5HXBA

Cereblon in complex with ddb1, cc-885, and gspt1
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
196
structure length
196
Chain Sequence
PIRLPIVDKYKDMGTVVLGKLESGSICKGQQLVMMPNKHNVEVLGILSDDVETDTVAPGENLKIRLKGIEEEEILPGFILCDPNNLCHSGRTFDAQIVIIEHKSIICPGYNAVLHIHTCIEEVEITALICLVDKKSGEKSKTRPRFVKQDQVCIARLRTAGTICLETFKDFPQMGRFTLRDEGKTIAIGKVLKLVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Eukaryotic peptide chain release factor GTP-binding subunit
publication title A novel cereblon modulator recruits GSPT1 to the CRL4(CRBN) ubiquitin ligase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 27
structure length 196
sequence length 196
chains with identical sequence X
ec nomenclature
pdb deposition date 2016-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03143 GTP_EFTU_D3 Elongation factor Tu C-terminal domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 5hxbA02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 5hxbA01
3W5UA 3AGQA 1G7TA 3E1YE 1KK1A 1M1KD 4C43A 5GV8A 1S0UA 1ZM9A 1EP2B 3W5VA 3ZBTA 4LBYA 3QFSA 1VQ5B 3QSYA 1HA3A 5FA6A 4B44A 4QFMA 1GVHA 4P3YA 3AVVA 5DSZA 1AIPA 1YJWB 2BN4A 1TUIA 1VQ7B 4ZV4A 1UMKA 2XNCA 1YJNB 3W5HA 3CXCB 1VQNB 2X3UA 1FRNA 2YWGA 2QA4B 1R5NA 3FJOA 4Y7CA 2E1RA 2QMUA 1QUEA 2VNJA 4B48A 1J9ZA 1OB2A 2PIAA 4IW3B 3CCVB 2BM0A 4RD0A 1KK2A 1JB9A 3CW2A 3B82A 3AVUA 1R5BA 1FRQA 1SM4A 2BV3A 3U2QA 1CNEA 4H9GA 4F7DA 3ES9A 1S72B 4G1VA 1FNMA 1QGZA 2BSAA 1JJ2B 4RCZA 4LC0A 3FPKA 1EFCA 1KD1D 1IB0A 3AVTA 4RD2A 3CPWB 1QG0A 3VNVA 2CNDA 2HMAA 1KQSB 1D2EA 1M90D 1YHQB 4FK8A 1GO2A 4FN5A 1K8AD 3CCJB 1FNDA 1H85A 1JNYA 1JA1A 3QE2A 3OZUA 4NCNA 4DQKA 3LO8A 4YAFA 4AF7A 4AF6A 1YJ9B 3CCRB 3WBJA 4PC3A 1QVGB 5H5JA 1CQXA 3U6BA 4ZGQB 2YWHA 1SKQA 3E20A 3VMFA 1FNBA 2D74A 3W2IA 4ZGNB 2VNIA 3B8HA 1ZM4A 4PC6A 2EIXA 1KTVA 3VO1A 2YWEA 5KSWB 4TMXA 4RD6A 1K9MD 1F20A 2DERA 3W2GA 1ZM2A 3U6KA 1GAWA 1G7RA 2DEUA 1FNCA 3CC4B 2HCJB 1QFZA 1EP1B 1BJKA 4ZCLA 4Y9RA 4PC7A 3OZVA 2DETA 3QFTA 3W2FA 4DQLA 1KRHA 3MCAA 2BVNA 5JBQA 3JQRA 3CCLB 1N0UA 3WY9A 1BX0A 3CCUB 3OJXA 3I56B 1CNFA 5GV7A 1QH0A 2AHOA 2B7CA 3AVXA 3CCSB 1DARA 1OGJA 1XB2A 1YI2B 4TN1A 2J7KA 4YALA 3W2HA 1W34A 1YIJB 1Q82D 2NPFA 2FX3A 3CC2B 4Y9UA 3CRZA 3JQQA 1D8TA 5EMNA 3ZZ0A 1QVFB 1DDGA 1H42A 1EXMA 1DDIA 1OGIA 2BF4A 3AGPA 2DY1A 4PGOA 2VNHA 2OK7A 4M2LA 4EH1A 2EFGA 1G7CA 4C0SA 1TVCA 4K1XA 2HDNB 4YAUA 1I7PA 3P27A 1ELOA 2YWFA 1OB5A 3W2EA 1VQKB 1JA0A 2BGIA 2QTLA 1VQ9B 1TLLA 3AVYA 2C78A 2ZITA 3ZZUA 1VQOB 2QEXB 1W87A 1K73D 3VO2A 1EWYA 5TV2A 4ZCIA 2R6HA 1TTTA 2B7BA 4G5GA 1Q81D 3PENA 1EFTA 2QN6A 2DCUA 4YHBA 1W35A 3WNCA 1N0VC 3ZZTA 3CMEB 3I55B 5AN9A 2BM1A 4M53A 1QX4A 4N3GA 1U2RA 3ZC3A 4QHYA 4LBZA 2XEXA 3J81k 4Q7JB 3MMPA 3JQPA 1VQ8B 4NBSA 1Q86D 1B2RA 2GQFA 1F60A 3CD6B 3SJZA 3B78A 1KK0A 4TMTA 4AC9A 3G6EB 1GR1A 1VQMB 3OZWA 4ACBA 2PMDA 4UAJA 4MYUA 3CC7B 1KC8D 3VNUA 2RC5A 1IJFA 1E64A 2B5OA 1D1NA 1FDRA 5THXA 4B43A 1YITB 4M1KA 1IJEA 1ZM3A 4ACAA 4WQMA 1QGAA 4HE6A 1E63A 3WYAA 2QDXA 3WNDA 4P6VF 4LBWA 3QFRA 4M4SA 2OTJB 1KK3A 2C77A 1BQEA 1VQLB 4TMVA 4N3NA 3LVBA 2VYQA 2XNJA 3I1FA 1G7SA 3MHPA 4YAOA 1Q7YD 4FWTA 1QFYA 3OW2B 5HXBA 1EFUA 1GAQA 2PLFA 2VNKA 2GPJA 4LBVA 4B3XA 3CCQB 4YAWA 1R5OA 4ZCMA 3CCMB 4B4DA 1VQ6B 4M0LA 1GJRA 4TMZA 1QFJA 4PC2A 4RD3A 2CRVA 1WDTA 1XE1A 4J0QA 1NJID 3P26A 1BX1A 2VZLA 1QUFA 3WXMA 4MYTA 4G1BA 3CCEB 3OJWA 3QFCA 4RCYA 3V76A 3G4SB 4RJLA 4BPRA 1QGYA 2OK8A 1DG1G 1VQPB 4HE5A 4B47A 2BPOA 5TR9A 2BMWA 1E62A 4TMWA 3ZBUA 1ZUNB 2OTLB 4RD1A 1AMOA 3G71B 3CMAB 3CB4A 2RC6A 3WNBA 1EP3B 2BGJA 3WBKA 1VQ4B 2QTZA 5TY0A 4RD4A 4PC1A 1N8RD 4R71A 1W2BB 1B23P 4U9UA 1NDHA 3AVWA 1A8PA 5H59A 1KJZA
chains in the Genus database with same CATH superfamily
3W5UA 1NRKA 1V5VA 3AGQA 4XORA 1G7TA 1WU8A 2FVGA 4ROXA 4P9SA 3V7AA 3E1YE 2X6XA 4XQFA 1KK1A 1M1KD 2X6YA 5J35A 4C43A 5GV8A 5IYWA 1HVXA 1S0UA 4II3A 4B3GA 4QVAA 1ZM9A 1EP2B 5DN6A 3W5VA 3SLDA 3ZBTA 2E1BA 4KKSA 4LBYA 3QFSA 4WZKA 1VQ5B 3QSYA 3A8KA 1HA3A 5F4OA 5FA6A 1W9XA 4B44A 4QFMA 4P1VA 1WOSA 1WORA 1GVHA 4P3YA 3AVVA 5DSZA 1AIPA 1YJWB 2BN4A 1TUIA 3BY2A 1VQ7B 3PA2A 4ZV4A 1UMKA 2XNCA 3VR6A 1YJNB 2DIEA 3BNWA 3W5HA 3CXCB 1VQNB 1UD8A 4DK0A 2X3UA 1FRNA 4RPDA 2ZL6A 2YWGA 2QA4B 2R9VA 1R5NA 3FJOA 4E0FA 4Y7CA 2E1RA 3ZPNA 2QGGA 4KKTA 2QMUA 2ZL5A 1UD3A 1QUEA 1WPCA 3GSIA 1K28D 4G7XA 2VNJA 2VJIA 4B48A 1J9ZA 1OB2A 2ZXHA 1PKVA 2PIAA 4IW3B 3CCVB 2BM0A 2V7WA 4RD0A 1KK2A 1JB9A 1VF7A 3CW2A 3B82A 2JN9A 3AVUA 1W0JA 1R5BA 1FRQA 2F4NA 3G05A 3CTAA 3ASTA 2CC2A 3Q3AA 1SM4A 2BV3A 3U2QA 1CNEA 4H9GA 4F7DA 5J3OA 3BH4A 2CW5A 3ES9A 1S72B 4G1VA 2OBRA 1P4MA 2Q6KA 1FNMA 1QGZA 1T6XA 4DNRB 2BSAA 4X7FA 1JJ2B 4RCZA 4LC0A 3PA1A 3FPKA 1EFCA 4WZEA 2F43A 1KD1D 1IB0A 3AVTA 1SKYB 4RD2A 3CPWB 1QG0A 3VNVA 2C4TA 2CNDA 2HMAA 1KQSB 4X0CA 1D2EA 1M90D 1YHQB 2XZLA 5F4MA 3D26A 4FK8A 1GO2A 1E3XA 1RQPA 4FN5A 4G7WA 1K8AD 2XNDA 3Q39A 3CCJB 1FNDA 3BCFA 1H85A 1WTHD 1JNYA 1JA1A 3PUNA 3QE2A 3OZUA 4NCNA 2XOKA 4DQKA 3LO8A 1UD5A 1E79A 4YAFA 2Q6LA 4AF7A 4WWVA 3R6KA 2OYNA 4X05A 4AF6A 1YJ9B 3CCRB 4P6YA 1UD2A 2VBUA 4UZUA 3WBJA 2WYRA 4PC3A 1QVGB 1NB0A 5H5JA 1CQXA 4CQJA 2GK6A 4Z4VA 2XZOA 3U6BA 3CPXA 4ZGQB 5CDFA 3LQ6A 2JDIA 4XLCA 2YWHA 3BCDA 3LNNA 3T51B 1SKQA 4XKWA 3Q6QA 3KEWA 3E20A 2ZBVA 1WSVA 1FNBA 3OOCA 3VMFA 3R6JA 2D74A 1PJ5A 3W2IA 4ZGNB 2F1MA 2VNIA 2V7VA 3ONYA 3B8HA 1ZM4A 4X7DA 4PC6A 2EIXA 4OOVA 2V7XA 1E1QA 1KTVA 1V0FA 5L46A 3OPOA 3VO1A 5FO1A 4Z4SA 1YLOA 2YWEA 2ZXIA 4HIZA 5KSWB 4TMXA 4RD6A 1K9MD 2W6IA 1F20A 2DERA 3W2GA 2VBVA 1ZM2A 4X06A 3U6KA 4P25A 4RM0A 1GAWA 1G7RA 2DEUA 4P26A 1FNCA 1WOOA 3CC4B 2HCJB 1QFZA 1EP1B 1BJKA 2WZNA 1COWA 4P12A 5IK2A 4ZCLA 4Y9RA 4PC7A 1N07A 3OZVA 5HZBA 3OEHA 2DETA 3QFTA 2ZTGA 3W2FA 4DQLA 1KRHA 3ASQA 1BPLA 3MCAA 2BVNA 2X8KA 5JBQA 3JQRA 4AVZA 3CCLB 4XR6A 1N0UA 2F1LA 4FXUA 1T6ZA 4XN0A 5B6IA 1UD6A 3BC9A 5FIUA 1VHEA 3WY9A 1PJ7A 1BX0A 2WPDA 5FL7A 2W6JA 5BSYA 3CCUB 3OJXA 3I56B 1CNFA 5GV7A 1QH0A 3SEJA 2AHOA 2B7CA 2VJJA 3ZIAA 3AVXA 3CCSB 1DARA 1Y0RA 1OGJA 1XB2A 1YI2B 4TN1A 2J7KA 2V7QA 4YALA 3W2HA 1W34A 1IHMA 1YIJB 3A8JA 1Q82D 4JMQA 5TRDA 2NPFA 5BSXA 2FX3A 4XL9A 3CC2B 4Y9UA 4XLHA 3CRZA 3JQQA 1N05A 1D8TA 1S4MA 5EMNA 3ZZ0A 1QVFB 4QV2A 4XOTA 1DDGA 3ISXA 1H42A 4XD7A 1T5EA 1EXMA 1DDIA 1OGIA 2BF4A 3AGPA 2DY1A 4PGOA 3OAAA 2VNHA 2OK7A 2ZZGA 3ASRA 4M2LA 4TSFA 1RQRA 2D3LA 4EH1A 4QUZA 2GJRA 2V4DA 2EFGA 1H8HA 1I18A 1VHOA 1G7CA 1OHHA 2PE3A 2WSSA 4C0SA 2OBSA 4UZFA 1TVCA 4K1XA 4TKOB 1E43A 2HDNB 4YAUA 1N06A 2CF4A 2HLDA 1I7PA 3P27A 3OEEA 1ELOA 2YWFA 5A89A 1OB5A 4P2NA 3W2EA 3H94A 1VQKB 3CMMA 1JA0A 2BGIA 2D9RA 2GREA 2C5HA 2Z6BD 3Q6RA 2QTLA 4X7CA 2X53S 1TLLA 1VQ9B 2C78A 3AVYA 2ZITA 3ZZUA 2QE7A 2X6WA 4OPOA 4YEJA 1VQOB 2QEXB 1W87A 2ZZEA 5DS0A 3GIRA 3VO2A 1K73D 5KNLA 1EWYA 3WQZA 1XQBA 2CK3A 5TV2A 4ZCIA 2R6HA 2ZZQA 5IYQA 1Y0YA 1XFOA 4OP7A 1TTTA 2B7BA 4G5GA 2XZPA 2ZBUA 1Q81D 3PENA 4XOPA 3SJPA 4P3IA 2ZL7A 4RLZA 1EFTA 2QN6A 2DCUA 4PABA 4WZTA 5E6TA 4YHBA 4XMYA 4XLAA 1W35A 3WNCA 1KMHA 1N0VC 3ZZTA 1T6YA 3CMEB 3I55B 4XKVA 5AN9A 4OPSA 2BM1A 1PJ6A 2ZTNA 4M53A 3A8IA 2JJ2A 1QX4A 2C4UA 4N3GA 4RDLA 1EFRA 1U2RA 3ZC3A 2D3NA 4QHYA 4LBZA 2XEXA 3J81k 4Q7JB 4XNFA 3MMPA 3GVJA 3JQPA 1VQ8B 4NBSA 1Q86D 3Q38A 1B2RA 2GQFA 1F60A 2OBTA 1W0KA 3CD6B 1H8EA 3SJZA 3CP2A 3RY8A 3B78A 5KW9A 1FX0A 1VLOA 1KK0A 4TMTA 4AC9A 3G6EB 5HZAA 4RDJA 3CP8A 2WR8A 4WZLA 1GR1A 1VQMB 3OZWA 4ACBA 4G6IA 2PMDA 4UAJA 4MYUA 5HKKA 3KL9A 2GJPA 4DNTB 2Q6OA 5A8AA 1BLIA 3JU4A 3T56B 3CC7B 1KC8D 2X0KA 3VNUA 2RC5A 2JIZA 1YX2A 1IJFA 1KZLA 4DK1A 3ONUA 1BMFA 4UZEA 1E64A 3LQEA 5IYRA 2B5OA 2DYIA 3OKXA 1FDRA 4Z4YA 1D1NA 4X7EA 5THXA 1NBMA 4XONA 4B43A 1YITB 4M1KA 1IJEA 3A1PA 1ZM3A 4TT3A 4ACAA 4WQMA 4L8JA 2VBSA 5FNZA 1UD4A 2LZJA 3OP1A 1QGAA 3CESA 3A3BA 2C2WA 4HE6A 1E63A 3WYAA 2QDXA 3GQBA 4XN3A 4P6VF 3WNDA 4Z4RA 4LBWA 3QFRA 3NE5B 4NNJA 2I1LA 4M4SA 3OFNA 2OTJB 4RDKA 1KK3A 3OW7A 2C77A 2Q6IA 4PAAA 4Z4ZA 1BQEA 2V31A 5IYPA 5A88A 5IYNA 2C5BA 1VQLB 4TMVA 2VBTA 4N3NA 3LVBA 2KVOA 2VYQA 2XNJA 5F4JA 3OE7A 1N08A 3I1FA 1G7SA 3MHPA 4YXWA 2WZPP 4OOXA 4YAOA 3ASPA 3PUMA 1Q7YD 2V7TA 5FO0A 3SLNA 4FWTA 1QFYA 4ASUA 3OW2B 1KJZA 5HXBA 1EFUA 1GAQA 2X85A 2PLFA 2JJ1A 3GVLA 1HZEA 2VNKA 2GPJA 4LBVA 3SKBA 1WOPA 4YAWA 4B3XA 3CCQB 1R5OA 1E3ZA 4RPBA 4B3FX 4ZCMA 3CCMB 2CBXA 4B4DA 1VQ6B 4M0LA 1GJRA 2GK7A 2M5SA 4P22A 2XGJA 4XLEA 1VJSA 4Z4UA 4TMZA 1QFJA 4PC2A 4RD3A 2CRVA 1WDTA 1XE1A 4GQNA 3A35A 4J0QA 5LMZA 3BY1A 3HAGA 3P26A 1NJID 4X8IA 1MABA 4Z4TA 1BX1A 2VZLA 1WP6A 3H9NA 1QUFA 4YELA 3WXMA 4MYTA 3GVKA 4II2A 4Z4WA 3T53B 4G1BA 1E1RA 1OB0A 4OPVA 3CCEB 2WJVA 4KKUA 3OJWA 3QFCA 2GJKA 2WJYA 4RCYA 1I8DA 2P3MA 1V0EA 3A3GA 3V76A 3G4SB 4RJLA 3ZUGA 2ZZFA 1NB9A 1QGYA 4BPRA 1WSRA 2OK8A 1DG1G 1MRZA 1VQPB 4HE5A 4B47A 2BPOA 4XM3A 5TR9A 3PVDA 2BMWA 1E62A 4TMWA 3ZBUA 1ZUNB 2OTLB 3BQJA 4RD1A 1AMOA 3G71B 4QVJA 3FKSA 3CMAB 3CB4A 2RC6A 1VLYA 3WNBA 2DOGA 1EP3B 2BGJA 3DDYA 3FPPA 3ASSA 3WBKA 1VQ4B 4OOSA 1Q9SA 2QTZA 5TY0A 4Z1MA 4PC1A 4RD4A 4X07A 1N8RD 4R71A 4XLFA 1W2BB 2V7UA 1B23P 4U9UA 1NDHA 3AVWA 1A8PA 5H59A 2NV4A
chains in the Genus database with same CATH topology
3W5UA 3AGQA 1G7TA 3E1YE 1KK1A 1M1KD 4C43A 5GV8A 1S0UA 1ZM9A 1EP2B 3W5VA 3ZBTA 4LBYA 3QFSA 1VQ5B 3QSYA 1HA3A 5FA6A 4B44A 4QFMA 1GVHA 4P3YA 3AVVA 5DSZA 1AIPA 1YJWB 2BN4A 1TUIA 1VQ7B 4ZV4A 1UMKA 2XNCA 1YJNB 3W5HA 3CXCB 1VQNB 2X3UA 1FRNA 2YWGA 2QA4B 1R5NA 3FJOA 4Y7CA 2E1RA 2QMUA 1QUEA 2VNJA 4B48A 1J9ZA 1OB2A 2PIAA 4IW3B 3CCVB 2BM0A 4RD0A 1KK2A 1JB9A 3CW2A 3B82A 3AVUA 1R5BA 1FRQA 1SM4A 2BV3A 3U2QA 1CNEA 4H9GA 4F7DA 3ES9A 1S72B 4G1VA 1FNMA 1QGZA 2BSAA 1JJ2B 4RCZA 4LC0A 3FPKA 1EFCA 1KD1D 1IB0A 3AVTA 4RD2A 3CPWB 1QG0A 3VNVA 2CNDA 2HMAA 1KQSB 1D2EA 1M90D 1YHQB 4FK8A 1GO2A 4FN5A 1K8AD 3CCJB 1FNDA 1H85A 1JNYA 1JA1A 3QE2A 3OZUA 4NCNA 4DQKA 3LO8A 4YAFA 4AF7A 4AF6A 1YJ9B 3CCRB 3WBJA 4PC3A 1QVGB 5H5JA 1CQXA 3U6BA 4ZGQB 2YWHA 1SKQA 3E20A 3VMFA 1FNBA 2D74A 3W2IA 4ZGNB 2VNIA 3B8HA 1ZM4A 4PC6A 2EIXA 1KTVA 3VO1A 2YWEA 5KSWB 4TMXA 4RD6A 1K9MD 1F20A 2DERA 3W2GA 1ZM2A 3U6KA 1GAWA 1G7RA 2DEUA 1FNCA 3CC4B 2HCJB 1QFZA 1EP1B 1BJKA 4ZCLA 4Y9RA 4PC7A 3OZVA 2DETA 3QFTA 3W2FA 4DQLA 1KRHA 3MCAA 2BVNA 5JBQA 3JQRA 3CCLB 1N0UA 3WY9A 1BX0A 3CCUB 3OJXA 3I56B 1CNFA 5GV7A 1QH0A 2AHOA 2B7CA 3AVXA 3CCSB 1DARA 1OGJA 1XB2A 1YI2B 4TN1A 2J7KA 4YALA 3W2HA 1W34A 1YIJB 1Q82D 2NPFA 2FX3A 3CC2B 4Y9UA 3CRZA 3JQQA 1D8TA 5EMNA 3ZZ0A 1QVFB 1DDGA 1H42A 1EXMA 1DDIA 1OGIA 2BF4A 3AGPA 2DY1A 4PGOA 2VNHA 2OK7A 4M2LA 4EH1A 2EFGA 1G7CA 4C0SA 1TVCA 4K1XA 2HDNB 4YAUA 1I7PA 3P27A 1ELOA 2YWFA 1OB5A 3W2EA 1VQKB 1JA0A 2BGIA 2QTLA 1VQ9B 1TLLA 3AVYA 2C78A 2ZITA 3ZZUA 1VQOB 2QEXB 1W87A 1K73D 3VO2A 1EWYA 5TV2A 4ZCIA 2R6HA 1TTTA 2B7BA 4G5GA 1Q81D 3PENA 1EFTA 2QN6A 2DCUA 4YHBA 1W35A 3WNCA 1N0VC 3ZZTA 3CMEB 3I55B 5AN9A 2BM1A 4M53A 1QX4A 4N3GA 1U2RA 3ZC3A 4QHYA 4LBZA 2XEXA 3J81k 4Q7JB 3MMPA 3JQPA 1VQ8B 4NBSA 1Q86D 1B2RA 2GQFA 1F60A 3CD6B 3SJZA 3B78A 1KK0A 4TMTA 4AC9A 3G6EB 1GR1A 1VQMB 3OZWA 4ACBA 2PMDA 4UAJA 4MYUA 3CC7B 1KC8D 3VNUA 2RC5A 1IJFA 1E64A 2B5OA 1D1NA 1FDRA 5THXA 4B43A 1YITB 4M1KA 1IJEA 1ZM3A 4ACAA 4WQMA 1QGAA 4HE6A 1E63A 3WYAA 2QDXA 3WNDA 4P6VF 4LBWA 3QFRA 4M4SA 2OTJB 1KK3A 2C77A 1BQEA 1VQLB 4TMVA 4N3NA 3LVBA 2VYQA 2XNJA 3I1FA 1G7SA 3MHPA 4YAOA 1Q7YD 4FWTA 1QFYA 3OW2B 5HXBA 1EFUA 1GAQA 2PLFA 2VNKA 2GPJA 4LBVA 4B3XA 3CCQB 4YAWA 1R5OA 4ZCMA 3CCMB 4B4DA 1VQ6B 4M0LA 1GJRA 4TMZA 1QFJA 4PC2A 4RD3A 2CRVA 1WDTA 1XE1A 4J0QA 1NJID 3P26A 1BX1A 2VZLA 1QUFA 3WXMA 4MYTA 4G1BA 3CCEB 3OJWA 3QFCA 4RCYA 3V76A 3G4SB 4RJLA 4BPRA 1QGYA 2OK8A 1DG1G 1VQPB 4HE5A 4B47A 2BPOA 5TR9A 2BMWA 1E62A 4TMWA 3ZBUA 1ZUNB 2OTLB 4RD1A 1AMOA 3G71B 3CMAB 3CB4A 2RC6A 3WNBA 1EP3B 2BGJA 3WBKA 1VQ4B 2QTZA 5TY0A 4RD4A 4PC1A 1N8RD 4R71A 1W2BB 1B23P 4U9UA 1NDHA 3AVWA 1A8PA 5H59A 1KJZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3W5U A;  3AGQ A;  1G7T A;  3E1Y E;  1KK1 A;  1M1K D;  4C43 A;  5GV8 A;  1S0U A;  1ZM9 A;  1EP2 B;  3W5V A;  3ZBT A;  4LBY A;  3QFS A;  1VQ5 B;  3QSY A;  1HA3 A;  5FA6 A;  4B44 A;  4QFM A;  1GVH A;  4P3Y A;  3AVV A;  5DSZ A;  1AIP A;  1YJW B;  2BN4 A;  1TUI A;  1VQ7 B;  4ZV4 A;  1UMK A;  2XNC A;  1YJN B;  3W5H A;  3CXC B;  1VQN B;  2X3U A;  1FRN A;  2YWG A;  2QA4 B;  1R5N A;  3FJO A;  4Y7C A;  2E1R A;  2QMU A;  1QUE A;  2VNJ A;  4B48 A;  1J9Z A;  1OB2 A;  2PIA A;  4IW3 B;  3CCV B;  2BM0 A;  4RD0 A;  1KK2 A;  1JB9 A;  3CW2 A;  3B82 A;  3AVU A;  1R5B A;  1FRQ A;  1SM4 A;  2BV3 A;  3U2Q A;  1CNE A;  4H9G A;  4F7D A;  3ES9 A;  1S72 B;  4G1V A;  1FNM A;  1QGZ A;  2BSA A;  1JJ2 B;  4RCZ A;  4LC0 A;  3FPK A;  1EFC A;  1KD1 D;  1IB0 A;  3AVT A;  4RD2 A;  3CPW B;  1QG0 A;  3VNV A;  2CND A;  2HMA A;  1KQS B;  1D2E A;  1M90 D;  1YHQ B;  4FK8 A;  1GO2 A;  4FN5 A;  1K8A D;  3CCJ B;  1FND A;  1H85 A;  1JNY A;  1JA1 A;  3QE2 A;  3OZU A;  4NCN A;  4DQK A;  3LO8 A;  4YAF A;  4AF7 A;  4AF6 A;  1YJ9 B;  3CCR B;  3WBJ A;  4PC3 A;  1QVG B;  5H5J A;  1CQX A;  3U6B A;  4ZGQ B;  2YWH A;  1SKQ A;  3E20 A;  3VMF A;  1FNB A;  2D74 A;  3W2I A;  4ZGN B;  2VNI A;  3B8H A;  1ZM4 A;  4PC6 A;  2EIX A;  1KTV A;  3VO1 A;  2YWE A;  5KSW B;  4TMX A;  4RD6 A;  1K9M D;  1F20 A;  2DER A;  3W2G A;  1ZM2 A;  3U6K A;  1GAW A;  1G7R A;  2DEU A;  1FNC A;  3CC4 B;  2HCJ B;  1QFZ A;  1EP1 B;  1BJK A;  4ZCL A;  4Y9R A;  4PC7 A;  3OZV A;  2DET A;  3QFT A;  3W2F A;  4DQL A;  1KRH A;  3MCA A;  2BVN A;  5JBQ A;  3JQR A;  3CCL B;  1N0U A;  3WY9 A;  1BX0 A;  3CCU B;  3OJX A;  3I56 B;  1CNF A;  5GV7 A;  1QH0 A;  2AHO A;  2B7C A;  3AVX A;  3CCS B;  1DAR A;  1OGJ A;  1XB2 A;  1YI2 B;  4TN1 A;  2J7K A;  4YAL A;  3W2H A;  1W34 A;  1YIJ B;  1Q82 D;  2NPF A;  2FX3 A;  3CC2 B;  4Y9U A;  3CRZ A;  3JQQ A;  1D8T A;  5EMN A;  3ZZ0 A;  1QVF B;  1DDG A;  1H42 A;  1EXM A;  1DDI A;  1OGI A;  2BF4 A;  3AGP A;  2DY1 A;  4PGO A;  2VNH A;  2OK7 A;  4M2L A;  4EH1 A;  2EFG A;  1G7C A;  4C0S A;  1TVC A;  4K1X A;  2HDN B;  4YAU A;  1I7P A;  3P27 A;  1ELO A;  2YWF A;  1OB5 A;  3W2E A;  1VQK B;  1JA0 A;  2BGI A;  2QTL A;  1VQ9 B;  1TLL A;  3AVY A;  2C78 A;  2ZIT A;  3ZZU A;  1VQO B;  2QEX B;  1W87 A;  1K73 D;  3VO2 A;  1EWY A;  5TV2 A;  4ZCI A;  2R6H A;  1TTT A;  2B7B A;  4G5G A;  1Q81 D;  3PEN A;  1EFT A;  2QN6 A;  2DCU A;  4YHB A;  1W35 A;  3WNC A;  1N0V C;  3ZZT A;  3CME B;  3I55 B;  5AN9 A;  2BM1 A;  4M53 A;  1QX4 A;  4N3G A;  1U2R A;  3ZC3 A;  4QHY A;  4LBZ A;  2XEX A;  3J81 k;  4Q7J B;  3MMP A;  3JQP A;  1VQ8 B;  4NBS A;  1Q86 D;  1B2R A;  2GQF A;  1F60 A;  3CD6 B;  3SJZ A;  3B78 A;  1KK0 A;  4TMT A;  4AC9 A;  3G6E B;  1GR1 A;  1VQM B;  3OZW A;  4ACB A;  2PMD A;  4UAJ A;  4MYU A;  3CC7 B;  1KC8 D;  3VNU A;  2RC5 A;  1IJF A;  1E64 A;  2B5O A;  1D1N A;  1FDR A;  5THX A;  4B43 A;  1YIT B;  4M1K A;  1IJE A;  1ZM3 A;  4ACA A;  4WQM A;  1QGA A;  4HE6 A;  1E63 A;  3WYA A;  2QDX A;  3WND A;  4P6V F;  4LBW A;  3QFR A;  4M4S A;  2OTJ B;  1KK3 A;  2C77 A;  1BQE A;  1VQL B;  4TMV A;  4N3N A;  3LVB A;  2VYQ A;  2XNJ A;  3I1F A;  1G7S A;  3MHP A;  4YAO A;  1Q7Y D;  4FWT A;  1QFY A;  3OW2 B;  5HXB A;  1EFU A;  1GAQ A;  2PLF A;  2VNK A;  2GPJ A;  4LBV A;  4B3X A;  3CCQ B;  4YAW A;  1R5O A;  4ZCM A;  3CCM B;  4B4D A;  1VQ6 B;  4M0L A;  1GJR A;  4TMZ A;  1QFJ A;  4PC2 A;  4RD3 A;  2CRV A;  1WDT A;  1XE1 A;  4J0Q A;  1NJI D;  3P26 A;  1BX1 A;  2VZL A;  1QUF A;  3WXM A;  4MYT A;  4G1B A;  3CCE B;  3OJW A;  3QFC A;  4RCY A;  3V76 A;  3G4S B;  4RJL A;  4BPR A;  1QGY A;  2OK8 A;  1DG1 G;  1VQP B;  4HE5 A;  4B47 A;  2BPO A;  5TR9 A;  2BMW A;  1E62 A;  4TMW A;  3ZBU A;  1ZUN B;  2OTL B;  4RD1 A;  1AMO A;  3G71 B;  3CMA B;  3CB4 A;  2RC6 A;  3WNB A;  1EP3 B;  2BGJ A;  3WBK A;  1VQ4 B;  2QTZ A;  5TY0 A;  4RD4 A;  4PC1 A;  1N8R D;  4R71 A;  1W2B B;  1B23 P;  4U9U A;  1NDH A;  3AVW A;  1A8P A;  5H59 A;  1KJZ A; 
#chains in the Genus database with same CATH topology
 3W5U A;  1NRK A;  1V5V A;  3AGQ A;  4XOR A;  1G7T A;  1WU8 A;  2FVG A;  4ROX A;  4P9S A;  3V7A A;  3E1Y E;  2X6X A;  4XQF A;  1KK1 A;  1M1K D;  2X6Y A;  5J35 A;  4C43 A;  5GV8 A;  5IYW A;  1HVX A;  1S0U A;  4II3 A;  4B3G A;  4QVA A;  1ZM9 A;  1EP2 B;  5DN6 A;  3W5V A;  3SLD A;  3ZBT A;  2E1B A;  4KKS A;  4LBY A;  3QFS A;  4WZK A;  1VQ5 B;  3QSY A;  3A8K A;  1HA3 A;  5F4O A;  5FA6 A;  1W9X A;  4B44 A;  4QFM A;  4P1V A;  1WOS A;  1WOR A;  1GVH A;  4P3Y A;  3AVV A;  5DSZ A;  1AIP A;  1YJW B;  2BN4 A;  1TUI A;  3BY2 A;  1VQ7 B;  3PA2 A;  4ZV4 A;  1UMK A;  2XNC A;  3VR6 A;  1YJN B;  2DIE A;  3BNW A;  3W5H A;  3CXC B;  1VQN B;  1UD8 A;  4DK0 A;  2X3U A;  1FRN A;  4RPD A;  2ZL6 A;  2YWG A;  2QA4 B;  2R9V A;  1R5N A;  3FJO A;  4E0F A;  4Y7C A;  2E1R A;  3ZPN A;  2QGG A;  4KKT A;  2QMU A;  2ZL5 A;  1UD3 A;  1QUE A;  1WPC A;  3GSI A;  1K28 D;  4G7X A;  2VNJ A;  2VJI A;  4B48 A;  1J9Z A;  1OB2 A;  2ZXH A;  1PKV A;  2PIA A;  4IW3 B;  3CCV B;  2BM0 A;  2V7W A;  4RD0 A;  1KK2 A;  1JB9 A;  1VF7 A;  3CW2 A;  3B82 A;  2JN9 A;  3AVU A;  1W0J A;  1R5B A;  1FRQ A;  2F4N A;  3G05 A;  3CTA A;  3AST A;  2CC2 A;  3Q3A A;  1SM4 A;  2BV3 A;  3U2Q A;  1CNE A;  4H9G A;  4F7D A;  5J3O A;  3BH4 A;  2CW5 A;  3ES9 A;  1S72 B;  4G1V A;  2OBR A;  1P4M A;  2Q6K A;  1FNM A;  1QGZ A;  1T6X A;  4DNR B;  2BSA A;  4X7F A;  1JJ2 B;  4RCZ A;  4LC0 A;  3PA1 A;  3FPK A;  1EFC A;  4WZE A;  2F43 A;  1KD1 D;  1IB0 A;  3AVT A;  1SKY B;  4RD2 A;  3CPW B;  1QG0 A;  3VNV A;  2C4T A;  2CND A;  2HMA A;  1KQS B;  4X0C A;  1D2E A;  1M90 D;  1YHQ B;  2XZL A;  5F4M A;  3D26 A;  4FK8 A;  1GO2 A;  1E3X A;  1RQP A;  4FN5 A;  4G7W A;  1K8A D;  2XND A;  3Q39 A;  3CCJ B;  1FND A;  3BCF A;  1H85 A;  1WTH D;  1JNY A;  1JA1 A;  3PUN A;  3QE2 A;  3OZU A;  4NCN A;  2XOK A;  4DQK A;  3LO8 A;  1UD5 A;  1E79 A;  4YAF A;  2Q6L A;  4AF7 A;  4WWV A;  3R6K A;  2OYN A;  4X05 A;  4AF6 A;  1YJ9 B;  3CCR B;  4P6Y A;  1UD2 A;  2VBU A;  4UZU A;  3WBJ A;  2WYR A;  4PC3 A;  1QVG B;  1NB0 A;  5H5J A;  1CQX A;  4CQJ A;  2GK6 A;  4Z4V A;  2XZO A;  3U6B A;  3CPX A;  4ZGQ B;  5CDF A;  3LQ6 A;  2JDI A;  4XLC A;  2YWH A;  3BCD A;  3LNN A;  3T51 B;  1SKQ A;  4XKW A;  3Q6Q A;  3KEW A;  3E20 A;  2ZBV A;  1WSV A;  1FNB A;  3OOC A;  3VMF A;  3R6J A;  2D74 A;  1PJ5 A;  3W2I A;  4ZGN B;  2F1M A;  2VNI A;  2V7V A;  3ONY A;  3B8H A;  1ZM4 A;  4X7D A;  4PC6 A;  2EIX A;  4OOV A;  2V7X A;  1E1Q A;  1KTV A;  1V0F A;  5L46 A;  3OPO A;  3VO1 A;  5FO1 A;  4Z4S A;  1YLO A;  2YWE A;  2ZXI A;  4HIZ A;  5KSW B;  4TMX A;  4RD6 A;  1K9M D;  2W6I A;  1F20 A;  2DER A;  3W2G A;  2VBV A;  1ZM2 A;  4X06 A;  3U6K A;  4P25 A;  4RM0 A;  1GAW A;  1G7R A;  2DEU A;  4P26 A;  1FNC A;  1WOO A;  3CC4 B;  2HCJ B;  1QFZ A;  1EP1 B;  1BJK A;  2WZN A;  1COW A;  4P12 A;  5IK2 A;  4ZCL A;  4Y9R A;  4PC7 A;  1N07 A;  3OZV A;  5HZB A;  3OEH A;  2DET A;  3QFT A;  2ZTG A;  3W2F A;  4DQL A;  1KRH A;  3ASQ A;  1BPL A;  3MCA A;  2BVN A;  2X8K A;  5JBQ A;  3JQR A;  4AVZ A;  3CCL B;  4XR6 A;  1N0U A;  2F1L A;  4FXU A;  1T6Z A;  4XN0 A;  5B6I A;  1UD6 A;  3BC9 A;  5FIU A;  1VHE A;  3WY9 A;  1PJ7 A;  1BX0 A;  2WPD A;  5FL7 A;  2W6J A;  5BSY A;  3CCU B;  3OJX A;  3I56 B;  1CNF A;  5GV7 A;  1QH0 A;  3SEJ A;  2AHO A;  2B7C A;  2VJJ A;  3ZIA A;  3AVX A;  3CCS B;  1DAR A;  1Y0R A;  1OGJ A;  1XB2 A;  1YI2 B;  4TN1 A;  2J7K A;  2V7Q A;  4YAL A;  3W2H A;  1W34 A;  1IHM A;  1YIJ B;  3A8J A;  1Q82 D;  4JMQ A;  5TRD A;  2NPF A;  5BSX A;  2FX3 A;  4XL9 A;  3CC2 B;  4Y9U A;  4XLH A;  3CRZ A;  3JQQ A;  1N05 A;  1D8T A;  1S4M A;  5EMN A;  3ZZ0 A;  1QVF B;  4QV2 A;  4XOT A;  1DDG A;  3ISX A;  1H42 A;  4XD7 A;  1T5E A;  1EXM A;  1DDI A;  1OGI A;  2BF4 A;  3AGP A;  2DY1 A;  4PGO A;  3OAA A;  2VNH A;  2OK7 A;  2ZZG A;  3ASR A;  4M2L A;  4TSF A;  1RQR A;  2D3L A;  4EH1 A;  4QUZ A;  2GJR A;  2V4D A;  2EFG A;  1H8H A;  1I18 A;  1VHO A;  1G7C A;  1OHH A;  2PE3 A;  2WSS A;  4C0S A;  2OBS A;  4UZF A;  1TVC A;  4K1X A;  4TKO B;  1E43 A;  2HDN B;  4YAU A;  1N06 A;  2CF4 A;  2HLD A;  1I7P A;  3P27 A;  3OEE A;  1ELO A;  2YWF A;  5A89 A;  1OB5 A;  4P2N A;  3W2E A;  3H94 A;  1VQK B;  3CMM A;  1JA0 A;  2BGI A;  2D9R A;  2GRE A;  2C5H A;  2Z6B D;  3Q6R A;  2QTL A;  4X7C A;  2X53 S;  1TLL A;  1VQ9 B;  2C78 A;  3AVY A;  2ZIT A;  3ZZU A;  2QE7 A;  2X6W A;  4OPO A;  4YEJ A;  1VQO B;  2QEX B;  1W87 A;  2ZZE A;  5DS0 A;  3GIR A;  3VO2 A;  1K73 D;  5KNL A;  1EWY A;  3WQZ A;  1XQB A;  2CK3 A;  5TV2 A;  4ZCI A;  2R6H A;  2ZZQ A;  5IYQ A;  1Y0Y A;  1XFO A;  4OP7 A;  1TTT A;  2B7B A;  4G5G A;  2XZP A;  2ZBU A;  1Q81 D;  3PEN A;  4XOP A;  3SJP A;  4P3I A;  2ZL7 A;  4RLZ A;  1EFT A;  2QN6 A;  2DCU A;  4PAB A;  4WZT A;  5E6T A;  4YHB A;  4XMY A;  4XLA A;  1W35 A;  3WNC A;  1KMH A;  1N0V C;  3ZZT A;  1T6Y A;  3CME B;  3I55 B;  4XKV A;  5AN9 A;  4OPS A;  2BM1 A;  1PJ6 A;  2ZTN A;  4M53 A;  3A8I A;  2JJ2 A;  1QX4 A;  2C4U A;  4N3G A;  4RDL A;  1EFR A;  1U2R A;  3ZC3 A;  2D3N A;  4QHY A;  4LBZ A;  2XEX A;  3J81 k;  4Q7J B;  4XNF A;  3MMP A;  3GVJ A;  3JQP A;  1VQ8 B;  4NBS A;  1Q86 D;  3Q38 A;  1B2R A;  2GQF A;  1F60 A;  2OBT A;  1W0K A;  3CD6 B;  1H8E A;  3SJZ A;  3CP2 A;  3RY8 A;  3B78 A;  5KW9 A;  1FX0 A;  1VLO A;  1KK0 A;  4TMT A;  4AC9 A;  3G6E B;  5HZA A;  4RDJ A;  3CP8 A;  2WR8 A;  4WZL A;  1GR1 A;  1VQM B;  3OZW A;  4ACB A;  4G6I A;  2PMD A;  4UAJ A;  4MYU A;  5HKK A;  3KL9 A;  2GJP A;  4DNT B;  2Q6O A;  5A8A A;  1BLI A;  3JU4 A;  3T56 B;  3CC7 B;  1KC8 D;  2X0K A;  3VNU A;  2RC5 A;  2JIZ A;  1YX2 A;  1IJF A;  1KZL A;  4DK1 A;  3ONU A;  1BMF A;  4UZE A;  1E64 A;  3LQE A;  5IYR A;  2B5O A;  2DYI A;  3OKX A;  1FDR A;  4Z4Y A;  1D1N A;  4X7E A;  5THX A;  1NBM A;  4XON A;  4B43 A;  1YIT B;  4M1K A;  1IJE A;  3A1P A;  1ZM3 A;  4TT3 A;  4ACA A;  4WQM A;  4L8J A;  2VBS A;  5FNZ A;  1UD4 A;  2LZJ A;  3OP1 A;  1QGA A;  3CES A;  3A3B A;  2C2W A;  4HE6 A;  1E63 A;  3WYA A;  2QDX A;  3GQB A;  4XN3 A;  4P6V F;  3WND A;  4Z4R A;  4LBW A;  3QFR A;  3NE5 B;  4NNJ A;  2I1L A;  4M4S A;  3OFN A;  2OTJ B;  4RDK A;  1KK3 A;  3OW7 A;  2C77 A;  2Q6I A;  4PAA A;  4Z4Z A;  1BQE A;  2V31 A;  5IYP A;  5A88 A;  5IYN A;  2C5B A;  1VQL B;  4TMV A;  2VBT A;  4N3N A;  3LVB A;  2KVO A;  2VYQ A;  2XNJ A;  5F4J A;  3OE7 A;  1N08 A;  3I1F A;  1G7S A;  3MHP A;  4YXW A;  2WZP P;  4OOX A;  4YAO A;  3ASP A;  3PUM A;  1Q7Y D;  2V7T A;  5FO0 A;  3SLN A;  4FWT A;  1QFY A;  4ASU A;  3OW2 B;  1KJZ A;  5HXB A;  1EFU A;  1GAQ A;  2X85 A;  2PLF A;  2JJ1 A;  3GVL A;  1HZE A;  2VNK A;  2GPJ A;  4LBV A;  3SKB A;  1WOP A;  4YAW A;  4B3X A;  3CCQ B;  1R5O A;  1E3Z A;  4RPB A;  4B3F X;  4ZCM A;  3CCM B;  2CBX A;  4B4D A;  1VQ6 B;  4M0L A;  1GJR A;  2GK7 A;  2M5S A;  4P22 A;  2XGJ A;  4XLE A;  1VJS A;  4Z4U A;  4TMZ A;  1QFJ A;  4PC2 A;  4RD3 A;  2CRV A;  1WDT A;  1XE1 A;  4GQN A;  3A35 A;  4J0Q A;  5LMZ A;  3BY1 A;  3HAG A;  3P26 A;  1NJI D;  4X8I A;  1MAB A;  4Z4T A;  1BX1 A;  2VZL A;  1WP6 A;  3H9N A;  1QUF A;  4YEL A;  3WXM A;  4MYT A;  3GVK A;  4II2 A;  4Z4W A;  3T53 B;  4G1B A;  1E1R A;  1OB0 A;  4OPV A;  3CCE B;  2WJV A;  4KKU A;  3OJW A;  3QFC A;  2GJK A;  2WJY A;  4RCY A;  1I8D A;  2P3M A;  1V0E A;  3A3G A;  3V76 A;  3G4S B;  4RJL A;  3ZUG A;  2ZZF A;  1NB9 A;  1QGY A;  4BPR A;  1WSR A;  2OK8 A;  1DG1 G;  1MRZ A;  1VQP B;  4HE5 A;  4B47 A;  2BPO A;  4XM3 A;  5TR9 A;  3PVD A;  2BMW A;  1E62 A;  4TMW A;  3ZBU A;  1ZUN B;  2OTL B;  3BQJ A;  4RD1 A;  1AMO A;  3G71 B;  4QVJ A;  3FKS A;  3CMA B;  3CB4 A;  2RC6 A;  1VLY A;  3WNB A;  2DOG A;  1EP3 B;  2BGJ A;  3DDY A;  3FPP A;  3ASS A;  3WBK A;  1VQ4 B;  4OOS A;  1Q9S A;  2QTZ A;  5TY0 A;  4Z1M A;  4PC1 A;  4RD4 A;  4X07 A;  1N8R D;  4R71 A;  4XLF A;  1W2B B;  2V7U A;  1B23 P;  4U9U A;  1NDH A;  3AVW A;  1A8P A;  5H59 A;  2NV4 A; 
#chains in the Genus database with same CATH homology
 3W5U A;  3AGQ A;  1G7T A;  3E1Y E;  1KK1 A;  1M1K D;  4C43 A;  5GV8 A;  1S0U A;  1ZM9 A;  1EP2 B;  3W5V A;  3ZBT A;  4LBY A;  3QFS A;  1VQ5 B;  3QSY A;  1HA3 A;  5FA6 A;  4B44 A;  4QFM A;  1GVH A;  4P3Y A;  3AVV A;  5DSZ A;  1AIP A;  1YJW B;  2BN4 A;  1TUI A;  1VQ7 B;  4ZV4 A;  1UMK A;  2XNC A;  1YJN B;  3W5H A;  3CXC B;  1VQN B;  2X3U A;  1FRN A;  2YWG A;  2QA4 B;  1R5N A;  3FJO A;  4Y7C A;  2E1R A;  2QMU A;  1QUE A;  2VNJ A;  4B48 A;  1J9Z A;  1OB2 A;  2PIA A;  4IW3 B;  3CCV B;  2BM0 A;  4RD0 A;  1KK2 A;  1JB9 A;  3CW2 A;  3B82 A;  3AVU A;  1R5B A;  1FRQ A;  1SM4 A;  2BV3 A;  3U2Q A;  1CNE A;  4H9G A;  4F7D A;  3ES9 A;  1S72 B;  4G1V A;  1FNM A;  1QGZ A;  2BSA A;  1JJ2 B;  4RCZ A;  4LC0 A;  3FPK A;  1EFC A;  1KD1 D;  1IB0 A;  3AVT A;  4RD2 A;  3CPW B;  1QG0 A;  3VNV A;  2CND A;  2HMA A;  1KQS B;  1D2E A;  1M90 D;  1YHQ B;  4FK8 A;  1GO2 A;  4FN5 A;  1K8A D;  3CCJ B;  1FND A;  1H85 A;  1JNY A;  1JA1 A;  3QE2 A;  3OZU A;  4NCN A;  4DQK A;  3LO8 A;  4YAF A;  4AF7 A;  4AF6 A;  1YJ9 B;  3CCR B;  3WBJ A;  4PC3 A;  1QVG B;  5H5J A;  1CQX A;  3U6B A;  4ZGQ B;  2YWH A;  1SKQ A;  3E20 A;  3VMF A;  1FNB A;  2D74 A;  3W2I A;  4ZGN B;  2VNI A;  3B8H A;  1ZM4 A;  4PC6 A;  2EIX A;  1KTV A;  3VO1 A;  2YWE A;  5KSW B;  4TMX A;  4RD6 A;  1K9M D;  1F20 A;  2DER A;  3W2G A;  1ZM2 A;  3U6K A;  1GAW A;  1G7R A;  2DEU A;  1FNC A;  3CC4 B;  2HCJ B;  1QFZ A;  1EP1 B;  1BJK A;  4ZCL A;  4Y9R A;  4PC7 A;  3OZV A;  2DET A;  3QFT A;  3W2F A;  4DQL A;  1KRH A;  3MCA A;  2BVN A;  5JBQ A;  3JQR A;  3CCL B;  1N0U A;  3WY9 A;  1BX0 A;  3CCU B;  3OJX A;  3I56 B;  1CNF A;  5GV7 A;  1QH0 A;  2AHO A;  2B7C A;  3AVX A;  3CCS B;  1DAR A;  1OGJ A;  1XB2 A;  1YI2 B;  4TN1 A;  2J7K A;  4YAL A;  3W2H A;  1W34 A;  1YIJ B;  1Q82 D;  2NPF A;  2FX3 A;  3CC2 B;  4Y9U A;  3CRZ A;  3JQQ A;  1D8T A;  5EMN A;  3ZZ0 A;  1QVF B;  1DDG A;  1H42 A;  1EXM A;  1DDI A;  1OGI A;  2BF4 A;  3AGP A;  2DY1 A;  4PGO A;  2VNH A;  2OK7 A;  4M2L A;  4EH1 A;  2EFG A;  1G7C A;  4C0S A;  1TVC A;  4K1X A;  2HDN B;  4YAU A;  1I7P A;  3P27 A;  1ELO A;  2YWF A;  1OB5 A;  3W2E A;  1VQK B;  1JA0 A;  2BGI A;  2QTL A;  1VQ9 B;  1TLL A;  3AVY A;  2C78 A;  2ZIT A;  3ZZU A;  1VQO B;  2QEX B;  1W87 A;  1K73 D;  3VO2 A;  1EWY A;  5TV2 A;  4ZCI A;  2R6H A;  1TTT A;  2B7B A;  4G5G A;  1Q81 D;  3PEN A;  1EFT A;  2QN6 A;  2DCU A;  4YHB A;  1W35 A;  3WNC A;  1N0V C;  3ZZT A;  3CME B;  3I55 B;  5AN9 A;  2BM1 A;  4M53 A;  1QX4 A;  4N3G A;  1U2R A;  3ZC3 A;  4QHY A;  4LBZ A;  2XEX A;  3J81 k;  4Q7J B;  3MMP A;  3JQP A;  1VQ8 B;  4NBS A;  1Q86 D;  1B2R A;  2GQF A;  1F60 A;  3CD6 B;  3SJZ A;  3B78 A;  1KK0 A;  4TMT A;  4AC9 A;  3G6E B;  1GR1 A;  1VQM B;  3OZW A;  4ACB A;  2PMD A;  4UAJ A;  4MYU A;  3CC7 B;  1KC8 D;  3VNU A;  2RC5 A;  1IJF A;  1E64 A;  2B5O A;  1D1N A;  1FDR A;  5THX A;  4B43 A;  1YIT B;  4M1K A;  1IJE A;  1ZM3 A;  4ACA A;  4WQM A;  1QGA A;  4HE6 A;  1E63 A;  3WYA A;  2QDX A;  3WND A;  4P6V F;  4LBW A;  3QFR A;  4M4S A;  2OTJ B;  1KK3 A;  2C77 A;  1BQE A;  1VQL B;  4TMV A;  4N3N A;  3LVB A;  2VYQ A;  2XNJ A;  3I1F A;  1G7S A;  3MHP A;  4YAO A;  1Q7Y D;  4FWT A;  1QFY A;  3OW2 B;  5HXB A;  1EFU A;  1GAQ A;  2PLF A;  2VNK A;  2GPJ A;  4LBV A;  4B3X A;  3CCQ B;  4YAW A;  1R5O A;  4ZCM A;  3CCM B;  4B4D A;  1VQ6 B;  4M0L A;  1GJR A;  4TMZ A;  1QFJ A;  4PC2 A;  4RD3 A;  2CRV A;  1WDT A;  1XE1 A;  4J0Q A;  1NJI D;  3P26 A;  1BX1 A;  2VZL A;  1QUF A;  3WXM A;  4MYT A;  4G1B A;  3CCE B;  3OJW A;  3QFC A;  4RCY A;  3V76 A;  3G4S B;  4RJL A;  4BPR A;  1QGY A;  2OK8 A;  1DG1 G;  1VQP B;  4HE5 A;  4B47 A;  2BPO A;  5TR9 A;  2BMW A;  1E62 A;  4TMW A;  3ZBU A;  1ZUN B;  2OTL B;  4RD1 A;  1AMO A;  3G71 B;  3CMA B;  3CB4 A;  2RC6 A;  3WNB A;  1EP3 B;  2BGJ A;  3WBK A;  1VQ4 B;  2QTZ A;  5TY0 A;  4RD4 A;  4PC1 A;  1N8R D;  4R71 A;  1W2B B;  1B23 P;  4U9U A;  1NDH A;  3AVW A;  1A8P A;  5H59 A;  1KJZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...