3UPRA

Hla-b*57:01 complexed to pep-v and abacavir
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
275
structure length
275
Chain Sequence
SHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRMAPRAPWIEQEGPEYWDGETRNMKASAQTYRENLRIALRYYNQSEAGSHIIQVMYGCDVGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, B-57 alpha chain
publication title Drug hypersensitivity caused by alteration of the MHC-presented self-peptide repertoire.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 77
structure length 275
sequence length 275
chains with identical sequence C
ec nomenclature
pdb deposition date 2011-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3uprA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3uprA01
1UADC 1CLOL 2P5WD 4J7RA 5GS1A 4HLZG 3N85H 2AJSL 1RUPL 5GGTA 5JW4R 3RY6A 4Z7VA 3S88L 4EN3A 4PRDB 3EYQC 2JCCE 3UROR 1P7KA 4P5TB 2R4RH 5E5MB 5HTSA 3GSNB 2D0FA 2OR9H 1KB9J 4XNXL 5KSBA 2MCPL 3LOWA 2VISB 1IAOB 2ICWJ 5I1AA 5E94A 4G8EA 4XTRC 5JDJA 4WI9A 3DRTB 3TBVB 5IBTH 3QIBB 4JFFE 1ZT4A 1O7VA 3QXUA 4KJYA 4P2RA 4UNUA 2WWMC 2Y07L 4OI8A 3B43A 3IFNL 2DYPD 2Q6WB 1G7QA 5TE7L 4YPJA 5C0EA 4EDWH 4TSCL 1WCQA 2OL3B 3OG6B 5KVGL 4I9WD 4NZTH 1BX2B 3FT4B 5BRZA 2ID5A 1U3HA 2YZ1A 3VH8B 1BGXH 4JB9L 3CMOL 2LTQC 3CH8A 5DFVC 3WE6A 2UWEE 4QOKB 4W4OA 3F7VA 1JF1B 1T0MA 1H3PH 1ZLWK 4M7JH 3VXNB 1FCCA 2ZUTA 1LEIB 5DS8B 1JF5A 5T3XL 1V3KA 4N9GA 1F97A 1XIWC 1IM9B 3TBTA 4F7TB 5C0BA 3ULVC 1RUKH 3JV6B 4K3JL 4A6YH 3HR6A 1I9IH 3BUYA 5AG9A 5KANI 4NPYB 5EU4B 4HWEH 1HKLL 1YPZE 2PXYD 1D5MB 5FHBH 3DV4B 3KNBA 4XCFH 4L9LA 4M02A 1PEWA 1PYWA 3DX9B 3QAZB 3NMEA 4Q9RL 1G6RA 3MLWL 1A7QH 1N7ML 1Q0XH 4X5XA 1MF2L 2OXGA 4JZNA 2R0WH 4ZPVA 1WSST 1MFNA 5IFAL 4YPGB 3TA3B 3EJZD 1WT5C 2J4WH 4WVRA 1A7BA 2FRGP 2IMMA 1YEJH 5JXEA 3DROB 3DGGB 4HUUA 4U1SA 3EYVB 2ICWB 4PRHE 5DC4B 3WN5B 1L7IH 4M62L 4BSWB 3SKMA 4E5XB 5EWIL 4GUPB 2DKUA 4UTBH 4HWBL 2HVKA 4I3RH 3GSXA 4QHNB 5DHXB 4JRXD 5EFIB 4KKNA 4QXGL 2D7QA 1A47A 3OJVC 4PJCE 1S7QA 5C8JB 4KY1H 4TOYL 5HPOA 2AXFB 4M8QB 5EUOA 2VL5B 4IMLB 1ORQA 3DYMA 1UKQA 3E6HA 3C60C 5E9DB 2EDBA 1J88A 5B21A 4G5ZH 3CIQA 4EI5D 5GGRA 2VRAA 1D6EB 4OLZL 1D9KA 3RHWF 3RWFB 5L8LB 5ISZB 3WSQH 2GFBA 3CXDH 2OCFD 2AVGA 2FEEL 4MD5A 1CZ8L 1DR9A 3GHEL 4YHLH 1IJ9A 2Z92B 4CJ0A 4NFBA 3PNWA 1H5BC 4IDLA 5EN2A 3TFKC 4YHNB 1RI8A 2WLYA 2EKSB 4Z95L 2FIKB 5A40E 2OX5A 2LABA 4BSJA 5I15L 1HILB 4OCNC 1UWXH 4FNLH 2CGRL 4HPYL 5FYKL 5GS0H 3U9UB 3UEZA 3RTQB 1MI5A 4FQXD 1PSKH 1OARH 3HZYB 3C2AH 2J8UE 3RFZC 4PRPB 3BFOA 4R26H 1S8DA 3MYJA 4YX2L 2A6DB 5FAAA 4APQD 3SGKA 1HYRC 4J6RH 4ZFOB 1RD6A 3K80A 5FEBA 4FQLH 3K46A 4UDTA 1RK0A 5IEHB 3V9FA 5L8JB 3RL1A 4LVHC 1E6OL 1KB5H 2X4QB 4Y4HD 4EUPB 4N8VG 4OCRL 2YSSB 4KGJA 2RR3A 5JDSA 5J12B 4GKNB 4OGYH 4E41A 4CJ1A 2J88H 4WI4A 4LSSL 1FFPB 1MREH 4K3GA 1M7DB 4HJ0C 1JGDB 1U58B 3EOBB 5J11C 3BKCH 5D7LB 2H2SD 4QYOA 2IH1A 5FYJE 1ORSB 3OAUH 2D7TL 1BJ8A 1FDLL 2VSCA 5GJSL 3OKDA 3JXAA 3O6FB 1SJEB 5JHDA 2AJYL 2PR4H 4HFUL 5MERB 1LEGB 5E6IA 4K71C 4UDUA 3FCTA 4M7ZB 3BZFB 4V2BA 2CPCA 3M45A 3U48A 3NZHL 5FK9B 4RDQF 4AG4L 3HR5B 4EI6A 3CVHL 1Q0YH 3H9ZA 1ZVSA 2YWZA 2EDOA 1CXKA 4L4TD 2Z0BA 1FL5A 4KTEH 3IF1B 3LS4L 1EUUA 5E5RB 5EO0A 5F3HA 1D5IH 1DUYA 2EDTA 3IKCA 4YC2C 1BM3H 4Y4FA 3TJHD 3S37L 4IJ3B 4OCYH 3RZCB 1KPVB 2C4FT 5EU6B 4BQ8A 5IW6A 4OJFL 5FF6A 1W0YT 4L4VE 5DJ2A 3IFOA 1XGTA 2Y7QA 1KTDA 3BPLC 1R6VA 1CGTA 43CAB 3KJ4C 4M7KL 5E5UB 2ZUWA 5FIEA 2P42B 1VKXA 3RDTD 2BSTA 5B38G 2XG4A 1A1MA 5T1LA 1R3JA 3NH7H 5FV2A 5E2JA 5HHMD 3BDYH 2JCCB 1IMHC 4KTYA 4XNYH 5HGAB 3NPSB 1CT8A 5I8OL 5IB1B 2AJZA 4WFFE 4XP1H 3QZWA 4U6YA 2AQ3A 2E27L 3DSNA 4UIKH 4RRPA 4JCLA 3F7YA 3VFGL 1UXSA 5KANG 4JFFB 3RVVD 1QSEA 4OZ4A 5DFWH 4YHOH 3MROA 1UB5B 4OCXH 4XP5H 2C3WA 4Z7QE 3MFGB 4M4RA 3S7GA 3C6LC 2AJUL 5DR5H 1VPOL 2R69H 4V1DE 3UPRA 2NXZB 3ARQA 4H8WL 4JPWH 1T5WB 4H20H 5CLWA 4KUZH 3HG1E 2AEPL 3SKUD 2DQIL 3UC0H 3OJMB 1UKTA 2P5WE 4NFCA 4ELKB 4NIKB 2UWEB 4I18B 1F8TH 4PG2A 5E4IA 5IVXF 4XAWL 3BH8A 1HXYB 5DGQA 3S35L 5GS0C 4X7TA 5F9OL 2CKBA 4F8QA 1EHLL 3JWOC 2G75B 1MFBH 4NKDB 4BUHA 5FGSA 1J1OL 1U93A 1CXIA 3WO3B 1I1YA 4QTIL 3FO0H 2BX5A 4WW1B 5ADPL 2Q8AL 1AGFB 2V5RA 2HVJB 1S9VA 3L9RA 4KFZC 4OCMC 1QA9A 4UILH 3RWGB 4CADA 2VDNL 4JM2D 2WBJB 5E7BA 1ZV5A 2V5SA 1HCVA 5M95B 1YPZB 3MSPA 1MJ8L 4OLUH 3UTPD 1CFVH 1Y6NR 5J6GA 1B2WL 1QSFD 3QEGH 1U8HB 4M1GH 3ZKXC 1T20B 2D4DA 4OZIA 3GBNH 1NANI 4Y5YC 4G8FA 3B6SB 1BVLA 3D39A 5JA8B 1N26A 5KW9L 1G7LA 2P7TB 4XHQA 2CXKA 1NANH 4CRPA 2OZ4A 3HC0A 2VDLH 3AXLB 3PDDA 2AJSH 3RPIB 2BJML 1R3HA 4GQ9H 3T2OA 1U92B 1KJVB 1CFSA 2EYRA 1UM5L 4PRHB 4F3FA 1NFIA 2X40A 4OM0L 4MDIB 1T6WA 2I27N 5CIPH 3VXUE 1P7QD 2EYTB 4XNXH 3BWAA 4Y1AE 5DJZA 2XRAL 2FR4A 3CK0H 5GSVA 4YAQB 4S1SL 4WEBH 1UZ8A 1MAJA 5JOFB 4MNGE 4WFGD 4PJCB 4YK4B 2R0ZH 3ARBC 4KPHH 1IKNC 4KK6C 1M71A 3LEXA 2Y07H 4JY4A 3FQUA 4IRSC 1UVQB 5EU7C 5C0AD 2DMBA 4M6NH 4R2GB 4G80A 2GCYB 3KPOA 1AI1H 5TE7H 2IF7A 2DIJA 2EIDA 3VA6A 2VLRA 3MRKA 5INCB 1CBVL 1IC5H 2XIDA 1NLDH 4OI7A 5IKCA 5I19L 3SDAC 5TDNA 4YFLF 3CMOH 3RRQA 4CVZA 1QFHA 6CGTA 5ICYA 1G7JB 3TYFA 4PIRF 4LHUB 3MBEC 2VZOA 1CGXA 1P6FA 3T0BA 2E6QA 2DICA 3WHXB 1KC5L 1F45A 5ANME 1J05B 4MAYA 3GUTA 7FABH 3X13A 2EDDA 1U9KA 1RIUH 3KPNA 4JO1L 2J8UB 4NC2B 1PKQE 1CR9L 1EEYB 1X5IA 3NACL 1S5IL 3B9AA 3JTSA 3IDMA 4NQDE 5KZCD 3HAEB 1MCBA 1URLA 1PLGH 4P46D 3T4YA 3PL6B 1AR2A 3MV8A 4LCCA 1LWRA 5GGTH 4Q2ZA 4Q74A 3T65B 5SV3A 3QHZL 3PDOB 5HHPA 4LNVA 4Q9RH 3QCUH 4QY8B 5LXGL 1MF2H 3UMTA 3WLBB 5IFAH 2IALB 5LWYH 3VFNB 3D9AL 4RGMB 2BVQA 4AH2A 4QXTB 5C71A 5DMIL 4P5KA 2XZCH 4F37K 3MRCB 4MQXC 2HA1A 5AG8A 3QPQD 5HDBE 5JR1L 4XMKL 4GRLB 1MLCA 2LAAA 3DARA 3GSOA 5KVDH 4PY8J 4HIHB 4Z5RA 2BSRB 4KZDL 1CXHA 3D25B 1DVFB 5D71L 2OXHA 3I6KB 5MEPA 4Y4KC 2HT2C 1WIOA 3DNKA 4NNXA 1TETL 4U1HB 3TYGH 3JV0A 4KXZI 3MBXL 4XC1L 5EOQH 1TJHH 1FN4B 2D31A 1AIFB 4F9PA 5C7XL 4MD4A 4XVJH 2FEEI 4KXZH 1TJIL 4I3SL 4N0UE 3OKKB 1MCEA 4G8GA 3MV01 3BN9D 4FRWA 1ZWIB 2Z8SA 4LK4A 5B4MC 1CZ8H 3G6DH 3VG0H 1FZOA 3LHPH 5F1OB 1ZSDB 4KDTC 2G5RA 4L4VB 1YA5A 5DQJA 2DM7A 5K9QG 2FB4L 1JMXA 3FMGL 3K81A 3BDXA 1A3LH 2M26A 4HEPG 3UTSD 2J6EA 2D0GA 5D2NE 2ZOLA 3CFKA 2CGRH 3MLUH 3HNTH 4QGTA 5D1QB 4F57L 5ID0B 4YDKL 2R2EA 4M1CD 5E03A 4HXAH 3O45A 2CRIA 4UOW0 1CCZA 4U1KA 5K59E 1NGZB 1A0QL 2PKDA 3X12A 4TRPH 4YX2H 2FJGB 2H8PB 4KAQL 4O51B 4QHKI 1S9YA 2DKSA 3AAZB 3D2UB 2PUQT 3VFRA 3ZDXE 1AHWC 1MHEA 1UFUA 2CXGA 1E6OH 2D7PA 2X7LA 3QULA 4LSTH 3W82A 3I6GB 2FSEA 5A2KH 4YIQB 4MCYA 1TZGH 1KTLB 1V7NL 1QO3B 5DYOA 2I5YH 1QSVA 5E00B 2HJKB 4V1DB 4HUVA 4PJ9B 3NCCB 4WUUD 3QG7L 3MUGA 5DK3A 4LCIL 5IB2A 2JE8A 2UUDH 3HG1B 3U0TA 1U8NA 3IJYB 3DURB 4BA8A 3NFNA 1JNHA 4JFZH 3CX2A 2P5WB 1DBML 4K7FA 2D7TH 5GJSH 5I17B 3JWNC 4ODTH 3RPKA 4HFUH 1IGMH 2B1AL 4KDVA 3HPJB 4AZ8A 4LNRB 4RWYL 3KDMB 1NSNL 4HKZA 3S98A 4HDIA 3STBA 4X4YB 5BO1H 4AG4H 2GK0A 1IGYB 5ITFA 1HQRB 1DBKL 2JIXA 2V7HB 5ALBL 4FQ1L 4JM4H 5C0JB 2IAMA 3WKMH 1CVRA 2NY3D 5E99L 2HLFD 3B2UC 3KPSD 4UOJA 5GS1C 2RFXA 3DRQA 1A5FL 5GS3A 3GRWL 2XTJE 3CDGB 3VGDA 3AREB 4R0LA 3RY6C 4DKEL 1XGUA 4EN3C 4YDJA 1ULVA 2AAVA 2DYPB 2A73B 3MRMA 4J1UA 1H15A 4POZD 5IGXL 1EVUA 1EJ6A 2XG5A 3SCMB 4S0UC 1MCDA 1E28B 3BKJH 4KRPD 4ZOAA 3WEXB 5M7QA 1OVZA 1GSMA 1T03L 2X4TB 3W0WE 4F15C 3CPLB 3ROOA 5C0FA 3NCBB 4HBQA 4JY5L 1PGRB 3JV4A 4GAJL 1K8IB 2FCBA 3VXUB 4Y1AB 2BRRL 3LRSB 1YEFL 2ZJSH 4XP6L 1XGPA 2F5BH 3CH1A 3JTTA 2O26U 4MNGB 1OSPL 3E2HA 4FFZH 4XMPH 1PG7X 4XH2B 1U3HC 5ILTL 2C1PB 3FOLA 5CBEB 2OM5A 5EBMA 5IQ7H 1IM3B 4HMEA 4WW2A 4ZUTB 1IQDB 4W4OC 1IGCH 5LG1A 3OXSB 5FO7A 1VPOH 2ADIA 1CE1L 4PJXE 3KPRE 4X0KA 5KSAA 4FFWC 4MB3A 3I02A 4PJ8A 1GCFA 2DQIH 1J11A 1AXSA 2Z91A 5E8DL 2OSLB 3IXTB 2RB8A 2QKIB 2BCKA 3T0XA 1S3KL 3BN3B 4QNPF 3OZ9L 2PTVA 3UAJD 2ATPB 3QEQE 3U6RA 3VMNA 3W11D 3LD8C 1C8PA 4F9LA 1Z3GL 2X44D 2FL5A 1U6AL 2Z8RA 3AS3A 5F9OH 1CFNB 5E6ZA 2EE2A 2E7HA 3BP6B 5ANMB 4YXKL 4ESKA 3SO5A 2X1OA 1JWMB 2BNQD 1J1OH 4L9LC 1ZLVH 1RJLA 3KYMB 5TE6L 3D1MC 3MV7D 4XC3L 2X70A 5AD0B 1A6AA 1FJ1B 3L5WA 3O3DB 3B9KD 1PKQB 1KULA 4X7FC 2A74B 1MJ8H 1KJ2L 2X09A 5E4EC 1B2WH 4LLQA 1JUFA 4NQDB 3QP3A 4R97C 2WINA 3EYFB 5DUPH 5JXEC 5IMKB 2A6KB 4DGVH 1M1SA 1HHJA 5KW9H 1OGAE 4PP1C 4DN4L 2P45B 4FXKA 1YEDA 5F71A 2CIKB 1KEML 4DUWA 5HBBA 3O81A 5EIIB 3G6AB 2BJMH 1VADB 3R06B 1EFQA 1WF5A 1JP5A 3D85B 3UTQB 4ZAKD 3G08B 2EE6A 1FAIH 1MHHA 4K7PX 3KWWB 3A6BL 1DDHA 5HDOA 4U3XA 1F2QA 3T0WA 3QRGH 1NEZB 4NGHL 2NY4C 3CSGA 3C8KA 1TIUA 1NBQA 4BFBD 1D9KC 3WXWL 4FQXB 4M3KB 1NFDA 4ODSL 3ULUH 5CD3A 1IGJB 5TQ2L 3KJ6L 3E1F1 3QDJD 2G2RA 5HY9A 4F7MA 5BCAA 4LRIA 4DN3L 1IGFL 4N0UB 1MQKL 1RHHA 1VHPA 1QFOA 3S3SA 1UXWA 3DETD 1FRGL 1TJGH 4JRYA 2F54D 5F6HI 5I19H 3K4AA 4OIAA 4OF3A 5CJOL 5H94B 1F00I 1UKSA 3CZJA 3LKRA 4PJDE 2DLEA 1JK8B 3IDIB 4PV9A 5D2NB 3P0YL 2ADFH 5FA4A 1KF9B 3WLWC 3EJYC 5C07A 3VDAA 3RNKA 1B4JL 1F3DH 1AR1C 3O6MH 2P47B 4RAUB 4P2OA 5D1ZD 2XI9A 5HHXH 1MEXH 4M7LL 1KLGB 2E6PA 2B5IC 2PF6A 4N0CD 5BV7C 2XWBA 1AKJD 3VFWA 2HH0L 1VA9A 5EPMA 4CMMB 4GAYA 1JIBA 5JXAL 2FGWH 4HH8A 1GGCH 3QSKB 1BP3B 2OK0H 3CLEL 2V6HA 1QR4A 4ODBD 5LXGH 4X6CE 1REIA 4NNPL 2HTKC 5F9JA 3SE3A 2P44B 5SWZE 5DRWA 1HHKB 1XGQB 2DQDL 1D3CA 2DL2A 4CL7A 5E6IC 1QR1A 1Z9LA 2V5MA 2ZPKL 5DMIH 5IM7B 4JM2F 1JHTB 1Z5LB 2VDKL 1Q8MA 1YMHB 2MHAB 3EDDA 3U4BL 4X7CC 1CLYL 2G60L 5JR1H 3WNNA 3HE6D 1YY8A 4XMKH 3U0PB 3V6FB 4AT6B 4NN7C 2AKRB 4X4XA 4XPBL 4KZDH 1P4BL 5GGSA 5F93C 4JPVH 4Y4FC 2ESVA 3I75B 4YBLC 1S7UB 5EOCH 1PBYA 1RVFH 2YD1A 5CLTA 4XC1H 3PQYA 4ZD3H 1I7ZB 2XZQL 3LIZH 2DJUA 5CSGA 4OD2B 1QBML 3ARFD 1UA6H 3CSYB 3AMLA 1OTUD 2XTJB 4R6UA 5H2BA 3FN3A 2QQQA 1LQVA 2VZ3A 3BVNB 4UBDD 4EXKA 1KCGC 2XV6B 4Y5VA 4LSUL 1CGSH 3K2MC 2O61B 3SQOL 3E6FA 2ICCA 2FB4H 4JPKL 2X1QA 3H0TA 1Q94A 2FNBA 3GIZL 4ZS6D 4WUUE 2FD6H 4C59B 1DEEA 1A1NA 5ENWA 3H9SD 4HWZB 4LLUB 3BD5A 3MLXH 3LKNA 1YN7A 1Q9OB 3W0WB 3BQUB 3VWJD 1CXFA 2LQRA 4I77L 2CUHA 4OV6F 3QDME 1A0QH 2XZZA 4A2MA 1NDGB 2EDHA 4O4YL 4PRAB 1P1ZA 4JDTL 2BVPB 2YD2A 3ULUC 3CSBA 5GIRB 1U8PA 4P57A 4XB8A 5TDPA 4JFDD 5BW7A 2H32A 4KK5D 4LLMB 5DJYB 5C0CA 2V2XA 3KPSE 1DQDH 4NO3B 3MNZB 3H9HB 1FLRL 1BFOA 1LD9A 4PG2C 5JLZA 3VXSD 3QZWG 2BVEA 1YEIH 5A16B 4PJXB 3KPRB 3TO4B 2P1YA 5FDWA 2Z31D 5KS9E 4RRPG 2VZ1A 4LCIH 4NZDA 1V8HA 4AQOA 4YR6A 5HSFA 3EYUL 1J1XL 1YJDC 2HN7B 5IEKA 2AI0L 2HG5B 2WBWB 3P30H 4N0FA 4U1NA 5AAWA 4KKCC 5CZVH 1N6UA 3QEQB 3K1KC 3OGOE 3F62A 4OCSL 1ZS8A 4GRWE 2CDGA 1JPTL 1LO5B 1KIQA 3UYPA 4LCYB 1FVCB 2MJWA 4ZXBD 1KIRB 2E3VA 5CUSL 3VD7A 3LPWA 5C6TH 3WV0A 2H2PC 3SKNA 4LSRH 1JPGA 4PJFA 5C08A 5ALBH 1GC1L 5T3XD 2VQ1A 3VE0B 3ZE0F 4HX1B 1G6VK 4BH8B 3GRWH 5TE4L 4JR9H 5ETUA 1NL0L 2NY2D 3LV3B 4JFHE 1A64A 5JZ7D 1RULH 3KPQA 3BGAA 1MCJA 1OGAB 5D7IA 4MAUH 1EEZA 3WFEL 4MJ5A 3OGCB 4JEGB 4PGEB 2NNAA 2YA1A 3GJFA 1IFHL 4HZAA 2B1HL 2VDQL 3FO1A 4JZOA 3UBXA 1IGIH 3MA7B 2GTZB 5DJAB 4N0YH 5DURD 3VMPA 5T3ZH 1FH5L 1T22B 4L3AA 1T03H 5SX4H 1JNNL 4PJ7E 1AD0A 3FQRB 2EH8L 4JG1L 1MAMH 4HIXL 5EH1A 4U31A 3PJSB 4PP2B 1YEFH 1BOYA 4XWOC 5JQ6L 1WZKA 4YDLC 4RZCB 4JAMB 1N0XH 2BNQE 4NC0B 1N4XL 4X4ME 5EZLB 1D5BB 1X6LA 3O9WA 1WWBX 2VTFA 3MCKB 3P73B 2FH6A 3MGOA 4TPRH 4PRDA 4KHXL 2ENSA 2AGJH 1E4WL 5I0ZA 3V5KB 5FUCC 4P5TA 4NWUL 4GS7C 3GSNA 2PTUA 5KZCB 4DW2L 1DSFL 2VISA 1IAOA 8FABB 3VGEA 4MS8A 3RVWC 3KLHD 3BD3A 4MAYC 3TBVA 1FSKC 3QIBA 4M43H 4L8BB 4L8CB 4AEFA 5TH2B 5BXFB 1CFBA 4PJDB 3OZ9H 3UDWA 2Q6WA 1U6AH 1EMTL 1EXUB 5DUML 4Y2DB 4S1DC 3VDBA 2OL3A 1P4LB 1BX2A 4K9EH 2R39A 3FT4A 4LCCC 3REVB 3HRZB 1M6OB 3UZQA 5TE6H 4HAGA 4TUKL 2ZKHL 5FYKD 4F7CA 3GBML 5DHVB 2QSCH 1ZMYA 4XC3H 3RIFK 3DUUA 4QOKA 2VWEE 1JF1A 1XF3B 4WHDA 5A2LH 4OKDA 3VXNA 5HI4D 1LEIA 3F6LA 5DS8A 5J7CC 4XNZB 1HZHL 4EKXA 4J3OC 3WYRA 1B0RB 1I4FA 1IM9A 2CUMA 3QDJE 4F7TA 4X9BA 1S7XB 4NO2B 4DN4H 5LGHL 1X5AA 3JV6A 5DUBB 3L3OB 4X6CB 1F58L 1NCAL 3ZT7A 1I8IB 1JV5B 2WV3A 1KEMH 2GAZB 5SWZB 4QRPD 3VFSB 4Z7UF 4NPYA 4OZGE 1D5MA 3DV4A 1P2CB 1OPGH 4L5FH 4RNRB 2DQCL 3DX9A 2ZUUA 1FBIL 1OP3H 4F9PC 5F6IB 4NGHH 4NUGL 4YPGA 3TA3A 3INUH 3WXWH 1SVZA 5ESAB 5GRZA 2P46B 3PUCA 2HP4A 5T5NG 3NIDF 3NBNA 3Q3GB 1KNOA 3DROA 3DGGA 4OCLC 3OJDB 3EYVA 1LMKA 2ICWA 5F9AC 4AIXA 3WN5A 3DBXB 4BSWA 4E5XA 4HKXB 4KDWA 4B0MM 4GUPA 4KI5E 4DN3H 1IGFH 1IBGL 4HIJB 1UM4L 4QHNA 5EFIA 1MFCH 4FQCL 1ZAGA 1P9MA 1ROWA 1FRGH 5GRJH 4M5ZL 4G9DB 3GDBA 2Q86B 5C8JA 2AXFA 3TEUA 4M8QA 2YOCA 3BO8B 3K7UA 3WUWB 2VL5A 4IMLA 4KKAC 3WHE0 3ZKQD 4LVNC 5E9DA 2W92A 3FOMA 2NY6B 4HS3B 2NXYD 3VD3A 4XVSL 3FJTA 3K2UL 1D6EA 3P0YH 4LQFL 4WUUB 3RWFA 2AJXL 3I84A 5ISZA 3SDDD 4U05A 3QI9D 1S78D 5J9PB 1J10A 4M7LH 4QWWD 3O3UN 4Z7NE 2Z92A 5A2FA 1T83A 1RJYB 2AK4E 4MQSB 3MRPB 4YWGH 4YHNA 2EKSA 2FIKA 3QDMB 1S7RA 3WFHB 3S4SB 5DXWA 4B41A 2XICA 4OQTA 3UYRL 1HILA 1NBZB 3CLEH 4KC3B 4L8DB 3U9UA 4RGOL 4OUOA 1LHZA 3RTQA 1R3LB 5E1AB 5D2LF 1ZKAA 2DQHL 1IL1B 3HZYA 2XFXB 3KPSB 2XNAB 3OAZK 3I50L 5HYJA 5F7YC 1FPTL 1R5WA 4PRPA 5DD0H 2J2ZA 4A6YB 5IBUG 1H0DB 1BQLL 2R29H 2A6DA 5IWLA 2R1WA 3FFCA 4J8RB 3TVMA 4ZFOA 3IETB 5KS9B 3KYOA 2VDKH 5GRWA 4U3CA 1Q38A 3U4BH 2VLJD 4AENB 3PP3K 4BQBA 5IEHA 1CN4A 2X4QA 4D9RD 4EUPA 4JN2B 2AXHA 4MJ6B 1J12A 2IAMC 2YK1H 4XPBH 2YSSA 4GKNA 1WBYB 4GRWB 3MFFB 5GGQL 1FFPA 4KRPB 4LP4A 1M7DA 1CQYA 4K7PL 1OAQH 1S9WB 1JGDA 2YR3A 4PRNB 1MIEH 1U58A 4R0LC 5L9DL 4KROD 5KVMC 3EOBA 2XZQH 1NAKL 5D7LA 1X44A 1ORSA 1DFBH 4NBYB 4F7PB 1SJEA 2IADB 4LCWD 5MERA 1LEGA 4OIIH 4RMQA 2XA8H 3IS1X 5CEZD 1JRHI 3MXWL 5FK9A 5IFJB 3HR5A 3SO3B 4P2YA 3SQOH 3G5XB 1HEZB 1JRHH 4RIRA 1SEBB 3IF1A 2CRZA 4N90D 4L1DA 2WK2A 3TN0B 4GAGH 4HUNB 2E6JA 3E2HC 2HMID 4K23H 3ILPA 2YPKB 1UQSB 4NBXB 2FBJL 1KPVA 5AUMB 5EU6A 4PJ7B 4I0PD 3EBAA 3AS2A 4LF3B 1L9MA 1P53A 4WW2C 4NJAH 4HUXA 2PYEE 5HYSG 4YFEA 4O4YH 1FFNA 4NO5B 2FYYB 4IRZL 4JDTH 4Y19D 5I1GL 2IG2L 2D03L 3VFOA 5KSAC 3W2DH 3ZYZA 2BNQB 3LZFH 4MLSA 2NYYC 4PJ8C 2HT3D 5T3XE 4RX4A 3BT2L 1NCCH 1CL7L 2JCCA 1JZ2A 1E4KA 2CR3A 3QNZB 4XWGH 2FATL 3B9KB 3QFJD 4G6JL 5HGAA 4XPTH 5CJQH 1F6AB 4PB0H 1XMWA 4F9LC 4JQIH 1RIHH 4LPTA 2GITB 2BK8A 5DJXB 4JFFA 4YHIB 5T1DH 3A67H 4M6AA 3A0OA 1UB5A 4MMXC 1S7WB 3HFML 4PRID 3QCVL 4LLWB 1P5UA 1YEKH 1QG3A 2EEBA 5DD1L 3UJTL 2EH7H 5CUSH 2FX8L 2OJEB 4PBXA 4ZAKB 4C57C 1T5WA 5F8QC 3V6BR 3QO1B 1VFAB 3AFLA 3L5XL 3MRQB 3I9GL 3O3BB 1E6JL 2UWEA 4I18A 2FECI 2YEZB 4Q6IB 4JFPB 1HXYA 1KCUL 1NL0H 4PGBB 4MDJA 1T6VN 2QHRH 2GSIB 3V0AC 2W9EH 2G75A 3N50A 4NKDA 4UINL 5ESVA 3QDJB 4HPOL 3DXAE 2B0SL 1X9QA 3TBWB 3BIBX 3C5SB 3MACH 1AGFA 2HVJA 4HJJH 2C7UA 3ARZA 4M61B 2WBJA 4U6VH 2VDQH 1UGNA 4OZGB 3L3DB 2FHFA 4CMHB 1YPZA 4PJEF 1U8HA 1T20A 1FH5H 2WUCH 4FQJL 1Q9LA 1MCLA 1AH1A 3DO7B 2J8HA 3ZYOA 3B6SA 1HSBA 4B5EA 3NCJL 2P7TA 1QOKA 4MA8H 2VIRB 2ARWA 4LRIC 4WRLA 1JI1A 3AXLA 2H26B 3RPIA 4Y89A 1B0GB 3TNMB 3QUZA 4Z7WE 1U92A 1KJVA 5FYKE 3WIHH 1AKJB 3MLRH 4HJGA 4IOIB 4XNMB 4NWUH 5I1HL 3MTRA 5I2IB 4XP9L 3BKML 2EYTA 3ZTJG 2X1XR 4BSVB 1U8IA 4YAQA 3RY4A 5JOFA 2R23B 1U95B 3EYQD 4PJCA 4PTTB 5EIVA 2ZCLL 4P2OC 2Y36L 2QADB 1UVQA 1SBSH 4MGXA 5FO8B 2DQGL 1G0DA 4HKJB 2GCYA 4MJ2A 1W72A 1PW3A 4XTRD 1DQMH 3BIKB 4WHTB 1EMTH 5DUMH 3E8UL 5INCA 3QXVA 5D7KD 1LP9E 1NC4D 2WSKA 2WWMD 2HT4C 4ETQB 3S34H 3AU1B 1BBJB 1QFWL 2AK4B 3A6CH 4M03A 4CNIB 5JMRA 1DTUA 3P11L 2GHWB 3SE3C 1G7JA 4LHUA 3QWQB 4LAQL 1BAFL 3WNLA 5BVPH 1AO7D 3BUTA 4HIEB 3NVQA 1MFDL 1TZHB 1WQVT 1HZHH 1J05A 4MQ7B 2JJWA 1KG0B 1MFEL 5DFVD 1PKOA 2YPLE 1Y6KR 5LGHH 3QWOB 1F58H 4XVTL 2EIZB 4LIQL 4YEEA 2J8UA 2YMXL 5TFSH 4M1DL 1ZGLM 1EEYA 4X80H 1I8KB 3ZKMC 1XIWD 5I71B 3HAEA 2RBLA 3EOTL 3HKFA 3ULVD 5SX5K 2OZ4L 1IE5A 1SJHA 3PL6A 2DQCH 1FZKB 3D0LA 1YEEL 2I07B 1N5YL 2IBZX 1OQOA 3PDOA 5GRVL 3ZHKA 1UH4A 3E0GA 1U8MB 4QY8A 1GGTA 4FFYL 4KVNL 3WLBA 3LSOB 4NUGH 2IALA 4XCCL 3VFNA 4WTZA 4NZUH 3AVEA 4KKLD 4BQCA 1F3RB 2ZCHH 1JPFB 3O0RL 4L29B 2ZG2A 4QXTA 4YDIH 3VWJB 1NUFA 3MRCA 1QFWM 4Y5VC 1UH3A 1TQCC 3BHBB 4Z0XB 3HZVB 4I2XE 4LGRB 5JUEH 4GRLA 1JPSL 2JJUA 2XQBL 3VRLF 1DQQB 4NKIH 4OLWH 3ARTA 3C9NA 4HIHA 2BSRA 4LPVA 3L5HA 3D25A 3MOAL 1DVFA 1CGYA 4TSBH 3I6KA 3MJ9H 3IDNB 4S11A 2JTDA 1MH5B 3ROLB 2ZUVA 1HDMB 3KHOA 3U2SB 4U1HA 5D6CB 4UT9L 2J8OA 1HH9B 3A6OA 1F4XL 3B8YA 5HVHB 1D6VH 1FN4A 2FLBT 1AIFA 5DJDB 4OFKA 1TTUA 2I24N 3OKKA 3DVIA 5HGHB 1FIGH 2AJXH 1NCDH 1ZWIA 1A6WH 5CSZA 5H37H 2VN4A 1U3YA 1ZSDA 1QFUL 4DEPB 3MLZL 5CS7A 2EEDA 5CJBA 3SGDI 2OMBA 5BW7C 1VGEL 5GS2D 4L4VA 1ZLSL 1I1FB 1WZ1L 2PYEB 3RGVB 4IOFC 3SGDH 5J3HC 3H8NA 3V7AE 2DBJA 1QKZL 4ZXBB 1VGKB 4NM8L 2Z4QB 4RGOH 5KVEL 5J4MA 5ID0A 3TFKD 3WFCH 1A7NH 2CK2A 4GLRI 4QKXB 4TVPH 1A7OL 4TUJB 1D5ZB 1T2QH 1NGZA 2P5EA 4Q97A 4GLRH 1BQLH 3EO1B 2NY2B 3H42H 2FJGA 2H8PA 3FO9B 4LRNL 3W81A 4KVCL 3V5HB 2ICWI 1JYWA 3AAZA 3P4OB 3D2UA 2H1PL 4EDXB 5E6YA 4ZNEE 2R2HB 1RURH 1CK0L 1HKFA 4N90E 3I6GA 2VLKD 4YIQA 1KTLA 2IGFH 3GK8L 5HGBB 4LASH 1QO3A 4QCIB 5E00A 2BNRD 2HJKA 4V1DA 3SN6N 2PW1A 2V9RA 5E24E 4QHUB 4PJ9A 3BE1L 4MNQE 15C8L 1KTKE 2CK0L 3GSRB 1GGYA 3O2WL 4S1QH 3HG1A 3IU3B 4NN5B 3IJYA 3DVGB 2P49B 2P5WA 5I17A 3NA9L 5GGSY 4Y19E 1KCRH 4MQTB 4WFHD 1MY5A 4OD1H 25C8L 2W0PA 5D1XB 4LNRA 4KU1A 3EZ8A 1PY4A 4ZMAT 3NIFE 4X4YA 1FP5A 1IGYA 3RU8L 1HQRA 4ZTOL 3T2NL 1TVHA 2V7HA 3DXAB 2FHCA 1WC7A 5CGTA 5ICXB 4QGYA 5C0JA 1AFVH 5J13B 2WW8A 2ENYA 4AEHH 2P24B 1I75A 1Y18B 3L3KB 3RIFF 3B5HA 5FKPB 3CDGA 3O9WC 3AREA 4CBPA 3JUZA 4LVOC 2J6EL 5EO1B 1WCBB 3P0VL 4U0QB 4BELD 1AC0A 4HG4K 4PRIE 1CD1B 1UACL 4P5TC 1EHXA 1YC7A 2A73A 5K9KB 1TLKA 3MUHL 4QTHB 3RIAK 4FZ8H 4IRZH 1NC2D 5I1GH 5IFHL 2VKWA 1FL6B 5CILL 1G9ML 3VGBA 3UBXG 4MS8C 3SCMA 3NCYP 2X1WL 1E28A 4Z7WB 4PJHE 3QIBC 4RQQB 3BT2H 4AIZB 3WEXA 1A14H 1QBLL 2ARJQ 2X4TA 3KXFD 2ZUQC 4KRLB 2Q20A 2IBBA 3CPLA 3HA0A 3NZ8A 1LK3H 4G6JH 4PYGA 4YNYB 3VXUA 1K8IA 1PX4A 3SDXF 3UDWC 4MXVF 2FIRT 4L1HA 4Y1AA 1QACA 5F1SA 2ZNXA 4WI6A 4MNGA 2UYLB 2Q8BH 5TF0A 2ITDB 4XH2A 3MA9H 2C1PA 3FB5B 4DKAA 4G6FD 5CBEA 3BRDA 1IM3A 5ERWA 3HFMH 4ZUTA 3QCVH 4K3EH 2EC9T 4XPAL 1Q72L 3P9WB 5IT2H 3ZTNH 4IBLT 1LP9B 3UZEA 2FX8H 5KAQG 1TQBB 1JHLH 4LGPB 2OSLA 3IXTA 3C6LD 4HXBL 2QKIA 1JZ8A 4FQHB 1YQVL 4QF1B 2ATPA 5SWSD 3S5LA 2UZIL 1KCUH 2VABB 5DVKA 4PJ5E 1JGVL 2A0LC 3BP6A 5BS0E 5CEYB 1JWMA 1UZ6E 4YQXH 1A3RL 2YPLB 5AYQA 3AC0A 4GH7B 2FX7L 3KYMA 5GZND 1Z2KA 3QAZC 2CDEB 3VH8G 5FV1L 3MRBB 3W9DA 3QDAA 3CVHB 5AD0A 1DQLH 5E2VL 5GS0D 1FJ1A 1HINL 35C8L 1PKQA 2KKQA 2DLIA 3DI3B 4UUJA 2A74A 1NQBA 1KCSL 4HD9A 3TA3C 4LU5H 2VH5L 5H37G 4NQDA 4WHCA 1TMCB 4FZEL 2HFFB 3CC5B 1K2DB 2F53E 4RMVA 4RMTA 1RU9L 5IMKA 3BKYH 2A6KA 3PP4L 1A22B 3WN5C 3QJFB 5DTFB 3KS0J 4E42B 5CSBA 2CIKA 1JTOA 2N56A 3UTTE 2DQFB 1YYML 5D7KE 3P4MB 5EIIA 3G6AA 4MXQA 1VADA 5AYUH 1P9MC 5MI0B 1A6VL 1WEJL 1OLLA 3MV11 4EEEA 3EGSA 4KUCD 4X6DF 3D85A 3UTQA 3VW3H 3G08A 2OYPA 1EVTC 1MHPL 4X8JB 3DX7B 1J0HA 4I2XB 4XP9H 3KWWA 5L2KD 5MEND 1RFDL 3W39B 3BAEL 1MJUL 1PD6A 2APTA 3DIFB 1NEZA 4NC1C 1F90L 4PR5B 1JGUH 1T89A 2PO6A 1SY6A 1PQZB 2ZCLH 4XGZA 1EBAA 1OM3H 3LEVH 4ZYKB 4GMSH 4G6ML 1IGJA 2IAND 3DX8A 1T83C 2AERT 2X89D 5HVFB 3L3IB 4P23D 5AWNL 3E8UH 4RAVB 4N0UA 3ARBD 4WENB 1VFBA 5DC9B 4IRSD 1WFNA 5GRYA 3V4UL 1KTRL 3RTQC 5FO9B 4JY6B 5H94A 5CZXC 4YZFE 3GSUB 4WY7L 1T21B 1DBJH 2LU3A 1AXTH 2OBGA 1NGQL 3F65A 1M05A 3OHXA 2DQTL 4BZ2L 1AGCB 5IK3A 1CF8H 4Q9QL 1G1CA 1JK8A 3IDIA 2UY7A 1MFDH 5FHAL 3SDAD 4OCWL 4KV5E 5IWLC 2O5XL 2BHUA 3TVMC 5CEXA 4G9FD 2AEIT 3L3JB 4PJIF 2Y5TB 1KLGA 1ERNA 2VR5A 3MBED 2AV7B 1EHAA 4LIQH 2DRUA 4DZ8B 3ETBF 2PTTB 5J12C 4CMMA 4LSPH 5IHUL 1J9CT 5CGYD 4ZQKB 5I6XB 3O6KL 4J3WA 2C3HA 3RJDA 3DYOA 5DQDL 5ACZB 1RZ7L 3RAJL 1HHIB 3KPLB 4NWTL 1N5YH 5AAMA 5EBGA 3IS0X 2ADGA 5IW3A 3GMMB 3QG6A 1HHKA 4YUEH 1J7VR 1GGBL 2A77L 4XCCH 1QEWB 3TJHA 4L8SB 3TO2B 5CJ8A 1FZMB 4M7ZC 4MNQB 5I1EH 5LKNA 4LPCA 5IM7A 1Z5LA 1YMHA 2MHAA 3U0PA 3MUJA 3HI1B 3MPCA 1U2HA 3V6FA 4EUPG 2LV4A 4AT6A 1N6VA 2AKRA 4Y19B 1NBVL 5I9QB 1T04B 3MOAH 1HI6B 2QQNH 5FUOL 1MCPL 1ZE3C 4MQXD 3WXVH 3I75A 4IJ3C 4LARL 5IHLB 1S7UA 4PJAF 4UT9H 2IQAB 1F4XH 1VERA 4GXVL 4UIMB 4OD2A 4R8WH 4HC1A 1CU4H 4URTB 4Y4KD 2HT2D 3CSYA 4JG0L 4UMGA 1Z0MA 5GRUL 3BVNA 2W9DH 3GMNB 3GKWL 4F80A 3GHBH 1E4KC 2JK5B 2O61A 1ZLSH 4PRIB 3NCYS 3NPSC 2BNRE 5B4MD 4KQ3L 2MPAH 1QKZH 4X7EC 4OZFH 1WVZA 4H25B 5JNYB 5D7JB 5CCKH 4P4KB 3MGTB 1RUMH 2AXJA 3MRLB 4PJHB 4LLUA 5I74B 2NY5C 1Q9OA 3W0WA 3BQUA 5I1CH 1T3FB 1S7VB 4WFHE 3RUGA 4ZS7H 5DJ8B 1NDGA 1GZPA 4P9HC 4PRAA 2BVPA 4WUKH 4KMQA 1J8HE 1TCMA 5F7LB 2HAZA 5GIRA 4POUB 1INQB 4G3YL 3RVTC 1JI2A 4ZO8A 1C1EL 4LLMA 5DJYA 5F7NC 4U0RB 4OLXL 4XPGH 5C2BL 2XPGB 4NO3A 3MNZA 4I18C 1WV7T 3FFDB 2C4FU 3ARGB 5A16A 4PJXA 1PEZA 3QDGD 3KPRA 3TO4A 3QQNA 3VRIB 2CK0H 3BI9X 3GMQB 3O2WH 3HMXA 4QXWA 4JKLA 1MCCA 2HN7A 2NY1D 4G7YL 2HG5A 4YFLI 1TVBB 4AL8H 3ULVF 1SBBA 4DVBB 4PJGE 2IPTH 5J1AB 3QEQA 2WBJC 1I3GH 1AE6L 1OAUL 1LO5A 1BJMA 4LCYA 3NGBB 5I1JH 4PJ5B 2MKLC 4LOUC 1U8OB 4YZFF 5DRNB 5BS0B 1KIRA 3KXFE 3DMMA 3RWHB 1BECA 3SE9H 1CLZL 1EEUA 1IAKB 2WZPD 4HX1A 5BVJB 4RDQG 2XN9D 3MV9D 4BH8A 1FGVH 3J8F7 4ZFFB 1HHGB 3LV3A 3QUZC 2F53B 5DO2C 3MXVH 4P2QD 5HDQH 3VMOA 1IRAY 1J0IA 2MQ3A 3BW9B 1OGAA 2Y72A 3HI5H 3PWPE 4WTXA 4J4PA 3V8OA 4XP4L 4PGEA 3UTTB 2RAMA 1NC4B 5TDOB 2R0KL 4BYHA 1G9MH 3MA7A 4EN3D 3HC3L 2GTZA 3LKQB 5DJAA 1ZTXH 2J7LA 2IPUG 4YK4C 3UTZB 3IXAB 1AD9B 1SM3L 4PLKC 1T22A 1ZT1B 1ZHNB 1A9BB 3FQRA 4LSVL 3PJSA 3RI5F 4M5YH 4PY8I 4RZCA 4JAMA 4ELMF 2V17H 5EZLA 4P2RD 2APFA 1D5BA 1YECL 3MCKA 3RX5A 2WIIB 4ISVB 2CJUH 4NOBA 3V5KA 1HXMB 2ZUXA 1LE5B 3OKLB 3EYOB 2EO1A 4XPAH 1Q72H 4QLRA 1A21A 5GHWH 5BOPA 5BRZD 1XF5B 1XF1A 8FABA 4OM1H 3T3PE 2YD7A 1U3HD 4P49A 4FQ2L 5TPWL 4L8BA 4C55A 4L8CA 4PGDB 3HMWL 1MFAL 2Q3AA 1NJ9B 5BXFA 4UNVA 32C2B 3N1GC 4PJDA 3TM6A 4ZUUB 4EOWL 4FFWD 3G04B 3U9PH 2A9NH 2NMSA 5AZ2L 1Q9WB 1EXUA 4Y2DA 4D0DB 1MPAH 2R2CA 4X99B 3LS5H 3GEWB 1P4LA 4JHZA 3PL6C 2NY7L 3FTGB 1A3RH 3REVA 2JLLA 3HRZA 2Y6SC 1M6OA 5I8KL 5L2KE 5MENE 5D8JL 1MCOL 2I60H 1LO3H 5DHVA 3V4PL 1XF3A 1EO8L 1U8LB 2BSSB 1N8ZB 4RGMC 4MVBA 2VXQL 4KK9D 1RU9H 1B0RA 1Y0LB 3SGEI 5I75B 1S7XA 4NO2A 3OWEA 3L3OA 4X6CA 4GRLC 2GY5A 2YN3A 4K94C 2WY3A 1OCWH 1I8IA 1JV5A 5D5MA 5SWZA 2GAZA 1JGLL 3VFSA 5BMFH 3SGEH 1GZQB 4O2CB 5JA9A 5JXED 1DVFC 3TJEL 3JWDH 3G6JE 3QXDA 1PX3A 1WEJH 1A6PA 5CP3H 2E7CA 3HAEG 4PP1D 5CGMA 4RNRA 2X4SB 3OF6A 4YHYC 1MHPH 2BVYA 3T3MF 1RFDH 5J1TC 3BAEH 1MJUH 3N1FC 4XVUC 2AJVL 3O4OB 2RIKA 2W07A 1BFSA 4WTZG 3GSNL 3BPOB 5ESAA 1YY9C 4G9FE 1CXLA 3MREB 3Q3GA 2OJZL 3GNML 3OJDA 1KCKA 2ZUYA 2NY0C 4CVXB 5IESL 1KUMA 2XXMB 4HKXA 3P9MB 1MRFL 5C0RL 1IQWL 12E8H 2P8LB 1NCBL 1XF4A 4HIJA 3K8KA 5B3JF 3IJHB 1BLNB 2G9HB 4G9DA 1IC7H 3V4UH 5DGRA 4D9QE 1EEQA 3WFDL 4GOSA 3BO8A 3RVXC 1RHFA 1W2KT 2OL3L 2VC2L 3WUWA 2W65B 5DA0B 2DQTH 4N9OB 4QO1A 4BZ2H 1UYWH 3PGFL 2NW3B 3C87A 4HS3A 2BNRB 4MA7L 5D7SL 1ZLWH 3MODL 1LO0H 1NGPL 4BFGA 1KPUB 5FHAH 1T7VA 4WUUA 1CD0A 5DD3L 3RX8A 4MMZC 2VDOH 5J9PA 1QYGH 4R7DB 2R4SL 4R90L 1LE9B 1UWEL 1RJYA 3DUSB 3MRPA 1OP9A 5DSCB 1CDIA 4B50A 3QDMA 4HUWB 3EJYD 5IHUH 2FWOB 3WFHA 1AR1D 3S4SA 3WS6A 4MB4A 4HG4J 3Q1SL 4NQTA 1NBZA 5DQDH 5HYSB 4Z78B 1J8HB 4PJ9C 2F74B 1GYAA 4L8DA 4JQXA 3RAJH 3ECBA 4P3CH 4WEMB 1RUQL 1R3LA 5E1AA 4ODVL 3GO1H 5B8CB 4XCYB 4E41D 1IL1A 5EOTB 2XFXA 1A6TB 2XNAA 3V4VL 2A77H 4OBSA 3MNVB 4A6YA 4ZO9A 1H0DA 4R4BB 1KENH 4PY7B 1JZ3A 4J8RA 5KS9A 2HKFL 3ZDYF 4NQXB 4Q7DA 4AENA 2HTKD 2NCMA 5LQBL 3ORJA 3VFVB 1SMAA 4RFOL 4OZHF 4MJ6A 5IMLB 4PJGB 1T2XA 5EBLB 1WBYA 4W81A 3BJ91 3MFFA 3VFUA 1BJ1H 1S9WA 2VDML 3BPLB 2A9MH 4PRNA 3AREC 3KJ4B 3FB6B 3KXFB 2VXVH 3CJJA 4GXVH 5EZJB 5LGJB 2VR4A 4OQ1A 4PLNC 4LDEB 4Y4FD 4F7PA 1RZ8B 3KPMB 4Z7OF 4I4WB 3CLFL 1RZJL 3ZE1E 1VEOA 3SCMC 3O6LL 2FO4A 4UT7H 1I9RH 1UWGH 5IFJA 4G6FB 3GKWH 3BSZL 4LBEB 5ALCL 2OR7A 3PWPB 1HEZA 2GIYA 4G7VL 6FABL 5K93A 4L4JA 2BOCB 4K8RL 5GQBA 4HHAB 5T1LD 3T0EE 3TN0A 3VU2A 3P4NB 2CKNA 2NPLX 4EBQH 2JJSA 3QXTA 4GG6E 1FGNL 4ZNCD 1OT2A 2V9TA 5DI8B 3W9EB 1OF2B 3IDGA 1K5NB 1UQSA 2YPKA 4OQTL 5AUMA 4KTDL 4PJ7A 2E8ZA 1KSRA 4RA3A 4GSDH 1FAKT 2QQLL 3EO9L 4HCRH 1DUZB 1IILE 2DBLL 1MRDL 1NMBL 2MFNA 4NO5A 2FYYA 1A4JB 3EW3B 4HF5H 1ES0B 1QSED 4X4MA 5A3IC 4U2ZA 2NZ9C 5IROA 4FFVC 1C1EH 3ZKSD 3K74B 3LH2L 4OLXH 4ZFGL 3QNZA 4MYWB 3Q6GL 5L7XH 1G9NH 1KBGL 2Z35B 3B9KA 1F6AA 5IVNA 5GRVK 4H26B 1QBAA 1KJMB 2ADJB 5B39B 1GRWA 2GJZA 4P2QE 1HCFX 2GITA 3O3AB 1DL7L 4YHIA 1J86A 4XX1E 3B8SA 4NKOB 5I16B 4HMCA 2B4CC 1S7WA 4OGAD 3ZKXB 4OI9A 1KB5A 4LLWA 5DLMH 1JF6A 1QLEL 3IU4L 2OJEA 4ZAKA 2H9GA 5EC2B 2MKWA 1CD8A 1GGUA 1IKFL 1ACYH 1VFAA 4KKCD 5L2KB 5MENB 2NR6D 1CLZH 3MRQA 3R1GH 4DK6A 2DLFL 1OAYH 5E2UH 1RZFH 2IC2A 2YEZA 1NGWB 4Q6IA 4HQQH 3VI3E 4JFPA 2H2PD 3QUXA 4MXQC 1S9XB 3OKOB 4CVWA 4E0RB 4PGBA 2BHYA 4P4RB 2YD8A 3D39D 4RMSA 3U4EB 4HS8L 2GSIA 2IANB 3S3JA 1RZKC 2YD3A 2YUXA 1R0AH 2XXCB 4ZG1A 4P23B 3TBWA 5IR1B 2P8PB 3C5SA 1LVEA 4J3SA 3O4LE 3Q5YA 4M61A 5D70H 2E8YA 4OZGA 4M6OL 4QT5B 3L3DA 1Q9KB 3ULSB 3WKNA 1CIUA 1T89C 4UV7L 3G6JB 4UTAL 2PO6C 4CDGC 1F6FB 5JOEA 3MZTA 2VNCA 5DK2B 3T0AA 3DO7A 5MEQB 2D7MA 1U91B 3NFSH 4KQ4H 2VIRA 3SKJL 4Q58C 3HHRB 3TNNA 5JW3H 5GRXG 2DD8H 2H26A 1B0GA 2YWYA 4G9FB 4QRTA 4WU5B 3TNMA 3ZDZE 4MNHB 2GUOB 3MBEB 3X3GH 5DD5L 4N1HB 1I8MB 1E4XL 2W59A 2EIEA 2XY2A 4XWOD 4IOIA 4OAWA 4XNMA 2YRLA 2ZNWA 1SJXA 5I2IA 1IEAB 2NY5L 5DEGB 1I9JL 4P0DA 4TVPE 3QA3B 3C08L 4W6XB 2NW2B 2X10A 1NEZG 2R23A 2C3XA 4FQ2H 1U95A 3MRFB 4NSKB 1T4KB 4IDJH 4NHCL 4PTTA 2OMNA 1MCNA 4P9HL 1KT2B 5DVOA 3VGHA 2IWGA 3K8MA 2CUIA 4Z9KB 1INEL 4JO2L 5FO8A 5INDB 2AW2A 4JCMA 1KELL 1WAAF 3RVWD 3BIKA 4WHTA 5HHVL 4RISH 3LDBB 4MHHG 4D3CL 4GRMB 3WD5L 3ARVA 3HUJF 3PGCA 4TTDD 5I8KH 1RSFA 5SV4A 4ETQA 2XQYK 1MCOH 1BBJA 4CDHA 3V4PH 2AK4A 3T2PA 3C09B 3FRUB 4S1DD 1EO8H 4PJBA 2GSGB 4HT1H 3DGCR 4HIEA 4Q0XL 3TJHC 4W70A 4WWKA 1TZHA 4NUJA 1R3IL 2VAAB 2K9UA 3H3PL 1QVOB 1KG0A 4JHWL 2CLZB 1G9NC 3QWOA 2V9QA 2HKHH 4JREB 3SPVB 2F8XC 3B5GA 3C5JB 2EIZA 1JGLH 4FTVD 2ILLA 1KJ3L 4MB5A 2AEQH 2FLRT 2G5BB 4D2NA 3TJEH 1J0KA 5CHNB 1I8KA 4UAOC 4ALAL 2XT1B 4C54A 1FZKA 4LVEA 1AJ7H 2I07A 4XMLL 1U8MA 3UJIL 5C3LD 4XBGB 2VLMD 2YUVA 3L1OH 3LSOA 1KEGL 3MLYL 3R8BB 1NCWL 2XTJC 3RWIB 5IB3A 1JPFA 2V7NA 2BY3A 1YEGL 2XKNB 4TQEH 4Z7VF 1BBDL 3BHBA 4UZGA 4Z0XA 5FOBB 1MIML 2P4AB 3HZVA 4ZSOA 1MRFH 4G8GD 4Y16B 4HK0B 3GI8H 1DQQA 4JHBA 4OGXH 1CFTB 4WCYL 5CIPA 5I1KL 2DIAA 4QHLB 1T1XB 5KSBF 4PUBL 4GW5B 1W72L 3IDNA 4CU6A 1MH5A 3ROLA 1HDMA 4TSAH 3U2SA 1DQJB 4R4FH 5D6CA 1GHFL 3X14B 4RSVA 2ZWLT 4L3EE 3PXHA 1HH9A 3ARWA 3WNKA 4JFEE 3DPBA 2XY1A 3BQUC 5EZIH 5JIPA 3PGFH 5DJDA 5D9SB 2NLJB 5CINH 3CFDA 4MA7H 5JPMB 5ELIA 2QSQA 5HGHA 1Q1JL 3T0EB 2CR6A 5EUKA 3VXPB 2YXMA 3ARSA 4GG6B 4KKAD 5SWQB 4JO4L 2NY1B 4JVPA 1UWEH 1YNKL 3VXMD 4QRRE 1MCSA 4LLDB 5E8OB 2BVTA 3IDYC 2QSVA 2PYEA 3ARDA 3RGVA 5C0NC 4AIOA 4YHKL 4ZXBA 3Q1SH 3S9DB 2E7BA 2R56L 3TO4C 4A2LA 1VGKA 1FFOB 2KPNA 4DQOH 2Z4QA 1JYXA 4QEGA 4M48H 2H41A 4WJ5B 1MHCB 4DAGH 1X5LA 4ONGH 5FCUL 5EO9B 1YDPB 4C56E 1X4ZA 4TUJA 5HYEA 1D5ZA 1T7WA 1RZIB 5IHZB 3B2VL 3EO1A 3DJ9A 3FO9A 3KYNB 1OAZH 3V5HA 4P2QB 4OLEA 3P4OA 3ALXA 2UVFA 3DMMC 5GS1B 2RGSA 2R2HA 5LQBH 3GB7A 3SDCB 1ZHLB 1EZVX 2X4NB 1N64L 3MLPA 3N1MC 2XWTB 3HZKB 4O2FB 1J0YA 3KLSA 3TBYB 4LSQL 5CFHA 1O5DT 2F8VA 4M7LT 1C5CL 1LDPL 4QHUA 2VDMH 2JIXD 3QO0A 4X9GA 3GSRA 1QSZA 2IAMD 1I1AB 3MYZA 3IU3A 2OP4L 5I1AB 5J0BA 2R9HC 2W0KA 3DVGA 4G8EB 1HWGB 4KJQC 4K2UH 5HHNA 4J4PC 1ZT4B 4HBCL 3CLFH 4PGZA 2VDPH 5HPMB 2QHLA 5D1XA 2GJJA 1N0LA 4Y88A 3TZVA 3DECA 4J12A 3BSZH 1X5JA 3MOBL 4QRQA 3DXAA 5ICXA 5ECJE 5EUOF 2PYFB 4MCZB 3O4LB 1S7SA 3JUYA 2M2DA 1AQKL 5FYKU 2P24A 1Y18A 3NIGF 3L3KA 1R5IB 5KBNC 1FGNH 1TFHA 4G42A 3F7VB 4O9HL 1T0MB 2IQ9L 1WCBA 4F2MB 2L7UA 4CW1B 2QQLH 5JPNB 1CD1A 3FRPA 4G6KH 5CKGA 1MRDH 1B88A 2IFFL 5K9KA 4JN1L 4QTHA 5TQ0L 4MJIE 2QTEA 1FL6A 2CMRH 3X3FL 4LSDA 1KFAH 1DZBA 3BZ4B 4Z7WA 1BIIB 3VFTB 4RQQA 1JGEB 4Y8AA 5KSUB 3LD8B 3LH2H 1FZJB 4NKQB 1KBGH 4UV4H 4YNYA 3ZYJA 3B83A 2JELL 4LIQE 2JB5L 4HS6B 2NYYD 4PJ8D 4AK1A 4Y2DC 1ZEAH 4GRWH 4OSUH 4PGCA 5IVZB 3LMJH 1II4E 2UYLA 2DLTA 4X5XB 1UB6B 2DQJL 2DL9A 2ITDA 2HJFB 3TH3T 5I1IH 3VI4F 3TH4T 5LAXB 2E7MA 1DN2A 1A6UH 4MZ2A 4XBPB 1FG2B 3MCLL 3FB5A 4PREB 3HE7D 4BZ1H 1C16B 1CGUA 2QLVB 4EIZC 3ARRA 3EOYG 1BEYL 4WI8A 5HHOE 1DE4B 4XNUL 4FQIL 4PPTA 3LQAH 1LP9A 4MVBC 4I5BA 3TWCL 3TCXA 4OT1H 4U7MA 4GW4B 1KPRB 2BXYA 4YBHA 1CDUA 1EZVY 4JO3L 4NRYB 3V52H 3IVKB 2VL4A 1S7QB 4FQHA 4J2XA 3UPCA 5T33L 1IT9H 2AP2A 4QF1A 4KZEL 3VCLB 5ITBH 1RJZA 2XWJB 3HLAB 2VABA 3IAQA 2YBRB 4NZRL 5CEYA 4HS8H 4BK4A 2N7AA 3RQ3A 2YPLA 3CZFB 2CDEA 5IVXE 5I66B 3HTLX 5I1LA 3CVHA 4GKOA 3BMVA 5F6IC 4M6OH 4ZOBA 3TESA 2EDJA 5FUCE 5DMKB 1TMCA 2HFFA 5EN2B 4HFWB 4YGVB 2WBKA 1CG9A 4OFVA 2ICEB 3CC5A 1K2DA 3SE8L 3B9EA 5BQ7A 5C09E 3GSWB 2PW2B 5FXCH 3QJFA 4MWFB 5HHQB 5DTFA 1FCGA 2F8OA 2X4UB 4E42A 1FORH 3M8OH 4RCAA 1ACZA 2DQFA 3P4MA 3U4AA 4QHMB 5AZEL 2A1WH 2V5YA 3ARYA 1HH6A 1NUDA 3QJHB 1QBBA 5DD5H 3L5JA 2W1NA 4TUOB 4X8JA 3LAFA 3DX7A 1YNLL 5FA3B 3W39A 2NY6C 3RNQB 1ZXQA 4JRYD 2B39A 4DVRL 1ZGLP 2P8MB 3RL1B 2X41A 1PQZA 4NHCH 3VXTB 3LKOB 3WJJA 1FC1A 3CFEB 5KTEL 1KN4L 4ZYKA 3IDJB 4KJWC 4Z8FH 3FHAA 4L3EB 4JFEB 4FTVE 5EDXA 1UM6H 2X2YA 2NX5D 3L3IA 3CUPB 2YD6A 1JWUB 3I2CL 1JWSB 5C07D 4RAVA 1I3VA 1F4WH 3RWJB 3WS6C 1ETZB 4CKVX 3FT2B 2VN7A 1KXTB 4JQXC 1OAXH 4XNQB 1X3DA 3ULUF 3OKDB 3PWLB 5FO9A 4JY6A 5JOPD 5F96L 3IKKA 3VFPB 3GSUA 1T21A 3WUWG 4QRRB 3UXFA 1MQ8A 2WQ8A 1GIGL 2HLFC 2CIIA 3UPAA 3LN9A 2W9LA 1AGCA 3OXRB 2K3TA 1RUAL 1DBAL 2HT4D 1MWAL 3TT3H 5DDHB 4OLVL 5I76B 4XAKE 1BFVH 2VXUH 4WWID 4W6YB 3O2VL 3QEHB 2X4PB 3L3JA 1I3RB 3SOBL 1INDH 3QPXL 2F19L 2AV7A 3P40A 4C56B 1CICB 5BOZG 3S36L 4DZ8A 3WJLA 4GG8B 5DT1L 2PTTA 2ZCKL 2AXGA 1EJOL 3DWTA 3S4SG 4ALAH 3IFOB 1ZA6B 5ACZA 3KPLA 2FX9H 4XMLH 4ZNEA 4OZIF 3QUML 4NHUE 2RJMA 5T5FL 4O58H 3UJIH 4OUUB 2DM4A 5EA0H 3FHQA 3U7WL 3ZKMD 3MLYH 2MQCA 3MQIA 2ESVD 3KR3H 1QEWA 2ARJB 4L8SA 5E8NB 1LO4L 3GSVB 3PDGA 1FZMA 3PQYD 3FQXB 4MNQA 5FYLD 1CT8B 4BQ6A 3SJVE 1GAFL 1BBDH 3VXME 4NQSB 1SY6L 3SO3C 3RKDC 4FP8H 2YPVL 3HI1A 1T04A 4OZ4B 1HI6A 3ALPA 5I1KH 1NAML 1JL8A 1R3KB 4PUBH 1ZGLB 2HYMA 5IG7B 3TN0C 3GMRB 2Y4SA 4YHPA 2JJSC 4UQ3B 1L7TH 4AEEA 3CGTA 3CFCH 2RCSL 3IDXH 4H88H 1AP2B 2IQAA 4UIMA 5E8PB 4KMTL 2HFTA 1I8LA 1B6DA 4WFEE 3HB3C 2ICES 2AJ3B 3UP1A 1OWWA 1YQ2A 3VXQB 3CD4A 4EQ3A 5F7EL 3JTCA 2VLLB 3GMNA 5IROC 3U7AA 3B9VA 1P4IH 2R2BB 2JK5A 2W0LA 4PRIA 2HTLC 3B9KC 5F9WC 1GL4B 4XBEL 1F4AA 3F12A 4MJIB 4YHKH 4CU7A 4H25A 5JNYA 4JFQB 2WM0A 5D7JA 4P4KA 2A38A 3MGTA 4X6BB 5F7FA 3LKSA 3MRLA 2ORBH 4K3DL 4KJPC 4PJHA 5CEZL 5C0CD 1K6QL 4ZO6A 5D96B 2EDNA 1V7MH 1FYHB 2F5AH 4DUVA 4NKMB 4IOFD 3GJFK 4K3HA 4I48B 1T3FA 2HRPH 4U6XB 3MLVH 1S7VA 4OZIB 5DJ8A 3BIAX 5I30H 4JKPL 5EC1A 1C08B 1CLOH 1W8OA 3SE4A 4O02L 1INQA 4U1LB 4I9WE 1RUPH 1MVFA 3HC0B 4XPHL 2IEPA 8CGTA 3S88H 3VD5A 1OW0A 3MRJB 2XPGA 5DJ0B 3TGXA 1NUNB 2VWEC 2EYRB 3FFDA 5HHOB 3OB0K 4Q6IC 3ARGA 5JHLL 1G1YA 1LDPH 3I3BA 3QUXC 2MNUA 2C4XA 3VRIA 2MCPH 3GMQA 3GI9L 2JJTA 5T5NF 5GSVB 4NO0B 2OP4H 1UZ8B 4CN6A 1C5BL 1TVBA 3NCEB 1X6NA 4DVBA 3FONA 3QIWB 3G9AB 5J1AA 1OWRM 5LCVL 2IBGA 2GEEA 3IFNH 3U83A 4Z76B 2R1YB 4CMHC 4PJ5A 1U8OA 4EXPX 5BS0A 4PLOB 3CDFA 2GK2A 4XCNB 1I1CA 4U6HB 4TSCH 2VB5A 2A6JB 5KVGH 3VA2C 5MEOB 3MRKB 3WL9B 5IVXB 3PXJA 1IAKA 3CU7A 3BP7B 4JB9H 4NCC1 4RMWA 3VGGA 1HHGA 5EU5B 4JZJB 2IQ9H 2F53A 5T1MB 4ODHL 5C09B 4PD4K 5T3XH 1F2XK 3BW9A 3ESVF 2VUYA 1GOFA 4KI5C 3GUTB 5TQ0H 4FN0A 3UTTA 3O9WD 5TDOA 4K3JH 5E2WL 3GMPB 2NTFB 5F8RC 2QR0B 4OZFB 3LKQA 5F7WC 4JRXE 3PHQB 2VAJA 1FE8L 4RWHA 1VENA 3IXAA 1H8NA 1HKLH 3TBSB 4P5TD 1LO2L 1ZT1A 2QADC 1ZHNA 5A2IH 1X7QB 4MS8D 2JB5H 4Q2ZB 5DMJB 3MLWH 3QIBD 1N7MH 5HHPB 1FO0L 5KJRL 3S3PA 2ZG1A 2WIIA 4ISVA 2B2XL 3KYAA 4KHTL 2D9QB 3IFLL 3DSFL 4FTVB 1LE5A 1J0ZA 3OKLA 3EYOA 4Z18A 4P5KB 5C0GB 5H35B 4M62H 1W8NA 5EWIH 2O5ZL 1HIML 1XF5A 2EECA 4WWKC 1EIBA 3EFDL 4HWBH 2UZYB 4QXGH 1NJ9A 4NJ9L 4QOKD 2DJ4A 1DLFL 4TOYH 4ZUUA 2KQMA 3G04A 3UJJL 1OTUC 4NCDA 1WGOA 1Q9WA 5GGVL 4J3XA 4D0DA 3T4AB 1FL3A 5EG6C 1IM9D 5I71C 4X99A 4Y2OA 1BVKB 4P3DB 5KSVB 3WO4B 1F42A 3FTGA 1S7TB 4OLZH 4OTXL 4QNPE 3SKOB 3RZWA 3OG4B 3GHEH 1BWWA 2FEDC 4F58L 1EK3A 3L7EB 3PV6A 1U8LA 2BSSA 4YJZL 1N8ZA 4Z95H 3IRPX 1MNUL 3OAYK 4NP4L 3GRWA 3WIIL 5I15H 1C7SA 2BY0A 4NHUB 4HPYH 5FYKH 2NX5E 4W68A 3DLQR 4BQ9A 5HYQB 1KYOK 1I1RA 3TA3D 5L6YL 1OB1B 3G5YB 1GZQA 4I1NB 1JHKL 1FQ9C 4PB9L 2ZSWB 3OB8A 3SJVB 4KK5C 2X4SA 3O2DL 3MJ6A 3VXMB 1ZA3B 1EERB 5HVHC 2VMFA 3D69B 3JVGA 3SDYL 1A7RL 4EVNA 3VFRB 1Y6MR 4L4TE 1MHEB 2BZDA 2UVEA 1XF2B 4N8PA 3T0DA 4OCRH 4YH6A 3L6FB 3ULVL 4MCYB 1KN4H 3MREA 4LPWA 4LSSH 4DEPC 5E9DD 3F7QA 2WWKT 3MR9B 5T1KB 5TF1L 4DGIL 3P9MA 4NN6B 3WNOA 2P8LA 5ISZD 3ARDC 3RGVC 4WW2F 4ERSL 5IB2B 2CRMA 4ZXBC 1U8NB 3IJHA 1BLNA 1FDLH 2YKLL 5CBAB 2G9HA 3G5VB 2AJYH 4K8RD 1CYGA 3D3VD 3U79A 2DB8A 3BESR 3FT3B 3QYCA 2W65A 3KYKL 4M6ML 3NZHH 5HHME 2NW3A 3BEWA 4HKZB 2IMNA 1XH3B 4KK8C 4MA1B 2BNRA 3OX8B 3CVHH 3VD9A 3PHOB 1KPUA 5ITFB 1MWAH 4JGMA 4N1EA 2UZXB 4OLVH 3AS1A 3RTQD 3LS4H 5CZXD 1JJUA 4F7EB 2IPKB 2J1KA 3O2VH 4R7DA 1LE9A 5F9DC 4ORZC 3SOBH 5HYJD 3DRQB 3S37H 4UI2A 1HWHB 4PRPD 2MCG1 4U1JB 3DUSA 5JO5B 5DT1H 1PDKA 1CTNA 4HUWA 3FFCD 3TVMD 4OJFH 3BPCA 5HGGS 1EJOH 3V2AR 5IJKA 5HYSA 4M7KH 4Z78A 1J8HA 2F74A 3THML 1XR9B 4X5WB 1UJTA 4NN5C 5B8CA 4XCYA 2DN7A 3O8XD 3U7WH 5EOTA 3N9GL 1WFOA 1A6TA 4YE4L 4U4BA 1FYTA 3MNVA 1U2CA 4R4BA 5I8OH 1LO4H 2BHZA 4PY7A 1NBYB 5D1XC 3RBSA 5KOMC 5D7LD 4LDOB 3LPGA 3TZVC 2E27H 4NQXA 1TPXB 3VFGH 1FNGB 2Z9TA 3VFVA 3N85L 2YPVH 2H6PA 5J13C 5IMLA 4PJGA 5EBLA 1NAMH 4ODWB 2AJUH 5GSRB 2PXYB 4WW2B 3UTPE 3FB6A 1QSFE 3KXFA 1Z6JT 1JN6B 1NFDF 2OR9L 3BZDA 5EZJA 3LN4B 4H8WH 4K07A 1E4JA 2AEPH 5JMOC 1CIDA 5IBTL 3LEYL 3LB6D 1RZ8A 3KPMA 1BJ1J 4I4WA 3MGAA 2VERN 2DJSA 5EU6D 5DK0B 2XOTA 4XAWH 3MX0A 3S35H 1NMCB 4F33B 3HE7B 4JGJA 4LBEA 1LGVA 1EHLH 5DZLA 5IMMB 4EDWL 3PWPA 1KIPB 2EDYA 4XBEH 4NZTL 4V2CB 5DQ9B 4QTIH 2BOCA 3JZ7A 4HHAA 5H8DA 1RJLB 2Q8AH 2VZTA 4RX4D 5ADPH 3P4NA 2VDNH 2M8XA 4JRXB 1B3JA 2X70B 5CEZH 3KS0H 4WFGE 1LQSR 4R9HA 5DI8A 3W9EA 1OF2A 1K5NA 1H3PL 1BQHB 1DN0B 4M7JL 4QXUL 5C0AE 1DUZA 3FRPG 4AYFA 3OAZH 4HGMA 4JFFD 4GMTL 4EI5B 2CLRB 3PWUB 1RUKL 4FXKB 5F1IB 4A6YL 1YEDB 1I9IL 1TQBC 3PP3H 1OD7A 4HWEL 2Z35A 5FHBL 1UM5H 5MHSD 4O00A 4WI3A 3OKNB 4OM0H 4XCFL 4H26A 1KJMA 2ADJA 5F7MC 5B39A 2ED9A 3RVTD 2XRAH 3GI9H 3O3AA 4S1SH 1A7QL 2DQUL 2BY2A 4JVUA 2DMKA 3RKPA 2R0WL 1IC1A 3C8KB 4NKOA 4WHYH 3VG9B 4NCC2 5KG9B 1V3JA 5DHYB 4NRXB 5HY9B 4C83B 4U1MB 1CE6B 5EC2A 5FKAB 4APQB 4GFTB 1CBVH 4AEIL 2EDRA 4R7NB 3S8WA 4I3RL 5MENA 3RP1A 2WBJD 1JZ6A 3OR6B 2V5TA 5F88B 1FV1B 2VQUA 4LOUD 3NA4A 4Y4HB 1NGWA 3S37X 1S78C 5MI0C 3OKOA 4E0RA 3QNYA 4P4RA 1XGRB 2D3VA 3U4EA 3ZE0E 3LKPB 1KC5H 4G5ZL 3D6GA 4WV1A 2NX5B 2OQJB 3HCVB 3SGKC 4H0IA 4P23A 5IR1A 2P8PA 1H3VA 1VESA 3QUYA 3RNKB 2J12B 3CXDL 3STLB 2YD4A 4JLRB 3WSQL 4NOFA 1RV6X 3EFFB 4YHLL 3QUZD 3QWRA 4LKCB 1J1PL 4QT5A 1Q9KA 4JO1H 5DO2D 2YA0A 4HULB 3QUKB 3G6JA 1FE8H 2XWBB 1CR9H 3VFWB 2ED7A 3NACH 3WJJC 1S5IH 2VKXA 5DK2A 1YNTB 3MJ8B 4GAYB 5MEQA 1K9TA 3NCFB 1HNGA 1NKOA 3CMGA 1U91A 5GS0L 3QHZH 3TPUE 4L4TB 2CO7B 3JWOL 4PLKD 4POYA 1FVDB 4G9FA 4WU5A 1A6ZB 4MNHA 3T8XB 3D9AH 3C2AL 4KHTH 2GUOA 3V5DB 3MRHA 1I8MA 5C0IA 2DTSA 2JB6B 1DEDA 1IEAA 4J6RL 1CXEA 4MX7B 2OTUB 3U46B 3BPNB 3QA3A 4FQLL 2NW2A 2O5ZH 1HIMH 5EZOL 2CRYA 1EFXD 1YY8B 4ACPA 4NSKA 1T4KA 2KL6A 1KB5L 1I7TB 3UTSE 1T66C 3RDTB 5D71H 1KT2A 3ZL4L 4OGYL 1TETH 4LHUD 3B3IB 3QXAB 5HHMB 1MREL 3VWKA 1VACA 3MBXH 3WJLC 1C7TA 5GGVH 1XR8B 3S35X 5C7XH 4GRMA 5I6XC 1L6ZA 3FB8B 3BKCL 2VE6B 1TJIH 2W60B 4I3SH 4ORGB 3U7YL 4U6TA 4KKBD 2WP3T 2X4OA 1XAUA 4BUGA 4PJFF 1GJIA 2PR4L 4JRWA 3FRUA 2BRQA 2GSGA 2MSPA 4Y5VB 3CCHB 4L8SC 3V7AG 2Y6SD 2HMIC 1MNUH 3FMGH 2QQKL 1QVOA 3WIIH 1WJ3A 3IJSB 3H0TB 1Q94B 4KTEL 1BIHA 5E08L 2CLZA 4HAFA 4F57H 1HOCA 3L3HB 3C5JA 4YDKH 3R8QA 2DI7A 5D7IF 1NFKA 5I9QC 2G5BA 3LKNB 4OCYL 5CHNA 4PB9H 3OKMB 3D3VE 1IARB 1OD9A 2WLZA 5FYJD 3O2DH 4GRLD 4KAQH 5IF0B 3X11B 3SDYH 4J23A 4Z7UE 1DVFD 1I8LC 5IHBA 1JE6A 1A7RH 1EAJA 4HV8B 1NDMB 1MCQA 1YMMA 3NH7L 4IIQB 3N06B 1FFQA 4JM2B 4KWUA 3BDYL 1V7NH 3ULVH 3RWIA 1K8DB 3MO1B 4XNYL 5HYJE 2XKNA 1QSFB 4P59L 4XP1L 3FQTB 4HW6A 3SEPA 1VFMA 3QG7H 5M94B 3WFBL 5FOBA 4UIKL 3FFCE 4Y16A 3WIHA 2Y5EA 4HK0A 4GBXD 4QRSA 4UU9B 1YY9D 1CFTA 3WIFB 1DBMH 4QHLA 2Q7YB 1T1XA 3NIDE 5D7JC 5IEKB 2RHEA 4GW5A 5ID1B 4P4KC 3PIQB 4OCXL 1HSAB 2NY0D 2UV3A 4PDCE 4U1NB 2PCPB 1IC4L 2B1AH 3QFDA 5KAQF 4L4VD 1P5VA 3GMLB 1AXIB 5I74C 2CDGB 5DR5L 3TIEB 4WHYG 4RWYH 1W0VB 1NSNH 2R69L 4M6MH 3MLTA 3P0GB 4FMKA 1GVIA 3LRGA 5D9SA 2NLJA 5LBSL 1DBKH 5JPMA 4FQ1H 4H20L 1P7QB 2XACC 4KUZL 2XKSA 3T0EA 5E99H 3V6ZB 4LLYB 3VXPA 3RVXD 5I8EA 1VSCA 1AGEB 4HK3N 5SWQA 4GG6A 1ADQL 2DF3A 3SE4C 1N5AB 1R5VB 1A5FH 1EGJL 1G7MB 2RQ8A 1UC6A 2P5ED 4WFFD 1V05A 4LLDA 5FM4A 4U0RC 1G7IA 4DKEH 5E8OA 5C0AB 1OW0C 3N1PC 4WU7B 4PD4J 3PHSA 2EDKA 1MFBL 3ARGC 3D2UD 4JFXB 4M9PA 1OGTB 1FFOA 5SX5H 3FO0L 5HD8C 5HI5C 5IGXH 2JJTC 4UILL 4WJ5A 1MHCA 4IRJD 4JZOB 4WO4A 5GS2H 5IB5B 5EO9A 1YDPA 3CSPA 1ED3B 4OLUL 4TVSa 4V1DD 3QEGL 4M1GL 1RZIA 4PJ9D 3M17B 5IHZA 3MRRB 5HI3C 4JY5H 4GAJH 4DTGL 4HSQA 3KYNA 3U1SL 3HG1D 2BRRH 4P2QA 4XP6H 3ALWA 4RBPK 5DMYA 5D2LE 3OL2A 2KUTA 5JTWA 1OSPH 5A1AA 1BQSA 3SDCA 1ZHLA 2VDLL 2X4NA 4LEOB 1TXKA 2XWTA 3HZKA 4O2FA 3O9WB 3TBYA 4GQ9L 5ILTH 3MV7E 2DWDB 5DMGC 5I0DA 3ELAT 4LVOB 3MGOB 4JJ5B 3UX9B 2GKIA 3HNSL 3Q48A 5E5MA 2EXYC 3QEUB 1CE1H 4P46B 1I1AA 1LNUB 3PGDB 3CK0L 1KLUB 1BF8A 4RMRA 3DRTA 4WEBL 5GPRA 3H3BC 3ARUA 3LEYH 3OTTA 5E8DH 2R0ZL 4KPHL 1WISA 3ARED 1S3KH 4RFNB 1CFQB 2ZUQB 4J3UA 5HPMA 4M6NL 2FGZA 3MNWB 1Z3GH 1B0WA 3MJ9A 2YRZA 1AI1L 4YXKH 5MHSE 1X5XA 3QB7C 1IC5L 2VITB 3H9YA 2PYFA 4MCZA 3O4LA 1NLDL 2EZ0D 5JORB 3SCMD 3VH8A 3AB0C 3IDUA 4F7CB 3I6LD 1H3UA 5K9JL 1JZ7A 3LCYA 1R5IA 4D0BB 3DUUB 3RVUC 1KJ2H 3VXUD 4F2MA 4Y1AD 2GTWB 4CW1A 1L9NA 4QXUH 5JPNA 1RZGB 5IVOA 4R3SB 3P77B 4MSWB 3FQNB 3TPUB 1I4FB 4YEFA 7FABL 4GMTH 3C6SB 5DFTA 1KYOJ 5A2JH 1J8KA 4D94A 1X5KA 3L7FB 1RIUL 3BZ4A 1BIIA 1H3TA 3VFTA 1JGEA 5EU4A 5KSUA 4Q6YA 1FZJA 2F54E 3D5OF 2WMPA 4ZUSB 1U3ZA 4XI5C 4KH2A 3PWNB 1PLGL 4KRMB 4HS6A 1OLZA 2WIMA 4KKLC 5GGTL 5A3ID 3A6BH 2BVOB 2NZ9D 4FFVD 1XGYL 3BOVA 5IVZA 3QCUL 3UTSB 5IQ9B 4H0GA 2DQUH 1UB6A 2HJFA 3EDEA 5LAXA 5C86A 4XBPA 1CDYA 1FG2A 4ODSH 5LWYL 2Q3ZA 4PREA 1RMFL 1C16A 3DYPA 5TQ2H 1KNOB 3KJ6H 2XZCL 1DE4A 3SBWA 2Y9RT 1Z9SA 1DLHB 1MQKH 4GW4A 3LY6A 4AEIH 5KVDL 1KPRA 1PG7L 4HZLB 2VZUA 2LE9A 2IH3B 5I75C 4NRYA 4MJ4A 3IVKA 5CJOH 4NQDD 3VCLA 3TYGL 2XWJA 3QQ4B 3HLAA 2FO1A 2YBRA 3OKEB 3FZUC 5E70A 5EOQL 2KQNA 1TJHL 2LVCA 2Y25A 3FOMB 4XVJL 1IZJA 1PFCA 5GGVY 4HH9B 1B4JH 3CZFA 3FAWA 3PABB 3B4NA 3DVNB 3JVGC 5I66A 3DV6B 3HPLB 4MXQD 3G6DL 3VG0L 1IEBB 3LHPL 3O4OC 1J1PH 2HH0H 3D85D 2IFGA 5DMKA 3D3VB 3BPOC 4HFWA 4YGVA 2ICEA 3C5ZD 3D0VB 5JXAH 5F89B 1S7RB 1QLRB 2E7LA 1A3LL 3GSWA 2PW2A 4H1LB 4L3CB 5HHQA 1J87A 4MWFA 4Z7UB 3MLUL 2WAHA 5HGDB 3HNTL 2X4UA 2PO6D 4PJEE 4XB7A 3SQBA 2NY3B 4QHMA 5E7FA 1WWCA 3JWOH 4NNPH 4UOW1 4HXAL 4PV8B 3N1QC 2C5DC 2DQDH 1JZ5A 3QJHA 4XHJC 5F1NB 3DVFA 3EIFA 5CD5C 5HYJB 1G6RL 1R5WB 4YBQC 3ZT6A 4TUOA 2APVA 2ZPKH 4TRPL 4OFYD 2JCCF 2HFEB 2R1WB 3FFCB 3TVMB 5FA3A 5J89A 4GKSB 3KYOB 1CLYH 2G60H 3RNQA 5EZOH 1G7HB 3HNVL 2P8MA 4LSTL 3VXTA 1P4BH 3LKOA 1TZGL 3CFEA 3ZL4H 3IDJA 5IUSA 3O8XB 3H9SE 4K9EC 4L3EA 2I5YL 4JFEA 5IIEB 3EDFA 1X5FA 3DUHA 3E3QA 3CUPA 1JWUA 1JWSA 5GGUB 3RWJA 1ETZA 1QBMH 3FT2A 5IJKC 1A4KB 3NAAL 1LEKB 4JFZL 5GZOD 3O6FA 3BEVB 4XNQA 3U7YH 4ODTL 3PWLA 3VFMB 3FN9A 3VFPA 1IGML 1FNEB 3BZFA 4QRRA 5B8CC 1UENA 4JFDE 4DJMA 4P5MB 4LSUH 4UNTA 3OXRA 2UWEF 5BO1L 4PLJC 3PWJB 4X6FB 4JPKH 5DDHA 3VXSE 4JM4L 3QIUD 2QQKH 3GIZH 1A2YB 5I76A 1NCNA 4RIRB 3WKML 3AUVA 5E08H 5F7UA 3QEHA 2X4PA 1I3RA 4FQPA 4C56A 1CICA 3Q5TA 5CWSB 4LPYA 4GG8A 5ABDE 3RZCA 1BF2A 3ILPB 4JKWA 1ZLUK 3BYYA 4I77H 43CAA 3VD4A 1YPZF 1ZA6A 1NLBL 4HUXB 5D2LB 2GT9B 1FFNB 3T09A 4OUUA 3VFOB 3STZB 3BZEB 3CFJB 5IJVB 3TF7A 3MV7B 1HYSC 3BKJL 1J5OL 5JW4N 2ARJA 4OKVB 1D5XB 5DEFB 5E8NA 5IB1A 3TCLB 1FLRH 3GSVA 3FQXA 1E27B 5BV7L 4P59H 2P5EE 4NQSA 2YS4A 2ZJSL 3WFBH 2F5BL 1SJVA 3AS0A 3EYUH 1J1XH 2XTJD 2OI9B 2AI0H 4FFZL 4XMPL 4EZMA 2E9BA 1R3KA 1ZGLA 5IG7A 2OTWB 1CS6A 1X4YA 2FHBA 3GMRA 4I0KA 1IC4H 4OCSH 4G43B 5I73B 4C4KO 4UQ3A 5IQ7L 1JPTH 4DKDC 1MVUB 4PJCF 4WI2A 1IGCL 1AP2A 3VRLE 5E8PA 2CDFB 4PBWD 2CLVB 5LBSH 1GC1H 4WNQB 5K9QI 1JBJA 2AJ3A 3D87B 4ELKA 3VXQA 5JIKA 1ADQH 3W0WD 3BQUD 3H7BB 5BZDB 1EGJH 3ES6B 5GZNC 5TE4H 2VLLA 1XZ0B 2R2BA 4LEXL 1ZT7B 4MDJB 2FBOJ 4N5EA 5HYIA 4OLYL 4MJIA 5ESVB 4CAGA 5E8EB 1L0QA 4I0CC 2X5PA 4JFQA 3WFEH 4WW1A 4YO0B 4X6BA 1T7XA 3RWGA 1IFHH 5ESQB 2B1HH 5C2UB 2C7UB 2YUZA 4ETYA 2F54B 4NKMA 1TZIB 5C0ND 5I8CB 2XKUA 4I48A 4U6XA 3KPRD 3OPZL 3TO4D 1JNNH 5DUPL 4BM7A 1Q9LB 4JG1H 2EH8H 2J8UF 4HIXH 4DTGH 3U1SH 3ERYA 1HSBB 4DGVL 1C08A 1OQXA 5JQ6H 3GM8A 4U1LA 1H8OA 1N4XH 5D1ZB 3QEQD 1L6XA 2YXFA 3BH9B 3MRJA 4KHXH 3H6JA 3QUZB 1UCTA 5DJ0A 4PRHA 1E4WH 3I6LE 2EDEA 3HNSH 3MUY1 5HHOA 4MDIA 1AGDB 4HJGB 3DMMD 1FAIL 5B39G 3F7PC 4DW2H 1DSFH 1U8IB 4WV1C 3QRGL 4NO0A 3ZLQC 3DTXB 5D93C 1KXVC 4P23C 1SEQL 3OJ2C 3QIWA 2V2WB 3QUYC 4WIQA 4YHML 1DQTA 1M7IB 3T2QA 3ULUL 1CWVA 4QRPE 4Z76A 2R1YA 4B7LA 1N3NB 2DMCA 4GW1B 3SGJA 3FQWB 1W72B 2R9HD 4LQ1A 4XCNA 4RFEB 4U6HA 1OGAD 3GMOB 4KJQD 3T77B 2A6JA 4J4PD 5MEOA 3WL9A 4P9ML 1GGIL 5IVXA 3HE6B 1TJGL 4TUKH 2ZKHH 3BP7A 1EFXB 3GBMH 2CKBL