2E7LE

Structure of a high-affinity mutant of the 2c tcr in complex with ld/ql9
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
175
structure length
175
Chain Sequence
GPHSMRYFETAVSRRGLGEPRYISVGYVDDKEFVRFDSDAENPRYEPQVPWMEQEGPEYWERITQVAKGQEQWFRVNLRTLLGYYNQSAGGTHTLQRMYGCDVGSDGRLLRGYEQFAYDGCDYIALNEDLRTWTAADMAAQITRRKWEQAGAAEYYRAYLEGECVEWLHRYLKNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Cytotoxic Tcell receptor
publication title How a single T cell receptor recognizes both self and foreign MHC.
pubmed doi rcsb
source organism Mus musculus
total genus 51
structure length 175
sequence length 175
chains with identical sequence F
ec nomenclature
pdb deposition date 2007-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 2e7lE00
4Z77A 3SKMA 4G8GA 1AGFA 2CIIA 1S9WA 1T21A 3DX6A 5DEGA 4Z76A 4JFOA 4PRIA 3FONA 3LKNA 3G08A 4HUUA 1ONQA 2YPKA 3RZCA 5IROA 1E27A 4NQCA 4HUVA 2XPGA 2ZSVA 2GITA 3GSUA 3ERYA 1YN7A 4K7FA 1I7TA 5F9JA 1PQZA 4JRYA 3VWJA 4L4VA 4L9LC 4ZFZA 3RWCA 1HHJA 4NO0A 1S7XA 3ARDA 4L3CA 3UPRA 2HLAA 5ACZA 1T80A 2ZSWA 4PJ7A 1KJ3H 5IEHA 1KPVA 1BZ9A 3TA3A 3O9WA 3VXUA 2X4OA 5GSRA 2BVPA 1MI5A 3H7BA 4G42A 1T0MA 1KPRA 2GT9A 4FTVA 2GUOA 1I7UA 4G59A 5B38A 4UQ2A 3WS3A 1U58A 3HAEA 1XH3A 3BVNA 5HHPA 4NNXA 1JE6A 2C7UA 1L8JA 2ZOKA 1ZT1A 3D18A 4LHUA 3ECBA 1JPGA 4PV9A 3X11A 1S7SA 1QEWA 3V5KA 5MEPA 3MYJA 1LP9A 5E9DA 1JUFA 4F7TA 4Y16A 3RWFA 3CPLA 3QZWA 4U1IA 2P5EA 3MRMA 2CLRA 3HE6A 5C0CA 2AK4A 1MHCA 3GSQA 3L3DA 4PDCE 1A1MA 4NQEA 3RGVC 5EU3A 3MRIA 1ZSDA 3L3HA 2GTZA 4XXCA 3MRCA 5C0EA 5D7LA 1P4LA 1AO7A 4MJ6A 2BCKA 1W0VA 2BVOA 4N8VA 1AGEA 3HPJA 3SKOA 4JFEA 2FZ3A 1YPZA 1RK1A 3BH8A 1TVBA 3MV9A 3H9SA 3M17A 3TBVA 3GMMA 4Y4HA 3UBXA 5HGHA 3SDAA 4F7CA 1ED3A 3TVMA 1S7VA 2VAAA 2VABA 3IXAA 2WY3A 4ZUSA 3VFNA 4JFPA 2XFXA 3RL1A 4PJBA 2JCCA 3TIDA 2FWOA 1VACA 2A83A 4JRXA 4IIQC 4JFQA 1ZHNA 3FRUA 5D2NA 1HHIA 1M6OA 4JQXA 5C0DA 3VFPA 3JVGA 4PJEA 1LEKA 1K8DA 3SJVA 1HOCA 1DDHA 3MRJA 1EFXA 3QUXA 4PRNA 1EEZA 1RJYA 3BZFA 4PGDA 3B3IA 1W72A 4PRHA 5EU6A 1T7WA 2CLZA 3E3QA 5D9SA 3FQUA 1OGAA 3FQNA 1CG9A 5EO1A 4F7PA 4HS3A 4NQDA 1FFNA 3V5HA 3LN4A 4EN3C 5F1IA 1M05A 4WJ5A 5ISZA 1TMCA 1JPFA 4ZAKA 3P4MA 5F1NA 3MRGA 5J6HA 4MVBA 2AKRA 5F7DA 3TBWA 3TBYA 3MGTA 4LNRA 4E5XA 3T8XA 2X4PA 1AGCA 3CC5A 4IRJA 3VFUA 3QDMA 5BRZA 5SWZA 5EU4A 1FG2A 3RWGA 3LKOA 5C08A 4NHUE 1FZKA 4PJCA 1TVHA 3SDXA 3QDGA 3RL2A 1DE4A 1IM3A 3GMNA 1T1YA 2PYEA 3O3DA 4PJAA 1T7VA 3ILPA 4ZUTA 3L9RA 4MJ5A 5FA4A 2X4RA 2P5WA 3LKSA 3QQ4A 2OI9A 4L8DA 1DUZA 3TO4A 1YDPA 3VFOA 1LD9A 1RJZA 1AGDA 5MEQA 1WBXA 3WUWA 3TIEA 3QFJA 2NX5A 1QO3A 3W39A 3OX8A 3PWPA 5C07A 2F74A 3OV6A 4F7EA 3AU1A 4V3DB 5H94A 3BP4A 4NSKA 1FZOA 3LKRA 4HUXA 1KBGH 3WS6A 1Z5LA 3HUJA 4F7MA 1DUYA 3C8KA 3X12A 4PR5A 4HV8A 3O8XA 3ARFA 1A1OA 1GZQA 1S7UA 1A9EA 1B0RA 3P4NA 4IRSA 1INQA 4GUPA 4WU5A 2BVQA 3BUYA 4PP8C 2HJKA 3SCMA 4L3EA 4PJ9A 3P77A 2VLKA 3BGMA 2ESVA 4U1KA 3E2HA 3FT3A 1ZT7A 4HX1A 3KXFA 2GTWA 3JTTA 5HHOA 2X4SA 5BS0A 1QSFA 3DXAA 4PG2A 2VLRA 4O2FA 5IB1A 5IVXA 3SDDA 2AXFA 2FYYA 5ENWA 3MGOA 4G9DA 4PJHA 4NT6A 4NO3A 5HHNA 4Z78A 1T1ZA 3KLAA 5IEKA 1JHTA 1S9XA 3VFVA 1XR8A 1OGTA 1LDPH 3BP7A 5SWSA 4I4WA 1NEZA 2DYPA 4L8SC 4WWKC 1KJVA 3X14A 5D7JC 3VXSA 1QVOA 4MX7A 3WL9A 3DTXA 2BSRA 3MRPA 1KJMA 3LN5A 3VXRA 1QR1A 4HWZA 4CW1A 1T7XA 4MS8A 4PJXA 3GIVA 1ZAGA 5HHQA 1AGBA 1JFMA 1QRNA 4N5EA 3SPVA 5IM7A 2MHAA 1MHEA 1XR9A 4G43A 4JQVA 1KPUA 1I1YA 2BNQA 2CKBH 4WU7A 2X4QA 3KYOA 1ZT4A 1SYSA 3QULA 5IB2A 4JFFA 4O2EA 2V2WA 3I6GA 4QRTA 1CD1A 4HKJA 5D5MA 4FFEX 1CE6A 2D31A 3TPUE 3MRLA 1ZS8A 3GSOA 3TZVC 5C0JA 3BH9A 2X4UA 4PJGA 3PWUA 5SWQA 3O3EA 5EU5A 1QLFA 3QUYA 4MNGA 4MQ7A 3VXNA 4ONOA 3V5DA 3OXRA 1VGKA 4PJ8A 3VFTA 1ZHKA 3D25A 4G8IA 3QUKA 3RWDA 1T1WA 3I6KA 4U1NA 1FO0H 3FFCA 1G7PA 5B39A 1W0WA 4IHOA 1ZHBA 5E00A 3ARBA 5C0BA 3TN0A 4N0FA 1NAMH 1Q94A 3UTQA 3HLAA 3HE7A 3MRHA 1JGEA 1SYVA 4QOKA 2FO4A 4Y4FA 4PGBA 3VRIA 3C9NA 1YN6A 5IB5A 2PO6A 1I1FA 3CH1A 3JTCA 4PJIA 2CLVA 2RFXA 4ZUUA 5HGBA 3KPQA 3ARGA 4U1SA 3H9HA 5AD0A 4PJ5A 5MENA 1HSBA 3MROA 1BD2A 1N59A 1T20A 3E6FA 1ZHLA 3GSVA 3L3IA 4U1HA 5HHMA 5IB4A 3S6CA 1WBZA 3GJFA 3VXMA 4D0BA 3MRQA 4G9FA 4EUPA 1NANH 5E8NA 3D3VA 3MRRA 5GSVA 1T0NA 1KTLA 2E7LE 3DX8A 3LV3A 3PWVA 3DMMA 1N3NA 4LCYA 1K5NA 3O4LA 4X6CA 4JFDA 4CVXA 4E0RA 1A9BA 2V2XA 5L2KA 1UXWA 5D7IA 3VXPA 1S7TA 3RWJA 3MRNA 3ROLA 4NNYA 1A1NA 4U1LA 3RWIA 4U1MA 4NO2A 2OL3H 3GMPA 4PREA 3TJHA 2BSSA 3L3KA 3P9MA 1HYRC 4PRPA 1HHGA 3GMLA 1P7QA 3MV8A 3W0WA 1P1ZA 2F53A 3LKPA 3I6LD 3WLBA 1T22A 2X70A 3FOLA 3D39A 3VXOA 1E28A 1N2RA 5HYJA 1QQDA 3DBXA 3BEWA 3O3AA 1R3HA 3RTQA 4D0CA 5L2JA 2NW3A 3GMQA 2YPLA 4PRDA 5C0AA 3MRBA 5BXFA 1S7RA 3GMOA 1S7QA 4U6XA 3OXSA 5C9JA 1IM9A 3ES6A 2J8UA 3PWJA 1UXSA 3E6HA 3FTGA 3GSXA 1N5AA 1T7ZA 3MRDA 3VCLA 1BIIA 3X13A 1S9YA 3BZEA 3VH8A 3IT8D 3MR9A 4QRPA 5EUOA 3QUZA 1S7WA 3MRKA 1T1XA 3FQTA 5C0FA 3PQYA 1LEGA 3VFSA 3MA7A 1XZ0A 3L3GA 1FZJA 3QDJA 2FIKA 3P4OA 4NO5A 3CVHA 3QI9A 4EI5A 1LK2A 4APQA 1G6RH 3RWEA 2X4NA 4PJFA 3LKQA 3FT4A 4PGCA 3MRFA 4PGEA 2BSTA 4K71B 1KJ2H 1JF1A 1C16A 3B6SA 3KWWA 1EEYA 4ZUVA 3GSWA 1RK0A 4U6YA 4X6DA 4V3EB 4ZUWA 5MEOA 3QQ3A 3D2UA 5IB3A 3HG1A 5E8PA 1KCGC 3BEVA 3FQXA 3VRJA 3VFMA 1I1AA 3AREA 5C0IA 1EXUA 5E8OA 5FA3A 2BNRA 3PWNA 3SDCA 3CZFA 1LQVA 1FZMA 4X6EA 3TBSA 4PRBA 3VFWA 2VE6A 3TFKA 4GKNA 1X7QA 1T7YA 5BJTA 5FKPA 3KPNA 3T1FA 3RWHA 3MREA 3FOMA 5J1AA 1WBYA 4WUUA 4PV8A 1A6ZA 1UQSA 3CDGA 1HHKA 3QEQA 3QFDA 4MJIA 5D2LA 2Q7YA 2VLJA 1BQHA 5FDWA 3PWLA 3KPRA 4QRUA 5MERA 5EOTA 2F54A 3MV7A 2X4TA 4Y4KA 3BHBA 1ZVSA 3BW9A 4L29A 3UTSA 5DEFA 3TO2A 3KPLA 4QRSA 2AXGA 3GMRA 3L3JA 1QSEA 4LCCC 1B0GA 4LCWA 3FQRA 1MWAH 2GAZA 3KPOA 5C0GA 3PABA 3TBTA 1JGDA 2YEZA 4PG9A 4UQ3A 4CVZA 1I7RA 3P73A 5E6IC 2HJLA 4X6FA 3BWAA 1B3JA 2H26A 4NQVA 4GKSA 3HCVA 4QRQA 5INDA 3RUGA 2CIKA 1OSZA 3CCHA 5DDHA 2GJ6A 1HSAA 4WDIA 1FFOA 3AM8A 4ELMA 3KPMA 3JTSA 1AKJA 5JHDA 5HGDA 3DX7A 2AV7A 5J6GA 3KYNA 4MNQA 4N0UA 3NFNA 3U0PA 3GSNH 5HGAA 1I4FA 1S8DA 2VLLA 2ZOLA 1HHHA 3O3BA 3UTTA 3VJ6A 4WW2C 4PJDA 3KPSA 3REWA 4L4TA 2H6PA 3FQWA 1G7QA 5EO0A 4U1JA 5EFIA 3M1BA 1VADA 1OF2A 4PRAA 4L8CA 4O2CA 4L8BA 4Y2DA 5C09A 4I48A 4WO4A 3TF7A 4D0DA 2AV1A 4NQXA 3VFRA 3FT2A 3VWKA 2HN7A 1GZPA 3ILQC 3ROOA 4QRRA 4N0CA 5INCA 3KPPA 3BO8A 2UWEA 4S0UC 1FFPA 4HUWA 4MXQA 3P9LA 3GSRA 3BXNA
chains in the Genus database with same CATH superfamily
4Z77A 3SKMA 4G8GA 1AGFA 2CIIA 1S9WA 1T21A 3DX6A 5DEGA 4Z76A 4JFOA 4PRIA 3FONA 3LKNA 3G08A 4HUUA 1ONQA 2YPKA 3RZCA 5IROA 1E27A 4NQCA 4HUVA 2XPGA 2ZSVA 2GITA 3GSUA 3ERYA 1YN7A 4K7FA 1I7TA 5F9JA 1PQZA 4JRYA 3VWJA 4L4VA 4L9LC 4ZFZA 3RWCA 1HHJA 4NO0A 1S7XA 3ARDA 4L3CA 3UPRA 2HLAA 5ACZA 1T80A 2ZSWA 4PJ7A 1KJ3H 5IEHA 1KPVA 1BZ9A 3TA3A 3O9WA 3VXUA 2X4OA 5GSRA 2BVPA 1MI5A 3H7BA 4G42A 1T0MA 1KPRA 2GT9A 4FTVA 2GUOA 1I7UA 4G59A 5B38A 4UQ2A 3WS3A 1U58A 3HAEA 1XH3A 3BVNA 5HHPA 4NNXA 1JE6A 2C7UA 1L8JA 2ZOKA 1ZT1A 3D18A 4LHUA 3ECBA 1JPGA 4PV9A 3X11A 1S7SA 1QEWA 3V5KA 5MEPA 3MYJA 1LP9A 5E9DA 1JUFA 4F7TA 4Y16A 3RWFA 3CPLA 3QZWA 4U1IA 2P5EA 3MRMA 2CLRA 3HE6A 5C0CA 2AK4A 1MHCA 3GSQA 3L3DA 4PDCE 1A1MA 4NQEA 3RGVC 5EU3A 3MRIA 1ZSDA 3L3HA 2GTZA 4XXCA 3MRCA 5C0EA 5D7LA 1P4LA 1AO7A 4MJ6A 2BCKA 1W0VA 2BVOA 4N8VA 1AGEA 3HPJA 3SKOA 4JFEA 2FZ3A 1YPZA 1RK1A 3BH8A 1TVBA 3MV9A 3H9SA 3M17A 3TBVA 3GMMA 4Y4HA 3UBXA 5HGHA 3SDAA 4F7CA 1ED3A 3TVMA 1S7VA 2VAAA 2VABA 3IXAA 2WY3A 4ZUSA 3VFNA 4JFPA 2XFXA 3RL1A 4PJBA 2JCCA 3TIDA 2FWOA 1VACA 2A83A 4JRXA 4IIQC 4JFQA 1ZHNA 3FRUA 5D2NA 1HHIA 1M6OA 4JQXA 5C0DA 3VFPA 3JVGA 4PJEA 1LEKA 1K8DA 3SJVA 1HOCA 1DDHA 3MRJA 1EFXA 3QUXA 4PRNA 1EEZA 1RJYA 3BZFA 4PGDA 3B3IA 1W72A 4PRHA 5EU6A 1T7WA 2CLZA 3E3QA 5D9SA 2IA1A 3FQUA 1OGAA 3FQNA 1CG9A 5EO1A 4F7PA 4HS3A 4NQDA 1FFNA 3V5HA 3LN4A 4EN3C 5F1IA 1M05A 4WJ5A 5ISZA 1TMCA 1JPFA 4ZAKA 3P4MA 5F1NA 3MRGA 5J6HA 4MVBA 2AKRA 5F7DA 3TBWA 3TBYA 3MGTA 4LNRA 4E5XA 3T8XA 2X4PA 1AGCA 3CC5A 4IRJA 3VFUA 3QDMA 5BRZA 5SWZA 5EU4A 1FG2A 3RWGA 3LKOA 5C08A 4NHUE 1FZKA 4PJCA 1TVHA 3SDXA 3QDGA 3RL2A 1DE4A 1IM3A 3GMNA 1T1YA 2PYEA 3O3DA 4PJAA 1T7VA 3ILPA 4ZUTA 3L9RA 4MJ5A 5FA4A 2X4RA 2P5WA 3LKSA 3QQ4A 2OI9A 4L8DA 1DUZA 3TO4A 1YDPA 3VFOA 1LD9A 1RJZA 1AGDA 5MEQA 1WBXA 3WUWA 3TIEA 3QFJA 2NX5A 1QO3A 3W39A 3OX8A 3PWPA 5C07A 2F74A 3OV6A 4F7EA 3AU1A 4V3DB 5H94A 3BP4A 4NSKA 1FZOA 3LKRA 4HUXA 1KBGH 4JO8A 3WS6A 1Z5LA 3HUJA 4F7MA 1DUYA 3C8KA 3X12A 4PR5A 4HV8A 3O8XA 3ARFA 1A1OA 1GZQA 1S7UA 1A9EA 1B0RA 3P4NA 4IRSA 1INQA 4GUPA 4WU5A 2BVQA 3BUYA 4PP8C 2HJKA 3SCMA 4L3EA 4PJ9A 3P77A 2VLKA 3BGMA 2ESVA 4U1KA 3E2HA 3FT3A 1ZT7A 4HX1A 3KXFA 2GTWA 3JTTA 5HHOA 2X4SA 5BS0A 1QSFA 3DXAA 4PG2A 2VLRA 4O2FA 5IB1A 5IVXA 3SDDA 2AXFA 2FYYA 5ENWA 3MGOA 4G9DA 4PJHA 4NT6A 4NO3A 5HHNA 4Z78A 1T1ZA 3KLAA 5IEKA 1JHTA 1S9XA 3VFVA 1XR8A 1OGTA 1LDPH 3BP7A 5SWSA 4I4WA 1NEZA 2DYPA 4L8SC 4WWKC 1KJVA 3X14A 5D7JC 3VXSA 1QVOA 4MX7A 3WL9A 3DTXA 2BSRA 3MRPA 1KJMA 3LN5A 3VXRA 1QR1A 4HWZA 4CW1A 1T7XA 4MS8A 4PJXA 3GIVA 1ZAGA 5HHQA 1AGBA 1JFMA 1QRNA 4N5EA 3SPVA 5IM7A 2MHAA 1MHEA 1XR9A 4G43A 4JQVA 1KPUA 1I1YA 2BNQA 2CKBH 4WU7A 2X4QA 3KYOA 1ZT4A 1SYSA 3I0TA 3QULA 5IB2A 4JFFA 4O2EA 2V2WA 3I6GA 4QRTA 1CD1A 4HKJA 5D5MA 4FFEX 1CE6A 2D31A 3TPUE 3MRLA 1ZS8A 3GSOA 3TZVC 5C0JA 3BH9A 2X4UA 4PJGA 3PWUA 5SWQA 3O3EA 5EU5A 1QLFA 3QUYA 4MNGA 4MQ7A 3VXNA 4ONOA 3V5DA 3OXRA 1VGKA 4PJ8A 3VFTA 1ZHKA 3D25A 4G8IA 3QUKA 3RWDA 1T1WA 3I6KA 4U1NA 1FO0H 3FFCA 1G7PA 5B39A 1W0WA 4IHOA 1ZHBA 5E00A 3ARBA 5C0BA 3TN0A 4N0FA 1NAMH 1Q94A 3UTQA 3HLAA 3HE7A 3MRHA 1JGEA 1SYVA 4QOKA 2FO4A 4Y4FA 4PGBA 3VRIA 3C9NA 1YN6A 5IB5A 2PO6A 1I1FA 3CH1A 3JTCA 4PJIA 2CLVA 2RFXA 4ZUUA 5HGBA 3KPQA 3ARGA 4U1SA 3H9HA 5AD0A 4PJ5A 5MENA 1HSBA 3MROA 1BD2A 1N59A 1T20A 3E6FA 1ZHLA 3GSVA 3L3IA 4U1HA 5HHMA 5IB4A 3S6CA 1WBZA 3GJFA 3VXMA 4D0BA 3MRQA 4G9FA 4EUPA 1NANH 5E8NA 3D3VA 3MRRA 5GSVA 1T0NA 1KTLA 2E7LE 3DX8A 3LV3A 3PWVA 3DMMA 1N3NA 4LCYA 1K5NA 3O4LA 4X6CA 4JFDA 4CVXA 4E0RA 1A9BA 2V2XA 5L2KA 1UXWA 5D7IA 3VXPA 1S7TA 3RWJA 3MRNA 3ROLA 4NNYA 1A1NA 4U1LA 3RWIA 4U1MA 4BKWA 4NO2A 2OL3H 3GMPA 4PREA 3TJHA 2BSSA 3L3KA 3P9MA 1HYRC 4PRPA 1HHGA 3GMLA 1P7QA 3MV8A 3W0WA 1P1ZA 2F53A 3LKPA 3I6LD 3WLBA 1T22A 2X70A 3FOLA 3D39A 3VXOA 1E28A 1N2RA 5HYJA 1QQDA 3DBXA 3BEWA 3O3AA 1R3HA 3RTQA 4D0CA 5L2JA 2NW3A 3GMQA 2YPLA 4PRDA 5C0AA 3MRBA 5BXFA 1S7RA 3GMOA 1S7QA 4U6XA 3OXSA 5C9JA 1IM9A 3ES6A 2J8UA 3PWJA 1UXSA 3E6HA 3FTGA 3GSXA 1N5AA 1T7ZA 3MRDA 3VCLA 1BIIA 3X13A 1S9YA 3BZEA 3VH8A 3IT8D 3MR9A 4QRPA 5EUOA 3QUZA 1S7WA 3MRKA 1T1XA 3FQTA 5C0FA 3PQYA 1LEGA 3VFSA 3MA7A 1XZ0A 3L3GA 1FZJA 3QDJA 2FIKA 3P4OA 4NO5A 3CVHA 3QI9A 4EI5A 1LK2A 4APQA 1G6RH 3RWEA 2X4NA 4PJFA 3LKQA 3FT4A 4PGCA 3MRFA 4PGEA 2BSTA 4K71B 1KJ2H 1JF1A 1C16A 3B6SA 3KWWA 1EEYA 4ZUVA 3GSWA 1RK0A 4U6YA 4X6DA 4V3EB 4ZUWA 5MEOA 3QQ3A 3D2UA 5IB3A 3HG1A 5E8PA 1KCGC 3BEVA 3FQXA 3VRJA 3VFMA 1I1AA 3AREA 5C0IA 1EXUA 5E8OA 5FA3A 2BNRA 3PWNA 3SDCA 3CZFA 1LQVA 1FZMA 4X6EA 3TBSA 4PRBA 3VFWA 2VE6A 3TFKA 4GKNA 1X7QA 1T7YA 5BJTA 5FKPA 3KPNA 3T1FA 3RWHA 3MREA 3FOMA 5J1AA 1WBYA 4WUUA 4PV8A 1A6ZA 1UQSA 3CDGA 1HHKA 3QEQA 3QFDA 4MJIA 5D2LA 2Q7YA 2VLJA 1BQHA 5FDWA 3PWLA 3KPRA 4QRUA 5MERA 5EOTA 2F54A 3MV7A 2X4TA 4Y4KA 3BHBA 1ZVSA 2O5NA 3BW9A 4L29A 3UTSA 5DEFA 3TO2A 3KPLA 4QRSA 2AXGA 3GMRA 3L3JA 1QSEA 2NYKA 4LCCC 1B0GA 4LCWA 3FQRA 1MWAH 2GAZA 3KPOA 5C0GA 3PABA 3TBTA 1JGDA 2YEZA 4PG9A 4UQ3A 4CVZA 1I7RA 3P73A 5E6IC 2HJLA 4X6FA 3BWAA 1B3JA 2H26A 4NQVA 4GKSA 3HCVA 4QRQA 5INDA 3RUGA 2CIKA 1OSZA 3CCHA 5DDHA 2GJ6A 1HSAA 4WDIA 1FFOA 3AM8A 4ELMA 3KPMA 3JTSA 1AKJA 5JHDA 5HGDA 3DX7A 2AV7A 5J6GA 3KYNA 4MNQA 4N0UA 3NFNA 3U0PA 3GSNH 5HGAA 1I4FA 1S8DA 2VLLA 2ZOLA 1HHHA 3O3BA 3UTTA 3VJ6A 4WW2C 4PJDA 3KPSA 3REWA 4L4TA 2H6PA 3FQWA 1G7QA 4G59C 5EO0A 4U1JA 5EFIA 3M1BA 1VADA 1OF2A 4PRAA 4L8CA 4O2CA 4L8BA 4Y2DA 5C09A 4I48A 4WO4A 3TF7A 4D0DA 2AV1A 4NQXA 3VFRA 3FT2A 3VWKA 2HN7A 1GZPA 3ILQC 3ROOA 4QRRA 4N0CA 5INCA 3KPPA 3BO8A 2UWEA 4S0UC 1FFPA 4HUWA 4MXQA 3P9LA 3GSRA 3BXNA
chains in the Genus database with same CATH topology
4Z77A 3SKMA 4G8GA 1AGFA 2CIIA 1S9WA 1T21A 3DX6A 5DEGA 4Z76A 4JFOA 4PRIA 3FONA 3LKNA 3G08A 4HUUA 1ONQA 2YPKA 3RZCA 5IROA 1E27A 4NQCA 4HUVA 2XPGA 2ZSVA 2GITA 3GSUA 3ERYA 1YN7A 4K7FA 1I7TA 5F9JA 1PQZA 4JRYA 3VWJA 4L4VA 4L9LC 4ZFZA 3RWCA 1HHJA 4NO0A 1S7XA 3ARDA 4L3CA 3UPRA 2HLAA 5ACZA 1T80A 2ZSWA 4PJ7A 1KJ3H 5IEHA 1KPVA 1BZ9A 3TA3A 3O9WA 3VXUA 2X4OA 5GSRA 2BVPA 1MI5A 3H7BA 4G42A 1T0MA 1KPRA 2GT9A 4FTVA 2GUOA 1I7UA 4G59A 5B38A 4UQ2A 3WS3A 1U58A 3HAEA 1XH3A 3BVNA 5HHPA 4NNXA 1JE6A 2C7UA 1L8JA 2ZOKA 1ZT1A 3D18A 4LHUA 3ECBA 1JPGA 4PV9A 3X11A 1S7SA 1QEWA 3V5KA 5MEPA 3MYJA 1LP9A 5E9DA 1JUFA 4F7TA 4Y16A 3RWFA 3CPLA 3QZWA 4U1IA 2P5EA 3MRMA 2CLRA 3HE6A 5C0CA 2AK4A 1MHCA 3GSQA 3L3DA 4PDCE 1A1MA 4NQEA 3RGVC 5EU3A 3MRIA 1ZSDA 3L3HA 2GTZA 4XXCA 3MRCA 5C0EA 5D7LA 1P4LA 1AO7A 4MJ6A 2BCKA 1W0VA 2BVOA 4N8VA 1AGEA 3HPJA 3SKOA 4JFEA 2FZ3A 1YPZA 1RK1A 3BH8A 1TVBA 3MV9A 3H9SA 3M17A 3TBVA 3GMMA 4Y4HA 3UBXA 5HGHA 3SDAA 4F7CA 1ED3A 3TVMA 1S7VA 2VAAA 2VABA 3IXAA 2WY3A 4ZUSA 3VFNA 4JFPA 2XFXA 3RL1A 4PJBA 2JCCA 3TIDA 2FWOA 1VACA 2A83A 4JRXA 4IIQC 4JFQA 1ZHNA 3FRUA 5D2NA 1HHIA 1M6OA 4JQXA 5C0DA 3VFPA 3JVGA 4PJEA 1LEKA 1K8DA 3SJVA 1HOCA 1DDHA 3MRJA 1EFXA 3QUXA 4PRNA 1EEZA 1RJYA 3BZFA 4PGDA 3B3IA 1W72A 4PRHA 5EU6A 1T7WA 2CLZA 3E3QA 5D9SA 3FQUA 1OGAA 3FQNA 1CG9A 5EO1A 4F7PA 4HS3A 4NQDA 1FFNA 3V5HA 3LN4A 4EN3C 5F1IA 1M05A 4WJ5A 5ISZA 1TMCA 1JPFA 4ZAKA 3P4MA 5F1NA 3MRGA 5J6HA 4MVBA 2AKRA 5F7DA 3TBWA 3TBYA 3MGTA 4LNRA 4E5XA 3T8XA 2X4PA 1AGCA 3CC5A 4IRJA 3VFUA 3QDMA 5BRZA 5SWZA 5EU4A 1FG2A 3RWGA 3LKOA 5C08A 4NHUE 1FZKA 4PJCA 1TVHA 3SDXA 3QDGA 3RL2A 1DE4A 1IM3A 3GMNA 1T1YA 2PYEA 3O3DA 4PJAA 1T7VA 3ILPA 4ZUTA 3L9RA 4MJ5A 5FA4A 2X4RA 2P5WA 3LKSA 3QQ4A 2OI9A 4L8DA 1DUZA 3TO4A 1YDPA 3VFOA 1LD9A 1RJZA 1AGDA 5MEQA 1WBXA 3WUWA 3TIEA 3QFJA 2NX5A 1QO3A 3W39A 3OX8A 3PWPA 5C07A 2F74A 3OV6A 4F7EA 3AU1A 4V3DB 5H94A 3BP4A 4NSKA 1FZOA 3LKRA 4HUXA 1KBGH 3WS6A 1Z5LA 3HUJA 4F7MA 1DUYA 3C8KA 3X12A 4PR5A 4HV8A 3O8XA 3ARFA 1A1OA 1GZQA 1S7UA 1A9EA 1B0RA 3P4NA 4IRSA 1INQA 4GUPA 4WU5A 2BVQA 3BUYA 4PP8C 2HJKA 3SCMA 4L3EA 4PJ9A 3P77A 2VLKA 3BGMA 2ESVA 4U1KA 3E2HA 3FT3A 1ZT7A 4HX1A 3KXFA 2GTWA 3JTTA 5HHOA 2X4SA 5BS0A 1QSFA 3DXAA 4PG2A 2VLRA 4O2FA 5IB1A 5IVXA 3SDDA 2AXFA 2FYYA 5ENWA 3MGOA 4G9DA 4PJHA 4NT6A 4NO3A 5HHNA 4Z78A 1T1ZA 3KLAA 5IEKA 1JHTA 1S9XA 3VFVA 1XR8A 1OGTA 1LDPH 3BP7A 5SWSA 4I4WA 1NEZA 2DYPA 4L8SC 4WWKC 1KJVA 3X14A 5D7JC 3VXSA 1QVOA 4MX7A 3WL9A 3DTXA 2BSRA 3MRPA 1KJMA 3LN5A 3VXRA 1QR1A 4HWZA 4CW1A 1T7XA 4MS8A 4PJXA 3GIVA 1ZAGA 5HHQA 1AGBA 1JFMA 1QRNA 4N5EA 3SPVA 5IM7A 2MHAA 1MHEA 1XR9A 4G43A 4JQVA 1KPUA 1I1YA 2BNQA 2CKBH 4WU7A 2X4QA 3KYOA 1ZT4A 1SYSA 3QULA 5IB2A 4JFFA 4O2EA 2V2WA 3I6GA 4QRTA 1CD1A 4HKJA 5D5MA 4FFEX 1CE6A 2D31A 3TPUE 3MRLA 1ZS8A 3GSOA 3TZVC 5C0JA 3BH9A 2X4UA 4PJGA 3PWUA 5SWQA 3O3EA 5EU5A 1QLFA 3QUYA 4MNGA 4MQ7A 3VXNA 4ONOA 3V5DA 3OXRA 1VGKA 4PJ8A 3VFTA 1ZHKA 3D25A 4G8IA 3QUKA 3RWDA 1T1WA 3I6KA 4U1NA 1FO0H 3FFCA 1G7PA 5B39A 1W0WA 4IHOA 1ZHBA 5E00A 3ARBA 5C0BA 3TN0A 4N0FA 1NAMH 1Q94A 3UTQA 3HLAA 3HE7A 3MRHA 1JGEA 1SYVA 4QOKA 2FO4A 4Y4FA 4PGBA 3VRIA 3C9NA 1YN6A 5IB5A 2PO6A 1I1FA 3CH1A 3JTCA 4PJIA 2CLVA 2RFXA 4ZUUA 5HGBA 3KPQA 3ARGA 4U1SA 3H9HA 5AD0A 4PJ5A 5MENA 1HSBA 3MROA 1BD2A 1N59A 1T20A 3E6FA 1ZHLA 3GSVA 3L3IA 4U1HA 5HHMA 5IB4A 3S6CA 1WBZA 3GJFA 3VXMA 4D0BA 3MRQA 4G9FA 4EUPA 1NANH 5E8NA 3D3VA 3MRRA 5GSVA 1T0NA 1KTLA 2E7LE 3DX8A 3LV3A 3PWVA 3DMMA 1N3NA 4LCYA 1K5NA 3O4LA 4X6CA 4JFDA 4CVXA 4E0RA 1A9BA 2V2XA 5L2KA 1UXWA 5D7IA 3VXPA 1S7TA 3RWJA 3MRNA 3ROLA 4NNYA 1A1NA 4U1LA 3RWIA 4U1MA 4NO2A 2OL3H 3GMPA 4PREA 3TJHA 2BSSA 3L3KA 3P9MA 1HYRC 4PRPA 1HHGA 3GMLA 1P7QA 3MV8A 3W0WA 1P1ZA 2F53A 3LKPA 3I6LD 3WLBA 1T22A 2X70A 3FOLA 3D39A 3VXOA 1E28A 1N2RA 5HYJA 1QQDA 3DBXA 3BEWA 3O3AA 1R3HA 3RTQA 4D0CA 5L2JA 2NW3A 3GMQA 2YPLA 4PRDA 5C0AA 3MRBA 5BXFA 1S7RA 3GMOA 1S7QA 4U6XA 3OXSA 5C9JA 1IM9A 3ES6A 2J8UA 3PWJA 1UXSA 3E6HA 3FTGA 3GSXA 1N5AA 1T7ZA 3MRDA 3VCLA 1BIIA 3X13A 1S9YA 3BZEA 3VH8A 3IT8D 3MR9A 4QRPA 5EUOA 3QUZA 1S7WA 3MRKA 1T1XA 3FQTA 5C0FA 3PQYA 1LEGA 3VFSA 3MA7A 1XZ0A 3L3GA 1FZJA 3QDJA 2FIKA 3P4OA 4NO5A 3CVHA 3QI9A 4EI5A 1LK2A 4APQA 1G6RH 3RWEA 2X4NA 4PJFA 3LKQA 3FT4A 4PGCA 3MRFA 4PGEA 2BSTA 4K71B 1KJ2H 1JF1A 1C16A 3B6SA 3KWWA 1EEYA 4ZUVA 3GSWA 1RK0A 4U6YA 4X6DA 4V3EB 4ZUWA 5MEOA 3QQ3A 3D2UA 5IB3A 3HG1A 5E8PA 1KCGC 3BEVA 3FQXA 3VRJA 3VFMA 1I1AA 3AREA 5C0IA 1EXUA 5E8OA 5FA3A 2BNRA 3PWNA 3SDCA 3CZFA 1LQVA 1FZMA 4X6EA 3TBSA 4PRBA 3VFWA 2VE6A 3TFKA 4GKNA 1X7QA 1T7YA 5BJTA 5FKPA 3KPNA 3T1FA 3RWHA 3MREA 3FOMA 5J1AA 1WBYA 4WUUA 4PV8A 1A6ZA 1UQSA 3CDGA 1HHKA 3QEQA 3QFDA 4MJIA 5D2LA 2Q7YA 2VLJA 1BQHA 5FDWA 3PWLA 3KPRA 4QRUA 5MERA 5EOTA 2F54A 3MV7A 2X4TA 4Y4KA 3BHBA 1ZVSA 3BW9A 4L29A 3UTSA 5DEFA 3TO2A 3KPLA 4QRSA 2AXGA 3GMRA 3L3JA 1QSEA 4LCCC 1B0GA 4LCWA 3FQRA 1MWAH 2GAZA 3KPOA 5C0GA 3PABA 3TBTA 1JGDA 2YEZA 4PG9A 4UQ3A 4CVZA 1I7RA 3P73A 5E6IC 2HJLA 4X6FA 3BWAA 1B3JA 2H26A 4NQVA 4GKSA 3HCVA 4QRQA 5INDA 3RUGA 2CIKA 1OSZA 3CCHA 5DDHA 2GJ6A 1HSAA 4WDIA 1FFOA 3AM8A 4ELMA 3KPMA 3JTSA 1AKJA 5JHDA 5HGDA 3DX7A 2AV7A 5J6GA 3KYNA 4MNQA 4N0UA 3NFNA 3U0PA 3GSNH 5HGAA 1I4FA 1S8DA 2VLLA 2ZOLA 1HHHA 3O3BA 3UTTA 3VJ6A 4WW2C 4PJDA 3KPSA 3REWA 4L4TA 2H6PA 3FQWA 1G7QA 5EO0A 4U1JA 5EFIA 3M1BA 1VADA 1OF2A 4PRAA 4L8CA 4O2CA 4L8BA 4Y2DA 5C09A 4I48A 4WO4A 3TF7A 4D0DA 2AV1A 4NQXA 3VFRA 3FT2A 3VWKA 2HN7A 1GZPA 3ILQC 3ROOA 4QRRA 4N0CA 5INCA 3KPPA 3BO8A 2UWEA 4S0UC 1FFPA 4HUWA 4MXQA 3P9LA 3GSRA 3BXNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z77 A;  3SKM A;  4G8G A;  1AGF A;  2CII A;  1S9W A;  1T21 A;  3DX6 A;  5DEG A;  4Z76 A;  4JFO A;  4PRI A;  3FON A;  3LKN A;  3G08 A;  4HUU A;  1ONQ A;  2YPK A;  3RZC A;  5IRO A;  1E27 A;  4NQC A;  4HUV A;  2XPG A;  2ZSV A;  2GIT A;  3GSU A;  3ERY A;  1YN7 A;  4K7F A;  1I7T A;  5F9J A;  1PQZ A;  4JRY A;  3VWJ A;  4L4V A;  4L9L C;  4ZFZ A;  3RWC A;  1HHJ A;  4NO0 A;  1S7X A;  3ARD A;  4L3C A;  3UPR A;  2HLA A;  5ACZ A;  1T80 A;  2ZSW A;  4PJ7 A;  1KJ3 H;  5IEH A;  1KPV A;  1BZ9 A;  3TA3 A;  3O9W A;  3VXU A;  2X4O A;  5GSR A;  2BVP A;  1MI5 A;  3H7B A;  4G42 A;  1T0M A;  1KPR A;  2GT9 A;  4FTV A;  2GUO A;  1I7U A;  4G59 A;  5B38 A;  4UQ2 A;  3WS3 A;  1U58 A;  3HAE A;  1XH3 A;  3BVN A;  5HHP A;  4NNX A;  1JE6 A;  2C7U A;  1L8J A;  2ZOK A;  1ZT1 A;  3D18 A;  4LHU A;  3ECB A;  1JPG A;  4PV9 A;  3X11 A;  1S7S A;  1QEW A;  3V5K A;  5MEP A;  3MYJ A;  1LP9 A;  5E9D A;  1JUF A;  4F7T A;  4Y16 A;  3RWF A;  3CPL A;  3QZW A;  4U1I A;  2P5E A;  3MRM A;  2CLR A;  3HE6 A;  5C0C A;  2AK4 A;  1MHC A;  3GSQ A;  3L3D A;  4PDC E;  1A1M A;  4NQE A;  3RGV C;  5EU3 A;  3MRI A;  1ZSD A;  3L3H A;  2GTZ A;  4XXC A;  3MRC A;  5C0E A;  5D7L A;  1P4L A;  1AO7 A;  4MJ6 A;  2BCK A;  1W0V A;  2BVO A;  4N8V A;  1AGE A;  3HPJ A;  3SKO A;  4JFE A;  2FZ3 A;  1YPZ A;  1RK1 A;  3BH8 A;  1TVB A;  3MV9 A;  3H9S A;  3M17 A;  3TBV A;  3GMM A;  4Y4H A;  3UBX A;  5HGH A;  3SDA A;  4F7C A;  1ED3 A;  3TVM A;  1S7V A;  2VAA A;  2VAB A;  3IXA A;  2WY3 A;  4ZUS A;  3VFN A;  4JFP A;  2XFX A;  3RL1 A;  4PJB A;  2JCC A;  3TID A;  2FWO A;  1VAC A;  2A83 A;  4JRX A;  4IIQ C;  4JFQ A;  1ZHN A;  3FRU A;  5D2N A;  1HHI A;  1M6O A;  4JQX A;  5C0D A;  3VFP A;  3JVG A;  4PJE A;  1LEK A;  1K8D A;  3SJV A;  1HOC A;  1DDH A;  3MRJ A;  1EFX A;  3QUX A;  4PRN A;  1EEZ A;  1RJY A;  3BZF A;  4PGD A;  3B3I A;  1W72 A;  4PRH A;  5EU6 A;  1T7W A;  2CLZ A;  3E3Q A;  5D9S A;  3FQU A;  1OGA A;  3FQN A;  1CG9 A;  5EO1 A;  4F7P A;  4HS3 A;  4NQD A;  1FFN A;  3V5H A;  3LN4 A;  4EN3 C;  5F1I A;  1M05 A;  4WJ5 A;  5ISZ A;  1TMC A;  1JPF A;  4ZAK A;  3P4M A;  5F1N A;  3MRG A;  5J6H A;  4MVB A;  2AKR A;  5F7D A;  3TBW A;  3TBY A;  3MGT A;  4LNR A;  4E5X A;  3T8X A;  2X4P A;  1AGC A;  3CC5 A;  4IRJ A;  3VFU A;  3QDM A;  5BRZ A;  5SWZ A;  5EU4 A;  1FG2 A;  3RWG A;  3LKO A;  5C08 A;  4NHU E;  1FZK A;  4PJC A;  1TVH A;  3SDX A;  3QDG A;  3RL2 A;  1DE4 A;  1IM3 A;  3GMN A;  1T1Y A;  2PYE A;  3O3D A;  4PJA A;  1T7V A;  3ILP A;  4ZUT A;  3L9R A;  4MJ5 A;  5FA4 A;  2X4R A;  2P5W A;  3LKS A;  3QQ4 A;  2OI9 A;  4L8D A;  1DUZ A;  3TO4 A;  1YDP A;  3VFO A;  1LD9 A;  1RJZ A;  1AGD A;  5MEQ A;  1WBX A;  3WUW A;  3TIE A;  3QFJ A;  2NX5 A;  1QO3 A;  3W39 A;  3OX8 A;  3PWP A;  5C07 A;  2F74 A;  3OV6 A;  4F7E A;  3AU1 A;  4V3D B;  5H94 A;  3BP4 A;  4NSK A;  1FZO A;  3LKR A;  4HUX A;  1KBG H;  3WS6 A;  1Z5L A;  3HUJ A;  4F7M A;  1DUY A;  3C8K A;  3X12 A;  4PR5 A;  4HV8 A;  3O8X A;  3ARF A;  1A1O A;  1GZQ A;  1S7U A;  1A9E A;  1B0R A;  3P4N A;  4IRS A;  1INQ A;  4GUP A;  4WU5 A;  2BVQ A;  3BUY A;  4PP8 C;  2HJK A;  3SCM A;  4L3E A;  4PJ9 A;  3P77 A;  2VLK A;  3BGM A;  2ESV A;  4U1K A;  3E2H A;  3FT3 A;  1ZT7 A;  4HX1 A;  3KXF A;  2GTW A;  3JTT A;  5HHO A;  2X4S A;  5BS0 A;  1QSF A;  3DXA A;  4PG2 A;  2VLR A;  4O2F A;  5IB1 A;  5IVX A;  3SDD A;  2AXF A;  2FYY A;  5ENW A;  3MGO A;  4G9D A;  4PJH A;  4NT6 A;  4NO3 A;  5HHN A;  4Z78 A;  1T1Z A;  3KLA A;  5IEK A;  1JHT A;  1S9X A;  3VFV A;  1XR8 A;  1OGT A;  1LDP H;  3BP7 A;  5SWS A;  4I4W A;  1NEZ A;  2DYP A;  4L8S C;  4WWK C;  1KJV A;  3X14 A;  5D7J C;  3VXS A;  1QVO A;  4MX7 A;  3WL9 A;  3DTX A;  2BSR A;  3MRP A;  1KJM A;  3LN5 A;  3VXR A;  1QR1 A;  4HWZ A;  4CW1 A;  1T7X A;  4MS8 A;  4PJX A;  3GIV A;  1ZAG A;  5HHQ A;  1AGB A;  1JFM A;  1QRN A;  4N5E A;  3SPV A;  5IM7 A;  2MHA A;  1MHE A;  1XR9 A;  4G43 A;  4JQV A;  1KPU A;  1I1Y A;  2BNQ A;  2CKB H;  4WU7 A;  2X4Q A;  3KYO A;  1ZT4 A;  1SYS A;  3QUL A;  5IB2 A;  4JFF A;  4O2E A;  2V2W A;  3I6G A;  4QRT A;  1CD1 A;  4HKJ A;  5D5M A;  4FFE X;  1CE6 A;  2D31 A;  3TPU E;  3MRL A;  1ZS8 A;  3GSO A;  3TZV C;  5C0J A;  3BH9 A;  2X4U A;  4PJG A;  3PWU A;  5SWQ A;  3O3E A;  5EU5 A;  1QLF A;  3QUY A;  4MNG A;  4MQ7 A;  3VXN A;  4ONO A;  3V5D A;  3OXR A;  1VGK A;  4PJ8 A;  3VFT A;  1ZHK A;  3D25 A;  4G8I A;  3QUK A;  3RWD A;  1T1W A;  3I6K A;  4U1N A;  1FO0 H;  3FFC A;  1G7P A;  5B39 A;  1W0W A;  4IHO A;  1ZHB A;  5E00 A;  3ARB A;  5C0B A;  3TN0 A;  4N0F A;  1NAM H;  1Q94 A;  3UTQ A;  3HLA A;  3HE7 A;  3MRH A;  1JGE A;  1SYV A;  4QOK A;  2FO4 A;  4Y4F A;  4PGB A;  3VRI A;  3C9N A;  1YN6 A;  5IB5 A;  2PO6 A;  1I1F A;  3CH1 A;  3JTC A;  4PJI A;  2CLV A;  2RFX A;  4ZUU A;  5HGB A;  3KPQ A;  3ARG A;  4U1S A;  3H9H A;  5AD0 A;  4PJ5 A;  5MEN A;  1HSB A;  3MRO A;  1BD2 A;  1N59 A;  1T20 A;  3E6F A;  1ZHL A;  3GSV A;  3L3I A;  4U1H A;  5HHM A;  5IB4 A;  3S6C A;  1WBZ A;  3GJF A;  3VXM A;  4D0B A;  3MRQ A;  4G9F A;  4EUP A;  1NAN H;  5E8N A;  3D3V A;  3MRR A;  5GSV A;  1T0N A;  1KTL A;  2E7L E;  3DX8 A;  3LV3 A;  3PWV A;  3DMM A;  1N3N A;  4LCY A;  1K5N A;  3O4L A;  4X6C A;  4JFD A;  4CVX A;  4E0R A;  1A9B A;  2V2X A;  5L2K A;  1UXW A;  5D7I A;  3VXP A;  1S7T A;  3RWJ A;  3MRN A;  3ROL A;  4NNY A;  1A1N A;  4U1L A;  3RWI A;  4U1M A;  4NO2 A;  2OL3 H;  3GMP A;  4PRE A;  3TJH A;  2BSS A;  3L3K A;  3P9M A;  1HYR C;  4PRP A;  1HHG A;  3GML A;  1P7Q A;  3MV8 A;  3W0W A;  1P1Z A;  2F53 A;  3LKP A;  3I6L D;  3WLB A;  1T22 A;  2X70 A;  3FOL A;  3D39 A;  3VXO A;  1E28 A;  1N2R A;  5HYJ A;  1QQD A;  3DBX A;  3BEW A;  3O3A A;  1R3H A;  3RTQ A;  4D0C A;  5L2J A;  2NW3 A;  3GMQ A;  2YPL A;  4PRD A;  5C0A A;  3MRB A;  5BXF A;  1S7R A;  3GMO A;  1S7Q A;  4U6X A;  3OXS A;  5C9J A;  1IM9 A;  3ES6 A;  2J8U A;  3PWJ A;  1UXS A;  3E6H A;  3FTG A;  3GSX A;  1N5A A;  1T7Z A;  3MRD A;  3VCL A;  1BII A;  3X13 A;  1S9Y A;  3BZE A;  3VH8 A;  3IT8 D;  3MR9 A;  4QRP A;  5EUO A;  3QUZ A;  1S7W A;  3MRK A;  1T1X A;  3FQT A;  5C0F A;  3PQY A;  1LEG A;  3VFS A;  3MA7 A;  1XZ0 A;  3L3G A;  1FZJ A;  3QDJ A;  2FIK A;  3P4O A;  4NO5 A;  3CVH A;  3QI9 A;  4EI5 A;  1LK2 A;  4APQ A;  1G6R H;  3RWE A;  2X4N A;  4PJF A;  3LKQ A;  3FT4 A;  4PGC A;  3MRF A;  4PGE A;  2BST A;  4K71 B;  1KJ2 H;  1JF1 A;  1C16 A;  3B6S A;  3KWW A;  1EEY A;  4ZUV A;  3GSW A;  1RK0 A;  4U6Y A;  4X6D A;  4V3E B;  4ZUW A;  5MEO A;  3QQ3 A;  3D2U A;  5IB3 A;  3HG1 A;  5E8P A;  1KCG C;  3BEV A;  3FQX A;  3VRJ A;  3VFM A;  1I1A A;  3ARE A;  5C0I A;  1EXU A;  5E8O A;  5FA3 A;  2BNR A;  3PWN A;  3SDC A;  3CZF A;  1LQV A;  1FZM A;  4X6E A;  3TBS A;  4PRB A;  3VFW A;  2VE6 A;  3TFK A;  4GKN A;  1X7Q A;  1T7Y A;  5BJT A;  5FKP A;  3KPN A;  3T1F A;  3RWH A;  3MRE A;  3FOM A;  5J1A A;  1WBY A;  4WUU A;  4PV8 A;  1A6Z A;  1UQS A;  3CDG A;  1HHK A;  3QEQ A;  3QFD A;  4MJI A;  5D2L A;  2Q7Y A;  2VLJ A;  1BQH A;  5FDW A;  3PWL A;  3KPR A;  4QRU A;  5MER A;  5EOT A;  2F54 A;  3MV7 A;  2X4T A;  4Y4K A;  3BHB A;  1ZVS A;  3BW9 A;  4L29 A;  3UTS A;  5DEF A;  3TO2 A;  3KPL A;  4QRS A;  2AXG A;  3GMR A;  3L3J A;  1QSE A;  4LCC C;  1B0G A;  4LCW A;  3FQR A;  1MWA H;  2GAZ A;  3KPO A;  5C0G A;  3PAB A;  3TBT A;  1JGD A;  2YEZ A;  4PG9 A;  4UQ3 A;  4CVZ A;  1I7R A;  3P73 A;  5E6I C;  2HJL A;  4X6F A;  3BWA A;  1B3J A;  2H26 A;  4NQV A;  4GKS A;  3HCV A;  4QRQ A;  5IND A;  3RUG A;  2CIK A;  1OSZ A;  3CCH A;  5DDH A;  2GJ6 A;  1HSA A;  4WDI A;  1FFO A;  3AM8 A;  4ELM A;  3KPM A;  3JTS A;  1AKJ A;  5JHD A;  5HGD A;  3DX7 A;  2AV7 A;  5J6G A;  3KYN A;  4MNQ A;  4N0U A;  3NFN A;  3U0P A;  3GSN H;  5HGA A;  1I4F A;  1S8D A;  2VLL A;  2ZOL A;  1HHH A;  3O3B A;  3UTT A;  3VJ6 A;  4WW2 C;  4PJD A;  3KPS A;  3REW A;  4L4T A;  2H6P A;  3FQW A;  1G7Q A;  5EO0 A;  4U1J A;  5EFI A;  3M1B A;  1VAD A;  1OF2 A;  4PRA A;  4L8C A;  4O2C A;  4L8B A;  4Y2D A;  5C09 A;  4I48 A;  4WO4 A;  3TF7 A;  4D0D A;  2AV1 A;  4NQX A;  3VFR A;  3FT2 A;  3VWK A;  2HN7 A;  1GZP A;  3ILQ C;  3ROO A;  4QRR A;  4N0C A;  5INC A;  3KPP A;  3BO8 A;  2UWE A;  4S0U C;  1FFP A;  4HUW A;  4MXQ A;  3P9L A;  3GSR A;  3BXN A; 
#chains in the Genus database with same CATH topology
 4Z77 A;  3SKM A;  4G8G A;  1AGF A;  2CII A;  1S9W A;  1T21 A;  3DX6 A;  5DEG A;  4Z76 A;  4JFO A;  4PRI A;  3FON A;  3LKN A;  3G08 A;  4HUU A;  1ONQ A;  2YPK A;  3RZC A;  5IRO A;  1E27 A;  4NQC A;  4HUV A;  2XPG A;  2ZSV A;  2GIT A;  3GSU A;  3ERY A;  1YN7 A;  4K7F A;  1I7T A;  5F9J A;  1PQZ A;  4JRY A;  3VWJ A;  4L4V A;  4L9L C;  4ZFZ A;  3RWC A;  1HHJ A;  4NO0 A;  1S7X A;  3ARD A;  4L3C A;  3UPR A;  2HLA A;  5ACZ A;  1T80 A;  2ZSW A;  4PJ7 A;  1KJ3 H;  5IEH A;  1KPV A;  1BZ9 A;  3TA3 A;  3O9W A;  3VXU A;  2X4O A;  5GSR A;  2BVP A;  1MI5 A;  3H7B A;  4G42 A;  1T0M A;  1KPR A;  2GT9 A;  4FTV A;  2GUO A;  1I7U A;  4G59 A;  5B38 A;  4UQ2 A;  3WS3 A;  1U58 A;  3HAE A;  1XH3 A;  3BVN A;  5HHP A;  4NNX A;  1JE6 A;  2C7U A;  1L8J A;  2ZOK A;  1ZT1 A;  3D18 A;  4LHU A;  3ECB A;  1JPG A;  4PV9 A;  3X11 A;  1S7S A;  1QEW A;  3V5K A;  5MEP A;  3MYJ A;  1LP9 A;  5E9D A;  1JUF A;  4F7T A;  4Y16 A;  3RWF A;  3CPL A;  3QZW A;  4U1I A;  2P5E A;  3MRM A;  2CLR A;  3HE6 A;  5C0C A;  2AK4 A;  1MHC A;  3GSQ A;  3L3D A;  4PDC E;  1A1M A;  4NQE A;  3RGV C;  5EU3 A;  3MRI A;  1ZSD A;  3L3H A;  2GTZ A;  4XXC A;  3MRC A;  5C0E A;  5D7L A;  1P4L A;  1AO7 A;  4MJ6 A;  2BCK A;  1W0V A;  2BVO A;  4N8V A;  1AGE A;  3HPJ A;  3SKO A;  4JFE A;  2FZ3 A;  1YPZ A;  1RK1 A;  3BH8 A;  1TVB A;  3MV9 A;  3H9S A;  3M17 A;  3TBV A;  3GMM A;  4Y4H A;  3UBX A;  5HGH A;  3SDA A;  4F7C A;  1ED3 A;  3TVM A;  1S7V A;  2VAA A;  2VAB A;  3IXA A;  2WY3 A;  4ZUS A;  3VFN A;  4JFP A;  2XFX A;  3RL1 A;  4PJB A;  2JCC A;  3TID A;  2FWO A;  1VAC A;  2A83 A;  4JRX A;  4IIQ C;  4JFQ A;  1ZHN A;  3FRU A;  5D2N A;  1HHI A;  1M6O A;  4JQX A;  5C0D A;  3VFP A;  3JVG A;  4PJE A;  1LEK A;  1K8D A;  3SJV A;  1HOC A;  1DDH A;  3MRJ A;  1EFX A;  3QUX A;  4PRN A;  1EEZ A;  1RJY A;  3BZF A;  4PGD A;  3B3I A;  1W72 A;  4PRH A;  5EU6 A;  1T7W A;  2CLZ A;  3E3Q A;  5D9S A;  2IA1 A;  3FQU A;  1OGA A;  3FQN A;  1CG9 A;  5EO1 A;  4F7P A;  4HS3 A;  4NQD A;  1FFN A;  3V5H A;  3LN4 A;  4EN3 C;  5F1I A;  1M05 A;  4WJ5 A;  5ISZ A;  1TMC A;  1JPF A;  4ZAK A;  3P4M A;  5F1N A;  3MRG A;  5J6H A;  4MVB A;  2AKR A;  5F7D A;  3TBW A;  3TBY A;  3MGT A;  4LNR A;  4E5X A;  3T8X A;  2X4P A;  1AGC A;  3CC5 A;  4IRJ A;  3VFU A;  3QDM A;  5BRZ A;  5SWZ A;  5EU4 A;  1FG2 A;  3RWG A;  3LKO A;  5C08 A;  4NHU E;  1FZK A;  4PJC A;  1TVH A;  3SDX A;  3QDG A;  3RL2 A;  1DE4 A;  1IM3 A;  3GMN A;  1T1Y A;  2PYE A;  3O3D A;  4PJA A;  1T7V A;  3ILP A;  4ZUT A;  3L9R A;  4MJ5 A;  5FA4 A;  2X4R A;  2P5W A;  3LKS A;  3QQ4 A;  2OI9 A;  4L8D A;  1DUZ A;  3TO4 A;  1YDP A;  3VFO A;  1LD9 A;  1RJZ A;  1AGD A;  5MEQ A;  1WBX A;  3WUW A;  3TIE A;  3QFJ A;  2NX5 A;  1QO3 A;  3W39 A;  3OX8 A;  3PWP A;  5C07 A;  2F74 A;  3OV6 A;  4F7E A;  3AU1 A;  4V3D B;  5H94 A;  3BP4 A;  4NSK A;  1FZO A;  3LKR A;  4HUX A;  1KBG H;  4JO8 A;  3WS6 A;  1Z5L A;  3HUJ A;  4F7M A;  1DUY A;  3C8K A;  3X12 A;  4PR5 A;  4HV8 A;  3O8X A;  3ARF A;  1A1O A;  1GZQ A;  1S7U A;  1A9E A;  1B0R A;  3P4N A;  4IRS A;  1INQ A;  4GUP A;  4WU5 A;  2BVQ A;  3BUY A;  4PP8 C;  2HJK A;  3SCM A;  4L3E A;  4PJ9 A;  3P77 A;  2VLK A;  3BGM A;  2ESV A;  4U1K A;  3E2H A;  3FT3 A;  1ZT7 A;  4HX1 A;  3KXF A;  2GTW A;  3JTT A;  5HHO A;  2X4S A;  5BS0 A;  1QSF A;  3DXA A;  4PG2 A;  2VLR A;  4O2F A;  5IB1 A;  5IVX A;  3SDD A;  2AXF A;  2FYY A;  5ENW A;  3MGO A;  4G9D A;  4PJH A;  4NT6 A;  4NO3 A;  5HHN A;  4Z78 A;  1T1Z A;  3KLA A;  5IEK A;  1JHT A;  1S9X A;  3VFV A;  1XR8 A;  1OGT A;  1LDP H;  3BP7 A;  5SWS A;  4I4W A;  1NEZ A;  2DYP A;  4L8S C;  4WWK C;  1KJV A;  3X14 A;  5D7J C;  3VXS A;  1QVO A;  4MX7 A;  3WL9 A;  3DTX A;  2BSR A;  3MRP A;  1KJM A;  3LN5 A;  3VXR A;  1QR1 A;  4HWZ A;  4CW1 A;  1T7X A;  4MS8 A;  4PJX A;  3GIV A;  1ZAG A;  5HHQ A;  1AGB A;  1JFM A;  1QRN A;  4N5E A;  3SPV A;  5IM7 A;  2MHA A;  1MHE A;  1XR9 A;  4G43 A;  4JQV A;  1KPU A;  1I1Y A;  2BNQ A;  2CKB H;  4WU7 A;  2X4Q A;  3KYO A;  1ZT4 A;  1SYS A;  3I0T A;  3QUL A;  5IB2 A;  4JFF A;  4O2E A;  2V2W A;  3I6G A;  4QRT A;  1CD1 A;  4HKJ A;  5D5M A;  4FFE X;  1CE6 A;  2D31 A;  3TPU E;  3MRL A;  1ZS8 A;  3GSO A;  3TZV C;  5C0J A;  3BH9 A;  2X4U A;  4PJG A;  3PWU A;  5SWQ A;  3O3E A;  5EU5 A;  1QLF A;  3QUY A;  4MNG A;  4MQ7 A;  3VXN A;  4ONO A;  3V5D A;  3OXR A;  1VGK A;  4PJ8 A;  3VFT A;  1ZHK A;  3D25 A;  4G8I A;  3QUK A;  3RWD A;  1T1W A;  3I6K A;  4U1N A;  1FO0 H;  3FFC A;  1G7P A;  5B39 A;  1W0W A;  4IHO A;  1ZHB A;  5E00 A;  3ARB A;  5C0B A;  3TN0 A;  4N0F A;  1NAM H;  1Q94 A;  3UTQ A;  3HLA A;  3HE7 A;  3MRH A;  1JGE A;  1SYV A;  4QOK A;  2FO4 A;  4Y4F A;  4PGB A;  3VRI A;  3C9N A;  1YN6 A;  5IB5 A;  2PO6 A;  1I1F A;  3CH1 A;  3JTC A;  4PJI A;  2CLV A;  2RFX A;  4ZUU A;  5HGB A;  3KPQ A;  3ARG A;  4U1S A;  3H9H A;  5AD0 A;  4PJ5 A;  5MEN A;  1HSB A;  3MRO A;  1BD2 A;  1N59 A;  1T20 A;  3E6F A;  1ZHL A;  3GSV A;  3L3I A;  4U1H A;  5HHM A;  5IB4 A;  3S6C A;  1WBZ A;  3GJF A;  3VXM A;  4D0B A;  3MRQ A;  4G9F A;  4EUP A;  1NAN H;  5E8N A;  3D3V A;  3MRR A;  5GSV A;  1T0N A;  1KTL A;  2E7L E;  3DX8 A;  3LV3 A;  3PWV A;  3DMM A;  1N3N A;  4LCY A;  1K5N A;  3O4L A;  4X6C A;  4JFD A;  4CVX A;  4E0R A;  1A9B A;  2V2X A;  5L2K A;  1UXW A;  5D7I A;  3VXP A;  1S7T A;  3RWJ A;  3MRN A;  3ROL A;  4NNY A;  1A1N A;  4U1L A;  3RWI A;  4U1M A;  4BKW A;  4NO2 A;  2OL3 H;  3GMP A;  4PRE A;  3TJH A;  2BSS A;  3L3K A;  3P9M A;  1HYR C;  4PRP A;  1HHG A;  3GML A;  1P7Q A;  3MV8 A;  3W0W A;  1P1Z A;  2F53 A;  3LKP A;  3I6L D;  3WLB A;  1T22 A;  2X70 A;  3FOL A;  3D39 A;  3VXO A;  1E28 A;  1N2R A;  5HYJ A;  1QQD A;  3DBX A;  3BEW A;  3O3A A;  1R3H A;  3RTQ A;  4D0C A;  5L2J A;  2NW3 A;  3GMQ A;  2YPL A;  4PRD A;  5C0A A;  3MRB A;  5BXF A;  1S7R A;  3GMO A;  1S7Q A;  4U6X A;  3OXS A;  5C9J A;  1IM9 A;  3ES6 A;  2J8U A;  3PWJ A;  1UXS A;  3E6H A;  3FTG A;  3GSX A;  1N5A A;  1T7Z A;  3MRD A;  3VCL A;  1BII A;  3X13 A;  1S9Y A;  3BZE A;  3VH8 A;  3IT8 D;  3MR9 A;  4QRP A;  5EUO A;  3QUZ A;  1S7W A;  3MRK A;  1T1X A;  3FQT A;  5C0F A;  3PQY A;  1LEG A;  3VFS A;  3MA7 A;  1XZ0 A;  3L3G A;  1FZJ A;  3QDJ A;  2FIK A;  3P4O A;  4NO5 A;  3CVH A;  3QI9 A;  4EI5 A;  1LK2 A;  4APQ A;  1G6R H;  3RWE A;  2X4N A;  4PJF A;  3LKQ A;  3FT4 A;  4PGC A;  3MRF A;  4PGE A;  2BST A;  4K71 B;  1KJ2 H;  1JF1 A;  1C16 A;  3B6S A;  3KWW A;  1EEY A;  4ZUV A;  3GSW A;  1RK0 A;  4U6Y A;  4X6D A;  4V3E B;  4ZUW A;  5MEO A;  3QQ3 A;  3D2U A;  5IB3 A;  3HG1 A;  5E8P A;  1KCG C;  3BEV A;  3FQX A;  3VRJ A;  3VFM A;  1I1A A;  3ARE A;  5C0I A;  1EXU A;  5E8O A;  5FA3 A;  2BNR A;  3PWN A;  3SDC A;  3CZF A;  1LQV A;  1FZM A;  4X6E A;  3TBS A;  4PRB A;  3VFW A;  2VE6 A;  3TFK A;  4GKN A;  1X7Q A;  1T7Y A;  5BJT A;  5FKP A;  3KPN A;  3T1F A;  3RWH A;  3MRE A;  3FOM A;  5J1A A;  1WBY A;  4WUU A;  4PV8 A;  1A6Z A;  1UQS A;  3CDG A;  1HHK A;  3QEQ A;  3QFD A;  4MJI A;  5D2L A;  2Q7Y A;  2VLJ A;  1BQH A;  5FDW A;  3PWL A;  3KPR A;  4QRU A;  5MER A;  5EOT A;  2F54 A;  3MV7 A;  2X4T A;  4Y4K A;  3BHB A;  1ZVS A;  2O5N A;  3BW9 A;  4L29 A;  3UTS A;  5DEF A;  3TO2 A;  3KPL A;  4QRS A;  2AXG A;  3GMR A;  3L3J A;  1QSE A;  2NYK A;  4LCC C;  1B0G A;  4LCW A;  3FQR A;  1MWA H;  2GAZ A;  3KPO A;  5C0G A;  3PAB A;  3TBT A;  1JGD A;  2YEZ A;  4PG9 A;  4UQ3 A;  4CVZ A;  1I7R A;  3P73 A;  5E6I C;  2HJL A;  4X6F A;  3BWA A;  1B3J A;  2H26 A;  4NQV A;  4GKS A;  3HCV A;  4QRQ A;  5IND A;  3RUG A;  2CIK A;  1OSZ A;  3CCH A;  5DDH A;  2GJ6 A;  1HSA A;  4WDI A;  1FFO A;  3AM8 A;  4ELM A;  3KPM A;  3JTS A;  1AKJ A;  5JHD A;  5HGD A;  3DX7 A;  2AV7 A;  5J6G A;  3KYN A;  4MNQ A;  4N0U A;  3NFN A;  3U0P A;  3GSN H;  5HGA A;  1I4F A;  1S8D A;  2VLL A;  2ZOL A;  1HHH A;  3O3B A;  3UTT A;  3VJ6 A;  4WW2 C;  4PJD A;  3KPS A;  3REW A;  4L4T A;  2H6P A;  3FQW A;  1G7Q A;  4G59 C;  5EO0 A;  4U1J A;  5EFI A;  3M1B A;  1VAD A;  1OF2 A;  4PRA A;  4L8C A;  4O2C A;  4L8B A;  4Y2D A;  5C09 A;  4I48 A;  4WO4 A;  3TF7 A;  4D0D A;  2AV1 A;  4NQX A;  3VFR A;  3FT2 A;  3VWK A;  2HN7 A;  1GZP A;  3ILQ C;  3ROO A;  4QRR A;  4N0C A;  5INC A;  3KPP A;  3BO8 A;  2UWE A;  4S0U C;  1FFP A;  4HUW A;  4MXQ A;  3P9L A;  3GSR A;  3BXN A; 
#chains in the Genus database with same CATH homology
 4Z77 A;  3SKM A;  4G8G A;  1AGF A;  2CII A;  1S9W A;  1T21 A;  3DX6 A;  5DEG A;  4Z76 A;  4JFO A;  4PRI A;  3FON A;  3LKN A;  3G08 A;  4HUU A;  1ONQ A;  2YPK A;  3RZC A;  5IRO A;  1E27 A;  4NQC A;  4HUV A;  2XPG A;  2ZSV A;  2GIT A;  3GSU A;  3ERY A;  1YN7 A;  4K7F A;  1I7T A;  5F9J A;  1PQZ A;  4JRY A;  3VWJ A;  4L4V A;  4L9L C;  4ZFZ A;  3RWC A;  1HHJ A;  4NO0 A;  1S7X A;  3ARD A;  4L3C A;  3UPR A;  2HLA A;  5ACZ A;  1T80 A;  2ZSW A;  4PJ7 A;  1KJ3 H;  5IEH A;  1KPV A;  1BZ9 A;  3TA3 A;  3O9W A;  3VXU A;  2X4O A;  5GSR A;  2BVP A;  1MI5 A;  3H7B A;  4G42 A;  1T0M A;  1KPR A;  2GT9 A;  4FTV A;  2GUO A;  1I7U A;  4G59 A;  5B38 A;  4UQ2 A;  3WS3 A;  1U58 A;  3HAE A;  1XH3 A;  3BVN A;  5HHP A;  4NNX A;  1JE6 A;  2C7U A;  1L8J A;  2ZOK A;  1ZT1 A;  3D18 A;  4LHU A;  3ECB A;  1JPG A;  4PV9 A;  3X11 A;  1S7S A;  1QEW A;  3V5K A;  5MEP A;  3MYJ A;  1LP9 A;  5E9D A;  1JUF A;  4F7T A;  4Y16 A;  3RWF A;  3CPL A;  3QZW A;  4U1I A;  2P5E A;  3MRM A;  2CLR A;  3HE6 A;  5C0C A;  2AK4 A;  1MHC A;  3GSQ A;  3L3D A;  4PDC E;  1A1M A;  4NQE A;  3RGV C;  5EU3 A;  3MRI A;  1ZSD A;  3L3H A;  2GTZ A;  4XXC A;  3MRC A;  5C0E A;  5D7L A;  1P4L A;  1AO7 A;  4MJ6 A;  2BCK A;  1W0V A;  2BVO A;  4N8V A;  1AGE A;  3HPJ A;  3SKO A;  4JFE A;  2FZ3 A;  1YPZ A;  1RK1 A;  3BH8 A;  1TVB A;  3MV9 A;  3H9S A;  3M17 A;  3TBV A;  3GMM A;  4Y4H A;  3UBX A;  5HGH A;  3SDA A;  4F7C A;  1ED3 A;  3TVM A;  1S7V A;  2VAA A;  2VAB A;  3IXA A;  2WY3 A;  4ZUS A;  3VFN A;  4JFP A;  2XFX A;  3RL1 A;  4PJB A;  2JCC A;  3TID A;  2FWO A;  1VAC A;  2A83 A;  4JRX A;  4IIQ C;  4JFQ A;  1ZHN A;  3FRU A;  5D2N A;  1HHI A;  1M6O A;  4JQX A;  5C0D A;  3VFP A;  3JVG A;  4PJE A;  1LEK A;  1K8D A;  3SJV A;  1HOC A;  1DDH A;  3MRJ A;  1EFX A;  3QUX A;  4PRN A;  1EEZ A;  1RJY A;  3BZF A;  4PGD A;  3B3I A;  1W72 A;  4PRH A;  5EU6 A;  1T7W A;  2CLZ A;  3E3Q A;  5D9S A;  3FQU A;  1OGA A;  3FQN A;  1CG9 A;  5EO1 A;  4F7P A;  4HS3 A;  4NQD A;  1FFN A;  3V5H A;  3LN4 A;  4EN3 C;  5F1I A;  1M05 A;  4WJ5 A;  5ISZ A;  1TMC A;  1JPF A;  4ZAK A;  3P4M A;  5F1N A;  3MRG A;  5J6H A;  4MVB A;  2AKR A;  5F7D A;  3TBW A;  3TBY A;  3MGT A;  4LNR A;  4E5X A;  3T8X A;  2X4P A;  1AGC A;  3CC5 A;  4IRJ A;  3VFU A;  3QDM A;  5BRZ A;  5SWZ A;  5EU4 A;  1FG2 A;  3RWG A;  3LKO A;  5C08 A;  4NHU E;  1FZK A;  4PJC A;  1TVH A;  3SDX A;  3QDG A;  3RL2 A;  1DE4 A;  1IM3 A;  3GMN A;  1T1Y A;  2PYE A;  3O3D A;  4PJA A;  1T7V A;  3ILP A;  4ZUT A;  3L9R A;  4MJ5 A;  5FA4 A;  2X4R A;  2P5W A;  3LKS A;  3QQ4 A;  2OI9 A;  4L8D A;  1DUZ A;  3TO4 A;  1YDP A;  3VFO A;  1LD9 A;  1RJZ A;  1AGD A;  5MEQ A;  1WBX A;  3WUW A;  3TIE A;  3QFJ A;  2NX5 A;  1QO3 A;  3W39 A;  3OX8 A;  3PWP A;  5C07 A;  2F74 A;  3OV6 A;  4F7E A;  3AU1 A;  4V3D B;  5H94 A;  3BP4 A;  4NSK A;  1FZO A;  3LKR A;  4HUX A;  1KBG H;  3WS6 A;  1Z5L A;  3HUJ A;  4F7M A;  1DUY A;  3C8K A;  3X12 A;  4PR5 A;  4HV8 A;  3O8X A;  3ARF A;  1A1O A;  1GZQ A;  1S7U A;  1A9E A;  1B0R A;  3P4N A;  4IRS A;  1INQ A;  4GUP A;  4WU5 A;  2BVQ A;  3BUY A;  4PP8 C;  2HJK A;  3SCM A;  4L3E A;  4PJ9 A;  3P77 A;  2VLK A;  3BGM A;  2ESV A;  4U1K A;  3E2H A;  3FT3 A;  1ZT7 A;  4HX1 A;  3KXF A;  2GTW A;  3JTT A;  5HHO A;  2X4S A;  5BS0 A;  1QSF A;  3DXA A;  4PG2 A;  2VLR A;  4O2F A;  5IB1 A;  5IVX A;  3SDD A;  2AXF A;  2FYY A;  5ENW A;  3MGO A;  4G9D A;  4PJH A;  4NT6 A;  4NO3 A;  5HHN A;  4Z78 A;  1T1Z A;  3KLA A;  5IEK A;  1JHT A;  1S9X A;  3VFV A;  1XR8 A;  1OGT A;  1LDP H;  3BP7 A;  5SWS A;  4I4W A;  1NEZ A;  2DYP A;  4L8S C;  4WWK C;  1KJV A;  3X14 A;  5D7J C;  3VXS A;  1QVO A;  4MX7 A;  3WL9 A;  3DTX A;  2BSR A;  3MRP A;  1KJM A;  3LN5 A;  3VXR A;  1QR1 A;  4HWZ A;  4CW1 A;  1T7X A;  4MS8 A;  4PJX A;  3GIV A;  1ZAG A;  5HHQ A;  1AGB A;  1JFM A;  1QRN A;  4N5E A;  3SPV A;  5IM7 A;  2MHA A;  1MHE A;  1XR9 A;  4G43 A;  4JQV A;  1KPU A;  1I1Y A;  2BNQ A;  2CKB H;  4WU7 A;  2X4Q A;  3KYO A;  1ZT4 A;  1SYS A;  3QUL A;  5IB2 A;  4JFF A;  4O2E A;  2V2W A;  3I6G A;  4QRT A;  1CD1 A;  4HKJ A;  5D5M A;  4FFE X;  1CE6 A;  2D31 A;  3TPU E;  3MRL A;  1ZS8 A;  3GSO A;  3TZV C;  5C0J A;  3BH9 A;  2X4U A;  4PJG A;  3PWU A;  5SWQ A;  3O3E A;  5EU5 A;  1QLF A;  3QUY A;  4MNG A;  4MQ7 A;  3VXN A;  4ONO A;  3V5D A;  3OXR A;  1VGK A;  4PJ8 A;  3VFT A;  1ZHK A;  3D25 A;  4G8I A;  3QUK A;  3RWD A;  1T1W A;  3I6K A;  4U1N A;  1FO0 H;  3FFC A;  1G7P A;  5B39 A;  1W0W A;  4IHO A;  1ZHB A;  5E00 A;  3ARB A;  5C0B A;  3TN0 A;  4N0F A;  1NAM H;  1Q94 A;  3UTQ A;  3HLA A;  3HE7 A;  3MRH A;  1JGE A;  1SYV A;  4QOK A;  2FO4 A;  4Y4F A;  4PGB A;  3VRI A;  3C9N A;  1YN6 A;  5IB5 A;  2PO6 A;  1I1F A;  3CH1 A;  3JTC A;  4PJI A;  2CLV A;  2RFX A;  4ZUU A;  5HGB A;  3KPQ A;  3ARG A;  4U1S A;  3H9H A;  5AD0 A;  4PJ5 A;  5MEN A;  1HSB A;  3MRO A;  1BD2 A;  1N59 A;  1T20 A;  3E6F A;  1ZHL A;  3GSV A;  3L3I A;  4U1H A;  5HHM A;  5IB4 A;  3S6C A;  1WBZ A;  3GJF A;  3VXM A;  4D0B A;  3MRQ A;  4G9F A;  4EUP A;  1NAN H;  5E8N A;  3D3V A;  3MRR A;  5GSV A;  1T0N A;  1KTL A;  2E7L E;  3DX8 A;  3LV3 A;  3PWV A;  3DMM A;  1N3N A;  4LCY A;  1K5N A;  3O4L A;  4X6C A;  4JFD A;  4CVX A;  4E0R A;  1A9B A;  2V2X A;  5L2K A;  1UXW A;  5D7I A;  3VXP A;  1S7T A;  3RWJ A;  3MRN A;  3ROL A;  4NNY A;  1A1N A;  4U1L A;  3RWI A;  4U1M A;  4NO2 A;  2OL3 H;  3GMP A;  4PRE A;  3TJH A;  2BSS A;  3L3K A;  3P9M A;  1HYR C;  4PRP A;  1HHG A;  3GML A;  1P7Q A;  3MV8 A;  3W0W A;  1P1Z A;  2F53 A;  3LKP A;  3I6L D;  3WLB A;  1T22 A;  2X70 A;  3FOL A;  3D39 A;  3VXO A;  1E28 A;  1N2R A;  5HYJ A;  1QQD A;  3DBX A;  3BEW A;  3O3A A;  1R3H A;  3RTQ A;  4D0C A;  5L2J A;  2NW3 A;  3GMQ A;  2YPL A;  4PRD A;  5C0A A;  3MRB A;  5BXF A;  1S7R A;  3GMO A;  1S7Q A;  4U6X A;  3OXS A;  5C9J A;  1IM9 A;  3ES6 A;  2J8U A;  3PWJ A;  1UXS A;  3E6H A;  3FTG A;  3GSX A;  1N5A A;  1T7Z A;  3MRD A;  3VCL A;  1BII A;  3X13 A;  1S9Y A;  3BZE A;  3VH8 A;  3IT8 D;  3MR9 A;  4QRP A;  5EUO A;  3QUZ A;  1S7W A;  3MRK A;  1T1X A;  3FQT A;  5C0F A;  3PQY A;  1LEG A;  3VFS A;  3MA7 A;  1XZ0 A;  3L3G A;  1FZJ A;  3QDJ A;  2FIK A;  3P4O A;  4NO5 A;  3CVH A;  3QI9 A;  4EI5 A;  1LK2 A;  4APQ A;  1G6R H;  3RWE A;  2X4N A;  4PJF A;  3LKQ A;  3FT4 A;  4PGC A;  3MRF A;  4PGE A;  2BST A;  4K71 B;  1KJ2 H;  1JF1 A;  1C16 A;  3B6S A;  3KWW A;  1EEY A;  4ZUV A;  3GSW A;  1RK0 A;  4U6Y A;  4X6D A;  4V3E B;  4ZUW A;  5MEO A;  3QQ3 A;  3D2U A;  5IB3 A;  3HG1 A;  5E8P A;  1KCG C;  3BEV A;  3FQX A;  3VRJ A;  3VFM A;  1I1A A;  3ARE A;  5C0I A;  1EXU A;  5E8O A;  5FA3 A;  2BNR A;  3PWN A;  3SDC A;  3CZF A;  1LQV A;  1FZM A;  4X6E A;  3TBS A;  4PRB A;  3VFW A;  2VE6 A;  3TFK A;  4GKN A;  1X7Q A;  1T7Y A;  5BJT A;  5FKP A;  3KPN A;  3T1F A;  3RWH A;  3MRE A;  3FOM A;  5J1A A;  1WBY A;  4WUU A;  4PV8 A;  1A6Z A;  1UQS A;  3CDG A;  1HHK A;  3QEQ A;  3QFD A;  4MJI A;  5D2L A;  2Q7Y A;  2VLJ A;  1BQH A;  5FDW A;  3PWL A;  3KPR A;  4QRU A;  5MER A;  5EOT A;  2F54 A;  3MV7 A;  2X4T A;  4Y4K A;  3BHB A;  1ZVS A;  3BW9 A;  4L29 A;  3UTS A;  5DEF A;  3TO2 A;  3KPL A;  4QRS A;  2AXG A;  3GMR A;  3L3J A;  1QSE A;  4LCC C;  1B0G A;  4LCW A;  3FQR A;  1MWA H;  2GAZ A;  3KPO A;  5C0G A;  3PAB A;  3TBT A;  1JGD A;  2YEZ A;  4PG9 A;  4UQ3 A;  4CVZ A;  1I7R A;  3P73 A;  5E6I C;  2HJL A;  4X6F A;  3BWA A;  1B3J A;  2H26 A;  4NQV A;  4GKS A;  3HCV A;  4QRQ A;  5IND A;  3RUG A;  2CIK A;  1OSZ A;  3CCH A;  5DDH A;  2GJ6 A;  1HSA A;  4WDI A;  1FFO A;  3AM8 A;  4ELM A;  3KPM A;  3JTS A;  1AKJ A;  5JHD A;  5HGD A;  3DX7 A;  2AV7 A;  5J6G A;  3KYN A;  4MNQ A;  4N0U A;  3NFN A;  3U0P A;  3GSN H;  5HGA A;  1I4F A;  1S8D A;  2VLL A;  2ZOL A;  1HHH A;  3O3B A;  3UTT A;  3VJ6 A;  4WW2 C;  4PJD A;  3KPS A;  3REW A;  4L4T A;  2H6P A;  3FQW A;  1G7Q A;  5EO0 A;  4U1J A;  5EFI A;  3M1B A;  1VAD A;  1OF2 A;  4PRA A;  4L8C A;  4O2C A;  4L8B A;  4Y2D A;  5C09 A;  4I48 A;  4WO4 A;  3TF7 A;  4D0D A;  2AV1 A;  4NQX A;  3VFR A;  3FT2 A;  3VWK A;  2HN7 A;  1GZP A;  3ILQ C;  3ROO A;  4QRR A;  4N0C A;  5INC A;  3KPP A;  3BO8 A;  2UWE A;  4S0U C;  1FFP A;  4HUW A;  4MXQ A;  3P9L A;  3GSR A;  3BXN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...