3UPRA

Hla-b*57:01 complexed to pep-v and abacavir
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
275
structure length
275
Chain Sequence
SHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRMAPRAPWIEQEGPEYWDGETRNMKASAQTYRENLRIALRYYNQSEAGSHIIQVMYGCDVGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, B-57 alpha chain
publication title Drug hypersensitivity caused by alteration of the MHC-presented self-peptide repertoire.
pubmed doi rcsb
source organism Homo sapiens
total genus 77
structure length 275
sequence length 275
chains with identical sequence C
ec nomenclature
pdb deposition date 2011-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3uprA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3uprA01
4Z7NF 3ZT5A 1MLCA 1JGVH 1OLZA 3LEYL 4LCCC 4J3UA 5ESAB 4KVNL 1MCQA 2HP4A 2P42B 1GRWA 3L5WA 1T0PB 4LEXH 5D1XA 4PG9B 3PG2A 3O2WH 2P8LB 3EO1B 3AM8C 3NFNB 2X9WA 1GH7A 4YWGL 3BT2H 2UY6A 4TQEL 4GMSL 3L3JB 5HHOB 1F97A 1JN6A 1CICD 2IANE 3UYOD 4U33A 2BNQB 4S2SB 1T7WA 2J6EH 4GG8A 4EUPB 3BUYA 4JM2C 1EZVY 5CWSA 5F6IC 3QG7H 1HH9B 3CVIH 4Y2OA 4OFKA 3X3FH 2J8OA 2OQJA 5CGTA 1TVDA 4Z5RA 1AH1A 3O6MH 4XAKE 1AJ7H 1BZQK 1T0NA 3CC5B 4QCIA 4X80L 5J89A 3MRFB 3WD5H 3QHFH 1NCTA 1Q38A 1G1CA 4JFHE 4G43B 3HRPA 5F7KC 4LVHC 3TIDA 2HRPL 4CVZA 5F7LB 4PJAB 2CO7B 2R1XB 4Q9QL 5HGDA 4HS3A 4Z18A 4YR6A 4MSWB 4G9FE 3VG0L 1R3LA 3OR7B 3F12A 5GSVA 1GCFA 5KJRH 4HUNB 1EO5A 3LDBB 4I8DA 4F7TB 3MGTA 3DMMB 4HMEA 3H9HB 3AS2A 4I1NB 3MJ9L 4C55A 1HYSD 1KN4H 3HR5B 4OLXH 3TM6A 1I8MB 4PJ5D 1MHPL 2GHWB 2R0WL 3C6SA 4MNGB 1LO4H 3MSPA 5FGBA 3ULSA 4N0UB 3CSGA 1LNUA 3S6CA 3UC0H 1T04A 4NN7C 1XF4B 3JTSB 5FHAL 3RJDA 4ZD3H 3SJVE 2QKIA 1FZJA 1P4IL 2W60A 3WN5B 4O02H 1Y6KR 4KRPC 1P4BH 2HVJA 4ONOA 4W68A 3L95A 3BE1H 2AJSL 2QQLH 4CUCA 5DDHA 1DJSA 4PV9A 5CSZA 1MPAH 2R29H 3QIWD 5FGSA 3FOMB 4L4VB 5SX5K 3UEZA 4K94H 1FL6B 5J57B 3MJ8A 3WS3A 3NA4A 3QT2A 3VFRA 1YNLL 4CNIB 2VJXA 3LIZL 5KSAD 2NY5L 2NY3B 3HC4L 2KH2B 4JB9L 2P24A 1DBKH 3AS3A 3P11H 4M7KL 4UU9A 1AR1C 5GIRB 4QRSA 3PGDA 4XCFL 3I6GA 3I3DA 3MRQA 2HT4D 4M9PA 1MJ7L 5B3JE 2H41A 4L8DB 2IG2L 3MRIA 5ANMA 3WSQL 4R7DA 3Q6GL 3DO7B 5JIIA 3P73B 3E2HB 1I85C 5FOJA 2I25N 1ADQL 2P49B 2I07A 1IGYA 3BN9C 1CFQA 5KS9B 1G7MA 2QSTA 5HHMB 3EJJX 1N7MH 1IAMA 3B43A 5HI5D 2DM4A 4XPGH 1XIWB 1K3IA 4OCWL 5JLZB 5HYSA 4RAUB 1S9VB 4Z0BH 4GT7A 3RKDC 2D0GA 3LEVH 2CGRH 4G42A 3Q1SH 3BN3B 4Y4FA 5BCAA 1YEIH 4NYLA 4KY1L 1NCCL 4PLOB 4JJ5B 4Z5RB 1S78C 1SHMA 4FFEX 1BFSA 1I9RH 1SEQH 3WFEL 1CFNA 2P7TA 5DTFA 1ES0B 3GEWB 4JAMA 2FHBA 3QBTB 3TCLA 5IB3B 4OZIA 4PRBB 1XH3B 5IVOA 1A3LL 5FM5O 4F7MA 1EEZB 5L2KE 1PKQE 3OJDA 4P23B 5D6CB 3QXVA 1R3LB 3NVQA 2DTML 5GSVB 2RAMA 3WKNA 2AEPL 4O00A 5CIPH 4JREB 3SQOH 5K33A 4MB5A 3I6LD 4OAWB 1IAKB 4F9LC 4N9OB 2VB5A 3C6SB 5EU6A 4NNXB 3OKNB 5J6GA 2HFEB 1OAUL 4LLDB 1QFUH 3PDOA 3PIQB 4I9WD 1T04B 5KVEL 4NIKB 4F80A 3AREA 2VZTA 2ZZUT 1AC0A 2DLTA 3T2NL 2W60B 4Y2DB 4U6XB 4JFEE 4JDTH 3UO1H 4JPWL 2DYPD 2EZ0C 5DDHB 1UB5A 4H25A 4PV9B 5I0DA 5E7FA 1NC4D 1JWSA 5IJKA 4MX7A 2OXHA 4JANA 4G5ZH 4XP9L 2APXA 5C8JA 5J9PB 4PJ7B 2O5ZL 4D8PB 3ARBC 1NCBH 5DWUL 1WCQA 4HF5H 5TE4L 3LVEA 2XNAA 3CFCH 4OQTH 3PP3H 4LGRB 1FQ9C 2I26N 3MV8A 1ED3B 5TDNA 1MWAA 2UVFA 1L9MA 2QQKL 2VXTH 1IC4L 3GMMA 4YHZL 1NFIA 4QRSB 1Q9KB 1OTUC 4WU7A 4XPBL 5IW6A 5I75B 4TOYH 1IGCH 4I0PD 3KGRA 1BEYL 1XGQB 4YHMH 2P48B 3MRIB 4NJ9L 3HI5L 3RWCA 3HE6C 1B4RA 3OG6B 1QZ1A 3PWJB 4P5KA 5DJXB 1L9NA 1TCMA 5DJCB 1Y18B 1JCKA 1MCNA 2DJ4A 1IGYB 3CFKA 2QEJA 5ESVA 1G7MB 1AP2B 2OP4H 2YMXL 3D5OF 1KENL 5E5UB 5MHSD 3CFEA 4BFIA 5HYSB 4HXAL 2EYTB 2O5XL 2G75B 2WWKT 4G42B 2HT3D 5HHVH 2ZG2A 4NYLB 5K59F 4HWBH 1U9KA 2PO6D 2IEPA 4K55A 2XN9A 2HTKC 1MFBL 1FVEA 1ZS8B 4PRHD 5D5ME 4YHYB 1LK3H 3F58H 2BCKA 4OFYA 4Z9KB 4CRPA 3MRMB 4YC2B 4UV7L 2CQVA 1M4KA 2IBZX 1RUMH 4ZSOE 4PR5A 1CFNB 2P7TB 5DTFB 3TZVA 1HWGB 5HHXH 1F5WA 3GMOA 3EZJB 5D1QA 5IB2A 3MXVH 4YDLB 1XAUA 4Z78A 5KVGH 3G6DL 2YWYA 4PG2A 4OZIB 1JZ6A 3D3VA 3OJDB 4WFHD 3ARWA 5C0CD 1HYSC 4YIQB 1DTUA 1N5YH 5ID0A 1NQBA 3VXQA 2GJZB 4KFZC 4JO2L 1UM6H 3MUZ1 1X3DA 1ZVHA 1AFVL 1C12A 1BD2E 1KPVA 1X44A 2VLLB 3HI6H 1T20B 4DVRL 5IFAL 4WFGD 1EPFA 4JG0H 5CILH 1C5BH 1YMHA 2AXJA 1TLKA 3TWCH 4HMCA 4LBEB 2NXZB 4HK0B 2A6IB 4HW6A 1OAKH 4PJGB 1KJ2H 1OARH 4R8WH 5CBEB 2CRYA 5T3XH 2IANA 4KXZI 1KCUH 4XNUL 4H25B 1A6UL 4JDVB 3GSNH 2F15A 4LCCA 3WDJA 1VERA 5C8JB 4WENB 5KSAC 4MJ6B 5J13C 2WUBH 3AM8A 1YPZB 2W9DH 4N0CC 3QHZH 2F54B 1PYWA 4Y1AB 3ILQD 5GGUB 3IDXL 2XNAB 5F7DA 5I8CA 3B8SA 3L3HB 3QI9D 3RY4A 5CLTA 2HT4C 4W6YB 3UDWC 3ESVF 1ZANL 1I1AB 1MWAB 3GMMB 3VDAA 1PFCA 3CDGB 4KK5C 4XP4H 5TH2B 3VMPA 4JM2A 3H42L 1KB5A 4MZ3A 5GISH 5HHQA 3N0PB 4G9FA 3OQ3B 5F1SA 3IFNH 4KROB 5ITBL 2FRGP 5J11B 4HZLA 2DQCL 3P0VH 2HKHH 2A6JA 3ALPA 3TCXA 5FIEA 1SYSB 4OIBA 5HI5C 1ONQA 3QAZC 3QCUH 3DUSB 4UTAH 4XP1H 2CKNA 4P2RE 4Y8DC 3GMLB 3QJFB 4K9EC 1DQJA 3L6FB 5LGKA 1Q0XH 2JIXA 4PREA 4BFGA 4JFDB 2AK4E 2VC2H 2XTJB 1P4LB 5EU5A 4X8JA 4JFFB 4QHUA 3SJVA 3DXAB 1BOGB 4XXDA 4QHLB 3HKFA 4K3JL 4P2CG 3I2CH 3GNML 1MCEA 3PWPD 5IVZA 5ICZB 2CR6A 4PFEA 1YYML 2F5AH 1WJ3A 2RCSH 3VFPB 3VDCA 1N5AA 2QADB 3OBAA 2GITA 2PN5A 2FB4H 3HNSL 4ZNCD 1EHAA 3MRBA 32C2A 4NZUL 1F4AA 2VWEE 4P4KC 2KDGA 4LF3B 2YD3A 4PLKD 1QR1A 4KZDH 2MCPH 1FCCA 5KN5A 4CAGA 4HFWA 4HH9A 4R26L 2YD2A 1Q94A 5E2WH 5TDOA 2W59A 1YQVH 3D85A 5D1QB 3O4LB 2YPLD 2N7AA 5LCVH 1CGXA 3REWB 2FX7H 4GRMB 4ZFOB 5BO1L 4S1SH 4U1MA 3KJ6H 3DYPA 1NAMB 3IDMA 1A4JA 2HWZH 3T65A 2ZP0T 4NPYA 4QTIL 5F7NC 3W9DB 3SKJH 2ITDA 3BDYH 3FFCD 4IDLA 3ECBA 2Y5TA 3WFHA 1JMZA 1T2XA 1OW0A 3AGVA 2FLRT 5F44A 3WE6A 3MLTA 3T3PE 3AROA 3T77A 1T1YA 1DBJL 2CUMA 2FATL 3VXRE 2Q7YA 1FZKB 4TSAL 3VRIB 4C57C 4GKZB 1CT8A 4OZ4B 2APFA 3SGEH 3RWHA 5IKCB 2E7HA 3C2AH 5D2NC 4OF3A 2SEBB 5HDBF 2V5TA 1EIBA 5EH1A 3VJ6B 3QEGH 2VNCA 1NMBH 3MACH 4TVPH 3N06B 1I85A 4IJ3B 1OAZH 5DXWA 1X5IA 2CKBL 3IVKB 4KUZL 4KTYA 4I4WA 4QXGL 2R69L 2X44D 3VXNB 4NQSB 3ZE1E 4MA8L 1CLCA 4QRUA 3TJHD 4NBZB 4MAUH 3E6HA 4J4PD 5D2NE 4MVBD 3QDGE 3NABH 3VGBA 1CD9B 4Y4KD 3U4BL 1PX3A 4MQXC 1AXSA 4J3WA 3LKNA 3WMSA 2QSCL 2IQ9L 1UZ6E 3O9WB 1NGPH 3MLPA 2GFBA 2XOTA 3MV7B 1PKQA 5L2KA 1KCSH 5IWLC 3KXFE 5JW5B 4M7JH 1KULA 4CBPA 3V5HA 1MCWW 2YD4A 4EN3C 1SJVA 4ZTPH 4TUKL 1ONQB 3SDCC 1RK1A 5C0RL 4XPFH 3WIIL 3M17B 1DQML 2BNRE 3N1QC 1AIFA 2V7HA 3WEXA 1BP3B 1PAMA 4HUXA 2HG5A 4IOFD 4CL7A 5I1AA 5F9AC 2CO6B 3P4LA 2ZJSH 2XRAL 2JIXB 1EA9C 1ZSDA 3EAKA 2WP3T 4Q6IB 3CSPA 4I3SL 4XXDB 1BHGA 5C1MB 2HRLA 3EOTH 5I17A 3KYNB 3GSVB 5DK2A 1KXVC 4JFEA 1QVOA 4HLZH 4F37K 1OAXL 4OSUL 2AJYH 4U1JA 2GITB 3EOBB 2B7DT 4ODWA 4F9LA 3EO0A 1ND0A 4XH2A 32C2B 4G8EA 3X17A 2Z8VC 1JRHI 3KYKH 5HDLA 1DE4B 3ZTNL 4HPYL 5E2JA 2W38A 5JQHC 4HH9B 1Q94B 2ZSWB 3D85B 4YBLB 1HH6B 4X98B 1DZBA 1H0DA 5ADPH 1EO7A 2Y23A 1RU9L 3HMXL 4XB8A 4ODXA 3UZEA 5CP7A 5B39B 4WUUD 1A4JB 1HHKB 2FD6L 3C8KB 3T65B 2H32B 2OR8A 3ARBA 1YEGH 2ITDB 2W91A 3UPRB 2CSPA 2BY1A 2NCMA 3NN8B 1NUFA 1CGTA 1W2KT 3LKRB 1UGNA 1ZLVH 3WNLA 2VYRE 5K9KB 4NO3A 1X5JA 1EDQA 1PX4A 2ZWLT 4XNYL 5DJ2B 2Q7YB 4JFYA 4HK3N 2AXGA 4POYA 4U6HB 4XI5D 4XBPA 4WNQB 3TBSA 4X6BB 4QGTA 4QXWA 1CT8B 1RZKC 4LSTH 2FSEB 1A9BA 5E8DL 1FJ1B 3AS1A 3HPLA 1IVLA 1NCUA 4YAQB 3ZYIA 5GRWA 1AR2A 1IL1A 4FMFA 5I73B 4X6CE 1Z9MA 3HE6A 3PGFL 1QFWM 2ZNWA 1IGFL 4E41D 3QZWG 5D5MA 3BRDA 1NGZB 4NQVA 1TJHL 5CEZE 5DUPH 5IMKA 4ZSOA 3TF7C 3I02B 3WJJC 3U2SA 2B39A 4UILH 3FTGB 5I8KL 1J1PH 3MBEA 2DWEB 3U1SL 2ICCA 3LKNB 4RGMC 2QQQA 4EOWL 4I77H 3OHXA 1PKQB 3TEUA 1I1FB 5C0JB 1UM4H 3V5HB 1NAML 1UH2A 4L8SB 4DK6A 1P53A 4XCNB 3W81A 1EBPA 4CMHB 1FNGB 3VW3L 1RK1B 4X7TB 3LS5L 1BD2A 2Z31B 2AGJH 4YHPA 3ARGA 5ISZE 3HZVB 2V7HB 4N8CL 3QEHA 4FNLH 1F3JA 4X99A 1OP3H 2BHUA 4JY5H 3A6OA 4MQSB 3GSOB 2N7BA 4Q6YA 1LP9E 1KJMB 3TYFA 4G7VH 4N9GB 2GCYA 1Q72H 3CGTA 4BKLA 5DK2B 2CJUL 5F21B 1S7TA 5JZ7C 4JQXC 1E6JH 1F4YH 3O45A 2CIIA 2CMRL 3FO1B 3GBLA 4ODWB 4ZXBB 5BV7C 5BVJB 4XH2B 4MCYA 4HV8A 2P4AB 5CUSL 3QEUA 4P46D 2ERJC 4JPKL 4HGKC 5CD5D 4XCYB 2KBGA 3HMWL 3KWWA 2Q3AA 3GDBA 3O2VH 1UG9A 3STLA 1ZEAL 1Q9WB 1GL4B 1CFBA 2BRRH 2FBJL 2YKLH 3C9NA 2C3VA 3CX5J 5EZLB 5T1LA 4LKCB 1H0DB 1F11B 3L5IA 3WLBA 3GSUA 4ODXB 2FGWH 3S34H 2XA8L 3FT4A 1QLRB 3UBXG 2VXUL 3I84A 1F58L 3WCYA 4IRZH 1WZMA 3GJFK 4KKCD 5CP7B 1YDPA 3LCYA 1PDKA 5E99H 1RV6X 1BIHA 2HMID 4N0CA 4EXPX 3GMNA 4U1NA 3LEYH 1IC5H 4PBVC 4HD9A 4KVNH 1N3NA 4P2RA 2B20A 4DEPC 3GSWA 3UDWA 3FN0L 1B0GB 1QHPA 1F2XK 4YGAB 1TENA 1QQDB 4UOJA 2XZAL 2AK4A 5C0AD 3UMTA 3BZEB 4DGVL 2Y1VA 5ICXA 4TQEH 4FTVE 4GMSH 3PV6B 3HPLB 2BC4A 1AQDA 4HWUA 4YNYB 3LY6A 4LARL 2YC1A 1I3RA 3MRJA 3ULVD 4HHAA 2NNAB 4MNQE 3MMEA 3TJHC 1CDYA 4ELMB 2BJML 2AW2A 2X4SA 3AU1B 3MRLA 4DGYL 4OGXL 5A2IH 3EFDL 5EFIA 4FG6C 3BKJL 3IS0X 4Y4KC 4M48H 4GXVL 4B7LA 2HT2D 5JQ6L 2OX5A 2X09A 4KKNA 4ZSOB 3NA9L 5SWZD 4MAYD 4GW5A 2D2OA 3U2SB 5EWIL 1CGUA 4UZGA 2EXWD 4LIQH 4QT5A 4YEFA 3MBEB 3MFGB 2VMFA 1WK0A 4QLRA 4M6AA 1QNZL 2HRPH 3FB6A 4PRIB 5CKGA 3R06A 2Y06H 3QZWA 2AEQL 4IOFC 1IC1A 5BW7A 4JY4B 2EDEA 5D8JL 5IB1B 2LE9A 1G9EA 4P4KA 1BD2B 1H9VA 1UQSB 3ARGB 1YYLH 1G6RA 4Q0XL 3MJ9H 3MRDB 1F3JB 2GK0B 4PY8I 4P2OD 5GS3A 3VXRA 1DP0A 1MHPH 2R0WH 1E6OH 3HCVA 5DRXB 4R96A 4F7EA 3THMH 3DI2B 3OKMA 2YSSA 4BKLB 4GBXD 5FHAH 3QXWA 4G6KH 1A5FL 3Q3GA 2HFFB 3AFLA 5DMJB 5EA0L 1P4IH 1DBAL 4ALAH 3F7YA 1FAIL 2AJSH 4HLJA 2B4CC 2EE9A 5MENB 1V7NL 4UB0H 1UB6B 1ZVSA 3SGKA 1C8PA 4Q58C 1FN4A 1JPFA 2XACC 2VZ3A 5ALCL 2P5ED 4JRXE 5FYKH 5DVKA 2VO5A 3KWWB 1O5DT 2CDFA 3STLB 5IHZA 35C8L 2C3VB 5D2NA 5F7FA 3QDGA 4HJJL 2ZOLA 5DA4A 5GZND 4KZEL 3WLBB 2C1PA 3GSUB 3WFCH 5LKNA 3HC4H 1X5HA 2EDYA 1RK0A 2Y6SC 2OTUA 1T2QL 4M7KH 3KXFA 5DQDH 5GJTL 3PHQB 3GGWB 4O51B 3PL6C 4XCFH 4XI5C 5I1IL 1MJ7H 2P5WD 5F9OL 2R2BA 1N4XL 1XR9A 2BNRA 4P9HL 3Q6GH 1J5OL 4MQ7B 1J18A 3EBAA 3MJGX 4KUCF 4LLWB 1DANT 1ADQH 4MA3B 3HA0A 4YXKL 2AEWA 3NCYS 4M93C 2XZZA 4CMMA 1F42A 4B41A 5KS9F 4OZGB 1FFNA 1GZQA 5IWLA 2BC4B 2MCG1 5EO0A 2BVPA 4GG6E 15C8H 4OF7A 2YRZA 3KYAA 3V0VB 1X7QB 4Z7VB 3VFTA 2NY2D 4EN3A 1F6AA 1E4XH 2EE6A 3SDCA 4HBQA 4G6AD 3JV6A 3VRLF 4ZUVB 3M45A 1NCCH 1G6VK 1NGXB 1BLNA 1AD0A 4FA8A 4S1DD 3VXME 4EQ3A 3NCJL 3IJHB 5I1CH 3D39E 3VGGA 3QXDB 4PRHA 5DVNA 5ERWA 3PUCA 3LRSA 1MAJA 2NW2B 4XCEB 4ZS6C 3VFVB 1QPPA 2R2HB 2V2TA 3X12A 1A3LH 5H94A 4PTTB 1A47A 4AQOA 3D1MC 4LHUD 2AEPH 4P4KB 4J8RB 3TESA 4NCDA 4R3SB 1W72L 4F3FB 4AIXA 1DVFD 1QBBA 5C0CA 1C16A 3ROOA 4I18B 3ZE0E 5HY9B 1U3HB 1U8IB 4R96B 4YHIB 3C8DA 1A4KA 3O8XB 1OAUH 3VXUD 3OKMB 5KVEH 1YY8B 1WC7B 5DZOA 1RY7B 4X7SL 4GRWB 3A0OA 5D9SB 5FYLE 4YHKL 1GZPA 1JWUB 3GI9H 4X6CA 4JPWH 5DZLA 1YEFL 4LEOB 3QDMB 1H15A 2V2WB 1MJ8L 5CEYA 4IEFB 4EUPH 3C08L 1U8QA 4AEHL 5MEPA 3C5ZB 1KNOA 5JTWA 3KPSD 4XP9H 5KANI 3QA3B 2O5ZH 1OGTB 4PJ7F 4ZYKB 4G8IA 2JELL 2CDFB 5DWUH 1XF3A 1J7VR 5TE4H 1HOCA 1YEEL 1BFOA 5BXFA 3TBTA 2ZOLB 5H8DA 2PXYB 1P7KB 1VPOH 2HMIC 1CR9L 1PQZB 5DMYA 5HYEA 2QQKH 3O4OB 4TSBL 1IC4H 2YA1A 4YHZH 3KXFB 2NR6D 3B9KC 3HUJB 4WDIB 5CKAA 4X8XA 1DR9A 1KTRL 1JPSL 4UI2A 3W39A 4AMKH 2R2BB 2BSSA 4NBYB 5GXBB 4P4RA 3SKMB 1KG0A 1UWXH 2IAMA 5ISZA 4WW2B 3TIEA 3WJJA 5I2IA 5BRZB 1PKOA 3NZ8A 1R0AL 2Q86B 1T21B 2LTQB 3ULVC 3UBXB 5I71B 3G5ZA 1VFBA 4XX1E 1HI6A 1GZQB 1LP9A 2VN4A 1KENH 2ZUQB 4GMTL 5EO0B 1IM9D 2DQTL 1B6DA 4M7ZB 1J11A 4PJBE 4FQXB 4HXAH 1Z0NA 2HT2C 3VFTB 2R0KH 5DS8B 1HHJA 3ZKSD 5IB5B 1JK8A 4LHJB 1U8JB 2IALA 1VGKA 1SJHA 2EXWC 2NY0B 2P1YA 1BLNB 5SWSE 5JOPD 4GQ9L 1MFBH 3RFZC 4OB5L 43C9A 4RA0C 5TE6L 4KK9D 5I30L 2EDTA 2EDHA 5INCB 5HGHA 5FO8A 5FXCH 4AL8L 1FGNL 1HILA 4UV7H 1T0MA 2BSTA 2J8UE 1CQYA 3IAPA 4KJYA 1GOFA 5FGCE 1ZKAA 3WIFB 4ZOBA 4MCZA 2D0FA 3N1GC 4JQXA 3G6DH 2V2TB 3ROLA 4NO0B 4ZAKD 4P2OC 3B5TA 4LCWD 4JO2H 4LVOC 3VG9C 1CK0L 4OD1L 2DQIH 5I6XC 4UT7L 2FWOB 3IFOA 1AFVH 4UNUA 5M94B 4YDIL 5IW3A 2NLJB 2H9GA 3S96B 4DVRH 4NUGL 4NC2B 2LFGA 5IFAH 1HHHA 3K3QA 2ESVE 2Q7NA 1MIML 2DBLH 4J3SA 4YE4H 3OL2A 3HRZA 2VDMH 2NX5E 3CDCA 5GRVK 4IM8A 4PTUB 4O2CA 5EUKA 4RGOL 2R8SL 4FTVA 1N59B 3FKUS 1GZPB 4GAJL 4PJGF 3RX7A 1LVEA 3UTOA 3LD8C 1YEKL 2R0LH 4ONGL 4XNUH 4MNQA 1FP5A 1A6UH 4GSDL 4ODVL 4R2GD 3FB5B 3V4UL 43CAA 4K7FB 5BS0D 5GZNC 2CUIA 1KIRB 2J2ZA 1FNSL 3MUGA 3TO2A 1PSKL 3S5LA 4PB0H 1XF3B 1YPZF 1I7RA 3IDXH 4LSQL 1QYGL 1BFOB 2UZXB 5EO1A 1FFOB 3QUZC 1L7IL 3T1FA 3B8YA 5E24E 1EJOL 4GKOA 5IM7B 1YQ2A 5I1EL 1QA9B 2WW8A 1ZANH 3RX8A 2A9ML 5I76B 3QQ4B 3H42H 3KPTA 4O58L 3ZKMC 1G9NL 3IU4L 1K8DB 3D9AL 4Y4KA 1G7IB 2IFFH 4JQIL 5EPMB 1A7RL 4P4RB 5JOFB 2DQCH 2IAMB 5ISZB 1MRCL 3TIEB 4DCQA 4ONHB 1A7BA 3IRPX 3HG1D 2P45B 1IAOB 3L5HA 2EXYC 1QSFB 2NY2C 2QBWA 3IXAA 3G5ZB 3LV3A 4G6AC 5I15L 3PQYE 2A2QT 5C08E 3RY6C 4GW1B 3ARXA 1AO7D 1A0QL 1OB1A 4I48A 2E9BA 4KPHL 4KK8D 4W70A 4S1DC 4NGHL 3PV7A 4K3JH 3CVHB 3GNMH 1JK8B 3CSYA 1CVRA 4NKQB 5DK0A 5DQJA 1OY3B 5EUOE 1YYMH 5FO9B 2EECA 3H3PL 3HNSH 2JJUA 1MCOL 2VDLL 4N5ED 4GRLA 4NZUH 1HILB 3MYJB 1T0MB 2BSTB 4Z7UF 4YDVB 5BMFL 2XG5A 4P5TD 2UV3A 1TZHB 2CLRA 1ZV5A 5JPMA 4OKVA 4WJ5A 2VLJE 4MCZB 1FC1A 4R26H 2FHFA 1U58B 5IBUG 1MAMH 1R3IL 5C6TL 2YZ1A 3SDXE 1UJ3A 3T0AA 2ATPA 4XX1G 2D9QB 3QQNA 5BO1H 4NOBA 4X7FC 4APQB 1MCSA 1OAQH 3WXVL 1IZJA 3UX9B 1AGFA 5IT2L 4IIQB 1IQDB 4NO2B 2DLEA 5D93C 3BSZL 3UTSD 4U4BA 1JV5A 3RWDB 4YXHL 2NXYD 1A1OB 2IPTH 3NGBC 1I7ZB 1DBJH 2FATH 1U6AL 7FABL 3DYOA 3NBNA 2DTSA 4J1UA 4LAJH 5T3XD 4K94C 4Y16B 4O2CB 1TVHA 3CFDA 1S8DB 3ARDD 3VE0A 3PL6A 3RIAK 3QULB 5J3HC 3CAFA 3OJ2C 1A7NH 3I3BA 4OI9A 3L1OL 3W5NA 1IEAA 3DRTA 2DQHL 4NJAH 5CBAA 2ZUUA 5F6HJ 3EOAB 4ZS7L 1ZGLB 2YOCA 2Z8WC 4LGPB 3MUGB 5IW1A 4Z0XA 3WDIA 2JB5L 1D6EB 1CGVA 4KUZH 3S37X 4H0HB 5CMAB 2XWTA 5BZDA 2H2SD 4QXGH 2R69H 2N56A 4KMTH 3VXMA 3IDYB 1ZE3C 3BESR 1P1ZB 2NR6C 3D39A 2V5YA 2VISB 4E41A 3T1FB 5T3ZE 5CJQL 2HN7B 3U4BH 5HYQA 1ORQA 2FIKB 1RZJL 2GJ6E 2QSCH 1FZOB 4LNRA 1IQWH 4L9LB 1I1RA 3ES6B 1V7ML 4AENA 1OVZA 1JGEB 4OZHE 2IADA 4OUUB 5EU3A 2BVQA 2YS4A 4X6FB 4PJCE 4MJ5B 2XY1A 3ZDXF 5C0RH 4XP5L 1DQMH 4MA1B 5DEGA 3OF6A 3CDFA 1K5NA 4LDOB 1TETL 2XRAH 4E42A 3V7MA 4W6XB 1BBDH 3VXSD 3BFOA 5FOBA 3MA7A 3KPRD 4I3SH 3T2OA 1M7DA 5IK3A 4HCRL 4LLQB 4QWWC 3HR6A 3FO2B 1R24B 1OAXH 4OSUH 5K9JH 1SBSL 1H3VA 3NCFB 4U1GB 5I9QB 2EC9U 4GRLB 4JRXB 5C0IB 3ARFA 4KDWA 3ZTNH 1R5WB 4HPYH 4A2MA 3IDNA 2APTA 3T1WA 2JCCE 4H1LB 5KG9B 4ZAKC 4NFDA 2VH5H 5CJOL 3PGCB 3SE3C 3MNVA 1U8LB 1AKJB 1MWAH 1XGYL 2AAVA 4JG1L 3HMXH 1LMKA 5DHVH 1P7QA 1UJ3B 3RUGE 1G7JA 3EGSB 3ZL4L 4M4PA 4K71C 3K0WA 2VXVL 5CCKH 1LK2A 2E9WA 2GK2A 4QHKI 5K93A 2FD6H 3IFPB 1AGFB 1K2DA 2WINA 3H9SE 5B3JF 3LKOB 4Z95H 3GFUA 4Z7NE 2IMMA 1UKSA 2VLKD 3T0EB 5JMOC 4X4XB 3BUTA 4XNYH 5LVEA 4XHJC 5EORL 3K1DA 4Y5VB 3BDBA 4B50A 3RZWA 1SY6A 3WLWD 4M61A 1CBVH 4X5XA 4YHOH 4GG6B 1EHNA 5HVGB 1E4JA 3B9KA 4LPUA 4P49A 1MIEL 4BH8A 1HEZA 3CVHL 3OXSA 5DC9B 5CBAB 5AZ2L 4RA3A 2CLVA 3PGFH 4NQEB 1D5ZA 5SWSA 3BGMA 5IW1B 1IGFH 3NZHL 4Y7MA 3RVXC 1CGSL 4UT6H 4BQBA 2XWTB 4LKXA 1AHWC 1YMME 3C6LA 4JGUA 4XC3L 1UXWB 3RVTC 2OSLB 4JZJC 1DDHA 4G80B 3HB3C 3QCTL 5HPMA 2J8UA 3QIBA 1W8NA 5IF0A 5B8CB 4TTDC 3NCCB 1HDMB 2JJVA 1OD9A 3EYQD 2EDJA 2GSGB 4MJIE 1PZ5B 5D7JA 1CD1A 8FABA 5BQ7A 5EBLA 2D7PA 3TBYA 2N1KA 1NAMH 1G7LB 5DHXB 5CGYD 1HCVA 1A21A 1UYWH 4Q2ZB 5EIQA 1XR8A 1QHOA 3VGAB 4F58L 3JTTB 3LS5H 4NQXA 5H35B 4U3CA 1RHHB 4M7LL 3QJHB 4AEIL 3SBWC 4PJEA 2ESVA 5ACLA 5J12C 5F9WB 2NX5A 3DBXA 2YPVH 4YLQT 4NDMB 1MQKH 4MNHB 1FVCA 4P2OA 3KPQA 4KC3B 2GI7A 1B0RA 1GC1L 3H7LA 1IGJB 2VL5A 3DHMA 4RMTA 2WBJC 4WEUD 2CMRH 4OLZL 3RGVB 4HFUL 2EDQA 4ZFFA 4NQDB 2A83A 5CUSH 3ARFB 3B9AA 4JRYB 4JPKH 1T5XB 1JP5A 2V9RA 4WUKL 2DIBA 2H6PA 5C2BL 3HMWH 4LVNB 5C0BE 2GUOB 1ZEAH 3Q6FA 4HWZA 5DFTA 5F8QC 3UTTE 2DD8L 3MNVB 2V17L 5C6PB 4J6RH 5F7UA 2OXGA 4QXTB 2D7OA 1P7QB 4F8TA 4WTWA 3RVWC 1G7JB 3MOAL 2XA8H 1U91B 4F9PC 4OTXL 2DF3A 1NDMB 5EZOH 1HWHB 1W0VA 1QUNA 4JFXB 5SWQA 1KC5L 5F93C 4ZG1A 3OAUL 4XRCB 1HQRA 5D1ZD 2UVEA 6CGTA 5IBUB 4MHHI 3ARDC 3QUZA 5J06A 4JPIB 3PNWB 2UY7A 4ZUSA 1IEBB 3FN0H 3SGDI 1LO2L 3HAEG 4IRJC 2OJEB 4WU5A 1WWBX 3PQYA 3RDTC 5KZCB 4RFNB 4PJBB 4J3VA 5C08A 3SDDC 2F53E 4YPGB 5E9DD 3I6KA 2H45A 1CXFA 1HEZB 3FQXB 3QUXC 4ODTL 4OCSH 4WIQA 3IKKA 1JFQH 1WTLA 1YNKL 4G8GE 3S3JA 1KLGB 5SWSB 4ELMF 2J6EA 3QSKB 4OGXH 4C83A 3SGJC 1P5VA 3VFNB 3GUTB 1UWXK 4BUGA 3C6LB 1KXTB 3SDAD 4BFBD 2VLRE 4GXVH 5JQ6H 1R3HA 3W2DL 3I75B 3QIBB 3NA9H 5DA0B 4BK5A 5IF0B 5EWIH 2VLJA 3FQTB 2C3WA 5AYQA 5DJYA 1JBJA 2VLMD 2I27N 2FNBA 3V6BR 5D7JB 3PWNA 3HZKA 3SDXA 3MGAA 3RWJA 5EBLB 4N0FA 1QNZH 5TFSH 4PJXA 5EZIL 1QLEL 2PF6A 2AEQH 3WL9B 3M8OL 2H32H 1XR8B 4L8BB 4YXLH 3T2QA 5DMGD 3RKPA 4K2UL 3VWJB 1X5FA 5CLWA 3ZKXC 2F74A 1EX0A 1QLFB 4Q0XH 5DD0L 4P0DA 5GRZA 4LHUA 3X3GL 4D0CA 4WGVB 3MROA 1SJEA 2X4UB 3F8UB 5E95B 4PV8B 1CD8A 2GQHA 4P5MA 2JJSC 1IGTA 3KPQB 1PG7X 1B0RB 4G3YL 4YQXL 5JNYA 3VFMB 3T4AA 4NQCE 5EA0H 2DQFA 1B0WA 3OR6B 3TN0A 4V1DE 3WHXB 3OKLA 2DKMA 1FAIH 4WWKD 4MYWB 2BOCB 2DWDA 4Z77A 1MFCL 4Q9RL 4PP1D 4RBPK 1V7NH 3FZUD 3IDIB 1T7ZA 3RWEB 1QRNE 5HPOA 1MLBA 3AXLA 3N9GL 5ALCH 1JNJA 2EDBA 1T7YA 4FZ8L 1KPRB 2H6PB 1MFDL 4X83A 2L4OA 4RQQB 3Q6FB 4JO4L 2B1HL 1D5MA 1MFAH 2H2PC 1EO8H 4DKAA 3QUYD 4DKEH 2BVEA 2OCFD 1YJDL 4PRPB 4U1SA 3V9FA 2BHYA 4EEEA 1T2QH 1MCJA 3TC9A 3RL1B 4PGDA 2FYYB 5HHNA 4O9HL 3QXAB 4YUEH 4TSCL 5GJTH 5L8LB 2HVKA 4OZHA 3OV6A 5I1IH 2EDLA 3T4YB 5SWQB 5F9OH 1OGAE 4PJCA 3WLWC 2EDFA 3FO9A 1HQRB 2GEEA 4P9HH 1N6VA 5J1AB 3DX6A 1DN0A 2ADJB 1J5OH 4YDJA 4K23L 1G7HB 4ZUSB 3IF1B 2EEDA 3I85A 4WU5B 2GTZA 1JWMB 3BP5B 4YXKH 2V9TA 3OKDB 3PQYB 4U7MA 4WFFE 5CZKA 2ORBH 5B38B 1IM3B 4XVJL 3MR9B 5IR1A 4OZGF 3GB7A 3OGOE 4C56D 4WTZG 5LGHL 4O2FA 4PB9L 3K1KC 4HS8L 2HFGL 3DVNB 1TFHA 4Z7VF 2WUCL 5EUOB 1N64L 2X40A 2EEAA 5L0QC 3GMPB 1IM9A 3E6FA 4NRYB 4OT1L 4TVPE 1XZ0B 5AAMA 2C9AA 5E6IB 3O6LL 3F5WA 3HS0A 5GS0L 3WV0A 1WWWX 2VDOL 4L3EE 4UDUA 4FABL 4XTRD 2BK8A 5FYJD 2CK0L 3VXPB 3EYOA 1KGCE 2JCCA 3NCJH 2VLJB 3LN4A 1NC2D 1DSFL 3QUML 3PDGA 5GGSB 3FT3A 4JFQB 2VAJA 3BP6A 3KS0H 3TA3D 4YH6A 3SE9L 1KPUA 4V3DB 3RUGA 5E2TL 5IQ9A 5HYIA 1G7PA 5C0GA 4RIRA 3R0NA 1RJZB 4JKPH 3K74B 1UENA 3O3EA 1M1SA 1UACL 3H9SA 1ZLUK 5FDWA 4NO5A 3H6JA 5DD1L 5DRWA 5CIPA 1RJCA 2F74B 2MHAA 1W72H 1A1NB 5HBBA 4PD4J 1T1WB 4G59A 2NY4D 2IH3A 3WO4B 2X4TA 2X9YA 3KLSA 2YPKA 1AE6L 1B4JL 1SYVA 5D4QA 2E7BA 2XQYG 1LO3L 3TVMD 4ZUWB 3D2UB 4OCXL 1EFXD 2BNUA 5EOQH 3UTPD 2MJWA 5ID1A 4BSVB 3SPVA 3KDMB 1OT1A 4X7SH 1T2JA 3NACH 4M5ZL 4XMLL 1CLYL 4GRWF 1FYTD 4YHKH 1S5IL 1BQHG 3TN0B 2AV7B 1TTUA 5D93B 5JHDB 1BZ9B 1YEFH 4EDXB 2K3TA 5HYJB 2DWDB 1QR4A 2E8ZA 2YA2A 4C4KO 1I7TA 5FYKD 3C08H 3FO0L 4AEHH 3OB0K 5GGQL 1T1XA 1NJ9B 1S7XA 3UAJC 5C7XL 5DMKA 4XBGA 4S11A 1MH5B 2BXYA 1MLBB 4PJ9D 5CP3H 5I1JL 3S35L 3RA7H 5E08L 3FRUB 4ETQB 3DURA 3ZE1F 2VDPL 3AY4C 3QO0B 2JELH 4NN5C 2G2RA 1D5MB 3MLWL 4ZO7A 3S37H 4QHNA 4QKXB 1Q9LB 2CDEB 3C60D 1JYNA 3DVGA 4OQTA 1YZZA 4P2QD 1J8HE 3ULUD 1IJ9A 1EXUA 4WV1C 5JXAL 3D0VB 4MJIA 2GJ6B 4ZUTB 3LN5A 2OJZL 4H20L 5D1ZC 1RUQH 4PGDB 4CU8A 3SE8H 3JV4B 1U2HA 2HVKB 3HUJF 5ILTL 2F9BT 1AHWA 1JZ2A 5EN2B 4FXLA 4JZJA 1JGUL 4NZTL 1EEYA 1BF8A 3RTQD 3Q48A 4JZNA 2RR3A 4ZOCA 4WW2F 2ICWA 3IETA 5L2JB 4ETYA 1IGML 3NCMA 1R0AH 4HAFA 1X5KA 3HI1A 3NPSC 2A6DB 5IR1B 4GMTH 1YEDA 3HG1A 4M9OA 2DQTH 5ACZB 5T1KB 5FUZL 1X5XA 3SDAC 4QY8B 1RD6A 1CQKA 2BP3A 5FYJU 4OM1H 4K8RD 3MLUL 4TRPL 3TYGH 1UVQB 1OTTD 5E6YA 2UWEF 1CICB 5DRNB 5LXGL 3DX7A 4HWBA 1UXSB 3HAEB 1EMTH 3SBWA 3LEXA 4OB5H 2ICWI 5TE6H 2AQ1A 3KNBA 5I30H 4WI8A 2ZCHL 2R0ZH 5GHWL 1FGNH 1ZLWK 3LN4B 1D9KD 1TCRA 1L0YA 3FT3B 3P9MA 3UTTA 2Z8RA 3EYFA 2XQBL 3CLEL 3V79C 1HINH 3MYZA 4XPAL 4PPTA 1D5IL 4HC1L 1JGDA 5IQ9B 3A6CH 2WBJA 2RFXA 2YD8A 4YX2L 2W1NA 3O3EB 4G7YL 3H9SB 1AI1L 4R4ND 1VACA 2DKUA 2ZOKB 3FFDA 1CK0H 3S9DB 1Z6JT 1T4KB 2MHAB 3S88L 2IBZY 1LD9A 3RZCB 1VEOA 1JI1A 3NCBB 2QTEA 4LPWA 4N1EA 2YRPA 1DLFH 4YDIH 2MKWA 2X1WL 5CEXA 4KKAD 4NSKA 4NUGH 2DS4A 4ENED 4EI5D 4WO4D 4L5FH 2YD9A 1FSKC 5HGBA 1MIMH 1NUDA 1ZA3B 3SPVB 4X0KA 3P9LB 5ADOL 4F9PA 4PJ5B 3F6LA 3DSFL 2F53A 4N0RA 3FZUC 3QP3A 1CDGA 4UTBL 4IS6A 4RGOH 1KJ2A 4GAJH 2R8SH 1QSED 4TVSa 3STBA 5HDBE 1MCLA 3GJFB 4RMUA 3G5VA 1ROWA 4R6UA 2OI9A 5GGRY 1UEYA 1YEKH 4ONGH 5FUCC 4R90H 1CF8L 4G8GA 4GSDH 2XPGA 1NUNB 4ODVH 3GSNA 3LSOA 4U1LB 2XZCL 1H5BC 2XFXA 4UQ2A 3V4UH 1CCZA 1FV1B 4HJ0C 1WISA 1YMMB 2KPNA 1IKFH 5FO7A 3V6FA 1FNSH 2VLRA 2AEIT 1CFSA 4IRJA 3JXAA 4NRXA 5FM5M 3RDTA 1WLHA 1INEL 4LSQH 3SDDA 1QYGH 3U0TA 2VXSL 4E5XA 4LCYA 3B3IA 1BQHA 1FL5A 5EIIB 5AZEL 3S4SA 4MJIB 1C7SA 5I1EH 3GSQB 3QUXA 3CH1B 3LN5B 2A9MH 4NWUL 5FAAA 4DZBA 3IJSB 3DMMD 1T3FB 2NY1D 4O58H 3SGJA 2DOCA 1G9NH 2GT9A 3IU4H 3D9AH 4JQIH 3E3QC 1A7PL 1A7RH 1VGEL 3MRGA 3KVQA 1ZHLB 1RZFL 1JRHL 1LE9A 2P47B 4HLZG 1GIGL 2EICA 3IETB 8CGTA 1Z3GL 1I4FA 4WHTA 3RI5K 3T0BA 3UPCA 4XNQB 2BVTA 4PRAA 2E27H 5KW9H 2R1WA 3MV11 2IQAA 5ELIA 3Q2CA 1OHQA 5I15H 3HC3H 4GRWH 5GJSL 2WBKA 4XAWL 1A0QH 2YWZA 3O6KL 4KPHH 4NQCA 1YN6A 4XNZC 3QIUD 1RZ7L 3E3QE 4L4VD 4NGHH 4XTRC 4V1DA 4F15C 3GIVB 2EKJA 1JNLH 1QEWB 4K3EL 1ORSA 2D31A 3DX7B 4GS7C 4KKLC 3H3PH 1KFAL 5MEOB 3TA3C 1QRNA 1GGBH 1MCOH 2VDLH 1J1OH 5CJBA 5FHBL 2NY3D 4KWUA 5C0BB 4OF5A 1A6TB 2JJSA 3HC0A 3BHBA 4BSWA 1KEGL 3UTTB 4R0LC 3DRQA 4LLUA 2XKNA 3HE7B 5JHLL 3AB0B 1FE8H 1JGDB 3MJ7A 1F6LL 4R7NB 1BAFL 5C6TH 3V4PL 2VRAA 1MCRA 3KLDA 5F3HB 4HS6A 1RAMA 1OSPL 4HUUA 4TUJB 5EG6C 3BPCB 5E8OA 1VACB 5EC1A 3TVMC 4QRPE 3WXVH 3U46A 2H8PA 5D1XD 5IT2H 2XIDA 1WBZB 1AD9B 4ZPVA 3BSZH 1LEIB 5HGAB 3QISA 2QR0A 4YXHH 1I3VA 3O0RH 1N8ZA 3NMEA 7FABH 4D9LL 4R97C 1WZLA 5AUMA 2VLKA 2N4IA 5MP6L 1K6QH 3GKWL 3RWIB 5FA3B 3F7RA 4PJ9C 2AJ3B 1P2CB 2OI9B 1BFVL 5FA4A 5F1NB 3L1OH 3MZGB 2RHEA 2DQHH 2R2EA 4UQ2B 3FB8A 4XWOD 1BPVA 2VDNL 3C60C 5FO7B 3GZKA 2DYPB 4TUOB 4OV5A 2ICEA 4CJ1A 2VLRB 3KJ4C 4YFLF 3GBML 5JIHA 1CFSB 4L3EA 4XPTL 1JIBA 2NY6D 4NRXB 2EDKA 1A1MA 3U0TB 4E5XB 2EE3A 2V5MA 5HGGS 4FQHA 1FL5B 4LVEA 2XT1B 3SGEI 4P23D 2NZIA 1B9ZA 2YRLA 12E8L 5CJQH 2PW1A 3MRHA 4EBQH 3ZKQD 5SV4A 4UNVA 1XGRA 1V7MH 4HX1A 3QFJE 4M1DL 4UOW0 5TF1L 2APWA 4XP5H 2VXQL 4I0PB 5ITFA 4RMSA 4WHTB 5TGBA 4D94A 2YZ8A 2C7UB 2C1OA 4XZUB 3KPMA 4XHQA 2RGSA 3MLRL 4LLMB 5I1KL 2RQ8A 4ZPTB 3TT3H 4CDGC 1J9CT 1CL7L 3F62A 3LQZB 2E7MA 5C0AE 4HCRH 4XVSL 3OB8A 4NZRL 5IJVA 2D31B 1F4WL 4KVCL 1NMCC 3RL2A 3KYMA 1SBSH 2ZCLH 2OR9H 1QRNB 5GSRB 5EOTA 3SCMA 2PO6B 3KPOB 3OKEA 1FGVH 3HC0B 5DSCA 1A6VL 5DYOB 5CJOH 1J8HA 3MJ7B 5A16A 3H0TA 1K8IA 1HYRC 5H37H 1XGYH 1CIDA 4JG1H 4ELKB 3RVUD 2A38A 5DJ8B 1TITA 1ZLSL 3ZL4H 5DMIL 1AQKL 4FQLH 4HKBB 2C26A 2VXVH 3O3BA 4RWHA 3PE9A 1NSNL 3U46B 1O0VA 1OGAB 1VFOA 3VD4A 1QKZL 1BFTA 3CFBB 3AY4A 1P5UA 2QR0B 3KHOA 2ADFL 2LAAA 3MGOB 3O3AA 1J05A 4RISL 4K7PL 1Z9LA 3H7BA 1KCVL 5EORH 3GSXB 3FB7A 4WV1A 5AUMB 4MMXC 5DZNA 1DQQB 4QF1A 1FC2D 4FZEH 4Y4FD 5JO5A 1J12A 2X42A 4L3CB 4GG6F 4G9DA 5FUOL 5E1AB 3QDHA 2YEZB 4Y4HB 4BK4A 1NLBH 1MIEH 4MB3A 5HHOE 2PTTA 2ZKHL 4RAVB 2A73B 3CVHH 3BH8A 3T3ME 1A6ZB 4AEFA 5AZ2H 2BNQE 1WBXB 4WFEE 1ZOXA 3PWLA 4OV5B 1ZMYA 4URTB 1LO0L 3N50A 3NZHH 2VITA 1JJUA 3ZO0A 4EXKA 5IMMA 3WIHL 2J7LA 4DW2H 3U36B 4ODUA 4XC3H 3LDBC 1A1MB 3QCTH 4JE4B 3K8MA 2Q8BL 2JKXA 1BIIA 1M7IB 5DJZA 3BP4A 4DQOL 5EU4A 1V8HA 2W65B 4QEGA 1F02I 3QI9B 5HD8D 1A9EA 4D0BA 1HKFA 1G0DA 1RUKH 3ARVA 5EU6D 2X4PA 3G08B 4PRNA 1Q0YL 3WN5C 3P30L 4DZ8A 3KPNA 2Q76B 5SX5H 2V7NB 5TGBB 1W8OA 3ARED 4M7LH 3DTXA 2FR4A 4AEIH 1I7UB 3LKQA 4MNGE 2XV6B 4X6EA 5DO2D 2AJUL 1IAIM 5KSBF 1H3XA 1MVUB 1U41A 4D9RD 5IJVB 2NY3C 1RURL 1T5WA 3ZSSA 5CINL 4OLUL 5EIVA 3CCHB 1OTSD 3RVVC 1YNTA 5IBLD 3TNNA 5EOTB 3SCMB 1GJIA 4HFUH 2X4OA 3L3OA 2K9UA 3OKEB 4OCRH 1ZT1A 3DI3B 1RJLB 3V4VH 1NBVL 1J1XL 5HDQL 2V2XA 5GS2D 2UUDK 5IEKA 3C09B 3E2HC 2DD8H 3EO9L 3DROB 1TTGA 4NNYB 3BAEL 5A16B 1NFKA 5FF6A 4O2EB 5IQ7L 4KROD 4XGZB 2FEEI 4F7PA 3MOAH 1JFMA 2YPLB 4OTXH 4Y89A 4E0RB 2IF7A 4IOIB 1MF2H 5KVFL 4OGAC 1WCBA 1XIWC 4NT6B 2DQJL 2H3NA 2JB6B 3OAUH 5A1AA 1Z9OA 2M26A 3FONB 3H7BB 2XTJD 3TBWB 4JFFD 4N0YL 1OF2A 3GRWL 1LO2H 5IVXB 3QPQD 1J8KA 4WI3A 1M05B 3MFFA 4XWOC 4G9DB 4PJBF 5HHME 2GTWA 1TJGL 2QADD 3DV6B 2XN9D 5I74B 3RU8L 5LJYH 3U9UA 3E3QA 4XC1L 1CG9A 1J0IA 5F96L 3ORJA 3IFLL 4J7RA 4OFYD 3GHBL 2A0LC 5E8NA 3WUWG 3MX0A 4P23C 5KSUB 3TZVD 1ZWIA 3IS1X 4S1RL 3R8QA 2ZSVA 3KPPA 5D1QD 1DEDA 3O4LD 1REIA 4JREC 2BRQA 3W2DH 3VCLB 3D3VD 4H1LH 5F1OB 5FK9A 1FG2B 3ZLQC 4AEEA 3BP4B 2X1QA 5HI4C 1ZHKA 3P4OB 1E28A 5CGMA 4KJQC 3G5XA 4GW4B 2ENYA 3AMLA 5FKAB 4U49A 3DSNA 4D9QE 3D18A 3OMZA 5F9JB 5EZIH 1QLEH 1XGUA 4HKZA 1DLHA 4X5WB 1CYGA 4QNPF 1C08A 3TA3A 4Y2DC 4QRPA 3M8OH 2G9HA 4M6NL 1I9JL 5L88L 4YFEA 1WFNA 3KPNB 5HJ3B 4K2UH 2W0FA 5DJDB 5DD0H 1XF2B 3MJ9A 3X3GH 1A14L 4LP5A 5JIKA 3VFSA 4P48A 5GGRA 3U30B 2IAND 5FV1L 4JFOB 4GKNA 1WBYA 1FPTH 3JV0A 2LAGB 4HIXH 3PP4L 4IRSB 4WY7L 2DLFH 2VN7A 4P57A 1T5WB 5C70A 4G8FA 4XAKD 1XGPB 5DLML 1HZHL 4QOKE 1NGYB 4Q9RH 1IRAY 1I8IA 1FYTA 2HH0L 1JTPA 4JFHD 4LHQB 3VFWA 5I75C 3Q5OA 1ZT1B 4F7CA 3RVUC 2NQCA 3N9GH 3QQ9D 3N1MC 4FZ8H 5I66A 3KYOA 1MFDH 4JM2D 2B1HH 2ZPKL 4G9FD 4PJ9A 3CZJA 3LMJH 1UKQA 3LS4L 1E4WL 1YJDH 3GHEL 4F7PB 3PABA 5C0FA 5F72S 4HWEH 2KQNA 2BVOA 2BERA 4YBQC 3C60A 5C0EA 5BVPL 1J0ZA 4Y5XA 5T1MA 2P8MB 3BXNA 4KJPD 4R4BA 1BBJB 5ESQA 1S5HA 4IOSD 3DLQR 2JIXD 3FQRB 1KTDB 4WUUB 5DVLA 3BW9B 4HT1L 2IH1B 4XBEL 2VIRB 5IEHA 4PGBA 2AS5M 5FB8A 4RFEA 4C58B 4K23H 3SJVD 4YHYC 5EU7E 1KCGC 3MFFB 1ADQA 1BVKA 1PY4A 1ITBB 2FHCA 2I5YH 1T89A 4XVJH 4DGIH 2VE6A 4XCCL 5F9DC 4OM0H 3KAAA 1CG9B 4PB9H 3W82A 4HS8H 1D6VL 2BOBA 4YDLC 5JUEL 2HFGH 3MA9L 3DARA 2AJVL 4I3GA 5EUOF 1QRKA 3DX9B 3SKOB 3L7EB 3EJYC 3MV9E 3OKKA 4OT1H 4S1QH 3STZB 4BZ1L 5CD3A 4N5UA 3O6LH 1FNHA 3D85D 5I16B 3RNKA 2W9LA 1RQ5A 5F88B 2VDOH 4FABH 4KRPD 3LHPL 4ZUUA 5HD8C 2CK0H 2X05A 5J1TC 1FBIL 4U1IB 1HSAA 3QUMH 1DSFH 1TZIA 3F7PC 5DHYA 3SE9H 4TPRL 5E00A 3EIFA 2FZ3A 3IXTA 5E2TH 4YK4B 3WUWA 4NKMA 4HKZB 2NXZC 1XT5A 2WK2A 6FABH 1E4XI 2LU3A 4F37F 4PGCB 1JHTB 3DIFA 1UACH 1R3JB 3TPUE 5DD1H 3GSRA 4JO1L 2W0FB 3INUH 5F71A 3ERYA 5C0DB 3OZ9L 2O61A 4FQJL 1AR1D 5ESAA 5HHPB 4HMDA 2DQUH 4BJLA 1AE6H 3V5DB 1TVBB 1IAIH 4LFHG 4MXWL 4OCXH 4CADB 4PG9A 4ISVB 2P8LA 3EO1A 4PJHB 1U8NB 4OLVH 2EKSA 1MI5E 4GJTB 4HGWB 4IBLT 5TDPB 4IMLB 4PJGE 4XMLH 4MZ2A 3L3JA 4EIGB 1S5IH 5HHOA 1I1AC 4LLVB 2R4SH 5EB9A 1B6UA 3BN9D 2BNQA 2RIKA 4S2SA 4RX4A 2FLBT 1I8IB 2R15A 5C7XH 1Q1JL 5EOCH 1MY5A 5I1JH 4KROC 3S35H 5E08H 2NPLX 5J11C 3GK8L 3GBNH 4PJDB 1YPZE 3DPBA 2VDPH 2CLZB 2F54E 4Y1AE 1MNUL 3CC5A 4WI7A 2B2XL 3MLWH 4P46B 4YZFF 5L2KD 3MRFA 1CS6A 1KIPA 2J5LB 1A02N 1N0LA 4OLWL 3U7YH 3BJ91 4G43A 1S78D 2E6JA 5JXAH 2OJZH 5ENWB 1VDGA 2PYEE 2XTJC 2R1XA 3QFJB 4Y5XB 5T1MB 5FCUL 3BXNB 2D9CA 4UAOB 3WDHA 3WFZA 2AJZA 4MJ2A 4F7TA 4LAQL 1JGUH 4NZTH 3H9HA 1PZUB 5FB8B 1F45A 2QADC 1DUYB 3HR5A 1IGMH 2AQ3A 1I8MA 1U3ZA 4U6VL 2GAZB 4JFED 4MNGA 3BKYH 3VMNA 2IC2A 3T04D 2NTFB 1ZHBA 1J0JA 3QXUA 1XF4A 2X1OA 5FUZH 5C0AB 4UT9L 2FL5B 2BOBB 3DXAE 5C07E 3WN5A 2I24N 1P6AB 3BGAA 5A40E 4NKOA 3IRZA 2FJHB 3RWGA 5LXGH 1FNLA 2DRUA 2O26U 3FOMA 4L4VA 2VDRL 2I60L 4A6YB 2D7NA 1NGQL 2APVA 4Z7UE 2EZ0D 1FL6A 5GHWH 3MRNB 4FFWC 2BY0A 1V3LA 4QRRE 1IE5A 2ATKB 2XQBH 5SWZB 4MAYB 5FECB 2B4CL 3ARBD 4XPAH 5D6DC 1D5IH 4HC1H 3IXTB 1LQVA 2E7LE 3WUWB 2VQ1B 1S7SB 2EDRA 5E5RB 5ICYB 1INDL 5GIRA 1AI1H 4WI5A 1WIOA 1Y6MR 3S88H 4L8DA 1F13A 2L0DA 1MCPL 1WICA 2O61B 7CGTA 2D3VA 3DO7A 1OTUD 3MRPB 3P73A 4IJ3C 3E2HA 3BO8B 3MCG1 4NZDA 5ADOH 2EKSB 3HE6D 5KS9A 1TQBB 3DSFH 2DMBA 3R4DA 3DVIA 5HHMA 4UTBH 1ERNA 2EYSB 3MBXL 1XIWA 5JLZA 5DGQA 4RAUA 1S9VA 3S36L 4GBXB 2OL3B 3QQ9C 1CF8H 2D7MA 4KTDH 3O9WC 2XZCH 3S8WA 2KKQA 4KH2A 5K9OB 3VXTB 3CNKA 4JJ5A 2CUHA 3MBED 1TJIL 1CE1L 1YY9C 1INEH 2AJXL 1KIPB 2AK1L 2GW5A 4JR9L 3ZKNC 2P5EB 1ES0A 2HTKD 4KJPC 3FCTB 3TFKC 2NW3B 3ABZA 3BWUC 3A6BL 4LCIL 1P84K 5IB3A 1X6LA 4PRBA 3WJLC 1BD2D 1XH3A 3ARGD 4Q6IC 2XA3A 1EEZA 1YC8A 3MV7E 4P23A 5D6CA 1CXKA 3RAJL 4BH7B 4YHLL 2AJZB 1A7PH 1RZFH 3EKCA 3ZDXE 4OAWA 1UWEL 1GIGH 2P5WB 1IAKA 2IBBA 1Z3GH 4FQQB 2NY7L 1CE6A 2Y7QA 4NNXA 1JE6A 3OKNA 3UYRL 2HFEA 4NBXB 1ZHBB 4LLDA 2A9NL 5BZWB 5DR5L 3PIQA 1Q8MA 1MHCB 4HIJB 2BHZA 2IPUK 5GJSH 1JNNH 4XAWH 4YBLC 4Y2DA 3O6KH 3VGDA 1EGJH 3WXWL 4U6XA 4BQ8A 4NKOB 3AAZB 4FXKB 5IUSA 25C8L 4QOKA 3RWGB 1FL3B 3UTZB 3IKCB 2CH8A 1KFAH 2EIBA 5T1LD 5J9PA 4PD4K 4PJ7A 1CLOH 5GGVH 4D8PA 4MJ4A 5FHBH 5IHUL 1OW0C 2XTLA 1Y0LB 3MCLL 5T3ZH 1KEGH 2X70B 3BPNB 3TV3L 2ED7A 4D3CL 1CD0A 5JHLH 5KVMC 2XWJA 1VEMA 1BAFH 2Y72A 4NHUB 4N0CD 3V4PH 1ED3A 2ITCA 2J3SA 1F4XH 3GI8L 1JF1B 1Q9KA 4HBCL 2M1KA 2QHRL 4P9ML 4P2RD 2CPCA 1NCAL 2IGFL 3CK0L 4NRZB 2A1WL 1XGQA 4AK1A 1JZ5A 5I73C 3KLAA 2AK4D 4KK5D 4WI2A 3L3DA 3B2UC 3PWJA 2VKXA 5DJXA 5DJCA 3RBSA 1DVFB 1Y18A 3EDFA 3RP1A 3BQUA 1WZ1L 2UZYB 4OUOA 4QRTA 4ODHL 4DN4H 1AP2A 1WFTA 2WAHA 3GKWH 1U2CA 3VXUB 3QEQE 3CSBA 1D3CA 3ZYOA 1BFVH 2EYTA 5LWYL 2G75A 3L3GB 1FRGH 3ISWA 1CGWA 2AXHA 2VDNH 3ULVL 1A6WH 3L3KB 3HAEH 5T5FL 4L8SC 1ZS8A 3GBMH 3OX8A 4A6YL 1UA6L 3BIKA 1N6UA 4XPTH 4MA7L 1I1CA 4CMHC 4DUVA 3MRMA 2Z31C 3MRKA 4P9HC 1UZ8A 2OR7A 3MQIA 3V7AE 3RIFK 5TPWH 12E8H 4OBSA 1FIGL 1D5XA 4WW1B 5E56A 4P4KD 1M6OA 5JDSB 1ZT7B 2X4QB 5BJTB 1MCWM 3F7QA 4YIQA 4TNWF 2GJZA 3VXRD 2YBRA 1D5BA 4M1DH 2QJDA 3TPUA 4JKWA 1EFQA 5TF1H 2FEDD 1XGTB 3T0XA 3ZE2F 2VXQH 4ZXBC 2VLLA 5JORB 1T20A 3I50L 1CE6B 2Y7QB 1WITA 2QLVB 3PWVB 1CFTB 3RX5A 3P4MB 4L3AA 3MLRH 2F8XC 1KYOJ 4PJ8B 1MI5A 5CZXC 4LBEA 4HK0A 2A6IA 1INQB 4EZMA 4PJGA 1CXEA 1CL7H 5L6YH 4POZC 1CZ8L 5DC0A 4UINH 4U6TA 5E2UH 4HUWB 5CBEA 3GJFH 1K85A 2OL3L 3MO1A 4L1HA 1U8MB 3B6SB 1KB9J 4QOKB 4JDVA 1E4KC 1F4WH 2LABA 1DUZB 4RWYH 4KVCH 4HXBL 3TNMB 3QDGD 4MJ6A 1H8SA 4OCNC 3UJJL 1YPZA 3R1GL 1OPGL 4Q7DA 2F54A 4Y1AA 1T1ZB 5IMLA 1A6VH 1HN1A 2VDKL 5GGUA 2LVCA 3KXFD 5C0ND 3L3HA 2XWJB 5DRZA 1I1AA 2ITCB 5DHVA 3HMXA 3ILPB 2EIDA 1DN2A 3CDGA 1ZLSH 2BNRD 5TH2A 5DMIH 1AQKH 2Y5EA 4P3DA 4LCUB 1U42A 2C4FT 1NSNH 1JGVL 1B88A 4NUJA 1QKZH 2QSQA 3KLAB 4FQCL 4MQXD 4PYGA 4LCWB 3L3DB 2ADFH 1SYSA 3DUSA 4RISH 3O2WL 4K7PH 2PCPB 3BQUB 1KCVH 3GMLA 3QJFA 4XT1C 3BT2L 3X13B 3L6FA 4QRTB 4EN3D 4JFDA 3SDCD 4G6ML 3S36X 3NTCH 1FCGA 1P4LA 4LSVL 3ZDZE 2NY0D 1KCKA 5FUOH 2Z92A 4JFFA 1KXQE 1FLTX 3DXAA 5C07A 1BOGA 2PUQT 1LEGB 3MBEC 4U1HB 4QHLA 5HVFB 5MERA 4HGMA 2J6EL 3BD4A 2OK0L 3MV9B 5ICZA 1DCLA 3VFPA 4ELME 3X3FL 4W81A 3BEVB 1LO0H 3QRGL 2CKBB 3SDYH 3OX8B 4AIOA 4R2GB 3BIKB 5B39G 1AJ7L 3WIHH 2DKSA 4OF6A 4Z7UA 5E2VH 2BX5A 4M4RA 5BS0B 3MRKB 3ARGC 3QHFL 4LF3A 2BZDA 1UZ8B 4CVUA 4QRRA 2Q8BH 4J3OC 4NKDB 5CS7A 1D5XB 3O4LA 4MD5A 4DQOH 1XEDA 4AIZB 1M6OB 4JVUA 3REWA 4GRMA 4PRIE 4ZFOA 1ZT4B 2YBRB 1D5BB 1NAMA 3TPUB 3QQ3B 1KN2L 3BPLB 1JZ7A 1FDLH 5A3IC 3P30H 3W9DA 2DM7A 1KN4L 4OLXL 3MLXL 3UJTH 1IZKA 4H8WL 1VESA 2G60H 1FZKA 1I9IL 5D6DA 3VRIA 4YBHA 4GKZA 4OI8A 1MI5B 4ZD3L 3LRGA 4OZ4A 1LO5B 5IKCA 5EC2A 2AJUH 3V0WL 1NGWA 4O02L 1HXYB 1P4BL 4JN2B 5E70A 1LEKA 3V7AG 2SEBA 2MPAH 2QQLL 1XCQB 2R39A 4QHKJ 3MO1B 5CEZD 1SMOA 3VJ6A 1MPAL 1RURH 2DQGL 4L29B 4DJMA 5J6HB 2XICA 5MENE 1CDBA 5EZJB 4M3KB 4ODBD 2PW2B 4K94L 4WI4A 3GIZH 5DD3L 3IVKA 1NH6A 4X6DE 2CRIA 1KIQB 3B5GA 5IMLB 3VXNA 4NQSA 2AABH 1NBVH 1J1XH 2HLAB 5HDQH 1JUFB 2ZNXA 3EO9H 3BAEH 5DRZB 3LPGA 5IQ7H 5DHVB 3ET9F 4PLNC 3P11L 2PYEB 1TMCB 2IAMD 3O9WA 5ISZD 4P3DB 3MV7A 1VB9A 5JW5A 5KVFH 5DD5L 4NUJB 5HVHB 5D7LE 5INDB 1RMFL 3M17A 3FQWB 4UNTA 1Z2KA 4XP6H 5F89B 3TFKA 1RZIB 3GRWH 4JHZA 2VWEC 1RIHL 1U8HB 1NAKL 2NXYB 4KKBC 5IVXF 3WJLA 3BZ4B 3MLVH 3G04B 4Q6IA 2X4NB 2Z92B 4OZGE 1TJGH 3RU8H 5C07B 5MERB 2CGRL 1KTLB 3Q1SL 3KYNA 3GSVA 4XC1H 2W07A 1GGCH 4Z7VE 3IFLH 3GHBH 3L5XL 1HNGA 3EOBA 4M8QB 2BXZA 1G9NC 5BW7C 4S1RH 1SEQL 4JPVL 4Z7UB 1TQCB 3QB7C 5JZ7D 1DE4A 4ZMAT 3Q5TA 1VENA 1G9MH 1IT9L 1F90H 4QRRB 1ZHNB 1ETZB 4I18C 2ZSWA 1C1EL 1U3HC 4MD5B 4WCYL 1HH6A 4X98A 5J7CC 3O8XC 4O5LL 2J1KA 2FEDC 5MI0B 2X2YA 3OGCA 5JXEC 5B39A 3SQOL 1HHKA 3C8KA 5CHNB 4M6NH 2H32A 1I9JH 5L88H 1ITCA 3UPRA 4FQ1L 4K3DL 3NN8A 2B0SL 3ELAT 4U0QB 4Z76B 1L7TL 3AC0A 3JVGC 5CZVH 2BVYA 4BQ6A 3LKRA 1Z5LB 3C5ZC 4ESKA 1A14H 4FTVD 3TH4T 5K9KA 3SGKC 1F2QA 5DJ2A 1UH3A 1MQ8A 4U6HA 4I0CC 4WNQA 4QXUL 2VR9A 3U7AA 4X6BA 4MNQD 3DNKA 5E0QA 1NEUA 5EC2B 2FSEA 2F58H 1NGWB 4GRWE 1GOGA 3O6FB 4HIEB 3QEQA 3I9GL 1LEKB 1TIUA 3BX7C 4JDTL 3VXSB 1FJ1A 2PXYC 3OWEA 3PP4H 4GOSA 4YAQA 2FH8A 3QDME 4OIIL 5DLMH 3O4OC 4FS0A 4G5ZL 1HZHH 3UTQB 5C0NC 5K9QG 2HH0H 4FFVD 1NGZA 2OLDA 4I2XE 4UIMB 1AGCA 2CIKA 3I02A 4WW2C 5GZOD 2ZPKH 4FG6D 5D70L 3LS4H 3FTGA 2VXTL 2DWEA 2LTQC 3DUUA 3GHEH 5I71C 3RIAF 1HE7A 1I1FA 2MQ0A 2XI9A 1IGCL 2ZUQC 1JZ4A 1GGIL 5C0JA 4M7ZC 4YHML 5BVPH 1VADB 3HUJE 4L8SA 5JPNB 4FQXC 4XCNA 1FNGA 4X7TA 1BVLB 2Z31A 2C3GA 4XBEH 3HZVA 2NY0C 5BRZE 3CX2A 5DI8B 5IBTL 5DJ6B 1X4YA 5IROC 3GSOA 3SKNB 1N0XL 2CXKA 1SM3L 3K8KA 1KJMA 5SV3A 2JK5A 4N9GA 2J88H 3O2DL 4EVNB 4N8VG 3X14B 4PJIE 5JUEH 1I1YA 4GRLD 5B22A 3MA9H 3IJYB 3HN3A 2AJVH 2IWGA 4ZXBA 3FO1A 3DV4B 2UWEE 4UOW1 3K2UL 5DFVC 4BZ1H 5BVJA 2B1AL 4YJZL 1MRDH 4FQ2L 1RUML 4HK3J 1PG7W 1TDQA 2QQNH 3LHPH 3MLYL 4U6YB 4XCYA 4L8CA 3H3KA 4KRLB 2MTPA 1FBIH 4OLYH 1KCRL 3MXVL 1Q9WA 3JWDC 5EZLA 3MNWB 1S9XB 4LKCA 2X89A 1F11A 1EAPB 3VFOB 1YN7B 3IYLW 4TPRH 4LQFL 1L6XA 3OGCB 5D2LE 4QHMB 3ZYZA 1BQLL 4J3XA 1E4KA 3SY0A 4PGJA 1QLRA 1KF9B 1UM6L 2WQ8A 5GRJH 1S7RB 3W0WE 4PP2B 3VWKB 4P3CL 5I8EB 1S9YA 3HI6L 4JO1H 3SE4C 3FOLB 1JNHB 2Y6SD 1W72A 4L4JA 2EO9A 3G6JF 3PL6D 2FO4A 4OGZA 2Y07L 4GUPB 4MXWH 3TWCL 1B0GA 4BZ2H 1QQDA 2F19L 3EDDA 4OF8A 1KJ2L 4PJHF 3BZEA 2D7QA 1G0XA 3QEQB 3NIFF 4OJFL 5T3XL 1KCUL 3PV6A 1KJ3L 4YNYA 2G5RA 4Z8FH 4WHCA 5EBWB 3ESUF 1CDUA 4UIKH 1AGBB 3VXMD 2NNAA 5E4EB 1WEJH 4ELMA 4LL9A 3AU1A 5LAXA 4HKXB 5AAWA 3D39D 4I5BB 2W9DL 3QHZL 4UBDC 5CP3A 3GMRB 1AGCB 5D7IB 1BX2A 2CIKB 3OKOB 2YN5A 3GK8H 1CXIA 2IAMC 4PJDF 3VH8G 4PLJD 1OT2A 4WGWB 2B2XH 1T66C 2G5BB 2JJTC 1QP1A 5TJWK 4OLWH 5DD6B 3DUUB 4XP4L 2C3HA 2PTVA 5GISL 3MRCB 4PRIA 1ZA6B 3IFNL 4EKXA 5FCUH 1MCIA 3OF6D 3P0VL 4JY4A 5IB1A 3CZFA 3L9RB 4ZS6D 4JM4L 4U2YA 2GSIA 5IOPB 4LNVA 3QCUL 4LAQH 3VXOB 4XP1L 1UQSA 1FFPA 1MEXL 2PR4L 1NBYB 3MRDA 4XMPH 5FYLD 2ARJQ 2GK0A 1U3YA 4MXQC 4JGMA 1UM5L 4U6VH 5DRXA 4MWFB 1BGXL 1QSFE 3V0AC 5MEQB 2HJKB 3JWNC 3DO3A 4PJFB 2JK5B 3I2CL 1ZXQA 1V3JA 2HFFA 3ZDYF 4UT9H 1I1YB 1MHHB 1PBYA 3ARFD 2HA1A 5E9DB 4CKVX 3U82B 1U3JA 2AKRB 1I8KB 2OM5A 5MENA 1UB6A 3UP1A 4APQC 2DI7A 5E8PB 1ZTXL 4PGZA 2VDRH 2VR5A 1NGQH 2MCPL 4IIQC 4L8CB 1P7QD 5DEFB 5E2WL 2R1YB 4N8VA 4N90E 3TO4A 1DBBH 5LCVL 2A6KA 2JJWA 2UYLB 4BUHA 4ZQKB 3SY0B 4Y16C 5I0ZA 1BJ1J 1V5JA 3FJTA 4Y19E 2Z93A 4M6OL 2HWZL 1INDH 4OCYL 3EFFB 2R4RL 3PHQA 3GGWA 4O51A 1WIPA 1S9YB 4DOHB 5SX4I 3NOIA 1W72B 1MCPH 4FHBD 5D7LA 3MRRA 3UZVB 2FO4B 3B9KD 3VFUB 3WKML 3BEWB 4MQ7A 3J8F7 4XVUD 3OAZK 4LLWA 1AY1L 3FQUB 2R2CA 4MA3A 4FP8L 1X5YA 4Z7OF 4YWGH 2BMKB 3IDYC 3P4NB 3MLZL 3BMVA 3C5JB 2Q6WB 4C59B 4OZGA 1FO0B 5SWSD 4CVXB 4FFVC 4JY6B 3MBXH 3LH2L 1FLRL 3S36H 3V0VA 1X7QA 3C6LD 5C2UB 4Z7VA 3T3MF 3CIQA 5LAXB 3REVB 3QIBD 5GZOC 4L9LC 2B8OT 4ZUVA 1TZGL 2GY5A 1NGXA 4WWKB 1TPXB 1BX2B 5ETUB 1B90A 4HH8A 1RIUL 4MAUL 4MD0B 1CE1H 5D7JD 4X80H 1A22B 2AJXH 3NABL 3IJHA 4MA1C 2AK1H 3QXDA 1HXMA 2NW2A 4XCEA 4LSUL 3VFVA 5E5MB 1SJXA 1WAAF 1KCSL 4LCIH 3A6BH 4M7JL 5GGTL 3ARQA 2R2HA 4YO0B 3QUYB 4PTTA 4XXCC 4GFTB 4Q9QH 2CRZA 5F7MC 3VG0H 3RAJH 4WHYG 3CZFB 3NIDF 4YHLH 2ESVD 2GSIB 4JVWA 4ZTPL 5DT1L 1MJUL 3BKML 4J8RA 4X9BA 3VH8A 4R3SA 1FFPB 5B4MC 2IJ0C 4MXVE 2NX5D 4F3FA 1KJVA 4I18A 2ZJSL 5HY9A 3O81A 1U3HA 4U1GC 3H9ZA 1U8IA 2NY7H 5I9QC 2ID5A 1IKNC 3GJEB 4YHIA 4GRLC 3T09A 3O8XA 3UYRH 4G6JL 2A9NH 1X6NA 3DETC 1YY8A 1WC7A 5DURB 5JXEA 4HDIB 4KHTL 4NWTL 5D9SA 3ZTJG 3CUPB 1JWUA 3WXWH 4FRWA 2MFNA 4X4YB 3MREB 4LEOA 3QDMA 1UJ3C 4PRDB 2V2WA 4U3XA 5H37G 3JVGA 25C8H 4PY7B 4KTEL 1NKRA 3C5ZA 3RNQB 3LB6D 4RGNE 4X6DB 3QA3A 1OGTA 4ZYKA 2X41A 4JGJA 3T0EC 4N8VB 3DGGA 3TO4B 3MCLH 3LAFA 1YNLH 4NOFA 1E27B 2A6KB 3LIZH 2PXYA 2NY5H 1P7KA 3OXRB 4Y5VC 1NC2B 1PQZA 2UZIL 1X5ZA 1U92A 4JB9H 1PJ9A 2P8PB 4KI5E 4F57L 1MHEA 2Z93B 4MLSA 1EUTA 4MD4B 3HUJA 1EK3A 2QHRH 3QUZD 4P9MH 3T2PA 4WDIA 1NCAH 2IGFH 3CK0H 4HULB 2HKFL 4IMKC 2IG2H 4OKDA 2A1WH 1OWRM 5D7LB 3MRRB 2DM3A 4NP4L 3SKMA 4DKDC 2W0PA 3WSQH 3PQYD 2XKSA 3T0EE 4WW2A 5C08D 3ZKMD 2WLZA 5D7KE 5BRZA 2VZOA 3HTLX 4IDJL 2ADGB 2Q86A 5JW3L 1T21A 5GPRA 1JGLL 2NY4B 3ZHKA 1NMAL 3UBXA 1NBQA 1Z0MA 3EYSL 4UDTB 2I9LB 1NFDB 4DN3L 4GLRH 4ONFL 1EFXB 1KCLA 1RZGB 4OCWH 5B8CC 5D96B 3BI9X 4FQXA 5E6ID 5IESL 2EXYD 4TNWK 5LWYH 5DS8A 1YJDC 2AXFB 1S7UB 5IB5A 2FJFA 4PLJC 1U8JA 2UWEA 4BQ9A 4KY1H 3VI4F 4NQEE 4ZO6A 2VLJD 4D9RE 5T5FH 2V5RA 2X4RB 1T03L 3FT2B 4A6YH 2A74B 5INCA 3TLRA 5IROA 5T33L 3VGAC 3UBXI 4UQ3A 3WFEH 3BIBX 3SOBL 2E8YA 1HXMB 4L4TE 3WIFA 3MV8E 4UV4L 3U0PB 4I77L 3LKSA 1FIGH 2QSVA 4C4KT 5D2LA 4TULL 3NCEB 5F9WC 2EDOA 4NO0A 3D0LB 5E4IA 5ALBL 2DTMH 1FORL 3L3IB 4L9DA 1UC6A 3VH8B 3V52L 4NFCA 5IP4A 2FWOA 1H3GA 1KJVB 3DVFA 4NKIL 2NLJA 2ZCKL 3OJVC 1GXEA 4JY5L 3I50H 3RGVC 3S96A 3P77B 3QNZB 3ARFC 3RTQB 3JWOL 4LGSB 1UFUA 3TN0D 4ORZC 3VD7A 2D0HA 1Q72L 1GAFL 1S7WA 2FEEL 1FO0L 4LVNC 4PTUA 1P6FA 3T2NH 1N59A 5KSBE 1CZ8H 4F33A 1E6JL 1YEHL 2OL3H 4HCRA 1N26A 2WWMC 3VRJB 1MCDA 3SE4A 4LSPL 4JKMA 3PWUB 1HIML 2R56L 3FB5A 4HXBH 4K7FA 5T3ZD 1QACA 4I2XB 4JN1L 1KIRA 5J3HD 4NQDE 4JRYE 1EEQA 3RRQA 3UJJH 3R1GH 1OPGH 2GJ6D 3DGGB 3V5KB 5D71L 3V6ZB 1FFOA 3FAWA 4RDQF 1YUHB 4YFDB 4U1KB 5IM7A 1D9KB 3MUJA 1QA9A 1VCAA 1U92B 3PXJA 2Z91B 1MHEB 4Z7QF 3V95A 4MDIB 4RFNC 3X11B 1RJYB 5I76A 4QYOB 3QQ4A 3CLFL 4XPBH 1K8DA 2YXFA 4XVUC 3NCYP 1G7IA 1BEYH 3HNTL 5EPMA 4NJ9H 5JOFA 3HI5H 4FQCH 1IC5L 4ERSL 4OZFG 3PHOB 4IHOB 2HTLC 4ONHA 1R5IB 2ENSA 1NANH 1CTOA 1IAOA 2JJTA 4XWGL 5T1KD 3C6LC 1OQXA 1QSFA 1HHIB 4HPOL 3QIBC 1CWVA 1EV2E 1Q9OA 1U0QA 2YMXH 4WO4B 4G6MH 4EI5B 4BELD 4LSVH 4H1LG 4GW1A 4PJIB 3CJJA 1MELA 3BGFB 2O5XH 1DQTA 4EI6B 4Y8AA 5EBGA 5ACMA 5D7JC 3CVHA 2FJFB 4JDZB 1QSEB 2UWEB 2OK0H 4OD2B 4FFYL 1JHLL 2VOTA 5FO9A 4M8VA 4M48L 2F8OA 4OI7A 1H3PL 3QRGH 2XKUA 5KOMC 4MXQA 4QWWD 1XF5A 4OQ1A 2ADIB 4U0RB 3MYJA 3QNXB 3VWJC 4UQ3B 4LIQL 4YDVA 2IFGA 1KT2A 3HPJB 5E03A 1TZHA 5FYJL 3KPLB 3LKSB 3H9SD 1U58A 1VKXB 5BOZG 5D2LB 2Y06L 2ZUYA 4JZOB 3RZCD 3T08A 3W0WB 2HJLB 2R9HD 4Y19A 3LN9A 4APQA 2H26B 4QNPE 1E0OB 1R6VA 1KN2H 4FOMA 5GGSY 1YYLL 4RBPH 4RMWA 2NY1B 4IIQA 4ZO8A 1IQDA 4NO2A 4M6ML 1JPGB 5JMRA 3IDUA 3MLXH 1E6OL 3RWDA 1MJJB 2VAAB 3QDJE 1A1OA 4H8WH 3THML 1I7ZA 2DQEL 1I9IH 1S7WB 1WQVT 5EDXA 4G6KL 5GS1B 2WQRA 4Y16A 2XZQL 2DJUA 3LB6C 3OPZL 4ALAL 1S8DA 3V0WH 4F33B 4XHJD 4X7DC 3QULA 4X7CC 1YMMD 2OZ4L 5C09E 3QUKB 2DQGH 4UB0L 3QIUB 3EOAA 1ZGLA 4MS8D 1JF5A 2IBGA 2RB8A 2XWBA 5DD3H 5FYKL 2AV1A 1CDHA 1D6EA 2E9IA 5CMAA 2HFTA 4MJID 2B5IB 3EYVB 4Y5YB 2Y36L 3RWFA 4KQ4L 3VFGL 1P1ZA 4RNRB 5DUBB 3UPAA 2VISA 3WFCL 1MCBA 1OSZB 3G5YB 3RVXD 1OP5K 3JSSA 3RVTD 2HN7A 3VD5A 1S7VA 3HB3D 5GGVY 3ULUL 4PRPE 2FIKA 5DQDL 3B9VA 1FZOA 1EAJA 4L9LA 4YPJA 5F1IB 3ES6A 1V3KA 4TTDD 1MLCB 5DD5H 2BVUA 1JGEA 5ITBH 3ARPA 4NM8L 4OUUA 4WEBL 4YFLI 3LPFA 4X6FA 1WT5C 5IGXL 4MJ5A 1RMFH 3L5WB 5D1XB 2WM0A 5E6IC 1QBAA 3AVEA 4JLRA 3JTCA 3MOBL 1QFWL 1RIHH 1NAKH 1Q9OB 15C8L 3D48R 1JN6B 3SO3B 4XXCA 3F65A 4OFDA 1E4XL 3BIAX 4GG8B 3BUYB 4OZFA 3WNMA 4LLQA 5CWSB 3FO2A 1R24A 4OFPA 1ZLUH 2OQJB 3VDBA 5C0BD 1BVZA 3L5XH 3UTTD 4K8RL 3P0GB 4DFHA 5JIPA 3HE7D 1IKNA 1T0NB 1XF5B 4JPVH 4QCIB 3VI3F 4NCC1 4JRXA 5C0IA 2EC9T 3VD9A 1R5WA 5I1CL 1KT2B 2WBJD 3RI5F 1IT9H 1A6AA 5TQ2L 4M5YL 4H1LA 1A64A 5KG9A 3WO4C 2NY6B 1C1EH 5ECJE 1KYOK 4XNXL 3PGCA 4WCYH 3TIDB 4OFVA 4CVZB 1U8LA 2QL1A 1IBGL 4O5LH 1AKJA 2HYMA 5HGDB 2X10A 4HS3B 1I3UA 4RMRA 4YR6B 4Y19B 3EGSA 2FH6A 3F12B 1BJ1H 4LASL 1KBGL 4QTHA 1KB9K 3MGTB 3IFPA 3OB0H 4QTIH 3LKOA 3TN0C 2MOVA 3RVWD 4FQ1H 4K3DH 1KEML 2B0SH 5TQ0L 3T0EA 1L7TH 4X4XA 2F53D 3ULSB 4KRMB 1LNUB 4TSAH 5CJ5A 4Y5VA 1WSST 4QXUH 3KR3L 4G8GD 2QKIB 1FZJB 1NDGA 4GG6A 5FV2A 3CDYA 3GI9L 2HVJB 3I9GH 3L95B 2VLRD 4IMKA 5CSZB 4IRJD 5JHDE 3UJIL 2Q87A 5HYJE 4OIIH 3RDTD 4NQEA 3SDDD 5DGRA 1MVFA 2XWBB 2CKBH 2AV1B 3MJ8B 3WS3B 1S7QA 3QUXD 5I1HL 1UXWA 4TNVK 3VFRB 3RWFB 1H8OA 2OSLA 3OAYK 4G80A 4MA8H 2Q8AL 3FN3A 4YZFE 1VPOL 1QPXA 3VU2A 5HYSG 4L4TA 5B8CA 5D70H 2P24B 1HDMA 2AP2A 4UU9B 1QO3A 1S7VB 2GSGA 3GKZA 4HUKB 1PZ5A 3DGCR 2IQ9H 3PGDB 3I6GB 3MRQB 1GGIH 5BOPA 4AMKL 1G7LA 2XY2A 5ANMB 4GO6B 1WV7T 5DEZA 4Q2ZA 4R7DB 4TUKH 3WIIH 3JTTA 3CXHK 1CICC 5H35A 1RHHA 3QPXL 2I07B 3QJHA 1EUUA 4JLRB 1CFQB 3NFPA 5IBTH 1ZLWH 4NQCD 1KLFA 4RMQA 4V1DD 3W5MA 1N0XH 4NDMA 4HUVA 1SM3H 4MNHA 5KSBA 2R0KL 2MWCA 3O2DH 1QRND 4OZFB 4KRNA 4Y4FB 4K7PY 1IGJA 3ALXA 4JKLA 2V6HA 2D4FA 3K2UH 4RGNB 3RGVA 4NHCL 4ZODA 2B1AH 1MREL 2VSCA 4NQDA 4JRYA 4FQPA 4FQ2H 2C3XA 1T5XA 1A6AB 3RZCC 2R9HC 3MLYH 5C9KA 1KCRH 2GUOA 3QUMA 2LV4A 4JAMB 3TCLB 4AG4L 3ME0A 4F7MB 1RU9H 4QXTA 1OGAD 4LQFH 4YDKL 1BQLH 1U91A 4OCLC 4QTHB 2DQIL 1NDMA 5IHBA 2H2PD 5B38G 4P3CH 4JFXA 4WFFD 5EU6B 4XRCA 1P69B 5J6GB 2YHGA 3PDOB 2DBLL 2K7PA 4JPIA 4YE4L 4DAGL 4R9HA 2VDML 3PNWA 4Y4HD 2Y07H 1IEBA 3NH7L 3AREB 3QIWC 2F19H 2OJEA 4FMKA 1NDGB 4PJ5E 4TVPD 4PJBA 3DYMA 4MS8C 3MV01 4YPGA 5E8DH 3MXWL 4OJFH 1YECL 2R0LL 1UB5B 3BOVA 1KJ3H 4L3ED 3FQXA 1JWSB 1DQLL 4MX7B 4HEME 1KGCD 4JANB 3BZDA 4LDLB 1KLGA 1WWAX 1XFPA 3T8XA 1RI8A 1TJHH 3VFNA 4PB0L 3GUTA 1S7QB 3AS0A 5C3TA 1IAII 5D7IF 1BM3L 1WF5A 3I75A 2FGZA 3BISA 4L4TB 3MV8B 3FQTA 5KAQG 5TDNB 5I8KH 2ZUXA 1EHLL 1QO3B 3U1SH 1NFIB 2C4FU 4EOWH 1QG3A 4WU7B 3KHQA 5IW6B 2IFFL 4Z7WF 3WL9A 3RWCB 1OCWL 2ZUSA 4L8BA