3UPRA

Hla-b*57:01 complexed to pep-v and abacavir
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
275
structure length
275
Chain Sequence
SHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRMAPRAPWIEQEGPEYWDGETRNMKASAQTYRENLRIALRYYNQSEAGSHIIQVMYGCDVGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, B-57 alpha chain
publication title Drug hypersensitivity caused by alteration of the MHC-presented self-peptide repertoire.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 77
structure length 275
sequence length 275
chains with identical sequence C
ec nomenclature
pdb deposition date 2011-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3uprA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3uprA01
4X0KA 1YY9C 5HD8D 3VG9C 4BJLA 1FAIL 5FHAH 5L0QB 5IV2B 4MDIB 1OGAD 2PKDA 2NXYD 4YFLF 5IW3A 3HC4L 3PHSA 2AXFA 2FSEB 3MMEA 5IBLD 2VLKB 2CR6A 2BC4B 2Y7QB 2FECL 5JW4R 3ULVC 4HIEB 1EK3A 3T1FA 1JNJA 5C0NC 1Q9KA 1YY9D 1ZS8B 5HHOE 3MO1B 2FX8H 3ABZA 1LK3L 5DD3H 4TTGA 1WICA 1YMHB 3PXHA 1BMGA 3X12B 2AGJL 5GRJH 3ULVD 3OB0K 1G6RB 4QT5A 3HCVB 3I6KA 1FAIH 1UXSB 5C0ND 3RU8H 3WDJA 2GSIA 3LEYL 1VKXB 1YYLH 2DLIA 1YA5A 3CC5B 1EXUB 1T03L 4QLRA 3HC4H 4R2GB 3OAUH 2BNQE 1ES0A 5I75B 1KC5L 3LN9A 4KHTL 4PIRF 2NY2C 5E7BA 3MYJB 3OKKA 4TVPH 1LK3H 4HLZH 3D25B 1R3JB 2HRPH 4XB8A 1RZKL 1CE6B 1I7ZA 3T4YB 4Q2ZA 3L3GA 4PJAF 5F1KC 1QFHA 2HFGH 3IS1X 2NY2D 3CH8A 25C8H 4TQEH 5T1LB 4JFFD 2GJJA 1C8PA 4OGXL 1T03H 5B38G 4NDMA 1EMTH 4CUCA 4LLYB 3DO3A 3WXVL 1U3HC 4MHHG 5DEFA 1O7VA 2IALA 2IQ9H 1HDMA 1RZKH 1MLCA 2QBWA 4X4ME 1HK6A 5FOBB 2I60L 3GRWA 3RTQB 2XICA 5C0GB 3UBXB 4I0CC 3VXRD 2Z93B 4JFXA 4WFFE 5JOPD 1D6EB 1MELA 4KVNH 1J05A 3BH9A 3ARDC 4YQXL 3K3QA 3GSNB 5SWQB 4DVBB 1FVCB 3O6ML 3O6FB 4HWZA 3U30C 1JI2A 1CVSC 2DQCH 3RWHA 2X41A 4S11A 1A2YB 1IQWH 5SWSD 1WEJH 1U92B 1WBZB 4PJHE 3MV8D 3HC0B 1C08A 3SDAB 4UV7L 2GUOA 2QSQA 3ALXA 2JK5B 2DLGA 4Y5XC 2E8ZA 4J4PA 2IAMB 3VCLB 3TEUA 1P7KA 3O6MH 1P4LA 2A9MH 3KR3L 4HMDA 3PDGA 3D85B 1CFNA 1FYTD 1U58A 3QQ3B 4X98B 5T1KA 1Z0MA 1Z3GL 4CMMA 1S7TB 1TVHA 4CBPA 3R8QA 1ZVYA 5T3ZE 1IGYA 3W9DA 3FT3A 2VDMH 3BUYA 5INDB 3ULUL 1MFBL 2BOBA 2CKBB 2RJMA 4GS7B 1Y0LB 1MF2L 4OCWL 4LSPL 3OV6A 2P5EA 1OL0A 3W0WD 4GH7B 4M1GH 2FR4B 2EC8A 2QR0A 3V6BR 5J06A 2V7NA 5T3ZL 1MI5D 5E9DE 3KR3H 4XXDB 1OQOA 4IRSD 1L9MA 1P5VA 1Y6KR 4P59L 2XKUA 1Z3GH 1M05A 4DUVA 3E6HA 5HJ3A 3ULUH 2BCKA 4L4TA 1RJCA 4N1HB 1BQUA 2FECI 5IQ9B 1JWSA 3P77A 1MF2H 4LSPH 4OZGE 2OQJA 2IPUG 1YN7A 2ESVB 4NT6A 3LN5B 1F58H 4JM2B 1X6NA 1EEQA 5E2UL 2CSPA 1G7MA 4X6EB 2WBWB 5BOPA 5TJWK 4JFQB 4M61A 4P59H 3UXFA 1DVFC 2GITB 5F93C 3IDYB 4RAUA 1T2XA 2NLJB 4JO2H 4S0SD 2OR7A 1O0VA 1PY9A 3QO1A 3WJLC 4LVNB 3D2UB 2XKNA 1DVFD 3WFBL 5TQ2L 3TNNA 3JV6A 2YR3A 2A77L 5JXEC 2H41A 1S7XA 1QSVA 3B5TA 2C3HA 3DI3B 1QSEA 1A9EB 4QHMB 1VFAA 4N0FB 2F54A 1XF3A 3T08A 2VABB 5JXED 1CFTB 1XR9B 1HHGB 3TZVB 1HHHA 3OKDB 4MD0B 2ZCHH 3ARFC 4FQPA 4EUPB 4ZNCD 1JGEB 4K3JH 3WFBH 4X99B 5L8JB 3V79C 4K7PX 2A77H 3BWUC 4PUBL 4EDXB 3ZE1F 1P1ZB 3D6GA 2BDNL 1H5BA 3R4DA 3CZJA 5ESVB 1FLRL 5I1AB 3ARFD 2CIKB 5DUPH 4NNYA 1F4XL 1DQLH 1T5WA 4I0PB 4ZSOE 5DRXA 3Q5TA 3LD8C 1CFSA 1TZHB 1JJUA 5IJKA 3W5NA 2E7LA 4MJ4A 3ERYA 5DLML 4N0CC 2BSSB 3DGGB 4ONGL 5DRNB 4X83A 2Q87A 5MENE 4PUBH 3TO2A 2YWZA 4YDVB 4YEFA 4XCFL 3CAFA 4GW5B 2BDNH 2DICA 4E41B 4PLJC 3BAEH 1FLRH 2ED9A 1A02N 2PTTA 1U8JA 1F4XH 1S7WB 5EBMA 4N0CD 4JPIB 3G04A 5FYJE 2G60H 4LHUB 4YHIB 3VXNB 4JGJA 1E6OL 2D7PA 4J8RB 5I2IA 4OGAC 4JFHD 4WI4A 4PLJD 4H0GA 5DLMH 4ONGH 5C07A 4PGCA 1U8QA 4PJ9B 2J6EA 5F7DA 5HHVL 3KJ4B 1CFBA 3LQAH 5ISZE 1AGCB 3PGDB 3JZ7A 5FYJL 1NCDH 3H9SD 4HDIA 4LEXL 3RWDA 4ZFFB 4XC1L 5D1QC 4PRIA 1T21A 3DVGB 2Z92B 4YNYB 1NGXA 3OJVC 4OGAD 2DJ4A 3MGTB 4HEPG 1DN0A 5GQBA 4OF7A 3QO0A 1IILE 3FZUD 3VA6A 5HYSA 4NQXB 4PRDB 5DK2A 1E6OH 4DGIH 3QWOA 5D1QD 4GAJL 1FN4B 5IG7B 1IC7H 1HCVA 5D9SA 3BMWA 3KHOA 1OW0A 1LO4H 1T66D 5H37H 4I4WB 1IKNA 3B9KC 5CEYA 3BHBA 1NLBL 1QRKA 1YQVL 4ORGA 4CN6A 4LEXH 2FO1A 1AHWB 5FECA 2E6JA 1PYWA 3OB0H 2Y5TB 5K9KB 2VRAA 2V2WA 1D9KB 2X4TA 3BWAA 4PJFE 3SDCD 2DQEH 5LVEA 4Y8AA 3B9KD 2V9TA 5IEKB 2X09A 3IRPX 3VFGH 2CMRH 4X8JB 3F65A 4GAJH 4A6YB 1MCHA 5DUBA 4BSWA 1AJ7L 2DYPB 3SJVD 4OLUL 5C6TL 1P4BL 3HMXH 2NW2A 4MGXA 5DF0A 2A9NL 1KCRH 2ATPB 1CS6A 4UQ2B 4H1LG 3BPOB 2VXTL 1XCQB 4WTWA 1A6TA 5EO9B 1PLGL 4Q58C 1JI1A 1A9BB 1LEGB 4GSDL 3HZKA 5JPMA 3FRPG 4I2XA 4NM8H 4AIXA 3QNYA 1G7PA 2GJ6E 1OY3B 3KLSA 4LIQE 4OLUH 5C6TH 1NLDL 5CIPA 3ILPB 2XFXA 5KAQG 1WWAX 3S5LA 2A9NH 5CLWA 1BLNA 3BZ4B 2N7AA 3IJSB 3UJJL 3TA3B 2R15A 2BNRB 2Q8AH 1EJOL 3QUXB 2H32B 2KDGA 4KK6C 4CNIB 5F89A 1AQKH 1NCCH 4OFPA 3GSUA 1PQZB 3AUVA 3UYPA 5GISH 1HQRB 5CBAB 1OARL 5GXBB 5F3BA 4PJHF 1PY4A 3CVIH 3Q6GL 3AB0C 5JTWA 3HZMB 2WUCL 3FKUS 3ALWA 4ZUUB 4C4KO 4KK6D 4CU6A 5J4MA 1N6QH 4MCZA 4JRWA 4NKOA 5JIIA 4X5XB 4A2LA 2YZ8A 3VH8B 1BD2B 4NOBA 1CDBA 2OI9A 3UTPE 3JTCA 3VFUA 3AS2A 4N8VG 4G7VL 1ETZA 3QYCA 4OFYA 3FN3A 4JPKL 2FX9H 3BP5B 4TULL 3QDMB 4OGYL 3ARPA 3SKUD 3X13A 1I7UB 1JWUA 1OARH 2B4CC 3ETBF 4OUOA 5F7FA 2XWTB 3TBYA 1FH5H 1CDUA 2UY7A 2WUCH 1KG0A 3KYOB 1VEOA 3KPRD 1I3RB 1KTLA 2IANA 1NFDF 3SHSA 1U8HB 5HVFB 1I75A 4Y1AD 2OR9L 1CDGA 2R23A 2F74B 1JN6B 1YZZA 1S9XB 2VLRB 1KLGB 2OX5A 3D0VA 3SKJL 5I16A 1FCGA 5BMFL 4FHBD 2PYFA 3BQUB 3HZVB 4P0DA 1F3JB 5D4QA 3OKMB 4NQSB 1D5MA 2BMKA 3MJ7A 2BJML 4OZGF 4Z7WA 3H9ZA 3TJEL 4NQVB 2Q8BL 1DEDA 1VHPA 1RUML 4J2XA 4OFVA 1MHEA 1I9JL 4DEPC 3IB4A 1C7TA 3MUHL 3GRWH 4OD1L 4YPGB 4XHJC 1EGJA 2XACC 4MWFA 4FXKB 4WGWB 4V1DE 1P4IH 3C5ZA 4RGMB 5BV7C 1ORSA 2O93L 5GGVL 4Z7VB 3VFNA 4MD5B 1FE8H 2OR9H 4JG1L 4X7CC 4Y19B 1AD0B 2J4WH 1QA9A 5CD3B 3D39D 5C9KA 4BQ9A 3O3DA 3TIEB 4XHJD 3VXSE 5TDPA 4YGAB 3FB6B 1WTGT 4NRYA 1FSKB 3MRBB 2QEJA 3CJJA 5T33L 2BJMH 2FGWH 2VL5A 2D0HA 1I9JH 1JPTL 4D0DA 5DQDH 5A40E 2AXJA 1RIHH 4XB7A 1UEMA 4QRTB 5CFHA 3P9WB 5GGVH 1TVBB 1ZGLM 1ZT7A 4OI8A 3D18A 3RVXD 2VR9A 32C2A 1TXKA 1IT9L 5JNYB 2PO6B 3QEHB 1GC1L 3TBTA 4KWUA 2A83B 4LPVA 1OQXA 1A7RH 4G5ZL 3MRCA 3WSQL 4JM4H 3DSFH 1FGVH 5L88H 3ROLB 2UVEA 4N8PA 1JF5A 5JQHC 1INQA 3PQYA 5C09D 1CLZL 2NTSP 5J12B 5J6GA 1HWGB 1QNZL 5LQBH 4YC2C 2BNUA 3DXAE 4J12A 1QBBA 3MNVA 5HHOD 1SBBA 5BJTA 4HPYL 3G5ZB 2CLZA 4I18C 5FB8B 4P5MB 2BVEA 4ONOA 3B2UC 4G5ZH 4L1DA 2MKWA 2OSLB 3WSQH 1K5NB 1HN1A 3OG6B 3GI9L 3I75B 3OGOE 2R29H 3NCEB 1PZ5B 1E28A 2HWZL 3QWRA 1HSBB 1QNZH 3QZWA 2PW1B 3I3BA 4MA3A 3L5HA 2BNQD 5FO7A 5D6DA 3S98A 1IGIL 1KEGH 2HN7B 4NO5A 5EC1A 3V9FA 4KMTL 3X17A 1KCSL 2OTWA 5GSRA 1W8OA 3MRNB 4HIJA 1U8OB 5EN2B 4EN3A 4Z95L 3RHWK 3BIBX 5B4MC 2FHCA 3EHBD 5GGSB 4TNWF 4PBXA 3NPSB 3GI9H 4HUXB 1LEIA 4Y2DB 4P5TB 5I9QB 1JYNA 2YBRB 2HWZH 2YHGA 2JJTA 2E6PA 4X7DC 4FXGB 1F6LL 3LVEA 2B1HH 5IIEB 1KJ3L 2CXKA 3NH7L 4QF1A 5C0RL 5B4MD 4YEEA 1M7DA 2UUDK 3BXNB 3JV4B 5HBBA 3HR5A 4ZOEA 2ID5A 3OAYH 1MCRA 1E27A 1AFVH 2JCCE 4TUJB 1CN4A 4ZO7A 4LKXB 4Z95H 2D2OA 3VU2A 3ZDYE 3C6LC 4R26L 3U4BL 1VACB 5J6HB 1FRGH 4WFFD 1A6ZA 4J3OC 5ICXA 1G7HA 1JGUL 3RUGB 2DL9A 4XPHL 4P4RB 4WCYH 1RVFL 4Q9BA 1KJ3H 2EIEA 3OR6A 5CCKL 1UACL 4Z8FL 3HUJB 3NH7H 4U4BA 3MLSH 4CMHB 3EYFB 4RMVA 3C6LD 4PJDE 3FCTB 5C07E 3SE8H 4PJFF 1NH6A 3KLAA 3O4LA 3T8XA 3DROA 4HBQA 4XAKE 4XNQB 3KPTA 3MNWB 2ADJA 4ZUWA 4WHTA 3G5YB 1OF2A 4U49A 1A3RL 4R26H 3U4BH 4AEHL 4L8CA 3EYOA 1JGUH 4X6FB 3HNVL 5CINH 5I8KL 3MACL 4HF5L 4Z7QE 2LQRA 3WS3A 1MH5B 1G1CA 4Z8FH 2NX5B 4ZAKA 4UTAL 3VFMB 3TT3L 1HE7A 1XH3A 5CKAA 5T3ZD 3C2SA 3M17B 1DUZB 2LU3A 5SWZB 3BZFB 4UU9A 1TDQA 3IGAA 1E4KC 4J23A 3BEWB 2GYSA 1MIMH 1F90L 1RSFA 3ZLQC 2XTLA 4NQCE 2OLDA 1A3RH 3O11A 1NDMA 3SQBA 4FFEX 1CCZA 4M4RA 3AY4C 1QYGH 3BDBA 4DN4H 2VKXA 2DF3A 5I8KH 3MACH 3U0TA 3T04D 5E9DD 4HF5H 1RK1B 2JJVA 2J6EH 3H2WA 3WFHA 4EI6B 3I85A 1KLFA 3QRGL 3TT3H 2OXGA 4IEFB 3U2SA 3GKWL 1IZKA 1AI1L 5IV2A 4ZPVB 4MDIA 2N7BA 4PRPB 3IDXL 1X5AA 4QHNA 4LCWE 5L2KE 2CR3A 3HKFA 1KCVL 3L3JB 2FSEA 4Y8DC 4PJXB 1F90H 1O5DT 2VLKA 2BC4A 2Y7QA 3MOAL 3RGVB 5CEXB 1I3UA 2NXZC 4HIEA 3GSVB 1ORQB 3CIQA 1ZS8A 2V5MA 4EEEA 3MO1A 1GPOH 2COQA 4WTZA 3QXAB 3IFLL 3QXDB 2P7TB 1NBZB 1PDKA 1YMHA 3QIBB 1XF4B 5EWIL 4K94C 3ZDZE 3QRGH 5B8CB 1B9ZA 2R0ZL 2NXZD 3GKWH 1G6RA 3HCVA 3CDYA 1AI1H 4ZTPL 5TQ0L 1UXSA 3P30L 5FXCH 1QPPA 2OL3L 1VKXA 4FFWC 1CXKA 3VGAC 1R5WB 3IDXH 3CC5A 1EXUA 4XNXH 3ARTA 4X80L 4W4OA 1OLZA 4XC3H 3MV9B 1YMME 4LFHD 4HWBA 4PGEA 3MYJA 3X14B 2ZPKH 4JO3L 3D25A 5DJXB 4FFWD 1CE6A 1FCCA 3T4YA 4HZAA 4ETYA 4IDJH 1JPSL 5EWIH 3C87A 4RCAA 3LIZH 1WVZA 5J0BA 1U9KA 3A6BH 5TQ0H 5T1LA 2CJUL 4X80H 3GO1L 4LLYA 1CT8B 1U3YA 2PYEE 3WN5B 2WAHA 5IF0B 4RDQF 3MV7B 5FM8A 1OAKH 2DKUA 4N8CL 5JXAL 2AV1B 5F6HJ 1EFQA 4O2EB 2R0KL 5CIPH 2ZUQC 1ZAGA 4YX2L 5F7EH 1SBSL 5FOBA 4XWOC 4NCC2 5I30H 3RTQA 2ITCB 3P11H 3VWKC 3QIWB 8FABB 5C0GA 2DBLL 4OLXL 3UBXA 2Z93A 2MFNA 1D6EA 4N90E 3MBED 3MA9L 3FOLA 2Y36H 3LRGA 4RAVB 5TE6L 3VRLE 3GSNA 5SWQA 3DYMA 4DVBA 1FVCA 3GO1H 3O6FA 3TH4T 3TCLB 1VEPA 2MWCA 3BD5A 4XWOD 3VWKD 4ZOAA 1A2YA 3KLHD 3O3BB 1CF8L 4PREB 4WDIB 4CN1A 2J88H 5J56B 3U9UB 5IEHB 2XI9A 1U92A 1WBZA 2EDKA 1QLRB 1J87A 1FG2B 4IIQB 1NFIB 4MQSB 3VI4E 3RAJH 1QACA 1FIEA 4XT1C 3HC0A 4EDWL 4PG2A 2VE6B 4M1CC 3SDAA 1F6AB 2DBLH 2DBJA 4OLXH 1WIPA 2FJFB 4XPGH 5FYJD 5HHPB 2JK5A 3MA9H 2IAMA 4NKIL 3VCLA 3MLUH 4JKMA 4YO0B 2MMXA 5E00B 3D85A 3QQ3A 4X98A 3TESA 1CICD 1MCNA 1RZGB 1S7TA 3T2NH 4I13B 2AEPH 3EJJX 1CF8H 2YD9A 5INDA 4XP5L 5ISZD 2CKBA 2CK2A 3CFCL 2VNCA 1Y0LA 1F2XK 5M7QA 4QGYA 1EERB 4EDWH 1P9MA 1IL1B 3WFCL 2A6IB 4P99A 4FRWA 3BPLC 3DO7A 1PSKH 4XXDA 2IG2L 4NQDB 4S10A 1MFDH 4JDVB 3TP4A 5D71L 4XP5H 2C3WA 4O58L 2FZ3B 4NO2B 2NNAB 2B7DT 3CFCH 5IQ9A 1F8TL 4P2OD 2D31B 1QQDB 2DI7A 3RX7A 1DUYB 4C54A 2ESVA 3LN5A 4JM2A 2HVKB 1EGJH 2BSRB 4ODBD 4P57B 3TPKA 1U8MB 4NC0B 5IQ7L 4MB4A 4JO1H 4X6EA 4HXBL 2Z35B 1A1MB 4C56E 2NY0B 3RVWD 2FB4H 3M8OL 2FHFA 3DPBA 3L3DB 4L8DB 4MNQA 4DW2L 2VDPH 3UTSE 4Y5VB 1Y6NR 1IC4L 3EYVA 4KV5E 2YEZB 3QRFM 3B83A 4XNZC 1F8TH 2NLJA 3S35H 2ERJC 2JTDA 1ZGLP 2X4OB 3MXVL 2VDOL 3QUYC 3PV7A 5KSBB 1N8ZB 1WK0A 3D2UA 3NCCB 4F7CB 3NAAH 2ZG3A 4WFHE 2E27L 1GVIA 1P2CB 2XN9B 5IQ7H 4ZXBC 3S88L 3U9PL 12E8L 4DW2H 1MCFA 3QUYD 4JJHA 2GTWA 4QHMA 1MCOL 4N0FA 3WLWC 2JCCF 5F21B 2IWGA 1NC2A 2VABA 3UTOA 4L29B 4ZXBD 3ZDYF 1B0WA 5DQ9B 5EG6C 4MNGE 3WUWB 1D5IL 1XCTB 2H6PB 1CFTA 1XR9A 2R2HB 3HPLB 2Q7NA 3IXAB 4I48A 1HHGA 5F6HI 3TZVA 3OKDA 4MD0A 3SDXE 4EUPA 1RU9H 5L6YL 1JGEA 1NGZB 4X99A 3RKDC 1I3GL 3WLWD 1P53A 2JJSC 3WHE0 2BRRH 4KJQD 1D5XB 4EDXA 4U1GC 5JW5B 3VDAA 1P1ZA 3U9PH 2HA1A 3D9AL 1CDCA 5ESVA 1DLFH 5I1AA 1MCOH 2CIKA 4OKVB 2F53B 3GIZL 3RKDD 4I0PA 3DUHA 5DD0L 1NFKA 4X7EC 4POYA 3B3IB 1TZHA 2AI0H 1CQYA 1Q1JH 1KJ2B 4Z7QF 5JHLH 3UTPD 1TPXC 3B9DA 1BVLB 2BSSA 3DGGA 1I3GH 2APWA 4OCYH 5DRNA 4MXQA 4KHXL 3FO2B 4G7YL 3U82B 4GJTB 3U46A 2QHRH 4YDVA 1WIUA 4GW5A 4E41A 4WTXA 4POZC 2QADC 2E7BA 5IM7B 1S7WA 2KZ1B 2ZKHH 4LHUA 3EO1B 4YHIA 3VXNA 3EIFA 4DGVL 1OAQL 4R7DB 1I8IB 5K9OB 3G08B 4J8RA 3BJLA 4HUUB 4POZD 5MP6L 5DI8B 3F6IA 2QADD 1GAFH 5E6ZA 3F7VB 4JFEE 3OAZK 3OKYA 4DZBB 4KHXH 1EO8L 4PJ9A 1NGQL 1BZ9B 3TF7A 2VZ1A 2GQHA 1AGCA 3PGDA 2EDQA 5EOCL 1FZMB 4Y4HC 1TCMA 4ZFFA 5I1DB 4HBCL 3STLB 4CL7A 1EHNA 1RY7B 3DVGA 5JW4N 4F37K 3QDAA 2CDEB 4J4PD 4O02H 1I9RL 3MGTA 2C3XA 3QXWA 1J8HE 4NQXA 4PRDA 5T1KD 3LHPH 1OAQH 4DGVH 4OM0L 4Y4HD 5DJ6B 4V1DD 4G43B 1FN4A 3QDJE 5IG7A 1AY1L 4O2CB 3O3AB 1EO8H 1NGQH 3ZDZF 4I4WA 4LMQE 5CZVH 4OLVH 5KSVB 1GC1C 2VXVH 3TYGL 4HBCH 1AHWA 4MQTB 4ODVH 1TVDA 2ZNXA 3VXSD 3QDGB 2AERT 5K9KA 2Y5TA 1UH2A 4D94A 1YN6A 4ZTOL 5KTEH 2HVJB 1D9KA 1A7NL 2R4SH 5BO1H 1QRNE 3BN9C 4JPWL 1GZPB 1MAKA 1J1PL 3PWPB 5IEKA 1RK0B 1EZVY 4EBQL 3JWOL 4KPHH 4X8JA 4A6YA 4L4TD 4LLVB 2EH8L 2DYPA 1AY1H 1JPST 2DQJL 2BX5A 4LEOB 3HI6L 3JWDH 3BN9D 1VFOA 3TYGH 5B38B 4NN5C 2F5AL 5GZNC 3CLFL 5E94B 2ATPA 5KVDH 4UQ2A 5HGBB 5FUCE 5D1ZC 3VWJC 1XCQA 4ZTOH 3V4PL 1A7NH 1KBGH 4OF5A 3VXMB 1A9BA 1LEGA 1V3LA 4EBQH 1RJLB 3JWOH 2YPKB 4JFDB 3THML 3QUZB 5GZND 3BO8B 2XWBA 5D1ZD 2DQJH 5F1OB 3VWJD 4K8RC 5GS0L 3ILPA 4M8QB 2O5YH 3HI6H 3QH3B 3V4VL 3LKSB 1X5LA 4JGMA 4PRHB 2UWEB 3A6CL 3BZ4A 5EOTB 1OHQA 2W60A 3G6AB 3IJSA 1G6RL 3VRLF 4L3EA 3TA3A 3UO1L 1U3ZA 2HFFB 2BNRA 3S3SA 4ZDHB 3QUXA 4KK8C 5GRUH 1OAXL 3V4PH 4RZCB 2H32A 4FFYH 5I6XB 4CNIA 5ABDE 3DRTB 1A3QA 4JRYE 3REWA 5F97E 4U1JB 5EUKB 1RZ8B 1PQZA 4DVRL 5FUZH 4P2QB 1HQRA 2EIZB 4QRQB 4TRPH 5GGVY 5CBAA 1PAMA 5F6IB 1BREA 3VI4F 2B39A 2IADB 5GS0H 4KK8D 3HZMA 1S9WA 4ZUUA 3V4VH 4LOUC 2R0LH 1PW3A 1NL0L 4NOFA 3QCVL 4X5XA 4XPFL 5F7YC 3VH8A 1BD2A 1G6RH 1QBLL 1YC7A 3RKPA 3QXTA 2OP4H 4XNUL 1OAXH 5IJKC 4NZTL 1OP9A 3BP5A 1ZT1B 1LO0H 1I7RB 4LOUD 3QDMA 5H94B 5C3TA 1I7UA 4HWBH 1LMKA 4L3CB 5C6WH 3MRJB 1IKFL 2E5EA 2XWTA 5TF1H 3T3PE 2P8PB 1H8SA 2CUMA 3KYOA 1MCJA 1I3RA 3QCVH 3L1OH 2HLFC 1U8HA 3RHWF 2DIBA 2J5LC 3T1WA 2F74A 1JN6A 1M71B 4WWKB 1S9XA 4FOMA 3O3EB 2VLRA 1KLGA 1LO2L 3IAPA 3ET9F 2MPAH 2HLFD 3BQUA 3HZVA 4JEGB 1F3JA 4HFWB 3OKMA 4NQSA 3O0RL 4JQIL 1IKFH 1WUNT 1R3HB 4MDJB 4NQVA 4EVNB 3CDFA 4LSRL 4YPGA 5ALCH 5C07D 3HG1E 2NMSA 4FXKA 1JE6A 1SQ2N 4M43L 1HHJB 1MREL 1NQBA 4Z7VA 4MD5A 4Y4FC 4XAKD 4Y19A 2E7HA 3WFEL 1AD0A 2DI9A 1J1OL 5AWNL 5CD3A 3GSNH 4MCYB 4URTB 5DUML 4DTGL 1LO2H 4XI5D 4KV5F 4ENEC 2F19L 3TIEA 4EKXA 3G6JE 3FQXB 3DX8B 2CLVA 3FB6A 3SE3A 3MRBA 1L0YA 2FL5B 3O0RH 4JQIH 4ZODA 4Y4FD 3BDYH 5JR1L 2DJSA 1PEWA 2AK1L 3STZA 5CILL 1BGXL 1F4HA 2C5DC 5LBSL 2EZ0D 4ENED 4M43H 2ATKA 4QRTA 3B2VL 3HZYB 1TVBA 3QPXH 4TVSa 5E8NB 3WFEH 2YXFA 1J1OH 3EFDL 1K85A 4GKNB 2A6JB 4AL8L 3S37X 4QXWA 2F5BH 3O2DL 1JZ7A 2PO6A 1RPQA 3QEHA 2A83A 3KPSB 2NZ9C 3BIKB 2CKBH 3D48R 1J11A 5JR1H 3SDXF 3ROLA 2P8MB 3DI2B 1RUPH 2AK1H 4J1UB 5JZ7C 5DD5L 5L2KD 4HCRL 4JREB 3EFDH 1CDYA 4UBDC 1EFXD 5C0CE 1CDJA 3PWVA 2R1YB 1O7SA 4K9EC 3G5ZA 5DT1L 4HIIB 4XXCC 5FB8A 3CMOL 5JZ7D 4P5MA 3AXLB 4YE4L 2OSLA 1OWWA 1K5NA 4LVOB 2AVGA 4MX7B 4UBDD 5J1SC 3I75A 1R0AL 5MEQB 1PZ5A 4XRCB 2R8SL 1OTUC 3WCYA 5DD5H 1HSBA 2BRQA 4LCCB 2PW1A 5I18L 3JV0A 4W70A 1YMMD 1XAUA 5FYKE 1TENA 2HN7A 1SVZA 2OYPA 4OIIL 1WBXB 1T7ZA 3HE6B 3MRNA 1OTUD 1QFUH 3GIVB 1RULL 3P4NB 2J2ZA 4YE4H 5EN2A 5HI3C 3NA9H 4CAGA 1K8IB 4ZNEE 1MRCL 3S36L 1HILB 5GGSA 1PKQE 4HUXA 1R0AH 2QV2A 4IBLT 4Y2DA 5FYKL 4AMKL 2P5WE 5DQJB 3RX5A 4P5TA 2R8SH 5JMOC 4OZIE 2YBRA 5H2BB 3EOYG 4K71B 3Q2CA 5I18H 4DN3L 4FXGA 3TPUE 5IIEA 3OAZH 2XT1B 2VQTA 2YD8A 2PYED 4JY4B 5HI3D 2AXGB 1UADC 4R90L 3L5XH 4P2RE 3UBXI 1IM9B 3BXNA 1NBVH 3JV4A 3OXSB 1AD9B 3MRGB 3EYQC 4GW4B 2F9BT 5FOJA 1YEGL 2LTQB 4TUJA 3QISA 4KAQL 4LKXA 4M93B 1MRCH 3S36H 2B1AL 1G7JB 3QEQE 1NBYB 1VACA 5ESAA 5J6HA 5FYKH 4N90D 1JMZA 1IEBB 4R97B 3RUGA 4EUPH 1QFPA 4P4RA 2APFA 4XP6H 1KB5B 3P0YL 2YD6A 4DN3H 1YPZB 1RD6A 5F9DC 3HUJA 1E4WH 4R90H 3EYFA 5EO0B 5D7IE 2HG5B 3E8UL 3FCTA 3S96B 3ZHDA 4CVZB 1MAML 4XNQA 1VCAA 3MNWA 3CX5K 4PD4K 3QI9C 3G5YA 4OJFH 5I1EH 4UIKH 3LB6C 1FL3B 4JZNB 4X6FA 1KENL 4Y88A 5GZOC 1VFUA 5KBNC 3P0YH 4H1LB 2PTVA 1GGIL 1FLTX 1MH5A 4NM4L 2NX5A 1A8JH 2LAAA 4F15C 3VFMA 3K80A 3QI9D 4MAUH 2HKFL 2VH5L 3E8UH 5EC2B 5I19L 3M17A 4QOKE 1DUZA 1W0YT 3LB6D 1MCPL 5SWZA 3BZFA 1CL7H 3T2QA 4OM1H 3MJ9A 5GZOD 2YK1H 3BEWA 4UI2A 2VISB 4ODTH 1RZ7L 4DKFL 2H8PB 3RA7H 1QFOA 2QQNL 1UGNA 4GMTH 1T0MB 4MJIE 4G8GB 1RK1A 1WC7B 5IHBA 4K3GA 4NM4H 5A1AA 3TFKC 4EI6A 4PJGB 3WXWH 3RVUC 1NCWL 4CGTA 4ZPVA 5T5FH 3U7YL 4PRPA 5D7LE 1I8LA 3ZT6A 5KW9L 3WD5L 5BXFB 3L3JA 4AQOA 1RZ7H 2YOCA 5CEXA 4DKFH 3TFKD 3HS0B 3RGVA 4F7EB 4OV6F 3GSVA 1ORQA 2WIMA 2R56L 2QQNH 3RVUD 1IMHC 3QXAA 3QXDA 4M5YH 2P7TA 1NBZA 2XZCL 1SM3L 5FGSA 3QIBA 4XP9H 3PQYD 4N8VB 1XF4A 2B2XL 2FX7L 5B8CA 3T0EB 4K55A 5ETUB 3UTSD 5JMRA 3MLWL 5D5MF 4P48A 1R5WA 1IBGL 5DSCB 1S9VB 1IC1A 1LNUB 5C3LD 3MV9A 2I24N 2XTJE 4WFHD 4XMPH 2Q7YB 3TBSB 5EZOH 3ARQA 3X14A 3R1GH 4LSSL 4A6YH 1JNNL 3T3PF 2VDRL 4NO0B 5DJXA 2Q86B 3GNMH 3V0WL 3KPNB 1SM3H 3GBNH 4XVJL 1I4FB 2YD2A 2KBGA 4ODUB 4QRRE 3MLWH 5I1IH 5CJXC 4DKEH 1HYSC 1DBJL 2IPTH 3QFJB 1IBGH 3V0VB 2GAZB 2WUBL 1CT8A 2JF1A 4NKMB 3WN5A 4Q97A 2VSDA 1G6VK 3IJYB 5EU6E 4LSSH 2HH0L 2AV1A 3KXFE 1J5OL 1HYSD 3SCMC 4LDOB 5FV1L 3OXRB 4O2EA 3JSSA 5DGQA 1TJGL 5FF6B 4XVJH 1HKLL 5A16B 5HVHC 4PLOB 3KPMB 2ITCA 4XVSL 5E2TL 3QIWA 8FABA 2P42B 4DAGL 3UJIL 1TFHA 2EDEA 2YPVL 1WAAE 4NFDA 4RAVA 5KVFL 1IGTB 2EC9T 5JIKA 3SCMD 4Z5RB 2H32H 4MA1B 3G6JF 3TCLA 5EBGA 3RY5A 5C7XL 1QHPA 1R5VB 4GRMB 6FABH 1PEZA 2HH0H 5SV3A 3O3BA 4PREA 4WDIA 1J5OH 2DM4A 3U9UA 5IEHA 1JPGB 3MREB 4H26B 5F96L 1QLRA 4UT7L 3CFDB 1FG2A 1TJGH 2GY7B 4IIQA 1NFIA 4OI7A 5E95B 1HKLH 1CD1B 1E0OB 4DK3A 3U4EB 4QXUH 4XVSH 4HXAH 4ZD3L 2VE6A 2Q76B 1F6AA 1JIBA 3P4MB 4FTVE 2FJFA 5ERWB 4DAGH 1UA6L 5HHPA 4M3KB 2YPVH 1OCWL 1BBDL 5KVFH 1VSCA 3H0TA 4YO0A 5E00A 4U6VL 5FGBA 2I9LB 4RFNC 4CVWA 1RZGA 1BFOB 3BVNB 4XTRC 3RY6C 4DGYL 4QXGL 5AYUH 1R3IH 4UT7H 2VB5A 5DMYA 1C5DB 1TZIB 3A0OA 1C5CH 4U1HB 4ZD3H 1IL1A 2VN4A 4J3WA 1F3RB 2DQFB 3LS4H 3SBWC 1RFDL 1YEFH 4YFEA 2A6IA 1J8HD 1CI5A 4XTRD 3TM6A 5JQ6L 4QKXB 1MRFL 4NQDA 2RCSH 4JDVA 2ICEB 3SE4C 1YEKL 1FNSH 2LE9A 1OWRM 4YJZL 3W5MA 3NCFB 1K4CB 2DTSA 3PL6B 1ZXQA 2FZ3A 4NO2A 1OSZB 4R8WH 2NNAA 1KIRB 2D31A 1QQDA 5CMAB 4HK3J 1EVUA 4F7PB 2B0SL 1DUYA 3FFCE 2C4XA 2XZQH 1RFDH 2EKJA 2HVKA 4WI8A 4Z7UB 3QG7L 2BSRA 4P57A 4J3SA 1FIGL 1SJVA 5GS2H 4GAGH 1U8MA 1T04B 2OJZH 1QRND 4WW1B 2Z35A 1A1MA 5JQ6H 3DRQB 4M62L 1SYSB 3L3DA 4L8DA 5FUCC 5H8DA 4N9GB 4Y5VA 2ZP0T 3DV6B 5CGTA 1FP5A 2YEZA 4S0TD 4ZS7L 3QCUL 4WI7A 3UTTE 4YDJB 3BN3B 4OZIF 1CGVA 2X4OA 2GCYA 5KSBA 1AGBB 1N59B 4PRBB 4YXHL 4QHUB 4F7CA 4KU1A 4LAQL 1P2CA 2DMBA 2XN9A 1HEZB 4WI2A 1S7SB 2FWOB 4NCDA 1MPAL 4R0LC 3C09C 4M62H 4TSCL 4JO4L 3S4SG 5J11B 1KIPB 3SQOL 2WQRA 5CJ5A 3KYKL 1MCBA 2HJFB 3WKMH 4LASL 2DQDL 2W65B 4L29A 5DQ9A 3WUWA 1GZQB 1UB6B 1XCTA 2H6PA 3HPLA 5AG9A 3IXAA 5J1AB 2VQ1B 3CX5J 1JFQH 3HRZB 4PD4J 4RIRB 1BHGA 1NGZA 4XCCH 1KEMH 4B41A 5DDHB 3VW3L 1MPAH 4OBRA 1D5XA 1LDSA 1M1SA 3I6GB 5D7IF 5JW5A 2YKLH 2VLJB 4JO4H 5T1LD 2Z31C 2YUVA 4N0UB 1A7QL 5HHME 1FQ9C 2EDNA 2JELL 3QSKB 4OKVA 2F53A 1WZ1H 1T89A 3ZKMC 3F12B 1T83C 2DQDH 3L9RB 3O6LL 4HWUA 2CPCA 3B3IA 2NTFB 3WLBB 3UTZA 4HIXH 1B4JL 2OJEB 2Z31D 1KJ2A 3UJTL 1BVLA 5DK0B 5HSFA 3FO2A 3ZKMD 1FZKB 4XWGH 4HUVB 2FIKB 1I8MB 2LU4A 1A7QH 1Q0XL 1Y18B 4PLNC 4L4VB 3EYUH 5IM7A 4KJYB 4F7TB 3VMNA 3EO1A 1LDPL 4XGZB 4WO4C 4NNPL 1NBQA 3MLZH 3F7PC 4R7DA 4BQ8A 1I8IA 5K9OA 3G08A 1B2WL 3R0MA 5GHWL 4HUUA 2VXSH 3UJTH 5DI8A 1QBML 3LAFA 4S2SB 3TVMB 4DZBA 4JQXC 1EO5A 3AM8A 1HZHH 3NCJL 1BZ9A 3O9WB 4NJAL 1LK2B 4WO4D 4EI5C 1FZMA 4HPOL 5I1DA 1RZJH 2BXYA 3STLA 4WFGE 1Q38A 5KSAB 2CDEA 1H0DB 4B5EA 1FVEB 1C1EH 4RMSA 5IHZB 1LDPH 3D85D 1ITCA 4M7LL 3GMQB 3UZVB 2J1KA 4Q9RH 2AJVL 4EI5D 2FHBA 3HG1D 4IMKC 5DJ6A 3K7UA 1B2WH 1NCAH 4G43A 3QR2A 5DFWH 4I3GA 5FEBA 1QBMH 2VXUH 4O2CA 3O3AA 4K07A 2R0WL 3NCJH 4LK4A 2VDQL 4PJEE 5KSVA 1YJDH 4HPOH 4WU7A 2AKRB 4P23C 5GJTH 1WZMA 4YUEL 4QHKI 3QDGA 3ZYIA 1TQBC 2HVJA 3N1GC 4M7LH 3PV6B 1GZPA 5KS9E 2GJZB 5IB3B 3PWPA 2AJVH 1RK0A 5AYQA 5E03A 4P23D 1HQ4A 2V5YA 4PRPE 4LFHG 4H25B 4LLVA 4YHPB 1L0XA 2PXYC 2MTPA 2PUQT 4LEOA 1D5BB 4PJXE 4HH8A 2C4FT 2BOCB 4K7FB 2ESVD 4ZOCA 3ELAT 2AJZA 2EEBA 2AJUH 3P3YA 4JM2D 5B38A 4YUEH 5E94A 5HYIA 5HGBA 4TSBL 2JB6B 1OM3L 2H45A 1BEYH 4BSJA 5I1JL 4YR6B 1VERA 4HD9A 3VXMA 3FMGH 4L8BA 1A7OL 1RJLA 2YPKA 4JFDA 5DVKA 1JHTB 3QUZA 3RI5K 4XZUB 3BO8A 1RQ5A 3O8XB 4O9HH 3C60B 4YDLC 1DBAL 5FYJU 1XGTB 3R8BB 5D2NB 3NIGE 2GIYA 3RDTC 3OHXB 5IK3B 4M8QA 5C0CD 3QH3A 4OLYH 3LKSA 4EOWL 2W59A 5C0IB 4PRHA 2BP3A 3VG0H 2UWEA 4HUWB 1WAAF 1X44A 4U6XB 5EOTA 3G6AA 3D3VE 1ND0B 2B5IB 2BVQB 2HFFA 5D5MA 5IFHL 4ZDHA 4L5FL 4RZCA 3WMSA 3RDTD 1Z9SA 5I1JH 4F9PA 1QR1B 2DLHA 4LSVH 3DRTA 1A7OH 5HDBE 4HWNA 1RZIB 5EUKA 1RZ8A 2WQ8A 4NUGL 4P2QA 2EIZA 4QRQA 4MAYB 5D7JB 1DANT 1DBAH 3HC3H 1FFQA 2IADA 5HGHB 2MQCA 5FYKD 5DJZB 3UAJC 1KXVC 3TZVD 1GHFL 5IVZB 4H88H 3EDEA 3MV7E 3MV01 3KYAA 4WUUE 4WHYH 5IFHH 1ZTXL 4CW1B 5ANMB 4L5FH 2HJLB 1A6UH 5GGRB 2VDKL 2WLZA 5D70L 1I8KB 4PJIB 2PETA 3UAJD 1ZT1A 1I7RA 1ZVSB 3QQNA 5H94A 2AQ2A 1ROWA 4L3CA 1OD7A 1FO0B 2R1XB 1UCBL 3MRJA 5B3JE 2P8PA 4HFUL 3TV3H 5GSVB 3W9EB 2DQUH 2Z8VC 1B3JA 2J8UB 1ZTXH 1BQSA 4LSTH 3ARGB 2VDKH 1U93B 1M71A 4WWKA 5D70H 5FK9B 5DA4A 3RNQB 3O3EA 3QEQD 1N6VA 4MQ7B 5JPNB 4LHUG 3KJ6L 5LGHL 3OJMB 5EORL 2R2CA 4EQ3A 5INCA 1A0QL 1V3MA 4OD3L 1M7IB 3PWNB 3MUZ1 1MHHB 3O4OC 2ZCKH 4HFWA 2BY1A 1CGWA 1UCBH 1R3HA 2BSED 4M1DH 4MDJA 1SHMA 2KQNA 4EVNA 4IOFD 5J3HC 3SGJC 2QHLA 3ARRA 3FL7A 2DM7A 1INDH 1CK0L 1GGCL 1HHJA 4BM7A 3BP6B 4D9LH 3GJFK 5IMMB 1HXYB 4MCYA 5I0ZA 1X5XA 2W0FB 3KJ6H 4LLDB 5LGHH 5J3HD 4FQJH 3H6JA 1UZ6E 3P73B 1A64A 3FQXA 3S7GA 3DX8A 5F8RC 1MQ8A 2ZCLH 4QRUB 1WIOA 5TGBB 2X1QA 5ECJE 1JMXA 5F7HA 2FL5A 4LSQL 2W91A 5C2UB 4PJ7E 2VDNL 3PJSB 3WHXB 3VGHA 5HHQB 1V7ML 1CXIA 1ZLVH 3MRDB 4QOKD 3UCRA 2VKWA 1GOHA 1GGCH 2BY3A 2P47B 3HZYA 3NVQA 3FFDB 1SMOA 5E8NA 2Q6WB 3KAAA 2WV3A 5IESH 1FORL 3C2AH 4GKNA 4NN7B 1UWGL 1YNKH 4JRXE 2A6JA 1E4XH 4KDTA 1X5JA 3NZ8B 3H3PL 4OLZL 5BRZE 2H2PC 1D9KD 1RUKL 1M7XA 4MJID 4Q2ZB 1MSPA 2CQVA 1L6XA 3KPSA 2FLRT 3BIKA 1FL5B 1ZEAH 5J1TC 2P8MA 1VGKB 3IDGB 1KV3A 1V7MH 3EO9L 2EDBA 3LKQB 2EYRB 4J1UA 1ULVA 3HLAB 1TMCB 2H2PD 4M4PA 4OZHF 4AEIL 4X4XB 4I3RL 2BHZA 1FORH 3V4UH 3FONB 3CSYB 4ZFGL 1N26A 2R1YA 3H3PH 2P4AB 4OLZH 4GBXC 2IPUK 1RUKH 4DQOL 4HIIA 4JCLA 3AXLA 1MCKA 4AJ0A 2XTJC 3M45A 1WT5A 4ZO8A 4MX7A 2R2BB 5FYLE 1P84K 4KDVA 5CJBA 3EO9H 4P3DB 2YA1A 5MEQA 4YHYB 4XRCA 2EXWC 5DWUL 4YK4C 1UKQA 4GBXD 4LCCA 4AEIH 1IC5L 1MIEH 4I3RH 3OKEB 4JDTH 3VXUA 2HMIC 2XTJD 2VUYA 3E2HA 4PJCB 4P4KC 2VC2L 1WBXA 1J0IA 3F7YB 3HE6A 4PB9L 2NY3B 4DQOH 2EXWD 3BGAA 1H9VA 3LPWA 4LRNL 4HK3N 5DYOB 3P4NA 3WIHA 4YDKL 3SO3B 3BEVB 5KN5B 1K8IA 2HMID 1HILA 4K7PH 4QRRD 5DQJA 1B6UA 1WISA 5H2BA 2RAMA 2WSKA 3LS5L 3VFVB 3EFFB 4JY4A 4G6KL 2AXGA 1OGAB 4GFTB 2EDLA 3SPVB 2NXYB 1IM9A 1NUGA 3OXSA 1AD9A 3KXFD 3MRGA 5K59E 4M7LT 3L7FB 4GW4A 4RDQG 4YDKH 3VG9B 4PP1C 1CD8A 1NBYA 2MNUA 2V7NB 1IEBA 1UXWB 4PJEF 3RBGA 1KB5A 3FTGA 1YPZA 2ADFL 4PP1D 3MFFB 4M6ML 5EO0A 2HG5A 2E8YA 5EZJB 5DD6B 3S96A 3EJZC 3FJTA 4F7MB 4RNRB 4CVXB 5KS9F 4CJ0A 4CVZA 2HTKC 1G0XA 2VLRD 2OQJB 5L9DH 3DECA 2DM2A 2YZ1A 1IAIL 3IFOB 2EXYC 3RVTD 4FTVD 4G6JL 1FL3A 1KJ2H 4JZNA 2X2YA 2HJKB 2UY6A 3EJZD 2X1OA 4H1LA 5L7XH 3BYYA 1Z5LB 4OB5L 4O5LH 4JFFB 5E6IC 1OAYL 2FJGB 5T1DL 1CE1L 3FRPA 2EXYD 5EC2A 4CN4A 1N2RB 5IVXB 1J0HA 1S3KH 4IMLB 5KG9B 1AR1C 2YWYA 3TGXA 1MJJB 1FHGA 2VISA 1FC1A 2X1XR 3WFDL 4NPYB 3BT2L 2H8PA 4YXLL 2QTEA 3NIGF 1OB1B 3AS3A 3NABH 3O2WH 5ICYB 3MR9B 3E3QE 1QD0A 5CWSB 4G8GA 1AR1D 1WC7A 1U3HB 3VXRB 1J10A 4OB5H 4PJGA 3GMMB 1OAYH 5LAXB 4LLUB 4P9ML 2X4NB 3U7AA 3D0LB 2DQHL 5EUOE 4FG6C 2B8OT 5BXFA 5HDBF 1U8IB 1NGPH 2GHWB 5EOQL 3FFCD 3HS0A 5I1CH 4F7EA 3TT1L 3ARDB 4Z7OE 4FQXC 4X7SH 3VFWB 1CXHA 3MV8B 2BVPB 1DCLA 2AAVA 2W9DH 4A2MA 3U30B 3UYRH 4FG6D 1DN2A 1BWWA 1G7LB 2ARWA 1ZK9A 2CUHA 4JJ5B 2BY2A 4N8VA 1YEEH 3T0EA 5JOPE 1A5FL 4UDTA 1MLBB 2G9HB 1A1NB 5ETUA 1NMBH 1AKJA 5E5MB 5FDYA 5DSCA 1S9VA 5J89A 1LNUA 3CXDL 5EOQH 1ZHNB 4Y5XB 2A0LC 1RAMA 2Q7YA 3TBSA 5SWSE 4IJ3B 3IYLW 5B3JF 4KRLB 4NO0A 1J7VR 1MAJA 5C0AE 2Q86A 3V5KB 1P6AB 3W0WB 1CU4H 3UC0L 3V6OA 2QQLL 1FNHA 5K9QI 2D4DA 3LN4B 4G9FB 3LH2H 4ODUA 5JLZB 2A0LD 3C08L 4YHKH 1T1WB 5FO8B 4HKBB 3PUCA 5DXWA 3QFJA 3NCYP 3BKJH 1L4IA 3U7WL 3V0VA 2GAZA 1FYTE 3CXDH 5I9QC 4K23L 2VLLB 4BQ6A 1TJHH 4NFBA 5LXGH 3IJYA 2OMNA 4X6CE 1ODAA 4F9LA 3U1SL 2EYTB 3QXUA 1KELL 3UX9B 3OXRA 4NQEE 4NWTL 4Y2DD 3MLTB 5FF6A 1IGMH 2QQLH 5A16A 3KPMA 5HHMD 4X6DB 5IB5B 3PHOB 3ZDXE 3C08H 1J0JA 4KUZL 5DZNA 3RJDA 5IWLA 3QWOB 1IGTA 2DD8L 2AS5M 1UZ6F 4U3XA 1LE5B 4K23H 1NCBH 1YNLL 1MUJB 3FN0L 2VAAB 3BX7C 1I1AC 4JR9H 4RWYL 4GRMA 1R5VA 3L3KB 4UAOC 4EXKA 3BHBB 4PJ7F 4IOSD 1JPGA 3MREA 4H26A 4CMHC 3VD9A 1U6AL 4NWTH 3CFDA 3UPRB 1DVFB 1N6UA 1CD1A 3AS0A 3U4EA 2Q76A 2O5XH 5F9JB 5ERWA 4HJJL 1I1AD 1HHKB 3MUJA 1HWHB 3SEPA 2DD8H 1MJ7H 4WENB 4XMKL 4BSWB 2I26N 2I9LA 4LCUB 4RWYH 1BFOA 3BVNA 4FQLL 4GG6B 1WWBX 5AZ2L 1T7WA 3VI3E 1C5DA 1TZIA 4U1HA 5GPRA 4F58L 5LGKA 2DQFA 4MZ3A 2M8XA 4E42B 1P84J 2V5RA 4HKZB 4JHBA 3MRPB 3I3EA 3VGDA 3RFZC 1UKSA 3WJJC 2WBKA 4XMKH 2XPGB 3O81A 2ICEA 1YYMH 1LO3L 3PWUB 5SWZD 1XF2B 3HTLX 2XYCA 4FQLH 1K4CA 5KANI 3PL6A 4DKDC 5KVGL 4R4BB 1KIRA 1CLOH 4IRZL 5CMAA 4G6MH 4F58H 4F7PA 5DD1L 3MCKB 2DLTA 4Z7UA 4TNVK 2OCFD 4MVBA 1T04A 2AK4A 4LVHC 4WW1A 3DRQA 5HDQL 5JORA 4P9HC 5GGSY 3CLEL 1SYSA 1JK8B 1LO3H 2X89A 3L5WB 4PRPD 4N9GA 4H0HB 1SJXA 4MHHI 2I9TB 2G2RB 3DV6A 1QSFB 1D5ZB 3BP4B 3W81A 4PJAB 3GI8H 4M00A 2XG5A 4GRWE 5I17B 4YDJA 1IE5A 3RQ3A 1RV6X 3O6KH 5DD1H 2YPLE 1AGBA 1N59A 4PRBA 4LSDA 1DBBH 4QHUA 4Y89A 3BRFA 4NHUB 2OR8A 3H9SB 4OZHA 1HEZA 4MB5A 1CFVL 1S7SA 2FWOA 2YN5A 1QVOA 3V7AE 5I8OL 2DQIH 5K59F 1KIPA 1T0PB 2KUTA 4RFEB 5GGQL 1URLA 2WBJC 3OG4B 5LWYH 2HJFA 3FO9B 2BVTA 1IM3B 1KG0B 2W92A 2W65A 5D1QB 3OF6D 5IJVB 1GZQA 1UB6A 1JWMA 1PBYA 3QUMB 5J1AA 2VQ1A 3D3VD 2R9HC 4FQCH 3HRZA 4RIRA 2WBJD 1JNLL 1UJ3C 5FUOL 3NTCL 5DDHA 4GG8B 2YMXH 5I16B 4Z9KB 2GI7A 2UZIH 3I6GA 1JBJA 2HP4A 43CAB 2VLJA 5HYJB 4N0UA 4JY5L 1ZSDB 1BFVH 2R9HD 3B9KB 4YWGL 1ZANL 1L7IH 2DTMH 4UTBL 3F12A 1MHEB 3L9RA 5E5RB 2DWEB 3QIWC 4KZEL 4PJ8C 5IROA 4KKAC 2NTFA 3WLBA 3MV7D 4HZLB 3SJVB 4WUUD 2OJEA 3BKCL 4LRIA 4XP4L 5DK0A 3T09A 3NTCH 3V52L 1RURL 4WIQA 1FZKA 3DBXA 3QIWD 4PJ8D 1FNGB 4KKAD 4HUVA 2FIKA 1I8MA 4CRPA 2QQKL 3GFUA 1Y18A 4YHNB 2XQBH 4NCC1 4L4VA 3GMNB 4KROC 4LLAA 4KJYA 1XR8B 4TOYL 4YHZH 4F7TA 2EEDA 1SY6A 4OGZA 2VL5B 4FQIL 4XGZA 1WZKA 3SN6N 1JHLH 2AQ3A 3WIHH 8CGTA 5D72L 5T3XE 3L7EB 1FFOB 2RIKA 3BKCH 4LU5H 1NC4D 5DTFB 5BS0E 1QZ1A 5CJOH 4S2SA 3TVMA 4BFIB 4KROD 5IB4B 3V52H 3GK8L 3O9WA 1KB5L 1LK2A 1PZUB 5EUOF 2QQKH 1MNUL 5KVEH 3NGBC 5KSAA 2X6MA 1H0DA 1FVEA 3ARSA 1S9KC 1FZJB 4FQIH 1IGCL 5IHZA 5DVNA 1IAIM 4Z7OF 3GMQA 3W2DL 1OSPL 3BP7B 2DQGL 1PFCA 4YHML 3DTXB 5J9PB 3MC0A 4HWEH 2DS4A 4NZRL 3GK8H 1KB5H 1ITBB 4ISVB 1F5WA 1VGEL 3CFJB 1AO7B 2AKRA 1ADQA 3RWJB 2HT2C 3I2CL 1MNUH 5HHXL 5DC0A 3AB0B 4ZFOB 3TH2T 1WTLA 5CLTA 4JZJC 4OFIA 5E4IA 3ZKSD 1IGCH 3LEXB 4PGBB 1C5BH 2OZ4A 3X3FL 3PV6A 2GJZA 5IB3A 1OSPH 3DGCR 2M1KA 3WYRA 4H25A 4YHPA 4YHMH 5AZEL 3B9AA 1I7TB 1GYAA 2DAVA 1D5BA 4H1LH 4KC3B 4JRXD 1UWXH 2ADGA 2IMMA 2KKQA 4K7FA 4Y5VC 5T5NF 2DQTH 5BRZD 5HHXH 3QCTH 2JB6A 1CGXA 1FDLL 1OPGL 4LPCA 1KN4H 3X3FH 2FLBT 1ACYL 2EEAA 4X6CF 2D9QB 4S1QL 1JHTA 3PF2A 4XZUA 3O8XA 3C60A 1XGTA 3OQ3B 4U1SB 3RWIB 1J8KA 5D2NA 4XHQA 1H8NA 5IK3A 3MCLL 3FHQA 3ZDXF 3RRQA 2WY3A 3KNBB 3OGCB 5C0IA 4HUWA 4Y1AE 4RX4D 4U6XA 1S9YB 4LDLB 1ND0A 2BVQA 3D39B 1X5KA 1FDLH 3BZDA 1NGYB 2DOCA 4I3SL 5ACZB 4DEPB 1QR1A 3Q0HA 1ACYH 5EIIB 1OVZA 4IHOB 5BV7B 1G7HB 5CP7B 4PYHA 4P46C 4YZFE 1RZIA 4JGUA 4WWID 1AGFB 5B39G 1DQDH 35C8L 3GMOB 4LARL 3GSXB 4MAYA 5D7JA 3VDCA 4AH2B 4D8PB 1AR2A 2XKSA 4ELME 4KKNA 5HGHA 5DJZA 3MCLH 4PGZA 5A2LH 1CXFA 5GRXG 5I1KL 5IVZA 4OCXL 1R5IB 2W07A 3KLAB 3QEGL 4OCRL 4P46D 4OIAA 1TCRA 4R3SB 1J0KA 1K3IA 3IDIB 4H20L 4CW1A 5ANMA 4ODHL 2HJLA 4PJBE 5GGRA 5C0EB 2CGRH 4AG4L 3VD7A 1I8KA 4PJIA 5CEZE 1ZVSA 1AC0A 1DQQB 5L8KB 4LCIL 35C8H 4LARH 1Z9MA 3GZKA 3CU1A 1GXEA 1FO0A 2R1XA 1JPFB 4NC2B 3DYOA 4L9LC 4RGNE 5FHAL 4OCXH 5GSVA 5CEZL 1V3KA 4OCRH 3RP1A 3W9EA 4XPAH 5HHNB 2J8UA 1UG9A 1F4YL 1HCFX 2VZVA 1RIVH 3ARGA 3ZHLA 1U93A 1G9EA 4AG4H 1C16B 5DJ8B 1T80A 5DHYB 5FK9A 3RNQA 4MQ7A 2FX8L 5DVMA 2E9WA 5DD3L 3BJ91 1M7IA 3PWNA 4YC2B 2A6DB 1MHHA 2EE3A 5IBLC 5C08E 1FYHB 5EU4B 1ONQB 4TVPE 5GRJL 2NZIA 5TE7H 1UCTA 3RU8L 3SGEH 5C09E 5JHDE 1YYLL 4I18B 5CEZH 2BNQB 4QHNB 4JQVA 4PLKC 5IW6B 1TTUA 1F4YH 3OAUL 3BP6A 1UVQB 1GGBH 5IMMA 1WFTA 4K7PY 1HXYA 4AIOA 4WW2F 2W0FA 4TVPL 1K2DB 4LLDA 3OSKA 4PP8C 3P73A 2HRPL 2OTUB 4EIZC 4PLKD 4QRUA 4GRWF 5TGBA 4MSWB 4QRPE 2FJHB 3LZFH 2HFGL 4NSKB 25C8L 3PJSA 4TQEL 3WHXA 5HHQA 1R6VA 3MRDA 3S4SB 3E3QC 2RR3A 1EMTL 1TZGH 4G3YL 3FFDA 2Q6WA 3BGFC 4PGEB 4BELD 3RWEA 4LQ1A 4H8WH 3ZE0E 4N5EA 1WF5A 2A6KB 3TN0C 4YH6A 5DRZB 2VZTA 3AMLA 2H1PH 2IQ9L 3NZ8A 1KOAA 4YHOL 4ZPTB 2IBZX 3GBMH 3PWPD 3GM0A 3UDWA 5FKPB 1QLFB 1FL5A 4C59B 4HJGB 4LSUL 1VGKA 4KVNL 3IDGA 2P48B 2VN7A 3TN0D 3LKQA 2EYRA 3HLAA 3BESR 1H3UA 4G3YH 4YDIL 4DJMA 1TMCA 5FCUH 5AG8A 4X4XA 3C6LB 5LCVL 3QUZC 2DQCL 3FONA 3CSYA 4HS3B 1NUFA 1BZ7B 5D7SL 1IQWL 1WEJL 4PJHB 4O2FB 4DFHA 4YHOH 1KIUA 2PF6A 4K3HA 5CGMA 4M3JA 2VQUA 4JFDD 4ODSL 3QUZD 4OF0A 2R2BA 4LSUH 4P3DA 3FOLB 4WI5A 4F9PC 4IDLA 1F97A 1BJ1J 2A9ML 4YDIH 2EC9U 5LCVH 1RJZB 5ID1B 4PRHD 3OKEA 4CU7A 5F6IC 1ZGLB 4PJCA 3OKOB 2VDML 5D7SH 2J8HA 3F7YA 3MA7B 1MFAH 5C0AD 3EO0B 5DYOA 4QWWC 5HDLA 3CVHB 3BEVA 4ODSH 4RGOH 5KN5A 1T0NB 3AFLA 1NFDB 5C86A 3ULUE 2GK2A 4M1GL 5I1LB 5E9DB 4BFBD 4K3DH 1BJ1H 1H3PH 3OR7B 3SGKA 4JHZA 4JVWA 5ADPL 4W81A 5EIVA 3SGEI 4QWWD 3VFVA 3EFFA 3SKOB 2APTA 1OGAA 4OT1L 3SPVA 1NEZG 3ZZ1A 5E5UB 1LILA 4D3CL 4RSVA 4OZGB 4IRSC 1GJIA 2WP3T 3L7FA 4XCEB 4NQED 3LKPB 2E6QA 1F58L 3AAZB 3QJFB 3MGAA 3DO7B 2IH1B 3QAZB 2D7TL 1UXWA 5ADPH 5EULV 2NXZB 4Y16C 3PDDA 4OT1H 3MFFA 5D96C 2D03H 4WUKL 1J1XH 1XIWC 4D3CH 5EZJA 5DD6A 4LP5A 3FB5B 1FJ1A 1UJTA 4RRPG 4F7MA 4RNRA 4CVXA 4JO2L 3CFEB 4MJ5B 1SY6L 1MFEH 3BISA 4Y16D 3NFSL 5GGTA 4WEBH 1JHKL 1KXQE 3IFOA 3VGAB 2P8LB 2D7TH 1KACB 1XIWD 2Y1VA 1N0XH 2C1PB 2HJKA 1KGCE 2FCBA 5IGXH 1U8PB 3DV4B 4MNQB 3QIUC 1Z5LA 3HHRB 5C8JB 4JFFA 3EYVB 2EH7H 2FJGA 4C57C 4WUKH 1N2RA 5IVXA 1ERNA 5I73B 4JN2B 4IRJC 4H0IA 4IMLA 5KG9A 3VDBA 4JHWH 1DZBA 3LEVH 4NN6B 1MJJA 1SY6H 5FYKU 4PTUB 3VFTB 5F9WC 2ZCHL 4GXUN 3NFSH 3QIUD 4NPYA 4K3JL 1JHKH 2X05A 1OB1A 5ICYA 3MR9A 4IRJD 1I85C 5CWSA 4AZ8A 3EZ8A 1U3HA 5ITFB 3VXRA 2GTWB 5DUPL 1JF1B 3GMMA 2XZAH 4ZSOB 4LLUA 5LAXA 5MHSE 2X4NA 4MJ6B 1DQLL 3D0LA 1NC2B 5IVNA 3QHTC 4KK5D 4I48B 4L8SC 4YZFF 3P40A 5HVWA 3VWKB 1U8IA 4WW2C 4EIGB 1AGEB 3HE7C 3ARDA 4XNYH 5MENB 4ELMF 4HGKC 4JREC 3B8SA 3KPSD 4OTXH 3VFWA 3MV8A 2BVPA 7FABH 4V3EB 2HFEB 1G7LA 5DFVD 5J8OA 3RZCC 3BAEL 4JJ5A 3KYMB 4I0KA 4LQFH 1MLBA 2G9HA 1A1NA 1ADQH 3HE7D 2G60L 2VR4A 1N5YL 4PJBF 5E5MA 5BVJB 5EDXA 5D93C 3S6CA 3CSGA 3FQRB 1NUNB 4FQ2H 3MRQB 2OZ4H 5EB9A 3RZCD 1MCLA 1LP9E 1ZHNA 2YPLD 3PNWB 5ISZB 4Y5XA 2XNAA 4JANB 1KFAL 4G8EB 3LQAL 3U46B 3WS6C 1NCTA 1NCDL 4KH2A 4PJ5E 3V5KA 2X4PB 5D2LE 3W0WA 4TTDC 2F8XC 3LN4A 4G9FA 3NA4A 2E9IA 1MI5A 5E0QA 4Z78B 5JLZA 1N5YH 5GRYA 5FO8A 1T1WA 4HKBA 1OT2A 5HY9B 5IT2H 4DGIL 4C55A 3N85H 1C12B 1DJSA 3N0PB 1BX2B 4TTDD 4D0BB 1IC7L 2VLLA 3HE6D 4RMTA 3BPLB 3HNTH 3FZUC 3JVGC 3CZFB 4HK0B 1LO4L 1KFAH 1UB5B 1B90A 5HYFA 3GM8A 2EYTA 5FV2A 2BSTB 4Z76B 1UM4H 3MLTA 3ZKNC 3OAYK 4PJFB 2Z9TA 4X6DA 3CU7A 4M6OL 2Y6SC 5DVOA 5IB5A 3PHOA 4FFZH 1T66C 3EAKA 2DQEL 1F2QA 4M93C 3IAQA 1D7FA 4QGTA 4QXTB 5EZLB 3VFGL 2CMRL 2I27N 3CX2A 1IM9D 1LE5A 5DMIL 3ZKND 1KYOK 1MUJA 2VAAA 1AXSB 1Q9OA 2Y6SD 3HMXL 1YEJL 1OP5K 1ZLWH 3SDCC 3L3KA 4ELKB 1TTGA 5LJYH 2W9EL 1KCRL 5FKAB 3UPRA 1DVFA 4DCQB 3JV5A 4M6OH 1NMCB 1YN6B 5FO9B 5F9JA 2E3VA 4XNZB 4P2CG 4KKLC 2ERJB 1HHKA 3GSRA 3ZE0F 3CD4A 3QUYB 2GJ6B 1T1XB 4NM8L 4GOSA 5T3XD 3WJLA 1QBAA 5DMIH 3FHAA 4KQ4H 3RX8A 1DQML 3GMRA 5BS0D 4ZXBB 4LCUA 1YEJH 5JXEA 5C1MB 1CR9L 4OAWB 4Z0XB 1IFHH 2YRZA 3BZEB 4KKLD 4GG6A 2C4FU 2W9EH 1FO0H 1VPOL 1IJ9A 1FFRA 4KJPC 2Q8AL 4DUWA 4E42A 4KJWC 1HNGA 2DMKA 2IBBA 4HKZA 1AQKL 3MRPA 1NCCL 3ARFA 4MJ2A 1F3DJ 5GISL 2CK0H 5ITBL 1GGTA 2XPGA 3PWUA 1DQMH 3RIFF 2XWBB 1XF2A 3CVIL 4KJPD 4CDGC 1CR9H 3MOBH 2YA0A 4U1GB 4KJWD 1N6QL 2M2DA 4R4BA 4S1RH 1A14L 3LKOB 3PGFH 1KB9K 1VPOH 2W60B 1T3FB 3V8CA 4L3EB 4HUMB 2WIIB 3MCKA 5E6YA 3CCHB 3S37H 2FX9L 3AMKA 3REWB 1F3DH 2VJXA 5E8DL 1QEWB 3BPNB 2EKSB 5ITBH 3WDHA 4N0CA 2E7CA 2RQ8A 1JK8A 3L5WA 1DANU 2RGSA 5A2KH 1UC6A 3HI5L 2JIXD 2I9TA 2G2RA 1QSFA 1S9WB 1FH5L 1D5ZA 3BP4A 4WY7H 4PGDB 1K8DB 4Y5YC 3ULUF 4PJAA 1VENA 1A14H 2QADB 1G9ML 2M26A 5I17A 3TBVA 1JTPA 1JZ5A 4Q6IC 2ICCA 4XP1H 1FNFA 4KZDL 1EHLL 4NHUA 3MJ6A 3H9SA 2NY5L 4QTHB 5E8DH 2CLRB 3T0ED 1VADB 4G8IB 2D3VA 4RFEA 3HI5H 4WV1B 1XGQB 3FO9A 4Y4HB 1IM3A 4V1DB 2MHAB 5D1QA 5IJVA 1DQJB 1G9MH 3GRWL 3QUMA 3F5WB 2D9CA 1P4IL 3QULB 4ERSH 1UM6H 4FABH 1FE8L 5DEZA 4KZDH 1EHLH 2J4WL 4UIMB 4R96B 5DEGB 2NY5H 4GG8A 3VXSB 5TPWH 2CXGA 4N0RA 1CGTA 1NPUA 43CAA 5CZKA 5HYJA 2X9YA 3ARBC 3NN8B 3H9HB 1ZSDA 3B9KA 5K33A 2X5PA 2FGWL 4M48L 2DWEA 5DQDL 4JKWA 1RIHL 4HZLA 3SJVA 3T3ME 3C6SB 1S78C 3V95A 3TBWB 3JWNC 3ARBD 4NJ9H 5E2JA 5BZWB 4WHCA 5CEZD 4RGNC 2P5EE 5FCSH 1MCCA 1G1YA 1FNGA 2NPLX 2CLVB 2J3SA 5I71C 4YHNA 1A7RL 3GMNA 1S78D 1XR8A 4JM4L 3DSFL 3RVXC 1FGVL 5L88L 4M48H 4NN5B 4P3CL 4RGND 3TLRA 3STZB 3L7EA 3VWJB 5D1ZB 2ATKB 4L4TE 1FFOA 4U0QB 3DXAB 5DGRA 2VZOA 4F8QA 2Z0BA 2Q3AA 1KJMB 5DTFA 5LQBL 4BFIA 2F58L 5IB4A 4MYWB 1AP2B 43C9A 2BHYA 1A6PA 3LV3B 3MPCA 5JA9A 5C08D 2OS7A 4RAHA 4DZ8B 4TVPD 1FZJA 3QFDA 4P3CH 3HPJB 5E7FA 2R29L 5C0FB 3FQWB 5JHDD 4HGWB 2XQYG 3DIFB 3BP7A 3DTXA 5J9PA 1R3LB 2F58H 4S1DC 1KEGL 1F4WH 1S7UB 1RZKC 3ULVH 3PWVB 4ISVA 2KPNA 3CFJA 1AO7A 3D87B 5DHVB 3RWJA 2D7MA 1WBYB 4OBSA 5IFAL 1QFWL 4M6NL 1LQSR 4ZFOA 5DJAB 1I9IL 4QRPD 1LP9F 3LEXA 4PGBA 4GQ9H 4S1DD 5F3HB 1QSEE 5ALBH 3LRHA 5IBTH 2F54E 4L3AA 5GGTH 3FQTB 1UKTA 5KJRL 2B1HL 3TO4C 5D2LF 3EHBC 1I7TA 3KPRA 4Q6YA 5SX4H 5MERB 3P9MA 3S36X 1A6WL 2EECA 2ZZUT 3C9NB 2JCCB 5IFAH 1QFWH 4MVBD 4M6NH 5ACLA 3UZEA 1QKZH 1KPUB 1AFVL 3LDBB 1I9IH 3TO4D 5I15H 1BPVA 2V17L 1FRGL 2X89D 1P7QD 1ZV5A 1KSRA 2WLYA 2J5LB 4D0CB 4WCYL 2GK0B 5KJRH 1AE6L 4ZUSB 4U6HB 4U1SA 1KYOJ 3RWIA 4UT6H 1BOYA 3MRRB 3MLSL 2E7LE 2X4RB 2SEBB 1U3JA 3MODL 1A6WH 2FBOJ 3KNBA 3SE8L 3OGCA 3AREC 3B6SB 4N9OB 4Y2OA 3D69B 3MYZA 1S9YA 5IBUG 1SEQH 2UYLB 3D39A 3I9GL 3IFPB 1NGYA 3DMMC 2ZNWA 5ACZA 2V17H 5ESAB 4UB0H 4Z18A 3EW3B 5EIIA 4IHOA 5CP7A 3CMGA 1FV1B 5CINL 1AGFA 4Y4FB 3UPAA 1K6QH 3ARED 3WEXB 1ZA6B 3GMOA 3GSXA 4AH2A 1AE6H 4PYGA 4D8PA 1OP5H 2C7UB 4S0UC 3ULUC 2UVFA 3DMMD 3MODH 5I8CB 1ZLSH 4U0RB 4BZ2L 1R5IA 3ARYA 3EOTH 4HV8B 5B21A 4AK1A 4NQCB 1QG3A 4R3SA 3IDIA 3I9GH 4ETQB 1MJ8H 1MIML 4PRIE 5C0EA 2DB8A 3ULUD 5KSUB 1X5GA 4DN4L 1QYGL 4Y0GA 1DQQA 1YY8A 4UT9H 2J6EL 4HIHB 1MCWW 3MBXH 3N06B 4X7FC 3T2PA 5IR1B 1JPFA 4YXKH 4LCWB 4BZ2H 5L2KB 5HPOA 1KB9J 2IGFL 5HHNA 1EFXB 1PKOA 1SJEB 5HGDB 3ZKXC 2OL3B 1CFQB 1NAMB 5HHOA 3UROR 4MMXC 1T2JA 3DURB 1C16A 5DJ8A 5DHYA 1HINH 4J3TA 4EJ1C 2ITDB 4L4VD 3P0VH 1GPOL 2A6DA 1TQCC 4TUOB 5EU4A 1ONQA 1A7PL 1EJ6A 3VFSB 3WDIA 4U31A 3OJDB 4I18A 4WI9A 3TVMD 1ZOXA 5FGCE 2BNQA 1YMMB 2IGFH 2EDWA 4XNXL 5SX4I 5IW6A 4HT1L 2D7QA 4XC3L 1GOGA 1V8HA 2R4RH 2EDXA 3DUUB 4NKDA 1UVQA 5JO5B 3VA2C 1LHZA 1QFWI 5KSAD 1V7NL 1K2DA 2X7LB 2ZPKL 2AJSL 3ARXA 4PB0H 2OTUA 1KGCD 4IDJL 3MLXL 4MSWA 4I2XE 5ILTH 1AQDB 5D1XC 2FJHA 1A7PH 3LIZL 4NSKA 5GIRB 5IMOB 3A6BL 3ORJA 5EZIH 3S4SA 2PYEB 4HT1H 3G9VA 4CDHA 1DBML 4G6FB 1D6VL 5D1XD 1V7NH 1OAKL 4JB9H 4D9RD 2A6KA 2AJSH 5DRZA 5ADOH 4X4MA 2VWEE 3V5HB 3TC9A 4ZPTA 1EIBA 3MLXH 1X6LA 5F7EL 3T65B 4GLRH 5IFJB 5I30L 4B7LA 3P11L 5FKPA 1QLFA 4N5UA 3QPQD 5MHSD 3MUGB 4HJGA 2QSCH 2YS4A 2Y36L 4RFOH 1MY5A 2FBJH 4ZQKB 3ZO0A 1DBMH 4UZGA 3MOQA 3C6LA 1INEL 4DOHE 1D6VH 1KCUL 3LQAC 3JBG7 1IVLA 3MBEC 4HS3A 1BZ7A 4KRMB 4KY1H 2J88L 1CWVA 4PJHA 4O2FA 4GT7A 4HSQA 5F7NC 3WKNA 5EBLB 3RAJL 3T3MF 3FO1B 1MWAB 3KLHC 4I77H 4XPGL 3I3DA 3O8XD 4GRLC 5C2BH 1P6FA 4WHDA 4L9DA 3HRPA 3MLUL 5IB1B 5FAAA 3QI9B 4ZG1A 2IANE 1RJZA 5ID1A 1INEH 4FQQA 1IRAY 1KCUH 4JAMB 4PPTA 5D7JC 3S3PA 3T2NL 1VFBB 5BW7C 4XBPB 1ZGLA 2AEPL 3OKOA 4GRLD 3I02B 1XGPB 3MA7A 4QYOB 4F15B 4PJ5D 3EO0A 3JTTB 5FA4B 2BFVH 2FEDC 1CICC 3CVHA 4LP4A 4MS8C 5E2WL 5M95B 1T0NA 1NFDA 5D7JD 2L7JA 4MAYD 5I1LA 5E9DA 2GFBB 1E4KA 1PSKL 4Z7WE 1SMAA 3OR7A 1J18A 4XAWH 3RWFB 3H0TB 4LDEB 1RJYB 1MFDL 3CFBB 2FEDD 5GS1C 1JRHL 3AY4A 4MS8D 3SKOA 1JYXA 4W6XB 5E8OB 3JXAA 1ZHKB 4OZGA 4Y4KC 5JW3H 4XCEA 4APQC 3LKPA 3OPZH 5TH2B 5E2WH 5F9AC 3QJFA 3AAZA 4UV4L 3QUMH 5D8JL 1EGJL 1F02I 4C56B 4ZUTB 1RUAH 2IH1A 4JO1L 4P2OC 1FPTH 2OXHA 4NFCA 1KT2B 4Y4KD 3SDDC 2FB4L 4UNUA 3UTSB 2A1WL 2FO4B 2NQCA 3CSPA 4APQD 2VDPL 1JRHH 3K2UL 3WHE1 5F1SA 4WEUD 5CKGA 3MGOB 1JYVA 3FB5A 1CQKA 2PW2B 3RVWC 3H9YA 3S35L 1G0YR 1A47A 3CFEA 4MJ5A 4RBPK 3SDDD 4OIBA 1I1YB 1K4DB 4UV4H 3NAAL 5D8JH 4KQ3H 3PWJB 3BW9B 2P8LA 2VSCA 3NZHL 4GLRI 1SJHB 2C1PA 2VAJA 1IZJA 1U8PA 2A1WH 3PQYE 3DV4A 3S9DB 3K2UH 2VITB 5C8JA 4MNGB 4YFLI 5F7WC 1DTUA 1FFNB 5CAYB 1XGYL 4JN2A 5B3NA 3SDXB 3ME0A 1BVKB 5JUEH 2VZ3A 4PTUA 1T1YA 3VFTA 1KTDB 2OK0L 1AO7E 2GCYB 3FO0L 1RU9L 4ACPA 2VUOA 2BRRL 3NZHH 2VDLL 5FM5O 3VXOB 5ITFA 1DLFL 1QP1A 2ICWB 5FGRA 3AROA 1JF1A 3E0GA 1T2QL 4ZSOA 4W68A 4MJ6A 3SCMB 4KJQC 2VTFA 2V2XB 5E1AB 3UDWC 3HNSH 2BVYA 5B39B 3U4AA 1XGYH 5DZLA 2DWDB 4XVTL 5HVHB 4QY8B 1CG9B 2DKSA 2AI0L 3VWKA 2OK0H 1Q1JL 3FO0H 2EDHA 5JHLL 2NY5C 2DJUA 1AGEA 4OCYL 5MENA 4TUKH 2I5YH 2AV7B 4YBLC 3VFPA 1HIML 2VDLH 4PJDF 2QHRL 2HFEA 5GGRY 5JW4M 3M07A 5TE4H 1B88A 3KYMA 1T2QH 4UOW1 4JPVH 2ZKHL 5BVJA 1WFNA 5FM5M 3FQRA 4XVTH 3UTZB 2AEIT 3WO3B 4E5XB 3MRQA 1NDGB 4JFEB 3MRHB 3KG5A 1GAFL 3PNWA 4YBQC 5ISZA 4JANA 2V9RA 1X4XA 3H3KA 4G8EA 5JA8B 1HIMH 4F33B 3PGCB 2AJYH 4J3XA 1L6ZA 4RFNB 4BH7B 2X4PA 4HGMA 3NCYS 1J8HB 4O02L 1BQHG 4YBQD 1HXMB 2B4CH 2VZUA 4P2YA 4Z78A 4EZMA 3DX6B 1X7QB 4NC1E 5HY9A 3LHPL 4BQBA 1JRHI 3QDJB 1C12A 4PR5B 3TWCL 3BPCB 4J4PC 1BX2A 5I0DA 4D0BA 2O5ZH 3O4LE 4QTIH 4NZUH 2CH8A 5E4EC 3DETC 4OF8A 4HK0A 3CZFA 4LF3B 1UB5A 5CZVL 4OLVL 2BSTA 2VXVL 4ODVL 1MHPL 4Z76A 1XT5A 2Q20A 4PJFA 1QRNB 1SVCP 3FB8B 5KTEL 3DETD 2R4SL 4BK4A 5BO1L 1MCSA 4QXTA 7CGTA 4LKCB 5EZLA 4KPHL 2RFXB 3FOMA 3TWCH 4YIQA 5ELIA 4F80A 2QQQA 4WVRA 5BV7H 1AXSA 1EUUA 4ELKA 4UOW0 3JWDL 2P5ED 1W72B 4WU7B 4O00A 1MHPH 1UQSB 5FKAA 3ZTJG 3FQNB 1G84A 5KVDL 4DCQA 4CADB 5FO9A 4JFZL 3LCYA 1KBGL 2X70B 2G75B 2IH3B 1YDPB 4AIZB 3IF1B 4X8XA 3BRGC 3QUYA 2GJ6A 2XY1A 1KIQB 4TNWK 1T1XA 1HQ4B 3QEUB 1GCFA 4ZXBA 3HA0A 4R0LB 4OAWA 4Z0XA 1QTYT 3C09B 4PG9A 2VLKE 2O5YL 5KANG 3BZEA 2AJZB 4UDUB 1DDHA 4XMLL 4KRPC 4HUKB 1IEAB 2ZUTA 2AGJH 5GRUL 4JRYB 4JFZH 2NY1C 4FFYL 5HXMA 5JIPA 3B8YA 1MJUL 4L8BB 3LEYH 3GJEB 3KPPB 4GW1A 4U7MA 5FUZL 1NSNL 2H9GB 1WGOA 4KRPD 4TRPL 4LPUA 2JJSA 1KC5H 4KHTH 1S7VB 5E99L 3VGFA 2NY1D 4KTEL 3GGWB 2R0LL 4FN0A 4XMLH 1AXTL 2LU7A 2Z31B 3OKNB 3VD3A 3LKOA 5E8EB 1PG7L 1T3FA 3WIFB 1EEUA 3F8UB 5D5MB 2WIIA 4MNHB 2OP4L 5GGUB 2QJDA 1U3HD 3CCHA 1LO0L 1MJUH 1QSED 1QEWA 2F54D 4OGXH 2EKSA 1HH9B 1NSNH 3BUTA 4PTTA 4LLQB 4HWBL 3PHQB 5CUSL 1H15B 3RNKB 1U2HA 3WXVH 3GSOB 1H5BC 5E99H 5TF1L 2FDBP 2VOTA 5DJYB 1FC2D 4KTEH 4PGDA 1K8DA 1AXTH 3S34L 3ARDD 3L1OL 1PG7H 3KWWB 4Z7WF 5F7KC 1N4XL 2I60H 1NMAL 3TJHA 4WO4B 1NEZB 1WQVT 2MJWA 3MV11 2E7LC 5T5NG 4M7ZC 4YQXH 4QTHA 2CLRA 1VADA 2MPAL 4G8IA 4IJ3C 5F8QC 1YUHB 5CUSH 4HEME 4HG4K 3BRDA 4WV1A 3Q6FB 1XGQA 4EI5B 4Y4HA 3HG1B 4ALAL 1XZ0A 4V1DA 5J57B 2MHAA 3S34H 1DQJA 5ALCL 5DJ0B 3F5WA 3QULA 5KZCD 1N4XH 2XY2A 1K9TA 3BGMB 4OD2B 1NMAH 4AQ1B 3MZTA 2VERN 4UIMA 4R96A 3MRKB 1X9QA 1J88A 3GSNL 4UV7H 4RA3A 5DJDB 5DEGA 3G6JB 1NCUA 3VXSA 4WRLA 4G9FD 1NFDE 1L8JA 5INCB 2Y06L 4U1NB 3U0WL 2OTPA 3NIFE 4PBWD 3NN8A 3H9HA 4I9WE 3BDYL 2IBGA 4ALAH 4P23B 5J13C 4XI5C 1MCEA 4TSAL 3P2TA 2ZUSA 4RBPH 1MFBH 3CVHL 3ZYJA 1TQBB 3QP3A 4F3FA 3C6SA 4OCWH 3QPXL 1JGLL 3TBWA 4PRID 4XNMB 5BZWA 5IHUL 2F5BL 4X6BB 1OW0C 5T3ZH 1X5HA 2EZ0C 2Y06H 4HMEA 5L2JB 5CP3A 1IKNC 3U0WH 2PXYB 2VYRE 1QLEL 3GMLA 2CKBL 5F88B 2WW8A 4TSAH 4OZ4B 1RUPL 3CVHH 3KYNB 1R24B 1E6JL 2FD6L 3BD4A 3DUSB 1ZWIB 5D1ZA 3VWJA 3DXAA 3Q5YA 5C0CB 1JGLH 1XFPA 1KJMA 3VFRB 1FAKT 3KPQB 1VB9A 5E2UH 1AP2A 2ESVE 5IHUH 4YDLB 3CUPB 5MEOB 1IAKB 3LV3A 3RDTB 2HTLC 3ZT5A 1QLEH 1FNEB 1ZHBB 4GUPB 2EIBA 4I1NB 4DZ8A 2RB8A 4MNQE 4YGVB 2PN5A 4K94L 3HPJA 5C0FA 4FMFA 3FQWA 1E6JH 2FD6H 4HGWA 4U1MB 4GKZA 3U83A 3OJ2C 3DIFA 4W6YB 2HTLD 1PJ9A 1R3LA 5TQ2H 1S7UA 3OL2A 4MA7L 1DFBL 5A2IH 1NCNA 5DHVA 3ULSB 1WBYA 1QFUL 1F42A 2P44B 1AH1A 1PKQB 5DJAA 3RPIB 3NA9L 1PX3A 1GOFA 2P5WB 2N1KA 4LAJH 5F1IB 2PNDA 5F3HA 4OZIB 4K94H 3VXQB 1F13A 3TPUB 1UYWL 5FFLA 2VWEC 3NFPB 3LKNB 3FQTA 3VXUB 2VR5A 4P2RB 4JCMA 3E2HB 5MERA 3WO4C 4MA7H 3L5XL 4MQXC 1NBVL 1I1CA 1DFBH 3V7AG 2HAZA 3P9LB 3C9NA 2JCCA 3ZSSA 3VRIB 1YC8A 1KPUA 4X5WB 3QEQB 2XWJB 4XX1E 5JDJA 2VMFA 3MROB 2OI9C 4NBZB 3CXHK 4MQXD 1UYWH 3Q5OA 1BBJB 1QSFD 4XP6L 4D0CA 2GK0A 1QSZA 4ZUSA 1EUTA 4U6HA 3B43A 4WFEE 1VDGA 5D7IB 4PJDA 3MRRA 1E4WL 4MXWL 4Z6AT 2X4RA 2SEBA 4GO6B 4OFYD 3O4OB 2GKIA 3B6SA 4XCFH 3D69A 5C92A 5I76B 2CO7B 2UYLA 3IFPA 2EYSB 4E41E 4OJFL 5I1EL 4UIKL 1JV5B 3ARUA 3U6RB 15C8L 2EIDA 4PY7B 5AD0B 4OZFG 2ED7A 3MNZB 5CGYC 1FV1A 4Y4FA 2APVA 3FTGB 3WEXA 1ZA6A 4YBHA 3N1PC 4OI9A 2IAND 2C7UA 4MXWH 2NY4C 4QOKB 1FVDA 4MAUL 5HHVH 5I8CA 3NMEA 5FYJH 1CL7L 4HV8A 4OM1L 4XCYB 5CGYD 5SX5K 4XC1H 2YK1L 4NQCA 4KKBC 4ODTL 4ETQA 3C5ZC 4RA0C 1F4AA 3RA7L 5HYJD 2NY4D 5K93A 5KSUA 3VMPA 4MJIB 15C8H 5MI0C 4GMTL 4FQ1L 5D6CB 3RPKA 2W38A 2EDFA 3ZYOA 4HIHA 4KKBD 3BH8B 1BOGB 5JOFB 3C5ZD 5IR1A 1AC6A 3WXWL 5D7LB 4OCNC 3S97C 4LCWA 1NLBH 5L2KA 1YQVH 5T5FL 3CK0L 4KTYA 1T22B 3QT2A 5C0BB 3WNLA 1EFXA 1SJEA 4OFKA 5HGDA 2OL3A 1CFQA 1NAMA 1SYVB 3IDMB 3DURA 3EZJB 3PXJA 2NY6C 2ITDA 2X4QB 3MLYL 2AQ1A 4FQ1H 4F8TA 1ZKAA 1MCIA 3O3UN 3F7QA 4M5YL 1ED3B 4XH2B 4TUOA 4ZYKB 5H35B 4XP9L 1AJ7H 4EQ2A 1DL7L 4MB3A 1P4BH 2NY7L 4N1CA 3VFSA 5I74C 4GBXB 3OJDA 2C9AA 2NY6D 4XXCA 3CK0H 3LPFA 1TLKA 1YMMA 2XTJB 5HTSA 4PFEA 1JZ4A 2C1OB 3DUUA 2VXTH 5JO5A 4XMPL 1PLGH 5EZOL 4YK4B 3MLYH 4LIQL 3R1GL 4A6YL 2X7LA 4C4KT 4GSDH 4YFDB 3GNML 3GBNL 4UINL 1W8NA 4F2MB 3W39B 1AQDA 4HG4J 1DL7H 4QRRB 2GW5A