1N05A

Crystal structure of schizosaccharomyces pombe riboflavin kinase reveals a novel atp and riboflavin binding fold
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
153
structure length
142
Chain Sequence
PEIVGPEKVQSPYPIRFEGKVVHGFGRGSKELGIPTANISEDAIQELLRYRDSGVYFGYAMVQKRVFPMVMSVSAEVHLIERQGEDFYEEIMRVIVLGYIRPELNYAGLDKLIEDIHTDIRVALNSMDRPSYSSYKKDPFFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Schizosaccharomyces pombe Riboflavin Kinase Reveals a Novel ATP and Riboflavin Binding Fold
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Transferase
molecule keywords putative Riboflavin kinase
total genus 35
structure length 142
sequence length 153
ec nomenclature ec 2.7.1.26: Riboflavin kinase.
pdb deposition date 2002-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01687 Flavokinase Riboflavin kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.30 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Riboflavin kinase-like 1n05A00
3ZUGA 3OP1A 2VBSA 5TRDA 1MRZA 5FO0A 4UZFA 1T6YA 4UZEA 3CTAA 1NB0A 5FNZA 5A8AA 2P3MA 2VBUA 1N08A 1S4MA 3BNWA 1T6ZA 1NB9A 5FO1A 1Q9SA 5A89A 1T6XA 2X0KA 1N07A 2VBTA 5A88A 1P4MA 2I1LA 2OYNA 1N06A 1N05A 2VBVA
chains in the Genus database with same CATH superfamily
2JJ2A 2PLFA 4X07A 3W5VA 3CCVB 3CP2A 2NPFA 1VQ6B 4UAJA 5IK2A 3A35A 2OTLB 4XQFA 5E6TA 3U6BA 4P2NA 4P25A 3KL9A 4LBYA 2WSSA 1T5EA 1TTTA 1A8PA 1EP3B 4TT3A 3CCSB 3ZBTA 5IYNA 1VQ4B 3AVUA 1JNYA 1E64A 1ZM2A 2QDXA 5JBQA 1E1QA 1S0UA 2C5HA 2DCUA 2DIEA 1R5BA 2OTJB 2F4NA 2ZZQA 4P6VF 2F1LA 5F4MA 3RY8A 4KKSA 5A88A 1V0EA 2VZLA 1TUIA 3WBJA 1QUEA 1WDTA 4FK8A 4MYTA 5TR9A 4XONA 4ZCIA 1Y0YA 3R6KA 1EXMA 1Y0RA 4N3GA 3VNVA 4XL9A 1VHOA 1YHQB 4Z1MA 3MCAA 1DG1G 1QVFB 3I56B 3E20A 1WP6A 2YWHA 3GVKA 4ZGQB 4B43A 2WR8A 4TKOB 2WJYA 3CPWB 1N07A 3ZBUA 4P12A 4LBZA 1FRQA 4U9UA 3CCLB 2W6IA 1OB2A 1K73D 1XB2A 1YJ9B 4X7DA 1WPCA 2KVOA 1N0VC 2ZBUA 3CTAA 4YEJA 3ONUA 2QEXB 2HMAA 3FJOA 4X06A 4YALA 4RLZA 1BX0A 4RDKA 4XN3A 3LVBA 5KSWB 1OB5A 1IJEA 1OGIA 3H94A 2BGJA 2BMWA 4NCNA 2CC2A 3I1FA 1QGYA 3ZIAA 1AIPA 2B7CA 4X8IA 1BQEA 4YAOA 2XOKA 2YWEA 4DK1A 2XEXA 2OYNA 3WNBA 3ZC3A 3LNNA 4PC1A 3AVYA 2GJKA 2D3NA 2ZZGA 1KJZA 2Q6KA 4WZLA 5B6IA 4XLEA 3I55B 2BN4A 3LQ6A 2DERA 1NB0A 1UD5A 3VR6A 4CQJA 4G7XA 1BLIA 3U6KA 4OOXA 1DARA 3GIRA 4Z4TA 3W5HA 3CC2B 3OZUA 3VO2A 1EWYA 4F7DA 4ZV4A 4NNJA 5H5JA 3PVDA 2RC5A 4G5GA 5DN6A 2X3UA 2HDNB 2WZNA 3R6JA 4B3GA 1TVCA 4B3XA 1KK0A 4OPSA 1V5VA 4R71A 2JN9A 1KZLA 2EIXA 4P1VA 3PA1A 1CNFA 2VBVA 4PC3A 3QSYA 2ZZFA 2XNCA 2WJVA 4DNRB 1M90D 2BF4A 1EFCA 4UZEA 3H9NA 2HLDA 3J81k 2YWFA 5FL7A 1U2RA 3E1YE 3WBKA 3BY1A 4QVAA 1ZM4A 2QTLA 4LBWA 2VJIA 2C77A 3BCDA 4AF7A 3CP8A 1QG0A 2V7QA 3CCQB 5KNLA 4UZUA 2JDIA 1E3ZA 3CCRB 1JA0A 1I8DA 2ZXIA 3MMPA 3Q6QA 3QE2A 4PC2A 5HXBA 2B5OA 2OBSA 5IYQA 3G05A 4X7EA 1Q86D 1UD6A 3GQBA 2DOGA 3GSIA 3CC7B 3GVJA 2VBSA 4PAAA 2GPJA 1E62A 4TMWA 1GAQA 1I18A 1G7RA 5L46A 1E79A 1PJ7A 1D8TA 4PC7A 1KQSB 3HAGA 2V7UA 3DDYA 4X7CA 3FPPA 2AHOA 1Q9SA 2YWGA 2BV3A 3OZWA 1G7CA 3CXCB 1FRNA 4ACAA 1GVHA 4L8JA 3BCFA 4K1XA 2OK7A 3OPOA 3SKBA 5FA6A 3CCUB 4Y9UA 1M1KD 4XM3A 4B44A 1QX4A 5DSZA 4ZCMA 1JJ2B 5CDFA 4Z4ZA 1NBMA 4ZGNB 4OOSA 1BPLA 1SKYB 4WZTA 5LMZA 1B2RA 4PC6A 4XKWA 4XORA 1UD2A 1OGJA 5F4OA 2C78A 1COWA 2VJJA 2W6JA 1CQXA 1QUFA 2CW5A 4YELA 2E1RA 4P6YA 4XLHA 4C43A 2E1BA 1H85A 4M1KA 1Q7YD 3B8HA 4PGOA 4RD4A 2CRVA 2V31A 1WOPA 2QA4B 3CCEB 3ZZUA 1DDGA 2J7KA 3LQEA 3PA2A 1FNDA 1QGAA 3PUNA 3OP1A 4TN1A 4DNTB 3CD6B 4RCZA 1VQKB 2DETA 3MHPA 1UMKA 2R6HA 4Q7JB 2DEUA 3A8IA 1EP2B 4ASUA 3VO1A 1N0UA 2V7VA 2WPDA 3CMMA 2F43A 2V7TA 1YX2A 3GVLA 1VHEA 2BM1A 3OZVA 5A89A 2XNJA 3A3GA 4RD0A 4P3IA 4XKVA 2QN6A 1YI2B 3ONYA 4H9GA 1G7TA 5IYRA 1E63A 1P4MA 2F1MA 3W5UA 2WYRA 3NE5B 4OPVA 5IYPA 2B7BA 1BMFA 1PKVA 5EMNA 4RCYA 2OBRA 2X8KA 3JQQA 2X53S 1NDHA 3CW2A 1CNEA 1EFTA 1VQ7B 1VQ8B 4RM0A 1S4MA 1YJWB 1EP1B 4HIZA 2JJ1A 1W0KA 2D74A 2VNIA 3PENA 1Q81D 3Q6RA 4YXWA 4RDJA 2ZTGA 3QFSA 1HZEA 1W0JA 3OFNA 1IJFA 1W2BB 3A8JA 2XGJA 1JB9A 5HZAA 2ZZEA 3QFTA 3CMAB 2Q6IA 3WNDA 3OJXA 1E3XA 2VNHA 3BH4A 4XOTA 1VQNB 4ZCLA 1PJ5A 1GAWA 2OBTA 4E0FA 1UD8A 4P3YA 3OEHA 4P9SA 1SKQA 4YAFA 1UD4A 3SLDA 1V0FA 1WSRA 4EH1A 1JA1A 2VBUA 2XNDA 1N08A 1R5NA 3SJZA 4YAUA 1YJNB 4YHBA 1FX0A 2BSAA 3AVXA 1VQMB 5J3OA 4TMTA 1KD1D 3V7AA 1KTVA 4M0LA 1J9ZA 3ASSA 4WWVA 1VQPB 2PE3A 4C0SA 2D9RA 1WU8A 1FNBA 1E1RA 4XLAA 1EFRA 2CF4A 3AGPA 1W35A 1XFOA 3Q38A 3CC4B 4ACBA 1OB0A 2QGGA 4HE6A 2QTZA 2PIAA 4II2A 1QFJA 3ZUGA 4B4DA 2Q6OA 5TRDA 3W2GA 1D2EA 1S72B 1GJRA 2C4UA 2VYQA 3ASTA 1FNCA 4RD2A 5FIUA 1HVXA 5AN9A 4ROXA 1VQ5B 1T6ZA 1AMOA 4LBVA 2C2WA 1GR1A 3Q39A 1WSVA 2GK7A 2QE7A 1VF7A 4QUZA 5H59A 4G6IA 3W2HA 1ZUNB 1BJKA 1VJSA 3ZZTA 4Z4SA 2EFGA 1FDRA 1QFYA 3P27A 1H42A 1D1NA 3OE7A 4AF6A 1SM4A 4Z4WA 1YIJB 3VNUA 3KEWA 4KKUA 2GJPA 1UD3A 2CNDA 3B78A 5FO0A 3V76A 5IYWA 3CCJB 3G6EB 1BX1A 3AVVA 3A8KA 2X85A 3PUMA 4B48A 3BNWA 3JQRA 2ZBVA 4XNFA 3T51B 1GO2A 1NB9A 1VLOA 4XMYA 1WOOA 4P26A 2GJRA 1E43A 1EFUA 3BQJA 3A3BA 3ES9A 4QVJA 1QGZA 4XOPA 4JMQA 4PABA 2VBTA 2I1LA 2X6XA 5KW9A 3CPXA 3SJPA 4RD3A 3OKXA 3W2IA 3W2EA 3ASPA 4WZKA 1VLYA 2HCJB 2NV4A 4DQKA 1MRZA 3ASRA 4X7FA 4IW3B 4AC9A 1NRKA 4UZFA 4AVZA 3A1PA 5HKKA 5GV7A 1PJ6A 3ZZ0A 3WXMA 1KMHA 1RQPA 3OW7A 3U2QA 1H8HA 4NBSA 4M53A 1IB0A 2WZPP 5FO1A 1H8EA 5BSXA 4YAWA 2CBXA 2Q6LA 2C5BA 3JU4A 3FKSA 1T6XA 5GV8A 4HE5A 2X0KA 2ZTNA 4OOVA 3D26A 2M5SA 4II3A 4G1BA 2FVGA 3G71B 1W34A 2VNJA 1RQRA 4QV2A 4Y9RA 2XZPA 3VMFA 3SLNA 4XLFA 3BC9A 4RPDA 2XZOA 1K9MD 1KK2A 4RJLA 1ELOA 1XQBA 2P3MA 2ZXHA 1KC8D 4Z4UA 3OEEA 4Y7CA 4RD1A 1YLOA 4M2LA 2ZL6A 4GQNA 5BSYA 1HA3A 3LO8A 4TSFA 2RC6A 5F4JA 1YITB 3G4SB 2C4TA 2PMDA 1K28D 1VQLB 4FN5A 2FX3A 4FXUA 3FPKA 1DDIA 2CK3A 1N06A 4G7WA 1N05A 2QMUA 1FNMA 4RD6A 3AVWA 4QHYA 4WQMA 2X6WA 2ZL5A 3T53B 2BVNA 1MABA 1T6YA 4XLCA 1F60A 2DYIA 3ZPNA 2BM0A 5TV2A 3Q3AA 3T56B 1F20A 3W2FA 3CESA 5A8AA 3WQZA 1B23P 2DY1A 4B47A 3WY9A 4TMXA 4RPBA 2V7XA 1KRHA 2VNKA 1KK1A 3QFCA 3OW2B 3P26A 3CB4A 4LC0A 4G1VA 4WZEA 1KK3A 5THXA 3CCMB 1Q82D 4TMVA 2XZLA 2R9VA 4XR6A 3WYAA 1I7PA 4N3NA 4XN0A 4B3FX 1QVGB 4TMZA 1W9XA 2BGIA 1OHHA 1R5OA 4J0QA 4DK0A 3ISXA 4X05A 1QFZA 4XD7A 5DS0A 3OOCA 2GQFA 5TY0A 3AVTA 4Z4YA 5HZBA 2BPOA 1WOSA 2LZJA 5FNZA 1IHMA 1TLLA 1W87A 4FWTA 1ZM9A 4Z4VA 4RDLA 1NJID 5J35A 4OP7A 1XE1A 4MYUA 1QH0A 3OAAA 4P22A 2X6YA 4Z4RA 1G7SA 3WNCA 3B82A 3BY2A 2V7WA 2D3LA 3CMEB 1ZM3A 3ASQA 4KKTA 1WTHD 3QFRA 1VQ9B 2Z6BD 3AGQA 2GK6A 2V4DA 1WORA 3CRZA 1K8AD 2GREA 2OK8A 2JIZA 3OJWA 2ZITA 3JQPA 3SEJA 4DQLA 1N8RD 2ZL7A 4BPRA 1VQOB 4OPOA 4X0CA 4QFMA 4M4SA
chains in the Genus database with same CATH topology
3ZUGA 3OP1A 2VBSA 5TRDA 1MRZA 5FO0A 4UZFA 1T6YA 4UZEA 3CTAA 1NB0A 5FNZA 5A8AA 2P3MA 2VBUA 1N08A 1S4MA 3BNWA 1T6ZA 1NB9A 5FO1A 1Q9SA 5A89A 1T6XA 2X0KA 1N07A 2VBTA 5A88A 1P4MA 2I1LA 2OYNA 1N06A 1N05A 2VBVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZUG A;  3OP1 A;  2VBS A;  5TRD A;  1MRZ A;  5FO0 A;  4UZF A;  1T6Y A;  4UZE A;  3CTA A;  1NB0 A;  5FNZ A;  5A8A A;  2P3M A;  2VBU A;  1N08 A;  1S4M A;  3BNW A;  1T6Z A;  1NB9 A;  5FO1 A;  1Q9S A;  5A89 A;  1T6X A;  2X0K A;  1N07 A;  2VBT A;  5A88 A;  1P4M A;  2I1L A;  2OYN A;  1N06 A;  1N05 A;  2VBV A; 
#chains in the Genus database with same CATH topology
 2JJ2 A;  2PLF A;  4X07 A;  3W5V A;  3CCV B;  3CP2 A;  2NPF A;  1VQ6 B;  4UAJ A;  5IK2 A;  3A35 A;  2OTL B;  4XQF A;  5E6T A;  3U6B A;  4P2N A;  4P25 A;  3KL9 A;  4LBY A;  2WSS A;  1T5E A;  1TTT A;  1A8P A;  1EP3 B;  4TT3 A;  3CCS B;  3ZBT A;  5IYN A;  1VQ4 B;  3AVU A;  1JNY A;  1E64 A;  1ZM2 A;  2QDX A;  5JBQ A;  1E1Q A;  1S0U A;  2C5H A;  2DCU A;  2DIE A;  1R5B A;  2OTJ B;  2F4N A;  2ZZQ A;  4P6V F;  2F1L A;  5F4M A;  3RY8 A;  4KKS A;  5A88 A;  1V0E A;  2VZL A;  1TUI A;  3WBJ A;  1QUE A;  1WDT A;  4FK8 A;  4MYT A;  5TR9 A;  4XON A;  4ZCI A;  1Y0Y A;  3R6K A;  1EXM A;  1Y0R A;  4N3G A;  3VNV A;  4XL9 A;  1VHO A;  1YHQ B;  4Z1M A;  3MCA A;  1DG1 G;  1QVF B;  3I56 B;  3E20 A;  1WP6 A;  2YWH A;  3GVK A;  4ZGQ B;  4B43 A;  2WR8 A;  4TKO B;  2WJY A;  3CPW B;  1N07 A;  3ZBU A;  4P12 A;  4LBZ A;  1FRQ A;  4U9U A;  3CCL B;  2W6I A;  1OB2 A;  1K73 D;  1XB2 A;  1YJ9 B;  4X7D A;  1WPC A;  2KVO A;  1N0V C;  2ZBU A;  3CTA A;  4YEJ A;  3ONU A;  2QEX B;  2HMA A;  3FJO A;  4X06 A;  4YAL A;  4RLZ A;  1BX0 A;  4RDK A;  4XN3 A;  3LVB A;  5KSW B;  1OB5 A;  1IJE A;  1OGI A;  3H94 A;  2BGJ A;  2BMW A;  4NCN A;  2CC2 A;  3I1F A;  1QGY A;  3ZIA A;  1AIP A;  2B7C A;  4X8I A;  1BQE A;  4YAO A;  2XOK A;  2YWE A;  4DK1 A;  2XEX A;  2OYN A;  3WNB A;  3ZC3 A;  3LNN A;  4PC1 A;  3AVY A;  2GJK A;  2D3N A;  2ZZG A;  1KJZ A;  2Q6K A;  4WZL A;  5B6I A;  4XLE A;  3I55 B;  2BN4 A;  3LQ6 A;  2DER A;  1NB0 A;  1UD5 A;  3VR6 A;  4CQJ A;  4G7X A;  1BLI A;  3U6K A;  4OOX A;  1DAR A;  3GIR A;  4Z4T A;  3W5H A;  3CC2 B;  3OZU A;  3VO2 A;  1EWY A;  4F7D A;  4ZV4 A;  4NNJ A;  5H5J A;  3PVD A;  2RC5 A;  4G5G A;  5DN6 A;  2X3U A;  2HDN B;  2WZN A;  3R6J A;  4B3G A;  1TVC A;  4B3X A;  1KK0 A;  4OPS A;  1V5V A;  4R71 A;  2JN9 A;  1KZL A;  2EIX A;  4P1V A;  3PA1 A;  1CNF A;  2VBV A;  4PC3 A;  3QSY A;  2ZZF A;  2XNC A;  2WJV A;  4DNR B;  1M90 D;  2BF4 A;  1EFC A;  4UZE A;  3H9N A;  2HLD A;  3J81 k;  2YWF A;  5FL7 A;  1U2R A;  3E1Y E;  3WBK A;  3BY1 A;  4QVA A;  1ZM4 A;  2QTL A;  4LBW A;  2VJI A;  2C77 A;  3BCD A;  4AF7 A;  3CP8 A;  1QG0 A;  2V7Q A;  3CCQ B;  5KNL A;  4UZU A;  2JDI A;  1E3Z A;  3CCR B;  1JA0 A;  1I8D A;  2ZXI A;  3MMP A;  3Q6Q A;  3QE2 A;  4PC2 A;  5HXB A;  2B5O A;  2OBS A;  5IYQ A;  3G05 A;  4X7E A;  1Q86 D;  1UD6 A;  3GQB A;  2DOG A;  3GSI A;  3CC7 B;  3GVJ A;  2VBS A;  4PAA A;  2GPJ A;  1E62 A;  4TMW A;  1GAQ A;  1I18 A;  1G7R A;  5L46 A;  1E79 A;  1PJ7 A;  1D8T A;  4PC7 A;  1KQS B;  3HAG A;  2V7U A;  3DDY A;  4X7C A;  3FPP A;  2AHO A;  1Q9S A;  2YWG A;  2BV3 A;  3OZW A;  1G7C A;  3CXC B;  1FRN A;  4ACA A;  1GVH A;  4L8J A;  3BCF A;  4K1X A;  2OK7 A;  3OPO A;  3SKB A;  5FA6 A;  3CCU B;  4Y9U A;  1M1K D;  4XM3 A;  4B44 A;  1QX4 A;  5DSZ A;  4ZCM A;  1JJ2 B;  5CDF A;  4Z4Z A;  1NBM A;  4ZGN B;  4OOS A;  1BPL A;  1SKY B;  4WZT A;  5LMZ A;  1B2R A;  4PC6 A;  4XKW A;  4XOR A;  1UD2 A;  1OGJ A;  5F4O A;  2C78 A;  1COW A;  2VJJ A;  2W6J A;  1CQX A;  1QUF A;  2CW5 A;  4YEL A;  2E1R A;  4P6Y A;  4XLH A;  4C43 A;  2E1B A;  1H85 A;  4M1K A;  1Q7Y D;  3B8H A;  4PGO A;  4RD4 A;  2CRV A;  2V31 A;  1WOP A;  2QA4 B;  3CCE B;  3ZZU A;  1DDG A;  2J7K A;  3LQE A;  3PA2 A;  1FND A;  1QGA A;  3PUN A;  3OP1 A;  4TN1 A;  4DNT B;  3CD6 B;  4RCZ A;  1VQK B;  2DET A;  3MHP A;  1UMK A;  2R6H A;  4Q7J B;  2DEU A;  3A8I A;  1EP2 B;  4ASU A;  3VO1 A;  1N0U A;  2V7V A;  2WPD A;  3CMM A;  2F43 A;  2V7T A;  1YX2 A;  3GVL A;  1VHE A;  2BM1 A;  3OZV A;  5A89 A;  2XNJ A;  3A3G A;  4RD0 A;  4P3I A;  4XKV A;  2QN6 A;  1YI2 B;  3ONY A;  4H9G A;  1G7T A;  5IYR A;  1E63 A;  1P4M A;  2F1M A;  3W5U A;  2WYR A;  3NE5 B;  4OPV A;  5IYP A;  2B7B A;  1BMF A;  1PKV A;  5EMN A;  4RCY A;  2OBR A;  2X8K A;  3JQQ A;  2X53 S;  1NDH A;  3CW2 A;  1CNE A;  1EFT A;  1VQ7 B;  1VQ8 B;  4RM0 A;  1S4M A;  1YJW B;  1EP1 B;  4HIZ A;  2JJ1 A;  1W0K A;  2D74 A;  2VNI A;  3PEN A;  1Q81 D;  3Q6R A;  4YXW A;  4RDJ A;  2ZTG A;  3QFS A;  1HZE A;  1W0J A;  3OFN A;  1IJF A;  1W2B B;  3A8J A;  2XGJ A;  1JB9 A;  5HZA A;  2ZZE A;  3QFT A;  3CMA B;  2Q6I A;  3WND A;  3OJX A;  1E3X A;  2VNH A;  3BH4 A;  4XOT A;  1VQN B;  4ZCL A;  1PJ5 A;  1GAW A;  2OBT A;  4E0F A;  1UD8 A;  4P3Y A;  3OEH A;  4P9S A;  1SKQ A;  4YAF A;  1UD4 A;  3SLD A;  1V0F A;  1WSR A;  4EH1 A;  1JA1 A;  2VBU A;  2XND A;  1N08 A;  1R5N A;  3SJZ A;  4YAU A;  1YJN B;  4YHB A;  1FX0 A;  2BSA A;  3AVX A;  1VQM B;  5J3O A;  4TMT A;  1KD1 D;  3V7A A;  1KTV A;  4M0L A;  1J9Z A;  3ASS A;  4WWV A;  1VQP B;  2PE3 A;  4C0S A;  2D9R A;  1WU8 A;  1FNB A;  1E1R A;  4XLA A;  1EFR A;  2CF4 A;  3AGP A;  1W35 A;  1XFO A;  3Q38 A;  3CC4 B;  4ACB A;  1OB0 A;  2QGG A;  4HE6 A;  2QTZ A;  2PIA A;  4II2 A;  1QFJ A;  3ZUG A;  4B4D A;  2Q6O A;  5TRD A;  3W2G A;  1D2E A;  1S72 B;  1GJR A;  2C4U A;  2VYQ A;  3AST A;  1FNC A;  4RD2 A;  5FIU A;  1HVX A;  5AN9 A;  4ROX A;  1VQ5 B;  1T6Z A;  1AMO A;  4LBV A;  2C2W A;  1GR1 A;  3Q39 A;  1WSV A;  2GK7 A;  2QE7 A;  1VF7 A;  4QUZ A;  5H59 A;  4G6I A;  3W2H A;  1ZUN B;  1BJK A;  1VJS A;  3ZZT A;  4Z4S A;  2EFG A;  1FDR A;  1QFY A;  3P27 A;  1H42 A;  1D1N A;  3OE7 A;  4AF6 A;  1SM4 A;  4Z4W A;  1YIJ B;  3VNU A;  3KEW A;  4KKU A;  2GJP A;  1UD3 A;  2CND A;  3B78 A;  5FO0 A;  3V76 A;  5IYW A;  3CCJ B;  3G6E B;  1BX1 A;  3AVV A;  3A8K A;  2X85 A;  3PUM A;  4B48 A;  3BNW A;  3JQR A;  2ZBV A;  4XNF A;  3T51 B;  1GO2 A;  1NB9 A;  1VLO A;  4XMY A;  1WOO A;  4P26 A;  2GJR A;  1E43 A;  1EFU A;  3BQJ A;  3A3B A;  3ES9 A;  4QVJ A;  1QGZ A;  4XOP A;  4JMQ A;  4PAB A;  2VBT A;  2I1L A;  2X6X A;  5KW9 A;  3CPX A;  3SJP A;  4RD3 A;  3OKX A;  3W2I A;  3W2E A;  3ASP A;  4WZK A;  1VLY A;  2HCJ B;  2NV4 A;  4DQK A;  1MRZ A;  3ASR A;  4X7F A;  4IW3 B;  4AC9 A;  1NRK A;  4UZF A;  4AVZ A;  3A1P A;  5HKK A;  5GV7 A;  1PJ6 A;  3ZZ0 A;  3WXM A;  1KMH A;  1RQP A;  3OW7 A;  3U2Q A;  1H8H A;  4NBS A;  4M53 A;  1IB0 A;  2WZP P;  5FO1 A;  1H8E A;  5BSX A;  4YAW A;  2CBX A;  2Q6L A;  2C5B A;  3JU4 A;  3FKS A;  1T6X A;  5GV8 A;  4HE5 A;  2X0K A;  2ZTN A;  4OOV A;  3D26 A;  2M5S A;  4II3 A;  4G1B A;  2FVG A;  3G71 B;  1W34 A;  2VNJ A;  1RQR A;  4QV2 A;  4Y9R A;  2XZP A;  3VMF A;  3SLN A;  4XLF A;  3BC9 A;  4RPD A;  2XZO A;  1K9M D;  1KK2 A;  4RJL A;  1ELO A;  1XQB A;  2P3M A;  2ZXH A;  1KC8 D;  4Z4U A;  3OEE A;  4Y7C A;  4RD1 A;  1YLO A;  4M2L A;  2ZL6 A;  4GQN A;  5BSY A;  1HA3 A;  3LO8 A;  4TSF A;  2RC6 A;  5F4J A;  1YIT B;  3G4S B;  2C4T A;  2PMD A;  1K28 D;  1VQL B;  4FN5 A;  2FX3 A;  4FXU A;  3FPK A;  1DDI A;  2CK3 A;  1N06 A;  4G7W A;  1N05 A;  2QMU A;  1FNM A;  4RD6 A;  3AVW A;  4QHY A;  4WQM A;  2X6W A;  2ZL5 A;  3T53 B;  2BVN A;  1MAB A;  1T6Y A;  4XLC A;  1F60 A;  2DYI A;  3ZPN A;  2BM0 A;  5TV2 A;  3Q3A A;  3T56 B;  1F20 A;  3W2F A;  3CES A;  5A8A A;  3WQZ A;  1B23 P;  2DY1 A;  4B47 A;  3WY9 A;  4TMX A;  4RPB A;  2V7X A;  1KRH A;  2VNK A;  1KK1 A;  3QFC A;  3OW2 B;  3P26 A;  3CB4 A;  4LC0 A;  4G1V A;  4WZE A;  1KK3 A;  5THX A;  3CCM B;  1Q82 D;  4TMV A;  2XZL A;  2R9V A;  4XR6 A;  3WYA A;  1I7P A;  4N3N A;  4XN0 A;  4B3F X;  1QVG B;  4TMZ A;  1W9X A;  2BGI A;  1OHH A;  1R5O A;  4J0Q A;  4DK0 A;  3ISX A;  4X05 A;  1QFZ A;  4XD7 A;  5DS0 A;  3OOC A;  2GQF A;  5TY0 A;  3AVT A;  4Z4Y A;  5HZB A;  2BPO A;  1WOS A;  2LZJ A;  5FNZ A;  1IHM A;  1TLL A;  1W87 A;  4FWT A;  1ZM9 A;  4Z4V A;  4RDL A;  1NJI D;  5J35 A;  4OP7 A;  1XE1 A;  4MYU A;  1QH0 A;  3OAA A;  4P22 A;  2X6Y A;  4Z4R A;  1G7S A;  3WNC A;  3B82 A;  3BY2 A;  2V7W A;  2D3L A;  3CME B;  1ZM3 A;  3ASQ A;  4KKT A;  1WTH D;  3QFR A;  1VQ9 B;  2Z6B D;  3AGQ A;  2GK6 A;  2V4D A;  1WOR A;  3CRZ A;  1K8A D;  2GRE A;  2OK8 A;  2JIZ A;  3OJW A;  2ZIT A;  3JQP A;  3SEJ A;  4DQL A;  1N8R D;  2ZL7 A;  4BPR A;  1VQO B;  4OPO A;  4X0C A;  4QFM A;  4M4S A; 
#chains in the Genus database with same CATH homology
 3ZUG A;  3OP1 A;  2VBS A;  5TRD A;  1MRZ A;  5FO0 A;  4UZF A;  1T6Y A;  4UZE A;  3CTA A;  1NB0 A;  5FNZ A;  5A8A A;  2P3M A;  2VBU A;  1N08 A;  1S4M A;  3BNW A;  1T6Z A;  1NB9 A;  5FO1 A;  1Q9S A;  5A89 A;  1T6X A;  2X0K A;  1N07 A;  2VBT A;  5A88 A;  1P4M A;  2I1L A;  2OYN A;  1N06 A;  1N05 A;  2VBV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...