 4WJ5B 4OV5B 4U1LA 3IDIA 4JVWA 5FOJA 3UTTB 1QACA 3WD5L 2FL5A 4J12A 1Q8MA 3VFOA 1AQDB 4JFXB 3O2DL 3CC5B 2H41A 2ZKHL 3RRQA 4JFEB 5SWSA 5I15L 3D9AH 3MGAA 1AGEA 1K6QH 3ZE0E 3VFSA 5I1EH 1I7UA 3UO1L 4M48L 1EEZA 5F3BB 4PJ5E 1Z9SA 4GAJL 2A6JB 4Q9BA 3JWOC 2YWYA 1I1AA 4QHMA 3MRMA 2C7UA 2QQLH 2VXVL 2C3VB 4K3DH 1EO8H 5D96B 2AV7A 2YRLA 5SWQB 3C8DA 4LPTA 3B43A 1Y6MR 1I1RA 5DRNA 3U0WH 1NANI 2AI0H 4EQ3A 4Z7UA 1NANH 3PDDA 4FNLH 1B4JH 4HHAB 3HAEG 1S7VB 4IDJH 4OLZL 4WW1B 5AYUL 1KPRB 4TUOB 1T7YA 3ARFA 5C70A 3GMMA 4MZ2A 1C16B 4HFWA 4Z18A 4Y4HC 5F8RC 4Z78B 3HZMB 4L4TD 4GBXB 3FO1A 2FYYA 3P9MB 5H37H 1MHEB 2XFXB 2FX8L 1F4WH 4PRHA 3OGCB 2WQRA 4HFUH 4LGRB 4GMTH 1JZ8A 2XWBB 1QLEL 4PJIA 3BD3A 1MAKA 5JOFA 5TE6H 3SQBA 5DUPL 5E08H 2DRUA 4YXLH 4LCUB 1ONQA 3B3IB 2DDQH 3S3SA 4HQQL 5D9SB 1I1FA 5BRZD 4ERSH 4JRYD 3C60C 4P5KB 1GPOH 1QFUL 4EBQH 5I16B 3OXSA 3AREC 3KLDA 1CLOH 1NBQA 2DLIA 5I71C 1UCTA 1D5MB 1MCOL 4MAYB 2H2SC 4OF3A 3VXSE 5FECB 3GMRB 1NFKA 3OHXA 1K8IA 3PWPA 1AGDB 5MHSD 3UPRA 1AHWA 4ZFFA 4TSAH 3T8XB 3EAKA 2IPKB 5H35A 3DVNA 4ONOA 3THMH 3PL6A 4WFHD 1NGWB 5E4EB 1MREL 5HDLA 1MQKH 3IFOB 5ADPH 4WNQB 1RUKL 2O61B 2BVPA 2CPCA 3N85H 5DQDL 2FNBA 1ZT1A 4GUPA 4XPHH 3VXOA 1CGYA 4ORZC 2PW2A 3GJEB 4G7VH 4N0FA 5FB8B 4NQSA 3C5SA 3MLRL 1JJUA 2D31B 3FQUA 3K7UA 5D1XA 1DVFD 2XTJC 4PGDB 1P4BL 1RU9L 3DURB 4HZLA 3KLHD 3LN5B 1X4XA 2NX5E 4XMLL 2GITA 2VE6A 4NZTL 4ZO7A 1A9BA 1VSCA 3LDBC 1T1YA 4DJMA 3RVTC 1HK6A 5ICXB 1EAPA 4ODSL 5E2TH 3TBVA 4YQXH 5B21A 4YXHH 3EJJX 1U6AH 3KWWA 4HUMB 4XBGA 4TUJA 3NCYP 1LHZA 1L7TL 1NC4A 2NNAA 1A6ZB 1NBVH 3HS0B 4N0UB 5JW4M 3A6OA 3TBSA 2FWOA 1KCVL 2NY2D 5HHOE 4MD0B 5DVNA 4ZSOE 4CU8A 1F4XH 5CJ8A 3VG0L 1ADQA 3KPSB 3BD5A 3VDBA 2ZNXA 3E6HB 4JG1L 4KJPC 1DL7H 4NKOB 3MXVL 3ULVH 1KB9K 1NCCH 2EDDA 1U8NA 5KTEL 1UJ3C 1PG7W 5FKAB 3NFSH 2CLZA 4OF6A 2VSCA 1INQA 4OFYD 5FUCE 1OWWA 4JZNB 5I1LA 1MLCA 3O2WH 3IFLH 4KRNA 4YDLB 4QGYA 3BQUA 2W0PA 5JHDB 3QZWA 2EDRA 3BPNB 4Z7WA 2R4RH 3MRJB 4JB9L 2YD7A 3OPZH 2LQRA 3RUGE 1IAII 3Q3GA 3HE6A 3Q48A 3VXSA 3WIFB 4QRRB 4MYWB 5JMRA 5D2NB 4L8SB 3WHXA 2OTWA 2YBRA 5A16B 4XGZA 3M8OH 4R7DB 5EU6D 1MPAH 4ZG1A 2YXMA 4NNPL 1RZ8B 3ARGA 3CZFA 2QADC 1JUFA 4V2CB 1VPOH 3LKPB 3KS0J 3QQ3A 4OM1H 2YD1A 5E2UL 3DV6B 5IQ9A 3WNNA 2R2EB 3VA2C 1HI6B 2DQTH 4PRNA 1W2KT 4P23B 3GSXB 4WI8A 4DN3L 2AKRB 5DJYB 1CGUA 15C8L 1ZHNA 2FHFA 1OD9A 2VABB 5EZIL 3H2WA 4X9BA 1F6AA 3S3PA 4LF3B 2WIIA 4MJ2A 4XMPH 1L8JA 3EO0A 1KBGH 1VKXB 5E8EB 3NN8B 2NX5A 2A2QT 4F33A 3RZCA 5GS0L 1MRFL 1PKOA 4MDJB 2AEQH 3KPPB 4LVNC 5JA8B 4G42A 5J11C 2BK8A 4L8BB 2PXYB 1S9VA 1U3YA 2R0ZH 1O7SA 1U8QB 2X1XR 4XNXL 3OKEB 2I9LA 1KCRH 3T1WA 2AEPL 2FJFB 4IOIB 4FMFA 1S5HB 3BZ4A 2VXQH 4Q2ZB 3VWKA 5AUMB 4RNRB 5HHOA 4GJTB 4ZSOA 1JPSH 1WAAE 4LLYA 2BVTA 3TNNA 5J12C 5IR1B 5FF6A 5I2IA 1SHMA 2R15A 3IDMA 4GW1A 2DQEH 4Y5VA 2O5ZH 4YHNA 2EIZA 2EICA 3UCRA 3L3IB 1GYAA 3FB8B 3NGBB 1KIQB 4XC3L 3EOAB 5TQ2L 1UH4A 1MAJA 4UILH 4C83B 3GB7A 5F7EL 1WFOA 3UP1A 1A7RH 1JNHB 3OKLA 2Z31A 5HHXL 3OB8A 1PSKH 4HWUA 2Y7QA 1SY6A 2F54D 4WWKB 4GAYB 4PJGB 1KJ2A 4RMTA 1W0WA 1P84K 1A1OB 4HAFA 4D8PB 3O11A 2A0LC 3OJMB 1CDCA 4X5WA 1S3KH 4IS6B 3BDBA 1P4IH 1LE5A 3GMNB 3ORJA 1NCWH 4WW2A 4OFIA 2VLJA 4JPIA 3PHSA 1A64A 1VADA 3QUMB 2PF6A 4FQCH 4XPAH 4NJ9H 1X6NA 1T4KB 5TGBB 5I74C 3K81A 3SPVA 5CJ5A 1NLBH 1IAOA 2JLLA 1KJVB 1Z9MA 1QLFB 2DQDL 2Q6WB 2L7JA 4ONHB 1ZSDB 3IDGA 4ODVH 4HH8A 4I2XA 3EYUH 1MHHA 2G9HB 5CBEB 4PRBA 3V79C 3NCJH 1OW0A 5ESQB 4B5EA 4ZYKB 1KEMH 1MEXL 5D6CB 3S4SA 2E27H 3L9RB 4FS0A 4I18A 1J87A 3BIAX 4PGJA 1N5AB 5DFWH 4FG6D 4KDTC 4C56D 3AUVA 2CO7B 1JRHL 1BQHG 3TH2T 4NBYB 3X14B 4H5SB 5I6XB 1N2RB 4DZ8B 2W0KA 1YJDC 4JO2L 1IQWH 4JFZL 5B38A 2KPNA 3FHQA 3OG6B 4RWHA 4ZS7L 3H0TB 3CUPB 4RGNC 1HH6A 3JWOL 4PG9B 1I3GL 1D6VL 4MNGE 4JJ5B 3ECBB 3CZJA 4KMLB 1UXWA 3C5ZA 3SKMB 1ADQH 4RFNB 3H6JA 3LQMA 2O5YL 3HMXL 3GJFK 5CLTA 1CE1H 1XGPB 3FOLB 5GGVH 5E5UB 1RZFH 4JRXB 5ESVB 4XCCH 3TIEB 3MQIA 3IXTB 3MXWL 3L3HB 7CGTA 4QHNB 5AZEL 2W59A 1XR9B 3L5WA 1AFVH 1BZ9B 2X4SA 3GI8H 3UTZB 4JHWH 3EYVB 3TWCH 3X3FL 2H26B 2ZCHL 1D9KC 1G7HB 4OIIL 4WI6A 2M1KA 4J1UA 4Y5YC 4JZJB 1JBJA 3C2AH 3L3KB 3KHQA 3HC3H 3QEQD 4PJ9C 5IW1B 1UYWL 2EE3A 3QQ9D 4K94H 5F96H 4QRUB 5KSAC 4OLXH 4KVNL 4PJBB 1ZGLP 3OJDB 1IAIL 4FQHA 1N0XL 3UTQA 1DUZB 2QKIA 5JW3L 4M03A 3MRBB 2F53D 4GS7B 4LU5H 1FNEB 5MERB 2MTPA 5BJTB 3E3QA 2XZZA 3DPBA 4JGUA 5BVJB 4OCMC 4MXVE 2CDEA 2XZAL 2JCCB 3EOBB 1IM3B 3VFWB 1XGYL 4JFPA 3BIBX 3RL1B 4JRWA 3STLB 5IGXL 2D9QB 4LLQB 4YFDB 4WFGD 4XPFL 1T3FA 5IG7B 4UDUB 4ODTH 5KW9H 1AGBA 2VUOA 4TNWF 5IMOB 4NWUL 2P5EA 3MV9D 5C7XH 1MOEA 2ZG1A 5C0CD 2IFFL 2UUDK 2FJGA 3ZDZF 4ZTOL 1IGYB 2V5RA 4G9FE 5FM4A 1KT2B 1TZHA 1MI5B 1RK0B 3EYSL 4XCFL 4PRAA 1YY9C 3VD4A 4OJFL 4ELMF 2OL3A 2D7MA 2NY4D 3SDCC 1K4CB 4U2ZA 5HHPB 4M00A 3AS1A 3QULB 4WU7A 5DJ8A 3QJHB 3V5DB 5I71B 3ARBA 4LCWD 5ISZE 1IQDB 2BNRD 5DJDB 3IXAA 3RIAF 2IMMA 3EBAA 4PY7B 1IGJB 4YHYC 3RBSA 1FFNB 5E70A 2VZTA 4U6HA 1ZA3B 1KIRB 3EOYG 2WLYA 4GAFB 3RA7H 5TDOA 4QHLA 2ZG2A 2C3WA 5LWYL 2EXWD 4K7FA 2VDPH 1GC1H 3VU2A 5IV2A 1BZ7B 4OBRA 5CKGA 3MYZA 4ZQKA 5DLMH 5F9WB 4WHCA 1NDGA 4U1KA 4WHDA 5EC1B 1EEYB 4DQOH 3A6CL 4F9PC 3I6KB 4M4RA 3RY6A 5IEKA 2C1OB 3MYJB 2AJUH 1D5BB 1S7XB 1QFWM 3RX5A 4GRWH 4U6TA 2IADB 1UWXK 5BCAA 1SY6H 5EWIH 3CFDB 1HEZB 1KJ2H 5TDPB 1G7LA 5SX4I 3OZ9H 3LDBB 3P9LA 1OAKL 3EFFB 5DZOA 4YHLL 3SKUD 1FZOA 3QDJA 4KKLD 5D6DC 1MIEL 2EH7H 3W11C 4LAQL 5CSZA 4K23L 4WI4A 4EXPX 1RJYA 4RX4D 5E8NB 5LGKA 3X12B 1RUQH 1VGEH 3EGSB 1YEJL 3BRGC 4G8EB 1BM3L 5D72L 1YEGH 3DX6A 4S1RH 4JR9H 4KC3B 4BSVA 4BUHA 3H7LA 1J1XH 1U3HA 3MBEC 4F58L 3PABB 5HYJD 4ELMB 3GSWA 5K9OB 4KK8C 2CIKA 1UWGH 2H9GA 4L3EE 5DMIH 5BV7H 4G9FA 4TTDD 3S36X 1S9WA 1SEQH 3UTSA 5GS0D 3K2MC 4Q6IA 4KQ4H 2OTUA 4KVCH 2FH6A 3QSKB 4MJ6B 1CFSB 4ZUTA 2AK4E 3L7FB 4OTXH 3K2UL 2X4UB 4ONGH 4OGZA 4Y4KB 5I17B 1ERNA 3ULSB 3FB6B 3VXME 2CD0A 4NO2A 4GW4B 4TQEH 3OG4B 2X4RB 2OJEA 5D7JB 4NZUL 5ISZA 5FO8A 3QWRD 1XR8B 3OB0H 3RAJL 3NCYS 3QDGD 4PJ7F 1U91B 1X7QA 3EJYD 4UI2A 4FXGB 4ZNEE 1A22B 2XN9D 1ITCA 2BC4B 2P5WE 5I1GL 1KV3A 5HYEA 3WJJA 1CVSC 2QADB 3MOQA 4NN7B 3O2VH 5T1KA 3ZHKA 3SGEI 4Z0BL 1FPTH 3O3DA 5JPNA 5JW4N 1OTSC 1YQVH 1NGZB 1CICC 1EVTC 3V0AC 4KKCC 3MREA 4RRPA 1TITA 2OJZL 3RPKA 1KCGC 3VFMB 4WUUB 1BIIB 2KBGA 1CWVA 5F6HJ 3D3VD 4JM4L 4Z5RB 5C0IB 3PIQB 2NY0C 2UVEA 1HYSD 1CD1B 3QH3A 3CU1A 5JUEH 3SBWC 3SDXF 3A6BH 4UT7L 3BH8B 3QEUA 1RHFA 4H8WC 2DICA 5C0FB 2G60L 3QG6A 4LNVA 1E6OH 1LNUB 4XP5H 3O0RL 3FQXB 3LQZB 1LGVA 1UWEH 3G6AB 4JO1L 4RCAA 5BZWA 1K9TA 2CKBL 3LHPH 1XF3B 3HZVB 4CL7A 3FOMB 3FAXA 1U8JA 5F7UA 3GHEH 5JXEA 5E8DH 4JN1L 5IMKB 4TNVK 2X4QB 4LIQE 1L0YA 3UYOD 3MGTB 1QFWL 4PTUB 5IB4B 3KPMA 1EA9C 1E4XI 4LVHC 5B3JE 2EDYA 4M61B 5MI0C 4L3EA 3AS3A 1Z6JT 3OR6B 1OT1A 5HHME 1FL3A 1LD9B 1NGPH 1S7QB 1JGLL 3R8QA 1U8MB 3QIWA 2OL3H 2BCKA 1I1YA 2BSSB 1QVOB 3NACH 4FQLH 4XPGL 5DRWA 1A1MA 4FZEL 5JA9A 4H1LA 3FFCE 2FD6H 4X4XB 4MNQD 2F5AL 1EXUB 3BEWA 3C09C 3OV6A 1QKZL 5L7XH 2DTSA 4NKDB 2WBJA 4KTDL 1I7TA 4ZXBA 1A6VL 4QRTA 2VLKD 4LGPB 5IM7B 2DMBA 3D2UB 4PYHA 3DUUB 5T3XL 3VE0B 4WI9A 4NRYB 3LKOA 5B38G 1XIWC 1LWRA 4TUKL 4NJAH 1WEJH 4KROC 5I74B 2VDOL 1DLHB 3BP4B 4HKBB 5AD0A 2Q7YB 5C07B 1ORQA 3JTCA 1CZ8H 1JV5B 4U1MB 1QNZL 4Y4HD 1UQSB 3RWEA 3O4OC 4O4YH 4I3RH 1CIDA 4G80B 1P1ZB 1OB1B 3KXFB 3WLBB 1BX2B 1FSKB 1S7RA 1MY7A 4N0RA 3FT3A 2XZCH 2DKSA 2OK0L 4XCNA 4N0CD 4LARL 2JJTC 5HVFB 3DRQA 2NXZD 2Y5TB 4KUCD 2E7CA 4WEUD 1TPXB 3QO0B 4QRQB 43C9A 3L6FB 1OTTD 4M6MH 1OGAE 3EZ8A 2GI7A 5HVGB 2QQNH 3WNLA 1PX3A 3RIFK 5IHZA 3ZDYF 5H94B 5A2FA 3REVA 3QA3A 3L3OA 4M6AA 4KMQA 4UTBL 3C60D 3P77B 5IROC 1FE8L 3SN6N 4ZAKA 4HCRA 5BS0A 4EVNA 2Z8WC 3S36H 5SWSD 3ARED 1A7NH 1KJ3L 4X6DE 1BOGB 4U1JA 1KIUA 2K7QA 4K3EH 1VERA 2FIKB 3X3GL 4L4TB 3RU8L 3TO4A 3VFPB 1OP3K 4JVUA 4HLJA 4AJ0A 3V4VH 4S1SL 5ESAA 5JOPE 1JPFB 3IJSA 1MLBB 3JVGC 1N64H 4X0KB 5CEZH 3PDOA 2QSCH 2FGZA 4XNYL 3NFNA 5ABDE 5GGQL 3BWAB 2OP4H 4C55A 3QIBA 5D1ZC 1ZLUH 3MA9H 4Y16A 4RDQF 3F12A 1D9KB 1HILA 5HHMA 4Y5YB 4OUUA 1DSFH 5HGBB 5CIPH 1LO4L 4PJCB 3RVVC 4P46A 3WNMA 1TQBB 5I73B 4IRJA 4MA7L 3ARSA 2DTMH 3S37L 4PJ9B 3C8KA 5E94B 4H25A 2R1WB 3U46B 2W92A 1FIEA 4JN2A 4ZDHA 2XTJD 3IDNA 3VD7A 4F7PA 2V5MA 5EOCJ 1BECA 3FQNA 1DBMH 2VDMH 4ZNCD 1J8KA 4JG0H 5EBWA 1EFXB 1OAQL 4BQ6A 1QSFD 3JWDC 3P3YA 1ZLWH 5CD3B 5L2JA 3MJ8A 4HBCL 3U9PH 4ODUA 4KUZH 3VFGL 3BHBB 4WU5B 5GSRB 5IVZA 1MCWW 2HFEA 2NY3B 2C1PA 1R5WB 3WS3A 4UU9B 3I75B 1LVEA 1N5YH 4YXKL 5CJQL 3MRQB 1AP2A 4ODBD 4X7CC 4KJPD 5EOTA 1BD2E 1QFHA 2ZCLL 4F7CB 4O51B 3PWPD 5JW5B 5EU7C 2D03L 1FL5B 5C9KA 4N8VA 4ZUSB 5T3ZL 3U4EB 4NHUE 4AIOA 3SDCB 3QCUL 1EGJL 1UACH 3QUKA 1EJOL 2R23B 3G5VB 1CI5A 5E6IA 1XF5B 3LD8C 2KQNA 1OAYH 2XWJB 1LMKA 5AAWA 4OZGF 4DVRL 4Z7NF 2HFGH 5JQ6L 5E4IA 5ITFB 5KSVA 4U1NB 1T03L 2PYEE 3P11H 4X6DA 3QDAA 4HWZA 2NXYC 4FQPA 5D1XD 2CUMA 2OZ4A 2VZOA 1MCKA 3SGDI 4YHZH 1RY7B 4G6KH 5GZOC 5MP6H 3KYKH 2HKFH 4N90E 4NNYA 3CXHJ 1DTUA 1GGIL 2BSRB 1F3DJ 4UIKH 1P7QA 1UA6H 1FN4B 1P4LA 4OFDA 3KPRA 3KJ6L 5E6ZA 4FQJL 1U58B 4Y2DB 5FYJU 5C0BE 1JWMA 4EUPA 1NC4D 1BBDH 1HE7A 3SE9H 3LKSA 5IW3A 4HT1H 2FEDD 4LK4A 1DQDH 4K2UL 4ZFGH 5HGHA 2F8OA 2O93L 1HHJA 1RJCA 1B9ZA 4R26H 1FVDA 5J8OA 5CBAB 1MCPL 3KAAA 2H2PC 1UEYA 5KVGH 3J7HA 1RK1A 4QOKE 2FZ3A 1VFMA 3SCMA 2A6IA 1U8LB 1GJIA 1UXSA 2VH5L 4IRZH 1ZANH 3TJEL 4AEIH 1IGML 4MB4A 1JPGB 5EA0H 2PCPA 5BW7A 4S1DC 4KRPC 2OR7A 4P2CG 3BJ91 4JKPH 4XP6H 1G7MA 3DHJA 3MBEB 1W72A 5I76A 5ADOL 3BQUD 1NBYB 3FQTB 3CFKB 3AXLB 2AP2A 4R90L 4LSSH 3VFRA 4WI2A 2VZSA 4KPHH 4JFYB 1P6AB 3QFJA 4BQBA 3MRKB 2V9TA 2YMXH 3HE6D 1BD2A 1X44A 3VXNA 1YNTA 4OZGB 1XCTA 2EDFA 2QJDA 1GRWA 2CXGA 4PB0L 1FLTX 5GS1C 3DXAD 2LFGA 2LV4A 2NZIA 4HCRH 3ARGD 1I3RB 4GSDH 4MXQA 1GCFA 4LSTL 2OX5A 2EYSB 3HN3A 4K3JH 3P9WB 4ZPVA 1RULH 1TTGA 3H42L 2D7NA 1RUPL 2Y5EA 4GO6B 4NN6C 3NIDF 1T80A 3PQYB 2V2TB 1FH5H 3OKNB 1G7IB 4H8WL 3H7BB 4Z8FH 5EO0B 1SYSB 4LIQH 1QRNB 1SJEB 3WIHL 2LU4A 1A9EA 3LN4B 3MV8B 2IPTL 1T89A 3RZCD 1WWCA 1ZA6B 1N8ZB 1NGYA 1JYXA 4V3EB 4JY4B 1ES0B 3P4MB 1NBZA 1V3JA 3TPUE 3BW9A 4ZODA 4I9WD 3QCTL 5SV4A 5HYSG 3WO4C 2MOVA 4EI6A 3L3JB 5JLZB 1K2DB 3QNYA 4AENA 4P9ML 3MBXH 1H0DA 4R4NC 1YYLH 1HXYA 5KS9E 3QISA 4D9LH 2MQ3A 1MIMH 2NY0B 4QTIH 5C0BA 4Z0XB 5D2LE 1WSST 2BSED 5C86A 1KLFA 5JNYA 1MRCH 3MV7E 3VFUB 4WV1A 3GMPA 3V4UL 3CSYA 4MA3A 4MB3A 2Q86B 4JREB 4JQXA 4R2GD 4S11A 3E1F1 3KLSA 1H5BC 1BREA 3MRIB 3X11B 2PW1B 3BGMB 1Q72L 4U05A 2FBOJ 2AK1L 3GSRA 2NY7H 4LKCB 5B3NA 2IQ9H 3QPXH 5TQ0L 3T0EC 1QSEE 4QOKA 3CSPA 5EPMB 1WJ3A 2ZPKH 3HC0B 3TJHC 3QCVL 3DHMA 3N06B 2XQYK 5CINH 1DBAL 4RGND 4CVZA 1H9VA 4RFEA 1KB9J 1JWUB 4GRLC 3HZYA 2DBLH 1YECH 1MJ8L 1JNLL 2Q8BH 2QQQA 3VH8A 4LGSB 3VXPB 4LVHB 4NT6B 1NAKH 5MI0B 4XAKD 2HN7B 4E0RB 4OZFG 3MRDB 4ZFOA 4PJEB 5J56B 4P99A 1L6XA 3HG1B 3Q6FB 4LPVA 2VLJD 3U7WL 3MUGA 3F58H 5JORA 1A6WH 3FB5B 4LSVL 4JFOA 1UB6B 4BFIB 3NH7L 1OSPL 4HDIA 4U1HA 2I25N 3TVMC 8FABA 3NIGE 3FRUB 3ET9F 1ZEAH 5SWZB 3T0XA 4JO3H 1CQYA 4N8CH 3EDKA 5KSAD 3QIUA 4WY7L 4D0CA 4M8QA 5DK2A 1II4E 5C0AD 4RGOH 1IKFH 3KLAB 2JJSC 3BP6B 1R3LA 5IB1A 3SJVA 4KROB 4YIQA 5IFAL 3QNXB 2I9TB 5MENE 1CLZL 2NY6C 1JZ6A 4ELKB 5A43C 3ELAT 3MJ9L 3GHBH 4M62L 3CFEA 4BK5A 4PGBB 3TPUA 5JXAH 4LCYA 3CFJB 5DSCB 1IGFH 3KJ4C 1VESA 2NYYC 4XNQB 2H32A 2EDNA 1BP3B 1OAZL 4EUPH 4CGTA 1PEZA 3LMJL 4NQDA 4XVSH 1UH3A 2R1YA 4RIRB 4X6FA 4L4VB 1NMBH 5FV1L 4H20L 2GSIB 1LDPH 1T1WB 4PJDE 3QXWA 5EULV 2ZP0T 2E9BA 3O3BB 1YY9D 4HF5H 2DI8A 2YSSB 1RUAL 3MRRB 2DJ4A 1WFUA 5F7LB 3S96A 4HUVB 1G84A 1LO0L 2EKSB 2JIXB 3LKNA 4Z7VE 3QJFB 4KMTL 3WFEL 3GIVB 1M05B 2EECA 4AG4H 2CMRL 4G8IB 2A74A 4J4PC 4JPKL 1INEL 3OKDB 2HJLB 1EHAA 3T0VA 1W72H 3DSFL 4JVPA 5IMMA 4Z95H 5DJ0A 3HE7A 3HAEB 4PB9L 2IALB 2PO6B 4XZUB 5C8JA 5DR5H 2CUHA 1CXKA 5CCKH 3S5LB 1MNUH 5ICZA 4YHIA 1KTLB 3O8XD 3JWDL 3CK0L 3I9GH 1FNSH 4KV5E 1RV6X 5GJSL 1CLYL 3MRNB 4NRXA 4OD1H 5C08B 5HPOA 2P7TA 3TFKC 3EHBC 1XH3A 5DJCB 1HSBB 3V4PL 5BVPL 2DWDB 5BO1L 4MQXC 3ILQC 3FFDB 4BA8A 3DV4B 2UVFA 3MCKB 3FRPA 3VXRE 2OI9B 2OQJB 1S9XA 4FN0A 3MRCA 1DR9A 1XGQA 4KK6C 1KXQE 2YPVL 1R3IH 5BMFH 2ESVA 2X42A 4P4KC 5EFIB 4PRID 5C0GB 4OKDA 4I5BB 5FOBB 1MHPH 1BEYH 2QHRL 4M43H 1LQVA 3FB7B 2V2XA 3VXUB 1F3JA 4ESKA 3P30L 4W4OC 3SE8L 1J8HE 4G6ML 4MJ4A 2NY1C 2PTTA 35C8H 2VAAA 1QQDB 3ZKXC 4HZAA 3FCTB 2X6MA 1K6QL 3D0LB 3PWLB 5I1JH 5DVKA 1M4KA 5HY9B 4MX7B 5ITBH 3DROA 3MOBH 1VFAB 3D39B 1NFDB 3KYNB 5HTSA 1XF2A 1QRKA 3F7VB 1K4DA 4YH6A 2B4CC 1H3VA 5KOMC 1EO8L 3LD8B 3TT1H 1BF8A 4IOFC 1O7VA 4OM0H 4X6CA 2IANB 4CVXB 4OSUH 3TCLB 4YK4C 1VB9A 1F11B 3U0WL 2AI0L 1RVFL 4Z7VA 5DJAB 1B4JL 4LASH 4V1DA 3HC4L 5E8OB 1OPGH 2R2HB 4DGYH 2P49B 2JJVA 3RNKA 1YDPB 3O9WA 1OLLA 4PJ8C 4YHPB 1O5DT 4U6XB 3DX8B 4KJYB 1QHOA 3V6FB 4O2FA 4M93B 5I8CA 1AGFA 1F4WL 3QDJD 1NJ9B 4GMTL 3R0NA 3TT3H 1IGIL 4MS8A 5DGRA 2RJMA 1S7SA 5JIKA 1ACYH 1R3JB 4F7EB 2X4PB 3PWJA 4NFCA 3LPFA 3TH4T 3BDXA 3CH1B 4CMHC 1CICD 2DDQL 4KKCD 5D1QC 1CG9A 3T3PF 4UT6L 5DS8A 3RWFA 2HLFD 4G6AC 1JNNH 1GPOL 1RAMA 4EBQL 4A6YL 3AU1B 1U3HD 1WIUA 3VXRA 1YEKH 3VI4E 2E7HA 3AM8C 1Q9WB 3QWQB 3C9NB 5F9AC 5CEZD 2J88H 1I9IH 3MUHL 1YC7A 5LXGH 1ZT7A 3S98A 2E7BA 3FMGH 2A38A 5C0DA 3UTSD 3T0AA 4KRPB 1A4KB 5K59E 2FLRT 3PWUA 3I3BA 3G04B 2PNDA 3ME0A 4KU1A 3THML 4K9EC 4I3GA 1MCEA 3FT4A 3NCEB 4PLKD 3WS6C 4FZ8L 2H32H 5FHAH 4A6YB 1J0JA 1I9RL 1IC7H 3ARYA 4PJHF 3ULVF 5DT1L 5KSBF 1XAUA 3QWOA 4YO0B 4NO3A 3W9EB 3OX8B 5JR1H 1AD0A 2BVUA 3D69B 2ORBH 3PWVA 3KPLB 4XBEH 3U7YH 3DGGA 3OKMB 4MVBC 3MLTA 4ZUVB 4QXUH 3QI9A 5J6HB 4LSUH 2FH8A 5GGSB 1WWWX 4TNWK 4OCYH 1CXIA 5F7MC 2CDFA 5T1KD 3V6ZA 1G9NH 4C59B 5EU4B 4ZD3H 4PDCE 1TCMA 5E2TL 3QXDB 1JGVL 2JK5A 1CGSH 4YQXL 3MZTA 2APTA 1NCUA 3G6JE 4QKXB 1QHPA 2FATH 3FO9B 5EH1A 4HS3A 4YNYA 1U6AL 4NN6B 5IP4A 2ICEB 1DN0B 4OKVA 1DLFL 1NBVL 1IC4H 5FUCC 1OWRM 4NDMA 4MQ7A 2Z35A 4H0HB 3ZT6A 2VITB 3ARPA 3ARWA 3U6RA 2Z31C 2EH8H 1LP9A 5L2KB 1S7WA 1XIWD 3RIAK 1RZKC 3WO4B 3B4NA 4U1IA 1DL7L 3UPAA 4PJBE 1YEDA 2GK0B 3ULVL 3X13B 3GMLA 5IB5A 3OXRB 1T0MB 4PGEA 3B8YA 2VIRA 2BRRH 1NCCL 1V3KA 3T65B 5FKPB 2DLEA 3AAZB 3TH3T 1GGCL 1HHKA 3BI9X 2ICES 4HJ0C 3BO8B 3IFLL 3PJSB 3QUZB 3VXTB 3T09A 4I0CC 3P0VH 4EIZC 2GW5A 4LCCA 1Q9OA 3WXWH 1UM5L 3C6SB 2JELH 3TYFB 3T04D 5T1LA 3KDMA 2BNQB 4APQC 2ZG3A 4V3DB 4QF1B 3NFPA 2GCYB 4Q9QL 4FP8L 2G2RB 2R9HC 3PGDA 3B6SA 5ACMA 4D9QE 3H8NA 1NEZA 2CR6A 1NMAL 4E41B 5I8KL 1P9MA 4O00A 4KY1L 4W68A 1MPAL 3QUYC 1OTUD 4PJIF 1YZZA 1UB5B 3TA3C 1R6VA 3RKDC 1SEBB 5KANG 4R0LC 1PYWA 1VPOL 4LSQH 4ZUUA 1Z0MA 4BZ2H 3IFNH 1JPST 4MJIE 1RZIA 3W0WB 5EC2A 4JFFB 1C5DA 1CF8H 3VWJA 3LEXB 5IWLA 3D85A 4PY8I 2GUOA 1B6UA 3ARDA 4U1LB 2YC1A 3Q2CA 2WZPD 3GDBA 1GHFL 2VXSH 3TVMB 2FL5B 3D25A 1JI2A 2VKWA 3FT2B 2AEQL 1JIBA 1A7QL 1ZVSA 4YUEH 4AIXA 5IFHH 3G6JA 3O3AA 4P57A 4XVTH 4GQ9L 2R0ZL 4EDXA 3CVIL 1KCRL 2BOBA 4GQPH 1EEZB 1BQHB 2DLFH 3WE6B 4DEPC 5AAMA 1UGNA 2VXQL 4EZMA 3CX2A 1I1AB 4QHMB 3QDMB 1GIGH 4NC0B 4ZOAA 2C7UB 1JPSL 3AVEA 5BXFA 4XCYA 1OQOA 2AV7B 2R56H 1X5AA 4NOBA 1BFSA 3MRHA 4P5TA 3KJ4B 2ITCA 4ZAKD 1KIPB 1KNOB 4DCQB 2HTKD 1J0HA 3OR7A 4Z7UB 4OZIF 3BKYL 3GEWB 2Y4SA 4XX1E 6FABL 2BNUA 4K71C 3T4AB 4CJ0A 4UILL 3ARFB 3B2UD 1HQRA 5I75C 3TZVA 1FZMA 1A7RL 3ZTNL 2A1WH 2RCSH 4JDTL 2FYYB 5FHBL 1EV2E 1PSKL 2AV1A 3C5JB 2BY2A 2W9EL 4PRHB 2NY5C 4WCYH 3VD9A 3PP4H 5D71H 5JZ7C 2HH0L 2ZUUA 4B7LA 4PJIB 1EAJA 1JZ5A 1CT8B 2MMXA 2AAVA 4J3OC 4TVPE 5JOFB 2BJML 4OLUH 5E9DE 4YR6A 1P4IL 4Y16D 4UMGA 2X9WA 1QR1A 4LBEA 4DZBA 1HHGA 4FQCL 3RWJB 1GGBH 4P46D 3UJIH 4IRJD 1RZ7H 2NXYD 3TF7C 5GGTA 1Q0YL 4ZFZA 5FYLD 3OXSB 1NLBL 5EBMB 3GUTA 4DKEH 1NSNH 2NLJB 5FCUH 2OXHA 2DLGA 5GZOD 3IRZA 3DMMC 5DHVA 3MO1A 3EYUL 1MAMH 2NW3A 3ROOA 1JVKA 1K8IB 5K9JH 4MJIA 1ACZA 2KZWA 1AHWB 1ZVYA 4FTVD 4ZFFB 5ANMB 5F6IC 1KEML 4J6RL 3DVNB 1IAKB 3IU4H 3ZKSD 4O02H 1NAML 2VDNH 4XPTH 3PL6B 5BQ7A 2E9WA 5LGHH 1LK2A 2KQMA 4KQ3H 4FXLA 4HKZA 3KNBA 3SGJA 1ZT1B 3VXOB 2WANA 4D0BB 1OM3H 4YGAB 1IQWL 3HB3C 2PW2B 3TC9A 4N0FB 1VA9A 2VLME 4NQSB 3C5SB 4P4KB 4F7MA 4WUUE 3FAWA 2B4CL 1H3PL 4KKAC 4MCZB 4PJ5B 1ZLSH 3FQUB 5D1XB 5FGCB 4D0DB 2VXUL 3OAUL 2JB5H 3W39A 5F7WC 4HZLB 1T83C 4P2RD 1ADQL 2I27N 3DO7A 2HLAA 3AFLA 1MH5A 4EDWL 2VE6B 3HI1A 4IRSA 1NAMB 2NY1B 1A9BB 1CE1L 1AO7A 1T1YB 5C1MB 1RZFL 4S1DD 5DJ6A 5E6ID 1IM9A 4WI7A 3TBVB 4DFIA 4F9LC 1J7VR 1TVDA 1C5CH 4PV9B 3BZFA 5INDA 4HK3N 1BAFH 4YC2C 3IAQA 1MQ8A 4RMQA 9CGTA 3I50H 3OAZK 4XBGB 3GI8L 1AY1H 4JHWL 1OAXH 1Q9KB 3NZHH 4MLIA 4TUJB 1NC4B 4CDHA 1BGXH 1JGDA 1FNGA 3TBSB 2FWOB 5DMYA 4N9GA 4GG6E 1IZJA 3C2AL 6CGTA 3H3PH 5IQ7H 5F96L 4K94L 2PYFA 4AH2A 4NM8H 2BDNL 3R06B 1P2CA 2D7OA 4YK4B 1WFTA 4NO5A 3SDAA 3QFDA 4PJAF 3SHSA 3RZWA 2DYPA 1P7QD 2IQAA 3BDYH 3KPRD 3PDGA 4P59H 4MMZC 4DTGH 4URTB 4NFDA 3WKNA 2CLZB 2MQ0A 1INQB 1IT9H 2Q3AA 5I1LB 3GRWH 4PJ8B 2X4OA 5EU5A 1I7ZA 4FFYH 3ULUE 1P5UA 2BY0A 3FJTA 3GJFA 5E2WH 3QDHA 2VWEE 5J89A 3RDTC 4Z7WB 5D7SL 5FDWA 4ODTL 3ZL4H 2CO6B 3OAYH 4KGJA 5C7XL 3B2VL 3MNVA 4S2SA 2BOCB 5ACZA 3Q3GB 1R0AH 1NL0H 3VXSB 5E1AB 5IHUL 1A7PH 3SCMD 1OCWH 1N6QL 3VRJA 2YBRB 4K9EL 3FO0H 4XGZB 5IBTH 3FTGA 5IVXA 4OZHE 2FJHA 4U3HA 1UKTA 1G1YA 3BESR 1DDHA 4WHTA 1HXMA 4P2OA 4PGCB 5J06A 3CZFB 3MOAL 1JUFB 4PD4J 4R3SA 1S7UA 3QQ3B 3RUGF 5FFLA 5IQ9B 4TULL 3L5IA 5F7DA 4D3CH 4Y19D 2IAMA 1CS6A 3IGAA 4PRNB 3TPKA 3LV3A 1TDQA 1ZHNB 5F7YC 1A6UH 1ZV5A 5A40E 3W9DA 3ALPA 3QFJD 4I0PA 1F6AB 3G6DH 3TN0A 4RFOH 4GAGH 1FVCB 3CDYA 1RIUH 3T0ED 3EO0B 1AJ7H 3RA7L 1QBML 2EC9U 1MFEL 3O3EA 2NX5B 2VDPL 3TJHD 1DN2A 1GL4B 1J0IA 4LLAA 2FX7H 1DJSA 4BUGA 5HVHC 5M95B 1MCDA 4G42B 4N5EA 4GRLD 4DQOL 3E2HC 4Q74A 4E9LA 3M17A 1IRAY 1S9VB 1NCBL 3K8MA 3O6MH 5I8EB 2I9LB 3MSPA 2AXJA 4QHUA 4WGVB 2X1PA 3W2DH 2UZXB 4UAOB 3VWKB 4WDIB 4L8DB 1SY6L 5HHOB 4L4TE 4DWHA 5CGYC 3VGHA 1RZKL 4ZSOB 4U31A 3L7EB 3OZ9L 4HUXA 1NLDH 3BEVB 2FB4L 3SY0B 5I2IB 2DKMA 1ZHLA 2B0SH 5C09D 4LHUA 4N0YH 3IDMB 4DKFL 4GW1B 1IL1A 4Y5VB 5C0EA 4YHNB 3L1OL 3IJYB 2H6PA 4HGWB 4ODHL 2IWGA 4DVBB 1E6JH 1N3NA 4FFWC 3IAPA 4FABH 3V5HA 3FN0L 2K1MA 1VGEL 2ZNWA 3PGFH 5EO1A 3GB7B 3IKCA 1WAAF 2QR0B 4NBXB 3S88H 4ZO8A 4JRYE 5GGTH 3QPQD 2ZUTA 3OKLB 2Z31B 1YEGL 4JR9L 3PHOB 4PJCE 3V52H 3UYPA 5ID0A 1J1XL 2Y7QB 1PDKA 1Q0XH 1H3GA 4NM4L 1KJ2B 5DHVH 3O41A 3MLWH 1M6OA 1CR9H 1UWGL 4X5WB 3RUGB 4HUNB 4LNRA 3RNQA 4A2LA 5LAXB 3T1FB 7FABH 2XKNB 2NYYD 2GJJA 5MHSE 4C54A 1SEQL 4JPIB 4X5LA 4MAUL 1FJ1A 4KVCL 1C5BH 2D0FA 4ONGL 4WFHE 3HI6L 3SOBH 3SPVB 5GRUH 4X80H 1QPXA 1I85A 1IAOB 1CGWA 3B9KC 1JHKL 3WNKA 3C6LA 4AZ8A 4I2XB 1XZ0A 3N0PB 4HKJA 2DAVA 4PRBB 5GZND 3RVXC 1HOCA 3RVWC 1TJIH 5BV7B 4I18B 4LVOB 3AGVA 1S7TB 2DIAA 4OFPA 2HTLC 3ARRA 3PP3K 2GJ6D 3QR2A 1G7QA 4CRPA 2XZQH 1EHXA 5J6GA 1YQVL 4XRCA 4MB5A 4MGXA 4AEEA 5B38B 2E7MA 3HFMH 2ICWA 2EDHA 1YYMH 4FOMA 5DQ9A 1F02I 5GSVA 1MFCL 5F7KC 1JGEA 4G43A 4CBPA 3C5ZB 4HMCA 2Y6SC 2UWEA 5I1HH 1JPTL 5JUEL 4NQED 2VLRA 4PYGA 2DJUA 5GGUA 4PUBH 4TVPH 3O45B 4RGMB 4WFED 3WFDH 1S5IH 1UZ8A 1FCCA 4XP5L 5IT2H 3WN5C 1V8HA 1WF5A 1UWEL 2MNUA 5GHWH 1AIFA 1RJZB 1C08A 5E6YA 3VCLB 3CMOL 2VDLL 4ZOBA 4DEPB 4NQDD 4PG2C 3KHOA 3TM6A 4LDEB 4J1UB 5LBSL 2W65A 5BRZA 3U30C 2NY5L 4JRYA 3UAJD 4RWYH 3N50A 2YPLA 2FLBT 4TOYL 4MQTB 4W6YB 4M7JL 2F58H 2CXKA 4X99B 1A4JB 2DN7A 1CDGA 5DEFB 4FXKA 1EDQA 4FQHB 1Y18A 5AG9A 5FYJD 2J6EA 4X98A 3UTQB 2QKIB 4G8GD 2CSPA 4JKWA 2XPGA 3WFBL 3LH2L 2CDEB 2F9BT 3CFCH 2OL3L 2Z91A 2Y36H 4JFPB 4KWUA 1U8KA 5EU6E 1K3IA 3NACL 4X7SH 3GNMH 1NCNA 1FFOB 1RHHB 1X5LA 1LK3H 5IVNA 2FD6L 5FUZL 1T3FB 3HE7D 3ZT7A 3P73B 3HNVH 1CL7H 4NCC2 5DEZA 4XH2A 2P5EB 3DRTA 1OY3B 4MXVF 3E6FB 1TMCA 3VFTA 3IFPA 5DI8B 2FJGB 3H9YA 4HWBA 4IOFD 1LILA 1H3TA 4Y4FA 1LEIB 3NVQA 4E5XA 4PRAB 1GOGA 5DD5H 5BZDA 4NHCH 2OL3B 4LDLB 4ETQA 4GLRH 1CZ8L 3K8LA 2UYLA 1J0YA 3RQ3A 4O4YL 3P4LA 2VSDA 4YFEA 3ARBB 2ARWA 3DMMB 5CJXA 1T1XB 1X5HA 4OGAC 1T6WA 3NCMA 1CK0H 4RISH 3AMKA 3IXAB 2XZCL 1BOYA 2H3NA 1HKFA 2ESVD 5F6IB 3GK8H 4KTEH 4MNGB 4EN3C 5I30L 1FIGH 5TDOB 3O6FC 4QHLB 1G7PA 3PQYE 3RGVA 2AXFA 1FP5A 5D1QD 4H88H 1KEGH 1SQ2N 3CLEH 1J9CT 2X1QA 5IV2B 4NN5C 2QQNL 4XX1G 2R1XA 4ZQKB 1NDGB 3QRFM 1TIUA 1KPUB 3MV8E 1H8OA 5C2BL 1AI1H 1MRDH 2WUCL 3T77A 5IEKB 4YDKH 2R8SH 1A7NL 3RWGA 3RTQA 1BVKB 3E8UL 3ULUH 3K8KA 4UDTA 1A2YA 3CX5J 4PBVC 3MRFA 1RMFL 3DGCR 4KHXH 2XACC 3P9LB 1Z3GH 2F54E 3MNZA 4DN4H 1GSMA 3OKYA 1KN4L 2DQIL 3I6GB 4JHAL 2Z8RA 3WNPA 4KKBD 4JDVB 4GXUM 3U0PA 3BOVA 1OD7A 1YNLH 1RJYB 1T04A 3S97C 1UWXH 1YY8B 2X44D 2V2WB 4NQXB 4PREA 5E5MA 4KI5E 2CGRH 3ES6B 5D7KD 3WSQH 4V1DD 4AIZA 3ILPA 3RJQB 4TRPL 2VDRH 3O9WD 4AQOA 2HT3C 1MJ7H 2HJKA 4IIQA 4MVBD 1YPZA 4LLUB 3GSWB 1CXFA 5JQHC 2GAZA 1MCQA 5IB2A 2CIKB 4P2QA 2VZUA 4HK3J 2VL5B 1UZ6F 4G9FB 3IAGC 2YK1H 2VDML 5EN2A 1S9WB 3FQWA 4OD2A 4P5MA 4PJEE 3SKJH 2OTUB 12E8H 2R4SL 1Q1JH 4HIJB 1G0XA 4HLZG 4KUZL 5CIPB 5CJOH 1ETZA 1XF1A 4C56E 3RDTB 3WJLC 1CD8A 2ICWI 3FONA 4HX1A 3WBDA 4JAMA 3MJ7A 1N5YL 3VFNB 1EMTL 3CLFL 4ODXA 1BIHA 3MODH 5I1CL 5ISZB 4G8FB 4HEPG 2KUTA 4YBQD 4H0GA 5DF0A 3GKWL 1CGTA 3GSQB 3J8F7 1IGCL 4FFVC 1M71A 5F9OH 2AJXH 3I02B 4F3FA 2DL9A 2F5BH 5HDQH 1RZGA 3MLVH 5TFSH 3O3DB 5JPNB 5KJRL 5CEXB 2EO9A 3VD3A 2WBWB 1KTRL 2EDKA 3MREB 2RIKA 4UNVA 1JZ7A 4OV5A 1G0DA 4MXWH 2HFGL 3UTTA 2ADGB 1AQDA 1H3XA 4JFXA 3P11L 3MRGB 4APQD 1QBLH 4JFEA 4LHUG 4OIBA 4WIQA 1NDMB 4M5YH 3I3EA 3T4YB 1JTPA 2O5XH 5F88A 1UG9A 2R0KL 3QEQE 3QEUB 3QI9D 1CGVA 1DANU 2RFXB 2J6EH 2HKFL 3KYKL 5F9JA 5GRWA 2F54A 2D9CA 1J18A 2AJZA 2CK0H 3UX9B 3TA3D 3RKDD 1J88A 1U2CA 2P8LA 4HIXH 4KJQC 1BLNA 2Q20A 3UJJH 4HWNA 3VDAA 2RB8A 3C08H 3GBNH 1F6LL 2F53E 5SWQA 5D70H 1QLRA 5B4MD 3S35X 1FNHA 5HYSB 4IMKC 3O2DA 4UV4L 1U8JB 1LO3H 4HT1L 2DS4A 2LTQC 4ZFGL 4WFGE 4WW1A 4A2MA 1BFOB 4Q7DA 4R26L 4HWBH 2J8UF 1NC2D 4GFTB 3HZMA 4LKXB 4XWOD 4GBXA 3MV9E 1NCAH 3BP7A 3BN9C 1KG0B 5CS7A 5C0CE 5KG9B 4L3EB 4G3YH 1IC5H 1B0GA 1IGTB 2LAGB 1FL3B 4IRZL 4NUGH 3QIWB 2BCKB 1SBSH 3HR6A 1I8LC 1A1MB 3B3IA 2DD8H 3BKMH 4JKPL 2HWZL 3BEWB 4M1DH 5B3JF 1DBJL 4XCEA 1QO3B 4HPYL 4P5KA 4XWGH 2WBJB 4HIIA 1KCLA 5DJZB 4LCWE 2Y07L 3CXDH 4LSSL 5I16A 2BNRE 5T1LD 1E28B 2BFVL 1G6RA 1G9MC 2VXTL 4PBWD 1I7TB 2HT2C 4ZXBB 3KYOA 4QRTB 1N4XH 2P8MA 3IRPX 2VB5A 3TESA 2C4XA 2P5WB 3EOTH 3LS5H 4OCSL 3LKOB 3WL9A 1EH9A 4XXCA 3GMRA 4OZFB 3K4DA 1ORQB 3EYQD 3KPQA 5DC4B 3T8XA 3LS4H 2IPKA 2YPKA 2E7LA 2KKQA 3B9KB 4PRPD 2ZUQB 4W6WB 1S7RB 3FN3A 3FT3B 5JZ7D 4P3DA 4NQCD 2O61A 4NFBA 4EOWH 3TV3H 1ZKAA 1YQ2A 1DQQA 3DRQB 2VL4A 3D39E 1WITA 1NFDE 3SDDC 3D85D 2XG4A 2BERA 4LIQL 3F6LA 5FB8A 4IBLT 1UCBH 5IHZB 3REVB 3QA3B 3ARDD 3L3OB 2D31A 5J0BA 1TNMA 3DURA 5BS0B 4LLDA 2IANE 3LN5A 2HAZA 5D7LD 4OLVL 1EEQA 2F53A 4HS8H 1QTYT 2AJ3B 5SV3A 2NPLX 1H15A 3JV0A 1KC5L 3TO4B 3L5XL 4FHBD 4R4FH 2RAMA 2BSTA 3BRFA 2D7TH 5DZLA 5ESAB 5F6HI 5J3HD 1A6ZA 4GKSA 4J3TA 4HMDA 2J4WL 1FDLL 3PDOB 3WXVL 5HYJE 2B1AL 4X6DF 4OD3H 1QEWB 1A0QL 2VR4A 3QIBB 1WT5A 1A8JH 1AXTH 2WWMC 5C0CA 2IQ9L 1HZHH 3KPSA 4AMKH 3E6HA 1HILB 1HKLL 5ALBL 5FAAA 4MAYC 5HHMB 5TPWH 1OP3H 4OUUB 3HB3D 3LZFL 4JZOB 3U30B 3BXNB 5EIIA 4JHZA 1TTUA 4P46B 4XAWH 5CINL 5IFJB 1FRGH 4K7PX 4DKDC 3C8KB 5FKAA 4H25B 4JN2B 4LMQI 2DBLL 3QUXD 5LJYH 4BM7A 3VRLF 4FQXC 5JMOC 1AGCA 3O4LA 5E4EC 4F7PB 4M02A 32C2B 5GGRY 1INDL 4KH2A 1BF2A 4U3CA 4LCWA 3TO2A 2DWEA 1NAKL 2BNRA 3FQNB 5JHDA 4JANB 3LB6D 3QDGE 2ENYA 4FQ1L 3QNZA 2XN9E 2I60L 5L2JB 3MJ8B 4ODUB 3F58L 3EKCA 1ORSB 3KG5A 4LQFH 2HFEB 1MF2H 3DO3A 1YEIL 2C1PB 5A16A 3WS3B 1FV1B 4PJFE 3JXAA 1ZEAL 3HCVB 1I8MA 4XTRC 3DX7A 4M6OL 1AP2B 4NWTH 3LKPA 5EOTB 3S35H 4RGOL 1J5OL 1IKFL 3D3VE 2R2EA 4ZS6C 1HI6A 4UBDC 5TF1L 4YE4H 2AKRA 5DJYA 1Q9LB 3QP3A 3HMWL 4QO1A 3JV4B 2UZIH 3EDJA 1OGAB 3HUJE 1WV7T 4MD5B 2EDEA 3OL2A 1YN7B 1YEFH 5ILTH 3GHBL 4JPWL 5JXAL 1VKXA 5E8EA 1IGFL 3OKOA 3WD5H 2EC9T 2HKHL 2YN5A 5KSVB 3UBXG 4Y8DC 3O2DH 2R0LL 1NMCC 2VQ1A 4X6DB 4XVSL 5C0NC 2ZKHH 3KPPA 4NKQB 4EN3B 4JGMA 1CCZA 1MSPA 1A6TB 5FIEA 1LDPL 3PE9A 3TEUA 3UO1H 3QG7H 2FJFA 2NQCA 4I13B 4NNYB 4IRSD 4HF5L 2LE9A 2XY2A 5HHQA 1B3JA 4RNRA 1P7QB 2LAAA 5L8KB 1P4LB 1EBPA 1JI1A 3BPNC 3IDXH 2VXVH 3RVUD 2CRZA 3O6KH 1CTOA 4KJWC 4HIEB 1JWSA 5I9QC 2EDBA 1JWMB 3WEXA 3LKQA 2YA2A 2HFFA 1FCGA 3LKSB 3PV6A 5DUMH 5D2NC 4L8SC 3FB8A 1KIQA 4UINL 3SE4A 3EOAA 4AT6A 4Z95L 2Q76A 1HHJB 4MNQE 4IJ3B 2XXCB 3OKKB 4N8PA 1XGTA 4S0UC 1GZPB 2AXGB 1CYGA 1G6RH 1DQJA 1JNHA 2B5IB 5CCKL 4LRIA 4F2MA 3EUUA 3RL2A 4GOSA 1RK1B 3RIFF 2FX8H 3I9GL 3QWRA 4WWKA 4GAYA 2A6IB 4P23C 1UXSB 1QLEH 3VW3L 5M7QA 4AY0A 2ADJA 2VLKE 2XN9A 5FEBA 1A1OA 3BD4A 2JKXA 4CW1B 5DUPH 3U36B 1U0QA 4UV7H 4IS6A 1G7MB 4KXZH 5GJTH 3GMNA 1W72B 1U3JA 1MJUL 2RHEA 1IFHH 4OZ4B 1A6AB 5CGYD 4MA8H 1UENA 4PJFA 1MFAL 1T4KA 1RPQA 2CH8A 1JFQH 3QFJB 3LPGA 1YNKL 1BD2B 2D7QA 5L6YH 3BPCB 5EBGA 2PXYC 2NR6C 4ZTPH 3U4BH 1YNTB 3VXNB 2CUIA 3W0WE 3ZSSA 4QWWC 1MCOH 4FFWD 4I3SL 2VTFA 4Q9RH 4NHUB 5CBEA 1P7HL 2VC2L 1M7DA 5DDHA 3WFHB 3ISWA 4P2OD 3PG2A 4J3XA 2HT4C 1QFPA 5CWSA 3NPZB 2J12B 5F1NA 5AG8A 2IAMD 2X5PA 1A5FH 5SWSE 4ZPVB 3VXMD 1RUKH 5JO5B 5I1JL 2Y9RT 4RSVA 3LIZL 5DQDH 3TN0D 1SJVA 2DQGH 1IMHC 4O2CB 4K7PH 5F7FA 1EIBA 1U8IA 4GXUN 3CUPA 1JMZA 1F58L 4WO4A 1A9EB 2ZSVA 4PG9A 5I1AB 1NGYB 5HDOA 1NBZB 1P4BH 1RU9H 3UROR 3BW9B 4OSUL 1ROWA 4N5ED 4XMLH 1F4HA 4AENB 4UQ2B 1I1CA 1H0DB 4Z7UE 4BFGA 3BVNB 4MCYA 4LASL 5C0BB 4ODSH 3L3HA 5FCSH 4QHNA 5JNYB 2HMID 1OPGL 2HG5A 4DGYL 4WV1B 4R8WL 1XR9A 3GMPB 4MA3B 3UTZA 3EYVA 1CU4H 1JF5A 1G7HA 2OLDA 3N1GC 3U0TA 5DMGD 5KS9F 3VG9B 5D2LF 3VG0H 5IW1A 3MLUH 4QOKB 2KDGA 4RMVA 2A9ML 3HMXA 4JG1H 1MVUB 3F8UB 1QSFE 3SE3C 1J11A 2OR9L 3MRBA 1FNEA 4M1GH 4UOW0 5ELIA 5BJTA 4MNHA 5F1IB 3HRPA 2Y6SD 3OMZA 3EOBA 4Y4HA 1AKJA 3MNWA 1YEKL 1G9ML 4C4KO 3STLA 4LLQA 5I6XC 5FA3B 1AE6H 4ZFOB 5IG7A 5HDBE 4UDUA 3UXFA 1HHHA 4JB9H 3PWPE 1MWAL 3FMGL 1BQLL 2O26U 5JORB 2HJFA 3F7PC 1UM6H 1RK0A 3QO1A 4RFNC 4HDIB 4U1HB 4JY5L 4TSBL 5JHLH 3C60A 3S34H 1PKQE 5FO9B 4NNPH 3QIUB 3C6LD 5HHPA 5DK2B 5FGBC 4G7YH 3AREA 4Q0XH 5E2UH 3V5DA 2ORBL 1T2QH 3NA9H 1CIUA 1R3LB 5DO2C 5IB1B 4XBEL 3SJVB 5FGCE 15C8H 2NTSP 4YIQB 3U7YL 1MWAB 4X5XB 1ZLVH 4PY7A 4JZJC 3ARVA 5DD1H 1ZA3A 1KIRA 3MLYL 2H1PL 4GG8A 4W6XB 4I4WA 3ESVF 1FG9C 3TPUB 4LCYB 3H9ZA 4ZD3L 3VMNA 2CIIA 4I1NB 2AW2A 1BZ7A 1CLCA 2FATL 5GS0H 5KS9B 1OHQA 2R1YB 5EC1A 1EEYA 4GS7C 2V7HA 3MC0A 4POUB 5D2LB 2J2ZA 3WLWC 3SDDB 4U6YA 3F7YA 3MV7B 3KPOA 3MYJA 4XNXH 4BKLA 3S5LG 5CZKA 4HH9A 1D5BA 1S7XA 5KN5A 2VLRD 4YGVA 1OP5K 2E3VA 1T1ZA 3CFDA 1HEZA 3IDJA 4J23A 1U41A 1KJMA 3LKNB 2BRRL 1QSEB 4HS6A 1R3HB 1MHCA 1ZWIB 2A74B 4PJDF 5MEQA 4OGAD 1QSFA 4GT7A 4YDVB 1C1EH 1WIOA 3BUYA 1N7MH 2LU3A 2WMPA 1OAUL 4YX2L 2DM7A 5IMMB 4OFVA 1TTFA 5TQ2H 3P0VL 4RMUA 3EGSA 2YPLD 3O6FD 4Z7VF 5C8JB 5DC9B 3EYFA 2JELL 4Z7WE 3QRGL 5ICZB 4YHIB 1YMMD 1BJMA 5KVFL 1IKNC 1CFVH 2IJ0C 5FA4A 5EOCL 2P7TB 1I8IB 4ELMA 1CBVH 4NQTA 1K8DB 4ISVA 3N1QC 1UJ3A 2ZUWA 4KK9C 3DXAE 4OCRL 4ENEC 4FQXB 3DIFA 5T1MB 5T1DH 1WFNA 4KV5F 1PKQA 3MRCB 3MROA 5F9WC 1J12A 4MJ6A 1CFSA 1LEKB 4EI5C 3L7FA 2A6KA 2X4UA 5I17A 3ULSA 3M1BB 1TVBA 3FB6A 5FK9B 2ADFL 2ESVB 3PUCA 4GW4A 1F42A 2FX9L 3TNMA 2DQDH 3IF1B 4Y4FD 1EVUA 3T08A 2HVKA 1CF8L 1KYOJ 5DRZA 5EZLA 4HUWA 2V2XB 5MENB 1F3JB 2DQUH 5F1OB 4FXGA 2PETA 1KCKA 2VXSL 4GKOA 2PTTB 5TE4H 2VAAB 1QSVA 5DRXA 4I9WE 4LP5A 3ZE2E 5JIPA 4XVTL 1JRHI 4L1HA 2P1YA 5GRXG 1U42A 3SDXE 1L7IL 2XG5A 1NGZA 4JO2H 2NCMA 1UJTA 1U36A 1XF2B 5I1IL 1K4DB 3RBGA 1J1PL 4ZS7H 3VFMA 3RGVD 1YMHB 4PJDB 4YFLI 1GIGL 5EB9A 4Z5RA 5C0IA 3BH9B 5EZJA 2BVOB 1RFDL 3PGCA 1CD1A 1ED3A 2O5YH 3HMXH 3BZEA 3BH8A 2X9YA 4JM2C 4Z7VB 3EO9L 5C0FA 1NMCB 4O58L 1DANT 2C5DC 1LNUA 3L95B 4XT1C 2BY3A 3FQXA 3RTQD 1OOAA 2D4FA 3G6AA 4JKMA 1D5ZB 3D5OF 4Y1AD 4RGNE 3W81A 5H37G 2A1WL 2B20A 2RCSL 2PYED 2V5SA 4ALAL 3T0DA 2ZCHH 1I7RA 4GRWE 4OIIH 5CILH 5I8CB 1AGFB 1XF3A 1TZIA 2OBGA 4Y4KC 3O6LH 4FFVD 5I8OH 2W0FA 5GGSY 1JGUL 4U0QB 5ICYA 2X70B 1E4KC 1PZ5A 5FYKD 4XAKE 1OGTA 2X4QA 2PKDA 4L3CA 3PWNA 5I9QB 4KVNH 3BSZH 5D7JC 3ARXA 1IAIH 5IB4A 1CG9B 2CDGB 1N0XH 3ZKNC 3ZO0A 5D7IE 5IF0B 4AQ1B 2J3SA 2VLJE 1LEGA 5JW3H 4M61A 1GGBL 4PJGF 2MCG1 3DXAA 3KR3L 4IMLB 4JO4H 5FM5O 2XZAH 1U8MA 2CKBA 1QFOA 4NN7C 3VXRB 2VRAA 4U3XA 1XGYH 4DKEL 1NSNL 4PJ7A 2Y06H 4PJXE 4M6NH 1A14H 5CP7A 3OF6D 4P2QD 4X4XA 1EXUA 5C0AE 4I2XE 1DQMH 1MAML 4HUKB 1ZT7B 4NKDA 4WWID 1V7MH 5C0DB 3Q5YA 2IFFH 1GAFH 3MV11 3PWUB 4O02L 2VDNL 3EYSH 4KQ3L 1J8HB 5IM7A 4OJFH 3DUUA 1IAMA 3DBXB 3VE0A 2X41A 3FL7A 3QWOB 4K8RC 1DLHA 3BP4A 2Q7YA 2VN7A 3BP5B 3PV7A 4WTXA 5DXWA 1MCRA 4U1MA 1H3UA 5K59F 1AD0B 3F7QA 1S9YB 1UQSA 4AM0A 3SDXA 1OB1A 3MLZH 3WLBA 1BX2A 4X8JB 1ZLSL 3DGGB 3HNSH 5EORL 2X4TB 3QI9B 1QA9A 3WUWA 3IDYB 4LEOB 1RD6A 1MJJB 3B5GA 2BXYA 2Y5TA 4L9LC 2COQA 2R0WL 4R6UA 5LWYH 2J5LC 4KDTA 2ADIB 2JK5B 2WINA 1C5CL 1FL6A 3L6FA 4QRQA 1IBGH 1ZK9A 5H94A 5B8CC 3I50L 4UNTA 3UTTD 1OAXL 3NZHL 2F19H 3A6CH 4MSWB 5IK3B 3QUML 5I1KH 1BGXL 3BE1L 4JFED 1X5IA 2NW2A 4MQ7B 2M2DA 3UZQA 3H3PL 4Z9KB 1BOGA 5IQ7L 3G6JF 2XT1B 3DNKA 2F15A 3MLXH 1S7WB 5FO7B 4NM8L 3BKCL 1IEAA 2VWEC 4OCXL 2YKLL 1M7IA 3HRZA 5KAQG 1YEDB 3GMLB 4JFDA 4PGEB 4D9RD 3BDYL 2VIRB 5EUKB 4DTGL 2IG2L 1JPFA 1MIEH 1F45A 4N1HB 4YFLF 3ARZA 3E3QE 5D7IA 3GRWL 3MRLA 3BWAA 1HHKB 1CFNA 4FFYL 1JF1A 4UUJA 2JF1A 3NCFB 1PQZB 1D9KA 4PJBF 5C6PB 1YEJH 4OI8A 4Y5YA 5HGBA 2IF7A 1B90A 1BM3H 4CKVX 5D72H 4PJXA 4DK6A 5T1LB 3KDMB 1JYNA 1BFTA 4PJ9A 1JYWA 4GBXD 2P5EE 5E94A 1ZLWK 1CN4A 2AS5M 2E5EA 5KSAA 3NFPB 4DW2L 1FSKC 5C0AA 3B6SB 2JCCF 1A7PL 1SMOA 3NCBB 1NEZB 2W9LA 1OCWL 4PRIE 3FO0L 3MA7B 4JLRB 4X9IA 2E6QA 1LQSR 2DKUA 2P42B 5HGDB 4BK4A 4XNZC 5IJKC 4LCIL 1EFXA 1TPXC 4NOFA 4KI1A 1X5YA 4Z7OE 1ZS8A 4ZUUB 4XI5D 3K2UH 4FFZH 3VXQA 5F89A 4WU5A 5GSRA 4KZEH 1RZIB 1NGXA 3G6DL 4RFOL 1Z9OA 3VWJB 1MCJA 1RIUL 4X83A 3RWIA 4AK1A 3RAJH 5K9KA 4I77L 4MAYD 3SEPA 3BPLB 3IT8D 2YC1B 4F7CA 3D25B 4OI9A 2WV3A 4ZPTA 1FL5A 5TDNB 5I1GH 1RIVL 3H9SA 5ETUA 3U4EA 3SDCA 3G6JB 3T0WA 2D0GA 3AB0C 3G5VA 3RX8A 4EDXB 2Z92A 3MR9A 1KXTB 4G9DB 2XWJA 3DYMA 1CXEA 4M7KL 3W2DL 3TBTB 3NPSB 4MDIB 1VDGA 4Z7QE 1JN6A 2V5YA 2MCPL 2W9DH 5LVEA 5E8PB 4JM4H 5BXFB 4XB7A 1TQBC 5I73C 1NLDL 2P47B 1WBXA 2B0SL 5C3LD 3QDJE 4P5TB 2OXGA 4M9OA 1DFBH 4PR5B 4UT7H 3GIZH 1CFQA 1EERB 3OR7B 3EIFA 5GGRA 3O8XA 4RAVA 2F8VA 1UVQB 4TPRH 1N6UA 2G60H 1E6JL 4M9PA 3UC0L 1EGJA 3I84A