5HXBA

Cereblon in complex with ddb1, cc-885, and gspt1
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
196
structure length
196
Chain Sequence
b'PIRLPIVDKYKDMGTVVLGKLESGSICKGQQLVMMPNKHNVEVLGILSDDVETDTVAPGENLKIRLKGIEEEEILPGFILCDPNNLCHSGRTFDAQIVIIEHKSIICPGYNAVLHIHTCIEEVEITALICLVDKKSGEKSKTRPRFVKQDQVCIARLRTAGTICLETFKDFPQMGRFTLRDEGKTIAIGKVLKLVP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Eukaryotic peptide chain release factor GTP-binding subunit
molecule tags Ligase
source organism Homo sapiens
publication title A novel cereblon modulator recruits GSPT1 to the CRL4(CRBN) ubiquitin ligase.
pubmed doi rcsb
total genus 27
structure length 196
sequence length 196
chains with identical sequence X
ec nomenclature
pdb deposition date 2016-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03143 GTP_EFTU_D3 Elongation factor Tu C-terminal domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 5hxbA02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 5hxbA01
3WBJA 3VNUA 2BF4A 1QGYA 3WNCA 1F20A 1IB0A 1E64A 1KC8D 4TN1A 4C0SA 1M1KD 4LBYA 3CCQB 1NJID 1XE1A 1FDRA 3W2EA 3CCEB 3J81k 1YJ9B 2QA4B 2QTZA 1VQKB 1QUFA 1G7RA 3W5HA 1GAQA 4N3NA 4ZCMA 3CCRB 2DERA 1EXMA 2R6HA 2XEXA 2QMUA 4B43A 3QFSA 3MCAA 1FRQA 2YWHA 5H59A 2GPJA 1YJWB 1SM4A 4BPRA 2RC5A 3G6EB 1FNCA 1DARA 4QFMA 4Q7JB 4G5GA 1E63A 3U2QA 1YI2B 4AF6A 4PC2A 3CPWB 1VQ6B 4M4SA 3WBKA 1NDHA 1ZM2A 1G7CA 1JA0A 2ZITA 4PC3A 4YALA 4YAOA 1K73D 1CNEA 1FNMA 4TMZA 2X3UA 5EMNA 1VQNB 1EFTA 4ZGQB 3CC2B 1B2RA 3U6KA 3CC4B 3QSYA 3CMAB 3CD6B 3CB4A 4B48A 3OZWA 4M1KA 1W2BB 4RD4A 1BJKA 2B7BA 5THXA 3JQPA 3I1FA 1JB9A 1TVCA 3OJWA 2DCUA 3G4SB 1FRNA 1W87A 4PC6A 1KD1D 4B47A 1U2RA 5GV8A 1N8RD 3WY9A 2BM1A 4YAUA 2DETA 3I55B 3E20A 3G71B 3AVYA 4RD0A 1IJEA 1QH0A 2YWEA 2HMAA 2VZLA 1GVHA 2B5OA 4J0QA 4PGOA 4YAFA 1VQLB 4QHYA 3VO1A 2BMWA 2OTJB 2VNIA 2E1RA 1D2EA 1R5OA 1QFZA 1BQEA 2OK8A 1VQ7B 4WQMA 4G1VA 2PIAA 4TMVA 4LBWA 5H5JA 4PC1A 3PENA 1TUIA 3CW2A 2AHOA 2J7KA 4ZGNB 1A8PA 1EP3B 1GAWA 1ZM9A 4NBSA 1VQ9B 3MHPA 1JA1A 1EP2B 4P6VF 4MYTA 4RJLA 4ACAA 4FK8A 5KSWB 3CRZA 1G7SA 3V76A 1QVFB 1CQXA 2D74A 1HA3A 1YJNB 4F7DA 3QFCA 1VQ5B 4ZCIA 2BV3A 3CXCB 3QE2A 3VMFA 1S0UA 1JNYA 4R71A 1QGAA 3I56B 4IW3B 4HE6A 3CCLB 4B4DA 3ZBUA 1YITB 4MYUA 2BM0A 1DDGA 2BPOA 2BN4A 4AC9A 1YIJB 4PC7A 1D8TA 2C78A 3ZZTA 1Q82D 4RCZA 3CCJB 1AMOA 1TLLA 2YWGA 1QX4A 4B44A 3W5UA 4DQKA 4M2LA 1AIPA 4FWTA 2BVNA 1OB2A 1KJZA 1SKQA 2FX3A 1BX1A 1EFCA 1VQPB 4B3XA 1Q86D 5GV7A 2XNCA 2CRVA 3E1YE 3ZZ0A 1OGIA 3ZC3A 2DEUA 3AVWA 2HDNB 2BGIA 4RCYA 1Q7YD 1VQ4B 2XNJA 1OGJA 4EH1A 4DQLA 1EWYA 2VNHA 1XB2A 5TY0A 4RD6A 2QN6A 1GJRA 1D1NA 3CMEB 5JBQA 1CNFA 4YAWA 5TR9A 4RD1A 4M53A 3W2HA 1IJFA 1VQ8B 1B23P 1EP1B 2VNKA 2YWFA 3OZUA 1KK0A 3QFRA 1KK2A 3FJOA 4P3YA 3SJZA 3LO8A 4LBZA 4ZV4A 1QVGB 3W2GA 1N0VC 1G7TA 1J9ZA 4C43A 4TMWA 1EFUA 1E62A 4AF7A 2BGJA 3U6BA 3OW2B 4M0LA 4U9UA 1ZUNB 1I7PA 3AGPA 1VQMB 1VQOB 1WDTA 1FNBA 4FN5A 3JQRA 3W2IA 3ZZUA 5DSZA 3B8HA 2EIXA 2OK7A 3JQQA 4YHBA 2PLFA 3AVUA 3CC7B 4K1XA 4Y9UA 1N0UA 1QFJA 2RC6A 1R5NA 4LC0A 1S72B 1OB5A 3OZVA 3CCMB 2PMDA 1K8AD 3WNBA 1DG1G 2DY1A 3P26A 3MMPA 1QUEA 3W2FA 3CCUB 3WXMA 2VYQA 1QGZA 2VNJA 2EFGA 2CNDA 3B78A 3AVTA 5HXBA 3W5VA 1ZM3A 2GQFA 3LVBA 3AGQA 1KRHA 2C77A 4NCNA 3AVXA 1QFYA 5FA6A 4Y7CA 1TTTA 1QG0A 4Y9RA 5TV2A 2BSAA 4N3GA 1GR1A 2QDXA 1W35A 4TMXA 1FNDA 3FPKA 3OJXA 1H42A 3VO2A 1K9MD 1ELOA 1Q81D 3B82A 3AVVA 1KK3A 1GO2A 3WYAA 4LBVA 4ZCLA 1ZM4A 2B7CA 1F60A 2QEXB 3ES9A 4UAJA 5AN9A 3ZBTA 2HCJB 4TMTA 3VNVA 1JJ2B 4G1BA 1DDIA 1H85A 3WNDA 3P27A 4HE5A 2OTLB 1BX0A 3QFTA 4H9GA 1KTVA 2QTLA 4RD2A 3CCVB 1YHQB 1M90D 1UMKA 2NPFA 4ACBA 1R5BA 1KK1A 4RD3A 3CCSB 1W34A 1KQSB
chains in the Genus database with same CATH superfamily
3WBJA 3VNUA 2BF4A 1PJ5A 1QGYA 3WNCA 3FKSA 1F20A 4PABA 4CQJA 2Q6OA 1IB0A 1E64A 1KC8D 4UZFA 1T6XA 4TN1A 2OYNA 4WZKA 5FL7A 5IYPA 1K28D 4C0SA 1WSRA 1M1KD 4LBYA 4Z4RA 3JU4A 4X07A 3CCQB 1NJID 1SKYB 1XE1A 4KKTA 1Y0RA 1COWA 1W9XA 1FDRA 4GQNA 4AVZA 3OOCA 3W2EA 1WOPA 3CCEB 3A8IA 3J81k 1YJ9B 4TT3A 2QA4B 2QTZA 2WJYA 4XN3A 4P22A 2VBVA 1VQKB 1QUFA 1G7RA 2OBTA 3W5HA 1RQPA 1GAQA 2V31A 1N05A 2F43A 2ZZQA 3OP1A 4N3NA 4XNFA 4ZCMA 3CCRB 3ZUGA 2DERA 4XKVA 1V0EA 2ZL6A 1EXMA 2R6HA 2XEXA 2GJPA 2QMUA 4WZEA 4B43A 1PJ6A 3QFSA 3MCAA 1FRQA 2YWHA 5H59A 2GPJA 1UD6A 1YJWB 4OPOA 1SM4A 4BPRA 2P3MA 3ZPNA 2RC5A 4YELA 2ZBVA 1VJSA 1E1RA 3G6EB 4E0FA 4P1VA 1FNCA 1Q9SA 1DARA 3Q6RA 4QFMA 2V7WA 1S4MA 4Q7JB 4G5GA 4TSFA 1E63A 3NE5B 3U2QA 2Q6IA 1YI2B 4AF6A 1OB0A 4PC2A 3CPWB 3OFNA 3BY2A 1VQ6B 4M4SA 3WBKA 4G7XA 1UD4A 1NDHA 1NRKA 1G7CA 1ZM2A 5TRDA 3PA2A 4FXUA 1JA0A 2ZITA 4PC3A 5BSYA 4YALA 3A8KA 4YAOA 1K73D 1CNEA 1FNMA 5FNZA 4HIZA 3BC9A 4TMZA 2X3UA 5EMNA 1VQNB 3CTAA 1EFTA 2WSSA 4ZGQB 1E79A 3CC2B 1B2RA 3U6KA 3LQ6A 2X0KA 1VLOA 2GJKA 3GQBA 3CC4B 1VHEA 3KEWA 3QSYA 1V0FA 4RPBA 1FX0A 1EFRA 3ASSA 4XORA 3CMAB 3CB4A 3V7AA 1Y0YA 4UZEA 4B48A 3OZWA 1P4MA 2C5HA 4M1KA 1BJKA 4RD4A 5B6IA 1W2BB 2B7BA 5THXA 3JQPA 5IK2A 3I1FA 2LZJA 4P26A 3GVKA 4X7DA 2F4NA 1JB9A 1TVCA 3OJWA 2DCUA 5FO0A 3G4SB 5HKKA 4XKWA 4OP7A 5HZAA 1NB0A 1FRNA 2D3NA 4XONA 1W87A 2V7UA 4PC6A 1KD1D 4B47A 1U2RA 5GV8A 1N8RD 4NNJA 3WY9A 5F4JA 2BM1A 4YAUA 1WOSA 3GIRA 4QV2A 2DETA 3I55B 3E20A 4P6YA 5J3OA 1OHHA 3G71B 3AVYA 2CF4A 4RD0A 4RM0A 1IJEA 4DK1A 3Q38A 1QH0A 2YWEA 2HMAA 4XLEA 2DIEA 3OEHA 2VZLA 1GVHA 2B5OA 1UD8A 4J0QA 4PGOA 4YAFA 2X53S 1VQLB 3A1PA 4QHYA 3VO1A 2BMWA 2OTJB 2VNIA 2E1RA 1D2EA 3SLDA 1QFZA 1R5OA 1BQEA 2OK8A 1WOOA 1VQ7B 4WQMA 4G1VA 2PIAA 4Z4UA 4P3IA 3PA1A 4TMVA 3OKXA 4LBWA 2X85A 4WZLA 5H5JA 4YEJA 4PC1A 1WPCA 5E6TA 3LQEA 3PENA 1TUIA 3BCDA 2AHOA 2J7KA 3CW2A 4ZGNB 1A8PA 1EP3B 3BCFA 1GAWA 1V5VA 4XM3A 3PUNA 1ZM9A 4NBSA 2JIZA 1VQ9B 3T51B 4P25A 4X7CA 3MHPA 1JA1A 2E1BA 1EP2B 4P6VF 4XMYA 4MYTA 4RJLA 4ACAA 4ASUA 4FK8A 5KSWB 4OOSA 3CRZA 1G7SA 4KKUA 3V76A 2X6YA 1QVFB 2GK7A 2X6XA 1CQXA 4JMQA 2D74A 4Z4TA 1HA3A 5KW9A 2VJIA 2C5BA 4P2NA 1YJNB 3Q39A 4F7DA 3QFCA 2W6JA 1VQ5B 4ZCIA 2BV3A 2Q6LA 3CXCB 3QE2A 3T56B 3VMFA 1S0UA 1MRZA 1JNYA 4R71A 1KMHA 1QGAA 2HLDA 2XZOA 3I56B 4IW3B 4HE6A 3CCLB 4B4DA 3ZBUA 1I8DA 2ZTNA 1YITB 4Z4VA 4MYUA 2VBSA 2BM0A 1DDGA 2BPOA 3Q3AA 2BN4A 2V7TA 2D9RA 4AC9A 1HZEA 2DOGA 4ROXA 1YIJB 4PC7A 1UD3A 3BNWA 3KL9A 3SEJA 5L46A 1D8TA 2C78A 2QGGA 2WZPP 3ZZTA 3OW7A 1Q82D 1HVXA 1VLYA 2Q6KA 4XN0A 4RCZA 3CCJB 3DDYA 2GK6A 4DK0A 4G7WA 1AMOA 1TLLA 2M5SA 2YWGA 5CDFA 2ZXHA 1QX4A 5BSXA 1E3ZA 2F1LA 4B44A 3W5UA 4DQKA 2WZNA 5FIUA 2ZL7A 1AIPA 4M2LA 3Q6QA 4FWTA 2BVNA 1OB2A 1KJZA 3CPXA 1SKQA 1UD5A 2FX3A 1BX1A 2GREA 3BY1A 3CP2A 4XD7A 4Z4YA 1EFCA 1UD2A 1WSVA 3D26A 4YXWA 1YX2A 1VQPB 3ZIAA 4B3XA 4B3FX 1Q86D 2VJJA 5A88A 4OPVA 5GV7A 2XNCA 2CRVA 3E1YE 3LNNA 3ZZ0A 1OGIA 3ZC3A 3ASRA 2DEUA 2W6IA 3AVWA 3ISXA 2HDNB 3OEEA 2BGIA 4RCYA 4XLHA 2Z6BD 1Q7YD 1VQ4B 2XNJA 2WYRA 1OGJA 4EH1A 1WU8A 2OBRA 1H8HA 1W0JA 4DQLA 3ASTA 1EWYA 2VNHA 1XB2A 3A35A 2C4TA 4RLZA 2I1LA 5DN6A 1XFOA 5TY0A 2V7VA 3OPOA 3CMMA 4RD6A 2QN6A 1GJRA 2R9VA 1WORA 2XOKA 1D1NA 3CMEB 5JBQA 1CNFA 2ZBUA 1N07A 4YAWA 4RDLA 4RD1A 4M53A 5TR9A 3W2HA 1T6YA 2JJ1A 1IJFA 1VQ8B 3OE7A 4XR6A 1BPLA 1XQBA 1B23P 4X06A 1EP1B 2VNKA 4OPSA 2YWFA 3BH4A 3OAAA 3OZUA 2ZZFA 2XZLA 3CP8A 3SLNA 4L8JA 4X8IA 1KK0A 3QFRA 1KK2A 3FJOA 4QVJA 4Z4WA 4P3YA 3SJZA 3CD6B 1PJ7A 3LO8A 2D3LA 3RY8A 3R6JA 4XQFA 4LBZA 3VR6A 4II2A 4ZV4A 1QVGB 1MABA 2ZL5A 2V7XA 3W2GA 1N0VC 1T5EA 1G7TA 1J9ZA 4C43A 4TMWA 1EFUA 1E62A 4XOPA 4AF7A 1IHMA 2BGJA 3A8JA 3U6BA 3OW2B 4M0LA 4U9UA 1ZUNB 1I7PA 3AGPA 1VQMB 1VQOB 1WDTA 2VBTA 4XOTA 1FNBA 1PKVA 3JQRA 4FN5A 2DYIA 1WP6A 3W2IA 2QE7A 3ONYA 2CBXA 2WPDA 2XGJA 5FO1A 4RPDA 5LMZA 2ZTGA 4WWVA 4G6IA 4UZUA 3ZZUA 1NBMA 4XLCA 5DSZA 3GVLA 3B8HA 2EIXA 2OK7A 3JQQA 1W0KA 4YHBA 2X6WA 5IYNA 2PLFA 3AVUA 3CC7B 1N06A 2CW5A 2WJVA 4K1XA 4X7EA 3BQJA 4Y9UA 1N0UA 1QFJA 2RC6A 4XL9A 1R5NA 2PE3A 4LC0A 4X7FA 5HZBA 1OB5A 3OZVA 1S72B 3ASQA 3CCMB 3H94A 2WR8A 2PMDA 2OBSA 2X8KA 1K8AD 2V7QA 2NV4A 3WNBA 1DG1G 2DY1A 2VBUA 3P26A 3MMPA 1QUEA 5J35A 3W2FA 3CCUB 1KZLA 4Z4ZA 4B3GA 3WXMA 2VYQA 1QGZA 2VNJA 3GVJA 1E3XA 2EFGA 2CNDA 3B78A 3H9NA 2CC2A 4RDKA 1T6ZA 3AVTA 2C2WA 4QUZA 5HXBA 4TKOB 3WQZA 3W5VA 4XLAA 1ZM3A 1BMFA 1E1QA 2GQFA 5F4MA 2ZZEA 4RDJA 4XLFA 1NB9A 3LVBA 4DNRB 3AGQA 1KRHA 2C77A 4NCNA 3AVXA 1QFYA 2FVGA 2ZZGA 5FA6A 3R6KA 3SKBA 2F1MA 4OOXA 4Y7CA 1VF7A 1QG0A 3PVDA 4P9SA 4Y9RA 5TV2A 1TTTA 2BSAA 2C4UA 4N3GA 2XNDA 1BLIA 1GR1A 2CK3A 2XZPA 2QDXA 3G05A 3ONUA 2KVOA 1W35A 4TMXA 1FNDA 3FPKA 3OJXA 1H42A 3VO2A 1K9MD 2JJ2A 1ELOA 1Q81D 3B82A 3CESA 5DS0A 2JN9A 3AVVA 1KK3A 3FPPA 1WTHD 2ZXIA 1N08A 1GO2A 3WYAA 4LBVA 4ZCLA 4PAAA 1ZM4A 2B7CA 1F60A 2QEXB 1VHOA 3ES9A 5KNLA 4UAJA 5AN9A 1RQRA 3ZBTA 3A3BA 4QVAA 2HCJB 4OOVA 4Z4SA 1YLOA 5IYRA 3PUMA 4TMTA 3VNVA 1JJ2B 4KKSA 4G1BA 4Z1MA 1DDIA 3ASPA 1H85A 4P12A 1H8EA 3WNDA 1E43A 3HAGA 3T53B 2JDIA 3P27A 4HE5A 2OTLB 1I18A 1BX0A 4X05A 3QFTA 4H9GA 1KTVA 2QTLA 4RD2A 4X0CA 2GJRA 5IYWA 3CCVB 1YHQB 3SJPA 1M90D 4II3A 3GSIA 1UMKA 5F4OA 2NPFA 4ACBA 4DNTB 1R5BA 1KK1A 4WZTA 4RD3A 5A89A 5A8AA 1W34A 5IYQA 3CCSB 1KQSB 2V4DA 3A3GA
chains in the Genus database with same CATH topology
3WBJA 3VNUA 2BF4A 1QGYA 3WNCA 1F20A 1IB0A 1E64A 1KC8D 4TN1A 4C0SA 1M1KD 4LBYA 3CCQB 1NJID 1XE1A 1FDRA 3W2EA 3CCEB 3J81k 1YJ9B 2QA4B 2QTZA 1VQKB 1QUFA 1G7RA 3W5HA 1GAQA 4N3NA 4ZCMA 3CCRB 2DERA 1EXMA 2R6HA 2XEXA 2QMUA 4B43A 3QFSA 3MCAA 1FRQA 2YWHA 5H59A 2GPJA 1YJWB 1SM4A 4BPRA 2RC5A 3G6EB 1FNCA 1DARA 4QFMA 4Q7JB 4G5GA 1E63A 3U2QA 1YI2B 4AF6A 4PC2A 3CPWB 1VQ6B 4M4SA 3WBKA 1NDHA 1ZM2A 1G7CA 1JA0A 2ZITA 4PC3A 4YALA 4YAOA 1K73D 1CNEA 1FNMA 4TMZA 2X3UA 5EMNA 1VQNB 1EFTA 4ZGQB 3CC2B 1B2RA 3U6KA 3CC4B 3QSYA 3CMAB 3CD6B 3CB4A 4B48A 3OZWA 4M1KA 1W2BB 4RD4A 1BJKA 2B7BA 5THXA 3JQPA 3I1FA 1JB9A 1TVCA 3OJWA 2DCUA 3G4SB 1FRNA 1W87A 4PC6A 1KD1D 4B47A 1U2RA 5GV8A 1N8RD 3WY9A 2BM1A 4YAUA 2DETA 3I55B 3E20A 3G71B 3AVYA 4RD0A 1IJEA 1QH0A 2YWEA 2HMAA 2VZLA 1GVHA 2B5OA 4J0QA 4PGOA 4YAFA 1VQLB 4QHYA 3VO1A 2BMWA 2OTJB 2VNIA 2E1RA 1D2EA 1R5OA 1QFZA 1BQEA 2OK8A 1VQ7B 4WQMA 4G1VA 2PIAA 4TMVA 4LBWA 5H5JA 4PC1A 3PENA 1TUIA 3CW2A 2AHOA 2J7KA 4ZGNB 1A8PA 1EP3B 1GAWA 1ZM9A 4NBSA 1VQ9B 3MHPA 1JA1A 1EP2B 4P6VF 4MYTA 4RJLA 4ACAA 4FK8A 5KSWB 3CRZA 1G7SA 3V76A 1QVFB 1CQXA 2D74A 1HA3A 1YJNB 4F7DA 3QFCA 1VQ5B 4ZCIA 2BV3A 3CXCB 3QE2A 3VMFA 1S0UA 1JNYA 4R71A 1QGAA 3I56B 4IW3B 4HE6A 3CCLB 4B4DA 3ZBUA 1YITB 4MYUA 2BM0A 1DDGA 2BPOA 2BN4A 4AC9A 1YIJB 4PC7A 1D8TA 2C78A 3ZZTA 1Q82D 4RCZA 3CCJB 1AMOA 1TLLA 2YWGA 1QX4A 4B44A 3W5UA 4DQKA 4M2LA 1AIPA 4FWTA 2BVNA 1OB2A 1KJZA 1SKQA 2FX3A 1BX1A 1EFCA 1VQPB 4B3XA 1Q86D 5GV7A 2XNCA 2CRVA 3E1YE 3ZZ0A 1OGIA 3ZC3A 2DEUA 3AVWA 2HDNB 2BGIA 4RCYA 1Q7YD 1VQ4B 2XNJA 1OGJA 4EH1A 4DQLA 1EWYA 2VNHA 1XB2A 5TY0A 4RD6A 2QN6A 1GJRA 1D1NA 3CMEB 5JBQA 1CNFA 4YAWA 5TR9A 4RD1A 4M53A 3W2HA 1IJFA 1VQ8B 1B23P 1EP1B 2VNKA 2YWFA 3OZUA 1KK0A 3QFRA 1KK2A 3FJOA 4P3YA 3SJZA 3LO8A 4LBZA 4ZV4A 1QVGB 3W2GA 1N0VC 1G7TA 1J9ZA 4C43A 4TMWA 1EFUA 1E62A 4AF7A 2BGJA 3U6BA 3OW2B 4M0LA 4U9UA 1ZUNB 1I7PA 3AGPA 1VQMB 1VQOB 1WDTA 1FNBA 4FN5A 3JQRA 3W2IA 3ZZUA 5DSZA 3B8HA 2EIXA 2OK7A 3JQQA 4YHBA 2PLFA 3AVUA 3CC7B 4K1XA 4Y9UA 1N0UA 1QFJA 2RC6A 1R5NA 4LC0A 1S72B 1OB5A 3OZVA 3CCMB 2PMDA 1K8AD 3WNBA 1DG1G 2DY1A 3P26A 3MMPA 1QUEA 3W2FA 3CCUB 3WXMA 2VYQA 1QGZA 2VNJA 2EFGA 2CNDA 3B78A 3AVTA 5HXBA 3W5VA 1ZM3A 2GQFA 3LVBA 3AGQA 1KRHA 2C77A 4NCNA 3AVXA 1QFYA 5FA6A 4Y7CA 1TTTA 1QG0A 4Y9RA 5TV2A 2BSAA 4N3GA 1GR1A 2QDXA 1W35A 4TMXA 1FNDA 3FPKA 3OJXA 1H42A 3VO2A 1K9MD 1ELOA 1Q81D 3B82A 3AVVA 1KK3A 1GO2A 3WYAA 4LBVA 4ZCLA 1ZM4A 2B7CA 1F60A 2QEXB 3ES9A 4UAJA 5AN9A 3ZBTA 2HCJB 4TMTA 3VNVA 1JJ2B 4G1BA 1DDIA 1H85A 3WNDA 3P27A 4HE5A 2OTLB 1BX0A 3QFTA 4H9GA 1KTVA 2QTLA 4RD2A 3CCVB 1YHQB 1M90D 1UMKA 2NPFA 4ACBA 1R5BA 1KK1A 4RD3A 3CCSB 1W34A 1KQSB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WBJ A;  3VNU A;  2BF4 A;  1QGY A;  3WNC A;  1F20 A;  1IB0 A;  1E64 A;  1KC8 D;  4TN1 A;  4C0S A;  1M1K D;  4LBY A;  3CCQ B;  1NJI D;  1XE1 A;  1FDR A;  3W2E A;  3CCE B;  3J81 k;  1YJ9 B;  2QA4 B;  2QTZ A;  1VQK B;  1QUF A;  1G7R A;  3W5H A;  1GAQ A;  4N3N A;  4ZCM A;  3CCR B;  2DER A;  1EXM A;  2R6H A;  2XEX A;  2QMU A;  4B43 A;  3QFS A;  3MCA A;  1FRQ A;  2YWH A;  5H59 A;  2GPJ A;  1YJW B;  1SM4 A;  4BPR A;  2RC5 A;  3G6E B;  1FNC A;  1DAR A;  4QFM A;  4Q7J B;  4G5G A;  1E63 A;  3U2Q A;  1YI2 B;  4AF6 A;  4PC2 A;  3CPW B;  1VQ6 B;  4M4S A;  3WBK A;  1NDH A;  1ZM2 A;  1G7C A;  1JA0 A;  2ZIT A;  4PC3 A;  4YAL A;  4YAO A;  1K73 D;  1CNE A;  1FNM A;  4TMZ A;  2X3U A;  5EMN A;  1VQN B;  1EFT A;  4ZGQ B;  3CC2 B;  1B2R A;  3U6K A;  3CC4 B;  3QSY A;  3CMA B;  3CD6 B;  3CB4 A;  4B48 A;  3OZW A;  4M1K A;  1W2B B;  4RD4 A;  1BJK A;  2B7B A;  5THX A;  3JQP A;  3I1F A;  1JB9 A;  1TVC A;  3OJW A;  2DCU A;  3G4S B;  1FRN A;  1W87 A;  4PC6 A;  1KD1 D;  4B47 A;  1U2R A;  5GV8 A;  1N8R D;  3WY9 A;  2BM1 A;  4YAU A;  2DET A;  3I55 B;  3E20 A;  3G71 B;  3AVY A;  4RD0 A;  1IJE A;  1QH0 A;  2YWE A;  2HMA A;  2VZL A;  1GVH A;  2B5O A;  4J0Q A;  4PGO A;  4YAF A;  1VQL B;  4QHY A;  3VO1 A;  2BMW A;  2OTJ B;  2VNI A;  2E1R A;  1D2E A;  1R5O A;  1QFZ A;  1BQE A;  2OK8 A;  1VQ7 B;  4WQM A;  4G1V A;  2PIA A;  4TMV A;  4LBW A;  5H5J A;  4PC1 A;  3PEN A;  1TUI A;  3CW2 A;  2AHO A;  2J7K A;  4ZGN B;  1A8P A;  1EP3 B;  1GAW A;  1ZM9 A;  4NBS A;  1VQ9 B;  3MHP A;  1JA1 A;  1EP2 B;  4P6V F;  4MYT A;  4RJL A;  4ACA A;  4FK8 A;  5KSW B;  3CRZ A;  1G7S A;  3V76 A;  1QVF B;  1CQX A;  2D74 A;  1HA3 A;  1YJN B;  4F7D A;  3QFC A;  1VQ5 B;  4ZCI A;  2BV3 A;  3CXC B;  3QE2 A;  3VMF A;  1S0U A;  1JNY A;  4R71 A;  1QGA A;  3I56 B;  4IW3 B;  4HE6 A;  3CCL B;  4B4D A;  3ZBU A;  1YIT B;  4MYU A;  2BM0 A;  1DDG A;  2BPO A;  2BN4 A;  4AC9 A;  1YIJ B;  4PC7 A;  1D8T A;  2C78 A;  3ZZT A;  1Q82 D;  4RCZ A;  3CCJ B;  1AMO A;  1TLL A;  2YWG A;  1QX4 A;  4B44 A;  3W5U A;  4DQK A;  4M2L A;  1AIP A;  4FWT A;  2BVN A;  1OB2 A;  1KJZ A;  1SKQ A;  2FX3 A;  1BX1 A;  1EFC A;  1VQP B;  4B3X A;  1Q86 D;  5GV7 A;  2XNC A;  2CRV A;  3E1Y E;  3ZZ0 A;  1OGI A;  3ZC3 A;  2DEU A;  3AVW A;  2HDN B;  2BGI A;  4RCY A;  1Q7Y D;  1VQ4 B;  2XNJ A;  1OGJ A;  4EH1 A;  4DQL A;  1EWY A;  2VNH A;  1XB2 A;  5TY0 A;  4RD6 A;  2QN6 A;  1GJR A;  1D1N A;  3CME B;  5JBQ A;  1CNF A;  4YAW A;  5TR9 A;  4RD1 A;  4M53 A;  3W2H A;  1IJF A;  1VQ8 B;  1B23 P;  1EP1 B;  2VNK A;  2YWF A;  3OZU A;  1KK0 A;  3QFR A;  1KK2 A;  3FJO A;  4P3Y A;  3SJZ A;  3LO8 A;  4LBZ A;  4ZV4 A;  1QVG B;  3W2G A;  1N0V C;  1G7T A;  1J9Z A;  4C43 A;  4TMW A;  1EFU A;  1E62 A;  4AF7 A;  2BGJ A;  3U6B A;  3OW2 B;  4M0L A;  4U9U A;  1ZUN B;  1I7P A;  3AGP A;  1VQM B;  1VQO B;  1WDT A;  1FNB A;  4FN5 A;  3JQR A;  3W2I A;  3ZZU A;  5DSZ A;  3B8H A;  2EIX A;  2OK7 A;  3JQQ A;  4YHB A;  2PLF A;  3AVU A;  3CC7 B;  4K1X A;  4Y9U A;  1N0U A;  1QFJ A;  2RC6 A;  1R5N A;  4LC0 A;  1S72 B;  1OB5 A;  3OZV A;  3CCM B;  2PMD A;  1K8A D;  3WNB A;  1DG1 G;  2DY1 A;  3P26 A;  3MMP A;  1QUE A;  3W2F A;  3CCU B;  3WXM A;  2VYQ A;  1QGZ A;  2VNJ A;  2EFG A;  2CND A;  3B78 A;  3AVT A;  5HXB A;  3W5V A;  1ZM3 A;  2GQF A;  3LVB A;  3AGQ A;  1KRH A;  2C77 A;  4NCN A;  3AVX A;  1QFY A;  5FA6 A;  4Y7C A;  1TTT A;  1QG0 A;  4Y9R A;  5TV2 A;  2BSA A;  4N3G A;  1GR1 A;  2QDX A;  1W35 A;  4TMX A;  1FND A;  3FPK A;  3OJX A;  1H42 A;  3VO2 A;  1K9M D;  1ELO A;  1Q81 D;  3B82 A;  3AVV A;  1KK3 A;  1GO2 A;  3WYA A;  4LBV A;  4ZCL A;  1ZM4 A;  2B7C A;  1F60 A;  2QEX B;  3ES9 A;  4UAJ A;  5AN9 A;  3ZBT A;  2HCJ B;  4TMT A;  3VNV A;  1JJ2 B;  4G1B A;  1DDI A;  1H85 A;  3WND A;  3P27 A;  4HE5 A;  2OTL B;  1BX0 A;  3QFT A;  4H9G A;  1KTV A;  2QTL A;  4RD2 A;  3CCV B;  1YHQ B;  1M90 D;  1UMK A;  2NPF A;  4ACB A;  1R5B A;  1KK1 A;  4RD3 A;  3CCS B;  1W34 A;  1KQS B; 
#chains in the Genus database with same CATH topology
 3WBJ A;  3VNU A;  2BF4 A;  1PJ5 A;  1QGY A;  3WNC A;  3FKS A;  1F20 A;  4PAB A;  4CQJ A;  2Q6O A;  1IB0 A;  1E64 A;  1KC8 D;  4UZF A;  1T6X A;  4TN1 A;  2OYN A;  4WZK A;  5FL7 A;  5IYP A;  1K28 D;  4C0S A;  1WSR A;  1M1K D;  4LBY A;  4Z4R A;  3JU4 A;  4X07 A;  3CCQ B;  1NJI D;  1SKY B;  1XE1 A;  4KKT A;  1Y0R A;  1COW A;  1W9X A;  1FDR A;  4GQN A;  4AVZ A;  3OOC A;  3W2E A;  1WOP A;  3CCE B;  3A8I A;  3J81 k;  1YJ9 B;  4TT3 A;  2QA4 B;  2QTZ A;  2WJY A;  4XN3 A;  4P22 A;  2VBV A;  1VQK B;  1QUF A;  1G7R A;  2OBT A;  3W5H A;  1RQP A;  1GAQ A;  2V31 A;  1N05 A;  2F43 A;  2ZZQ A;  3OP1 A;  4N3N A;  4XNF A;  4ZCM A;  3CCR B;  3ZUG A;  2DER A;  4XKV A;  1V0E A;  2ZL6 A;  1EXM A;  2R6H A;  2XEX A;  2GJP A;  2QMU A;  4WZE A;  4B43 A;  1PJ6 A;  3QFS A;  3MCA A;  1FRQ A;  2YWH A;  5H59 A;  2GPJ A;  1UD6 A;  1YJW B;  4OPO A;  1SM4 A;  4BPR A;  2P3M A;  3ZPN A;  2RC5 A;  4YEL A;  2ZBV A;  1VJS A;  1E1R A;  3G6E B;  4E0F A;  4P1V A;  1FNC A;  1Q9S A;  1DAR A;  3Q6R A;  4QFM A;  2V7W A;  1S4M A;  4Q7J B;  4G5G A;  4TSF A;  1E63 A;  3NE5 B;  3U2Q A;  2Q6I A;  1YI2 B;  4AF6 A;  1OB0 A;  4PC2 A;  3CPW B;  3OFN A;  3BY2 A;  1VQ6 B;  4M4S A;  3WBK A;  4G7X A;  1UD4 A;  1NDH A;  1NRK A;  1G7C A;  1ZM2 A;  5TRD A;  3PA2 A;  4FXU A;  1JA0 A;  2ZIT A;  4PC3 A;  5BSY A;  4YAL A;  3A8K A;  4YAO A;  1K73 D;  1CNE A;  1FNM A;  5FNZ A;  4HIZ A;  3BC9 A;  4TMZ A;  2X3U A;  5EMN A;  1VQN B;  3CTA A;  1EFT A;  2WSS A;  4ZGQ B;  1E79 A;  3CC2 B;  1B2R A;  3U6K A;  3LQ6 A;  2X0K A;  1VLO A;  2GJK A;  3GQB A;  3CC4 B;  1VHE A;  3KEW A;  3QSY A;  1V0F A;  4RPB A;  1FX0 A;  1EFR A;  3ASS A;  4XOR A;  3CMA B;  3CB4 A;  3V7A A;  1Y0Y A;  4UZE A;  4B48 A;  3OZW A;  1P4M A;  2C5H A;  4M1K A;  1BJK A;  4RD4 A;  5B6I A;  1W2B B;  2B7B A;  5THX A;  3JQP A;  5IK2 A;  3I1F A;  2LZJ A;  4P26 A;  3GVK A;  4X7D A;  2F4N A;  1JB9 A;  1TVC A;  3OJW A;  2DCU A;  5FO0 A;  3G4S B;  5HKK A;  4XKW A;  4OP7 A;  5HZA A;  1NB0 A;  1FRN A;  2D3N A;  4XON A;  1W87 A;  2V7U A;  4PC6 A;  1KD1 D;  4B47 A;  1U2R A;  5GV8 A;  1N8R D;  4NNJ A;  3WY9 A;  5F4J A;  2BM1 A;  4YAU A;  1WOS A;  3GIR A;  4QV2 A;  2DET A;  3I55 B;  3E20 A;  4P6Y A;  5J3O A;  1OHH A;  3G71 B;  3AVY A;  2CF4 A;  4RD0 A;  4RM0 A;  1IJE A;  4DK1 A;  3Q38 A;  1QH0 A;  2YWE A;  2HMA A;  4XLE A;  2DIE A;  3OEH A;  2VZL A;  1GVH A;  2B5O A;  1UD8 A;  4J0Q A;  4PGO A;  4YAF A;  2X53 S;  1VQL B;  3A1P A;  4QHY A;  3VO1 A;  2BMW A;  2OTJ B;  2VNI A;  2E1R A;  1D2E A;  3SLD A;  1QFZ A;  1R5O A;  1BQE A;  2OK8 A;  1WOO A;  1VQ7 B;  4WQM A;  4G1V A;  2PIA A;  4Z4U A;  4P3I A;  3PA1 A;  4TMV A;  3OKX A;  4LBW A;  2X85 A;  4WZL A;  5H5J A;  4YEJ A;  4PC1 A;  1WPC A;  5E6T A;  3LQE A;  3PEN A;  1TUI A;  3BCD A;  2AHO A;  2J7K A;  3CW2 A;  4ZGN B;  1A8P A;  1EP3 B;  3BCF A;  1GAW A;  1V5V A;  4XM3 A;  3PUN A;  1ZM9 A;  4NBS A;  2JIZ A;  1VQ9 B;  3T51 B;  4P25 A;  4X7C A;  3MHP A;  1JA1 A;  2E1B A;  1EP2 B;  4P6V F;  4XMY A;  4MYT A;  4RJL A;  4ACA A;  4ASU A;  4FK8 A;  5KSW B;  4OOS A;  3CRZ A;  1G7S A;  4KKU A;  3V76 A;  2X6Y A;  1QVF B;  2GK7 A;  2X6X A;  1CQX A;  4JMQ A;  2D74 A;  4Z4T A;  1HA3 A;  5KW9 A;  2VJI A;  2C5B A;  4P2N A;  1YJN B;  3Q39 A;  4F7D A;  3QFC A;  2W6J A;  1VQ5 B;  4ZCI A;  2BV3 A;  2Q6L A;  3CXC B;  3QE2 A;  3T56 B;  3VMF A;  1S0U A;  1MRZ A;  1JNY A;  4R71 A;  1KMH A;  1QGA A;  2HLD A;  2XZO A;  3I56 B;  4IW3 B;  4HE6 A;  3CCL B;  4B4D A;  3ZBU A;  1I8D A;  2ZTN A;  1YIT B;  4Z4V A;  4MYU A;  2VBS A;  2BM0 A;  1DDG A;  2BPO A;  3Q3A A;  2BN4 A;  2V7T A;  2D9R A;  4AC9 A;  1HZE A;  2DOG A;  4ROX A;  1YIJ B;  4PC7 A;  1UD3 A;  3BNW A;  3KL9 A;  3SEJ A;  5L46 A;  1D8T A;  2C78 A;  2QGG A;  2WZP P;  3ZZT A;  3OW7 A;  1Q82 D;  1HVX A;  1VLY A;  2Q6K A;  4XN0 A;  4RCZ A;  3CCJ B;  3DDY A;  2GK6 A;  4DK0 A;  4G7W A;  1AMO A;  1TLL A;  2M5S A;  2YWG A;  5CDF A;  2ZXH A;  1QX4 A;  5BSX A;  1E3Z A;  2F1L A;  4B44 A;  3W5U A;  4DQK A;  2WZN A;  5FIU A;  2ZL7 A;  1AIP A;  4M2L A;  3Q6Q A;  4FWT A;  2BVN A;  1OB2 A;  1KJZ A;  3CPX A;  1SKQ A;  1UD5 A;  2FX3 A;  1BX1 A;  2GRE A;  3BY1 A;  3CP2 A;  4XD7 A;  4Z4Y A;  1EFC A;  1UD2 A;  1WSV A;  3D26 A;  4YXW A;  1YX2 A;  1VQP B;  3ZIA A;  4B3X A;  4B3F X;  1Q86 D;  2VJJ A;  5A88 A;  4OPV A;  5GV7 A;  2XNC A;  2CRV A;  3E1Y E;  3LNN A;  3ZZ0 A;  1OGI A;  3ZC3 A;  3ASR A;  2DEU A;  2W6I A;  3AVW A;  3ISX A;  2HDN B;  3OEE A;  2BGI A;  4RCY A;  4XLH A;  2Z6B D;  1Q7Y D;  1VQ4 B;  2XNJ A;  2WYR A;  1OGJ A;  4EH1 A;  1WU8 A;  2OBR A;  1H8H A;  1W0J A;  4DQL A;  3AST A;  1EWY A;  2VNH A;  1XB2 A;  3A35 A;  2C4T A;  4RLZ A;  2I1L A;  5DN6 A;  1XFO A;  5TY0 A;  2V7V A;  3OPO A;  3CMM A;  4RD6 A;  2QN6 A;  1GJR A;  2R9V A;  1WOR A;  2XOK A;  1D1N A;  3CME B;  5JBQ A;  1CNF A;  2ZBU A;  1N07 A;  4YAW A;  4RDL A;  4RD1 A;  4M53 A;  5TR9 A;  3W2H A;  1T6Y A;  2JJ1 A;  1IJF A;  1VQ8 B;  3OE7 A;  4XR6 A;  1BPL A;  1XQB A;  1B23 P;  4X06 A;  1EP1 B;  2VNK A;  4OPS A;  2YWF A;  3BH4 A;  3OAA A;  3OZU A;  2ZZF A;  2XZL A;  3CP8 A;  3SLN A;  4L8J A;  4X8I A;  1KK0 A;  3QFR A;  1KK2 A;  3FJO A;  4QVJ A;  4Z4W A;  4P3Y A;  3SJZ A;  3CD6 B;  1PJ7 A;  3LO8 A;  2D3L A;  3RY8 A;  3R6J A;  4XQF A;  4LBZ A;  3VR6 A;  4II2 A;  4ZV4 A;  1QVG B;  1MAB A;  2ZL5 A;  2V7X A;  3W2G A;  1N0V C;  1T5E A;  1G7T A;  1J9Z A;  4C43 A;  4TMW A;  1EFU A;  1E62 A;  4XOP A;  4AF7 A;  1IHM A;  2BGJ A;  3A8J A;  3U6B A;  3OW2 B;  4M0L A;  4U9U A;  1ZUN B;  1I7P A;  3AGP A;  1VQM B;  1VQO B;  1WDT A;  2VBT A;  4XOT A;  1FNB A;  1PKV A;  3JQR A;  4FN5 A;  2DYI A;  1WP6 A;  3W2I A;  2QE7 A;  3ONY A;  2CBX A;  2WPD A;  2XGJ A;  5FO1 A;  4RPD A;  5LMZ A;  2ZTG A;  4WWV A;  4G6I A;  4UZU A;  3ZZU A;  1NBM A;  4XLC A;  5DSZ A;  3GVL A;  3B8H A;  2EIX A;  2OK7 A;  3JQQ A;  1W0K A;  4YHB A;  2X6W A;  5IYN A;  2PLF A;  3AVU A;  3CC7 B;  1N06 A;  2CW5 A;  2WJV A;  4K1X A;  4X7E A;  3BQJ A;  4Y9U A;  1N0U A;  1QFJ A;  2RC6 A;  4XL9 A;  1R5N A;  2PE3 A;  4LC0 A;  4X7F A;  5HZB A;  1OB5 A;  3OZV A;  1S72 B;  3ASQ A;  3CCM B;  3H94 A;  2WR8 A;  2PMD A;  2OBS A;  2X8K A;  1K8A D;  2V7Q A;  2NV4 A;  3WNB A;  1DG1 G;  2DY1 A;  2VBU A;  3P26 A;  3MMP A;  1QUE A;  5J35 A;  3W2F A;  3CCU B;  1KZL A;  4Z4Z A;  4B3G A;  3WXM A;  2VYQ A;  1QGZ A;  2VNJ A;  3GVJ A;  1E3X A;  2EFG A;  2CND A;  3B78 A;  3H9N A;  2CC2 A;  4RDK A;  1T6Z A;  3AVT A;  2C2W A;  4QUZ A;  5HXB A;  4TKO B;  3WQZ A;  3W5V A;  4XLA A;  1ZM3 A;  1BMF A;  1E1Q A;  2GQF A;  5F4M A;  2ZZE A;  4RDJ A;  4XLF A;  1NB9 A;  3LVB A;  4DNR B;  3AGQ A;  1KRH A;  2C77 A;  4NCN A;  3AVX A;  1QFY A;  2FVG A;  2ZZG A;  5FA6 A;  3R6K A;  3SKB A;  2F1M A;  4OOX A;  4Y7C A;  1VF7 A;  1QG0 A;  3PVD A;  4P9S A;  4Y9R A;  5TV2 A;  1TTT A;  2BSA A;  2C4U A;  4N3G A;  2XND A;  1BLI A;  1GR1 A;  2CK3 A;  2XZP A;  2QDX A;  3G05 A;  3ONU A;  2KVO A;  1W35 A;  4TMX A;  1FND A;  3FPK A;  3OJX A;  1H42 A;  3VO2 A;  1K9M D;  2JJ2 A;  1ELO A;  1Q81 D;  3B82 A;  3CES A;  5DS0 A;  2JN9 A;  3AVV A;  1KK3 A;  3FPP A;  1WTH D;  2ZXI A;  1N08 A;  1GO2 A;  3WYA A;  4LBV A;  4ZCL A;  4PAA A;  1ZM4 A;  2B7C A;  1F60 A;  2QEX B;  1VHO A;  3ES9 A;  5KNL A;  4UAJ A;  5AN9 A;  1RQR A;  3ZBT A;  3A3B A;  4QVA A;  2HCJ B;  4OOV A;  4Z4S A;  1YLO A;  5IYR A;  3PUM A;  4TMT A;  3VNV A;  1JJ2 B;  4KKS A;  4G1B A;  4Z1M A;  1DDI A;  3ASP A;  1H85 A;  4P12 A;  1H8E A;  3WND A;  1E43 A;  3HAG A;  3T53 B;  2JDI A;  3P27 A;  4HE5 A;  2OTL B;  1I18 A;  1BX0 A;  4X05 A;  3QFT A;  4H9G A;  1KTV A;  2QTL A;  4RD2 A;  4X0C A;  2GJR A;  5IYW A;  3CCV B;  1YHQ B;  3SJP A;  1M90 D;  4II3 A;  3GSI A;  1UMK A;  5F4O A;  2NPF A;  4ACB A;  4DNT B;  1R5B A;  1KK1 A;  4WZT A;  4RD3 A;  5A89 A;  5A8A A;  1W34 A;  5IYQ A;  3CCS B;  1KQS B;  2V4D A;  3A3G A; 
#chains in the Genus database with same CATH homology
 3WBJ A;  3VNU A;  2BF4 A;  1QGY A;  3WNC A;  1F20 A;  1IB0 A;  1E64 A;  1KC8 D;  4TN1 A;  4C0S A;  1M1K D;  4LBY A;  3CCQ B;  1NJI D;  1XE1 A;  1FDR A;  3W2E A;  3CCE B;  3J81 k;  1YJ9 B;  2QA4 B;  2QTZ A;  1VQK B;  1QUF A;  1G7R A;  3W5H A;  1GAQ A;  4N3N A;  4ZCM A;  3CCR B;  2DER A;  1EXM A;  2R6H A;  2XEX A;  2QMU A;  4B43 A;  3QFS A;  3MCA A;  1FRQ A;  2YWH A;  5H59 A;  2GPJ A;  1YJW B;  1SM4 A;  4BPR A;  2RC5 A;  3G6E B;  1FNC A;  1DAR A;  4QFM A;  4Q7J B;  4G5G A;  1E63 A;  3U2Q A;  1YI2 B;  4AF6 A;  4PC2 A;  3CPW B;  1VQ6 B;  4M4S A;  3WBK A;  1NDH A;  1ZM2 A;  1G7C A;  1JA0 A;  2ZIT A;  4PC3 A;  4YAL A;  4YAO A;  1K73 D;  1CNE A;  1FNM A;  4TMZ A;  2X3U A;  5EMN A;  1VQN B;  1EFT A;  4ZGQ B;  3CC2 B;  1B2R A;  3U6K A;  3CC4 B;  3QSY A;  3CMA B;  3CD6 B;  3CB4 A;  4B48 A;  3OZW A;  4M1K A;  1W2B B;  4RD4 A;  1BJK A;  2B7B A;  5THX A;  3JQP A;  3I1F A;  1JB9 A;  1TVC A;  3OJW A;  2DCU A;  3G4S B;  1FRN A;  1W87 A;  4PC6 A;  1KD1 D;  4B47 A;  1U2R A;  5GV8 A;  1N8R D;  3WY9 A;  2BM1 A;  4YAU A;  2DET A;  3I55 B;  3E20 A;  3G71 B;  3AVY A;  4RD0 A;  1IJE A;  1QH0 A;  2YWE A;  2HMA A;  2VZL A;  1GVH A;  2B5O A;  4J0Q A;  4PGO A;  4YAF A;  1VQL B;  4QHY A;  3VO1 A;  2BMW A;  2OTJ B;  2VNI A;  2E1R A;  1D2E A;  1R5O A;  1QFZ A;  1BQE A;  2OK8 A;  1VQ7 B;  4WQM A;  4G1V A;  2PIA A;  4TMV A;  4LBW A;  5H5J A;  4PC1 A;  3PEN A;  1TUI A;  3CW2 A;  2AHO A;  2J7K A;  4ZGN B;  1A8P A;  1EP3 B;  1GAW A;  1ZM9 A;  4NBS A;  1VQ9 B;  3MHP A;  1JA1 A;  1EP2 B;  4P6V F;  4MYT A;  4RJL A;  4ACA A;  4FK8 A;  5KSW B;  3CRZ A;  1G7S A;  3V76 A;  1QVF B;  1CQX A;  2D74 A;  1HA3 A;  1YJN B;  4F7D A;  3QFC A;  1VQ5 B;  4ZCI A;  2BV3 A;  3CXC B;  3QE2 A;  3VMF A;  1S0U A;  1JNY A;  4R71 A;  1QGA A;  3I56 B;  4IW3 B;  4HE6 A;  3CCL B;  4B4D A;  3ZBU A;  1YIT B;  4MYU A;  2BM0 A;  1DDG A;  2BPO A;  2BN4 A;  4AC9 A;  1YIJ B;  4PC7 A;  1D8T A;  2C78 A;  3ZZT A;  1Q82 D;  4RCZ A;  3CCJ B;  1AMO A;  1TLL A;  2YWG A;  1QX4 A;  4B44 A;  3W5U A;  4DQK A;  4M2L A;  1AIP A;  4FWT A;  2BVN A;  1OB2 A;  1KJZ A;  1SKQ A;  2FX3 A;  1BX1 A;  1EFC A;  1VQP B;  4B3X A;  1Q86 D;  5GV7 A;  2XNC A;  2CRV A;  3E1Y E;  3ZZ0 A;  1OGI A;  3ZC3 A;  2DEU A;  3AVW A;  2HDN B;  2BGI A;  4RCY A;  1Q7Y D;  1VQ4 B;  2XNJ A;  1OGJ A;  4EH1 A;  4DQL A;  1EWY A;  2VNH A;  1XB2 A;  5TY0 A;  4RD6 A;  2QN6 A;  1GJR A;  1D1N A;  3CME B;  5JBQ A;  1CNF A;  4YAW A;  5TR9 A;  4RD1 A;  4M53 A;  3W2H A;  1IJF A;  1VQ8 B;  1B23 P;  1EP1 B;  2VNK A;  2YWF A;  3OZU A;  1KK0 A;  3QFR A;  1KK2 A;  3FJO A;  4P3Y A;  3SJZ A;  3LO8 A;  4LBZ A;  4ZV4 A;  1QVG B;  3W2G A;  1N0V C;  1G7T A;  1J9Z A;  4C43 A;  4TMW A;  1EFU A;  1E62 A;  4AF7 A;  2BGJ A;  3U6B A;  3OW2 B;  4M0L A;  4U9U A;  1ZUN B;  1I7P A;  3AGP A;  1VQM B;  1VQO B;  1WDT A;  1FNB A;  4FN5 A;  3JQR A;  3W2I A;  3ZZU A;  5DSZ A;  3B8H A;  2EIX A;  2OK7 A;  3JQQ A;  4YHB A;  2PLF A;  3AVU A;  3CC7 B;  4K1X A;  4Y9U A;  1N0U A;  1QFJ A;  2RC6 A;  1R5N A;  4LC0 A;  1S72 B;  1OB5 A;  3OZV A;  3CCM B;  2PMD A;  1K8A D;  3WNB A;  1DG1 G;  2DY1 A;  3P26 A;  3MMP A;  1QUE A;  3W2F A;  3CCU B;  3WXM A;  2VYQ A;  1QGZ A;  2VNJ A;  2EFG A;  2CND A;  3B78 A;  3AVT A;  5HXB A;  3W5V A;  1ZM3 A;  2GQF A;  3LVB A;  3AGQ A;  1KRH A;  2C77 A;  4NCN A;  3AVX A;  1QFY A;  5FA6 A;  4Y7C A;  1TTT A;  1QG0 A;  4Y9R A;  5TV2 A;  2BSA A;  4N3G A;  1GR1 A;  2QDX A;  1W35 A;  4TMX A;  1FND A;  3FPK A;  3OJX A;  1H42 A;  3VO2 A;  1K9M D;  1ELO A;  1Q81 D;  3B82 A;  3AVV A;  1KK3 A;  1GO2 A;  3WYA A;  4LBV A;  4ZCL A;  1ZM4 A;  2B7C A;  1F60 A;  2QEX B;  3ES9 A;  4UAJ A;  5AN9 A;  3ZBT A;  2HCJ B;  4TMT A;  3VNV A;  1JJ2 B;  4G1B A;  1DDI A;  1H85 A;  3WND A;  3P27 A;  4HE5 A;  2OTL B;  1BX0 A;  3QFT A;  4H9G A;  1KTV A;  2QTL A;  4RD2 A;  3CCV B;  1YHQ B;  1M90 D;  1UMK A;  2NPF A;  4ACB A;  1R5B A;  1KK1 A;  4RD3 A;  3CCS B;  1W34 A;  1KQS B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...