3UPRA

Hla-b*57:01 complexed to pep-v and abacavir
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
275
structure length
275
Chain Sequence
SHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRMAPRAPWIEQEGPEYWDGETRNMKASAQTYRENLRIALRYYNQSEAGSHIIQVMYGCDVGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Drug hypersensitivity caused by alteration of the MHC-presented self-peptide repertoire.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, B-57 alpha chain
total genus 77
structure length 275
sequence length 275
chains with identical sequence C
ec nomenclature
pdb deposition date 2011-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3uprA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3uprA01
4PY8J 3WFEH 3LSOB 4ONFH 5I1HL 4PY7A 1X9QA 2IMNA 4H1LA 4KV5F 3JV0A 1CXFA 3GSVA 4L9LA 4O4YH 1YMMB 4XCCH 3VGGA 2Y7QB 3MOAL 3O11A 2R2CA 4PJDB 5CEYA 5FO8B 5I9QC 3R1GH 1U6AH 3MBEC 4ZSOE 3W81A 5C8JB 3BPCB 5FYKH 1RULH 3JUZA 3ZDZE 3DURA 5LJYH 3STBA 3VXSA 4NRYA 5D93B 4ISVA 3U4BL 4HK0B 1HQ4B 5KSAD 3PL6D 4F7CA 1A9EB 4JO2H 5FK9A 3LH2H 4UI2A 3JV4B 2YSSA 2NZIA 4E5XA 2O5XH 4KK8C 5ID0B 3NFPB 3ROLB 3B6SB 3EDKA 2HTLD 2DWEB 3VDAA 5HDOA 5HHXH 3LRSA 3TLRA 1JZ4A 5T1MA 2YOCA 4G6FD 3TYFB 5FGCE 1RSFA 3WV0A 4IDJL 1TTFA 3CVHL 3QUZA 3UAJC 5EU7E 3THML 5JXEA 4FQXA 4NQCE 1HIMH 1R3KA 3BZ4B 1AFVL 4OZGA 1F00I 4KTEL 5J9PA 1BD2A 3EDJA 2A77H 3C2SA 5E8EB 2CIKB 4JHWL 4RQQB 5F1KC 5TQ0L 5DQ9B 4Z7WE 4LPUA 3TJHD 2B0SH 4YHIB 4CU6A 25C8H 5DJ0A 4TUJB 3MLYL 2CUMA 3TVMD 5DJZB 3IF1B 2E9BA 3OAYK 3VCLB 5B4MD 3TFKC 5IG7A 5E1AA 3GK8L 4HDIA 3SKNB 1NFDE 3ABZA 4MJIB 1E6OL 3O8XD 1HNFA 5E2VH 3IU3B 2BCKA 5I8KL 4FFYH 4H1LH 3V4VH 1G1YA 4B50A 2BNRA 2MCG1 4ELMB 5DD5H 1FFQA 3RWIB 2JELH 3CDGA 3UZQA 3VFOB 1C08B 1F3JA 4MMZC 3MJ8B 4ZUTA 3QUYD 1CL7L 4S0UC 2CDFB 1RULL 3I3EA 3QDHA 4MD4B 1HHGA 4PS4H 1OSPL 1T2QL 3ARGA 4NOBA 1CGTA 2FEEL 4PRPE 1IL1A 2B1AL 4ZO9A 2PNDA 2X7LA 1WFNA 1XMWA 5I2IB 3VFWA 1NAMA 1I3GH 3GJEB 4HGMA 4QWWD 2RIKA 1WIOA 2EC9U 3VD5A 1RZGB 3GSWB 3V6BR 3BSZL 2OR9L 1HKLL 1F42A 2Y25A 4B7IA 2EIBA 3O9WC 2IPKA 3BXNA 5IM7A 3B9EA 2VB5A 5MEQB 4S10A 3IFNH 4GKSB 5H37G 2ID5A 4Q6IC 1MREH 5TQ2H 5CZVL 1XF3B 2F15A 3GSUA 4PJ7A 4S1SL 4NZJA 4OFVA 4HUUA 5GGQH 3VXME 5GGTH 3QUMA 1IJ9A 1TJHL 1D5MB 3GB7A 3BMWA 3NMEA 2X4TA 2BNQD 4UNTA 3MV9B 1R3HA 3MUGA 1U8PB 3P77B 3PGFL 5CCKH 5D1ZB 4L3AA 4IRJB 3SQBA 4PJGB 3VH8G 4K7FA 4GW4B 3RNKB 1KSRA 5ILTH 5C0AA 1OD7A 5EWIH 4JN1H 4GAJL 1MCKA 1EO8L 4Y4FA 4NQSA 3OJVC 2IPUG 4GXVH 4OD2A 4AEIH 4B5EA 2VZVA 3ULUL 2VNCA 5CINH 2ZCKH 3LKPA 2A83A 5TPWL 1RURL 3MBEB 5SWSE 3C6LB 5C6TH 3SGJA 4V1DB 4HWZB 3VD3A 1KJMA 1QRNE 1S5HA 4WWKD 4QGYA 1A0QL 4XBEH 1AKJA 3MYJA 2UYLB 1XR8A 3W5NA 4S0SD 2Q76A 3D39D 4NZRL 4YHIA 4X80H 2XFXA 4EQ2A 3DTXB 1UH2A 3SDDC 4JFFD 5CFHA 2H8PB 4HH8A 5ESVA 3KPMA 4O2FA 4H88H 3CMGA 4J3SA 4W4NA 1MCNA 4OQTA 4LEXL 3KDMB 3OGCB 5EIVA 2YK1H 5CP3A 5E5MA 4Y8DC 4M62L 1U8OA 1CTOA 4P49A 2F9BT 1MWAL 1ZT4B 1EX0A 4OZHB 1YJDC 5GPRA 4KVNH 3GMNA 4UT6H 3T3PE 1R3IH 1UYWL 4JRXA 3G6DH 3QRGH 3WD5H 1F2XK 1RZJC 4LIQL 5FUCE 2ICEB 3ZKXB 3MRLA 1DBAH 3D9AH 4Q2ZA 1V05A 3HE7A 2JELL 2ZKHL 1T5XB 2F53B 4RDQF 1KEGL 3G6AA 3MUJA 4U6XA 3SDCA 4TOYL 3B9VA 4S2SA 3X14A 4GRWE 4QHUA 5HI3C 2R1XA 1N3NA 3M45A 5E9DA 5I1LB 2VYRE 5ISZA 1KLFA 3U36A 5DD0H 5ESAA 1G7IB 5D4QA 4APQC 4IHOB 3RWEA 2VDKH 5I75B 5IR1A 4CMHC 3MACH 1FAIL 4M5ZL 3UTTD 4MNGE 5AEAA 5CSZA 1CQKA 3ARBB 1WBXB 2LU3A 2B2XH 5E8DL 3HAEA 1KT2B 3VWKD 2R1WB 4MDIB 1J1PH 1P9MA 2UZIL 3DECA 2W1NA 4F9PC 5IMMA 3TZVC 4K8RL 3RDTA 4JZOB 4Y2OA 4C56E 5CP7B 3WE6A 5GIRB 2JK5B 2PYEA 4XBPA 3KNBB 3RVWD 1I9RL 2VXUH 3VGHA 5C0JB 5GS0D 4I4WB 2VKWA 1T1XA 1XR9B 3FRUB 3BPCA 3O2DA 1U8IA 3OR6B 4DZBA 4JRYA 3DETD 4GFTB 3ULVD 2ZNWA 4NO0A 4NQTA 1PSKL 5FGCB 1ZOXA 4ENEC 1M6OB 4PJFE 2HFEA 3A6CH 1JV5B 1JYVA 1MFBL 1P7QD 3MUY1 1U3HB 1IVLA 1KPRB 1JGUL 3LS5H 4KKLD 1A5FL 1ZWIB 1DL7H 5CINL 4PP1C 4GS7B 3EOTL 3LHPL 3SCMC 3MXVL 4DQOH 5ISZB 2ATPA 3ZHLA 4YUEH 4PS4L 4O00A 3INUH 4AG4H 4TTDD 3VU2A 3NCYP 3LPGA 5I16B 3EYOB 1OGAE 1DLFL 5I73C 3T4YA 2B7DT 5E8NB 5A3IC 3W0WE 1MFCH 3CD4A 2FZ3A 3UTPD 4LBEB 1ZT1B 4F7MB 2Y36H 5EA0L 1A64A 5GJSL 5JDJA 3WN5B 5KS9F 1QNZH 1ZVSA 1G6RB 4X4XB 4OGAD 2E5EA 4BSJA 4XRCA 2AEWA 3WO4C 5CEZH 5ALCL 3WFDL 1MCJA 3CPLA 4MAYC 3SE8H 4FTVB 1JFMA 1FNGA 4CJ1A 3PQYE 3F8UB 2XZQH 5FHAL 5GSRA 5SV4A 1S9KC 4MJ4A 1H3TA 2R1XB 2CKBA 5GGTL 4F8QA 3I6KA 2DBLL 3FQWB 1QVOA 4XP1L 3KHOA 1ZHNB 3LN5A 2HT2D 3RDTD 2XA8L 1OPGH 1VACB 1JWUB 1JE6A 4LKXB 5H2BB 3ZTNH 2ICWA 3RGVC 3ZHDA 1N8ZB 4N0UA 2PYEB 4ZTPH 1FZJB 3EO1B 4OJFL 1KF9B 1T03L 3I2CL 2GT9A 3VRLF 4MD5A 4N0FB 4TPRH 3G9VA 3B2UD 3CMOH 1ZHBA 2N7AA 2CLZB 2A9ML 3OR7B 1UWXH 4PRIB 1KT2A 4U1SB 1LO5A 4ZO8A 3LS4L 3RIFK 5BVJB 3FB7A 3M8OH 4H0GA 5KVFH 2YZ1A 4DFHA 4Q6IA 1N2RB 2AGJL 3CFCL 2WUBL 4UAOC 4P46A 5FDWA 4IHOA 3RWEB 4XHJD 3GBNH 4HG4K 5E99L 3CFKA 3M07A 3V4UL 4OLUH 3R06B 1T20B 1IEBA 3GMPB 5DUPL 1U42A 4PGZA 4HUUB 1LK2A 1JTOA 1YPZA 5FKPA 3UJIL 5LQBL 4U6XB 4NGHL 4M43L 2HP4A 2V7NA 1QBMH 1NJ9A 1BOYA 4IRJC 1XF5A 3CU7A 3OKLA 1YEKH 4IEFB 5SWSB 3ZT6A 1GPOH 3QISA 4CVWA 5EBMA 3O2DH 4RFNB 5T1LB 4LDOB 2CDFA 3RFZC 5CKGA 4U7KA 3QUML 1MWAH 1EMTL 1H0DB 4MXQD 2HFGL 1ZGLB 4BZ2L 2DDQL 3DXAE 2R2EB 2YD2A 5I66A 5E4EB 5D9SB 3KYNA 3O4LB 1WK0A 1JK8A 2EEAA 3DO3A 2DOCA 4TUKH 1OQOA 1ZT7A 5T1DL 3QQNA 3AMKA 1RI8A 5JOEA 4Y8AA 2BNQA 2ICWJ 1JHLL 3HE6B 4HT1H 4PLOB 5E1AB 1LQVA 4M7LL 1ZA6B 2OI9A 1G9ML 2KQMA 2KUTA 4JM2D 5DEGA 1MI5D 2FJHB 1Q9OA 4XGZA 3RL1A 4QXGL 5JXEC 2EXWD 2EDLA 1GZQB 3GHEH 4OQTL 2B39A 5ID1A 2COQA 3KLHD 1C7SA 2FX8L 5EBGA 2CGRL 1TLKA 4YEEA 3F6IA 2OX5A 2EDYA 4YHNB 5JW3L 2EDWA 3WO3B 4JRYB 2DQDL 1W72L 5KJRL 4MVBD 1WAAF 4YEFA 1RAMA 2EDXA 5KOVC 1J8HA 2EZ0D 5I30L 3VXOB 1AE6H 3ELAT 4HWUA 2ZOKA 4ZDHB 1M7XA 1ZS8B 2BSRA 4LLAA 3D6GA 4S1RH 1OAZH 1AGEA 1BFOB 2VSDA 3X12B 3C5ZD 3JZ7A 3DX8B 4G5ZH 1IT9L 3TWCH 2X4TB 1QFUL 1D5MA 1CE1L 4RGNE 2EXYD 3G5ZB 4OF3A 1XFPA 1JFQL 5JUEL 3VFSB 2EDJA 1HEZA 4KKCD 4PV8A 4J1UB 3B9KD 1MFEH 1A7PL 4JFFE 1K5NB 4GSDH 1VPOH 3BEVB 1JNJA 3RZCA 4ZPVB 1OWWA 4PJDF 3Q2CA 2NX5D 1H8SA 5I74C 1P9MC 4PP1D 3TZVA 3UBXB 2VJXA 3MLRH 3H3KA 4LSPL 1X6NA 4JFDD 1VFUA 3D85B 1EVTC 1IZJA 3DV4A 3I6LE 2AJYL 1GZPA 4HMCA 1RUPH 4Z0BH 2DS4A 3NFNB 3B5HA 4RRPA 4FABL 4OCLC 3WFHA 4FNLH 4PJEF 2CSPA 3QAZB 5SWZA 3FO0L 3RL2B 4PGJA 2R4SH 1EZVX 1YEFH 1MCOL 5KN5A 4TUOA 5MP6H 2IG2L 4X8JB 1N4XL 3O2VL 2WV3A 4KUCD 2X41A 3BDYH 5GJSH 5JPNA 3QWRD 4U1LA 4UT6L 3GRWL 4AH2A 4FQHA 1AHWB 4PRNA 3RUGE 5IMLB 5DQJB 4OLZH 1KJVB 2F53E 2VLJA 4LSRL 3TCXA 1K6QH 1RZIA 4JKPH 1AI1L 4L4VA 3F58H 3P4MA 4PJHB 4QXTB 4L8SC 2X9XA 2EC9T 4Y4FC 1HQ4A 1KXVC 4I3GA 3LN4B 1NCDL 3EYQD 1ES0A 1YY8B 4DKDC 1MLCB 2ESVB 2CUIA 1LEIB 4YDVA 2EO9A 3C5JA 1T7XA 4K9EH 2Y7QA 1A6TB 2BY0A 4MZ3A 4PV9B 2F58H 4P2RA 3W9EA 1L6XA 4YHNA 4ZAKD 5J9PB 1CGVA 3MACL 3L7EA 3LSOA 5TF1L 5IGXH 5BZWB 4XNZC 1XGRA 1YZZA 2PTUA 5SX5H 2R4RL 4HWBH 5IB4A 4LLUA 1DFBL 2XTJE 2OMNA 3MA7A 3ARUA 4UTAH 5CD5D 1WTLA 2HTLC 5EU6A 4X98A 4C56B 1J1OL 2ZG3A 1Q9WB 3PXHA 1DE4A 5GGRB 3ESUF 1H3XA 1LP9E 2X9YA 3N85H 5JHLH 1I1YB 3IVKB 4L8CB 5MHSD 3QHFL 4HUKB 1CGUA 5EO0A 2EYTA 4OLYH 2IAMD 4JG1L 2NTFA 4U1LB 1BVZA 4UIMA 1EVUA 3B4NA 4HUMB 4UV4H 35C8H 3EFFA 3B8SA 1BF8A 2R0WH 4LNRA 4M5YH 5EN2A 5BXFB 1EFQA 5FYLD 4X6DB 3RTQD 3O81A 4KJYA 4GT7A 3K2MC 2P48B 3HI5H 4JY4A 3S97C 4RIRB 3QFJB 1B6UA 2PW2B 3O2WH 3QO0B 4PGDA 1N0LA 5HDLA 3GJEA 4APQB 4X9IA 3FQUB 4WU7A 1D5BB 4JZNA 4CVZA 3U1SH 4BH7B 4UU9A 1KB5L 3S36X 1NKRA 1NCNA 1BOGB 3NH7L 3E3QA 4I0CC 3CCHA 4Z7OF 1HDMA 5DJAB 1MIEH 3QWRA 3QZWG 1NEZB 4PJAA 1CD9B 1KXQE 4IRSA 3ARGB 2RJMA 2FX7L 4JO4H 2X4NB 3H3PL 4PRPB 3P9WB 3NFNA 5BW7A 5EFIA 2ZNXA 5ESQA 1C5BH 1NUFA 4L4VD 3OKEA 4N9GA 4R9HA 2AK4A 5GZOC 3S4SB 3GSRA 2ARJA 3CDGB 2P7TA 2VAAA 2XT1B 4XPHH 4WFED 1PYWB 3FB8A 3PQYD 1AXIB 1FPTL 1MPAH 5FO7B 3GSQB 1KUMA 2EE6A 1X4XA 3CU1A 5D7SH 5ACLA 4RGOH 1NSNL 2YMXH 1TFHA 1A3LH 2G75B 4FTVE 1NJ9B 3EOBA 1IM9D 3FT2A 3R4DA 3EDEA 5GZND 2HLFC 3NTCL 3DHJA 4H26B 1YA5A 2M1KA 3ARFA 2B5IB 1MHEA 1TNMA 4ORGA 3KXFB 1C12B 5D6CA 1BBJA 5D1QB 2WMPA 4YHMH 4JRWA 1EEUA 1TCRA 4LCWA 3DX7B 3I02B 3Q5TA 3R0NA 3GJFK 4FMFA 2DLTA 1JK8B 1FFPA 4JHAL 1G7HB 1K85A 3IFOA 4LVHC 4PJCF 3U30B 5KW9L 3P4NA 4AM0A 3FL7A 3G6JA 5J12C 4QRRA 2LU4A 5D2NC 3VWKB 4XBGA 1QZ1A 3SQOH 4G6AC 4GJTB 1ZT1A 3MV7E 4Z7QE 1KCSH 1XF1A 3ILPA 1GVIA 3MRGB 3QPQD 4WHYH 4P2QE 1KYOJ 2Q8AL 5K9OB 2AQ2A 1Z3GH 2XACC 3MODH 1DR9A 4WFGE 1SEQH 3RA7L 2ADFH 4G43A 1V3LA 4K71B 5K93A 5EZLA 3PGDB 3U4EA 4XWGL 1FL6B 2W38A 4JB9H 3VI4F 2ZUTA 3T2OA 4E41A 1QVOB 1WTGT 2DD8H 4QCIA 2DQGH 3V6OC 4O2EA 1BHGA 4FTVD 2AJYH 4U1KB 4FA8A 4X6EB 1FSKC 1Y0LA 1J1XL 2QQNL 3H42H 4JLRA 5DS8B 4WHDA 5J1AB 3QNXB 3GIZH 3QPXH 2BY1A 4HD9A 5BV7C 2AV7B 1UVQA 4LCYB 2Z35A 5M7QA 1U2HA 5DHXB 4PGDB 4TNVF 1XF2A 1NCCH 5C07D 4FQ1H 2R2EA 3EOYG 4YWGL 4RIRA 4RGOL 4U1JA 2NY6D 4PJ5D 2NY0D 2P44B 4RFEB 3V5DB 4MXQC 5F70A 4FP8L 3LB6D 1CD8A 2C7UB 3OZ9L 1VHPA 1E4KA 1AI1H 3WHE0 1G6VK 3GMRA 5T33L 1AXTH 2F54B 1OTUC 1AR1C 2YS4A 1HH6B 4G59A 3WLWC 3I6GA 2PR4L 1MJ7H 2BVTA 2PW1B 2XZCH 5GGSA 4G6JH 2PTTA 1IEBB 2LAAA 4D8PA 4UMGA 2VXVH 1NMAL 4D9QE 5C0RH 5DVLA 5JXED 2YHGA 4YC2B 5E94B 3PWJA 1HXMA 4JDTL 8CGTA 2X70A 1YDPB 4ONOA 4WW2B 4EUPA 2V17L 4PG2C 4NQCA 1AGCB 5JW3H 3NA9H 3NN8B 4AEEA 1PZ5B 5KSVA 2IH1A 1V8HA 2ADJA 2XQBH 4MVBC 1MAMH 3QJHB 1JCKA 1EGJL 1GGUA 3TIDB 4NZTH 1OT2A 1HHKA 4ZO7A 3NCMA 1O5DT 1T1ZA 5BRZB 3K1KC 4R7NB 1ADQL 3MRNA 1QSEE 2AJXL 4K2UL 1KCKA 3K8MA 4LARH 5DJ8A 1MCIA 3S4SA 1R5WB 4CDGC 2W0FA 3O4LD 2WLYA 2R0ZL 5J6GA 2APBA 3LN9A 3BN9D 1QLFB 5IKCB 2EXYC 5DK3A 4R2GD 5B8CB 3BUYB 4HEPG 5B39G 1Y18A 5B38A 1ACYL 3HAEB 3LKSA 1Z2KA 1YQVH 4GSDL 5A2KH 2HKHH 3FHAA 2HJLA 4RMTA 1S5IL 5DS8A 2EDKA 5LGJA 2NXYC 4UDTA 4Z95H 1DVFC 5D1XD 5KVGH 3UYPA 3IB4A 3IDYB 4G9FE 1CFTA 5ICXA 3WHXA 4O5LH 1IC5L 2FATL 3OG6B 3OR6A 5C6PB 4BQBA 4LBEA 4PRDB 1U95B 3TO4B 1RMFL 3ARYA 2DQIL 2VLMD 4NKDA 4WI7A 1FN4B 1G7MB 5GS1B 4AZ8A 3OKNA 1P4IL 2XZAH 4AIZA 4G6JL 4HG4J 1WWBX 3PWLB 4PD4J 4X80L 1V7NL 5F96H 2XICA 2C3XA 3I85A 4K3DH 2HRPL 1Z9LA 2IANE 4QRQA 2C1OB 3F62A 2VLJB 3KG5A 5F9AC 3CFJA 4ZXBB 4EIGB 4GG6B 1RD6A 1K5NA 4L9LC 4X4MA 1UKSA 2AK1H 3ARBA 3SCMD 3KPRB 4XCEB 4XXDB 3FQRB 3G5XA 1GL4B 1FV1A 5BMFH 4M6AA 4QOKE 2DMBA 2YKLL 2P8LB 5I15H 3SKOA 5I76B 4HGKC 4OI7A 2ADIB 3QEHB 1FBIL 1KGCD 5FOBA 2HWZL 3VMOA 3BP7A 4EI5D 2X4RA 2NLJA 3DV4B 5CD3A 1WLHA 3C5JB 4YLQT 4YGVA 1AQDA 1JNNH 4PREA 4LEOA 4Z5RB 5L8LB 3NFSH 2CLVA 1CFNB 3FFCD 5IOPA 2IQAB 4M93C 2J2ZA 1KLUA 5C92A 5IW3A 5C08E 4IOFC 1KJMB 4JN1L 2CDGB 2VDNH 2L4OA 1NMAH 1G9MC 4ENED 1JP5A 2OR8A 2APVA 2VR4A 1MRDH 1ZT4A 2R8SL 3MGTB 3PWVB 1R5VA 1S9VA 1FCCA 4LSQH 1TDQA 4P3WA 5KSBF 4QHKJ 5DO2D 1QEWA 3AXLB 1HIML 4KI5C 3MV01 5F7DA 3UPRB 3K46A 2MHAA 4DOHB 3KXFE 4R4ND 2OL3H 3TN0D 4PJCE 1CTNA 1OGTB 3VW3H 4RGMB 5FCSH 5CJXC 5DJAA 4NQDA 4X9FA 5L6YL 1PW3A 3ARDD 4NO5B 1MH5A 1L7TH 4K2UH 4YXHH 1OAKH 3U48A 3ULSA 3WJLA 3TGXA 1YC7A 3FO1B 3WXWH 3JTSA 1MFNA 1G9NH 3FMGH 1SM3L 2P5EE 4ZNEE 5ITFA 1NGZB 4P2QB 4HPYH 1HHIB 2VKXA 4OAWA 3D0VB 4U6YB 1X3DA 2ITDB 5DMKA 4PGBA 3LRGA 3O9WA 2DJUA 3MBEA 2PF6A 2A83B 5HYQB 3SE9H 4M6NH 3S6CA 1T22A 5EN2B 3KPMB 4ODVL 4PLKD 3QIUD 1PSKH 4WUKL 4NN5C 1VFBB 3QB7C 4UT7H 1CGYA 1D5XA 4U7SA 4I3SH 3OKOA 4MAYD 3BH9A 4BSVA 2EZ0C 5DEGB 1VEOA 3MMEB 4I5BB 3WNPA 1KIPB 3ZDYF 3U46A 1AKJB 2I60H 1MLBA 5I71B 1VFMA 4HIEB 4WIQA 1U93A 3EFDL 2P8MB 4GMSL 1TPXB 3QEQA 3MFFA 2Q7YA 4J7RA 2MNUA 4NNYB 3HKFA 4P46B 5SX4H 4Q9RL 3QG7H 2VDMH 3TIEB 2KZWA 2XKNA 2VXVL 1OGAD 5IVXF 1LVEA 5ICZA 1NAML 2IAMB 5C0CB 3RUGA 1TZIA 3KVQA 4XCFL 2R8SH 1FSKB 2DWEA 4B0MM 3RZWA 4JM2C 1JF1B 1AKJD 3SJVE 4J8RA 2Y36L 5EOTB 2OXHA 4QF1B 5E8DH 1CLZL 5L7XH 3VWJB 2YSSB 1I1RA 3S4SG 1HZHH 1LMKA 3UX9B 1OAYH 1U3YA 4JVWA 1NBYB 1UKQA 2CK0L 4ZFFB 4DN3L 2VABA 4JY6B 4LEOB 2ERJC 1QHPA 4RWYL 3WUWA 2AJXH 5IB2B 4D0CB 5D7JD 1NBVL 1F3DJ 3C2AL 5HHOD 1KCUL 1GGCH 2EEDA 4KTDH 5I1JL 1P84J 3MV8A 3B43A 3QEQD 2CRYA 4HUXB 2A6JA 3O6FC 3ARGD 4K7PX 2E7LA 3ZT5A 2W9DH 2B0SL 3HI6L 3KJ6H 3VFUB 3FONB 5A2IH 5IEKB 4ODWA 1U3ZA 2I5YL 1ZLUK 1A7RH 5E24E 4EUPG 4M1CC 1IGYB 1MHPH 1NBQA 3HA0A 3GIVA 3L3HB 3ULSB 4OJFH 1NDGB 1Q72L 1H0DA 4XPFL 3HZKB 3LKNB 4IOSD 2GAZB 3KLDA 4QHLB 4TULL 4M6MH 3LRHA 3PWPE 3FHQA 3MRPA 4MS8C 4PGBB 1N0XH 4OGXH 1ZTXH 4NM8H 1FNSL 5EU3A 2X6MA 3LS4H 3GSOB 2WSKA 4XP9L 4KUCF 3I6LD 3NCFB 2CR3A 3RVVD 3TBVA 3QA3B 2PCPA 4KQ3L 4IDJH 4NO5A 5DVOA 4GKNA 2YD6A 3RZCB 2X7LB 3T2PA 4U2ZA 2FHBA 4JKLA 3EDFA 4OM1H 4P4KC 4G8IB 4LEXH 4MDJB 1ED3A 5HGHB 2GSGA 1CQYA 4RX4A 2BJMH 4M7ZB 1IGJB 3VCLA 3D18B 3LQMA 4X6BA 4DUVA 5DJ0B 2BZDA 3EYUH 1TENA 1MEXH 2AQ3A 4F7MA 3DARA 3RQ3A 5HD8D 4JJHA 4YO0A 1FIEA 3U0PB 3G5VB 5C0BD 2ZKHH 3BQUB 1OOAA 3RVXD 4AT6B 2BNQE 4Y19B 5I16A 2VLRA 4GS7C 3BESR 4BSWB 3PQYB 1IAMA 3VFMA 2P47B 3CVIL 3BO8B 3H9YA 3S34H 1OPGL 4ETYA 4LLDB 5GRWA 3BE1H 3NACL 4TNWK 2PN5A 1S7QB 2HH0L 2LQRA 3QXDA 3RWGA 4GAGH 3QEUB 3BD5A 4YC2C 2Z93B 3T09A 1OAUH 3B9KC 5ILTL 5D7JA 5D2LB 5EC1A 3DV6B 2QR0B 5DJYA 3ARXA 3LCYA 1RJZB 1SYSB 3F7YA 4Y88A 3LKSB 3LN4A 2D7PA 4XCFH 1YDPA 4X4XA 3MUHL 4Z7WF 5IT2L 4CDHA 3P9LA 4Y5YA 2VXQL 5I19H 4MNQE 3E6HA 2BVPB 4GKNB 4R4NC 1CDIA 4ZO6A 5J6GB 5JHDE 1A1OA 1AD0B 3FT3B 2JIXB 1KEMH 3CXDH 3MRMB 3ROOB 2A0LD 3P0VH 1BPVA 2HJLB 1A4KB 2D7OA 2V2TA 1OAZL 2LFGA 2ZCHL 3UTSB 1R5IA 2R4SL 4WDIA 4Y4HD 4X6DE 3SDYL 1ZGLP 1CGSH 3LEXB 2Y4SA 1ACYH 4HS8L 4NKIH 1FRGH 2VXSH 1I9IL 4YDLC 1CD1B 3QFJE 4JR9L 5CZKA 3MLTA 3VFRA 1U8KB 5MI0B 1LE5B 3T0XA 1T66D 1F4WL 5CIPH 1R0AL 3QXVA 1LDPH 4ONFL 5FYJD 5FKPB 3TJEL 3VFNA 1RFDL 1AO7E 3KYOB 3QDJD 1YPZF 1J88A 3RTQC 1DZBA 2HLFD 4WV1B 1TETL 3C60B 4O2FB 4LOUD 3NIFF 1LEKB 1C7TA 5D7LD 1DBKH 3MCLL 4EJ1C 2B1HL 2HG5A 1W72A 1NKOA 3AM8C 2NLJB 4KJPC 5E4IA 5CD3B 3T0EB 5IJVA 4AEFA 3X14B 5FOBB 4KU1A 1EAJA 1T5WB 5EBLA 4RAHA 4G42B 3GKWH 3LIZH 3X11A 1G0DA 5I18H 4JRXD 4XNUH 4HWEH 4WFEE 1ODAA 1IEAB 4CVXB 5MEOA 1YY9D 3IU4H 3T0VA 3QIBA 5DO2C 3BIKB 3MJGX 1KFAL 3OHXB 1VKXA 4IRZL 5CHNB 1RUQL 4WEUD 5JO5A 4MAYA 4HKJB 2VDPH 6FABL 1I1AA 1S7TA 2NY5C 3UAJD 1QRKA 2AXFA 4R96A 2IG2H 2BNUA 4WTXA 4F3FA 1WZKA 3CX2A 1KIRA 3MRJA 5E70A 2GSGB 2YRZA 2BFVL 5IMKB 2OZ4A 1J8HB 5IQ7H 3MREB 3QDGE 5I1CL 5FYLH 4KVNL 5I1IH 5DJXA 1KCVH 1UH3A 4LPXA 3I9GH 4NCDA 1KIPA 5J6HB 1CLCA 5H35B 2R0WL 4M5YL 3W82A 3GSOA 1T7YA 4JEGB 4XNXH 4PRAA 4PRID 3O3EB 5D7LE 1XCTA 2Z4QB 5F7EL 1Z5LB 4QKXB 4P9MH 2ATKB 1TPXC 3DI2B 1OF2B 3WFBH 2F58L 3QI9A 4X7SL 3A6BL 5EC2A 2JCCF 3MSPA 3UTZA 2BSSB 1IAKB 1J8HD 1WC7B 2DTML 2GEEA 4P5TB 4FQCH 4QRRB 4AM0B 3ILQD 1VFAB 2CD0A 1BWMA 1NAMB 3FO1A 3V52H 2C3VA 2FO4A 1BM3H 1UJ3A 4JVPA 2IFFH 4YDIL 3PGDA 3U4EB 4CJ0A 1QO3B 3V7AE 2BY3A 4KZEH 4XVJL 4KAQH 5JZ7C 4GXUN 1FFOB 4PRPA 5FCUL 1UB5B 4BKLB 5JORB 4QT5A 2PYEE 1MFDL 5DJDA 1YNTA 3LKRA 3S3SA 1KXTB 4OLYL 4N0CA 3IU4L 3GO1L 1QBML 3KS0H 4FFEX 3SE3A 3BWUC 1AGDA 3ZKQD 2HT3C 4O51B 1KCLA 4JGUA 2BOBA 1AGBA 4MNGA 5IK3A 3DX7A 5EOTA 3K80A 1JVKA 4NKOB 1RVFH 4RFOL 4N90E 1CFVH 1UG9A 4HDIB 1G7LA 4AIOA 4UDUA 4LSRH 5HD8C 5F7LB 4XMPH 3BD3A 1MRFL 4UV7H 5ANME 3VI3E 4XBPB 1RFDH 4AK1A 5ICZB 1PKQE 1PJ9A 3OJDA 2F54A 1H5BC 1KPVA 1IGTB 4KRMB 3N1PC 3JWOC 2F54E 2R9HD 2XZQL 2WBJD 3BPLC 1SY6L 1BREA 4HX1A 4M4RA 5C0CE 1P53A 3UP1A 4AQ1B 3QUKA 4ELMF 1EEZA 4Y1AE 4WEBH 3IAGC 4U1JB 2FL5B 4J3UA 5CUSH 3ZTNL 2I27N 4R26L 5TFSH 1TZHA 5FYJU 2GW5A 3OSKA 4GAYA 2FSEB 2J6EL 3JWDL 3HG1B 4JY5H 4LK4A 3FQTA 5EBLB 4UNVA 3FQWA 3FRPG 4HCRL 4LLMB 3B9DA 4H8WL 2BCKB 4D9LH 4ZSOB 4ZMAT 4TSCH 5DRXB 5I17B 1MQKH 3EDDA 3U7WH 4XC3L 2XN9E 3BISA 2WBJB 3VD4A 4B41A 3OAYH 2EDEA 2LAGB 3GUTA 4I18B 4GRWB 4HH9B 5EOCL 3W11D 4JZJB 4HC1L 3RX7A 4XRCB 3ARTA 5IJKC 1OW0A 3OB8A 2VXTL 4N9GB 1WITA 5KSUB 3A67L 3GBNL 1VFAA 1QR4A 3MNZB 4LL9A 4I2XE 4OIBA 1E6JL 3MJ7B 4FHBD 3K0WA 2EO1A 2JB6A 5FHAH 3LAFA 4M48L 4ZXBC 5E2TH 4IDLA 3HPLA 3GMOB 2NY6C 4LPVA 5IBTH 1ITBB 5I0DA 4R7DB 3VGFA 2X4QB 4JFXA 1MCHA 3F7QA 4OZIA 3IDYC 3AREA 4Z0XA 4D0DA 1I1YA 5TPWH 1MRFH 3IJYA 4AYFA 1HILB 3CX5J 3TO4C 3L3KB 5F9JA 2X1OA 4NDMA 5D6CB 5HDQL 4YHPA 1ORSA 2IPUK 4KKAC 4KQ4L 3KR3H 3L3IA 43C9A 2EKJA 4UIMB 3UTSE 4P4RA 3GSNA 3TT1H 1K8IB 3PF2A 1WF5A 1XGRB 3HNTH 4P5KA 2HT4D 4Z7WB 4R6UA 5C1MB 4NQXB 3BP7B 2O5YH 1BQHA 5D7IF 4JFFB 1TQCC 1QLRB 2CPCA 1UGNA 4BZ1H 4L1HA 4PY7B 1GC1L 3EJZC 3SDAD 3MLXL 3LD8C 4U1GC 2D31A 4HZLA 1EEYB 1C16A 2CQVA 2J6EH 2W9LA 4BUGA 3CDYA 1G7QB 3VXPA 1PG7L 3LDBC 4OT1H 2WINB 1J7VR 2BRRH 1A6WH 5ISZE 4U1MB 3D69B 5I1EH 1J0IA 1RVFL 4HIIA 5IUSA 3ARRA 1MJUL 4QRQB 4OLXL 5DJ2A 4IRSB 5DFVD 4HBCH 1I8LC 2PO6C 5ID0A 1KPVB 4NJAH 3OZ9H 2VDLH 1MRCH 4OM0L 3VFVB 2AJVH 5T33H 5DUBA 4LOUC 1U58B 2GUOB 3C87A 1VFOA 4QGTA 3JSSA 1ZLSH 4ISVB 4O02L 2CXKA 1FAKT 3PDOB 4NRYB 2R2HA 3SE4C 5E7FA 3C6LD 4EDXB 5HGHA 4KRPC 2OMBA 4G5ZL 4J12A 4NQVB 1S7XB 2YPLE 1EBPA 1NC4D 1NDMB 2DQJH 1M7IA 4WNQB 1CD1A 3MNZA 3PJSB 4UTAL 4PV8B 1GZPB 4FZEH 2Q8BL 4QRPD 1I7UA 2RR3A 4RMVA 4S2SB 4IRSD 4ODXB 4FQQB 5L2JB 4JM4L 1I9JH 5F1IA 2ADFL 3TCLA 4HH9A 3MRDA 3HPLB 4BFEA 3DGCR 5E7BA 1A3RH 3RWJA 1N7ML 3UBXA 2VLKB 3CFBA 1IFHL 5CMAA 4F2MB 4NHUE 3TFKA 1XH3B 1HHGB 3RX8A 1FYTE 2FJFB 1NGYA 3VXMB 1S9XA 3HG1A 1Q0XL 2BVPA 3TPUA 4OD1H 4OZ4A 1FORL 1FL6A 3FQNB 4DTGH 1WBYA 4PJ7F 1UCTA 2BSRB 2RAMA 4HFWA 1FLTX 4HGWA 3VXPB 1DQML 3RAJL 1RUML 3MRFB 1AJ7L 2ED9A 2WM0A 5J11B 2EXWC 3BPOC 3FZUC 2NX5A 5F71A 1JGDB 5HGAA 1P4BH 1FGVL 1WVZA 3ILPB 5AYUL 1YYLH 2BX5A 2XWBB 3PGCB 3V4PL 4ZS7L 3CH1A 3MLVH 4FQ2L 4QRRE 2YA2A 4CNIB 3HZMB 4HV8A 4JFZL 2J8UA 4TSAH 3VXMD 43CAB 4ZOCA 1BZ7B 1B2WL 5ENWA 5L9DL 3RIFF 1WISA 3CC5B 1MCSA 5KANG 4HF5L 2YPLD 5AAMA 5CIPB 4KMTL 5DQDL 4NBYB 4FFVC 4XCCL 4OCMC 4XP6L 3BRFA 2GCYA 5D7JC 5ALBH 1JGEB 3WNOA 3K2UL 1HINL 2NNAA 3GM0A 3ZL4L 1J0HA 5E8OB 3HC0B 3IXTA 2QQLL 3CK0H 2D03L 3QUZC 1RPQA 3TYFA 3GMRB 2IAMA 2NXZC 2ZOKB 1DANU 1GGTA 1P4LA 2ZP0T 1U8JB 5B39A 3SY0A 3SJVB 4N0CD 3KYMB 2VDPL 3FOLB 5L0QC 1MFAH 1UACH 3ULUF 2C5DC 3ALPA 2Q7YB 1XIWA 3ZYOA 5IROA 1UA6H 3WFHB 3MLZL 1FP5A 3QHTC 5MEOB 2MMXA 5JXAH 9CGTA 1O7SA 1PY4A 1U93B 3CFCH 2EDNA 4H1LG 4S1SH 5GGQL 4P57A 4OF7A 2A74A 2R23A 1INQB 3AUVA 3JWOL 4YFDB 4GQ9H 3QCUL 4ZYKA 1EPFA 2XY2A 3DI3B 4PG9B 1T5WA 4GUPA 4HC1H 1QFWL 3MLPA 2A9NH 4ZAKA 4UDUB 3BKCH 1MJUH 3MRPB 4Q6YA 4M3KB 2IBZX 5JORA 1G6RH 4RFNC 5JTWA 5J3HD 4QRTB 4TVPD 1EDQA 3DRQA 4DK6A 1PY9A 3ZLQC 4WI4A 1Q8MA 2B4CL 3SGJC 4NP4L 5INDB 1KBGL 1NCAH 4Y5XB 4M1DL 2DQHH 1QFHA 3ARGC 3DMMD 1BZ9B 3DYOA 2MKLC 1BVKB 5EU4A 3UZEA 2XWJA 4G80A 1G9EA 2A6JB 3KJ4C 3SBWA 3OPZL 1YNTB 1OF2A 3KLAA 3OTTA 4N0UB 2E7LE 3V6OA 4XWGH 1AH1A 3VXTB 1QFPA 3LN5B 2VDOL 3QIBC 3GGWA 1WFTA 3HAEH 4MLSA 4MA1C 2BXYA 2C3VB 2FO4B 1V3MA 3SGKA 3OR7A 4HKXB 1II4E 5E6YA 5IJKA 4RGNB 1FNGB 5GGRA 2E9JA 1Q9WA 5FB8A 2D7TH 2RFXB 2I07A 4M62H 4JHWH 3BP5A 5IVZA 4X0KB 2W0LA 3OXSB 2DICA 1BFSA 2EEBA 1LNUA 1FZOA 2DBJA 4ELKA 3VRIA 1CBVH 2G75A 2DQCH 2OSLA 3IFLL 3JVGA 3VA2C 1DBBL 5BO1H 2Z93A 4KKAD 2LE9A 4WFHD 2DLFH 2XPGB 5ELIA 4GKOA 3EYQC 4GQ9L 1K4DB 2BOCB 1QRND 3V4VL 5GS2H 1P1ZB 1UB5A 2XXMB 5CGMA 3SKOB 1A2YA 1H3PH 5DRNA 3CLEL 2QV2A 4LSTL 4OCSH 4WI5A 3UTQA 3EJZD 3HN3A 2FWOA 1JTTA 1ZGLA 4I9WE 4N0YH 3VGAC 4XP5L 2IPTL 1O0VA 3DO7A 4YHLH 5KZCD 3IDGA 4ZXBA 3N9GH 4KHXH 1EFXA 4PJAB 3MV7D 3SGDI 1B4JL 1U3HC 3N1GC 1GC1C 4P2CG 3F7VA 5KS9B 2XWJB 1RV6X 2H32A 5HPMA 3V0VA 2XQYG 3NZ8B 1A4KA 1F3DH 1FLRL 5CJ5A 1D5BA 4Z8FH 1TZGL 3JV4A 3PUCA 4X7DC 4NJ9L 1C5DB 1P5UA 1JN6A 4MXVE 2Q8BH 2GJ6E 1E4JA 3JXAA 4OLVH 4XPAH 1P2CB 5E5UB 1A7QH 2JCCA 2VH5H 1K8DA 2ED8A 2HKFL 3P40A 4A6YA 5E6IC 2BVOA 3VFPB 2MKWA 3EO9L 4G8FA 5IEHB 3JBG7 2R0ZH 4I8DA 3S36H 2Q86A 1RZJH 4QXUL 3UPRA 4JFYA 4JDVA 3I3DA 2OQJB 5D2LA 1FL5A 3WXWL 4MZ2A 4LSSL 2ICEA 5IVNA 4PD4K 4LVNC 3CDCA 2ICES 4HIJB 1U8KA 4Q74A 4L5FL 2HKHL 1U8IB 2X05A 4IMLB 3HUJF 3BPNB 4ZOAA 2GK0A 1MHPL 2PO6D 5IVXA 4XI5D 3RPIB 5FAAA 2RGSA 3DV6A 3MXWL 1A22B 1AO7B 1IAIH 4ZUVA 1A3QA 3D87B 4OKVA 3HG1D 1Z6JT 3OQ3B 2PO6A 3K4ZA 4LLQB 5GS3A 1G0YR 3QUXD 4I3RH 2VLJD 2Q1EA 3QJHA 1YEJL 2VMFA 2D3VA 1JZ7A 2BSED 1S7VA 2EH8H 4N8CL 1ZSDB 2DTSA 2R69L 2O5YL 3F5WA 1OAXH 3DUSA 3LKQA 1GHFH 3QIUC 3VWJA 3CLFH 4F9PA 2ENSA 1T7WA 1UM5H 4X5WA 1FYHB 1HNGA 5EA0H 3WKML 2HVKB 3D39A 2BDNL 3C08H 3B3IB 3RVUC 1FL3B 5EIIB 4L1DA 5DQJA 3RU8L 4OZIB 1UEYA 2V17H 4YK4B 3DO7B 2P49B 4AH2B 4IIQC 4YE4L 3QQ9C 4HPOH 2M8XA 2PTVA 4OLVL 1E4XL 4XPAL 1QTYT 1U8QB 4JCLA 2ZJSL 5HJ3A 3C5ZB 3ZE0E 5K9KB 1YEIL 3QNYA 4DK3A 4G6ML 4WTZA 3RGVA 2DBLH 4N8VB 1WZ1L 4G80B 3VXMA 3MLSH 3RHWK 1KB9K 4ODTL 3S7GA 2EKSB 1UYWH 5BOZG 1M1SA 3B8YA 4W6YB 3ULUE 1MHHA 4IMKC 5FKAB 3GSNL 2VUYA 3AREC 4KPHL 4LVEA 4XP4L 4R8WL 2FYYA 1OP5K 4I0PC 1NGWA 1W8NA 2RCSH 2EIZA 4JDZA 5IW1A 4NQVA 5CBAA 3MXWH 3SDDD 3TA3D 2CRMA 1IC7L 3O4OC 2IFGA 4NT6A 5ADOL 3TBVB 4K94H 3MYJB 4GRWH 3L7FA 5FO9A 1LO2H 3WJLC 4H5SA 5FOJA 1F6AB 1URLA 1QSFA 5GRJL 1H5BB 1T89A 3VDCA 1BJ8A 1UB6B 2QADB 1FORH 4TNWF 1T0MB 3RI5K 5FDWB 1AGFA 2X5PA 1EERB 3EJYD 1JGVH 4QRUA 4Z9KB 3KWWA 3GSXB 1BLNB 3MCKB 1UM5L 3WKMH 5D96B 1NUDA 3MLWH 1FO0L 3GK8H 3PHQB 2D7NA 3DX9A 5HHMD 2P8PB 1BEYH 4NO2A 5JDSB 4L4TE 1RJYA 2IH3A 5IB3A 1VDGA 3E0GA 4QRTA 2DQTH 1I8LA 4LCIH 2WWKT 4M61B 3EYUL 4YHZL 4PJXA 3GBMH 4DN4H 4HCRA 4K07A 1KGCE 2ZOLB 3CSBA 3SKMB 4FQXD 1KTKE 2YKLH 3DMMC 4XC1L 3FT4A 3KPSD 3F7PC 4PG9A 3RL1B 3UCRA 2H1PL 4MQXC 5EU3B 4HV8B 4LCCB 4IOIB 1KN2L 2ARJQ 4Z77A 3T8XB 5DJCB 5C0CD 4GW4A 5J57B 3O6FA 2VLKD 5TJWK 3AU1B 4OCSL 4ZPTB 4HJJL 3X3FL 2ZUWA 3S34L 1XIWB 1JNNL 4XP5H 5HVWA 2NR6C 3TV3L 3QCTL 2L0DA 1KTLA 2WIMA 4YIQA 1GOHA 4R97B 3VWJD 4FRWA 1P4IH 2XZAL 3RY6C 4ALAH 1SYVA 3AY4C 1OB1A 4NQEB 2NW3A 1INDL 3C08L 5T1LA 4NJ9H 3CFEB 1WCBA 4PBXA 3B6SA 3TYGL 3T2NL 4PJBA 5C0DB 4NIKB 4JQIH 2BHYA 3SO3B 2VQ1B 5ITFB 3D3VA 2V7NB 2B4CC 4TUJA 1EHNA 2XFXB 4UTBL 3VH8A 4XAKD 4PLJD 3C09C 5FGSA 4PUBL 2VQTA 3MGTA 4Y4KD 3SDCD 1S3KH 3U9UB 5MENA 4I2XB 4Z78A 1ITCA 4PJ8C 4E42A 3KPSE 5C86A 1NAKL 1F4XL 2P43B 1DLHA 5L2KB 3GZKA 4LRIC 3SJVA 2QTEA 4FZ8H 1NGZA 4P2QA 5T1MB 3FFDB 4F58L 3MA9H 4FN0A 3QRGL 5EIQA 4JFEA 2F53D 3MLYH 1PQZA 3F12A 5IHBA 3QZWB 3M17B 4DZBB 1MH5B 3FOMB 3IAQA 4RISH 1TETH 4R90H 2WNGA 2O5XL 4OIIL 1KN2H 2XG4A 4X83A 1UZ6F 2MHAB 4EN3B 3MZGB 2YD3A 4NZRH 1DJSA 3G5XB 4K7PH 5E9DD 4KAQL 3AXLA 1XIWC 2J3SA 5IM7B 4JFFA 4OTXH 3MRHA 4QRPA 5FFLA 3L3DA 1UC6A 3ARVA 4HXAL 1KLGA 2C4FT 2DQUH 2XQBL 4OLUL 2BRQA 2D0HA 5JDSA 4ODHH 3KHQA 3PDOA 4Y89A 2GY7B 4Y19D 2NY2B 5E1HB 4LLVB 2F8VA 3IKCA 4ZAKC 3U2SA 5E94A 1Z0NA 2EDTA 4BFBD 5IW6B 4NDMB 3DURB 3LEYH 4KI5D 3RI5F 3GSXA 1K8DB 3HR6A 3VFTA 4X99A 5AG9A 2HT4C 4AIXA 1SMOA 3D5OF 5D70H 5DSCB 4U31A 1OGTA 1DANT 3NABH 4X6FA 3HMXA 1NFDB 3EUUA 4PJAE 4U6VH 1HI6A 1J8HE 4KI1A 3T0ED 3HNSH 4YBQC 1U3HD 2FBJL 4KXZH 2ATPB 2D9CA 2H9GA 3O41B 4U6HB 4LHJB 5D72H 4XP4H 2JCCB 2UZYB 2WQ8A 4RFEA 3TT3H 4DVRL 1FIGL 3ZE0F 2HJFB 4UILH 4KMLB 4UUJB 4CMMB 4KJWD 1ZK9A 3HZYA 4NQXA 5CUSL 3LKQB 1QKZL 1Z5LA 5GRXG 1YECH 3L6FA 1K4CB 1XCTB 4O5LL 3VFVA 3JWDH 1P1ZA 3RRQA 3T0AA 3PWNB 3O3AA 5BRZA 3RHWF 2A77L 1KPUB 4S1QL 3AROA 3D25B 3KPNA 1YEGL 2CLRA 1KN4H 2FECL 4OUUA 1N0XL 1CXKA 4TTGA 3VG0H 3V0WL 2FWOB 2G60H 1ZA3B 2AEQH 5GHWH 1U8LA 5JOPD 1V7NH 1LP9A 4MB3A 2OTWA 4JFOB 4HZAA 4XBEL 5HHNA 5D7IE 2FJGB 5IHUH 1QBLL 4QHKI 1S7RB 4L8DA 3TC9A 2QHRH 2IWGA 1F8TL 1MCLA 4YDLB 3EZ8A 4DGIL 3NGBC 3EBAA 4Q9QH 4GW1B 5JW5A 1A7BA 1Q9LB 5LGHL 2A6IB 5AZEL 2NY1D 2O26U 3WJJA 4RMWA 4ZFZA 3VGBA 4XVUC 5DHVA 2C3GA 5I8CA 5C2BL 1JWSB 1AGCA 1FVCA 5E5RB 3TN0C 4LCWE 5KTEH 3OJ2C 1B9ZA 1EO7A 4PRHB 4NPYA 4YAQA 4K7FB 2PETA 5E8PB 4WO4A 3L3JA 2DJ4A 4I3RL 3WL9B 1G7IA 5D8JH 5D71H 1B88A 3MOQA 1NMCB 1D5ZB 2EH8L 4N8CH 4R0LC 3TBWA 5I1DB 4HLZH 4Q97A 1D5IL 5HGGS 4Q9BA 4G9FA 1DSFL 5C07A 5LGJB 1EHLL 2F53A 4HLZG 5D72L 2FRGP 2AS5M 2OBGA 1FNSH 3N1QC 4LPWA 5IIEA 5F96L 2ZUXA 3FN9A 3HUJA 4LDLB 4M1CD 4NSKA 2VZ3A 1KJ2H 4G7YL 4W81A 1SQ2N 1XF4B 2C3WA 4YNYB 4PJBF 3QUYC 1IBGL 2AQ1A 1NDGA 3RGHA 5IHLB 1L9MA 3MRIB 3DIFB 1MUJB 3IDNB 2WUBH 4MWFB 3KPRD 4RA0C 1INQA 5LXGL 1F90H 5EZJA 5JHDD 2IBBA 3BX7C 4PR5A 4I18C 4LLWA 3REWB 5I1CH 4DGVL 2Y6SD 3LEYL 4PB0H 3MRMA 2JIXA 1LDSA 3DYPA 2QQQA 1UKTA 3RWHB 1ZE3C 4FQXC 5DRXA 5I17A 5JPMA 4N0CC 1I7RA 2H2SD 3FMGL 1G9NL 2V5YA 4XNQB 2ZPKH 4DGYH 1WQVT 4JHZA 5K59E 4XP1H 3JWNC 3FZUD 4WU7B 3U2SB 4OD3H 1M05A 3MRRA 2R1YA 3W2DL 3QJFB 3K74B 5F1SA 4DCQB 1Z3GL 3U6RA 4ONGL 4XHQA 2UV3A 4L8BB 1KEGH 3WL9A 3O45B 3PL6B 3MRGA 5F44A 3O2WL 1JPST 3IF1A 4K3JL 4O2CB 4QY8A 4H26A 1AGEB 3QIUA 5HDBE 5JHDA 3GMLB 2BSTB 3QUYB 4C54A 1SJXA 2AABL 4MX7B 4BJLA 4ESKA 3HMXH 2VLRB 3PDGA 2B8OT 4ZUUB 4RGNC 4MXWL 2DLGA 1TCRB 1KN4L 1T6VN 1AC6A 1R3KB 4YNYA 4OSUL 3SGEI 4YO0B 5K9QG 1WCQA 4RGMC 5LBSH 5DRWA 2BK8A 5BOPA 5F97E 4D2NA 1U8JA 1CR9H 3CXHK 2YZ8A 5CEXB 3HE7C 4P2RE 5FGBA 3C8KB 1HSAA 1F8TH 3KAAA 4G9FB 4TVSa 5FUOL 4QTIL 3E6FA 4PJEB 1MCPH 4DN3H 4NYLB 4TNVK 3NAAL 2DLEA 4RMRA 5T5FL 5DLML 4ZD3L 1S8DA 3U0WH 1QSFE 1J9CT 1PFCA 2BFVH 1RZFH 2MOVA 3PJSA 5HXMA 3SPVB 4ZFZB 3MBXL 1AXSB 5DWUL 5JW4Q 5I6XC 2YPKB 2Z8RA 1N5YL 2AXFB 1ZLSL 3ARFC 3T1FA 4DKFH 1KCVL 1NL0H 1JHLH 3V8OA 5F6IB 1JGDA 5HGAB 2R0LL 3WUZA 1MFEL 2WIIA 4UINL 3RWHA 3WCYA 1PEZA 4QOKB 5F1IB 5K9QI 3KPOA 1EHLH 5HHNB 1HYRC 3BI9X 1NBZB 3UBXG 3RWIA 5A40E 5DFVC 3PP4H 1KOAA 1YECL 4ODWB 3HB3C 2V7HA 4U1IA 5GS1C 1MUJA 3IDNA 4MWFA 3H9SB 2FJFA 1X5LA 1RIVH 1UFUA 1DLFH 2EH7H 3J7HA 1XCQA 4V1DD 3MV8B 5DC9B 1I85A 5D2LF 3RP1A 3ES6B 5HYEA 1MFCL 4YZFF 1MELA 3QCUH 3S35X 5CS7A 1JJUA 1FE8L 4JANA 1QFWH 1EJOH 4EDWH 4KWUA 5CJOL 1YNKL 1WAAA 4NUGL 3W0WD 1DE4B 1PD6A 1YNLL 2HLAA 4L29A 3HI6H 3W9DB 3H9SD 4KY1H 2R39A 4RAUB 5DYOB 3VGAB 1JPTH 2EDDA 1P7QA 2IBGA 3QO1B 2VIRA 4OCXL 1TZIB 3RTQB 3DVIA 2JJUA 4AY0A 4LHUA 1EO8H 5GRZA 1IE5A 1U8HA 1CF8H 5E56A 5EU6D 5EUKA 4BZYA 2R2BA 4YBQD 5DF0A 2I9TA 7FABH 1QSED 4XB8A 4LU5L 4MXQA 2Y72A 5IMOB 5HGBB 4ZS6D 5GGUB 2DDQH 3LVEA 4UU9B 4GQPH 4LSUH 1V7MH 3GI9L 5DMGD 3FQUA 4PJFB 4DZ8A 4MXWH 5KVDH 4EEEA 3K1DA 1JWMA 2EDFA 1U8LB 3IETB 4UBDC 4WWKB 5HVFB 2P46B 3BDXA 2FX9L 3O41A 4LMQE 2Z31B 4U6HA 1EH9A 2XI9A 4NC2B 4GRMA 4JE4B 2AEPH 1F11B 4JQXC 1N5AA 4HUWB 4D0BA 1GCFA 4QNPF 1UEMA 2VXQH 5I19L 1SEBB 5E2WH 2DM3A 4P3CL 5FKAA 4PTTB 2E27H 4OB5H 4C4KO 2WBJA 5C0FB 3RKDD 5JLZB 2OK0L 4OGZA 3TN0A 3E2HB 5EO0B 3UC0H 1CICD 4AT6A 3L3OA 1QLFA 4Z7UA 3QQ9D 4NGHH 3CGTA 1HOCA 4LHQB 3VFTB 3GMNB 3B2VL 4GH7B 1YEKL 3UPAA 1FVDB 5DJ8B 2JCCE 4XXCC 1I7ZB 1HQRA 4EN3C 1HH9B 1UZ8B 3D18A 4CRPA 4M7LT 1IAII 1HI6B 3NCJL 3GMOA 1IKFL 1UT9A 1LD9A 2Y07L 2APFA 1KJ3L 4ZNEA 1MJ7L 5TDOA 1W0VA 2ZSWB 3CXHJ 4GKZB 1H3GA 1QLEL 5JA8B 1JL8A 4F80A 4W4OA 5BVPH 5GGUA 2H2SC 3BJ91 3V0AC 2NY4C 5DJ6B 3QWQB 3L3KA 3HZVA 1YEJH 3BKMH 4PJEA 5D7IB 5ITBH 3X12A 1FNLA 4ZSOA 1OP5H 4FQIH 3ZTJH 4HK3J 1E4WH 5K9JL 1NBZA 3JV6B 1BIIA 1KFAH 1RJLA 3RNQA 5I76A 3EOAB 4GRLB 2D7TL 4P2OC 1IM9B 3DWTA 3I50L 1FE8H 3VXOA 2FL5A 1AIFB 3ZMRA 3UTOA 1YEEL 4EZMA 3TH3T 1LEGB 3IFNL 3L5WB 3BOVA 2NQCA 4XAWL 1E4XH 4NZDA 4NHUB 4OF0A 2P8MA 3U36B 4D9RE 4EOWH 2J6EA 2NY6B 5HI3D 4Z7WA 4NQUA 4LCYA 4JQVC 1E4XI 3P4OB 5DR5L 4WHCA 5DD3L 2EICA 1KTDB 5IEHA 5I1IL 4GKSA 1VFBA 3QI9B 1GIGH 2I9LB 4Q2ZB 3LY6A 4F7TA 3BKYL 4XNXL 3OB0H 4LLMA 2KBGA 2IPTH 4MA1B 4JM2A 1U6AL 3HRPA 3U83A 1EO5A 2FX8H 1QQDA 3TPKA 3MRRB 5HYJA 1M71B 3EIFA 4RGND 1RZKH 2OS7A 1AP2A 1DBJL 4LSDA 4XPHL 4MA3A 5CJXA 3LQZB 4WHTA 1U91A 4Y5VC 5HGBA 1YEHH 2BHZA 2FZ3B 3WXVL 1RUQH 4IJ3B 2W60B 3VXQA 4NBXB 3DPBA 5GS0C 1GGIH 1K3ZA 3HE7D 2LABA 3REVB 4XPTL 5AD0A 1QSFB 5DTFB 1KJ2B 4YHOH 1DCLA 2KKQA 4HIEA 2E7LC 3UTQB 2KPNA 4MYWB 4S1DD 3NZHH 4XVSH 5C0NC 1CICA 2VE6B 4TN9A 1S7TB 1B6DA 4Z76A 5CEZE 4LPCA 3HE6D 3PIQA 3SDXE 3THMH 4QTHB 1S5HB 5F7NC 5LWYL 5F1NB 1R3JB 3C6SA 5GRUL 1FDLH 4WW1A 4WUUB 4EXPX 2OP4L 4KUZH 4RNRA 4R0LB 4V2CB 4X7FC 2E8YA 3O6FB 4Q6IB 4LKXA 5H2BA 4M43H 3X11B 5EUOA 3VXRD 1VACA 2BERA 4YHZH 4ODSL 1OSZB 3P4OA 5E6ID 1VCAA 4PJ8D 1CFVL 5SWSD 1S7UB 1KJ3H 3GMPA 3P2TA 5FEBA 5CAYB 4IRJA 2MCPH 4WFGD 4WU5B 4WUKH 1VB9A 3QQ4B 1T03H 5C6TL 3P4LA 3L5HA 5EO9B 5J1TC 2V9RA 3RGVB 1U3JA 1QSEA 1YMMD 5J12B 1Y6KR 4K71C 2YC1B 5DD0L 3O6FD 4H0IA 5JHDB 4JO3L 3TO4D 8FABB 1WC7A 3EOAA 5ADPH 3KS0J 3QDMA 1NLBH 4HIJA 2J88L 2X9WA 4DVBA 5E6IB 5ETUA 3CVHH 2EYSB 4FTVA 4MD0A 4OV5B 4LHUD 5LCVH 2VR5A 4ZTOL 5HHPA 1AGBB 4JZNB 4NQDD 2YD4A 4WVRA 2HFTA 1BFVL 1PX3A 2JJTA 1TMCB 4PJ9C 5GS1A 4QNPE 4HK3N 1JWUA 2F74A 4NT6B 1HXYB 4N1HB 4P23C 5HGDA 2XY1A 3STLA 3BH8B 3MGOB 4P59H 4JJ5B 3QSKB 1I85C 3TFKD 4PB9L 1NEZG 2PO6B 3E6FB 4HUNB 3PWUB 1PLGH 3PXJA 4KRPD 5HJ3B 1A3LL 1FZKB 1NCUA 4GUPB 1DN0B 4AMKL 2ITCA 1N5YH 1QHOA 4PDCE 1FV1B 2WK2A 5DD5L 4L8CA 5IB5A 3L9RB 1BX2A 1CFSA 1YJDL 2A6KA 3LV3A 4UINH 5DRWB 4OZHA 2XTJC 2EKSA 1FLRH 4LLDA 4GMSH 2HVJB 4PGCB 3DUHA 1FCGA 3BUTA 3F7RA 3BO8A 4KDTC 3B9AA 1WICA 3ZL4H 2JE8A 3VI4E 3KDMA 3OGCA 4LRNL 3C5ZA 1OM3L 1JIBA 1NFDA 2QR0A 1ETZB 3FAXA 5DJYB 5I1GH 3O0RH 5GZOD 1FZMA 4GW5A 4GXVL 1TIUA 1XGUB 3HNVL 4NKDB 2H8PA 4Y2DD 2D7MA 4JFPA 2X4SA 4GAFB 1EV2E 4MHHG 3C6LC 3EYFB 4OZGF 4YK4C 3FRUA 5D1QA 3MLUH 4CN4A 1N26A 5AG8A 1BD2E 3PQYA 1QRNA 1LE9B 2MWCA 3LQAL 2HRPH 4KKBC 1CGSL 3H3BC 3IFPB 4HJ0C 5EU6E 4L5FH 3EOBB 3FT2B 4V3DB 3ZHKA 4H8WC 1P7KA 1QNZL 3ZE2E 2Q7NA 2A9NL 4DEPC 1LO0H 3DJ9A 3EO0B 2YRLA 3QDMB 4AL8L 4M8QA 1B90A 3UTSA 1T1YB 1QSZA 5IQ9A 1D9KB 4EI6A 4LCWD 4KK6C 2IANA 5EU7C 1MFBH 5IR1B 4Q58C 5FK9B 2JJSC 2UVFA 1BIHA 5J0BA 2IMMA 3QO1A 1CFQB 3Q6FB 4W4OC 1KCRL 2B1AH 2AJSL 5DD3H 1HOCB 4XVUD 3IDJA 4K55A 5D5ME 1BVKA 1NUNB 3ORJA 3L3OB 3LIZL 1N3NB 3HRZB 1YMMA 1W72B 3RBGA 1ZWIA 5J13B 3BYTA 2OSLB 3GEWB 3CJJA 3NOIA 1X4ZA 1FPTH 4OV5A 1N5AB 4HUWA 1T66C 3HFMH 5HTSA 3E8UL 3H7LA 4XMLH 5DVNA 3ALXA 2H2PC 3HZYB 3N9GL 1RY7B 4KHXL 1ND0A 4FZEL 3P11H 4LNVA 1MJ8H 4OFDA 4Q0XL 1TXKA 3SDXA 2ZUUA 4FFVD 5E95B 4ZAKB 5KVEL 5IGXL 4ZFGL 4NUJA 4OCWH 3BH8A 2AK4E 4JN2B 5BV7H 4DZ8B 1HXYA 4UB0H 3L3JB 3QPQC 1CDYA 4E0RA 3QXWA 2LTQC 2XN9A 4CADA 3TBSB 1OTSD 4OI8A 4KTEH 3V0VB 5BCAA 1DQQA 5IF0A 4PJBB 3EO0A 4WCYL 2P24B 5EU4B 4ZFOA 3P30L 3WEXB 1OTTC 5CWSB 4LIQE 2WINA 4CU7A 5JIIA 4CU8A 2A1WL 3ZSSA 1FGVH 5DRNB 5KAQG 2VTFA 4PJGA 4W70A 3LH2L 5I6XB 3BP4A 1GJIA 1JGEA 3MA9L 3LQAC 4L3EE 1OP3K 5EU5A 1JMXA 3UJJH 2HH0H 3NIGF 4YHLL 1A0QH 5EO1A 1F4AA 2PW1A 4M6OH 4N1CA 5C0CA 4HF5H 4QCIB 4Z7VB 5SX4I 3VH8B 5J3HC 1HSAB 1E27B 5EZOL 4LLYA 1A7OH 1X7QB 5JOFA 4HWBL 5I74B 5ECJE 3O0RL 3OV6A 4Z8FL 2QADC 2F5AH 3SE3C 2BVYA 4U05A 1R3HB 3CK0L 2JB5L 2IC2A 5HHMB 4D94A 3O9WB 1EXUB 3ZDZF 4QHMA 1RK1A 3EOTH 4NKMB 1RZ7H 1AFVH 3CH8A 4P2OD 3AM8A 4JRXE 5GSVB 1NCBH 1MIMH 2NMSA 2H45A 5IMLA 4LAQH 4Z76B 4C83B 1H8OA 5GJTH 1QQDB 5ABDE 3JV6A 4XAWH 3OWEA 1R3IL 1ADQH 4XH2B 3GBML 2OR9H 3HR5B 1ZLWH 1OAYL 3FFCA 4G9DB 4HS3B 4MDJA 3MUGB 3P77A 3NIFE 5DJ6A 3O3UN 1A4JA 3TBYB 4YX2H 3DGGB 3W5MA 5IW6A 4DCQA 1KB9J 3GSUB 1S8DB 4Y5XA 3IKCB 4APQA 5CKAA 4JN2A 1B0GB 3VFGL 2DIJA 4NWTH 4AQOA 3RY6A 2A73B 1CU4H 2VOTA 4ZUWB 3L3DB 4APQD 4L4TB 4QRPB 4H1LB 1DUYB 2VC2L 3QG7L 2Y23A 5EPMA 1T6WA 3MJ9H 4ONGH 3EHBD 1S78D 5FECB 4JY5L 3MV7A 3WXVH 1T1WB 4PRIA 5LKNA 2BVEA 3U7YH 3IDIB 4CUCA 2R0KH 1EEZB 3I02A 2NNAB 1XEDA 4XNZB 3KYKH 4QHMB 4JAMB 5DURD 4OZGB 5EORH 5BZDB 3LPFA 3DVGB 4BQ6A 4OKDA 1TQCB 4WU5A 4S1DC 4EVNB 3T77A 4MX7A 3L7FB 5FO9B 3T08A 2WY3A 2ESVE 3KLSA 4HULB 4WENB 3VG9C 3IKKA 4MSWB 4POZD 4OM1L 3VMPA 3WNKA 5CZVH 3IS0X 3DETC 2ZOLA 2VITB 4HFUL 2BMKB 5C08D 4NQEE 4Z7UF 3GO1H 3P30H 3MR9A 4X5WB 4GG8B 3FTGA 3WFDH 4OZFA 2XIDA 5DUPH 2QSCH 2W9EL 2YPLB 3V6ZB 5SV3A 4F33A 1KC5H 3L3IB 4BA8A 3GI8L 4P23A 5ID1B 5F89A 1IKNA 1GZQA 4DQOL 1BQLH 1DEEB 2YN3A 4XPFH 5C8JA 4DUXA 5KTEL 2NCMA 1HSBA 4OFYA 2Y06H 4RZCA 4PJIF 4BYHA 1DQQB 1YYML 4KQ4H 5K9KA 5A2LH 2ADIA 3QEHA 1DUZB 1ETZA 3MLRL 1R24B 3QT2A 2VIRB 5KOMC 2IBZY 3E3QE 1S7RA 3MJ8A 1NLBL 3ARBC 2F54D 1P7QB 2YBRB 2IALB 1NCTA 3K4DA 4OCNC 1T04B 3FKUS 3KPRA 4XCEA 4XXDA 4YIQB 3HS0A 4KK9C 3IETA 3IT8D 1QYGL 5HYJE 1G7PB 4G6KH 4JFHD 1BX2B 1CFSB 2A6KB 2W92A 4P4KB 2FCBA 2CDGA 5BMFL 1RUAH 3ZE1F 1FJ1B 4CBPA 5F6HI 1IC4L 4EKXA 4M7LH 1KLUB 2XRAH 1OW0C 5DJCA 5IG7B 2APTA 4ALAL 2Q86B 1A7QL 3DNKA 4HAGA 4HQQH 5C9KA 5KSBB 3CVHB 3QBTB 1DDHA 1AQDB 3P73A 4YHPB 4RQQA 2CIKA 1D5ZA 1UH4A 2D0FA 5F9JB 2NY4D 3MOAH 3FQXA 4JKPL 3SE4A 4GLRH 4K3EL 4RMUA 3R8QA 1M7IB 2V5RA 4J3OC 4PTUB 5IB1A 1CLZH 3P9MB 3LEVL 5GISL 1I1FA 1MJJB 3HNSL 4Q7DA 5C9JB 3C8HA 2WUCL 1YY9C 5E2VL 4JFXB 3ZKSD 3QQ3A 4X4YA 4ELME 2UVEA 2CRZA 3ZDXF 5DUBB 4LMQI 4HZLB 3NCYS 2HLAB 4NWTL 2EYSA 3L7EB 3SCMB 3C60D 1X4YA 1JRHH 5CJBA 4C4KT 4UQ3A 3MZTA 3IJHB 1FC1A 5SWZB 3RL2A 2Z91A 1N59A 1MWAA 3BP6B 1YQVL 2NY7L 5CBEB 3BN3B 5IBUG 4WGVB 4WI9A 4P4RB 3MRCB 2B1HH 2J1KA 3D85A 1BJ1H 2D0GA 3AB0B 4M02A 3ESVF 4N68A 2D31B 4QXGH 4WW2C 2PTTB 2HKFH 3T1WA 2E7MA 2V5SA 2F5AL 1SBSL 1XGUA 2CGRH 2AJ3B 5DMGC 1X5YA 2OZ4H 5H8DA 5D1XA 5FUCC 3QG6A 1A1NB 4NN6C 3CUPB 2YD8A 4G6KL 4MCYB 4Q9QL 4X9HA 5HY9B 2X70B 1AE6L 1CLYL 1E6OH 3V4PH 1YNKH 3ULVH 4CN6A 5DJDB 1WEJL 3IDGB 4N0UE 2NXZD 4YH6A 5FUOH 3SPVA 3HPJB 3IDMB 2AEIT 5D5MB 3TN0B 1KC5L 3PNWA 3MV9E 1PQZB 1KB5H 3PV6A 5T3XL 3MRNB 1DBML 2V5MA 3ZT7A 1MIEL 1JFQH 1NCWH 3LEVH 4U2YA 5DZLA 5F9DC 4OLZL 2ORBH 1DQDL 3ARZA 5JA9A 2X1XR 5TE6H 2R15A 2K1MA 1K2DB 1XF5B 2ADJB 3PABA 3SQOL 5CEXA 5I75C 1EJ6A 4KROC 3D39E 4LSUL 1UM4L 1RZ8B 2YUZA 4CW1B 5EDXA 1JRHI 2AAVA 3BT2H 3C6LA 1NFIB 4YPGA 3R06A 5DA4A 1F4YH 2XNAA 5I30H 5T1KD 4PJIA 1R3LA 1MY7A 4ZUUA 1N6VA 4K94L 2HFFA 4NWUL 3CSYA 1KTDA 4P5MB 5C7XH 1ZGLM 2W91A 1ZV5A 1ZT7B 3OX8B 4KVCH 4F15B 3TNNA 5L0QB 4YQXH 1MVUA 2HJKB 1RJCA 5EH1A 5C3LD 5MEND 4D3CH 3X3GH 4U1SA 1JYWA 1I3RB 2QHLA 4LKCA 1FFNB 1AC0A 5T3ZE 4I13B 3LZFH 4OQ1A 1E0OB 5D2NE 4L3CA 2DYPB 5EO9A 5ALCH 5KS9E 5CGYD 3HI1A 2N1KA 2G60L 3D85D 5GHWL 4ONHA 3BWAA 4LSVL 4RMQA 5F9WB 4NFCA 4WUUE 3SY0B 1CVSC 1YEDA 1Q0YL 4MS8A 1KEML 3CXDL 3TVMA 1TVDA 4KGJA 4NC1E 3MBED 3DRQB 4OV6F 4JKKA 4V3EB 1P4BL 3QEQE 4Y4HA 4PJ9D 1QBBA 3VE0B 4U3XA 3O6MH 3ZKNC 1BFTA 4GO6B 1BVLB 1BBJB 1SEQL 3RA7H 1FIGH 4CN1A 1EGJA 4MB5A 2JKXA 4I48B 5IB3B 4NRZA 4GG6F 4NPYB 4QHUB 3V52L 1BZ7A 5ENWB 4P5TC 5JMRA 5TGBA 4R97C 1MOEA 1QSVA 4I9WD 3MO1A 2MQCA 3QXTA 5EUOB 1FNFA 2VL5A 4G43B 1RZ7L 4PY8I 1Q9LA 3IJHA 3MYZA 3KWWB 4IM8A 3VFRB 1N7MH 1IGIL 4HKJA 5C0DA 2X89A 1FG2A 3HR5A 5K9OA 4HKBB 5GJTL 3V5DA 1SVCP 4YBHA 3C6SB 2PKDA 3LHPH 4FXKA 3VFOA 3EYOA 3GJFA 4LP4A 2OTWB 4A2MA 4YUEL 5SWQB 3BKJL 1I3GL 4O4YL 2XRAL 1H3UA 1JNHB 4HUVA 2IAMC 5C7XL 4MJ2A 3AAZB 3IAPA 1Y0LB 3WD5L 4MNQD 4Y5YB 3SKNA 1HZHL 4PLJC 1IQWL 2ZUYA 5IWLA 1U3HA 5IROC 4MCYA 1FO0A 3VFGH 2G5RA 4F3FB 2HFGH 5I8CB 1A1NA 2WP3T 3I84A 5D7JB 5EC1B 4NHCL 4BUHA 1NAKH 2ILLA 3QEGL 1OAUL 1ZVSB 3PABB 3SKJH 1S7XA 5JNYB 3D1MC 3LOWA 3FB5B 3ARBD 1ES0B 4L3CB 4M7JL 3VJ6A 2IALA 4XNYL 1JGUH 3LS5L 1R5IB 1D5IH 1RZKL 1QLEH 4LVOB 2AXGA 4LHUG 3KNBA 3DSNA 5FYJE 1FVCB 5KW9H 1UXWB 5IMOA 4OLEA 3ZE2F 1OP3H 2B2XL 1MVUB 2HJKA 4OZFG 1RZIB 3S35L 3QCVH 4U49A 5TQ0H 3OAUL 1PZUB 3ARPA 3KXFD 5DK2B 5KAQF 1KV3A 4EI5A 2ZCKL 1F2QA 3DX6A 4MLIA 1X5XA 3A6BH 1VSCA 2DQDH 3HCVB 5FIEA 4JFDE 3OHXA 4YQXL 1VKXB 1T2XA 1NGPL 4ODXA 3P0GB 3V6ZA 2VN7A 4BFIB 2FBOJ 3LKOB 5IVOA 1KCGC 4FFYL 1TVBA 4Z0BL 4XVJH 4N0RA 2UZXB 4L4VB 3NVQA 2MQ0A 1MVFA 2X42A 2ZSWA 5TDOB 2P5WB 3G04A 3QIWB 3GBLA 3TJEH 4OT1L 5AUMB 5J11C 4IRSC 3U82B 1LEKA 2ZPKL 3CVHA 2GFBB 4DKEL 4HLJA 1JZ2A 3RKPA 4P9HH 5DJ2B 3RWFB 5DRZB 2YD1A 4M1DH 2R29L 1C5CH 4OI9A 1AY1L 3B9KA 3IDJB 3LKNA 1G7PA 2AJVL 5EOCJ 3T65B 1CK0H 3BGFB 1MCEA 4XXCA 1NEZA 1GPOL 2P5EB 4FQLH 4XCNA 2Z31D 1H3PL 4FQJL 3I3BA 3HC3H 1DQDH 2WLZA 3CCHB 5D1QD 4GBXB 2VDRL 5E5MB 3QUMH 2GHWB 3RY4A 3TH4T 1D9KA 2X2YA 4EI6B 1L0XA 1OLZA 1PVHA 1R24A 2WIIB 1IAOB 4X8JA 4NOFA 3MNWA 4R4BB 3NCBB 4WWKC 4JCMA 4OF6A 1UCBL 1B4JH 4G8IA 2SEBB 5GGVL 2C26A 5F7UA 4JM4H 3NTCH 4U7MA 3HZVB 4KDVA 5FCUH 2XKUA 3WUWB 5IB2A 5IFJA 5MERA 4NN6B 5IESH 4WEBL 1ZLVH 4XHJC 3EFFB 3VDBA 1I3UA 3I75A 4MAUH 5J1SC 3SDCB 3SHSA 1OVZA 2NY2C 3VG0L 1CWVA 4PJBE 2J8UB 1CDUA 5JHLL 1BP3B 2BP3A 3ARQA 5FM4A 1D3CA 4QTIH 1JGLL 1X5FA 5T3ZH 5GGVY 1DP0A 4PJGF 2QHRL 2EYRB 1CE6B 1TZHB 4JGJA 3VFSA 3IXAB 4BSWA 1ZA6A 2OI9B 4XWOC 4YBLC 2NTSP 3I2CH 4UT7L 3WNNA 2ADGB 2XTLA 4PP2A 5T3XE 4NN5B 4OFIA 1OTTD 3CFJB 4TSAL 4R3SB 1T89C 5DDHB 3PG2A 4JG0L 4X6CF 3RVVC 4XNYH 3D25A 1U8HB 1DDHB 2QKIB 1K8IA 3V6OE 1FO0B 3TWCL 5T1KA 3A6OA 3A6CL 2J12B 3QDJB 2X09A 4Z7VE 4F7CB 1XR8B 4N8VG 3HE6A 1HHJA 3DROB 4WWID 5D7LB 3BMVA 5EBMB 2DQEL 7CGTA 4CMMA 2MPAH 3IDXL 3BP4B 3VGEA 4U6YA 5ADPL 5FB8B 1RJYB 5KG9B 3ECBA 2WAHA 2GQHA 4JFED 4G8GE 2WBJC 4LVOC 3UJIH 3EO9H 3KPLB 5HHVH 1MJ8L 4PBWD 1WJ3A 3MLZH 3QUKB 4KRLB 4MD0B 4DGIH 3RIAK 3S3JA 4P2RD 4HHAB 3VWJC 1U92A 4R4FL 3OKKB 5DUMH 4S0TD 1U8NA 2YPKA 1JHKL 1WCBB 3T8XA 1J05B 3OKYA 5DK0B 1WBZA 3H9SA 1JNLH 4PB0L 1QR1B 2WBWB 2VLLB 2YC1A 5DRZA 4ZUTB 1CVRA 2FEDC 3PHSA 3SKMA 1T1WA 3DIFA 4MB4A 3BQUC 2G2RA 3QI9C 4AMKH 5T1DH 1UJTA 3NH7H 3DMMB 5ALBL 4N90D 4DUWA 2XPGA 3RIAF 2B4CH 1DUYA 5C0AD 2C4FU 3AU1A 4KK5D 1QLRA 4MJIA 4NZUH 1I3VA 4J2XA 4Z77B 5HSFA 4JO4L 3GSNH 2VL5B 3U79A 3QWOB 2VSCA 2Z0BA 2AERT 1INDH 4X7TB 4YHYB 2UZIH 5CILH 5DQ9A 1DEDA 4WW2A 4EUPB 4M3JA 2OR7A 2I24N 4IJ3C 4TTDC 4NWUH 4X7SH 5HPOA 1MCRA 2HMIC 4NQDB 3CPLB 1QD0A 5TH2B 3L3GB 2DIAA 4XNMA 2ADGA 3S35H 3ARFD 4FXLA 4KZEL 1F6FB 2BNUB 3TVMB 3R8BB 2Z92B 3WN5A 5FECA 4O2CA 2GITB 1J5OH 4R2GC 1TVHB 5SWZD 1T22B 5LAXA 2X4UB 2V2WB 4FZ8L 3MFFB 4ZOEA 5A2FA 5KSAB 3T4YB 3PE9A 4CW1A 2EDBA 5HYIA 3N85L 3TPUE 3CC5A 3H9SE 5TGBB 2UWEA 4QRSA 2MCPL 4BSVB 3WDIA 3R1GL 4JG1H 4XVTH 2HT2C 4HPYL 4ORZC 3LKRB 4QY8B 1I7RB 5T5FH 3ZE1E 4RAVB 3SE9L 3FCTA 3PL6C 4UDTB 3ARDB 2Q20A 3FFCE 4XAKE 3MODL 1OB1B 3HI5L 3MRFA 1I8KA 4Y2DB 4BQ9A 2NYYD 4YBLB 1M05B 3SDDA 2AI0L 1T80A 5J06A 1LO2L 2DQEH 5HHXL 3HRZA 3U1SL 4PYGA 1HHHB 4PRBB 4GXUM 4MNHB 4OSUH 5B3JE 2AGJH 4Z7UB 2C1OA 4K8RD 3G08B 1IFHH 2MJWA 5MP6L 1PG7H 3ZZ1A 4LAQL 5EB9A 1T3FB 1FAIH 1ONQA 3K8LA 3NA9L 4FS0A 4ZFGH 1T7VA 3SE8L 1U8QA 4UB0L 1OAKL 1YPZB 1FN4A 4EI5C 1LK2B 1RZKC 2AJZA 1PKQA 1HHKB 4PJ8A 4R4FH 5I8OL 4PRDA 1JPFB 2J5LC 3O45A 3QNZB 2DQTL 4NKOA 3EGSB 4UTBH 3QDGD 2UY6A 3H0TB 4MA7H 5IVXB 5JXAL 1A6AB 2CJUH 5I1AB 3MRJB 3BPNC 1NMBH 3OXRB 4JHBA 1GRWA 3S3PA 3V7AG 3HZMA 2GJZA 2DM4A 3AC0A 3AS1A 5JR1H 4PJFF 1R0AH 3EKCA 3RY5A 1NBVH 3C2AH 3MRHB 1EHAA 3NCCB 2UY7A 3GJFH 5FYKD 3VXUA 2I9TB 32C2B 5E2TL 4F37K 5DT1H 4XZUB 2WZPD 1JF6A 3WIFB 12E8L 3VFMB 4X6CE 2OL3L 3RVTD 3WFCH 3MRCA 2R56H 1A1OB 3DXAD 3KYAA 5TE7H 4OZ4B 4OLWH 1IC5H 4JPWL 2E7CA 3S5LB 1ZMYA 1OAQH 3TBTB 5I1LA 3G5VA 3CZFB 1N64H 5ICXB 3WHXB 1H8NA 3DSFH 4HWEL 4XNUL 3P73B 4WJ5B 1ND0B 1VGKB 1NC2D 1GGIL 4IIQB 4KK9D 3PWLA 1PG7W 3IYLW 1D9KD 4HC1A 2MSPA 4JFOA 1I1FB 1MJJA 2J88H 3JTTA 2AEPL 3CFDA 5ESVB 1UM6L 3MLVL 4UUJA 1BJMA 2ZSVB 3V79C 1XCQB 1S7QA 1C1EL 3BHBB 1R3JA 3TA3C 5C2BH 1S3KL 1JPFA 4DKEH 1J11A 2UWEB 4QRSB 4WDIB 4HKZA 4KJQC 3QDJE 1H9VA 3QNYB 4TRPL 2V2TB 3T3ME 3GI8H 4D9RD 4Y19A 5IBTL 2X4QA 5CBEA 1ONQB 4PRPD 3FN0H 1T3FA 1I75A 3I9GL 4GOSA 1N59B 1I4FB 1UWXK 2IADB 4WTZG 2HJFA 4GAJH 4MDIA 1RUKL 5EIIA 3L1OH 4HXBH 5HHOB 2Y6SC 4XX1G 2C1PB 1WBXA 3VRLE 3BIKA 4RDQG 4X0KA 2EC8A 5F1OB 2F19H 2NW2A 1S7WA 2IQ9H 2OM5A 1YN6A 4WEMB 3H0TA 1MAKA 1M6OA 1OT1A 1M7DB 4OIAA 4I18A 3PWUA 4UILL 5CILL 2DKSA 3KPQB 1BQHB 4JFDA 3CNKA 1J0KA 5GGSB 2IFFL 2P42B 1PKQB 4X7CC 1S7UA 1CIUA 4NNPL 4LCCA 4GW5B 1LQSR 4NQED 4DGVH 2GYSA 5GGRY 3SDCC 3O3DA 1CG9A 2ERJB 4S11A 1OAQL 3NN8A 1MCWM 1WFOA 1TMCA 1ORSB 3DOSA 3N1MC 3KLAB 2I07B 5IT2H 2E8ZA 4G6MH 5CP7A 3WE6B 1X5IA 3PWJB 1G7JA 2G9HA 1A6WL 3QUZD 2X40A 3EHBC 3V4UH 3V9FA 3HI1B 3HUJE 5HYSA 5DMIL 5D2NB 1Q9KA 4K23L 3VWKC 1S9WB 1A7RL 3HS0B 1XGPB 1HCFX 3RUGB 2C3HA 2GTWB 4N5ED 3DVNA 1I8KB 4LCIL 5DC0A 4LIQH 3QDAA 3VXTA 1A6AA 4O02H 35C8L 3EJJX 1XGYH 2C7UA 2GI7A 1OCWL 3DVGA 3QEQB 3EGSA 1ZLUH 1HCVA 3QNZA 4PGEA 2VDOH 1NFIA 1CXIA 2AXJA 1IC7H 1F4WH 3DXAA 3BZEA 2H26A 2W07A 1E28A 4YDIH 1GIGL 1XF2B 1S7SA 3NPSB 2X1QA 3ZSTA 5GRJH 4XP6H 4BM7A 2VZSA 2FD6L 1EAPA 3NZ8A 3CH1B 1VERA 1HINH 1TQBB 1TZGH 1JPGB 2EECA 2BMKA 5D7LA 1XGQB 4PJHF 5E00A 1J1OH 1ROWA 1B0WA 3L3HA 1T04A 3MRBB 1MHCA 4PR5B 1CICB 1IEHA 2YBRA 2EYTB 4NFDA 2VLLA 2DI9A 2BNRB 2YEZA 4NNXB 5B21A 3LMJH 2DM2A 4NKQB 4FP8H 5DGQA 5C09E 4MQTB 5KSBE 1AIFA 4A2LA 3QUYA 3N1FC 2V9TA 3F12B 4N5UA 4S1RL 1MCCA 3K8KA 2GTWA 3ZKMD 5EO1B 3QO0A 2YPLA 4KTDL 5I1JH 2JIXD 1MF2L 5L2KA 4DW2L 1FL3A 4I0KA 5KG9A 1UXSA 4M03A 4O9HL 1TJHH 5I15L 4ERSL 1V3KA 2HVKA 3L1OL 2R4RH 3L5XL 4WO4D 2X4UA 3MTRA 3LKPB 5F1NA 4HT1L 4UQ2B 4HJGB 2YN5A 2ZUVA 4KKLC 4R26H 4GRWF 5TFSL 1NEUA 1WBYB 1Q9OB 4XGZB 1JI1A 5EFIB 12E8H 2P24A 4Y16D 4GMTL 1AGFB 3OPZH 3IVKA 4X5LA 4GG6E 1QUNA 4NC1C 5IVXE 1AO7A 4Y5VB 1HDMB 4QLRA 5FO7A 1CI5A 1U91B 1GAFL 3U0TA 4DAGH 3SBWC 2P8LA 4AEHH 2G2RB 1MRDL 3DX9B 3PHQA 2Z31C 2QSVA 5F9WC 5LXGH 3MRBA 5I66B 2FIKB 2VWEC 4F8TA 4JB9L 5JIKA 2P4AB 5KANI 5GZNC 4MA8H 4L9LB 1WFUA 4PJXF 4UOJA 1A1MB 1BFVH 2CKNA 5IF0B 3FN3A 1F4XH 5B22A 2P5WE 4OGAC 4JANB 4ZNCD 4K3HA 1RHHA 3O3AB 5C6WH 5AWNH 1QFUH 4P23D 3F6LA 3LMJL 1F6AA 2FHCA 3GRWH 3IGAA 2XOTA 3QXAA 2I5YH 4ZYKB 1FC2D 2HAZA 1VADB 4I77L 2LVCA 1FYTB 3Q6GH 1M4KA 2A74B 4LGSB 1DL7L 5EULV 3H3PH 4D9QD 1BD2B 1SM3H 4PJDA 4PJXB 2SEBA 2A6DB 3GSVB 5F7EH 4NCC1 5DLMH 4OGYL 3RGVD 4KKBD 2AI0H 4FQHB 4PRNB 4XH2A 1RUKH 4DOHE 3EYVB 1EUTA 1EEYA 1X44A 4ERSH 3MUZ1 2FD6H 3WEXA 4KH2A 2A6IA 3ISWA 2V2XB 3DX6B 1UWEL 4WJ5A 1RUAL 4Y7MA 3PWVA 4RBPK 1F02I 1IZKA 3T65A 1Q9KB 4XT1C 3AS2A 1RK1B 1LO4L 1PX4A 3FO2A 1EXUA 5D6DC 2NY4B 2AK1L 4LHUB 2YRPA 1D6VH 4I0PD 1AHWC