5HXBA

Cereblon in complex with ddb1, cc-885, and gspt1
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
196
structure length
196
Chain Sequence
PIRLPIVDKYKDMGTVVLGKLESGSICKGQQLVMMPNKHNVEVLGILSDDVETDTVAPGENLKIRLKGIEEEEILPGFILCDPNNLCHSGRTFDAQIVIIEHKSIICPGYNAVLHIHTCIEEVEITALICLVDKKSGEKSKTRPRFVKQDQVCIARLRTAGTICLETFKDFPQMGRFTLRDEGKTIAIGKVLKLVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Eukaryotic peptide chain release factor GTP-binding subunit
publication title A novel cereblon modulator recruits GSPT1 to the CRL4(CRBN) ubiquitin ligase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 27
structure length 196
sequence length 196
chains with identical sequence X
ec nomenclature
pdb deposition date 2016-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03143 GTP_EFTU_D3 Elongation factor Tu C-terminal domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 5hxbA02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 5hxbA01
3W2FA 3WYAA 3AVXA 1TLLA 5FA6A 1QGYA 2OTJB 1N0VC 1FRNA 1HA3A 1FNCA 4YAOA 1EWYA 3CB4A 1KK1A 1QX4A 4IW3B 1JA0A 3W5UA 3ZBTA 3CD6B 1EFCA 3CRZA 2XEXA 1QH0A 4NCNA 4B3XA 4RD2A 3AGPA 2VNHA 4G1BA 2CNDA 1GJRA 4P6VF 4M0LA 4TMZA 1KJZA 4AF6A 1W34A 4YAWA 1YI2B 1F60A 3CMEB 1AMOA 1D1NA 3CC2B 3CCUB 1B2RA 1E63A 1QGAA 1B23P 1I7PA 4NBSA 4RCYA 1W2BB 4FK8A 4Y7CA 2YWEA 1JNYA 3ZBUA 4C0SA 3W2GA 4RD1A 3QFSA 2QTZA 3B78A 1A8PA 1U2RA 2QA4B 3CCRB 1FDRA 2QTLA 4TMTA 3SJZA 3I55B 4HE5A 3AVVA 2OK7A 2QEXB 2VNJA 4RD3A 5TY0A 4QHYA 3MMPA 2BV3A 1J9ZA 3CXCB 1N8RD 1M90D 1VQLB 1OB5A 4G1VA 4B44A 1VQ8B 2QMUA 4PC6A 1QFZA 3ZZUA 4LC0A 3OJWA 2BMWA 1KTVA 3FJOA 3LVBA 1TVCA 3AGQA 1R5BA 1GAQA 2HDNB 2YWFA 4B4DA 3CC4B 1DARA 3ZC3A 1ZUNB 1VQPB 2OTLB 1GAWA 1VQ6B 4ZGQB 3P27A 4PC1A 1GO2A 1FNDA 3CCVB 3QFTA 4PGOA 1KK3A 1GR1A 1ZM2A 1Q7YD 5H5JA 1CQXA 3VO2A 4LBYA 1EFUA 4B43A 1YITB 4Q7JB 2BM0A 3CCSB 1JB9A 3V76A 1VQMB 1EP3B 3WBJA 1ZM3A 1VQOB 1QFJA 2X3UA 1FRQA 1YHQB 4RD4A 4RCZA 2BGIA 2VYQA 1IB0A 1R5OA 3WNDA 3U6KA 4ZV4A 1W87A 3E20A 4ACBA 3E1YE 3CC7B 4M53A 1KK0A 1VQ7B 2DEUA 1YJWB 1SKQA 3B82A 1KRHA 2HMAA 1OGIA 3WNCA 1ELOA 3WXMA 2VNIA 2BM1A 1NDHA 2VZLA 1Q82D 4RJLA 1FNBA 1S0UA 3CW2A 1GVHA 1YJ9B 4BPRA 2B5OA 4C43A 1K73D 1ZM9A 1VQ5B 1QVFB 1VQ9B 2B7BA 1CNFA 1XB2A 2OK8A 5AN9A 4B47A 2FX3A 1EP1B 2HCJB 3W2HA 3W5VA 3WY9A 1YJNB 1AIPA 1KQSB 3OZUA 3AVWA 4QFMA 3LO8A 1N0UA 3MHPA 1QUFA 2D74A 3OZVA 4P3YA 1G7CA 4RD0A 1VQNB 3VNUA 1XE1A 2QN6A 1E62A 3J81k 3CPWB 4UAJA 2EFGA 5H59A 1Q81D 4M1KA 4M2LA 5TV2A 5TR9A 1E64A 2EIXA 3G71B 4M4SA 1OGJA 2E1RA 4J0QA 4MYTA 3AVUA 2PIAA 2DETA 1TTTA 4HE6A 1QG0A 3W2EA 2NPFA 3W5HA 1DG1G 3CMAB 2QDXA 2BF4A 1TUIA 1D8TA 2AHOA 4TMXA 2GPJA 2BVNA 3CCJB 1EFTA 4RD6A 4LBVA 3QFRA 3JQQA 3G6EB 1G7TA 4ZCLA 1W35A 1Q86D 3PENA 3JQRA 4R71A 3JQPA 3OZWA 3CCEB 4LBZA 2RC6A 1IJFA 4Y9RA 1BJKA 3VNVA 2XNJA 1QGZA 4ACAA 4Y9UA 3QSYA 4PC7A 4AC9A 2PLFA 1G7SA 3CCMB 5KSWB 4YALA 5HXBA 3U2QA 1UMKA 3U6BA 1D2EA 3W2IA 4PC3A 1K9MD 2BGJA 5THXA 4WQMA 4DQKA 4YAUA 1JA1A 1WDTA 3WBKA 4F7DA 2GQFA 4H9GA 4B48A 4K1XA 4YAFA 3QE2A 1K8AD 4FN5A 3ZZTA 4PC2A 1EXMA 2VNKA 1JJ2B 5DSZA 2DY1A 3MCAA 2XNCA 4TN1A 1BX0A 4EH1A 3ES9A 4N3NA 2BN4A 1QUEA 1QVGB 4MYUA 5GV8A 1KK2A 5GV7A 1VQKB 1FNMA 4G5GA 3I56B 1OB2A 1EP2B 1M1KD 3ZZ0A 3OW2B 2YWHA 2C78A 2B7CA 2BSAA 3AVYA 3WNBA 3P26A 4TMVA 3CCQB 2RC5A 3QFCA 4N3GA 3G4SB 4TMWA 4U9UA 1ZM4A 3VO1A 3B8HA 4YHBA 4LBWA 1QFYA 1G7RA 3VMFA 2CRVA 1F20A 2J7KA 5EMNA 4ZCMA 1VQ4B 3FPKA 1CNEA 3AVTA 4ZCIA 2DERA 1BX1A 4ZGNB 1DDGA 1KC8D 2C77A 1KD1D 3CCLB 3I1FA 2R6HA 1H42A 3OJXA 4AF7A 2YWGA 5JBQA 1IJEA 4FWTA 1S72B 2DCUA 1R5NA 2BPOA 2ZITA 1H85A 2PMDA 1SM4A 1DDIA 1BQEA 1YIJB 4DQLA 1NJID
chains in the Genus database with same CATH superfamily
2W6JA 2HLDA 3W2FA 3WYAA 3ZUGA 3AVXA 1TLLA 1T6XA 4DNTB 5F4JA 5FA6A 3G05A 5J35A 3PUNA 4XN0A 1QGYA 3OW7A 2OTJB 4GQNA 3SLDA 2XOKA 4PABA 2P3MA 1N0VC 4X0CA 2PE3A 1E3XA 4X7CA 2WZNA 4OP7A 1FRNA 1HA3A 1FNCA 2E1BA 4YAOA 1EWYA 3CB4A 2OYNA 4P22A 1KK1A 1QX4A 4IW3B 1JA0A 4B3FX 3W5UA 3ZBTA 3CD6B 1EFCA 3SLNA 2GJPA 3GVJA 2JJ2A 3CRZA 1KMHA 2XEXA 1QH0A 4XLCA 2ZXHA 4NCNA 5HZBA 4B3XA 4RD2A 3AGPA 2VNHA 4G1BA 2CNDA 4X06A 1GJRA 2F43A 3SEJA 1Y0YA 4P6VF 4M0LA 4TMZA 1N07A 1KJZA 3T53B 4AF6A 2Q6KA 1W34A 4YAWA 4OOVA 1YI2B 1F60A 1RQPA 4X05A 1AMOA 3CMEB 3CC2B 1B2RA 3CCUB 1D1NA 1E63A 1QGAA 1SKYB 1B23P 1I7PA 4NBSA 4RCYA 1W2BB 5IYRA 4FK8A 3A8KA 3BCDA 4Y7CA 2YWEA 1JNYA 3ZBUA 4C0SA 3BY2A 3W2GA 3PUMA 3D26A 4RD1A 3QFSA 2DYIA 3Q6QA 2QTZA 1N08A 3OKXA 3R6KA 4WWVA 3B78A 1A8PA 1U2RA 1WORA 4WZEA 2QA4B 3CCRB 1FDRA 2QTLA 4TMTA 3SJZA 3I55B 4HE5A 4X8IA 2ZXIA 3AVVA 2OK7A 2QEXB 1NRKA 2VJJA 2VNJA 3ONUA 3ZIAA 4RD3A 3OP1A 2VBVA 5TY0A 4QHYA 3BC9A 4ROXA 3MMPA 2F4NA 3CPXA 2BV3A 1UD5A 2F1LA 2JDIA 1J9ZA 3CXCB 1N8RD 1M90D 2C2WA 5J3OA 1WOSA 1VQLB 4XLAA 2OBSA 4P26A 1E1QA 4P12A 1OB5A 4G1VA 3VR6A 4B44A 4II2A 4XLFA 3OOCA 4QV2A 3BH4A 2Z6BD 2QMUA 4PC6A 1VQ8B 1QFZA 3ZZUA 4LC0A 3OJWA 3A8IA 5F4MA 1N05A 2BMWA 2V7WA 5FO0A 1KTVA 1WOPA 2ZTNA 3FJOA 2DIEA 3LVBA 1TVCA 3AGQA 1R5BA 1GAQA 2HDNB 1HZEA 2YWFA 4B4DA 2OBRA 1DARA 2JJ1A 3CC4B 3ZC3A 4RPDA 1ZUNB 1VQPB 2OTLB 1GAWA 1VQ6B 4ZGQB 3P27A 4PC1A 1GO2A 1FNDA 3CCVB 4XOTA 3QFTA 4PGOA 1KK3A 1COWA 4X7DA 1UD4A 1W0JA 4YELA 1N06A 5FNZA 1GR1A 3CP2A 4Z4YA 1ZM2A 1Q7YD 3PA2A 5H5JA 3PA1A 1CQXA 4B3GA 4Z4RA 1VF7A 4E0FA 3VO2A 5IK2A 2D3LA 3LQ6A 4G7XA 4LBYA 4CQJA 3T56B 2R9VA 1W0KA 1EFUA 4B43A 1YITB 3ONYA 3KL9A 4Q7JB 2BM0A 3CCSB 1JB9A 3OEHA 3V76A 2M5SA 1T5EA 2JIZA 3OPOA 1VQMB 4XM3A 1EP3B 3WBJA 4L8JA 4TSFA 3Q39A 1ZM3A 3SKBA 4QUZA 1VQOB 1RQRA 1E1RA 1E43A 1QFJA 2X3UA 4RDLA 1FRQA 1YHQB 1NB9A 4RD4A 4RCZA 1PJ6A 2ZL6A 2BGIA 2VYQA 1IB0A 1R5OA 3WNDA 3ASTA 3U6KA 3CTAA 4XONA 4ZV4A 1H8HA 2ZL7A 2LZJA 1W87A 1I18A 3E20A 4ACBA 4XKVA 1UD6A 3E1YE 3CC7B 4M53A 1KK0A 2V7QA 3Q3AA 1VQ7B 1H8EA 4P1VA 2DEUA 1YJWB 1S4MA 1KZLA 1SKQA 2GJRA 1KRHA 2HMAA 2WPDA 3B82A 1OGIA 4OOXA 3WNCA 1ELOA 2GK7A 3WXMA 2VNIA 3ASSA 4RLZA 1W9XA 1VLYA 4P3IA 2BM1A 2ZZFA 3CESA 1NDHA 2JN9A 2VZLA 2ZBUA 1Q82D 1NB0A 3A3BA 5IYNA 4RJLA 1FNBA 4XNFA 1S0UA 3CW2A 1BPLA 1GVHA 4OPSA 2CBXA 3GQBA 3LQEA 2X53S 1YJ9B 4G7WA 1VHEA 2QE7A 2V31A 2V7TA 4BPRA 2B5OA 3JU4A 4C43A 1K73D 1ZM9A 4UZUA 1VQ5B 3OAAA 1QVFB 1VQ9B 2OBTA 5FIUA 2B7BA 3A3GA 2NV4A 3R6JA 1CNFA 1BLIA 1XB2A 2OK8A 5AN9A 5A8AA 4B47A 2FX3A 1EP1B 2HCJB 3W2HA 3W5VA 3WY9A 1YJNB 2X8KA 4XL9A 1AIPA 1IHMA 1MRZA 5FL7A 5IYWA 4RM0A 1KQSB 3OZUA 3AVWA 4QFMA 3LO8A 2V4DA 5L46A 4ASUA 1WSRA 1N0UA 3MHPA 3T51B 1QUFA 3BQJA 2D74A 4TT3A 3OZVA 3OEEA 4P3YA 4RDKA 2Q6IA 2VBSA 2X6WA 1G7CA 4RD0A 1VQNB 3VNUA 2ZZGA 2X6XA 1E3ZA 1XE1A 2QN6A 4OPVA 3SJPA 2VBTA 1E62A 3J81k 3CPWB 4UAJA 4X7FA 5BSXA 2EFGA 2Q6LA 5H59A 1BMFA 4M1KA 4UZEA 4XN3A 1Q81D 4M2LA 5TV2A 2WJVA 5DN6A 3CMMA 5TR9A 5BSYA 1E64A 2EIXA 3G71B 4M4SA 1OGJA 2E1RA 3Q38A 4XQFA 4Z4UA 4FXUA 2WZPP 4J0QA 4MYTA 3AVUA 4RPBA 2PIAA 5HZAA 2DETA 1TTTA 4HE6A 1QG0A 3W2EA 5KW9A 2V7VA 4DK0A 2NPFA 3W5HA 1DG1G 4WZKA 2XZOA 3CMAB 1V0EA 2WJYA 3A8JA 2CF4A 2QDXA 2CW5A 1OB0A 3A1PA 5LMZA 2BF4A 1TUIA 1D8TA 2AHOA 4JMQA 4TMXA 2GPJA 3BY1A 3GVLA 4G6IA 3ASRA 2BVNA 3CCJB 2ZL5A 5HKKA 1PJ7A 1EFTA 4PAAA 4RD6A 4LBVA 3ZPNA 2X0KA 2C5HA 3JQQA 3QFRA 3V7AA 3G6EB 1G7TA 1PKVA 4ZCLA 1T6ZA 1W35A 3FPPA 4P2NA 1T6YA 1Q86D 3PENA 3JQRA 4R71A 1OHHA 4RDJA 2CC2A 3JQPA 1VJSA 1WP6A 3GSIA 1UD3A 1V5VA 3OZWA 2VBUA 3CCEB 4LBZA 1FX0A 2RC6A 1IJFA 4Y9RA 2GJKA 1BJKA 4OOSA 3VNVA 2XNJA 1QGZA 4ACAA 2WSSA 4Y9UA 4Z4TA 4TKOB 4HIZA 3QSYA 4PC7A 4AC9A 2PLFA 1G7SA 3H94A 4WZTA 4Z1MA 3CCMB 5KNLA 5KSWB 4YALA 5HXBA 3DDYA 4X7EA 5FO1A 2D9RA 3OFNA 3A35A 3U2QA 2D3NA 1UMKA 3U6BA 1D2EA 3BNWA 4II3A 3W2IA 4PC3A 1K9MD 2BGJA 4XR6A 5THXA 2X6YA 4WQMA 4DQKA 4YAUA 5TRDA 1WOOA 1JA1A 1WDTA 3H9NA 4QVAA 3WBKA 1YX2A 4QVJA 4XLHA 4F7DA 2GQFA 4H9GA 1E79A 4B48A 3ASQA 4K1XA 4YAFA 3QE2A 1K8AD 4FN5A 3OE7A 3ZZTA 4PC2A 4KKUA 4P6YA 1EXMA 1Q9SA 2VNKA 1VHOA 4P9SA 4YXWA 2FVGA 1JJ2B 3GVKA 5DSZA 2DY1A 3MCAA 2XNCA 4TN1A 1BX0A 5CDFA 4EH1A 1HVXA 3ES9A 1WPCA 4N3NA 1P4MA 2X85A 2BN4A 1QUEA 2C4UA 4DNRB 4MYUA 5GV8A 1QVGB 2VJIA 3HAGA 2C5BA 1KK2A 5GV7A 2I1LA 1VQKB 1FNMA 4G5GA 5A89A 3I56B 1OB2A 3NE5B 1EP2B 3ISXA 1M1KD 3ZZ0A 3OW2B 1V0FA 2YWHA 2C78A 2ZTGA 1WSVA 3CP8A 4XORA 1XFOA 1NBMA 2B7CA 2BSAA 5F4OA 1EFRA 2Q6OA 3GIRA 3PVDA 4NNJA 2XZPA 2V7XA 4AVZA 4Z4WA 2WYRA 3WQZA 3AVYA 4Z4SA 2CK3A 3WNBA 3P26A 4TMVA 3Q6RA 3CCQB 1XQBA 2RC5A 3QFCA 4X07A 4N3GA 3G4SB 2W6IA 4TMWA 2F1MA 4U9UA 2C4TA 1ZM4A 2GK6A 5B6IA 4WZLA 3VO1A 3B8HA 2ZZQA 1PJ5A 2KVOA 2ZBVA 4YHBA 4LBWA 4XLEA 3KEWA 2GREA 1QFYA 1G7RA 3VMFA 3ASPA 1I8DA 5IYQA 2CRVA 1F20A 2J7KA 5EMNA 4ZCMA 1VQ4B 2XNDA 3FPKA 1WTHD 1CNEA 1UD8A 3AVTA 5DS0A 1UD2A 4ZCIA 2ZZEA 5E6TA 2DOGA 2DERA 1BX1A 1K28D 4ZGNB 3RY8A 3BCFA 2QGGA 1VLOA 1DDGA 1KC8D 2C77A 3FKSA 3LNNA 1KD1D 4XD7A 3CCLB 1MABA 1WU8A 3I1FA 2R6HA 5IYPA 1H42A 4XMYA 2XGJA 3OJXA 4AF7A 4DK1A 4UZFA 2XZLA 2YWGA 4KKSA 5JBQA 1IJEA 5A88A 4Z4ZA 1Y0RA 4KKTA 4XKWA 2V7UA 4XOPA 4FWTA 1S72B 4YEJA 2DCUA 1R5NA 1YLOA 2BPOA 2WR8A 2ZITA 1H85A 2PMDA 4P25A 1SM4A 1DDIA 1BQEA 1YIJB 4OPOA 4DQLA 1NJID 4Z4VA
chains in the Genus database with same CATH topology
3W2FA 3WYAA 3AVXA 1TLLA 5FA6A 1QGYA 2OTJB 1N0VC 1FRNA 1HA3A 1FNCA 4YAOA 1EWYA 3CB4A 1KK1A 1QX4A 4IW3B 1JA0A 3W5UA 3ZBTA 3CD6B 1EFCA 3CRZA 2XEXA 1QH0A 4NCNA 4B3XA 4RD2A 3AGPA 2VNHA 4G1BA 2CNDA 1GJRA 4P6VF 4M0LA 4TMZA 1KJZA 4AF6A 1W34A 4YAWA 1YI2B 1F60A 3CMEB 1AMOA 1D1NA 3CC2B 3CCUB 1B2RA 1E63A 1QGAA 1B23P 1I7PA 4NBSA 4RCYA 1W2BB 4FK8A 4Y7CA 2YWEA 1JNYA 3ZBUA 4C0SA 3W2GA 4RD1A 3QFSA 2QTZA 3B78A 1A8PA 1U2RA 2QA4B 3CCRB 1FDRA 2QTLA 4TMTA 3SJZA 3I55B 4HE5A 3AVVA 2OK7A 2QEXB 2VNJA 4RD3A 5TY0A 4QHYA 3MMPA 2BV3A 1J9ZA 3CXCB 1N8RD 1M90D 1VQLB 1OB5A 4G1VA 4B44A 1VQ8B 2QMUA 4PC6A 1QFZA 3ZZUA 4LC0A 3OJWA 2BMWA 1KTVA 3FJOA 3LVBA 1TVCA 3AGQA 1R5BA 1GAQA 2HDNB 2YWFA 4B4DA 3CC4B 1DARA 3ZC3A 1ZUNB 1VQPB 2OTLB 1GAWA 1VQ6B 4ZGQB 3P27A 4PC1A 1GO2A 1FNDA 3CCVB 3QFTA 4PGOA 1KK3A 1GR1A 1ZM2A 1Q7YD 5H5JA 1CQXA 3VO2A 4LBYA 1EFUA 4B43A 1YITB 4Q7JB 2BM0A 3CCSB 1JB9A 3V76A 1VQMB 1EP3B 3WBJA 1ZM3A 1VQOB 1QFJA 2X3UA 1FRQA 1YHQB 4RD4A 4RCZA 2BGIA 2VYQA 1IB0A 1R5OA 3WNDA 3U6KA 4ZV4A 1W87A 3E20A 4ACBA 3E1YE 3CC7B 4M53A 1KK0A 1VQ7B 2DEUA 1YJWB 1SKQA 3B82A 1KRHA 2HMAA 1OGIA 3WNCA 1ELOA 3WXMA 2VNIA 2BM1A 1NDHA 2VZLA 1Q82D 4RJLA 1FNBA 1S0UA 3CW2A 1GVHA 1YJ9B 4BPRA 2B5OA 4C43A 1K73D 1ZM9A 1VQ5B 1QVFB 1VQ9B 2B7BA 1CNFA 1XB2A 2OK8A 5AN9A 4B47A 2FX3A 1EP1B 2HCJB 3W2HA 3W5VA 3WY9A 1YJNB 1AIPA 1KQSB 3OZUA 3AVWA 4QFMA 3LO8A 1N0UA 3MHPA 1QUFA 2D74A 3OZVA 4P3YA 1G7CA 4RD0A 1VQNB 3VNUA 1XE1A 2QN6A 1E62A 3J81k 3CPWB 4UAJA 2EFGA 5H59A 1Q81D 4M1KA 4M2LA 5TV2A 5TR9A 1E64A 2EIXA 3G71B 4M4SA 1OGJA 2E1RA 4J0QA 4MYTA 3AVUA 2PIAA 2DETA 1TTTA 4HE6A 1QG0A 3W2EA 2NPFA 3W5HA 1DG1G 3CMAB 2QDXA 2BF4A 1TUIA 1D8TA 2AHOA 4TMXA 2GPJA 2BVNA 3CCJB 1EFTA 4RD6A 4LBVA 3QFRA 3JQQA 3G6EB 1G7TA 4ZCLA 1W35A 1Q86D 3PENA 3JQRA 4R71A 3JQPA 3OZWA 3CCEB 4LBZA 2RC6A 1IJFA 4Y9RA 1BJKA 3VNVA 2XNJA 1QGZA 4ACAA 4Y9UA 3QSYA 4PC7A 4AC9A 2PLFA 1G7SA 3CCMB 5KSWB 4YALA 5HXBA 3U2QA 1UMKA 3U6BA 1D2EA 3W2IA 4PC3A 1K9MD 2BGJA 5THXA 4WQMA 4DQKA 4YAUA 1JA1A 1WDTA 3WBKA 4F7DA 2GQFA 4H9GA 4B48A 4K1XA 4YAFA 3QE2A 1K8AD 4FN5A 3ZZTA 4PC2A 1EXMA 2VNKA 1JJ2B 5DSZA 2DY1A 3MCAA 2XNCA 4TN1A 1BX0A 4EH1A 3ES9A 4N3NA 2BN4A 1QUEA 1QVGB 4MYUA 5GV8A 1KK2A 5GV7A 1VQKB 1FNMA 4G5GA 3I56B 1OB2A 1EP2B 1M1KD 3ZZ0A 3OW2B 2YWHA 2C78A 2B7CA 2BSAA 3AVYA 3WNBA 3P26A 4TMVA 3CCQB 2RC5A 3QFCA 4N3GA 3G4SB 4TMWA 4U9UA 1ZM4A 3VO1A 3B8HA 4YHBA 4LBWA 1QFYA 1G7RA 3VMFA 2CRVA 1F20A 2J7KA 5EMNA 4ZCMA 1VQ4B 3FPKA 1CNEA 3AVTA 4ZCIA 2DERA 1BX1A 4ZGNB 1DDGA 1KC8D 2C77A 1KD1D 3CCLB 3I1FA 2R6HA 1H42A 3OJXA 4AF7A 2YWGA 5JBQA 1IJEA 4FWTA 1S72B 2DCUA 1R5NA 2BPOA 2ZITA 1H85A 2PMDA 1SM4A 1DDIA 1BQEA 1YIJB 4DQLA 1NJID
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3W2F A;  3WYA A;  3AVX A;  1TLL A;  5FA6 A;  1QGY A;  2OTJ B;  1N0V C;  1FRN A;  1HA3 A;  1FNC A;  4YAO A;  1EWY A;  3CB4 A;  1KK1 A;  1QX4 A;  4IW3 B;  1JA0 A;  3W5U A;  3ZBT A;  3CD6 B;  1EFC A;  3CRZ A;  2XEX A;  1QH0 A;  4NCN A;  4B3X A;  4RD2 A;  3AGP A;  2VNH A;  4G1B A;  2CND A;  1GJR A;  4P6V F;  4M0L A;  4TMZ A;  1KJZ A;  4AF6 A;  1W34 A;  4YAW A;  1YI2 B;  1F60 A;  3CME B;  1AMO A;  1D1N A;  3CC2 B;  3CCU B;  1B2R A;  1E63 A;  1QGA A;  1B23 P;  1I7P A;  4NBS A;  4RCY A;  1W2B B;  4FK8 A;  4Y7C A;  2YWE A;  1JNY A;  3ZBU A;  4C0S A;  3W2G A;  4RD1 A;  3QFS A;  2QTZ A;  3B78 A;  1A8P A;  1U2R A;  2QA4 B;  3CCR B;  1FDR A;  2QTL A;  4TMT A;  3SJZ A;  3I55 B;  4HE5 A;  3AVV A;  2OK7 A;  2QEX B;  2VNJ A;  4RD3 A;  5TY0 A;  4QHY A;  3MMP A;  2BV3 A;  1J9Z A;  3CXC B;  1N8R D;  1M90 D;  1VQL B;  1OB5 A;  4G1V A;  4B44 A;  1VQ8 B;  2QMU A;  4PC6 A;  1QFZ A;  3ZZU A;  4LC0 A;  3OJW A;  2BMW A;  1KTV A;  3FJO A;  3LVB A;  1TVC A;  3AGQ A;  1R5B A;  1GAQ A;  2HDN B;  2YWF A;  4B4D A;  3CC4 B;  1DAR A;  3ZC3 A;  1ZUN B;  1VQP B;  2OTL B;  1GAW A;  1VQ6 B;  4ZGQ B;  3P27 A;  4PC1 A;  1GO2 A;  1FND A;  3CCV B;  3QFT A;  4PGO A;  1KK3 A;  1GR1 A;  1ZM2 A;  1Q7Y D;  5H5J A;  1CQX A;  3VO2 A;  4LBY A;  1EFU A;  4B43 A;  1YIT B;  4Q7J B;  2BM0 A;  3CCS B;  1JB9 A;  3V76 A;  1VQM B;  1EP3 B;  3WBJ A;  1ZM3 A;  1VQO B;  1QFJ A;  2X3U A;  1FRQ A;  1YHQ B;  4RD4 A;  4RCZ A;  2BGI A;  2VYQ A;  1IB0 A;  1R5O A;  3WND A;  3U6K A;  4ZV4 A;  1W87 A;  3E20 A;  4ACB A;  3E1Y E;  3CC7 B;  4M53 A;  1KK0 A;  1VQ7 B;  2DEU A;  1YJW B;  1SKQ A;  3B82 A;  1KRH A;  2HMA A;  1OGI A;  3WNC A;  1ELO A;  3WXM A;  2VNI A;  2BM1 A;  1NDH A;  2VZL A;  1Q82 D;  4RJL A;  1FNB A;  1S0U A;  3CW2 A;  1GVH A;  1YJ9 B;  4BPR A;  2B5O A;  4C43 A;  1K73 D;  1ZM9 A;  1VQ5 B;  1QVF B;  1VQ9 B;  2B7B A;  1CNF A;  1XB2 A;  2OK8 A;  5AN9 A;  4B47 A;  2FX3 A;  1EP1 B;  2HCJ B;  3W2H A;  3W5V A;  3WY9 A;  1YJN B;  1AIP A;  1KQS B;  3OZU A;  3AVW A;  4QFM A;  3LO8 A;  1N0U A;  3MHP A;  1QUF A;  2D74 A;  3OZV A;  4P3Y A;  1G7C A;  4RD0 A;  1VQN B;  3VNU A;  1XE1 A;  2QN6 A;  1E62 A;  3J81 k;  3CPW B;  4UAJ A;  2EFG A;  5H59 A;  1Q81 D;  4M1K A;  4M2L A;  5TV2 A;  5TR9 A;  1E64 A;  2EIX A;  3G71 B;  4M4S A;  1OGJ A;  2E1R A;  4J0Q A;  4MYT A;  3AVU A;  2PIA A;  2DET A;  1TTT A;  4HE6 A;  1QG0 A;  3W2E A;  2NPF A;  3W5H A;  1DG1 G;  3CMA B;  2QDX A;  2BF4 A;  1TUI A;  1D8T A;  2AHO A;  4TMX A;  2GPJ A;  2BVN A;  3CCJ B;  1EFT A;  4RD6 A;  4LBV A;  3QFR A;  3JQQ A;  3G6E B;  1G7T A;  4ZCL A;  1W35 A;  1Q86 D;  3PEN A;  3JQR A;  4R71 A;  3JQP A;  3OZW A;  3CCE B;  4LBZ A;  2RC6 A;  1IJF A;  4Y9R A;  1BJK A;  3VNV A;  2XNJ A;  1QGZ A;  4ACA A;  4Y9U A;  3QSY A;  4PC7 A;  4AC9 A;  2PLF A;  1G7S A;  3CCM B;  5KSW B;  4YAL A;  5HXB A;  3U2Q A;  1UMK A;  3U6B A;  1D2E A;  3W2I A;  4PC3 A;  1K9M D;  2BGJ A;  5THX A;  4WQM A;  4DQK A;  4YAU A;  1JA1 A;  1WDT A;  3WBK A;  4F7D A;  2GQF A;  4H9G A;  4B48 A;  4K1X A;  4YAF A;  3QE2 A;  1K8A D;  4FN5 A;  3ZZT A;  4PC2 A;  1EXM A;  2VNK A;  1JJ2 B;  5DSZ A;  2DY1 A;  3MCA A;  2XNC A;  4TN1 A;  1BX0 A;  4EH1 A;  3ES9 A;  4N3N A;  2BN4 A;  1QUE A;  1QVG B;  4MYU A;  5GV8 A;  1KK2 A;  5GV7 A;  1VQK B;  1FNM A;  4G5G A;  3I56 B;  1OB2 A;  1EP2 B;  1M1K D;  3ZZ0 A;  3OW2 B;  2YWH A;  2C78 A;  2B7C A;  2BSA A;  3AVY A;  3WNB A;  3P26 A;  4TMV A;  3CCQ B;  2RC5 A;  3QFC A;  4N3G A;  3G4S B;  4TMW A;  4U9U A;  1ZM4 A;  3VO1 A;  3B8H A;  4YHB A;  4LBW A;  1QFY A;  1G7R A;  3VMF A;  2CRV A;  1F20 A;  2J7K A;  5EMN A;  4ZCM A;  1VQ4 B;  3FPK A;  1CNE A;  3AVT A;  4ZCI A;  2DER A;  1BX1 A;  4ZGN B;  1DDG A;  1KC8 D;  2C77 A;  1KD1 D;  3CCL B;  3I1F A;  2R6H A;  1H42 A;  3OJX A;  4AF7 A;  2YWG A;  5JBQ A;  1IJE A;  4FWT A;  1S72 B;  2DCU A;  1R5N A;  2BPO A;  2ZIT A;  1H85 A;  2PMD A;  1SM4 A;  1DDI A;  1BQE A;  1YIJ B;  4DQL A;  1NJI D; 
#chains in the Genus database with same CATH topology
 2W6J A;  2HLD A;  3W2F A;  3WYA A;  3ZUG A;  3AVX A;  1TLL A;  1T6X A;  4DNT B;  5F4J A;  5FA6 A;  3G05 A;  5J35 A;  3PUN A;  4XN0 A;  1QGY A;  3OW7 A;  2OTJ B;  4GQN A;  3SLD A;  2XOK A;  4PAB A;  2P3M A;  1N0V C;  4X0C A;  2PE3 A;  1E3X A;  4X7C A;  2WZN A;  4OP7 A;  1FRN A;  1HA3 A;  1FNC A;  2E1B A;  4YAO A;  1EWY A;  3CB4 A;  2OYN A;  4P22 A;  1KK1 A;  1QX4 A;  4IW3 B;  1JA0 A;  4B3F X;  3W5U A;  3ZBT A;  3CD6 B;  1EFC A;  3SLN A;  2GJP A;  3GVJ A;  2JJ2 A;  3CRZ A;  1KMH A;  2XEX A;  1QH0 A;  4XLC A;  2ZXH A;  4NCN A;  5HZB A;  4B3X A;  4RD2 A;  3AGP A;  2VNH A;  4G1B A;  2CND A;  4X06 A;  1GJR A;  2F43 A;  3SEJ A;  1Y0Y A;  4P6V F;  4M0L A;  4TMZ A;  1N07 A;  1KJZ A;  3T53 B;  4AF6 A;  2Q6K A;  1W34 A;  4YAW A;  4OOV A;  1YI2 B;  1F60 A;  1RQP A;  4X05 A;  1AMO A;  3CME B;  3CC2 B;  1B2R A;  3CCU B;  1D1N A;  1E63 A;  1QGA A;  1SKY B;  1B23 P;  1I7P A;  4NBS A;  4RCY A;  1W2B B;  5IYR A;  4FK8 A;  3A8K A;  3BCD A;  4Y7C A;  2YWE A;  1JNY A;  3ZBU A;  4C0S A;  3BY2 A;  3W2G A;  3PUM A;  3D26 A;  4RD1 A;  3QFS A;  2DYI A;  3Q6Q A;  2QTZ A;  1N08 A;  3OKX A;  3R6K A;  4WWV A;  3B78 A;  1A8P A;  1U2R A;  1WOR A;  4WZE A;  2QA4 B;  3CCR B;  1FDR A;  2QTL A;  4TMT A;  3SJZ A;  3I55 B;  4HE5 A;  4X8I A;  2ZXI A;  3AVV A;  2OK7 A;  2QEX B;  1NRK A;  2VJJ A;  2VNJ A;  3ONU A;  3ZIA A;  4RD3 A;  3OP1 A;  2VBV A;  5TY0 A;  4QHY A;  3BC9 A;  4ROX A;  3MMP A;  2F4N A;  3CPX A;  2BV3 A;  1UD5 A;  2F1L A;  2JDI A;  1J9Z A;  3CXC B;  1N8R D;  1M90 D;  2C2W A;  5J3O A;  1WOS A;  1VQL B;  4XLA A;  2OBS A;  4P26 A;  1E1Q A;  4P12 A;  1OB5 A;  4G1V A;  3VR6 A;  4B44 A;  4II2 A;  4XLF A;  3OOC A;  4QV2 A;  3BH4 A;  2Z6B D;  2QMU A;  4PC6 A;  1VQ8 B;  1QFZ A;  3ZZU A;  4LC0 A;  3OJW A;  3A8I A;  5F4M A;  1N05 A;  2BMW A;  2V7W A;  5FO0 A;  1KTV A;  1WOP A;  2ZTN A;  3FJO A;  2DIE A;  3LVB A;  1TVC A;  3AGQ A;  1R5B A;  1GAQ A;  2HDN B;  1HZE A;  2YWF A;  4B4D A;  2OBR A;  1DAR A;  2JJ1 A;  3CC4 B;  3ZC3 A;  4RPD A;  1ZUN B;  1VQP B;  2OTL B;  1GAW A;  1VQ6 B;  4ZGQ B;  3P27 A;  4PC1 A;  1GO2 A;  1FND A;  3CCV B;  4XOT A;  3QFT A;  4PGO A;  1KK3 A;  1COW A;  4X7D A;  1UD4 A;  1W0J A;  4YEL A;  1N06 A;  5FNZ A;  1GR1 A;  3CP2 A;  4Z4Y A;  1ZM2 A;  1Q7Y D;  3PA2 A;  5H5J A;  3PA1 A;  1CQX A;  4B3G A;  4Z4R A;  1VF7 A;  4E0F A;  3VO2 A;  5IK2 A;  2D3L A;  3LQ6 A;  4G7X A;  4LBY A;  4CQJ A;  3T56 B;  2R9V A;  1W0K A;  1EFU A;  4B43 A;  1YIT B;  3ONY A;  3KL9 A;  4Q7J B;  2BM0 A;  3CCS B;  1JB9 A;  3OEH A;  3V76 A;  2M5S A;  1T5E A;  2JIZ A;  3OPO A;  1VQM B;  4XM3 A;  1EP3 B;  3WBJ A;  4L8J A;  4TSF A;  3Q39 A;  1ZM3 A;  3SKB A;  4QUZ A;  1VQO B;  1RQR A;  1E1R A;  1E43 A;  1QFJ A;  2X3U A;  4RDL A;  1FRQ A;  1YHQ B;  1NB9 A;  4RD4 A;  4RCZ A;  1PJ6 A;  2ZL6 A;  2BGI A;  2VYQ A;  1IB0 A;  1R5O A;  3WND A;  3AST A;  3U6K A;  3CTA A;  4XON A;  4ZV4 A;  1H8H A;  2ZL7 A;  2LZJ A;  1W87 A;  1I18 A;  3E20 A;  4ACB A;  4XKV A;  1UD6 A;  3E1Y E;  3CC7 B;  4M53 A;  1KK0 A;  2V7Q A;  3Q3A A;  1VQ7 B;  1H8E A;  4P1V A;  2DEU A;  1YJW B;  1S4M A;  1KZL A;  1SKQ A;  2GJR A;  1KRH A;  2HMA A;  2WPD A;  3B82 A;  1OGI A;  4OOX A;  3WNC A;  1ELO A;  2GK7 A;  3WXM A;  2VNI A;  3ASS A;  4RLZ A;  1W9X A;  1VLY A;  4P3I A;  2BM1 A;  2ZZF A;  3CES A;  1NDH A;  2JN9 A;  2VZL A;  2ZBU A;  1Q82 D;  1NB0 A;  3A3B A;  5IYN A;  4RJL A;  1FNB A;  4XNF A;  1S0U A;  3CW2 A;  1BPL A;  1GVH A;  4OPS A;  2CBX A;  3GQB A;  3LQE A;  2X53 S;  1YJ9 B;  4G7W A;  1VHE A;  2QE7 A;  2V31 A;  2V7T A;  4BPR A;  2B5O A;  3JU4 A;  4C43 A;  1K73 D;  1ZM9 A;  4UZU A;  1VQ5 B;  3OAA A;  1QVF B;  1VQ9 B;  2OBT A;  5FIU A;  2B7B A;  3A3G A;  2NV4 A;  3R6J A;  1CNF A;  1BLI A;  1XB2 A;  2OK8 A;  5AN9 A;  5A8A A;  4B47 A;  2FX3 A;  1EP1 B;  2HCJ B;  3W2H A;  3W5V A;  3WY9 A;  1YJN B;  2X8K A;  4XL9 A;  1AIP A;  1IHM A;  1MRZ A;  5FL7 A;  5IYW A;  4RM0 A;  1KQS B;  3OZU A;  3AVW A;  4QFM A;  3LO8 A;  2V4D A;  5L46 A;  4ASU A;  1WSR A;  1N0U A;  3MHP A;  3T51 B;  1QUF A;  3BQJ A;  2D74 A;  4TT3 A;  3OZV A;  3OEE A;  4P3Y A;  4RDK A;  2Q6I A;  2VBS A;  2X6W A;  1G7C A;  4RD0 A;  1VQN B;  3VNU A;  2ZZG A;  2X6X A;  1E3Z A;  1XE1 A;  2QN6 A;  4OPV A;  3SJP A;  2VBT A;  1E62 A;  3J81 k;  3CPW B;  4UAJ A;  4X7F A;  5BSX A;  2EFG A;  2Q6L A;  5H59 A;  1BMF A;  4M1K A;  4UZE A;  4XN3 A;  1Q81 D;  4M2L A;  5TV2 A;  2WJV A;  5DN6 A;  3CMM A;  5TR9 A;  5BSY A;  1E64 A;  2EIX A;  3G71 B;  4M4S A;  1OGJ A;  2E1R A;  3Q38 A;  4XQF A;  4Z4U A;  4FXU A;  2WZP P;  4J0Q A;  4MYT A;  3AVU A;  4RPB A;  2PIA A;  5HZA A;  2DET A;  1TTT A;  4HE6 A;  1QG0 A;  3W2E A;  5KW9 A;  2V7V A;  4DK0 A;  2NPF A;  3W5H A;  1DG1 G;  4WZK A;  2XZO A;  3CMA B;  1V0E A;  2WJY A;  3A8J A;  2CF4 A;  2QDX A;  2CW5 A;  1OB0 A;  3A1P A;  5LMZ A;  2BF4 A;  1TUI A;  1D8T A;  2AHO A;  4JMQ A;  4TMX A;  2GPJ A;  3BY1 A;  3GVL A;  4G6I A;  3ASR A;  2BVN A;  3CCJ B;  2ZL5 A;  5HKK A;  1PJ7 A;  1EFT A;  4PAA A;  4RD6 A;  4LBV A;  3ZPN A;  2X0K A;  2C5H A;  3JQQ A;  3QFR A;  3V7A A;  3G6E B;  1G7T A;  1PKV A;  4ZCL A;  1T6Z A;  1W35 A;  3FPP A;  4P2N A;  1T6Y A;  1Q86 D;  3PEN A;  3JQR A;  4R71 A;  1OHH A;  4RDJ A;  2CC2 A;  3JQP A;  1VJS A;  1WP6 A;  3GSI A;  1UD3 A;  1V5V A;  3OZW A;  2VBU A;  3CCE B;  4LBZ A;  1FX0 A;  2RC6 A;  1IJF A;  4Y9R A;  2GJK A;  1BJK A;  4OOS A;  3VNV A;  2XNJ A;  1QGZ A;  4ACA A;  2WSS A;  4Y9U A;  4Z4T A;  4TKO B;  4HIZ A;  3QSY A;  4PC7 A;  4AC9 A;  2PLF A;  1G7S A;  3H94 A;  4WZT A;  4Z1M A;  3CCM B;  5KNL A;  5KSW B;  4YAL A;  5HXB A;  3DDY A;  4X7E A;  5FO1 A;  2D9R A;  3OFN A;  3A35 A;  3U2Q A;  2D3N A;  1UMK A;  3U6B A;  1D2E A;  3BNW A;  4II3 A;  3W2I A;  4PC3 A;  1K9M D;  2BGJ A;  4XR6 A;  5THX A;  2X6Y A;  4WQM A;  4DQK A;  4YAU A;  5TRD A;  1WOO A;  1JA1 A;  1WDT A;  3H9N A;  4QVA A;  3WBK A;  1YX2 A;  4QVJ A;  4XLH A;  4F7D A;  2GQF A;  4H9G A;  1E79 A;  4B48 A;  3ASQ A;  4K1X A;  4YAF A;  3QE2 A;  1K8A D;  4FN5 A;  3OE7 A;  3ZZT A;  4PC2 A;  4KKU A;  4P6Y A;  1EXM A;  1Q9S A;  2VNK A;  1VHO A;  4P9S A;  4YXW A;  2FVG A;  1JJ2 B;  3GVK A;  5DSZ A;  2DY1 A;  3MCA A;  2XNC A;  4TN1 A;  1BX0 A;  5CDF A;  4EH1 A;  1HVX A;  3ES9 A;  1WPC A;  4N3N A;  1P4M A;  2X85 A;  2BN4 A;  1QUE A;  2C4U A;  4DNR B;  4MYU A;  5GV8 A;  1QVG B;  2VJI A;  3HAG A;  2C5B A;  1KK2 A;  5GV7 A;  2I1L A;  1VQK B;  1FNM A;  4G5G A;  5A89 A;  3I56 B;  1OB2 A;  3NE5 B;  1EP2 B;  3ISX A;  1M1K D;  3ZZ0 A;  3OW2 B;  1V0F A;  2YWH A;  2C78 A;  2ZTG A;  1WSV A;  3CP8 A;  4XOR A;  1XFO A;  1NBM A;  2B7C A;  2BSA A;  5F4O A;  1EFR A;  2Q6O A;  3GIR A;  3PVD A;  4NNJ A;  2XZP A;  2V7X A;  4AVZ A;  4Z4W A;  2WYR A;  3WQZ A;  3AVY A;  4Z4S A;  2CK3 A;  3WNB A;  3P26 A;  4TMV A;  3Q6R A;  3CCQ B;  1XQB A;  2RC5 A;  3QFC A;  4X07 A;  4N3G A;  3G4S B;  2W6I A;  4TMW A;  2F1M A;  4U9U A;  2C4T A;  1ZM4 A;  2GK6 A;  5B6I A;  4WZL A;  3VO1 A;  3B8H A;  2ZZQ A;  1PJ5 A;  2KVO A;  2ZBV A;  4YHB A;  4LBW A;  4XLE A;  3KEW A;  2GRE A;  1QFY A;  1G7R A;  3VMF A;  3ASP A;  1I8D A;  5IYQ A;  2CRV A;  1F20 A;  2J7K A;  5EMN A;  4ZCM A;  1VQ4 B;  2XND A;  3FPK A;  1WTH D;  1CNE A;  1UD8 A;  3AVT A;  5DS0 A;  1UD2 A;  4ZCI A;  2ZZE A;  5E6T A;  2DOG A;  2DER A;  1BX1 A;  1K28 D;  4ZGN B;  3RY8 A;  3BCF A;  2QGG A;  1VLO A;  1DDG A;  1KC8 D;  2C77 A;  3FKS A;  3LNN A;  1KD1 D;  4XD7 A;  3CCL B;  1MAB A;  1WU8 A;  3I1F A;  2R6H A;  5IYP A;  1H42 A;  4XMY A;  2XGJ A;  3OJX A;  4AF7 A;  4DK1 A;  4UZF A;  2XZL A;  2YWG A;  4KKS A;  5JBQ A;  1IJE A;  5A88 A;  4Z4Z A;  1Y0R A;  4KKT A;  4XKW A;  2V7U A;  4XOP A;  4FWT A;  1S72 B;  4YEJ A;  2DCU A;  1R5N A;  1YLO A;  2BPO A;  2WR8 A;  2ZIT A;  1H85 A;  2PMD A;  4P25 A;  1SM4 A;  1DDI A;  1BQE A;  1YIJ B;  4OPO A;  4DQL A;  1NJI D;  4Z4V A; 
#chains in the Genus database with same CATH homology
 3W2F A;  3WYA A;  3AVX A;  1TLL A;  5FA6 A;  1QGY A;  2OTJ B;  1N0V C;  1FRN A;  1HA3 A;  1FNC A;  4YAO A;  1EWY A;  3CB4 A;  1KK1 A;  1QX4 A;  4IW3 B;  1JA0 A;  3W5U A;  3ZBT A;  3CD6 B;  1EFC A;  3CRZ A;  2XEX A;  1QH0 A;  4NCN A;  4B3X A;  4RD2 A;  3AGP A;  2VNH A;  4G1B A;  2CND A;  1GJR A;  4P6V F;  4M0L A;  4TMZ A;  1KJZ A;  4AF6 A;  1W34 A;  4YAW A;  1YI2 B;  1F60 A;  3CME B;  1AMO A;  1D1N A;  3CC2 B;  3CCU B;  1B2R A;  1E63 A;  1QGA A;  1B23 P;  1I7P A;  4NBS A;  4RCY A;  1W2B B;  4FK8 A;  4Y7C A;  2YWE A;  1JNY A;  3ZBU A;  4C0S A;  3W2G A;  4RD1 A;  3QFS A;  2QTZ A;  3B78 A;  1A8P A;  1U2R A;  2QA4 B;  3CCR B;  1FDR A;  2QTL A;  4TMT A;  3SJZ A;  3I55 B;  4HE5 A;  3AVV A;  2OK7 A;  2QEX B;  2VNJ A;  4RD3 A;  5TY0 A;  4QHY A;  3MMP A;  2BV3 A;  1J9Z A;  3CXC B;  1N8R D;  1M90 D;  1VQL B;  1OB5 A;  4G1V A;  4B44 A;  1VQ8 B;  2QMU A;  4PC6 A;  1QFZ A;  3ZZU A;  4LC0 A;  3OJW A;  2BMW A;  1KTV A;  3FJO A;  3LVB A;  1TVC A;  3AGQ A;  1R5B A;  1GAQ A;  2HDN B;  2YWF A;  4B4D A;  3CC4 B;  1DAR A;  3ZC3 A;  1ZUN B;  1VQP B;  2OTL B;  1GAW A;  1VQ6 B;  4ZGQ B;  3P27 A;  4PC1 A;  1GO2 A;  1FND A;  3CCV B;  3QFT A;  4PGO A;  1KK3 A;  1GR1 A;  1ZM2 A;  1Q7Y D;  5H5J A;  1CQX A;  3VO2 A;  4LBY A;  1EFU A;  4B43 A;  1YIT B;  4Q7J B;  2BM0 A;  3CCS B;  1JB9 A;  3V76 A;  1VQM B;  1EP3 B;  3WBJ A;  1ZM3 A;  1VQO B;  1QFJ A;  2X3U A;  1FRQ A;  1YHQ B;  4RD4 A;  4RCZ A;  2BGI A;  2VYQ A;  1IB0 A;  1R5O A;  3WND A;  3U6K A;  4ZV4 A;  1W87 A;  3E20 A;  4ACB A;  3E1Y E;  3CC7 B;  4M53 A;  1KK0 A;  1VQ7 B;  2DEU A;  1YJW B;  1SKQ A;  3B82 A;  1KRH A;  2HMA A;  1OGI A;  3WNC A;  1ELO A;  3WXM A;  2VNI A;  2BM1 A;  1NDH A;  2VZL A;  1Q82 D;  4RJL A;  1FNB A;  1S0U A;  3CW2 A;  1GVH A;  1YJ9 B;  4BPR A;  2B5O A;  4C43 A;  1K73 D;  1ZM9 A;  1VQ5 B;  1QVF B;  1VQ9 B;  2B7B A;  1CNF A;  1XB2 A;  2OK8 A;  5AN9 A;  4B47 A;  2FX3 A;  1EP1 B;  2HCJ B;  3W2H A;  3W5V A;  3WY9 A;  1YJN B;  1AIP A;  1KQS B;  3OZU A;  3AVW A;  4QFM A;  3LO8 A;  1N0U A;  3MHP A;  1QUF A;  2D74 A;  3OZV A;  4P3Y A;  1G7C A;  4RD0 A;  1VQN B;  3VNU A;  1XE1 A;  2QN6 A;  1E62 A;  3J81 k;  3CPW B;  4UAJ A;  2EFG A;  5H59 A;  1Q81 D;  4M1K A;  4M2L A;  5TV2 A;  5TR9 A;  1E64 A;  2EIX A;  3G71 B;  4M4S A;  1OGJ A;  2E1R A;  4J0Q A;  4MYT A;  3AVU A;  2PIA A;  2DET A;  1TTT A;  4HE6 A;  1QG0 A;  3W2E A;  2NPF A;  3W5H A;  1DG1 G;  3CMA B;  2QDX A;  2BF4 A;  1TUI A;  1D8T A;  2AHO A;  4TMX A;  2GPJ A;  2BVN A;  3CCJ B;  1EFT A;  4RD6 A;  4LBV A;  3QFR A;  3JQQ A;  3G6E B;  1G7T A;  4ZCL A;  1W35 A;  1Q86 D;  3PEN A;  3JQR A;  4R71 A;  3JQP A;  3OZW A;  3CCE B;  4LBZ A;  2RC6 A;  1IJF A;  4Y9R A;  1BJK A;  3VNV A;  2XNJ A;  1QGZ A;  4ACA A;  4Y9U A;  3QSY A;  4PC7 A;  4AC9 A;  2PLF A;  1G7S A;  3CCM B;  5KSW B;  4YAL A;  5HXB A;  3U2Q A;  1UMK A;  3U6B A;  1D2E A;  3W2I A;  4PC3 A;  1K9M D;  2BGJ A;  5THX A;  4WQM A;  4DQK A;  4YAU A;  1JA1 A;  1WDT A;  3WBK A;  4F7D A;  2GQF A;  4H9G A;  4B48 A;  4K1X A;  4YAF A;  3QE2 A;  1K8A D;  4FN5 A;  3ZZT A;  4PC2 A;  1EXM A;  2VNK A;  1JJ2 B;  5DSZ A;  2DY1 A;  3MCA A;  2XNC A;  4TN1 A;  1BX0 A;  4EH1 A;  3ES9 A;  4N3N A;  2BN4 A;  1QUE A;  1QVG B;  4MYU A;  5GV8 A;  1KK2 A;  5GV7 A;  1VQK B;  1FNM A;  4G5G A;  3I56 B;  1OB2 A;  1EP2 B;  1M1K D;  3ZZ0 A;  3OW2 B;  2YWH A;  2C78 A;  2B7C A;  2BSA A;  3AVY A;  3WNB A;  3P26 A;  4TMV A;  3CCQ B;  2RC5 A;  3QFC A;  4N3G A;  3G4S B;  4TMW A;  4U9U A;  1ZM4 A;  3VO1 A;  3B8H A;  4YHB A;  4LBW A;  1QFY A;  1G7R A;  3VMF A;  2CRV A;  1F20 A;  2J7K A;  5EMN A;  4ZCM A;  1VQ4 B;  3FPK A;  1CNE A;  3AVT A;  4ZCI A;  2DER A;  1BX1 A;  4ZGN B;  1DDG A;  1KC8 D;  2C77 A;  1KD1 D;  3CCL B;  3I1F A;  2R6H A;  1H42 A;  3OJX A;  4AF7 A;  2YWG A;  5JBQ A;  1IJE A;  4FWT A;  1S72 B;  2DCU A;  1R5N A;  2BPO A;  2ZIT A;  1H85 A;  2PMD A;  1SM4 A;  1DDI A;  1BQE A;  1YIJ B;  4DQL A;  1NJI D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...