3ERYA

Different thermodynamic binding mechanisms and peptide fine specificities associated with a panel of structurally similar high-affinity t cell receptors
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
174
structure length
174
Chain Sequence
GPHSMRYYETATSRRGLGEPRYTSVGYVDDKEFVRFDSDAENPRYEPQVPWMEQEGPEYWERITQVAKGQEQWFRVNLRTLLGYYNQSAGGTHTLQRMYGCDVGSDGRLLRGYEQFAYDGCDYIALNEDLRTWTAADMAAQITRRKWEQAGAAEYYRAYLEGECVEWLHRYLKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords H-2 class I histocompatibility antigen
publication title Different thermodynamic binding mechanisms and peptide fine specificities associated with a panel of structurally similar high-affinity T cell receptors
pubmed doi rcsb
source organism Homo sapiens
total genus 55
structure length 174
sequence length 174
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-10-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3eryA00
2AV1A 5C07A 2X4RA 1A1NA 5SWSA 1AGDA 1A6ZA 3SDDA 4L9LC 1HOCA 3QEQA 3I6KA 5J1AA 3TPUE 3LKRA 4PREA 1SYVA 3X12A 1XZ0A 4LNRA 1U58A 3RWIA 3VJ6A 5IB3A 3E3QA 4HWZA 3B3IA 4JFOA 4LCYA 3X11A 1QSEA 3KPOA 3RGVC 4PJFA 5D7IA 3D39A 4X6CA 2X4OA 3VRJA 2H26A 1QRNA 3O3DA 5C0DA 3LKOA 3HCVA 3L3JA 4JRYA 3O8XA 3C9NA 1TVHA 4NQEA 3UPRA 3MRJA 3PQYA 3QUKA 4WJ5A 4CVZA 5EO1A 5EOTA 3TF7A 3E6FA 3OX8A 1LEKA 3ROOA 3GMLA 1N2RA 3RWEA 3DBXA 3LN5A 1ZT4A 1T0MA 4X6FA 1AGFA 2AXFA 3GSVA 1S7VA 3V5HA 3VXUA 2X4UA 1DE4A 1UQSA 1KJVA 2P5WA 3BH8A 2NX5A 2D31A 5BJTA 1GZQA 5F9JA 3IT8D 1LQVA 3L3KA 1DDHA 4WW2C 3VWKA 2X4SA 1E27A 4U6XA 3MRPA 1HHGA 4MX7A 4QRQA 4PG2A 5FA4A 3MRIA 4L3CA 4ZFZA 4F7PA 3MRDA 1ZHNA 4NO3A 3MYJA 1KPVA 3KPPA 3VCLA 3VFWA 3PWLA 4F7MA 3ROLA 4CVXA 4G9FA 4GUPA 1T1WA 4S0UC 1IM3A 1HYRC 3MV7A 3CPLA 5INCA 2AV7A 4PV8A 2CIKA 5DEGA 3VXMA 5HHOA 4MQ7A 4X6EA 3T8XA 2J8UA 1FFPA 1AO7A 1TVBA 3QULA 2VLKA 1T1YA 1IM9A 4GKSA 3SDCA 3CVHA 3FT4A 5IEHA 3RWJA 4U1NA 3VRIA 4PRIA 1I7RA 1VACA 3E2HA 1NAMH 4L4VA 3V5KA 3MR9A 4MVBA 3REWA 4JFEA 5E6IC 2F74A 4F7TA 3LKSA 4PGDA 2VABA 1FO0H 3HE7A 4HUVA 1A1MA 4O2CA 3SJVA 4PGCA 3BEVA 2UWEA 3BGMA 3CZFA 4JFQA 4PJ9A 5B39A 3GSWA 1Z5LA 2HJLA 4D0DA 3HUJA 1JGEA 1AGBA 1GZPA 3ERYA 3ILPA 4MXQA 1OSZA 1T22A 3UTSA 3VFVA 3BZEA 4IRJA 5ISZA 3GJFA 1INQA 2GAZA 2CLZA 2OL3H 4O2EA 3MA7A 4WO4A 2V2XA 1S7RA 3SKOA 4PJAA 1JHTA 1QQDA 3GMRA 3FOMA 4NT6A 1L8JA 2PO6A 5DEFA 1S9YA 4U1LA 5H94A 1EXUA 3HLAA 4G8IA 1A9EA 1B0RA 4LHUA 3LKQA 3VFRA 4D0BA 4FTVA 1KBGH 5HGHA 3TA3A 1I1YA 5ENWA 4WWKC 1S7UA 2GUOA 4MNGA 1LDPH 1VGKA 5D5MA 3SKMA 1AGCA 3FOLA 5EU4A 2WY3A 3TO2A 2X4NA 3BVNA 4CW1A 1HSBA 5F1IA 4ELMA 1FZMA 3TZVC 3O3EA 1EEZA 3RUGA 4UQ2A 2JCCA 2HLAA 1UXWA 3BZFA 2X70A 4XXCA 5EU5A 1JPGA 3D18A 4NO2A 3CH1A 4ZUUA 1DUYA 5D7JC 3KPMA 3KYNA 4NQVA 3W39A 3CDGA 4LCWA 3W0WA 4U1KA 3GSUA 3QDJA 1I1AA 1PQZA 1ZHBA 1MWAH 3TIEA 4PJBA 1NANH 3GMNA 3GSNH 3PABA 3O4LA 5E8OA 5HHNA 5BRZA 5HHQA 3I6LD 4JRXA 4Y4FA 5EUOA 1E28A 5GSVA 1EFXA 3LKNA 1ZT1A 4WUUA 4PGBA 3MRMA 3OXRA 3ILQC 3FT3A 2XPGA 5INDA 1MI5A 3KXFA 1ZT7A 3VXPA 3O9WA 1KJMA 4QOKA 5C0FA 3X14A 1T7VA 1CG9A 1OGTA 2FO4A 2VLLA 1T7YA 2E7LE 3KPSA 5B38A 4HX1A 1EEYA 2BVOA 3LKPA 3U0PA 3GMMA 1YPZA 5E8PA 3VXNA 1BQHA 1KPUA 3HPJA 2FZ3A 5C0AA 3KLAA 3BEWA 3GSRA 1TMCA 2HJKA 4PJ5A 4U1JA 4G8GA 5IEKA 4EN3C 4ZUSA 4QRRA 5E00A 1M6OA 2MHAA 1QEWA 3PWUA 4N0FA 3D2UA 1QLFA 3O3BA 4U6YA 5HHPA 1BD2A 4EI5A 1KJ3H 3MRFA 3KPNA 5HGDA 5MEPA 3X13A 1RJYA 1RK1A 3P4NA 4PJXA 5F7DA 3KYOA 2C7UA 4NQXA 1ED3A 3VXSA 4MJ5A 3FQWA 1FG2A 4PGEA 3HE6A 3KPQA 2X4PA 5D2LA 3MRCA 4I4WA 3WLBA 4NO0A 3BXNA 4PJEA 4PR5A 3FT2A 1I7TA 4L8SC 1LK2A 1LP9A 5EO0A 3RWFA 1P7QA 4HKJA 3AM8A 1HHKA 1P4LA 4JQXA 3DXAA 1HHJA 1WBZA 3QUYA 4L3EA 4JFPA 4U1IA 4F7EA 3P73A 4L8CA 3M1BA 1T7ZA 4MNQA 3TBWA 3VFMA 1B3JA 1QR1A 3BHBA 4NSKA 3P9LA 4G59A 4NQCA 3G08A 2GTZA 3TJHA 3JTSA 4NNXA 1KCGC 3QI9A 5C9JA 5EU3A 3MRBA 4L4TA 4L29A 3SCMA 5BXFA 3VXRA 2DYPA 1N3NA 3ARBA 5HHMA 3KPRA 1T1ZA 5C0BA 5SWZA 3L3GA 5IB5A 4QRUA 4NNYA 1YDPA 5BS0A 3TBYA 3TIDA 1P1ZA 5D7LA 5L2JA 4L8BA 1XH3A 4X6DA 4Y2DA 1ZHKA 3WL9A 1FZOA 3P4OA 3S6CA 2V2WA 5FKPA 3D3VA 5IB1A 3MV9A 4PJ7A 4Y16A 3ARFA 2GITA 4E5XA 4PRBA 3T1FA 2GJ6A 1KJ2H 3L3HA 3NFNA 3TBSA 1HSAA 4HS3A 4QRSA 1LD9A 3BP7A 3RWGA 1JGDA 4Y4KA 3BW9A 2GT9A 1DUZA 3PWVA 3AREA 2NW3A 1JF1A 3CC5A 2CLVA 3D25A 1T1XA 4UQ3A 3BWAA 3ECBA 3VFNA 1QO3A 1S7XA 5E9DA 3JVGA 4HUUA 4NO5A 5IB4A 3ES6A 5JHDA 1YN7A 3GSQA 3CCHA 4PJIA 5MERA 1G6RH 1JPFA 4PJGA 5GSRA 3QZWA 2CKBH 5IROA 4QRPA 1G7QA 2ZSVA 3DX8A 5HGBA 3GIVA 3BP4A 2VLJA 3VWJA 5IVXA 4Z76A 1KTLA 3ARGA 4NHUE 1S7QA 2H6PA 4MS8A 2ESVA 2AXGA 1ZSDA 5ACZA 2VE6A 3QFJA 1T7WA 1YN6A 3HG1A 3PWPA 3PWNA 5FA3A 1AKJA 2BSSA 3P9MA 1HHHA 4FFEX 3VFOA 1N59A 1B0GA 1FZJA 1ONQA 3VFPA 3QFDA 1JUFA 3QQ3A 5EFIA 4U1HA 3FQUA 4HV8A 1ZS8A 2AK4A 2ZOKA 3GSOA 4PJ8A 1SYSA 3B6SA 4PRHA 4G9DA 5L2KA 1N5AA 4WU7A 3TBTA 1I4FA 5D2NA 5EU6A 4Z78A 3BO8A 1S7WA 1HHIA 1S7TA 4ZUWA 1UXSA 3LV3A 1BZ9A 3VFUA 4IRSA 5D9SA 3MGTA 4Y4HA 3FRUA 2BVPA 4F7CA 3HAEA 5F1NA 3TO4A 4HUWA 3IXAA 3QUXA 3FTGA 2YPKA 4PJHA 3WS6A 1W72A 1VADA 3SPVA 2BSRA 4V3DB 1R3HA 5J6GA 3DMMA 4N5EA 1CE6A 1T80A 1RJZA 1FZKA 3QDGA 3C8KA 5C0GA 2CLRA 3GSXA 1BIIA 3KPLA 3TBVA 1S7SA 4GKNA 3I6GA 3QQ4A 3SDXA 2YPLA 3DX6A 2Q7YA 2RFXA 2BNQA 3VFTA 3L3DA 4WU5A 3P4MA 3JTCA 3RL2A 4E0RA 4U1SA 3RWCA 1G7PA 3MRLA 1T20A 2VLRA 4PP8C 5IB2A 1T7XA 5C0JA 3RZCA 1AGEA 1NEZA 1S9XA 2A83A 3VFSA 4MJIA 3VH8A 1XR8A 3WS3A 5C0IA 4WDIA 4NQDA 3FQRA 1I1FA 3O3AA 3BH9A 3DX7A 5MENA 1C16A 1ZHLA 5MEOA 5AD0A 1K5NA 1FFNA 4PRNA 5C08A 1JE6A 3FQXA 4PRAA 3WUWA 1RK0A 2X4TA 3JTTA 4G43A 2FWOA 4APQA 4PDCE 3OXSA 1OGAA 3MGOA 4ONOA 5C09A 3RWDA 1CD1A 4Z77A 4LCCC 3MRRA 3GMOA 3RTQA 1T0NA 5DDHA 1S8DA 4QRTA 2X4QA 1WBXA 5FDWA 5MEQA 4JQVA 4ZAKA 1T21A 4MJ6A 4EUPA 2F53A 1KPRA 3P77A 4N0UA 3KWWA 4ZUTA 3RL1A 5C0EA 2ZSWA 3FFCA 3GMQA 3UTQA 3MRHA 4JFDA 3MRKA 5J6HA 2CIIA 1OF2A 2OI9A 2AKRA 4PRPA 4IHOA 4D0CA 1QSFA 2FIKA 2F54A 1K8DA 1A9BA 1ZVSA 2BCKA 4O2FA 4ZUVA 1JFMA 2BSTA 3MRNA 5E8NA 5IM7A 3TFKA 2PYEA 1MHEA 3TN0A 4G42A 5C0CA 1Q94A 3MRQA 2VAAA 1I7UA 3FQNA 3VXOA 1W0WA 1X7QA 1M05A 3E6HA 3MRGA 3GMPA 3OV6A 4PV9A 3UTTA 3L3IA 4N8VA 5SWQA 3RWHA 4K71B 3FONA 4PG9A 1A1OA 4PJCA 3SDAA 3H7BA 1XR9A 3QDMA 3H9SA 1S9WA 2XFXA 3TVMA 4JFFA 4N0CA 1LEGA 3PWJA 5HYJA 1QVOA 3ARDA 4IIQC 2YEZA 3FQTA 2BNRA 4I48A 3M17A 3AU1A 4L8DA 4HUXA 4V3EB 1W0VA 3L9RA 3DTXA 2ZOLA 4PJDA 3UBXA 2HN7A 3LN4A 5HGAA 3MREA 2FYYA 3MROA 3H9HA 3MV8A 3QUZA 3V5DA 1MHCA 2GTWA 1WBYA 4K7FA 4PRDA 4U1MA 2BVQA 1FFOA 3BUYA 1ZAGA 2P5EA
chains in the Genus database with same CATH superfamily
2AV1A 5C07A 2X4RA 1A1NA 5SWSA 1AGDA 1A6ZA 3SDDA 4L9LC 1HOCA 3QEQA 3I6KA 5J1AA 3TPUE 3LKRA 4PREA 1SYVA 3X12A 1XZ0A 4LNRA 1U58A 3RWIA 3VJ6A 5IB3A 3E3QA 4HWZA 3B3IA 4JFOA 4LCYA 3X11A 1QSEA 3KPOA 3RGVC 4PJFA 5D7IA 3D39A 4X6CA 2X4OA 3VRJA 2H26A 4G59C 1QRNA 3O3DA 5C0DA 3LKOA 3HCVA 3L3JA 4JRYA 3O8XA 3C9NA 1TVHA 4NQEA 3UPRA 3MRJA 3PQYA 3QUKA 4WJ5A 4CVZA 5EO1A 5EOTA 3TF7A 3E6FA 3OX8A 1LEKA 3ROOA 3GMLA 1N2RA 3RWEA 3DBXA 3LN5A 1ZT4A 1T0MA 4X6FA 1AGFA 2AXFA 3GSVA 1S7VA 3V5HA 3VXUA 2X4UA 1DE4A 1UQSA 1KJVA 2P5WA 3BH8A 2NX5A 4JO8A 2D31A 5BJTA 1GZQA 5F9JA 3IT8D 1LQVA 3L3KA 1DDHA 4WW2C 3VWKA 2X4SA 1E27A 4U6XA 3MRPA 1HHGA 4MX7A 4QRQA 4PG2A 5FA4A 3MRIA 4L3CA 4ZFZA 4F7PA 3MRDA 1ZHNA 4NO3A 3MYJA 1KPVA 3KPPA 3VCLA 3VFWA 3PWLA 4F7MA 3ROLA 4CVXA 4G9FA 4GUPA 1T1WA 4S0UC 1IM3A 1HYRC 3MV7A 3CPLA 5INCA 2AV7A 4PV8A 2CIKA 5DEGA 3VXMA 5HHOA 4MQ7A 4X6EA 3T8XA 2J8UA 1FFPA 1AO7A 1TVBA 3QULA 2VLKA 1T1YA 1IM9A 4GKSA 3SDCA 3CVHA 3FT4A 5IEHA 3RWJA 4U1NA 3VRIA 4PRIA 1I7RA 1VACA 3E2HA 1NAMH 4L4VA 3V5KA 3MR9A 4MVBA 3REWA 4JFEA 5E6IC 2F74A 4F7TA 3LKSA 4PGDA 2VABA 1FO0H 3HE7A 4HUVA 1A1MA 4O2CA 3SJVA 4PGCA 3BEVA 2UWEA 3BGMA 3CZFA 4JFQA 4PJ9A 5B39A 3GSWA 1Z5LA 2HJLA 4D0DA 3HUJA 1JGEA 1AGBA 1GZPA 3ERYA 3ILPA 4MXQA 1OSZA 1T22A 3UTSA 3VFVA 3BZEA 4IRJA 5ISZA 2NYKA 3GJFA 1INQA 2GAZA 2CLZA 2OL3H 4O2EA 3MA7A 4WO4A 2V2XA 1S7RA 3SKOA 4PJAA 1JHTA 1QQDA 3GMRA 3FOMA 4NT6A 1L8JA 2PO6A 5DEFA 1S9YA 4U1LA 5H94A 1EXUA 3HLAA 4G8IA 1A9EA 1B0RA 4LHUA 3LKQA 3VFRA 4D0BA 4FTVA 1KBGH 5HGHA 3TA3A 1I1YA 5ENWA 4WWKC 1S7UA 2GUOA 4MNGA 1LDPH 1VGKA 5D5MA 3SKMA 1AGCA 3FOLA 5EU4A 2WY3A 3TO2A 2X4NA 3BVNA 4CW1A 1HSBA 5F1IA 4ELMA 1FZMA 3TZVC 3O3EA 1EEZA 3RUGA 4UQ2A 2JCCA 2HLAA 1UXWA 3BZFA 2X70A 4XXCA 5EU5A 1JPGA 3D18A 4NO2A 4BKWA 3CH1A 4ZUUA 1DUYA 5D7JC 3KPMA 3KYNA 4NQVA 3W39A 3CDGA 4LCWA 3W0WA 4U1KA 3GSUA 3QDJA 1I1AA 1PQZA 1ZHBA 1MWAH 3TIEA 4PJBA 1NANH 3GMNA 3GSNH 3PABA 3O4LA 5E8OA 5HHNA 5BRZA 5HHQA 3I6LD 4JRXA 4Y4FA 5EUOA 1E28A 5GSVA 1EFXA 3LKNA 1ZT1A 4WUUA 4PGBA 3MRMA 3OXRA 3ILQC 3FT3A 2XPGA 5INDA 1MI5A 3KXFA 1ZT7A 3VXPA 3O9WA 1KJMA 4QOKA 5C0FA 3X14A 1T7VA 1CG9A 1OGTA 2FO4A 2VLLA 1T7YA 2E7LE 3KPSA 5B38A 4HX1A 1EEYA 2BVOA 3LKPA 3U0PA 3GMMA 1YPZA 5E8PA 3I0TA 3VXNA 1BQHA 1KPUA 3HPJA 2FZ3A 5C0AA 3KLAA 3BEWA 3GSRA 1TMCA 2HJKA 4PJ5A 4U1JA 4G8GA 5IEKA 4EN3C 4ZUSA 4QRRA 5E00A 1M6OA 2MHAA 1QEWA 3PWUA 4N0FA 3D2UA 1QLFA 3O3BA 4U6YA 5HHPA 1BD2A 4EI5A 1KJ3H 3MRFA 3KPNA 5HGDA 5MEPA 3X13A 1RJYA 1RK1A 3P4NA 4PJXA 5F7DA 3KYOA 2C7UA 4NQXA 1ED3A 3VXSA 4MJ5A 3FQWA 1FG2A 4PGEA 3HE6A 3KPQA 2X4PA 5D2LA 3MRCA 4I4WA 3WLBA 4NO0A 3BXNA 4PJEA 4PR5A 3FT2A 1I7TA 4L8SC 1LK2A 1LP9A 5EO0A 3RWFA 1P7QA 4HKJA 3AM8A 1HHKA 1P4LA 4JQXA 3DXAA 1HHJA 1WBZA 3QUYA 4L3EA 4JFPA 4U1IA 4F7EA 3P73A 4L8CA 3M1BA 1T7ZA 4MNQA 3TBWA 3VFMA 1B3JA 1QR1A 3BHBA 4NSKA 3P9LA 4G59A 4NQCA 3G08A 2GTZA 3TJHA 3JTSA 4NNXA 1KCGC 3QI9A 5C9JA 5EU3A 3MRBA 4L4TA 4L29A 3SCMA 5BXFA 3VXRA 2DYPA 1N3NA 3ARBA 5HHMA 3KPRA 1T1ZA 5C0BA 5SWZA 3L3GA 5IB5A 4QRUA 4NNYA 1YDPA 5BS0A 3TBYA 3TIDA 1P1ZA 5D7LA 5L2JA 4L8BA 1XH3A 4X6DA 4Y2DA 1ZHKA 3WL9A 1FZOA 3P4OA 3S6CA 2V2WA 5FKPA 3D3VA 5IB1A 3MV9A 4PJ7A 4Y16A 3ARFA 2GITA 4E5XA 4PRBA 3T1FA 2GJ6A 1KJ2H 3L3HA 3NFNA 3TBSA 1HSAA 4HS3A 4QRSA 1LD9A 3BP7A 3RWGA 1JGDA 4Y4KA 3BW9A 2GT9A 1DUZA 3PWVA 3AREA 2NW3A 1JF1A 3CC5A 2CLVA 3D25A 1T1XA 4UQ3A 3BWAA 3ECBA 3VFNA 1QO3A 1S7XA 5E9DA 3JVGA 4HUUA 4NO5A 5IB4A 3ES6A 5JHDA 1YN7A 3GSQA 3CCHA 4PJIA 5MERA 1G6RH 1JPFA 4PJGA 5GSRA 3QZWA 2CKBH 2IA1A 5IROA 4QRPA 1G7QA 2ZSVA 3DX8A 5HGBA 3GIVA 3BP4A 2VLJA 3VWJA 5IVXA 4Z76A 1KTLA 3ARGA 4NHUE 1S7QA 2H6PA 4MS8A 2ESVA 2AXGA 1ZSDA 5ACZA 2VE6A 3QFJA 1T7WA 1YN6A 3HG1A 3PWPA 3PWNA 5FA3A 1AKJA 2BSSA 3P9MA 1HHHA 4FFEX 3VFOA 1N59A 1B0GA 1FZJA 1ONQA 3VFPA 3QFDA 1JUFA 3QQ3A 5EFIA 4U1HA 3FQUA 4HV8A 1ZS8A 2AK4A 2ZOKA 3GSOA 4PJ8A 1SYSA 3B6SA 4PRHA 4G9DA 5L2KA 1N5AA 4WU7A 3TBTA 1I4FA 5D2NA 5EU6A 4Z78A 3BO8A 1S7WA 1HHIA 1S7TA 4ZUWA 1UXSA 3LV3A 1BZ9A 3VFUA 4IRSA 5D9SA 3MGTA 4Y4HA 3FRUA 2BVPA 4F7CA 3HAEA 5F1NA 3TO4A 4HUWA 3IXAA 3QUXA 3FTGA 2YPKA 4PJHA 3WS6A 1W72A 1VADA 3SPVA 2BSRA 4V3DB 1R3HA 5J6GA 3DMMA 4N5EA 1CE6A 1T80A 1RJZA 1FZKA 3QDGA 3C8KA 5C0GA 2CLRA 3GSXA 1BIIA 3KPLA 3TBVA 1S7SA 4GKNA 3I6GA 3QQ4A 3SDXA 2YPLA 3DX6A 2Q7YA 2RFXA 2BNQA 3VFTA 3L3DA 4WU5A 3P4MA 3JTCA 3RL2A 4E0RA 4U1SA 3RWCA 1G7PA 3MRLA 1T20A 2VLRA 4PP8C 5IB2A 1T7XA 5C0JA 3RZCA 1AGEA 1NEZA 1S9XA 2A83A 3VFSA 4MJIA 3VH8A 1XR8A 3WS3A 5C0IA 4WDIA 4NQDA 3FQRA 1I1FA 3O3AA 3BH9A 3DX7A 5MENA 1C16A 1ZHLA 5MEOA 5AD0A 1K5NA 1FFNA 4PRNA 5C08A 1JE6A 3FQXA 4PRAA 3WUWA 1RK0A 2X4TA 3JTTA 4G43A 2FWOA 4APQA 4PDCE 3OXSA 1OGAA 3MGOA 4ONOA 5C09A 3RWDA 1CD1A 4Z77A 4LCCC 3MRRA 3GMOA 2O5NA 3RTQA 1T0NA 5DDHA 1S8DA 4QRTA 2X4QA 1WBXA 5FDWA 5MEQA 4JQVA 4ZAKA 1T21A 4MJ6A 4EUPA 2F53A 1KPRA 3P77A 4N0UA 3KWWA 4ZUTA 3RL1A 5C0EA 2ZSWA 3FFCA 3GMQA 3UTQA 3MRHA 4JFDA 3MRKA 5J6HA 2CIIA 1OF2A 2OI9A 2AKRA 4PRPA 4IHOA 4D0CA 1QSFA 2FIKA 2F54A 1K8DA 1A9BA 1ZVSA 2BCKA 4O2FA 4ZUVA 1JFMA 2BSTA 3MRNA 5E8NA 5IM7A 3TFKA 2PYEA 1MHEA 3TN0A 4G42A 5C0CA 1Q94A 3MRQA 2VAAA 1I7UA 3FQNA 3VXOA 1W0WA 1X7QA 1M05A 3E6HA 3MRGA 3GMPA 3OV6A 4PV9A 3UTTA 3L3IA 4N8VA 5SWQA 3RWHA 4K71B 3FONA 4PG9A 1A1OA 4PJCA 3SDAA 3H7BA 1XR9A 3QDMA 3H9SA 1S9WA 2XFXA 3TVMA 4JFFA 4N0CA 1LEGA 3PWJA 5HYJA 1QVOA 3ARDA 4IIQC 2YEZA 3FQTA 2BNRA 4I48A 3M17A 3AU1A 4L8DA 4HUXA 4V3EB 1W0VA 3L9RA 3DTXA 2ZOLA 4PJDA 3UBXA 2HN7A 3LN4A 5HGAA 3MREA 2FYYA 3MROA 3H9HA 3MV8A 3QUZA 3V5DA 1MHCA 2GTWA 1WBYA 4K7FA 4PRDA 4U1MA 2BVQA 1FFOA 3BUYA 1ZAGA 2P5EA
chains in the Genus database with same CATH topology
2AV1A 5C07A 2X4RA 1A1NA 5SWSA 1AGDA 1A6ZA 3SDDA 4L9LC 1HOCA 3QEQA 3I6KA 5J1AA 3TPUE 3LKRA 4PREA 1SYVA 3X12A 1XZ0A 4LNRA 1U58A 3RWIA 3VJ6A 5IB3A 3E3QA 4HWZA 3B3IA 4JFOA 4LCYA 3X11A 1QSEA 3KPOA 3RGVC 4PJFA 5D7IA 3D39A 4X6CA 2X4OA 3VRJA 2H26A 1QRNA 3O3DA 5C0DA 3LKOA 3HCVA 3L3JA 4JRYA 3O8XA 3C9NA 1TVHA 4NQEA 3UPRA 3MRJA 3PQYA 3QUKA 4WJ5A 4CVZA 5EO1A 5EOTA 3TF7A 3E6FA 3OX8A 1LEKA 3ROOA 3GMLA 1N2RA 3RWEA 3DBXA 3LN5A 1ZT4A 1T0MA 4X6FA 1AGFA 2AXFA 3GSVA 1S7VA 3V5HA 3VXUA 2X4UA 1DE4A 1UQSA 1KJVA 2P5WA 3BH8A 2NX5A 2D31A 5BJTA 1GZQA 5F9JA 3IT8D 1LQVA 3L3KA 1DDHA 4WW2C 3VWKA 2X4SA 1E27A 4U6XA 3MRPA 1HHGA 4MX7A 4QRQA 4PG2A 5FA4A 3MRIA 4L3CA 4ZFZA 4F7PA 3MRDA 1ZHNA 4NO3A 3MYJA 1KPVA 3KPPA 3VCLA 3VFWA 3PWLA 4F7MA 3ROLA 4CVXA 4G9FA 4GUPA 1T1WA 4S0UC 1IM3A 1HYRC 3MV7A 3CPLA 5INCA 2AV7A 4PV8A 2CIKA 5DEGA 3VXMA 5HHOA 4MQ7A 4X6EA 3T8XA 2J8UA 1FFPA 1AO7A 1TVBA 3QULA 2VLKA 1T1YA 1IM9A 4GKSA 3SDCA 3CVHA 3FT4A 5IEHA 3RWJA 4U1NA 3VRIA 4PRIA 1I7RA 1VACA 3E2HA 1NAMH 4L4VA 3V5KA 3MR9A 4MVBA 3REWA 4JFEA 5E6IC 2F74A 4F7TA 3LKSA 4PGDA 2VABA 1FO0H 3HE7A 4HUVA 1A1MA 4O2CA 3SJVA 4PGCA 3BEVA 2UWEA 3BGMA 3CZFA 4JFQA 4PJ9A 5B39A 3GSWA 1Z5LA 2HJLA 4D0DA 3HUJA 1JGEA 1AGBA 1GZPA 3ERYA 3ILPA 4MXQA 1OSZA 1T22A 3UTSA 3VFVA 3BZEA 4IRJA 5ISZA 3GJFA 1INQA 2GAZA 2CLZA 2OL3H 4O2EA 3MA7A 4WO4A 2V2XA 1S7RA 3SKOA 4PJAA 1JHTA 1QQDA 3GMRA 3FOMA 4NT6A 1L8JA 2PO6A 5DEFA 1S9YA 4U1LA 5H94A 1EXUA 3HLAA 4G8IA 1A9EA 1B0RA 4LHUA 3LKQA 3VFRA 4D0BA 4FTVA 1KBGH 5HGHA 3TA3A 1I1YA 5ENWA 4WWKC 1S7UA 2GUOA 4MNGA 1LDPH 1VGKA 5D5MA 3SKMA 1AGCA 3FOLA 5EU4A 2WY3A 3TO2A 2X4NA 3BVNA 4CW1A 1HSBA 5F1IA 4ELMA 1FZMA 3TZVC 3O3EA 1EEZA 3RUGA 4UQ2A 2JCCA 2HLAA 1UXWA 3BZFA 2X70A 4XXCA 5EU5A 1JPGA 3D18A 4NO2A 3CH1A 4ZUUA 1DUYA 5D7JC 3KPMA 3KYNA 4NQVA 3W39A 3CDGA 4LCWA 3W0WA 4U1KA 3GSUA 3QDJA 1I1AA 1PQZA 1ZHBA 1MWAH 3TIEA 4PJBA 1NANH 3GMNA 3GSNH 3PABA 3O4LA 5E8OA 5HHNA 5BRZA 5HHQA 3I6LD 4JRXA 4Y4FA 5EUOA 1E28A 5GSVA 1EFXA 3LKNA 1ZT1A 4WUUA 4PGBA 3MRMA 3OXRA 3ILQC 3FT3A 2XPGA 5INDA 1MI5A 3KXFA 1ZT7A 3VXPA 3O9WA 1KJMA 4QOKA 5C0FA 3X14A 1T7VA 1CG9A 1OGTA 2FO4A 2VLLA 1T7YA 2E7LE 3KPSA 5B38A 4HX1A 1EEYA 2BVOA 3LKPA 3U0PA 3GMMA 1YPZA 5E8PA 3VXNA 1BQHA 1KPUA 3HPJA 2FZ3A 5C0AA 3KLAA 3BEWA 3GSRA 1TMCA 2HJKA 4PJ5A 4U1JA 4G8GA 5IEKA 4EN3C 4ZUSA 4QRRA 5E00A 1M6OA 2MHAA 1QEWA 3PWUA 4N0FA 3D2UA 1QLFA 3O3BA 4U6YA 5HHPA 1BD2A 4EI5A 1KJ3H 3MRFA 3KPNA 5HGDA 5MEPA 3X13A 1RJYA 1RK1A 3P4NA 4PJXA 5F7DA 3KYOA 2C7UA 4NQXA 1ED3A 3VXSA 4MJ5A 3FQWA 1FG2A 4PGEA 3HE6A 3KPQA 2X4PA 5D2LA 3MRCA 4I4WA 3WLBA 4NO0A 3BXNA 4PJEA 4PR5A 3FT2A 1I7TA 4L8SC 1LK2A 1LP9A 5EO0A 3RWFA 1P7QA 4HKJA 3AM8A 1HHKA 1P4LA 4JQXA 3DXAA 1HHJA 1WBZA 3QUYA 4L3EA 4JFPA 4U1IA 4F7EA 3P73A 4L8CA 3M1BA 1T7ZA 4MNQA 3TBWA 3VFMA 1B3JA 1QR1A 3BHBA 4NSKA 3P9LA 4G59A 4NQCA 3G08A 2GTZA 3TJHA 3JTSA 4NNXA 1KCGC 3QI9A 5C9JA 5EU3A 3MRBA 4L4TA 4L29A 3SCMA 5BXFA 3VXRA 2DYPA 1N3NA 3ARBA 5HHMA 3KPRA 1T1ZA 5C0BA 5SWZA 3L3GA 5IB5A 4QRUA 4NNYA 1YDPA 5BS0A 3TBYA 3TIDA 1P1ZA 5D7LA 5L2JA 4L8BA 1XH3A 4X6DA 4Y2DA 1ZHKA 3WL9A 1FZOA 3P4OA 3S6CA 2V2WA 5FKPA 3D3VA 5IB1A 3MV9A 4PJ7A 4Y16A 3ARFA 2GITA 4E5XA 4PRBA 3T1FA 2GJ6A 1KJ2H 3L3HA 3NFNA 3TBSA 1HSAA 4HS3A 4QRSA 1LD9A 3BP7A 3RWGA 1JGDA 4Y4KA 3BW9A 2GT9A 1DUZA 3PWVA 3AREA 2NW3A 1JF1A 3CC5A 2CLVA 3D25A 1T1XA 4UQ3A 3BWAA 3ECBA 3VFNA 1QO3A 1S7XA 5E9DA 3JVGA 4HUUA 4NO5A 5IB4A 3ES6A 5JHDA 1YN7A 3GSQA 3CCHA 4PJIA 5MERA 1G6RH 1JPFA 4PJGA 5GSRA 3QZWA 2CKBH 5IROA 4QRPA 1G7QA 2ZSVA 3DX8A 5HGBA 3GIVA 3BP4A 2VLJA 3VWJA 5IVXA 4Z76A 1KTLA 3ARGA 4NHUE 1S7QA 2H6PA 4MS8A 2ESVA 2AXGA 1ZSDA 5ACZA 2VE6A 3QFJA 1T7WA 1YN6A 3HG1A 3PWPA 3PWNA 5FA3A 1AKJA 2BSSA 3P9MA 1HHHA 4FFEX 3VFOA 1N59A 1B0GA 1FZJA 1ONQA 3VFPA 3QFDA 1JUFA 3QQ3A 5EFIA 4U1HA 3FQUA 4HV8A 1ZS8A 2AK4A 2ZOKA 3GSOA 4PJ8A 1SYSA 3B6SA 4PRHA 4G9DA 5L2KA 1N5AA 4WU7A 3TBTA 1I4FA 5D2NA 5EU6A 4Z78A 3BO8A 1S7WA 1HHIA 1S7TA 4ZUWA 1UXSA 3LV3A 1BZ9A 3VFUA 4IRSA 5D9SA 3MGTA 4Y4HA 3FRUA 2BVPA 4F7CA 3HAEA 5F1NA 3TO4A 4HUWA 3IXAA 3QUXA 3FTGA 2YPKA 4PJHA 3WS6A 1W72A 1VADA 3SPVA 2BSRA 4V3DB 1R3HA 5J6GA 3DMMA 4N5EA 1CE6A 1T80A 1RJZA 1FZKA 3QDGA 3C8KA 5C0GA 2CLRA 3GSXA 1BIIA 3KPLA 3TBVA 1S7SA 4GKNA 3I6GA 3QQ4A 3SDXA 2YPLA 3DX6A 2Q7YA 2RFXA 2BNQA 3VFTA 3L3DA 4WU5A 3P4MA 3JTCA 3RL2A 4E0RA 4U1SA 3RWCA 1G7PA 3MRLA 1T20A 2VLRA 4PP8C 5IB2A 1T7XA 5C0JA 3RZCA 1AGEA 1NEZA 1S9XA 2A83A 3VFSA 4MJIA 3VH8A 1XR8A 3WS3A 5C0IA 4WDIA 4NQDA 3FQRA 1I1FA 3O3AA 3BH9A 3DX7A 5MENA 1C16A 1ZHLA 5MEOA 5AD0A 1K5NA 1FFNA 4PRNA 5C08A 1JE6A 3FQXA 4PRAA 3WUWA 1RK0A 2X4TA 3JTTA 4G43A 2FWOA 4APQA 4PDCE 3OXSA 1OGAA 3MGOA 4ONOA 5C09A 3RWDA 1CD1A 4Z77A 4LCCC 3MRRA 3GMOA 3RTQA 1T0NA 5DDHA 1S8DA 4QRTA 2X4QA 1WBXA 5FDWA 5MEQA 4JQVA 4ZAKA 1T21A 4MJ6A 4EUPA 2F53A 1KPRA 3P77A 4N0UA 3KWWA 4ZUTA 3RL1A 5C0EA 2ZSWA 3FFCA 3GMQA 3UTQA 3MRHA 4JFDA 3MRKA 5J6HA 2CIIA 1OF2A 2OI9A 2AKRA 4PRPA 4IHOA 4D0CA 1QSFA 2FIKA 2F54A 1K8DA 1A9BA 1ZVSA 2BCKA 4O2FA 4ZUVA 1JFMA 2BSTA 3MRNA 5E8NA 5IM7A 3TFKA 2PYEA 1MHEA 3TN0A 4G42A 5C0CA 1Q94A 3MRQA 2VAAA 1I7UA 3FQNA 3VXOA 1W0WA 1X7QA 1M05A 3E6HA 3MRGA 3GMPA 3OV6A 4PV9A 3UTTA 3L3IA 4N8VA 5SWQA 3RWHA 4K71B 3FONA 4PG9A 1A1OA 4PJCA 3SDAA 3H7BA 1XR9A 3QDMA 3H9SA 1S9WA 2XFXA 3TVMA 4JFFA 4N0CA 1LEGA 3PWJA 5HYJA 1QVOA 3ARDA 4IIQC 2YEZA 3FQTA 2BNRA 4I48A 3M17A 3AU1A 4L8DA 4HUXA 4V3EB 1W0VA 3L9RA 3DTXA 2ZOLA 4PJDA 3UBXA 2HN7A 3LN4A 5HGAA 3MREA 2FYYA 3MROA 3H9HA 3MV8A 3QUZA 3V5DA 1MHCA 2GTWA 1WBYA 4K7FA 4PRDA 4U1MA 2BVQA 1FFOA 3BUYA 1ZAGA 2P5EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AV1 A;  5C07 A;  2X4R A;  1A1N A;  5SWS A;  1AGD A;  1A6Z A;  3SDD A;  4L9L C;  1HOC A;  3QEQ A;  3I6K A;  5J1A A;  3TPU E;  3LKR A;  4PRE A;  1SYV A;  3X12 A;  1XZ0 A;  4LNR A;  1U58 A;  3RWI A;  3VJ6 A;  5IB3 A;  3E3Q A;  4HWZ A;  3B3I A;  4JFO A;  4LCY A;  3X11 A;  1QSE A;  3KPO A;  3RGV C;  4PJF A;  5D7I A;  3D39 A;  4X6C A;  2X4O A;  3VRJ A;  2H26 A;  1QRN A;  3O3D A;  5C0D A;  3LKO A;  3HCV A;  3L3J A;  4JRY A;  3O8X A;  3C9N A;  1TVH A;  4NQE A;  3UPR A;  3MRJ A;  3PQY A;  3QUK A;  4WJ5 A;  4CVZ A;  5EO1 A;  5EOT A;  3TF7 A;  3E6F A;  3OX8 A;  1LEK A;  3ROO A;  3GML A;  1N2R A;  3RWE A;  3DBX A;  3LN5 A;  1ZT4 A;  1T0M A;  4X6F A;  1AGF A;  2AXF A;  3GSV A;  1S7V A;  3V5H A;  3VXU A;  2X4U A;  1DE4 A;  1UQS A;  1KJV A;  2P5W A;  3BH8 A;  2NX5 A;  2D31 A;  5BJT A;  1GZQ A;  5F9J A;  3IT8 D;  1LQV A;  3L3K A;  1DDH A;  4WW2 C;  3VWK A;  2X4S A;  1E27 A;  4U6X A;  3MRP A;  1HHG A;  4MX7 A;  4QRQ A;  4PG2 A;  5FA4 A;  3MRI A;  4L3C A;  4ZFZ A;  4F7P A;  3MRD A;  1ZHN A;  4NO3 A;  3MYJ A;  1KPV A;  3KPP A;  3VCL A;  3VFW A;  3PWL A;  4F7M A;  3ROL A;  4CVX A;  4G9F A;  4GUP A;  1T1W A;  4S0U C;  1IM3 A;  1HYR C;  3MV7 A;  3CPL A;  5INC A;  2AV7 A;  4PV8 A;  2CIK A;  5DEG A;  3VXM A;  5HHO A;  4MQ7 A;  4X6E A;  3T8X A;  2J8U A;  1FFP A;  1AO7 A;  1TVB A;  3QUL A;  2VLK A;  1T1Y A;  1IM9 A;  4GKS A;  3SDC A;  3CVH A;  3FT4 A;  5IEH A;  3RWJ A;  4U1N A;  3VRI A;  4PRI A;  1I7R A;  1VAC A;  3E2H A;  1NAM H;  4L4V A;  3V5K A;  3MR9 A;  4MVB A;  3REW A;  4JFE A;  5E6I C;  2F74 A;  4F7T A;  3LKS A;  4PGD A;  2VAB A;  1FO0 H;  3HE7 A;  4HUV A;  1A1M A;  4O2C A;  3SJV A;  4PGC A;  3BEV A;  2UWE A;  3BGM A;  3CZF A;  4JFQ A;  4PJ9 A;  5B39 A;  3GSW A;  1Z5L A;  2HJL A;  4D0D A;  3HUJ A;  1JGE A;  1AGB A;  1GZP A;  3ERY A;  3ILP A;  4MXQ A;  1OSZ A;  1T22 A;  3UTS A;  3VFV A;  3BZE A;  4IRJ A;  5ISZ A;  3GJF A;  1INQ A;  2GAZ A;  2CLZ A;  2OL3 H;  4O2E A;  3MA7 A;  4WO4 A;  2V2X A;  1S7R A;  3SKO A;  4PJA A;  1JHT A;  1QQD A;  3GMR A;  3FOM A;  4NT6 A;  1L8J A;  2PO6 A;  5DEF A;  1S9Y A;  4U1L A;  5H94 A;  1EXU A;  3HLA A;  4G8I A;  1A9E A;  1B0R A;  4LHU A;  3LKQ A;  3VFR A;  4D0B A;  4FTV A;  1KBG H;  5HGH A;  3TA3 A;  1I1Y A;  5ENW A;  4WWK C;  1S7U A;  2GUO A;  4MNG A;  1LDP H;  1VGK A;  5D5M A;  3SKM A;  1AGC A;  3FOL A;  5EU4 A;  2WY3 A;  3TO2 A;  2X4N A;  3BVN A;  4CW1 A;  1HSB A;  5F1I A;  4ELM A;  1FZM A;  3TZV C;  3O3E A;  1EEZ A;  3RUG A;  4UQ2 A;  2JCC A;  2HLA A;  1UXW A;  3BZF A;  2X70 A;  4XXC A;  5EU5 A;  1JPG A;  3D18 A;  4NO2 A;  3CH1 A;  4ZUU A;  1DUY A;  5D7J C;  3KPM A;  3KYN A;  4NQV A;  3W39 A;  3CDG A;  4LCW A;  3W0W A;  4U1K A;  3GSU A;  3QDJ A;  1I1A A;  1PQZ A;  1ZHB A;  1MWA H;  3TIE A;  4PJB A;  1NAN H;  3GMN A;  3GSN H;  3PAB A;  3O4L A;  5E8O A;  5HHN A;  5BRZ A;  5HHQ A;  3I6L D;  4JRX A;  4Y4F A;  5EUO A;  1E28 A;  5GSV A;  1EFX A;  3LKN A;  1ZT1 A;  4WUU A;  4PGB A;  3MRM A;  3OXR A;  3ILQ C;  3FT3 A;  2XPG A;  5IND A;  1MI5 A;  3KXF A;  1ZT7 A;  3VXP A;  3O9W A;  1KJM A;  4QOK A;  5C0F A;  3X14 A;  1T7V A;  1CG9 A;  1OGT A;  2FO4 A;  2VLL A;  1T7Y A;  2E7L E;  3KPS A;  5B38 A;  4HX1 A;  1EEY A;  2BVO A;  3LKP A;  3U0P A;  3GMM A;  1YPZ A;  5E8P A;  3VXN A;  1BQH A;  1KPU A;  3HPJ A;  2FZ3 A;  5C0A A;  3KLA A;  3BEW A;  3GSR A;  1TMC A;  2HJK A;  4PJ5 A;  4U1J A;  4G8G A;  5IEK A;  4EN3 C;  4ZUS A;  4QRR A;  5E00 A;  1M6O A;  2MHA A;  1QEW A;  3PWU A;  4N0F A;  3D2U A;  1QLF A;  3O3B A;  4U6Y A;  5HHP A;  1BD2 A;  4EI5 A;  1KJ3 H;  3MRF A;  3KPN A;  5HGD A;  5MEP A;  3X13 A;  1RJY A;  1RK1 A;  3P4N A;  4PJX A;  5F7D A;  3KYO A;  2C7U A;  4NQX A;  1ED3 A;  3VXS A;  4MJ5 A;  3FQW A;  1FG2 A;  4PGE A;  3HE6 A;  3KPQ A;  2X4P A;  5D2L A;  3MRC A;  4I4W A;  3WLB A;  4NO0 A;  3BXN A;  4PJE A;  4PR5 A;  3FT2 A;  1I7T A;  4L8S C;  1LK2 A;  1LP9 A;  5EO0 A;  3RWF A;  1P7Q A;  4HKJ A;  3AM8 A;  1HHK A;  1P4L A;  4JQX A;  3DXA A;  1HHJ A;  1WBZ A;  3QUY A;  4L3E A;  4JFP A;  4U1I A;  4F7E A;  3P73 A;  4L8C A;  3M1B A;  1T7Z A;  4MNQ A;  3TBW A;  3VFM A;  1B3J A;  1QR1 A;  3BHB A;  4NSK A;  3P9L A;  4G59 A;  4NQC A;  3G08 A;  2GTZ A;  3TJH A;  3JTS A;  4NNX A;  1KCG C;  3QI9 A;  5C9J A;  5EU3 A;  3MRB A;  4L4T A;  4L29 A;  3SCM A;  5BXF A;  3VXR A;  2DYP A;  1N3N A;  3ARB A;  5HHM A;  3KPR A;  1T1Z A;  5C0B A;  5SWZ A;  3L3G A;  5IB5 A;  4QRU A;  4NNY A;  1YDP A;  5BS0 A;  3TBY A;  3TID A;  1P1Z A;  5D7L A;  5L2J A;  4L8B A;  1XH3 A;  4X6D A;  4Y2D A;  1ZHK A;  3WL9 A;  1FZO A;  3P4O A;  3S6C A;  2V2W A;  5FKP A;  3D3V A;  5IB1 A;  3MV9 A;  4PJ7 A;  4Y16 A;  3ARF A;  2GIT A;  4E5X A;  4PRB A;  3T1F A;  2GJ6 A;  1KJ2 H;  3L3H A;  3NFN A;  3TBS A;  1HSA A;  4HS3 A;  4QRS A;  1LD9 A;  3BP7 A;  3RWG A;  1JGD A;  4Y4K A;  3BW9 A;  2GT9 A;  1DUZ A;  3PWV A;  3ARE A;  2NW3 A;  1JF1 A;  3CC5 A;  2CLV A;  3D25 A;  1T1X A;  4UQ3 A;  3BWA A;  3ECB A;  3VFN A;  1QO3 A;  1S7X A;  5E9D A;  3JVG A;  4HUU A;  4NO5 A;  5IB4 A;  3ES6 A;  5JHD A;  1YN7 A;  3GSQ A;  3CCH A;  4PJI A;  5MER A;  1G6R H;  1JPF A;  4PJG A;  5GSR A;  3QZW A;  2CKB H;  5IRO A;  4QRP A;  1G7Q A;  2ZSV A;  3DX8 A;  5HGB A;  3GIV A;  3BP4 A;  2VLJ A;  3VWJ A;  5IVX A;  4Z76 A;  1KTL A;  3ARG A;  4NHU E;  1S7Q A;  2H6P A;  4MS8 A;  2ESV A;  2AXG A;  1ZSD A;  5ACZ A;  2VE6 A;  3QFJ A;  1T7W A;  1YN6 A;  3HG1 A;  3PWP A;  3PWN A;  5FA3 A;  1AKJ A;  2BSS A;  3P9M A;  1HHH A;  4FFE X;  3VFO A;  1N59 A;  1B0G A;  1FZJ A;  1ONQ A;  3VFP A;  3QFD A;  1JUF A;  3QQ3 A;  5EFI A;  4U1H A;  3FQU A;  4HV8 A;  1ZS8 A;  2AK4 A;  2ZOK A;  3GSO A;  4PJ8 A;  1SYS A;  3B6S A;  4PRH A;  4G9D A;  5L2K A;  1N5A A;  4WU7 A;  3TBT A;  1I4F A;  5D2N A;  5EU6 A;  4Z78 A;  3BO8 A;  1S7W A;  1HHI A;  1S7T A;  4ZUW A;  1UXS A;  3LV3 A;  1BZ9 A;  3VFU A;  4IRS A;  5D9S A;  3MGT A;  4Y4H A;  3FRU A;  2BVP A;  4F7C A;  3HAE A;  5F1N A;  3TO4 A;  4HUW A;  3IXA A;  3QUX A;  3FTG A;  2YPK A;  4PJH A;  3WS6 A;  1W72 A;  1VAD A;  3SPV A;  2BSR A;  4V3D B;  1R3H A;  5J6G A;  3DMM A;  4N5E A;  1CE6 A;  1T80 A;  1RJZ A;  1FZK A;  3QDG A;  3C8K A;  5C0G A;  2CLR A;  3GSX A;  1BII A;  3KPL A;  3TBV A;  1S7S A;  4GKN A;  3I6G A;  3QQ4 A;  3SDX A;  2YPL A;  3DX6 A;  2Q7Y A;  2RFX A;  2BNQ A;  3VFT A;  3L3D A;  4WU5 A;  3P4M A;  3JTC A;  3RL2 A;  4E0R A;  4U1S A;  3RWC A;  1G7P A;  3MRL A;  1T20 A;  2VLR A;  4PP8 C;  5IB2 A;  1T7X A;  5C0J A;  3RZC A;  1AGE A;  1NEZ A;  1S9X A;  2A83 A;  3VFS A;  4MJI A;  3VH8 A;  1XR8 A;  3WS3 A;  5C0I A;  4WDI A;  4NQD A;  3FQR A;  1I1F A;  3O3A A;  3BH9 A;  3DX7 A;  5MEN A;  1C16 A;  1ZHL A;  5MEO A;  5AD0 A;  1K5N A;  1FFN A;  4PRN A;  5C08 A;  1JE6 A;  3FQX A;  4PRA A;  3WUW A;  1RK0 A;  2X4T A;  3JTT A;  4G43 A;  2FWO A;  4APQ A;  4PDC E;  3OXS A;  1OGA A;  3MGO A;  4ONO A;  5C09 A;  3RWD A;  1CD1 A;  4Z77 A;  4LCC C;  3MRR A;  3GMO A;  3RTQ A;  1T0N A;  5DDH A;  1S8D A;  4QRT A;  2X4Q A;  1WBX A;  5FDW A;  5MEQ A;  4JQV A;  4ZAK A;  1T21 A;  4MJ6 A;  4EUP A;  2F53 A;  1KPR A;  3P77 A;  4N0U A;  3KWW A;  4ZUT A;  3RL1 A;  5C0E A;  2ZSW A;  3FFC A;  3GMQ A;  3UTQ A;  3MRH A;  4JFD A;  3MRK A;  5J6H A;  2CII A;  1OF2 A;  2OI9 A;  2AKR A;  4PRP A;  4IHO A;  4D0C A;  1QSF A;  2FIK A;  2F54 A;  1K8D A;  1A9B A;  1ZVS A;  2BCK A;  4O2F A;  4ZUV A;  1JFM A;  2BST A;  3MRN A;  5E8N A;  5IM7 A;  3TFK A;  2PYE A;  1MHE A;  3TN0 A;  4G42 A;  5C0C A;  1Q94 A;  3MRQ A;  2VAA A;  1I7U A;  3FQN A;  3VXO A;  1W0W A;  1X7Q A;  1M05 A;  3E6H A;  3MRG A;  3GMP A;  3OV6 A;  4PV9 A;  3UTT A;  3L3I A;  4N8V A;  5SWQ A;  3RWH A;  4K71 B;  3FON A;  4PG9 A;  1A1O A;  4PJC A;  3SDA A;  3H7B A;  1XR9 A;  3QDM A;  3H9S A;  1S9W A;  2XFX A;  3TVM A;  4JFF A;  4N0C A;  1LEG A;  3PWJ A;  5HYJ A;  1QVO A;  3ARD A;  4IIQ C;  2YEZ A;  3FQT A;  2BNR A;  4I48 A;  3M17 A;  3AU1 A;  4L8D A;  4HUX A;  4V3E B;  1W0V A;  3L9R A;  3DTX A;  2ZOL A;  4PJD A;  3UBX A;  2HN7 A;  3LN4 A;  5HGA A;  3MRE A;  2FYY A;  3MRO A;  3H9H A;  3MV8 A;  3QUZ A;  3V5D A;  1MHC A;  2GTW A;  1WBY A;  4K7F A;  4PRD A;  4U1M A;  2BVQ A;  1FFO A;  3BUY A;  1ZAG A;  2P5E A; 
#chains in the Genus database with same CATH topology
 2AV1 A;  5C07 A;  2X4R A;  1A1N A;  5SWS A;  1AGD A;  1A6Z A;  3SDD A;  4L9L C;  1HOC A;  3QEQ A;  3I6K A;  5J1A A;  3TPU E;  3LKR A;  4PRE A;  1SYV A;  3X12 A;  1XZ0 A;  4LNR A;  1U58 A;  3RWI A;  3VJ6 A;  5IB3 A;  3E3Q A;  4HWZ A;  3B3I A;  4JFO A;  4LCY A;  3X11 A;  1QSE A;  3KPO A;  3RGV C;  4PJF A;  5D7I A;  3D39 A;  4X6C A;  2X4O A;  3VRJ A;  2H26 A;  4G59 C;  1QRN A;  3O3D A;  5C0D A;  3LKO A;  3HCV A;  3L3J A;  4JRY A;  3O8X A;  3C9N A;  1TVH A;  4NQE A;  3UPR A;  3MRJ A;  3PQY A;  3QUK A;  4WJ5 A;  4CVZ A;  5EO1 A;  5EOT A;  3TF7 A;  3E6F A;  3OX8 A;  1LEK A;  3ROO A;  3GML A;  1N2R A;  3RWE A;  3DBX A;  3LN5 A;  1ZT4 A;  1T0M A;  4X6F A;  1AGF A;  2AXF A;  3GSV A;  1S7V A;  3V5H A;  3VXU A;  2X4U A;  1DE4 A;  1UQS A;  1KJV A;  2P5W A;  3BH8 A;  2NX5 A;  4JO8 A;  2D31 A;  5BJT A;  1GZQ A;  5F9J A;  3IT8 D;  1LQV A;  3L3K A;  1DDH A;  4WW2 C;  3VWK A;  2X4S A;  1E27 A;  4U6X A;  3MRP A;  1HHG A;  4MX7 A;  4QRQ A;  4PG2 A;  5FA4 A;  3MRI A;  4L3C A;  4ZFZ A;  4F7P A;  3MRD A;  1ZHN A;  4NO3 A;  3MYJ A;  1KPV A;  3KPP A;  3VCL A;  3VFW A;  3PWL A;  4F7M A;  3ROL A;  4CVX A;  4G9F A;  4GUP A;  1T1W A;  4S0U C;  1IM3 A;  1HYR C;  3MV7 A;  3CPL A;  5INC A;  2AV7 A;  4PV8 A;  2CIK A;  5DEG A;  3VXM A;  5HHO A;  4MQ7 A;  4X6E A;  3T8X A;  2J8U A;  1FFP A;  1AO7 A;  1TVB A;  3QUL A;  2VLK A;  1T1Y A;  1IM9 A;  4GKS A;  3SDC A;  3CVH A;  3FT4 A;  5IEH A;  3RWJ A;  4U1N A;  3VRI A;  4PRI A;  1I7R A;  1VAC A;  3E2H A;  1NAM H;  4L4V A;  3V5K A;  3MR9 A;  4MVB A;  3REW A;  4JFE A;  5E6I C;  2F74 A;  4F7T A;  3LKS A;  4PGD A;  2VAB A;  1FO0 H;  3HE7 A;  4HUV A;  1A1M A;  4O2C A;  3SJV A;  4PGC A;  3BEV A;  2UWE A;  3BGM A;  3CZF A;  4JFQ A;  4PJ9 A;  5B39 A;  3GSW A;  1Z5L A;  2HJL A;  4D0D A;  3HUJ A;  1JGE A;  1AGB A;  1GZP A;  3ERY A;  3ILP A;  4MXQ A;  1OSZ A;  1T22 A;  3UTS A;  3VFV A;  3BZE A;  4IRJ A;  5ISZ A;  2NYK A;  3GJF A;  1INQ A;  2GAZ A;  2CLZ A;  2OL3 H;  4O2E A;  3MA7 A;  4WO4 A;  2V2X A;  1S7R A;  3SKO A;  4PJA A;  1JHT A;  1QQD A;  3GMR A;  3FOM A;  4NT6 A;  1L8J A;  2PO6 A;  5DEF A;  1S9Y A;  4U1L A;  5H94 A;  1EXU A;  3HLA A;  4G8I A;  1A9E A;  1B0R A;  4LHU A;  3LKQ A;  3VFR A;  4D0B A;  4FTV A;  1KBG H;  5HGH A;  3TA3 A;  1I1Y A;  5ENW A;  4WWK C;  1S7U A;  2GUO A;  4MNG A;  1LDP H;  1VGK A;  5D5M A;  3SKM A;  1AGC A;  3FOL A;  5EU4 A;  2WY3 A;  3TO2 A;  2X4N A;  3BVN A;  4CW1 A;  1HSB A;  5F1I A;  4ELM A;  1FZM A;  3TZV C;  3O3E A;  1EEZ A;  3RUG A;  4UQ2 A;  2JCC A;  2HLA A;  1UXW A;  3BZF A;  2X70 A;  4XXC A;  5EU5 A;  1JPG A;  3D18 A;  4NO2 A;  4BKW A;  3CH1 A;  4ZUU A;  1DUY A;  5D7J C;  3KPM A;  3KYN A;  4NQV A;  3W39 A;  3CDG A;  4LCW A;  3W0W A;  4U1K A;  3GSU A;  3QDJ A;  1I1A A;  1PQZ A;  1ZHB A;  1MWA H;  3TIE A;  4PJB A;  1NAN H;  3GMN A;  3GSN H;  3PAB A;  3O4L A;  5E8O A;  5HHN A;  5BRZ A;  5HHQ A;  3I6L D;  4JRX A;  4Y4F A;  5EUO A;  1E28 A;  5GSV A;  1EFX A;  3LKN A;  1ZT1 A;  4WUU A;  4PGB A;  3MRM A;  3OXR A;  3ILQ C;  3FT3 A;  2XPG A;  5IND A;  1MI5 A;  3KXF A;  1ZT7 A;  3VXP A;  3O9W A;  1KJM A;  4QOK A;  5C0F A;  3X14 A;  1T7V A;  1CG9 A;  1OGT A;  2FO4 A;  2VLL A;  1T7Y A;  2E7L E;  3KPS A;  5B38 A;  4HX1 A;  1EEY A;  2BVO A;  3LKP A;  3U0P A;  3GMM A;  1YPZ A;  5E8P A;  3I0T A;  3VXN A;  1BQH A;  1KPU A;  3HPJ A;  2FZ3 A;  5C0A A;  3KLA A;  3BEW A;  3GSR A;  1TMC A;  2HJK A;  4PJ5 A;  4U1J A;  4G8G A;  5IEK A;  4EN3 C;  4ZUS A;  4QRR A;  5E00 A;  1M6O A;  2MHA A;  1QEW A;  3PWU A;  4N0F A;  3D2U A;  1QLF A;  3O3B A;  4U6Y A;  5HHP A;  1BD2 A;  4EI5 A;  1KJ3 H;  3MRF A;  3KPN A;  5HGD A;  5MEP A;  3X13 A;  1RJY A;  1RK1 A;  3P4N A;  4PJX A;  5F7D A;  3KYO A;  2C7U A;  4NQX A;  1ED3 A;  3VXS A;  4MJ5 A;  3FQW A;  1FG2 A;  4PGE A;  3HE6 A;  3KPQ A;  2X4P A;  5D2L A;  3MRC A;  4I4W A;  3WLB A;  4NO0 A;  3BXN A;  4PJE A;  4PR5 A;  3FT2 A;  1I7T A;  4L8S C;  1LK2 A;  1LP9 A;  5EO0 A;  3RWF A;  1P7Q A;  4HKJ A;  3AM8 A;  1HHK A;  1P4L A;  4JQX A;  3DXA A;  1HHJ A;  1WBZ A;  3QUY A;  4L3E A;  4JFP A;  4U1I A;  4F7E A;  3P73 A;  4L8C A;  3M1B A;  1T7Z A;  4MNQ A;  3TBW A;  3VFM A;  1B3J A;  1QR1 A;  3BHB A;  4NSK A;  3P9L A;  4G59 A;  4NQC A;  3G08 A;  2GTZ A;  3TJH A;  3JTS A;  4NNX A;  1KCG C;  3QI9 A;  5C9J A;  5EU3 A;  3MRB A;  4L4T A;  4L29 A;  3SCM A;  5BXF A;  3VXR A;  2DYP A;  1N3N A;  3ARB A;  5HHM A;  3KPR A;  1T1Z A;  5C0B A;  5SWZ A;  3L3G A;  5IB5 A;  4QRU A;  4NNY A;  1YDP A;  5BS0 A;  3TBY A;  3TID A;  1P1Z A;  5D7L A;  5L2J A;  4L8B A;  1XH3 A;  4X6D A;  4Y2D A;  1ZHK A;  3WL9 A;  1FZO A;  3P4O A;  3S6C A;  2V2W A;  5FKP A;  3D3V A;  5IB1 A;  3MV9 A;  4PJ7 A;  4Y16 A;  3ARF A;  2GIT A;  4E5X A;  4PRB A;  3T1F A;  2GJ6 A;  1KJ2 H;  3L3H A;  3NFN A;  3TBS A;  1HSA A;  4HS3 A;  4QRS A;  1LD9 A;  3BP7 A;  3RWG A;  1JGD A;  4Y4K A;  3BW9 A;  2GT9 A;  1DUZ A;  3PWV A;  3ARE A;  2NW3 A;  1JF1 A;  3CC5 A;  2CLV A;  3D25 A;  1T1X A;  4UQ3 A;  3BWA A;  3ECB A;  3VFN A;  1QO3 A;  1S7X A;  5E9D A;  3JVG A;  4HUU A;  4NO5 A;  5IB4 A;  3ES6 A;  5JHD A;  1YN7 A;  3GSQ A;  3CCH A;  4PJI A;  5MER A;  1G6R H;  1JPF A;  4PJG A;  5GSR A;  3QZW A;  2CKB H;  2IA1 A;  5IRO A;  4QRP A;  1G7Q A;  2ZSV A;  3DX8 A;  5HGB A;  3GIV A;  3BP4 A;  2VLJ A;  3VWJ A;  5IVX A;  4Z76 A;  1KTL A;  3ARG A;  4NHU E;  1S7Q A;  2H6P A;  4MS8 A;  2ESV A;  2AXG A;  1ZSD A;  5ACZ A;  2VE6 A;  3QFJ A;  1T7W A;  1YN6 A;  3HG1 A;  3PWP A;  3PWN A;  5FA3 A;  1AKJ A;  2BSS A;  3P9M A;  1HHH A;  4FFE X;  3VFO A;  1N59 A;  1B0G A;  1FZJ A;  1ONQ A;  3VFP A;  3QFD A;  1JUF A;  3QQ3 A;  5EFI A;  4U1H A;  3FQU A;  4HV8 A;  1ZS8 A;  2AK4 A;  2ZOK A;  3GSO A;  4PJ8 A;  1SYS A;  3B6S A;  4PRH A;  4G9D A;  5L2K A;  1N5A A;  4WU7 A;  3TBT A;  1I4F A;  5D2N A;  5EU6 A;  4Z78 A;  3BO8 A;  1S7W A;  1HHI A;  1S7T A;  4ZUW A;  1UXS A;  3LV3 A;  1BZ9 A;  3VFU A;  4IRS A;  5D9S A;  3MGT A;  4Y4H A;  3FRU A;  2BVP A;  4F7C A;  3HAE A;  5F1N A;  3TO4 A;  4HUW A;  3IXA A;  3QUX A;  3FTG A;  2YPK A;  4PJH A;  3WS6 A;  1W72 A;  1VAD A;  3SPV A;  2BSR A;  4V3D B;  1R3H A;  5J6G A;  3DMM A;  4N5E A;  1CE6 A;  1T80 A;  1RJZ A;  1FZK A;  3QDG A;  3C8K A;  5C0G A;  2CLR A;  3GSX A;  1BII A;  3KPL A;  3TBV A;  1S7S A;  4GKN A;  3I6G A;  3QQ4 A;  3SDX A;  2YPL A;  3DX6 A;  2Q7Y A;  2RFX A;  2BNQ A;  3VFT A;  3L3D A;  4WU5 A;  3P4M A;  3JTC A;  3RL2 A;  4E0R A;  4U1S A;  3RWC A;  1G7P A;  3MRL A;  1T20 A;  2VLR A;  4PP8 C;  5IB2 A;  1T7X A;  5C0J A;  3RZC A;  1AGE A;  1NEZ A;  1S9X A;  2A83 A;  3VFS A;  4MJI A;  3VH8 A;  1XR8 A;  3WS3 A;  5C0I A;  4WDI A;  4NQD A;  3FQR A;  1I1F A;  3O3A A;  3BH9 A;  3DX7 A;  5MEN A;  1C16 A;  1ZHL A;  5MEO A;  5AD0 A;  1K5N A;  1FFN A;  4PRN A;  5C08 A;  1JE6 A;  3FQX A;  4PRA A;  3WUW A;  1RK0 A;  2X4T A;  3JTT A;  4G43 A;  2FWO A;  4APQ A;  4PDC E;  3OXS A;  1OGA A;  3MGO A;  4ONO A;  5C09 A;  3RWD A;  1CD1 A;  4Z77 A;  4LCC C;  3MRR A;  3GMO A;  2O5N A;  3RTQ A;  1T0N A;  5DDH A;  1S8D A;  4QRT A;  2X4Q A;  1WBX A;  5FDW A;  5MEQ A;  4JQV A;  4ZAK A;  1T21 A;  4MJ6 A;  4EUP A;  2F53 A;  1KPR A;  3P77 A;  4N0U A;  3KWW A;  4ZUT A;  3RL1 A;  5C0E A;  2ZSW A;  3FFC A;  3GMQ A;  3UTQ A;  3MRH A;  4JFD A;  3MRK A;  5J6H A;  2CII A;  1OF2 A;  2OI9 A;  2AKR A;  4PRP A;  4IHO A;  4D0C A;  1QSF A;  2FIK A;  2F54 A;  1K8D A;  1A9B A;  1ZVS A;  2BCK A;  4O2F A;  4ZUV A;  1JFM A;  2BST A;  3MRN A;  5E8N A;  5IM7 A;  3TFK A;  2PYE A;  1MHE A;  3TN0 A;  4G42 A;  5C0C A;  1Q94 A;  3MRQ A;  2VAA A;  1I7U A;  3FQN A;  3VXO A;  1W0W A;  1X7Q A;  1M05 A;  3E6H A;  3MRG A;  3GMP A;  3OV6 A;  4PV9 A;  3UTT A;  3L3I A;  4N8V A;  5SWQ A;  3RWH A;  4K71 B;  3FON A;  4PG9 A;  1A1O A;  4PJC A;  3SDA A;  3H7B A;  1XR9 A;  3QDM A;  3H9S A;  1S9W A;  2XFX A;  3TVM A;  4JFF A;  4N0C A;  1LEG A;  3PWJ A;  5HYJ A;  1QVO A;  3ARD A;  4IIQ C;  2YEZ A;  3FQT A;  2BNR A;  4I48 A;  3M17 A;  3AU1 A;  4L8D A;  4HUX A;  4V3E B;  1W0V A;  3L9R A;  3DTX A;  2ZOL A;  4PJD A;  3UBX A;  2HN7 A;  3LN4 A;  5HGA A;  3MRE A;  2FYY A;  3MRO A;  3H9H A;  3MV8 A;  3QUZ A;  3V5D A;  1MHC A;  2GTW A;  1WBY A;  4K7F A;  4PRD A;  4U1M A;  2BVQ A;  1FFO A;  3BUY A;  1ZAG A;  2P5E A; 
#chains in the Genus database with same CATH homology
 2AV1 A;  5C07 A;  2X4R A;  1A1N A;  5SWS A;  1AGD A;  1A6Z A;  3SDD A;  4L9L C;  1HOC A;  3QEQ A;  3I6K A;  5J1A A;  3TPU E;  3LKR A;  4PRE A;  1SYV A;  3X12 A;  1XZ0 A;  4LNR A;  1U58 A;  3RWI A;  3VJ6 A;  5IB3 A;  3E3Q A;  4HWZ A;  3B3I A;  4JFO A;  4LCY A;  3X11 A;  1QSE A;  3KPO A;  3RGV C;  4PJF A;  5D7I A;  3D39 A;  4X6C A;  2X4O A;  3VRJ A;  2H26 A;  1QRN A;  3O3D A;  5C0D A;  3LKO A;  3HCV A;  3L3J A;  4JRY A;  3O8X A;  3C9N A;  1TVH A;  4NQE A;  3UPR A;  3MRJ A;  3PQY A;  3QUK A;  4WJ5 A;  4CVZ A;  5EO1 A;  5EOT A;  3TF7 A;  3E6F A;  3OX8 A;  1LEK A;  3ROO A;  3GML A;  1N2R A;  3RWE A;  3DBX A;  3LN5 A;  1ZT4 A;  1T0M A;  4X6F A;  1AGF A;  2AXF A;  3GSV A;  1S7V A;  3V5H A;  3VXU A;  2X4U A;  1DE4 A;  1UQS A;  1KJV A;  2P5W A;  3BH8 A;  2NX5 A;  2D31 A;  5BJT A;  1GZQ A;  5F9J A;  3IT8 D;  1LQV A;  3L3K A;  1DDH A;  4WW2 C;  3VWK A;  2X4S A;  1E27 A;  4U6X A;  3MRP A;  1HHG A;  4MX7 A;  4QRQ A;  4PG2 A;  5FA4 A;  3MRI A;  4L3C A;  4ZFZ A;  4F7P A;  3MRD A;  1ZHN A;  4NO3 A;  3MYJ A;  1KPV A;  3KPP A;  3VCL A;  3VFW A;  3PWL A;  4F7M A;  3ROL A;  4CVX A;  4G9F A;  4GUP A;  1T1W A;  4S0U C;  1IM3 A;  1HYR C;  3MV7 A;  3CPL A;  5INC A;  2AV7 A;  4PV8 A;  2CIK A;  5DEG A;  3VXM A;  5HHO A;  4MQ7 A;  4X6E A;  3T8X A;  2J8U A;  1FFP A;  1AO7 A;  1TVB A;  3QUL A;  2VLK A;  1T1Y A;  1IM9 A;  4GKS A;  3SDC A;  3CVH A;  3FT4 A;  5IEH A;  3RWJ A;  4U1N A;  3VRI A;  4PRI A;  1I7R A;  1VAC A;  3E2H A;  1NAM H;  4L4V A;  3V5K A;  3MR9 A;  4MVB A;  3REW A;  4JFE A;  5E6I C;  2F74 A;  4F7T A;  3LKS A;  4PGD A;  2VAB A;  1FO0 H;  3HE7 A;  4HUV A;  1A1M A;  4O2C A;  3SJV A;  4PGC A;  3BEV A;  2UWE A;  3BGM A;  3CZF A;  4JFQ A;  4PJ9 A;  5B39 A;  3GSW A;  1Z5L A;  2HJL A;  4D0D A;  3HUJ A;  1JGE A;  1AGB A;  1GZP A;  3ERY A;  3ILP A;  4MXQ A;  1OSZ A;  1T22 A;  3UTS A;  3VFV A;  3BZE A;  4IRJ A;  5ISZ A;  3GJF A;  1INQ A;  2GAZ A;  2CLZ A;  2OL3 H;  4O2E A;  3MA7 A;  4WO4 A;  2V2X A;  1S7R A;  3SKO A;  4PJA A;  1JHT A;  1QQD A;  3GMR A;  3FOM A;  4NT6 A;  1L8J A;  2PO6 A;  5DEF A;  1S9Y A;  4U1L A;  5H94 A;  1EXU A;  3HLA A;  4G8I A;  1A9E A;  1B0R A;  4LHU A;  3LKQ A;  3VFR A;  4D0B A;  4FTV A;  1KBG H;  5HGH A;  3TA3 A;  1I1Y A;  5ENW A;  4WWK C;  1S7U A;  2GUO A;  4MNG A;  1LDP H;  1VGK A;  5D5M A;  3SKM A;  1AGC A;  3FOL A;  5EU4 A;  2WY3 A;  3TO2 A;  2X4N A;  3BVN A;  4CW1 A;  1HSB A;  5F1I A;  4ELM A;  1FZM A;  3TZV C;  3O3E A;  1EEZ A;  3RUG A;  4UQ2 A;  2JCC A;  2HLA A;  1UXW A;  3BZF A;  2X70 A;  4XXC A;  5EU5 A;  1JPG A;  3D18 A;  4NO2 A;  3CH1 A;  4ZUU A;  1DUY A;  5D7J C;  3KPM A;  3KYN A;  4NQV A;  3W39 A;  3CDG A;  4LCW A;  3W0W A;  4U1K A;  3GSU A;  3QDJ A;  1I1A A;  1PQZ A;  1ZHB A;  1MWA H;  3TIE A;  4PJB A;  1NAN H;  3GMN A;  3GSN H;  3PAB A;  3O4L A;  5E8O A;  5HHN A;  5BRZ A;  5HHQ A;  3I6L D;  4JRX A;  4Y4F A;  5EUO A;  1E28 A;  5GSV A;  1EFX A;  3LKN A;  1ZT1 A;  4WUU A;  4PGB A;  3MRM A;  3OXR A;  3ILQ C;  3FT3 A;  2XPG A;  5IND A;  1MI5 A;  3KXF A;  1ZT7 A;  3VXP A;  3O9W A;  1KJM A;  4QOK A;  5C0F A;  3X14 A;  1T7V A;  1CG9 A;  1OGT A;  2FO4 A;  2VLL A;  1T7Y A;  2E7L E;  3KPS A;  5B38 A;  4HX1 A;  1EEY A;  2BVO A;  3LKP A;  3U0P A;  3GMM A;  1YPZ A;  5E8P A;  3VXN A;  1BQH A;  1KPU A;  3HPJ A;  2FZ3 A;  5C0A A;  3KLA A;  3BEW A;  3GSR A;  1TMC A;  2HJK A;  4PJ5 A;  4U1J A;  4G8G A;  5IEK A;  4EN3 C;  4ZUS A;  4QRR A;  5E00 A;  1M6O A;  2MHA A;  1QEW A;  3PWU A;  4N0F A;  3D2U A;  1QLF A;  3O3B A;  4U6Y A;  5HHP A;  1BD2 A;  4EI5 A;  1KJ3 H;  3MRF A;  3KPN A;  5HGD A;  5MEP A;  3X13 A;  1RJY A;  1RK1 A;  3P4N A;  4PJX A;  5F7D A;  3KYO A;  2C7U A;  4NQX A;  1ED3 A;  3VXS A;  4MJ5 A;  3FQW A;  1FG2 A;  4PGE A;  3HE6 A;  3KPQ A;  2X4P A;  5D2L A;  3MRC A;  4I4W A;  3WLB A;  4NO0 A;  3BXN A;  4PJE A;  4PR5 A;  3FT2 A;  1I7T A;  4L8S C;  1LK2 A;  1LP9 A;  5EO0 A;  3RWF A;  1P7Q A;  4HKJ A;  3AM8 A;  1HHK A;  1P4L A;  4JQX A;  3DXA A;  1HHJ A;  1WBZ A;  3QUY A;  4L3E A;  4JFP A;  4U1I A;  4F7E A;  3P73 A;  4L8C A;  3M1B A;  1T7Z A;  4MNQ A;  3TBW A;  3VFM A;  1B3J A;  1QR1 A;  3BHB A;  4NSK A;  3P9L A;  4G59 A;  4NQC A;  3G08 A;  2GTZ A;  3TJH A;  3JTS A;  4NNX A;  1KCG C;  3QI9 A;  5C9J A;  5EU3 A;  3MRB A;  4L4T A;  4L29 A;  3SCM A;  5BXF A;  3VXR A;  2DYP A;  1N3N A;  3ARB A;  5HHM A;  3KPR A;  1T1Z A;  5C0B A;  5SWZ A;  3L3G A;  5IB5 A;  4QRU A;  4NNY A;  1YDP A;  5BS0 A;  3TBY A;  3TID A;  1P1Z A;  5D7L A;  5L2J A;  4L8B A;  1XH3 A;  4X6D A;  4Y2D A;  1ZHK A;  3WL9 A;  1FZO A;  3P4O A;  3S6C A;  2V2W A;  5FKP A;  3D3V A;  5IB1 A;  3MV9 A;  4PJ7 A;  4Y16 A;  3ARF A;  2GIT A;  4E5X A;  4PRB A;  3T1F A;  2GJ6 A;  1KJ2 H;  3L3H A;  3NFN A;  3TBS A;  1HSA A;  4HS3 A;  4QRS A;  1LD9 A;  3BP7 A;  3RWG A;  1JGD A;  4Y4K A;  3BW9 A;  2GT9 A;  1DUZ A;  3PWV A;  3ARE A;  2NW3 A;  1JF1 A;  3CC5 A;  2CLV A;  3D25 A;  1T1X A;  4UQ3 A;  3BWA A;  3ECB A;  3VFN A;  1QO3 A;  1S7X A;  5E9D A;  3JVG A;  4HUU A;  4NO5 A;  5IB4 A;  3ES6 A;  5JHD A;  1YN7 A;  3GSQ A;  3CCH A;  4PJI A;  5MER A;  1G6R H;  1JPF A;  4PJG A;  5GSR A;  3QZW A;  2CKB H;  5IRO A;  4QRP A;  1G7Q A;  2ZSV A;  3DX8 A;  5HGB A;  3GIV A;  3BP4 A;  2VLJ A;  3VWJ A;  5IVX A;  4Z76 A;  1KTL A;  3ARG A;  4NHU E;  1S7Q A;  2H6P A;  4MS8 A;  2ESV A;  2AXG A;  1ZSD A;  5ACZ A;  2VE6 A;  3QFJ A;  1T7W A;  1YN6 A;  3HG1 A;  3PWP A;  3PWN A;  5FA3 A;  1AKJ A;  2BSS A;  3P9M A;  1HHH A;  4FFE X;  3VFO A;  1N59 A;  1B0G A;  1FZJ A;  1ONQ A;  3VFP A;  3QFD A;  1JUF A;  3QQ3 A;  5EFI A;  4U1H A;  3FQU A;  4HV8 A;  1ZS8 A;  2AK4 A;  2ZOK A;  3GSO A;  4PJ8 A;  1SYS A;  3B6S A;  4PRH A;  4G9D A;  5L2K A;  1N5A A;  4WU7 A;  3TBT A;  1I4F A;  5D2N A;  5EU6 A;  4Z78 A;  3BO8 A;  1S7W A;  1HHI A;  1S7T A;  4ZUW A;  1UXS A;  3LV3 A;  1BZ9 A;  3VFU A;  4IRS A;  5D9S A;  3MGT A;  4Y4H A;  3FRU A;  2BVP A;  4F7C A;  3HAE A;  5F1N A;  3TO4 A;  4HUW A;  3IXA A;  3QUX A;  3FTG A;  2YPK A;  4PJH A;  3WS6 A;  1W72 A;  1VAD A;  3SPV A;  2BSR A;  4V3D B;  1R3H A;  5J6G A;  3DMM A;  4N5E A;  1CE6 A;  1T80 A;  1RJZ A;  1FZK A;  3QDG A;  3C8K A;  5C0G A;  2CLR A;  3GSX A;  1BII A;  3KPL A;  3TBV A;  1S7S A;  4GKN A;  3I6G A;  3QQ4 A;  3SDX A;  2YPL A;  3DX6 A;  2Q7Y A;  2RFX A;  2BNQ A;  3VFT A;  3L3D A;  4WU5 A;  3P4M A;  3JTC A;  3RL2 A;  4E0R A;  4U1S A;  3RWC A;  1G7P A;  3MRL A;  1T20 A;  2VLR A;  4PP8 C;  5IB2 A;  1T7X A;  5C0J A;  3RZC A;  1AGE A;  1NEZ A;  1S9X A;  2A83 A;  3VFS A;  4MJI A;  3VH8 A;  1XR8 A;  3WS3 A;  5C0I A;  4WDI A;  4NQD A;  3FQR A;  1I1F A;  3O3A A;  3BH9 A;  3DX7 A;  5MEN A;  1C16 A;  1ZHL A;  5MEO A;  5AD0 A;  1K5N A;  1FFN A;  4PRN A;  5C08 A;  1JE6 A;  3FQX A;  4PRA A;  3WUW A;  1RK0 A;  2X4T A;  3JTT A;  4G43 A;  2FWO A;  4APQ A;  4PDC E;  3OXS A;  1OGA A;  3MGO A;  4ONO A;  5C09 A;  3RWD A;  1CD1 A;  4Z77 A;  4LCC C;  3MRR A;  3GMO A;  3RTQ A;  1T0N A;  5DDH A;  1S8D A;  4QRT A;  2X4Q A;  1WBX A;  5FDW A;  5MEQ A;  4JQV A;  4ZAK A;  1T21 A;  4MJ6 A;  4EUP A;  2F53 A;  1KPR A;  3P77 A;  4N0U A;  3KWW A;  4ZUT A;  3RL1 A;  5C0E A;  2ZSW A;  3FFC A;  3GMQ A;  3UTQ A;  3MRH A;  4JFD A;  3MRK A;  5J6H A;  2CII A;  1OF2 A;  2OI9 A;  2AKR A;  4PRP A;  4IHO A;  4D0C A;  1QSF A;  2FIK A;  2F54 A;  1K8D A;  1A9B A;  1ZVS A;  2BCK A;  4O2F A;  4ZUV A;  1JFM A;  2BST A;  3MRN A;  5E8N A;  5IM7 A;  3TFK A;  2PYE A;  1MHE A;  3TN0 A;  4G42 A;  5C0C A;  1Q94 A;  3MRQ A;  2VAA A;  1I7U A;  3FQN A;  3VXO A;  1W0W A;  1X7Q A;  1M05 A;  3E6H A;  3MRG A;  3GMP A;  3OV6 A;  4PV9 A;  3UTT A;  3L3I A;  4N8V A;  5SWQ A;  3RWH A;  4K71 B;  3FON A;  4PG9 A;  1A1O A;  4PJC A;  3SDA A;  3H7B A;  1XR9 A;  3QDM A;  3H9S A;  1S9W A;  2XFX A;  3TVM A;  4JFF A;  4N0C A;  1LEG A;  3PWJ A;  5HYJ A;  1QVO A;  3ARD A;  4IIQ C;  2YEZ A;  3FQT A;  2BNR A;  4I48 A;  3M17 A;  3AU1 A;  4L8D A;  4HUX A;  4V3E B;  1W0V A;  3L9R A;  3DTX A;  2ZOL A;  4PJD A;  3UBX A;  2HN7 A;  3LN4 A;  5HGA A;  3MRE A;  2FYY A;  3MRO A;  3H9H A;  3MV8 A;  3QUZ A;  3V5D A;  1MHC A;  2GTW A;  1WBY A;  4K7F A;  4PRD A;  4U1M A;  2BVQ A;  1FFO A;  3BUY A;  1ZAG A;  2P5E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...