3UPRA

Hla-b*57:01 complexed to pep-v and abacavir
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
275
structure length
275
Chain Sequence
SHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRMAPRAPWIEQEGPEYWDGETRNMKASAQTYRENLRIALRYYNQSEAGSHIIQVMYGCDVGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Drug hypersensitivity caused by alteration of the MHC-presented self-peptide repertoire.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, B-57 alpha chain
total genus 77
structure length 275
sequence length 275
chains with identical sequence C
ec nomenclature
pdb deposition date 2011-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3uprA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3uprA01
2D0GA 1UB6A 5FCSH 2W38A 3QJHB 1IGFH 4X7EC 1FYTE 3VXTB 3QCTL 4XVUC 2XNAB 4QRRE 4M5ZH 3KHQA 1ZA6A 4K23H 4NQEB 1XMWA 3M17B 3WJLA 3FB6B 1S7SB 1UM5L 5C0IA 4M7JL 2C3VB 1CFVH 4ESKA 3GIVA 2SEBA 3CZFA 3UJIH 2GI7A 3MA7A 3JXAA 1AD0A 1O7SA 3TJEH 3UPRA 4GBXB 4NHCL 2O93L 5T1MA 3MRBA 4P5MB 4K9EH 4N8CH 4H0GA 4UT7H 2FECI 4ZUWB 3GM0A 4G80A 1OPGH 4QHMA 3FFDB 2VC2H 3L3OB 2CLZB 1U3HA 3BFOA 2HH0H 2BX5A 4M03A 5HYSG 1W0VA 2QADB 1LDPL 1FFOB 4YNYA 3VWKD 4KMQA 2W07A 4D8PB 5D2LA 2AKRA 3EDKA 1HSAB 3WIIL 5IHZA 4AMKH 1P9MA 2HFEA 4L4JA 4LP5A 2V6HA 1VPOH 2HVKB 5D2NB 1D6EB 3CC5A 3MLRH 5IB3A 4YHKH 4P2OC 2ED7A 2VDRH 1AQKL 1CE1H 2VUYA 5IBUG 4U1KB 3H9HB 2DS4A 1FNLA 1SJXA 5ESAB 2V17H 4GKSA 5EU7E 2FO4A 1L6XA 1U91B 5TF1H 5HY9A 4LSRL 4S2SB 4K8RC 3SKMB 1KN2L 1OP5K 5TH2B 2N1KA 4GKNA 3PP4L 5CUSL 5FYKD 1W0WB 5L2KA 4AEEA 1AGEB 2Z4QA 1Q0YL 1G9MH 1UCBL 1X4YA 4B41A 3TFKA 1HXYB 5D7IE 3VXNA 4NJ9H 3JWOH 4FP8H 1E27B 2CKBB 2Q86A 4APQD 4PJDF 3V6OC 3E6FA 3QDGE 1FNGB 3EYQC 4X8XA 2YKLH 1VFUA 4WGVB 3O4LB 1BFOA 3STLA 1U58A 4APQB 3DRQB 2EIDA 4U1SA 4MXVE 1L7IH 2XQYK 5FKAB 4KTEL 5CEZL 3B9AA 5DK3A 1ACYH 2YA1A 3O4LD 1E6JH 4W81A 4QHLA 3VXUD 2G60H 5K33A 4JN1L 3X3FH 2X41A 4XP9H 2YUWA 3LVEA 4OLWL 4YXLH 3UBXG 1PFCA 4MMZC 1PKQE 1S7WB 3ARBA 2BNRB 4EDXB 1U41A 2IMMA 2Z35B 1X6LA 3VG0L 3IAPA 4G8GD 1D6EA 4YDKL 4ZYKA 4OF6A 2IAMB 5CJBA 3VD9A 4QXTA 4LVNB 4J3XA 1KPRA 4X6CB 4Z5RB 3UBXI 32C2A 3H3PL 4AEFA 1X7QA 3H9SB 1HXMB 1JPTH 2ZPKH 3D3VB 4ALAL 2QQLH 4MB4A 3L6FA 1A5FL 2ZNXA 3OGCA 3STZA 2C4XA 4NN5B 3D2UD 2YPVH 2XWJB 2VXVH 3G5VB 3VXNB 3FHQA 5AZ2H 4JY6B 1E27A 2CKBA 2Q86B 3JWDC 4URTB 3U4BH 1G6RB 4L5FH 4OUUA 1F6FB 5HVHB 2NXYB 4WU5A 5MI0B 3BJLA 4OZGE 2DLIA 4XNQB 4XVTH 3ARSA 3NAAH 4XMPH 2HVJA 2W65B 5JHDB 3DX9A 2NQCA 4OM0L 2OTWB 2OL3A 5E8OA 1GRWA 4KKBC 1SYSA 3LS4H 3LKRA 3E2HB 4J8RA 4YXHH 2W92A 4GRLC 4Y0GA 3RWFB 1MRCH 1GVIA 2M2DA 2YPLD 1LMKA 3DI3B 1LNUB 4PJAE 3T1FA 5KOVC 1N2RA 2V7NB 1GOGA 4Z77A 2LVCA 2NTFA 5DZNA 2OL3L 2W0PA 3TT3H 1UQSA 2ED9A 3WIHL 5I30H 1JGUL 2DMKA 3QIWB 4AG4L 4QXTB 5IEKB 5ALCL 3NN8B 4WFFD 32C2B 5D7SH 4M6ML 4Y5XC 4N0UE 1A2YA 5E1AB 1NMAH 3VFGL 3VDCA 3D3VA 4U7MA 3SCMA 5IB1A 4XPBL 4M8VA 5GRUH 4JQVC 4JG0H 2YC1B 3T8XA 2D7MA 3FL7A 3LH2L 4WI4A 4R3SA 4NFCA 3WIHH 3QI9C 3RP1A 1Z9SA 2R1XA 4UOJA 1HIMH 4HGKC 4MS8C 3UO1L 1FGNL 1YMHB 2VN4A 3MYZA 4L4TB 5DQJB 1PVHA 4HJ0D 1K6QL 4UTBL 4HH9B 1OGTA 3FCTA 4IRJA 4UQ3A 5IIEB 2IQ9L 4JGMA 3MO1A 5JDJA 4JFXA 1MRFL 1R3KA 4IHOB 4JZOA 2IBGA 1DBAL 1NMBL 4I18A 3CLEH 2R69L 3C2AH 2H32A 4JKWA 4XBGB 4Z7VB 1H0DA 1A7RH 5AZ2L 1MCHA 3C9NB 5ESVA 3EW3B 4HKXB 1BZ7B 1EHLH 4LCWB 1FAKT 1DFBL 5E2TL 1UVQA 3H7BB 3QUZB 1ZLSL 2VLRD 3KLHD 3EJZD 2EO9A 5C7XH 3TNNA 1U8HB 4LLMA 4ODXB 3VXPB 5HYJD 4J3OC 3PG2A 2HVKA 1TIUA 4WFEE 1G0DA 1ZLUH 2LU7A 1CTNA 4U7KA 3QQ9D 1WIPA 4W6XB 1DBJH 4GAJL 4N0RA 5KSAC 3KYMB 4RGND 1VACA 2YPLB 4GKSB 1AY1L 5DRNB 5TF1L 4MNGB 3QPXH 2G5BB 4F9PC 5HY9B 1MFBH 2VQUA 1OTSC 1CT8A 1B0RA 5IF0B 3VI3E 4GKNB 1QO3A 4G8GA 1E4KC 1V3MA 4HUKB 4YQXH 4Z7UA 4FXLA 1JFMA 1RUQH 4GAJH 4JFFD 4ODVL 5E8DL 5F1NA 1AGFA 1T5WB 2YD2A 3FMGL 2YUZA 3MOQA 2V2XA 3SDAA 4L4VB 4TULL 4HUWB 4LOUD 4JZOB 3JTCA 3OAYH 4JY4B 4PJHB 3O3EB 3IFOB 4M7KH 4P23C 3ZDZF 1QLFB 3E6HA 2VWEE 5BXFA 4H8WL 2NY2D 1VFAB 3C08L 4OFIA 4I2XE 5ENWA 2I9TB 3KLSA 5TDNB 3TO2A 4Z7UE 2KQNA 4D0DB 4UINL 3D0VB 3SQBA 3LPFA 1C5CH 4EDXA 2EC9T 4O2EA 3FB5B 3L3HB 3PNWB 3WFEH 4XNQA 4PLNC 2IAMA 3RWHA 2BOBA 2NR6C 3ZHDA 5EU3A 5DURB 3UYOD 2JJUA 3HE7D 2YPLA 3CXDH 3BIKA 4ZO9A 4OV6F 2EDHA 5HHMB 9CGTA 5IHLB 2XTJB 4ODBD 4X9FA 5F7NC 3MNWA 2FIRT 3BQUC 4Y89A 5DD0L 1KC5L 1VEMA 4JFHD 3UTTE 3G08A 1BQLL 4G42B 1T04B 1T66D 2GKIA 3ZDYF 1WZLA 1JZ5A 1MCJA 2DWEA 4YZFE 4XPGH 5C6TL 4DKFL 4GRWE 3VH8B 5GPRA 4ZFGL 3FKUS 1PX3A 5SWZE 3HFML 5F96L 1LDPH 1UM6H 1MCOH 2VXQL 5KG9A 1NFDE 3OX8A 5B8CA 4CJ0A 1I9RL 2PN5A 4PP2B 1WWCA 2W9EL 1UWXK 1H3TA 5DHVH 4FFEX 5C6PB 5E8NA 1Q9LB 4NQEA 3BIAX 4MNQD 4BUHA 3I3EA 3V6ZB 3OF6D 5EO9B 5CBEB 4LLWA 3CFBB 4MMXC 4MYWB 4V2BA 4X8JB 5GS1B 3ALPA 1D5BA 4FN0A 5EUOA 1JYXA 3QEHA 2NXZC 3EO9L 3IS1X 3FT2B 4KKBD 3MGTA 2MKLC 1Q0YH 3FAWA 5FV1L 5T3XL 1ORQB 4R4FL 1TTGA 1DBBL 4K3HA 5BRZE 4L8SB 5HI5C 1TQCB 5I1CL 2HN7A 3VXRA 1LP9F 4MAYB 3S34L 4Z18A 3UJTH 4K55A 15C8H 3MV9A 3FFDA 2DIJA 4RZCA 2BVYA 1UZ8B 5C0CE 5JW4Q 3X13B 1LO3H 3QDGD 5BS0D 4ZFFB 4OLYL 3N0PB 2H6PA 4W6WB 2Y1VA 4YNYB 4EXKA 2P5ED 4HIHA 1W72H 2XG5A 1KEMH 1OY3B 4NWTH 5B39G 1UWGL 4GH7B 2VZVA 5D2NA 2MQ0A 5I17A 3JWDL 2HT3D 4Z95H 1YN7B 3VH8A 2XFXA 4U1KA 4HBQA 3T2NL 3MSPA 1P53A 2ORBL 4X6EB 1F6LL 2EDBA 1QSED 4HT1L 4LCIL 4JY5H 1A6ZA 1KF9B 3VXSE 3WD5H 3T0XA 3TBSB 5GGQL 1YJDL 3MLSH 5T5NF 1AGCB 4TUKH 4PBWD 2FX7H 2H2PC 3K0WA 5GGTA 2CIIB 3WLBB 4K7FA 5FDWA 1V8HA 3U2SA 5EBMA 3V0WL 2JE8A 3GSRB 2O5XL 1JRHI 2CLRA 3RTQC 3VMNA 3MRQA 3QDGB 1ULVA 4GG8B 4ZOAA 4EI5D 2OS7A 4D9LH 2AXGA 3GMQB 4QRUA 2BZDA 3BE1L 5IFAH 3O3BB 5EPMA 4GXVL 5D72H 1PBYA 4TUOA 3HB3D 5C1MB 2VZOA 3RWGB 3JV0A 3BSZH 3BAEL 1YNTA 3CSBA 3SJVA 1RZ7H 2DTMH 4ZXBA 2EKJA 1WAAF 3ULSA 2ADGB 2AJYL 3KYMA 4ZFFA 1Q9OA 4JLRB 3CCHA 4AT6A 4P4KC 1W0YT 4M62L 1R3JB 1WCBB 3DRTA 3MR9A 5DVMA 3P9LB 5HPMA 3RIFF 3NCCB 5IQ7L 1VDGA 3TF7C 1DUYB 1U8QA 1JVKA 1T83A 2YD3A 5FGCB 4PG2C 3RNQB 2QQNL 1A1NA 3PWPD 2XOTA 2B5IC 4U1NA 4A2MA 4I0PC 4FFWD 4JKMA 2EIBA 4P2QD 3H9SA 5CKAA 1XGQA 1E4KA 1ZT4A 4TUJA 3LD8C 2Y6SD 2V9QA 3LQMA 2IFFL 5EIIB 4CAGA 5IVXF 1TDQA 3EFDH 1JHKH 3RWEB 4LGRB 4QOKD 3DVGA 4R96B 2FSEB 1KLFA 5GS2D 1C5DB 4JPWH 2OLDA 3KWWA 3V5HA 4YGAB 4JN2B 1DEEB 4K3EL 5DHYA 4C56D 5CZVL 5GGRY 5DJ0B 1OPGL 3G6JE 5FCUH 3TPKA 1X5AA 5KVDH 2VIRA 5TGBA 1S7TB 4D94A 1FPTH 3MJ9A 3OKEA 4NO3B 5B4MD 5J13B 3QPXL 3NIGE 1JGEA 1FV1B 1JNHB 2NY0D 4DZ8A 1CGSL 3P73B 4MNQA 4QNPF 2X1WL 3B4NA 1WUNT 3MLTB 5CGTA 3UZEA 1H15A 1BGXL 3NA9H 1MI5E 4F58H 3V6BR 2M8XA 1AQKH 3K8MA 4ZXBC 1KJMA 2XTJE 4QY8A 2HRPL 3BZFB 3EUUA 2R2EA 1N8ZB 4ENED 3DVIA 2X4PA 1DUYA 1U8QB 3N9GH 3VFRB 3MOBL 5H37G 5J9PB 4OCRL 1PEZA 1A47A 2BNQB 1MSPA 2GJ6B 4XBPB 3OKMB 4PJGA 3NH7L 2XXCB 4H8WH 3U36B 5KG9B 2XQBL 1HI6A 3RGHA 2EDFA 3CX2A 1U8OA 2Y9RT 4Q9QH 2VL4A 3MLUL 4YGVB 3RPIA 3C5JB 2BRRL 4JPKL 3BZEA 1NEZG 4EBQL 5DMJB 1BVZA 4HWBA 1KFAH 2NY5L 5JOFA 1F3DJ 2ZG3A 4LLQA 3RL2B 4E0RB 1KLGA 4FABH 4UTAH 4X6DB 3P9MA 2JELH 3P40A 3W5NA 1NEUA 3WLWC 2DQTL 2F8VA 1M1SA 4FQCH 5IHUH 1NGWA 2BY3A 1YYLH 4LVNC 3MBED 2H3NB 3TBSA 1RUQL 2NXZD 1H15B 1IILE 1UACH 2P46B 2ATPA 2LFGA 3O8XD 3HE6B 3TV3H 2R8SL 3QO1A 3FRUB 4PJ7A 5C09D 3CMGA 4WUUD 4OCSH 5T33H 3AAZA 1FAIL 1YEKL 1U8JB 5CILL 1A6VH 2D4DA 1N5AA 2D7TH 4P59H 2WAHA 4KRPC 5L8LB 4NQXB 2AXJA 1LEGB 1ZGLM 2XFXB 3GIZL 4PJ8B 2YBRA 1OGAA 1D5MB 4JVPA 3VRIA 5I76B 4DCQB 1GJIA 2UWEB 3L3DA 1RHHB 2OSLB 4HUXA 4M43L 1CT8B 2CK0L 4GRLA 1OQXA 1FHGA 4KKLC 1IEAB 4NRYA 4DW2L 5C2BH 4NQUA 4M8QA 3K46A 4WO4B 5FYLD 1XFPA 1JGVH 5I15L 2I9LA 4NIKB 4QTIH 2FR4A 3LAFA 5FEBA 3ARDB 1FO0L 1F8TH 1NFIB 4PRDB 2CDGB 2JJTA 5HYSB 4QRQB 3CDGB 5B22A 5CP3H 4XMLL 5C08E 3KPOA 5KSVA 3ABZA 3BP5B 4XBEL 3H3PH 4PRPD 5HHOD 1INDH 2NY4C 3ZL4H 4CADA 2VL5A 1EHAA 1J1PH 4I48B 5TJWK 4C56A 2X89A 3DIFB 1N5YL 4NUJB 4XNMA 4M3JA 4HBCH 2Y06H 4PRNB 4ZFZA 3V5HB 1IC7H 4M6MH 3PHSA 4QCIA 2MCPH 5CHNA 1CFQB 1OTTD 1U8JA 3TYGH 1JTOA 3GHBL 4QHUB 4HIIA 3DYOA 3FB5A 4M5YH 4N9OB 1S78D 2D4FA 4U4BA 1NCTA 2LV4A 3OWEA 2HLFC 3RVXC 5EU3B 1QBBA 1C08A 5D1XA 2CIKA 3CD4A 5C08D 1WWBX 3PWUB 2WY3A 4JAMB 4DCQA 4PGBB 3ARED 1NANH 4MA1C 3MLZL 4LRNH 3AM8C 3U83A 5F8RC 1WK0A 2HYMA 5F6HJ 1MRCL 2AQ1A 4PJDA 3P4MB 5FYJE 3PQYB 5T1DL 2ZP0T 1WFNA 3MRKA 5FA3B 1P5UA 1UXSB 4U2YA 3C8HA 5HYJE 3NBNA 1PG7L 1P4BL 1PAMA 2FWOA 3HAEH 2FBJL 2W60B 1J1OL 5I8EB 5M95B 2ADJA 1KCKA 4M02A 5IQ9B 1AC6A 1TJGL 1RIVH 2E9JA 3MPCA 5GQBA 4DGVH 1JN6B 1JJUA 4IOIB 5DGQA 5JW5A 3Q5OA 4WTZA 4N0UB 5DJ8A 4Z8FL 4XVSH 3RPIB 4D0CB 2ZZUT 4L8DA 4NGHH 5C07A 4JR9L 2K7QA 2P8LB 5ILTL 4JRXE 1MCSA 2BY1A 4RMQA 3K3QA 1XGPB 4QY8B 3W9EB 4LSSH 4PTTA 5EDXA 4DK3A 4QRTA 3QRGL 5GRJL 1FVDB 3RI5F 1FH5L 4FHBD 2R2CA 3G04B 3MGTB 2HH0L 4KDVA 4MHHG 4X9GA 3VFUB 1JHLL 5JXAH 4Z8FH 5F44A 5EU6E 1CFBA 1QRND 2E27L 3QDJB 2BVUA 4MX7B 4YBQD 3TBTA 4WUUA 4I18C 5CP3A 1J0ZA 3LB6D 2UVEA 1P84K 4HLJA 4LLYA 4PRAB 5EUOE 1IMHC 5KAQG 1EFQA 2APBA 3TJHC 4HIHB 4G6KL 2DQHL 1QLEH 4JFDB 2F74A 5GGTH 2KQMA 3SQOH 4PYGA 3VGEA 2F53B 3QYCA 3VI3F 3R8BB 5DD5L 4PRIB 4RIRB 1OAYL 2B39A 4JVUA 5L6YH 5K93A 1BJ8A 4AH2B 1FO0H 5DJ6A 3V5DA 5DRXB 3CC5B 2BVQA 4TVPD 5F9AC 5J1AB 4DN3L 3FN0L 4CMMA 2HJLB 3EO0A 3WHE1 4YHIB 3CVHA 5DI8A 1YEGH 2BVOA 4NZJA 1U91A 3JTSB 4A6YH 2X4OB 2BHUA 3SKMA 5DJZA 3N9GL 4UI2A 2PXYA 1AGEA 2Z4QB 5FYKE 3INUH 3S35X 1ZLVK 2WANA 2DQJH 3CH8A 4MXWL 3CDGA 4P9HL 3QUML 4RSVA 5CIPA 3QEQB 1QFOA 3D85B 1Q94A 1YEHH 1NGPH 2VDQL 2X89D 1FNSH 5FYLH 2AAVA 1J7VR 2VQ1B 1A6AA 1PKQA 3V0VB 2DMCA 4PJBE 2DM3A 1BP3B 1I1RA 1HNGA 5H35A 4ZTOL 2VLRE 3DRTB 5IMKA 4FXGA 3AXLB 3D39D 4J2XA 3CIQA 4DN4L 3S88L 2FR4B 5D1QB 5BMFH 4J6RH 3BIBX 5BVJA 2XTJD 4BELD 3UTSA 2X4QB 4B50A 2PYEA 1A3RH 2RCSH 3RVWC 1QACA 3T0ED 1F00I 1HDMB 2F8XC 4LK4A 1AC0A 1QSZA 1U92B 3KPRE 2E3VA 3MRPA 2XWTB 2F54E 4WRLA 4D0BB 4OI9A 3KNBA 4Q9RH 4JFFE 4MAYD 5FA3A 1X5LA 2A2QT 3OJDA 3OKOB 3CAFA 3RU8H 2C3HA 1S9WB 1H5BA 1BM3L 1UKQA 2ESVA 4LQ1A 5JIKA 4L1DA 4U6YB 5GRWA 3MXWH 2RB8A 4HX1A 5DJ8B 4X6CE 1C8PA 2AJZB 1WBXA 3M1BB 4W4OA 3O9WD 4GMTH 4BFGA 4UTAL 3IJYA 4KC3B 1S7UA 4WHYH 1NCNA 3BHBA 3HC4L 3MNZA 2NPLX 3BZFA 1QR4A 4GAFB 3BN9C 3OKYA 4ORGA 1KXVC 4HT1H 4JREB 5KSUA 1U3YA 1KIRA 4FXGB 3FFCE 3QUXC 2HJFB 1A6PA 5DJAB 4KQ4H 1YJDH 3MLSL 2ICWA 5F7UA 2BNQA 5CKGA 4GW1A 5IG7B 4PRBA 2UYLA 4P23D 3G6AA 4V1DE 4HH8A 2G9HB 4Q7DA 1ND0A 3KG5A 3D25B 5FHAH 3IXAA 3N06B 3QHTC 4RRPG 5CS7A 1S8DA 1G7PB 4ODHL 2AW2A 4TOYH 1FZMA 1T0MA 2AJVL 1UB5B 3M45A 4S0TD 1IGFL 1BEYH 4PJXA 5F21B 3LS5L 5IB1B 1UADC 2Y4SA 2ZJSH 3SEPA 3K81A 3PL6B 3BD5A 2ZUWA 5JA8B 1A14L 1GC1L 1Y0LA 4I1NB 1OW0A 4OD3H 1BD2B 1A64A 1FH5H 1NAKL 5HYFA 1B90A 1NL0L 4PDCE 4OCWH 4KMTL 4OCLC 4AH2A 5D1ZC 1C7SA 4WJ5A 4S0UC 3LN5B 4NQVB 3IB4A 4ZD3H 1G1YA 2ZG1A 1OGTB 3DVNA 3B9DA 1MREH 2Y25A 3FQWB 3GSWB 3MLYH 1N59B 3L3KB 1X5ZA 4RFEA 4KUZL 4LKCA 4PJEB 3MCG1 4QOKE 3S3PA 3UROR 5C86A 4KDTC 4OZHE 4GG6B 4B7IA 5JIIA 1L7IL 5HYQB 1CXEA 1ZVYA 3MBEC 2WMPA 3D5OF 2EYRA 3MYJA 2EIZA 4JZJC 3ZE0E 3GSNL 4JJ5B 3P77A 4U1GC 3BISA 4K71C 4RCAA 2XRAH 4PJEE 2AV7A 4QOKB 3ARFC 3O9WB 4OZIB 5DD3H 4E41B 3PGCB 3CFKA 3C60A 3RDTC 4C55A 5L6YL 2JCCA 2R69H 1CYGA 3UTQA 2DQEL 5DT1H 1SJHB 4G6MH 2FEDD 1NDGA 2DIBA 4XP1L 5A43C 4XPAH 3KPRB 4ONGH 3WHXB 3ARDC 5F97E 3RX7A 3HPLB 2NY7L 2CLZA 3ECBB 5F8QC 4Y4HA 1G7JB 2CR6A 3HN3A 1SY6H 5DJZB 4YIQA 1NBYA 2ZPKL 2C7UA 2V5RA 3MGOB 4OB5H 2CMRL 3ZKNC 5LXGH 1JYWA 3SDYL 4A6YA 2F5AL 5IMMA 3CFCH 3SGEH 5GRVL 3VFOB 2OX5A 4WJ5B 1U93B 2HRPH 3QEQA 1RUAL 5F1NB 1UEYA 4JFED 2PXYC 4MLSA 3NPZB 4BZ1H 1HH9B 5D7JC 4WHDA 5E9DA 4H26A 1SY6L 1I3UA 4P2RD 5KZCB 5LKNA 1FVEA 2VISA 1RJLB 3FO0L 2CJUL 2VXSH 1CF8H 3O6KH 2JB5H 4KRMB 4OFKA 5GISL 2EYRB 3GK8H 2NY3D 2X4RB 1A0QH 4J23A 4NNXA 3T2QA 1LP9E 3FOLA 3T04D 1B0GB 4NNYA 4L3ED 2NY3B 3LQZB 2C3WA 4J6RL 4LHUD 1KENH 1R6VA 5BRZA 4PJ9B 2X4QA 1CD1A 2R1YB 2L4OA 4U33A 4B53A 2NY1D 1MWAA 4WEBL 2EO1A 1DN2A 2P5WD 4G3YL 1TQBB 1Z6JT 3QA3A 2FNBA 3D87B 4ORGB 4L4TD 3GEWB 3MODL 3GB7B 4K8RD 2V5MA 1FNAA 4NFBA 4XP5H 2QSQA 4K3DH 3SE3A 1I85A 3CX5K 4JO3H 5E03A 3FONB 2ICWB 3UP1A 3G5ZB 3ZMRA 2BNRA 4I3SH 3F7VA 4GW1B 3MRIA 2HLAA 1UFUA 5DUML 5DQDH 3HTLX 1FYTA 1TQCC 1AFVH 4GSDH 3EYSL 4MA8H 5HBBA 3KPLA 4YC2B 1UB5A 1YEKH 5CILH 3V4PL 5LQBL 1M7IB 1LGVA 1PEWA 5F9WB 3WNLA 3OPZH 1FIEA 4NC0B 3W5MA 2EDRA 5FUOH 4NHUE 5LXGL 4H5SA 3IDYC 3PL6A 1QLRB 1FJ1A 3DOSA 4P3CH 1CDUA 1DBAH 2AK1H 4DN3H 1OQOA 1DQLL 1S7RA 3IDIB 5CWSB 1RUAH 1MFDL 5AYUL 3R06A 3MCLL 1IGJB 1WAAE 2GK0B 4LDEB 3KPSE 1FL3B 5EO0A 4PLJD 2WUCL 1GIGL 4KKAC 3WUWG 3HNVL 1WGOA 3ARYA 4V2CB 1QRKA 3HE6D 5HHNB 1SY6A 5IG7A 1J05A 2EDOA 1BOGA 1IGTB 3LEXB 5BO1H 3QHZH 4MGXA 3ME0A 1ZLWH 2JB5L 5ACZA 4LCUA 4WUUB 2QQNH 4IOFD 1RVFH 2ZUQB 3DX9B 3U0WH 1P1ZB 1NC4D 5F1SA 2YUVA 5INCA 5JPNA 4N8VB 5CZXD 1MFDH 3P0GB 1KCVL 1JNLH 4JZJB 1BOYA 2B4CC 2OQJB 3T4AB 4CW1A 3RWFA 1HKLL 5E2VL 1SQ2N 1DVFB 1UJTA 4BSVA 5JQHC 2J8UF 1URLA 4G8EB 4UIMB 2VERN 3NH7H 2OJZH 5DD1H 5EO1A 1HQRB 1SEQH 5IVOA 4EVNB 5EZLB 3CXDL 5DVOA 3GMNA 2DBJA 2BNUB 4JQVA 2Y36L 1NDGB 3QCVH 3HMXL 3H9SE 4ZD3L 4OLZL 3D6GA 3NZ8A 3EO0B 3DPBA 3WUZA 5JTWA 3WHXA 2XA8L 1XCTA 5MERA 4G6JL 3DURB 3BJ91 3MV7B 4P2OD 4KI5E 2FJFA 3NMEA 2VXTH 4G43B 5DD6A 1QSFE 5E70A 3M17A 4RGMC 1S9XB 5GS3A 1FVCB 2GT9B 4PLJC 4DZBA 4BSWB 3R06B 3MYJB 2OP4L 2SEBB 1RV6X 4GMSH 4R0LA 1N0LA 4P5KA 1AD0B 4MQSB 4N1EA 1BVLA 4WEUD 1F4WH 2X10A 2VC2L 4OZIA 4DKDC 3H3BC 6FABH 5IVXB 2EDKA 2FLRT 2D7PA 1CDGA 5ACLA 2P47B 4FG6C 4X9IA 1I1AA 5L2JB 2Y07H 1YNTB 4PV9B 4KPHL 5I66A 5K9OA 3HZYA 1HHHA 4DVBB 5EZJA 4HKXA 1BZ7A 4P2YA 1FO0B 4JRYA 2V5YA 2R0LL 1A7OL 3JWOC 1DEDA 1UVQB 2IADA 4M6NH 4J4PA 5DFVC 3T77A 2HKHH 4NNPH 1QOKA 1IM9D 3DNKA 4X5WA 5D2LE 5JXED 5KANI 3BP7A 2HFEB 4MA3A 4OF3A 1YA5A 5I1CH 2J7LA 3MLXH 1XR8A 2AGJH 2C3GA 3ULUF 4Z7QE 3AY4C 4YK4B 1BBDL 1XGQB 4NBYB 2I25N 3LPWA 1OD7A 4CMHC 2CDFB 4Y5XA 5FA4B 1FVEB 2VISB 3DARA 1CXHA 1K2DB 1IGML 4KGLA 1L7TH 1LP9A 4TPRL 2CPCA 5F72S 4F7PB 2WIIA 1OAZL 3G5ZA 3UBXA 1JF1A 4Q9RL 4C54A 4PRIE 4LP4A 4X4ME 5H2BB 4OFDA 3ULVL 1ZGLB 4KHXL 1U8KB 1A9EB 4UB0H 3QIUD 4XP1H 5D7JA 1BVLB 1B0GA 1PGRB 3SQOL 5DO2D 2R0KH 3R0MA 1DLHB 1RIVL 2AJZA 4WDIB 1AIFA 1N3NB 4MJ2A 3PQYE 1S7UB 5LVEA 2R1YA 3BRGC 3EOAB 3BEVB 4WW2C 1V3JA 1X4XA 4LMQI 5IEHB 2AXFB 5CMAA 4M9OA 1QFUH 3WKNA 3QHZL 5KSAD 3ARGA 1MI5D 1S7RB 5CBAB 4G7VL 2AI0H 5TE6H 3TWCL 1JPSH 5TDNA 4O4YH 3FMGH 1FGVL 5J3HC 1FL3A 1WV7T 4LSDA 3WO3B 1I4FB 4FNLL 4KQ4L 4PJ5E 3GSQA 1WZKA 4YDVB 4AENA 4WI6A 4GS7B 1RZKL 4OT1H 5HGAB 3CFIC 3UEZA 2DQUH 4O5LH 3UPRB 4TVPH 3VGBA 1KPRB 1D3CA 5F96H 4JDTH 3H3KA 2PYFA 4PJGB 4UDTB 1RI8A 5JIHA 4HK0B 4ODSH 1IM9B 3HI6L 2KH2B 1DQJA 1TPXC 5DWUL 5ERWB 3LS5H 1U8MA 5I73B 3F65A 1WF5A 5C0AD 4DVRL 5I1IL 2RBLA 3EO1A 4EQ3A 1AHWB 4X80L 4FRWA 4X6FA 2CKNA 1SMOA 1MF2L 2FIKA 4F15C 3T0EE 3ARXA 4U0RC 2ZOLB 5CSZA 5D6DC 1YY9D 2NXYC 5AWNH 1BOGB 2ICWI 4FQLL 1ZHLA 1XF5A 4LKCB 4YPGB 1K8DA 7CGTA 1NAMB 4XH2A 3C2AL 1P1ZA 2D31B 1NMBH 2XQYG 3FTGB 1IC5H 4XXDB 4F57L 4Z7VA 3UJIL 4Z7OE 3MJ6A 4UB0L 1A3RL 2RCSL 1BAFL 1RD6A 2EIZB 5FYJU 3V6ZA 1HHIB 1CR9L 1DLFL 4PJBA 3O9WC 5CEZD 1T03L 3VG9B 2UVFA 4P5KB 1JPTL 3QUZA 3F58L 3BQUD 3QEHB 1F6AB 2QQLL 4MJ5B 1CGYA 1MJ7L 2Q7YB 1Z0NA 4HHAB 3O4LA 4FTVD 1N0XL 5KBNC 1KB5A 1R3IH 1UCTA 2WBJB 3IAGC 3LH2H 3PDOA 3MZTA 4OTXL 5ELIA 1JNNL 3HC0B 1QUNA 4DGYH 5DJXB 4J4PD 3HG1E 2GUOA 1IM9A 2UWEA 5C8JB 4JRYB 5FYKL 3REWB 5CSBA 3NTCL 3IDUA 3P30L 5I8KH 2EYTB 1J8KA 4R4BB 3QUMB 1CLOL 4QGYA 4Z7WA 3ULUH 1C5BH 5IOPA 4M1CC 5IW1A 2GT9A 5IMMB 2W0FA 4ELMF 1T1WA 4CU7A 4OZFH 5DMGD 3VFOA 5CGMA 1IAOB 5CZKA 3LHPH 5CZVH 4WWKB 1OHQA 2Z9TA 3H0TB 5E9DB 4YHYC 1XF5B 2HA1A 3RZCC 4L4VA 5EFIA 1XF3B 1QR1A 4M3KB 5C0AB 1MNUH 3OB8A 4R0LC 3QIUA 1P4LB 2BMKB 2CIIA 4GRWH 1V7MH 4NNXB 4ZO7A 5GSRA 4UILL 2IH1A 2B4CL 5HVHC 1HEZA 2CUMA 4NNYB 1HILB 1RZJL 4HUUA 5BS0E 3QZWA 3Q1SL 4D0DA 5IBLC 2R4SL 4OLEA 3FQNA 5F6IC 5GJSL 5I1AA 3DTXB 5T1DH 5B39A 4G6JH 4TUOB 3D18A 2AXHA 4WDIA 5KSAA 4NDMB 4RGNC 3QUYC 1FL5B 3IJHB 3IXTB 2L7JA 3QWRD 1C08B 3O2WL 3SJVB 5CMAB 3SCMC 1RZFH 4HWEL 3RBSA 3MLVL 1X7QB 1B2WH 3W2DH 1EO5A 3CFCL 4JDTL 2CDFA 3UTSE 4TQEH 3V6FB 4IIQC 3QR2A 3WN5C 3EJZC 2AJSH 3DV6A 4LIQE 4YR6A 2ZUVA 5IW1B 5ETUB 2HLAB 2I5YH 2V2WB 5H2BA 1RQ5A 2A6IA 1U8KA 3AY4A 4IOSD 1NCWH 1ZA3A 1DFBH 1YN6B 4JHWH 5AUMB 4Z6AT 4MCYA 1KV3A 5DUBB 4NQEE 5E2VH 1U3JA 3IFPA 1M7IA 5TQ2H 2HWZH 1FE8H 4RMUA 3O4OC 1XF3A 1QR1B 3U30C 1J11A 1FSKC 4NQCD 4K07A 1HSBA 1OLLA 3RZCA 2FSEA 5IVNA 1I8MA 5BW7A 1FJ1B 3KR3H 2D9QB 4KTEH 5CEZH 1MQ8A 1QYGL 3QUYD 5IMOA 4JM2D 5AYUH 3ZLQC 4IRJD 1YECL 4UT6H 5KSBF 1EFXA 2NY1B 3OAYK 4X4ZA 1MIML 1GIGH 1BBDH 2BK8A 3ROLB 2ARJA 4UQ3B 5IIEA 3LEXA 1KIQB 2CH8A 2B7DT 2EKSB 1CGUA 3FOMA 5DUPL 3LKOA 4OUOA 1MEXH 4PJIA 2DYPB 1Z2KA 4H0HB 3QRGH 4KU1A 1YMME 4U7SA 5GRJH 1W72B 2ESVE 3BQUA 2EE6A 1DSFL 2X4TA 1GZPA 5JMRA 4LIQH 4YE4H 1A6TA 4ISVB 4PJBB 2IWGA 2H41A 5ITBL 1E4XH 3DV6B 1UZ6E 4NOBA 4DFHA 2XZCL 3SDDA 2ZG2A 4POZD 5ETUA 4JEGB 4XC1H 3TBYB 2DWEB 4JJHA 4EVNA 1R5WA 2DLHA 1VB9A 4HKZB 5FUZL 2UZIL 2J4WL 3DGGB 1YMHA 5MHSD 2IAMC 2R0LH 3IT8D 1IKNA 1F90L 3QCVL 5DUBA 1DVFD 1OTUD 5DRXA 1RUML 4ZUTB 4RBPH 3IKCB 3BGFC 1U6AH 2BCKA 4YFLI 2IF7A 4I77L 4TSCH 3BWUC 4NWUL 1T5XA 4ZSOE 5C0CA 5HVWA 3QIBA 1NAMA 3L3GB 4MJIE 4V1DA 3BEWB 3V5KA 4MXQC 4OZGF 3AUVA 3Q5YA 3I02B 1RK0A 4E0RA 5DHVB 1RUKL 4DUVA 3TA3D 3LZFL 4YEFA 3P4OB 4EUPH 4Y5YC 1IBGL 3PV6A 4UIKL 3MRQB 5FO7A 4FQ1L 3W39B 1RUPL 4G6FD 2P43B 4O00A 3FO2B 1P6FA 4NT6B 3RVVD 1I1AB 3SGDH 1EJOH 3BW9B 3RKDD 2YD6A 3LMJH 1X5HA 4JPIB 3MUJA 1CL7I 4YDLB 5TDOA 5BXFB 4ODUA 1O0VA 5LQBH 1DQDL 1A6TB 4ISVA 3K2UL 1B0RB 4NJAH 5IF0A 1S3KL 1NMAL 5FGBA 3VFGH 4NCC2 3AAZB 4G8GB 2EYTA 1UA6H 5D2LB 1TLKA 1K4CA 2BNQE 4F58L 3EJJX 4YHOH 1T1WB 4N8CL 4OKDA 3MV7D 1ZS8A 1CS6A 4P2OB 3S37L 1WFUA 4ONGL 2AI0L 5TE6L 2BHZA 1AGFB 2G60L 2AEWA 3SDAB 1EHXA 3TT1L 2D03L 2YN5A 5ICXB 5FO9A 4HUXB 1ONQB 1KG0B 3O3EA 1K2DA 3GJFA 4RQQA 2FGWH 3L3GA 4JRXD 3B9KA 3SDAC 3BKJL 5HHPA 2KKQA 1MOEA 4E42B 1BIIB 1BJ1H 3CFDA 1HKFA 2X4NA 1T04A 4JN2A 5F9JB 4X7FC 1KT2B 4OZHF 5JW3L 4HIXH 5KVDL 3QJFB 4V3DB 2BP3A 3BKCH 1FP5A 3MRDA 3BH8B 4YAQA 1YY8A 5GRXG 1YDPB 5DZLA 3GBNH 3IDYB 3QUYA 3MV7E 4AEIL 1NCDH 3OAZH 4P49A 3GNML 3OPZL 2APTA 2YPVL 1F2QA 2H2SD 4YDLC 3S8WA 4NUJA 4XNMB 1TZIB 3PP3K 4OD2B 1E28B 4PR5A 4LPWA 2ENSA 4I0CC 4XXCA 2BY0A 1LE9A 3NFPB 2XPGA 3SGJA 1ITBB 5ADOL 4MVBC 4QRSB 1NCDL 2AK4D 3FT3A 5F7EH 3FRPA 1JZ3A 4Y5YB 5E94A 4U1NB 3U9PL 1Y6MR 3O8XC 1A14H 3VGDA 4EJ1C 4HMEA 5K9QI 1CIUA 5MP6H 4FFZH 4KROD 2IGFL 2FB4H 3RIFK 2B4CH 5BV7H 2BVPB 5HHVL 3QXAB 1F4HA 4O51B 5IGXH 1FZMB 1RIHL 4M1DH 2VRAA 1PQZA 1C5DA 2BOCB 2J8HA 4EBQH 1U8MB 4TRPL 4YUEH 5E8NB 1MJ8H 4IJ3C 4UNVA 2DWDB 3N1MC 3BZEB 4N68A 1U8LA 4M6OL 1KTDB 1L9MA 3FFCB 1XIWD 5JORA 2NTSP 2NY3C 1J0HA 3NGBB 1QSEA 2FIKB 1XGYH 4YO0B 4KZEL 3O3AB 3QIBD 4H1LB 4M62H 4WU5B 4M1DL 4LRNL 1S78C 1AI1L 1UXWB 3IKCA 1XGUB 1C5BL 3MA9H 4TRPH 2YWYA 3MREA 4HKBB 2OTWA 4MLIA 2X4UB 2QSVA 2DMBA 1AGCA 2ZUXA 3E1F1 3LKRB 1JCKA 1DL7L 1BM3H 5DURD 2DQIH 1FFNA 3BDBA 2KZWA 4LCYB 4UMGA 3W9EA 3J8F7 1AR2A 2XPGB 3X3GL 3LY6A 5HI3C 12E8H 1MFBL 2GTZB 4X98A 2NY4D 1VKXA 5FO7B 2A6JB 3U1SH 3U0TA 4N5EA 4ZXBD 5CLWA 1D9KA 2MWCA 5E6IC 1VPOL 4HKZA 1HHJA 3MJ8B 2NY2B 3UTQB 2ZUYA 5FCUL 4JHAL 4GAGH 1ES0B 4U3CA 4XNUH 3ARBC 1HN1A 3VFPA 4CVZA 1T5XB 5C0CB 1TVDA 1MY7A 5I19L 1BZ9B 5DD3L 2F53A 4K8RH 4OCXH 2VLJD 4JDZA 4XCEB 2K1MA 1QBMH 3ISWA 4PJ5D 3ZSTA 3BO8A 1CGXA 1L8JA 1Q1JL 4LARH 2Z91B 1NFIA 4PRDA 3PWLA 3LEYH 5FO8B 3TZVA 4RWHA 5IJVB 1OTTC 3GJFK 5ICYA 1VFBA 2X4SA 2FO1A 4S1QL 4EI6B 4YHZL 2NZ9C 3MV8A 4LU5H 1P7KA 7FABH 3B9KD 4JFEE 3LQAL 3U82B 1BQHG 1QSFD 4NC1E 4OFYA 4OLUH 1YEDB 3NIFE 3D85D 2XZCH 4DTGH 1B6UA 3B9KB 4Y8DC 2Z8VC 4XC1L 4XNXH 1WIOA 1BIIA 4KUCF 4LCWA 2AEQH 4CBPA 4C58B 1PX4A 1U0QA 1QKZH 4RISH 1UA6L 4FXKA 2AQ3A 2DQGL 3BX7C 4H88L 1L4IA 3A67H 1JNHA 3BH9A 4XCFL 3LQZA 3HE7C 1A1NB 2XN9A 4Y1AB 1ZV5A 4MNQB 2OJZL 3WE6A 4BH7A 4HIJB 1TZIA 3OBAA 5I76A 1J18A 5FUCE 1B2WL 4HXAH 1G7LA 1IAMA 2IMNA 3RVTD 2FHCA 1G0XA 3IU4L 1EUTA 1T21A 3DVGB 4UIKH 2X2YA 3B9KC 1ZT7A 2ADFL 3HAEA 1J1XH 3QAZB 5HHPB 2GY5A 3K2MC 1VEPA 4F57H 1OP9A 3PWLB 5ESQA 1YN6A 1FNEA 2CLVA 5CEYA 3IDJB 1TXKA 5SV3A 3U7WH 4QHNB 2P8MA 4Y1AE 5DDHA 4EI6A 2FWOB 3I84A 1R24A 4LF3B 1P7KB 5F7FA 3V95A 4MNHB 5IESL 2UZYB 2VZUA 4LSUH 1CE6A 4S1SH 4CU8A 2A83A 1ZT1B 3LD8B 3BGFB 4P59L 3HI6H 1IC4L 1LK2B 3U0PB 4YK4C 4E9LA 1T1YB 3KNBB 1EUUA 2YSSA 4JFYB 4ZUVB 5ENWB 3HMWH 5DMIH 5GS0L 2EDDA 1CFQA 2XACC 1GGCH 3MJ7B 4DK6A 4Y2DC 3P9WB 4ZOBA 2OTUA 2QQKL 5D7LE 1JGDB 4U6YA 5ISZE 2EXWD 4GW4B 5F3HB 3ARQA 4OCMC 5D6CB 3OTTA 1NAML 4OCYL 1J05B 2BSTA 1CFTB 3OKMA 2NW2B 4OGYL 1CICA 2ATPB 2EIEA 3RVWD 4XVJL 1W72A 1TMCB 3K4DA 4OZ4A 4PJAF 2BRQA 5EBLB 3NFSH 5LBSH 1TTUA 4ZQKB 2H26A 1AKJB 4N5ED 1PQZB 1CL7H 3C5JA 1D9KD 2H45A 2R0ZL 2DQHH 4MZ3A 2W1NA 4DAGH 1LILA 5I1EL 4UNUA 2DWDA 3DXAB 3VFSB 1W2KT 3U6RA 3G6DL 1WTLA 4NQSA 3KLAB 4TTGA 2UYLB 4W68A 3LDBB 4WFGD 5I8EA 4RAUA 1F90H 4U6XA 4MD0A 1KUMA 1UM5H 3QFJE 1A02N 4PP2A 2EDLA 3CSGA 5C3LD 2YRLA 1KC5H 2LAAA 2X40A 3LKPB 2R23B 3IVKA 3N50A 3P4LA 4WI8A 4XPGL 1CLOH 3ULUL 3SKNA 2Y36H 5FO8A 3GKWH 3HE6C 4PRPA 2FBOJ 2G2RA 1VFBB 1MHPL 3LN5A 4NQVA 3U48A 1DBML 1JPSL 3D85A 3K1KC 3GBML 3D1MC 5K59F 3QIWC 4TSAH 2C4FT 3WCYA 3KAAA 1LEGA 2EDWA 4GXUM 4IRZL 4M6AA 4R8WL 1PDKA 2DIAA 4HJGB 5GZOC 2DBLL 2NCMA 1BWMA 1GPOL 5EBLA 1VEOA 4LPYA 2OSLA 2ZUQC 2GK2A 2IC2A 5FUCC 4DVBA 2HFTA 4GRLB 1BBJB 1LWRA 3VXMA 4CGTA 5A2LH 3N85H 4PJAA 3QNXB 5F6IB 4NGHL 3GMPA 1S7XA 1IAIH 4J4PC 1M6OB 1T3FA 4ZFOB 1ZS8B 4XMKL 3VDAA 3C6SA 5ACMA 5JW4N 2VLRB 3OAUL 1DN0B 1SJHA 3LSOB 3NCYP 4X80H 2X70B 2YOCA 2HJLA 5DMKB 3HZVB 4OM1L 1MWAH 4XNZC 3U9PH 1BF2A 4KRPD 1XCQA 3L9RB 4H0IA 2Y6SC 1HOCA 4PD4K 3PQYA 3BDYL 1V5JA 3E3QC 2XWTA 4X4YA 4GUPA 4BFBD 3MLXL 5KVEH 5EBMB 5MENE 1YPZE 3ZT7A 2CLRB 2IH3A 5CIPB 2V5SA 4QHNA 3IDGB 5K9JL 4WI2A 2DKSA 2UWEE 4UT9H 4QHUA 1K3ZA 5DK0B 4FQIL 1T20A 5EPMB 4XAKE 1U8IB 3ALXA 1BVKA 1C16A 1GOHA 2AJ3A 3I2CH 1SJEB 5SWZA 3U7AA 1CE6B 4D9QE 4OD3L 1Z3GL 3VWKA 2G75A 5HJ3B 3RBGA 5HDBE 3IDNA 1NKRA 2P8LA 1UH3A 1QBML 3CVIH 1CXKA 1JPGA 2XG4A 5GGSB 3O2DA 4R2GD 3ZT6A 2JB6B 4LBEB 4PJ9C 1G7MA 1HWHB 2AJXH 3HRPA 1FDLH 1LO2H 3GMPB 1A21A 1X5XA 3WS3A 2HT4D 4XRCA 2A73B 1FFRA 4O02H 3TESA 4PGZA 5GRYA 1OTSD 5HGAA 1YNKH 1A5FH 1FFPB 1IARB 1MCWM 3X12A 4NN6B 4OKVA 2VABA 3QXAA 4NCC1 4I2XA 4LF3A 4ZPTB 4I0PB 5IBTH 3SPVB 4NKDA 3HNSL 1AXTL 3VU2A 4LLYB 4LQFL 4X6DE 3TVMC 1PD6A 3OXSB 1F13A 1RZGB 5KS9A 4KROB 4NKIL 4LHUB 4XCFH 4LEXH 4S11A 5I16B 3PHQB 1OTUC 2AK1L 4GRWF 4Y19E 3DUSB 4GMTL 4OFVA 1NGZB 2VDOL 2XTLA 3QPQC 3A6OA 3EO1B 1JGEB 5E6YA 4X6FB 3VXOA 1AI1H 2E6JA 4ZAKB 4E5XA 4G6AD 4YHIA 4EN3A 2FX8H 2MKWA 4LL9A 1YEGL 5IHBA 2I60L 3MLTA 1JWMA 1MCRA 3RTQA 2P42B 3GSXA 5DMGC 4QRRD 4ZAKC 4LCYA 1RURH 3QP3A 3EYFB 3RAJH 4OI7A 1DUZB 4KKCD 3CJJA 7FABL 4HWEH 3LZFH 4PJFB 1LK3H 3W9DA 5KJRL 4Z7NE 4F3FB 1KEGH 4J1UA 3TVMD 1C1EH 1YMMA 3QUZC 4Y19D 4LSUL 4QRPD 4UT7L 3VDBA 3TJHD 5IT2H 5D96B 1I9JH 2BFVL 3PGCA 3TN0D 4P5MA 1XF4B 2JK5A 4XHJD 4KVNL 3QQNA 1P4BH 1IVLA 1E6JL 2WLYA 2RFXB 5H35B 4GAGL 2VXUH 1ACZA 3OAUH 1T0NB 3RRQA 3C5SB 1I8KA 3LRHA 4PG2A 1YEJL 4J3TA 3H8NA 2XY1A 3N1GC 1RJZA 4KXZH 3V8CA 2MTPA 5BQ7B 1CK0L 4QEGA 5DJYA 5D1QA 4JHBA 4MCZB 4XZUB 1I7UB 2PYED 4MAUH 5DEFB 5D5ME 5C70A 3MGOA 1FZJB 3ZE2E 4ONOA 3UTSB 1X5FA 4A6YB 4O9HL 2PYEB 3NACL 1U93A 1DBMH 1GH7A 3TYGL 4GRMB 1QPXA 2VQ1A 3PQYD 1CU4L 3QQ3A 3EAKA 4IRZH 5DVNA 1EAJA 3QDME 4M48L 3T0BA 3MRCA 5LGJA 1YEIL 1ADQH 4NO5B 4MAUL 5DD6B 4YHNA 1IFHH 4X4YB 3G5XB 1IGCL 3QIUB 1CZ8H 2BVEA 2EDNA 4ODHH 4TOYL 5HD8D 3RNKA 2AEQL 4FA8A 3C08H 4FXKB 1EH9A 1KJ3L 4XP4L 2AV7B 3O6MH 2DQGH 3QNXA 4WW2A 4W4NA 3WXVL 3O9WA 1HILA 1NLDH 1N64L 4ERSL 1I75A 5FHBL 5HGHA 4Q2ZA 3SCMD 4CNIB 1U58B 2CRIA 5B39B 4EZMA 3TIEA 1ZTXH 1JYVA 4AYFA 4HZAA 4JANA 2FX7L 4AY0A 5E9DE 4OLVL 3TO4D 1FIGL 3L3DB 1CR9H 2VOTA 4OF5A 3HZYB 4QHLB 4NZTH 3S3JA 2IQ9H 1T21B 3MXVH 3IU4H 4OLXH 3GB7A 2I9LB 4P4KA 4AZ8A 1MUJB 3SKJL 3WS3B 4LPUA 4OGXH 1S5IL 2VDNH 4U6VL 2GAZB 5E8PA 5DR5L 5GGSY 5HYSA 4PJ7F 3KS0H 1HYSC 3AU1A 5EUKA 4ODTH 3X12B 5I1JH 5AUMA 4HGMA 4I0PA 4N0CC 4JO2H 1S5HA 1MFEH 4JFOA 4BQ9A 1T2JA 5DK2B 4YXKH 5BZDB 1WBXB 1I8MB 5HDQL 3DIFA 4HLZG 2IALB 2W0LA 5IQ7H 2A9NH 1LO4H 2XZAL 5ID1B 4JFYA 3UZQA 1X4ZA 3HMXH 5F88B 4YHPB 5I1JL 4LBEA 1T22B 1GGCL 3E8UL 3WD5L 1JGDA 4D2NA 4NP4H 2ITCA 5SV4A 1XF2A 1M7DA 5CINH 3MROB 3V4UH 2WBJC 4GW4A 3PXHA 5HGHB 1F58H 1RZKH 3D39B 4R2GC 1I1FB 5GRVK 5HDBF 3IDMB 4H25B 4QRRA 3S88H 1KIQA 2FJGA 1JWUA 4UDUA 1I3VA 4JANB 2X1OA 3ARWA 1OF2A 1FG2B 1Q1JH 5FUZH 1R5IA 1AD9A 1ZHBA 4I3GA 2HT2D 4OZ4B 4U0QB 1YYML 2DYPA 4XWGH 1I85C 3GIZH 4FQXA 4HC1H 4KFZC 2VR4A 2QHRH 2OK0L 3WBDA 2GJ6E 4Q0XH 5DS8B 1P69B 4R8WH 3TJHA 5CGYD 3MRKB 3KLAA 2UUDH 1KCRH 3U1SL 4AENB 3GJEB 3TCLA 1VHPA 1MEXL 2JCCB 5I2IB 3TO4B 4F7CB 3QISA 3OXRA 4YDIL 1CFNA 3UTPE 2ADJB 3C5ZC 4MXWH 3H9HA 5AAMA 1GGBH 3QULB 1SYVA 4O9HH 2X09A 1N59A 4OSUL 1P84J 4LCCA 2BCKB 3GJFH 3W81A 3SKJH 1QD0A 1NMCB 3AMKA 1J88A 2AGJL 3MACL 4H5SB 1CU4H 3A6BH 4JHZA 5DJYB 3S3SA 4LLVB 1JTTA 3QEQD 1U95A 1I7UA 4KROC 1J1PL 1IGJA 4IRSC 4ODTL 3ZTJH 4CU6A 2AQ2A 1GC1C 4BSWA 2Z31D 4ETQB 4Y4FD 1NGQH 5DJDB 3W9DB 3MA9L 4K3DL 1CLZH 1Y18B 1KSRA 4OCNC 4X9HA 3PGFL 1BJ1J 3BGMB 5D7KE 3DYPA 3O2VL 4ZOEA 3HG1B 3DETD 4N8VA 1R0AH 1WEJL 1K8IA 3UZVB 4BKLB 5LJYH 4GBXC 4KZDL 1MFNA 1SBBA 1YECH 4OJFH 4PV9A 1K3IA 5LGKA 1C12A 4Y2DA 3QZWG 3FO9A 5FIEA 3E0GA 2VDLH 5BRZD 4BSVB 3HA0A 4ZS6D 2ARJQ 5ISZD 5BRZB 2P24A 3MRRA 2Q76B 4U1LA 4NQED 4NQDE 3PDOB 3HC0A 5C0JA 3QA3B 2J12B 4PG9A 1S7VA 3O41B 4PD4J 1HXMA 3ZZ1A 4MAYC 4OT1L 4K3GA 2XNAA 4O2CA 2D7OA 2PXYB 1KG0A 5F93C 1T6WA 2JKXA 1WZ1L 2M26A 3TPUA 1OWRM 3F7YB 1U95B 2VUOA 3DHMA 2GJZB 3OKDB 1R3IL 4WV1C 1KTLB 1YC8A 3SE8H 4PBVC 4R0LB 3C2SA 3VXRD 3AU1B 1AKJD 5IW6A 3IJSA 1HKLH 3OR6B 3F6IA 2VDML 5FXCH 2BVTA 1UH4A 4BK4A 2VXQH 1SJEA 3DXAD 5SWZB 1MFCL 3QFJD 1VADA 5CCKH 3PL6D 5I1KL 4BZYA 2GITA 2Z31C 4ONHA 4B7LA 4UU9A 4AQOA 2W65A 4C4KO 1EXUB 2OXHA 4QHMB 1KLUA 1J0IA 5AEAA 3L3OA 4G5ZL 5EA0L 1G7MB 1GZQB 5I18H 2GY7B 2OR8A 2CRYA 4PGCB 4N8VG 4X4MA 5ANMB 5GGQH 3O2DL 2AKRB 1I9EA 3HPJA 5CCKL 4YBLC 5E4IA 4MJ6B 4Y16B 2DQDL 4WHTA 5I1AB 1ZXQA 1HNFA 3EBAA 4OFPA 1JZ7A 3MV9E 4YFDB 5DEGA 5E8DH 4UDTA 1KEGL 5C09B 1IE5A 1D5ZA 4JFOB 5E1AA 5JHDE 4XTRD 4ODSL 4P0DA 1RUMH 1KGCE 5TPWL 1LO4L 2P44B 5DTFA 3VG9C 2GYSA 1WAAA 4MVBD 4F7PA 3PGDA 5KVGH 1JBJA 1KTKE 4YR6B 2ZCHL 1QQDA 4JFHE 3GGWA 3T1WA 1B88A 4M7KL 2D3VA 3V2AR 1T7WA 4MDIB 3GSNA 3UAJD 4X5XB 5MEOB 2MJWA 3VWJC 4F7CA 4M1CD 2V2TB 4UAOB 1M7DB 2CRMA 3PL6C 2DM2A 1DLHA 4ENEC 2DB8A 1R5VA 3ZKXC 1ZHNB 4XHQA 1YQVH 3H42H 1KCLA 1JWMB 2COQA 4K9EC 3FZUC 4KDWA 1JZ8A 3VRLE 4TTDC 2FHFA 1Q9LA 2Z31A 2X4UA 4I18B 3E3QA 2D31A 3BPOC 3UDWA 3KPPA 2PCPB 1XIWC 4Q97A 4PP8C 4PJFA 3T08A 3CFBA 4R90L 3PWVB 4P2QA 3WLWD 1GYAA 4LSTH 3WFCL 1BX2A 3GSQB 4YDVA 1AXTH 3AREB 4G9DA 2ARJB 5FGSA 3RUGB 2Q7YA 1JI1A 2QTEA 2Q8AL 4ZUUB 1TNNA 4F33A 3ULVH 2J4WH 3GMRB 2JK5B 2D7NA 3HC4H 1QYGH 4OLYH 4XP4H 4BA8A 1LO0H 3BESR 5F9OL 3W0WE 2DI9A 4ZFGH 1PLGH 5K9OB 3WXVH 2UUDK 3TGXA 3WSQL 3X13A 4H1LG 5EZJB 1PSKH 4BH8A 4PTUB 4JVWA 2OZ4A 1CD0A 1UWEH 2G5BA 5KTEL 3ERYA 1T1XA 1HK6A 1YQ2A 3GI8L 4L1HA 1G0YR 5JXAL 3INUL 1JGUH 1LVEA 5DJ2A 1REIA 4XCEA 4CJ1A 1R5WB 5IUSA 1QTYT 5FHAL 2BSSA 4RRPA 1PLGL 1PZ5B 1YZZA 5A3IC 4WUKH 3FN3A 1ZHNA 4UOW0 3B5GA 5I6XB 2Q7NA 4YBHA 4LMQE 3WEXA 4NO5A 2FL5B 4XXDA 3NAAL 4XMPL 3WFHB 2DDQH 2PR4H 3WIHA 4P46C 1F2XK 3QIWD 1Z0MA 4ZG1A 2APXA 3FQXB 3LB6C 2EXYD 3NZHL 1VFAA 2AEIT 3FO9B 3GSRA 4C57C 4GKOA 2V5TA 3BD3A 1PZUB 4YH6A 4KXZI 2XZAH 1QHPA 4Q6YA 4X5WB 5IV2B 3FQRA 1MCPH 3MC0A 1MH5A 1WC7A 3CPLB 3U4EB 3A0OA 3EOAA 4NDMA 2E8ZA 5C09E 1FL5A 3IJHA 4GLRI 4ZXBB 2NYYD 1BQUA 3MLVH 1A8JH 3BPLB 3EGSA 4DEPB 5GRZA 1FL6A 4Y4HB 2R2BB 3AGVA 1ZE3C 1ZANH 2E9IA 3D69B 1RY7B 3MRHB 1NBYB 2Y5TA 4G6AC 5JNYB 3TIDA 3HPJB 5CSGA 4JCLA 1K4CB 4FG6D 3KPSB 5ICZA 1G1CA 1SM3L 4LIQL 3PWPE 1QBLL 5BOPA 1NUDA 5LAXB 5EOCJ 1M4KA 5FYLE 3TM6A 3EO9H 5MENA 3TVMB 1QA9B 5C09A 2CUIA 3BPOB 2X9WA 5C0AA 4P46D 4DN4H 4YFEA 1NLDL 1JPFB 3T0EB 4FQPA 3UTPD 3KWWB 1MVUA 4PB0L 2FX9H 5F88A 3KPNA 3R8QA 4CDGC 2YWZA 1QBLH 2YEZA 4UT6L 1GPOH 1LD9A 3QG6A 2UZXB 3MJ7A 4ZODA 5C08B 5ANMA 5C0BD 5EUOB 4IEFB 5BV7B 4OV5B 1U8HA 4QRRB 4P5TA 5I8KL 5GIRA 1JGVL 4Y4KA 2NY2C 3ZDZE 5I15H 3GDBA 1CIDA 5MP6L 1DDHA 3FOMB 3W11C 5JHDA 4BZ2L 5DC4B 5GGUB 4W4OC 3QXDB 1T2QL 4FZEH 4OD2A 2ITDB 3DGCR 3O6FD 2DM4A 4JHWL 4NKQB 2X4TB 3MXWL 2VAJA 5TDPA 1F5WA 1P6AB 5K9KA 3B6SA 4M48H 1PSKL 2X4PB 3MBXH 5ABDE 2FATH 3TO4C 1ED3A 3IKKA 1RU9L 2OZ4L 1INQA 2D9CA 2V7NA 1DANU 3KDMA 4HBCL 5E4EC 4XTRC 5EU5A 4ZUUA 1RVFL 3U0WL 4RAHA 3SDCA 4OLWH 4F37F 2VDRL 3VFWA 4G5ZH 2UY6A 3ILQD 1RZJH 3QQ4B 1GAFH 3Q2CA 2V9RA 5C0RL 1ZHLB 5JW4R 5CEZE 3IFOA 3QSKB 1MRDH 2APFA 3T8XB 2DOCA 4APQC 2D0HA 3IFNH 4IJ3B 4LLQB 3RL2A 3TJEL 2PKDA 5GGVY 1EFXB 4JFQB 5C08A 2B2XL 3JWOL 2DQCL 1CLZL 4JFZL 5JUEL 1II4E 5BCAA 4MJ5A 2HKFH 3RPKA 1QSFB 2P8PB 4P46B 4HHAA 3KJ6H 1G9NH 1I7TA 1W8NA 1IAIL 4JFXB 3C6LC 2HTLC 3HG1A 3VRJA 4PB9H 2X7LA 4G80B 2FL5A 3U4BL 2E7LE 4RWYL 1N4XH 2ZCHH 3BIKB 3VFMB 1ZMYA 1Z9MA 2AV1B 4ZTOH 1NL0H 5D1XC 35C8L 4FQ2H 1HEZB 4XB8A 4JO2L 3T4YA 1BBJA 4HUUB 4ZNEA 1GCFA 4XVSL 3QCTH 3QWRA 1J8HE 3FQRB 4PUBL 4NO2A 4OSUH 1OW0C 2F5AH 1JGLL 3QRFM 2NZIA 2DTML 1GGIL 4K3EH 5TQ0H 4N0CA 3FB8B 1S9VA 1B4RA 4S1QH 3KJ4B 5F1OB 4IRJC 3RIAF 3H2WA 3H0TA 3V9FA 2FO4B 4CN4A 1FORL 4E41D 2X70A 4BFIA 2VKWA 4MNGA 3UCRA 3S5LG 1HINL 1Z5LA 3WEXB 1MIEH 3F7YA 1QO3B 3PGFH 3ELAT 2BC4B 3X14B 1MELA 1PYWA 2VNCA 5IJVA 4G7YL 2IH3B 4WY7H 1LQVA 2P1YA 3H9YA 5HI3D 1T5WA 4NQCA 2X9XA 3ZKSD 3ARFD 3OSKA 3GMOB 5KVGL 3S4SA 1I7TB 5DD5H 1I1CA 1P7QD 3LRGA 4EIZC 2C1PB 2UZIH 2CO6B 3RZCB 4N1CA 4YHYB 5GHWL 1UZ8A 4RGNE 1MPAL 3IETA 4M1GH 5B3JF 5ISZB 5FYJL 5E08L 2H6PB 3QEQE 4RGMB 3WJLC 1JPGB 2DN7A 4KDTA 5CHNB 4XAWH 5E56A 4XVJH 4P5TD 3QCUH 1TZHB 4QXWA 3BE1H 1Q8MA 3H7LA 4LGSB 1JFQH 2HFFB 2IAND 1KN2H 8FABB 5F7EL 3K80A 5C0FA 3BP6A 3LQAH 1OAQL 4MSWA 1UZ6F 3LKOB 2GJ6A 4KVCH 4M7LH 5IVZB 3SO5A 2JJVA 4ORZC 3VMOA 1TFHA 3PWUA 5HGDA 4ONFH 5ICXA 1BMGA 5DYOA 4M6NL 4PJ9D 2ZSVA 2NX5E 3MNWB 1A4KB 4KK5C 1S5IH 4U6VH 4LHUG 1MCPL 3PGDB 1IAIM 3ZDYE 3EZ8A 4E42A 3SDCD 1NEZB 1D5IH 2BY2A 5I16A 3QFJB 3GSNB 1TJGH 1KN4L 4WENB 4YJZL 3KPRD 2IFFH 1KJ3H 5C0NC 4Q9QL 3TZVC 4GLRH 4YHML 4Y4KB 5DD0H 1IRAY 1J86A 4Z0BH 4LSPH 4U6TA 4OZFB 3TNMA 3S37H 1J1XL 2Z31B 2AXFA 3MREB 4Y4FB 1TCRA 1OARH 3B9EA 5E6ZA 3CCHB 5H8DA 3I02A 2YMXH 4OQTL 4PTTB 5HYEA 1FFNB 4L8SC 4P2QB 2VLKA 3DUUA 5D5MB 2NR6D 4M4PA 1JYNA 3FO1A 1CICC 2VO5A 5L0QB 2NXZB 5C7XL 4P2RB 4G9FA 5KZCD 5J12C 3TBVB 3T0AA 1XGTA 3VRJB 1KJVA 3MJ8A 1LDSA 4RISL 4MAYA 3G6JA 2YBRB 4JPIA 4RX4A 5F9OH 4FOMA 2VLMD 1TMCA 1C5CL 2YXMA 4DKEL 1RIUL 4N0FB 3PP3H 1CDYA 1CG9B 2HWZL 4AEIH 4KTYA 1GGTA 4LRIA 1NEZA 4HWBH 4JREC 1DEEA 4NC1C 2JJTC 5D1ZD 5GZND 5L7XH 1YNKL 4XZUA 2BSSB 1A4JA 3BO8B 5C0ND 1VGEH 4UUJA 4Q9CA 1S7TA 2IPUK 3BI9X 1U2CA 1FNHA 3ZTJG 4MD5A 2QQQA 4IRJB 4XPFH 1D6VL 4NKOA 4YHZH 3VGAB 3HUJA 5KOMC 2X5PA 1MLBA 4JKKA 3BYTA 1K8DB 5AD0B 1F58L 3CDCA 2BVOB 4CADB 1KEML 2X7LB 1P4IH 1ZEAH 5ESVB 5F9DC 4H8WC 1UWGH 3BKYH 35C8H 4FQ2L 1FLRL 3DECA 1PG7W 1NGYA 3ARFA 2VZTA 4X9BA 2Y5EA 5AZEL 1QP1A 4FQHA 3VXME 3SJVE 1KPVB 5L2KD 4NQCB 5AAWA 1YY8B 1WQVT 1P2CB 4XAWL 2J5LB 4CDHA 2ZJSL 4S1DC 3ZSSA 4FMFA 2C1OA 5LGHL 4Q2ZB 4CNIA 4NRZA 5L0QC 1KNOB 1FRGH 2DI7A 4Y7MA 5DJXA 3HC3H 2FBJH 4N90E 1E4JA 2ENYA 4OGAC 4HXBL 2GIYA 3ARPA 3D69A 5JUEH 3F58H 1ONQA 2AK4A 5L88H 3NFPA 4OZIE 4JPWL 2E7BA 2HFFA 5CD5C 3O2DH 4K3JH 2NY6B 3F5WB 4MSWB 2Z91A 3KR3L 4NQDD 1A4JB 4HFUH 2V9TA 1RJCA 4M4RA 5CZXC 2QJDA 1UM6L 3S35L 2PO6A 2AJUL 4HCRH 4WWKC 3HUJB 4F7MB 3ES6A 4HUWA 1VA9A 5F70A 3JBG7 5B38G 3QI9D 4MQTB 4NRXA 3RGVA 3WHE0 4PJDE 1EAPA 1U92A 2H3NA 4N0UA 3L9RA 4Q74A 4YUEL 5ADPL 1MVUB 3BZ4B 2HG5A 3D3VE 4KJYA 3QDJD 1GGIH 1VFMA 1JGLH 5M94B 2YSSB 2I9TA 1XGPA 5J89A 2PTTB 4U1MA 1S9WA 3I85A 4QRTB 2DLFL 5F9WC 3IDGA 3ET9F 3WFBL 4P2RE 1NCUA 4LVHC 4QRPE 5EU6D 5I9QC 1U3ZA 2K9UA 1LK3L 3D18B 2XN9B 4Y1AA 1BQHB 3JV4B 3N1PC 2CGRH 5TE7H 1I1FA 3A6CH 3HR6A 3BMVA 4HKBA 5FKPA 2G75B 5HJ3A 3SDYH 4JGJA 1TCRB 4PYHA 1O5DT 1OF2B 2VLKD 3HNSH 3CFEB 2DAVA 5I1LB 5DEZA 2E5EA 3V6FA 4JPVH 2J8OA 4X6BB 1CBVL 2R1WA 4G9FD 5BZWA 3QG7L 1H8NA 2O61B 3EFFA 2QKIB 5E00A 3VFRA 5ESQB 5ECJE 5JORB 2ILLA 3KLDA 4P2RA 1CLCA 4IS6B 4RIRA 2N7AA 4IMLA 2PO6B 2YZ8A 5JW3H 4X6DF 4ZUSB 3S96A 5IJKA 4JG0L 2MMXA 5IWLC 2EICA 1OWWA 4PPTA 3TYFA 2VL5B 1MRDL 5D1ZA 4JQXA 2WV3A 3VXSB 4DFIA 5HHQA 3JTSA 4XP6L 5I19H 5JW4M 2E7CA 5H94B 4LHUA 4P9ML 4ZFZB 4R26H 5JOFB 1OVZA 3ZKQD 2DQUL 1KIPA 2A9ML 4G8GE 4JM4H 1BD2A 5CJOH 4XWOC 4KV5F 1RULL 1RZ8A 4IRSA 3OKLA 1QZ1A 1QSFA 2P8PA 1Q94B 4U1HB 5F89A 2ICEA 1T4KB 3O11B 4ZAKA 2LTQC 1MLBB 3I3BA 3KJ6L 2FYYB 4TSAL 1T1ZB 3V8OA 3GSWA 1UJ3C 1CCZA 1INEH 2XTJC 3V0VA 1CICB 1RZ7L 5E99L 4N1HB 3E2HC 1J5OL 3BAEH 4FFYH 1P5VA 2Q3ZA 1K8IB 1SJVA 4C59B 3WFDH 4X6BA 2LAGB 5DO2C 3STBA 1JL8A 3OQ3B 2XN9D 4NZTL 3U6RB 4FQQA 1UGNA 1V7NH 2F5BH 3DMMD 5DT1L 2FZ3B 4MA1B 3S5LA 2W91A 3VXSD 1I3GL 5LWYL 1EJOL 5INDA 3OG4B 4QTHA 4C4KT 4UUJB 3DSFH 3TZVB 2RAMA 2W0KA 2ZSWB 5KSBA 3RDTB 5T3XE 4MD5B 3MCLH 4Q6IA 1NCWL 4G6KH 4IOIA 4FTVB 5D1QC 1NJ9B 2F54D 1YEDA 4LFHG 4NRYB 4RFOL 5B8CC 1YQVL 3HZKB 4PFEA 3BYYA 2AERT 1IFHL 1OSPL 2C7UB 3BUYA 1KIPB 1HE7A 2PO6D 3TH3T 2YPKB 5DEFA 1FVDA 4NPYA 4U1JA 4FFWC 5CJ8A 4QRQA 5MEQA 1SM3H 2VDKL 3OAZK 3THML 1H5BB 1EJ6A 2XN9E 5DDHB 1GXEA 5IR1B 2H1PH 3MUGA 4ZS7L 1EA9C 4MNGE 3OZ9H 4AIXA 5DVLA 3LKSB 4MNHA 1EIBA 2WIMA 3RWGA 1A1MB 1AJ7H 3QDJA 1OB1A 3NTCH 3P30H 5I1HH 3BW9A 1XR9B 3O2WH 4JFFA 3T3PE 3EYOA 2R56H 1T1YA 3L3JB 3BZ4A 4KJYB 4Y88A 4PJFE 2B1AL 5EU6A 4O58L 2H2SC 1YYLL 1R3JA 1WCBA 4GQ9H 4Y1AD 2YKLL 4OAWA 2OTUB 4PGCA 1NCBH 2XKNA 2ATKB 2YD1A 4L3EE 1ZHKB 5T3XH 4MJ6A 4Y16A 3VE0B 3IDJA 4WW1A 1R3HA 2WP3O 2BSTB 2W59A 4M9PA 3CFJB 5JQ6H 3VJ6A 3S36L 3UYRL 2PYEE 3BKML 3ULVD 1M7XA 1I9IL 2QEJA 4JAMA 1NJ9A 4WCYH 2LU3A 4MQXD 1PKOA 1FN4A 2NY0B 4KTDL 4MJIB 4YFLF 4TVPE 4Z9KB 2OBGA 2ZOKA 4L4TE 5C0EB 3M8OH 1MRFH 2CKBL 5BJTA 3U0PA 3CZJA 2R1WB 5BZWB 1N64H 2H32H 3T0EC 5KS9B 3QDHA 4AIOA 4CN1A 3F7VB 4XT1C 2VIRB 5D2NC 3HS0B 5E5RB 5TGBB 4WFED 4AIZB 4XI5C 4NO3A 1RZJC 3MRDB 4YWGL 4Q9BA 3GMMB 4HIEB 4NYLB 3TH2T 3CVIL 4U6XB 3FZUD 5E2WL 3GI9H 1T6VN 4FQCL 5IHUL 1M05A 3B8YA 4JRYD 1S5HB 2KZ1B 2P4AB 3TYFB 3MZGB 3FT4B 1D5XB 4KJPC 2IQAA 1OARL 5H94A 2JIXD 4PJEA 1E28A 1INEL 4RMSA 2R2EB 5CP7A 4JFDE 1GGYA 4XPAL 5F7YC 2H26B 1MHHB 3WIFA 5I71C 3GMLA 3I6LE 3V0WH 1LE9B 2HT4C 4XNYL 2AJUH 1QFHA 2ITCB 1F3JB 4JN1H 1MFAH 3X3FL 3WIIH 5F89B 2VH5H 1GHFH 4EDWH 3EIFA 5I74C 5KVEL 3OF6A 3UTZB 4IS6A 4M7ZC 2IBBA 5ILTH 1U3HC 6CGTA 1I3GH 4MD0B 5LWYH 1GSMA 4KVNH 5HVGB 3NFNA 2OMNA 2WINA 3IYLW 5T3ZH 5I8CB 3KYKL 4PRAA 3D48R 3MRPB 1CGVA 2VAAA 1RZGA 3KLHC 1NFDF 3VXSA 1AQDA 1G7JA 1RJZB 1FRGL 5IVXE 1UCBH 3WNMA 3DUSA 4BQ6A 4YIQB 3C8KB 3WNNA 1T83C 3O6KL 1BGXH 1NC2B 3NA9L 1H3PH 4MQXC 1ZVSA 2MPAL 1OAUH 5D7SL 1LEIA 5J11C 3D2UB 1KPUB 1CFNB 1YEHL 4YC2C 2R8SH 2J6EL 3THMH 5C9KA 2A6DA 2GFBA 3IDXL 5JO5B 4OCRH 4FNLH 2E6QA 4P3WA 4HAFA 4KVCL 3BPNC 1HOCB 3LV3A 3MRCB 4N5UA 4MDJA 1ZA6B 2Y23A 2Y7QA 4QYOA 1CLYL 1EEQA 1OAXL 2MCPL 4KMTH 1QFWH 1OP5H 1RZIB 3FQXA 1KCGC 4YDIH 2VDLL 5MEQB 4OTXH 2GTZA 2H8PB 4X98B 5SWZD 2P7TA 5IR1A 1UKSA 4JG1L 1DE4A 4LEXL 3QUKA 5HHME 4H20L 3D3VD 1KFAL 5IV2A 3ETBF 5INDB 3DSFL 4PJHF 1NBZA 1F11A 3GSOB 2ZSWA 3VWKB 5DHXB 3EOBA 3MRBB 4HJJL 1DBKH 1NC2D 3EYOB 2RFXA 1A22B 2Z8RA 1S8DB 2B5IB 3L5XL 5E2TH 1I8KB 3ZKMC 3LCYA 1FCGA 3Q6GH 2WWKT 5JZ7D 3OV6A 1K4DA 1IGYA 4GQPH 2J8UB 3CSYB 2VH5L 2KDGA 4Y16D 1OL0A 1SEBA 1ZAGA 4M93C 3V7AE 4ACPA 2MHAB 5I75B 4V3EB 4P4KB 4GUPB 3T2OA 2YA0A 5EG6C 1MCLA 4NPYB 4U1JB 2AVGA 2X4SB 2R2HB 3ES6B 5J12B 2FGZA 5EUKB 1IC7L 2EDTA 3BGAA 1HIML 3G5YA 4NRXB 3RGVB 3ARDD 1S3KH 1HH6A 5EC1B 1S7VB 1FZOB 4PJGE 4D9LL 4ZSOA 2CDEA 4I48A 4C56B 3LIZL 1JZ4A 5HPOA 5FA4A 5DWUH 3DX6A 1H3PL 1IKFH 4HUVA 1UENA 5J7CC 2YUXA 5DQ9B 5K9JH 3UBXB 4WFHE 5F71A 2PTVA 2JB6A 4J3SA 5SX4H 3X11B 3KPNB 5F7DB 4KKNA 4A2LA 4MXQA 5T1KB 3UPCA 4Z7OF 1JMZA 1KN4H 3CH1A 2Z0BA 4BSJA 2ESVB 2ZCLH 4EEEA 2DLFH 4HIIB 1YEJH 4K7PH 1RFDH 1I7ZA 4R90H 4JZNA 2OI9B 4E5XB 1I8IA 5IFHL 5CJQL 4K2UH 1RUKH 2X44D 4P5TC 5FKPB 1NKOA 1BFVL 5FYJD 3WE6B 4BH7B 3MLPA 4UU9B 3JWDH 3IJYB 2VABB 5DLMH 1UACL 3LHPL 5FOJA 3PWJA 4KJWC 4XPHL 1FLTX 4BQBA 1NFKA 4HV8B 1G7IB 1PG7H 2ITDA 1K4DB 3MGAA 1KYOK 3OXSA 5KSUB 2OK0H 3S35H 1RJYB 1QHOA 1GGUA 1A7NL 3SDAD 3VD5A 4U1IB 4XVTL 5IM7A 3TN0A 2CLVB 1TVHA 3WDIA 1DQQA 1KJ2L 5EO1B 4G59A 4NBZB 2DQFB 2IPUG 1KXQE 5EZLA 3ULVF 4RMRA 2DJUA 4NYLA 3L7EA 1DCLA 2NX5D 1JN6A 3GHBH 3EYQD 2LABA 3U4AA 4CN6A 5JW5B 3VXRE 5D1ZB 1NUNB 1JMXA 1D5ZB 4CMHB 4L29A 4DKEH 4D0CA 3G9VA 1EMTL 1F45A 3QULA 5C9JA 1LK2A 4EUPA 3FJTA 3MFFB 4A6YL 3K74B 5BQ7A 5I0DA 4BQ8A 1DL7H 1RSFA 5JPMB 5GS1C 1BQSA 5EORL 4U6HA 3G04A 2YK1H 4PJGF 1AHWA 2P5EE 4KJQD 3V4PH 1I7ZB 1IBGH 2AEPL 3IRPX 3PWNB 4LSPL 3VFTB 4MZ2A 5FFLA 1JWUB 2HT2C 1T89C 4NUGL 4WTXA 2DI8A 1AXSA 3ZL4L 1ACYL 1R5IB 1BLNA 3I9GH 1FSKB 4FQXB 1WBYB 2AV1A 4HJJH 2F19H 1FORH 2VAAB 4LASL 3MBEA 2DKUA 3P77B 3ORJA 3FONA 4U1IA 1V7NL 3NCFB 4OCXL 3P11L 2FZ3A 1A6UH 5HDOA 2P49B 2XZQL 4NWUH 4QTHB 5EOQH 3TO4A 2BSRA 4JB9H 4MA3B 5KSBB 3BT2L 4KUZH 5D93C 5GGVH 5IK3B 2BVQB 4MD4A 3WN5B 1KPUA 3GSUB 1LQSR 1AXIB 3FB8A 3TPUE 2A77L 4DKFH 5HYJB 5F7HA 3V79C 2GUOB 2XI9A 2D03H 4OF7A 3EDFA 3JV5A 2R4RH 3TT3L 4P3DA 3REWA 3L3IB 4JKLA 4ZDHB 3DX8A 3QWOA 5J1TC 2YC1A 4LVEA 4X7SH 3QXVA 1CGTA 1KJ2H 5GS0C 3TPUB 2GAZA 4LVHB 5E8PB 5I9QB 5DR5H 2C3VA 3GHEL 4I0PD 4PRPB 3V52H 3L1OH 3KPMA 4ZS7H 3GBNL 3IJSB 1WFOA 4WWKA 5L8JB 1DQDH 1P4IL 3WFEL 3BGMA 2YA2A 1UG9A 3C60C 4ZSOB 1Q72L 1VADB 2CDEB 3N1FC 4BJLA 3QNYB 1V7ML 3EOBB 2E7LC 2IALA 2NY4B 3RUGE 5IT2L 2VZ3A 4XGZA 4NM8L 4BK5A 4KZEH 4QT5A 5EU6B 3TFKC 5E6ID 1C12B 5HHOA 2BDNH 1W0VB 3W0WD 5T1LD 3UDWC 1RIUH 1DVFA 4OIBA 1KCVH 4QXUL 1TZHA 3UTTB 2MHAA 5J8OA 1HSAA 5IHZB 2H9GA 1YEFH 3CGTA 5E5UB 4LGPB 3OHXA 3PF2A 2F8OA 2WWKO 1GOFA 5KSAB 3CPLA 3U4EA 3WN5A 5MEPA 1RU9H 1CD1B 4DGIL 1ADQA 3GO1H 3K7UA 1QFWL 5FV2A 2M1KA 4WU7A 1M71A 3QFDB 5DMKA 2R29H 3TA3A 2HMIC 5C0EA 3QWOB 3JV6B 1MQKH 1DQJB 5C07E 4P3CL 3BT2H 1V3KA 3LN4B 2V2WA 1IZJA 4KGJA 3MRIB 2VSCA 5JR1H 4ZNCD 1P9MC 5EOCL 2VMFA 2OR7A 3ZT5A 4RMVA 4YWGH 3TEUA 4MDIA 2DQFA 4OGAD 4KK6C 1I3RA 4PRHE 2VR9A 4PJCB 3NCEB 5SX5H 5IJKC 1KB9J 5ADPH 4R4FH 1CQYA 1QA9A 3FFCD 1MIEL 2FJGB 4L29B 3T0WA 2EH8L 4DJMA 1MCWW 3MFFA 3MLWH 2MPAH 1TQBC 1EXUA 1ZHBB 1TCMA 3ZYOA 4XXCC 4HS3A 1F3RB 4Y4FA 1QLRA 2Q87A 4WWID 3NIGF 3L5WA 4WW2F 2EH7L 1ROWA 3MV01 5E7BA 2FLBT 4DAGL 2DLEA 3GKZA 3MNVA 4MA7L 4WGWB 1CXFA 2V7HB 5IMLA 2W9LA 2YD9A 1UT9A 4LLDB 1MCNA 5HHVH 5C07D 3W82A 4NWTL 2AJVH 3HHRB 3BKJH 1EHNA 3TN0B 3VFTA 1I9RH 1JRHH 3IGAA 1DQQB 5MEPB 1XR8B 4W6YB 5ACZB 1G6RH 1EX0A 1R3LB 3NFNB 4ZPTA 3KPTA 4PJIB 1LO5A 3W0WB 4Z7WE 4PGEA 5JXEC 2VLLB 2AJXL 4LOUC 5TQ2L 2YN3A 2G5RA 4U3XA 1ITCA 2BXZA 4AMKL 5TDPB 3L6FB 4TSBL 5DJCB 4LSVL 2R4RL 2WIIB 2WSKA 2GSGB 4M61A 5BS0B 4R4BA 1YEIH 1DZBA 4TVPL 5J11B 3DO7A 1ZGLA 5IOPB 5M7QA 3VG0H 4XNZB 1WLHA 4ETQA 4XVUD 2P5EB 4BZ2H 1G7QB 1JWSB 4XCNA 2JIXB 3RWIB 2LU4A 3O6FB 4AM0A 3DVNB 3OX8B 5B8CB 1T89A 5A16A 3QQ4A 4G7YH 4WY7L 4L9LA 3O41A 1CWVA 3EDDA 4NN7C 4S2SA 3RTQB 5AD0A 1I1AC 3U7WL 3VD7A 4EI5C 3GFUA 4M00A 1RPQA 3B5HA 4X4XA 4GOSA 4OQ1A 4Z7VE 1MCOL 1S9XA 3L5WB 4PY8I 3F62A 3BKMH 3ZYJA 1EGJA 4P23B 1RUPH 4LLWB 5GSRB 3N85L 1LNUA 4G6ML 3ARFB 1ZGLP 1DANT 4PJFF 3U9UB 5K59E 4KTDH 5D8JL 3PV6B 4G9DB 3H6JA 1D7FA 2PXYD 3FT2A 4HS6A 1FNGA 4U1GB 1MJ8L 4KRNA 4MNQE 3GBLA 5CIPH 5L2KE 4JRYE 5TQ0L 5SX4I 1QNZH 3KGRA 3VXUE 2C1OB 3IXTA 2QADD 3GKWL 4HK0A 5KJRH 4GJTB 5D2LF 2J8UA 3CSYA 43CAB 1BZQK 2OMBA 5HDQH 4J3VA 1VESA 2ZCKL 2Y5TB 3TIDB 5J6GB 1A3QA 1JV5A 1QRNE 1ZOXA 2OL3H 3Q3GA 4NZUH 4RA3A 1P7HL 1N7ML 1TENA 4YEEA 4PLKD 5F3BB 5DEGB 1OM3H 1ZWIA 2FDBP 3EYVA 1ZLVH 3RWDA 4DQOL 1A7OH 3VXTA 1WSST 3LIZH 4BFIB 3HZMA 2GITB 1IC4H 1RJLA 1A6ZB 1EAPB 4FFVD 3RGVC 4FZ8H 1JPST 2XA3A 1X5GA 4PJXE 4JB9L 2FX9L 1JPFA 3T0EA 2XZQH 2RIKA 1JF1B 3WYRA 5T3ZL 5KS9E 4F15B 4RFNB 3X14A 5F7KC 4X5XA 4CKVX 3I50H 5C0RH 4NSKB 4MS8A 2DF3A 1HZHL 1AGDB 4XC3L 4DQOH 4C83B 3Q6FA 3VGHA 2VR5A 4GRLD 3MRJB 4JDVA 1N3NA 1KULA 2CR3A 5FM5O 1J8HB 5J56B 3BEVA 2ESVD 4I8DA 3NIDF 4ONFL 3PWJB 4PJ5A 1SBSH 3IETB 5TE4H 3VWKC 4GKZB 3WJJC 5GSVA 5BOZG 5C8JA 3GBMH 3BQUB 2R0ZH 5IROA 3PWVA 3SN6N 3MNVB 4P4RB 1VERA 1XAUA 3RX5A 2OZ4H 1I1YA 2CGRL 8FABA 2W0FB 3C5ZD 4S1SL 1H3UA 4HCRA 1SEQL 5E94B 2EECA 4OFYD 3TBYA 1Z3GH 3TA3C 4F33B 1FYTB 1MCBA 1A7BA 3T2PA 2A9MH 3K8LA 5FYJH 4WEMB 5E08H 3CLFL 4M1GL 5GS2H 3ARUA 5CD3B 5FM5M 4ZUTA 1WT5C 1G9NC 4O51A 1TNMA 5DYOB 4PTUA 3B5TA 1IQWL 4LHQB 1W0WA 1ZVHA 5L2KB 4LPCA 4R96A 5HVFB 3UX9B 3L5HA 4OZHA 1HXYA 2BJMH 2GEEA 1MJUH 2PCPA 4R3SB 4O02L 2F58H 4KUCD 4PIRF 3QG6B 4TNVK 5D1XD 4OM1H 3EFDL 3MROA 4F37K 1CGWA 1FE8L 4PP1D 4C83A 4NN7B 1BX2B 1PW3A 4RFNC 3AREA 1FG9C 3O3AA 4ZMAT 2MQCA 1G9NL 1EBAA 3MRJA 1BF8A 3UPAA 1U9KA 4LEOA 4PJXF 5FKAA 4OZFG 6FABL 3RWHB 2QR0A 1W72L 5GGUA 4ZNEE 4N5EC 2H32B 5HHMA 1WBYA 3VFMA 5EC2B 3QUXA 3T65A 1OAXH 4WV1B 5FGBC 4PJIF 1UJ3B 3T4AA 4CW1B 1A6WH 3SGJC 2XXMB 3MCKA 5F7WC 4P4RA 2J5LC 2QHLA 3ULUC 1FBIL 3QO0B 5C0AE 4N9GA 3FO1B 4G42A 5HI4D