5HXBA

Cereblon in complex with ddb1, cc-885, and gspt1
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
196
structure length
196
Chain Sequence
PIRLPIVDKYKDMGTVVLGKLESGSICKGQQLVMMPNKHNVEVLGILSDDVETDTVAPGENLKIRLKGIEEEEILPGFILCDPNNLCHSGRTFDAQIVIIEHKSIICPGYNAVLHIHTCIEEVEITALICLVDKKSGEKSKTRPRFVKQDQVCIARLRTAGTICLETFKDFPQMGRFTLRDEGKTIAIGKVLKLVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords Eukaryotic peptide chain release factor GTP-binding subunit
publication title A novel cereblon modulator recruits GSPT1 to the CRL4(CRBN) ubiquitin ligase.
pubmed doi rcsb
source organism Homo sapiens
total genus 27
structure length 196
sequence length 196
chains with identical sequence X
ec nomenclature
pdb deposition date 2016-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03143 GTP_EFTU_D3 Elongation factor Tu C-terminal domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 5hxbA02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 5hxbA01
1G7TA 4G1VA 4TMXA 2EFGA 4NCNA 4B3XA 1K73D 3AVXA 3QFSA 1KK2A 1VQLB 4YAUA 3CC2B 2NPFA 1H42A 2XNCA 1W34A 3WNDA 4PC1A 3G71B 1ZM3A 3CMAB 1CNFA 4TMZA 2BVNA 4MYTA 1D1NA 3J81k 1U2RA 1YIJB 1W2BB 3SJZA 4N3NA 4J0QA 4BPRA 2BGIA 3CCUB 1KK3A 3AVYA 1DARA 3QSYA 5THXA 3JQRA 4F7DA 1I7PA 1IJEA 1AIPA 1QH0A 2OTJB 4K1XA 1EFUA 1KC8D 4PC6A 3CPWB 1GJRA 2QTZA 1H85A 1N8RD 4DQKA 1SM4A 1CNEA 3CRZA 2YWFA 1VQ4B 1VQ9B 2RC6A 2BGJA 3QFRA 4B48A 5JBQA 2B5OA 1Q7YD 3CMEB 2HCJB 1VQKB 3PENA 3WBKA 3W2IA 4TN1A 1VQ6B 4RD2A 2D74A 3ZBUA 4M4SA 1Q82D 1G7SA 1TLLA 5TY0A 1DG1G 2HMAA 4G5GA 5H5JA 1A8PA 3VO2A 3CCQB 4RD1A 4ZCLA 3W5UA 1OB5A 4P3YA 4TMTA 3U6KA 1ZM4A 2YWEA 3CC7B 3JQQA 2BN4A 1E62A 1VQOB 1YITB 1K9MD 3VO1A 2C78A 3CW2A 4DQLA 1YJNB 4U9UA 3AVTA 1KTVA 4YALA 2QMUA 5KSWB 4EH1A 1QFYA 2PLFA 2VNIA 3G4SB 1F20A 2QEXB 4ZCIA 2BMWA 2DEUA 1VQ8B 4PC7A 3W2GA 4PC3A 3CCJB 2VNKA 3AVWA 4ACAA 1F60A 4RCYA 1QFZA 3QFCA 1EXMA 2RC5A 3W5VA 1EWYA 3WBJA 1HA3A 1EP2B 2GQFA 3B82A 1FNMA 1R5BA 1JNYA 2PMDA 1KK0A 3W2FA 4IW3B 2OK8A 4AF6A 1ZUNB 4PC2A 1K8AD 1AMOA 4ZV4A 4AF7A 1NJID 1BJKA 1FNBA 1G7CA 3W2HA 1KD1D 2FX3A 1M90D 4Y7CA 3MMPA 3B8HA 4FK8A 1QVFB 2XEXA 4WQMA 3QFTA 3ZZTA 3AVUA 1VQNB 1DDIA 2BV3A 1CQXA 1ZM9A 1JJ2B 1QUEA 3QE2A 2X3UA 3WYAA 1NDHA 4RD6A 3CCMB 3CC4B 4YHBA 4R71A 3AGPA 1D8TA 2OK7A 1DDGA 1GO2A 1SKQA 4NBSA 1B2RA 2VYQA 2B7CA 3B78A 3WY9A 3OZWA 3FPKA 1VQ7B 1GAQA 2ZITA 1FDRA 4Q7JB 4LBZA 5GV8A 2OTLB 3CCLB 3I56B 1QX4A 1KQSB 4ZCMA 3I1FA 1EFTA 1KRHA 5TR9A 3VNVA 2DY1A 2C77A 1S0UA 2BM1A 3V76A 1BX1A 1G7RA 4RD0A 1FRNA 5EMNA 4M53A 1FNCA 1VQPB 1BX0A 5H59A 1OGJA 2J7KA 2R6HA 1YI2B 1JA1A 3ES9A 3ZC3A 1VQMB 1YHQB 1QVGB 2XNJA 2QA4B 1GVHA 1OB2A 1Q81D 3AVVA 4TMVA 1YJ9B 1ZM2A 4LBVA 5TV2A 2BPOA 2YWGA 2HDNB 3OZUA 3OW2B 1VQ5B 5AN9A 5FA6A 3LVBA 3CXCB 4H9GA 1N0VC 2GPJA 4YAFA 2DETA 4N3GA 5DSZA 1FRQA 1QFJA 4B44A 1QGAA 3FJOA 4ZGQB 1S72B 1UMKA 3WNBA 3E1YE 1IJFA 4LBWA 3U2QA 2DERA 1IB0A 3CD6B 1ELOA 3CB4A 4RCZA 1GAWA 5HXBA 2PIAA 2QDXA 1YJWB 1WDTA 1W35A 3W5HA 3E20A 4M1KA 1FNDA 1GR1A 4TMWA 4M2LA 4G1BA 3VMFA 1EP1B 2E1RA 2EIXA 3MCAA 3ZZ0A 3VNUA 1TVCA 2DCUA 4MYUA 4UAJA 4M0LA 2YWHA 2B7BA 1R5OA 4FWTA 1E63A 4C43A 1KK1A 3OJWA 4QFMA 1TUIA 1QGZA 3CCEB 4P6VF 1QUFA 4B4DA 1QGYA 1R5NA 4LBYA 3CCVB 3I55B 4YAOA 2CRVA 3ZBTA 4PGOA 2BF4A 2BM0A 3P27A 4HE6A 4ACBA 3CCRB 4QHYA 3U6BA 3MHPA 1D2EA 1JB9A 1TTTA 2QTLA 4RD4A 4C0SA 1J9ZA 2VNHA 1EFCA 1M1KD 4RD3A 3AGQA 1QG0A 4HE5A 1E64A 3CCSB 1JA0A 2AHOA 3ZZUA 1N0UA 3OZVA 3WNCA 4FN5A 4ZGNB 3WXMA 3OJXA 1KJZA 3JQPA 2QN6A 1B23P 1OGIA 3P26A 2VZLA 2VNJA 2BSAA 4B43A 1BQEA 4Y9UA 5GV7A 4Y9RA 3W2EA 2CNDA 1W87A 4LC0A 1EP3B 4B47A 1XB2A 4AC9A 1Q86D 4RJLA 3LO8A 1XE1A 3G6EB 4YAWA
chains in the Genus database with same CATH superfamily
3KEWA 2ZL5A 4OPSA 1WOSA 2NV4A 1G7TA 3A3GA 1I18A 3OAAA 4G1VA 2JDIA 4TMXA 2EFGA 2JIZA 4NCNA 3RY8A 3CMMA 4B3XA 4XNFA 1K73D 3AVXA 3QFSA 1KK2A 1VQLB 4YAUA 3Q3AA 2NPFA 3CC2B 3LQ6A 3H9NA 1H42A 4XLEA 5A89A 4RPDA 2V7TA 2XNCA 4OP7A 3T53B 4P26A 1W34A 3WNDA 4Z4UA 4PC1A 2ZXHA 3Q39A 3G71B 1ZM3A 4OOXA 2QGGA 2X0KA 3CMAB 3CESA 1CNFA 1YLOA 4TMZA 2BVNA 4MYTA 1D1NA 3BNWA 2ZZQA 3J81k 1E43A 1U2RA 1YIJB 1T6XA 1UD2A 1W2BB 3SJZA 2QE7A 1VHOA 2XNDA 1VF7A 3GVLA 4J0QA 1E3ZA 4N3NA 4BPRA 2BGIA 3CCUB 5FO0A 1KK3A 2X85A 1W0JA 3AVYA 1DARA 2XZOA 3QSYA 5THXA 2Q6OA 3JQRA 4F7DA 1I7PA 1H8EA 1IJEA 1AIPA 1QH0A 2OTJB 2I1LA 4RLZA 2C4UA 2XZLA 4K1XA 3SLNA 1EFUA 1XQBA 1KC8D 4PC6A 3CPWB 1GJRA 2QTZA 4X7DA 3HAGA 3OEEA 4XM3A 3OOCA 3PA2A 1H85A 1N8RD 3OKXA 2WJVA 4DQKA 2C5HA 2VJIA 3ZPNA 1SM4A 4XD7A 1V5VA 1WU8A 1CNEA 1BPLA 3CRZA 4B3GA 2ZXIA 3T51B 3ASQA 1I8DA 2YWFA 1VQ4B 4KKSA 1VQ9B 2RC6A 2BGJA 3QFRA 4B48A 5A88A 5JBQA 1WPCA 5KW9A 2B5OA 1Q7YD 3ONUA 4TSFA 5HZAA 3CMEB 2HCJB 1UD4A 1VQKB 5F4MA 3PENA 3WBKA 3W2IA 2C5BA 4TN1A 1WSVA 4CQJA 1VQ6B 4RD2A 2D74A 1VLYA 4M4SA 1V0FA 1G7SA 1TLLA 4ROXA 1DG1G 2HMAA 4G5GA 4XKWA 1A8PA 5H5JA 5TY0A 3VO2A 5HZBA 3CCQB 4RD1A 4ZCLA 3W5UA 1OB5A 2WR8A 4X7EA 2GJRA 3CTAA 2VJJA 4II3A 1Y0YA 4P3YA 2GREA 2F43A 4TMTA 1T5EA 2WZPP 1PJ7A 5L46A 5IYPA 2WPDA 3WQZA 3U6KA 1ZM4A 2YWEA 3CC7B 2GK6A 3PUNA 3A35A 3JQQA 2BN4A 1E62A 2WYRA 1VQOB 2V7VA 1YITB 1K9MD 2CBXA 3VO1A 1RQRA 2C78A 3OE7A 3CW2A 4DQLA 3DDYA 4FXUA 1YJNB 4U9UA 3PUMA 3AVTA 1KTVA 3KL9A 2VBTA 4YALA 3FPPA 1E1QA 2QMUA 5KSWB 4EH1A 3ASRA 1OHHA 4Z4RA 1QFYA 2PLFA 2VNIA 1YX2A 1NBMA 4X0CA 2Q6LA 3G4SB 1F20A 2QEXB 4ZCIA 2BMWA 2DEUA 3BY2A 2ZZEA 1VQ8B 4B3FX 4PC7A 3W2GA 4PC3A 4YELA 1COWA 3CCJB 1E1RA 2VNKA 3NE5B 3AVWA 4ACAA 1F60A 4RCYA 2V7UA 2OBSA 4RDKA 2F4NA 4P6YA 1QFZA 3QFCA 1EXMA 4Z4SA 2RC5A 5BSXA 4DK0A 3R6KA 1EWYA 3W5VA 3WBJA 1HA3A 1EP2B 2GQFA 2X8KA 1FNMA 1R5BA 3B82A 2X6YA 1JNYA 2HLDA 4QVAA 2PMDA 1KK0A 2ZBUA 3BQJA 3W2FA 4IW3B 3ASSA 2OK8A 4AF6A 1ZUNB 3ASTA 3SJPA 4PC2A 4XLAA 1K8AD 2D3LA 2WSSA 1AMOA 4ZV4A 1Q9SA 4AF7A 1NJID 1BJKA 1FNBA 3ZBUA 2OYNA 1G7CA 2ZTNA 3W2HA 1KD1D 2FX3A 3SEJA 1NRKA 4Y7CA 1M90D 1W9XA 2OBTA 3MMPA 3B8HA 3BCDA 2C4TA 3GVKA 4FK8A 4DNRB 4XLCA 4XMYA 1QVFB 2XEXA 4WQMA 4Z4YA 1KZLA 2P3MA 3QFTA 1IHMA 3CPXA 4KKUA 3ZZTA 1P4MA 3AVUA 1VQNB 5IK2A 1DDIA 2BV3A 1CQXA 1ZM9A 1JJ2B 5B6IA 1N08A 4XOTA 4OPVA 1QUEA 2C2WA 2ZZFA 2F1LA 3QE2A 4WZEA 3A8KA 4P9SA 2X3UA 4XORA 2JJ1A 4RM0A 2CW5A 3WYAA 1NDHA 4RD6A 3CCMB 3CC4B 4G7WA 3JU4A 2ZL7A 4YHBA 4R71A 4QUZA 1HZEA 3AGPA 2GJKA 1BMFA 4P2NA 1D8TA 2OK7A 2W6IA 1VJSA 4YEJA 1DDGA 1GO2A 2D3NA 5CDFA 4QV2A 1SKQA 2CC2A 4NBSA 1MABA 1B2RA 2VYQA 1PJ5A 2X6XA 2B7CA 3B78A 3WY9A 3SLDA 4UZFA 1E3XA 1N07A 3OZWA 4X07A 2V4DA 3BC9A 3FPKA 1WSRA 2VBSA 1VQ7B 1GAQA 2ZITA 1FDRA 3ASPA 2V7XA 1OB0A 3VR6A 4Q7JB 4LBZA 4X7CA 5GV8A 2OTLB 4ASUA 2JJ2A 3CCLB 1N06A 4RDLA 1QX4A 3I56B 4XKVA 1KQSB 2V7WA 4ZCMA 1KMHA 3I1FA 1EFTA 1NB9A 1KRHA 5TR9A 3VNVA 5FNZA 2GJPA 2DY1A 4G6IA 2DYIA 2C77A 2W6JA 5DN6A 1S0UA 1PJ6A 2BM1A 3ZUGA 3V76A 4XN3A 1BX1A 2M5SA 1G7RA 4RD0A 1Y0RA 4WZLA 2ZBVA 5IYQA 1FRNA 4Z1MA 3R6JA 5EMNA 5FIUA 4M53A 1FNCA 1VQPB 1BX0A 5H59A 1OGJA 4X06A 2J7KA 1BLIA 2R6HA 1WTHD 3CP2A 1YI2B 1JA1A 3ES9A 1H8HA 3ZC3A 5IYRA 3A8IA 4UZEA 3FKSA 4TKOB 5KNLA 1VLOA 5DS0A 1VQMB 2Z6BD 1YHQB 1QVGB 2XNJA 4OOVA 4TT3A 5HKKA 2E1BA 2QA4B 1GVHA 1OB2A 1Q81D 2CF4A 3AVVA 2VBUA 4TMVA 1YJ9B 1ZM2A 2XOKA 4LBVA 5J3OA 5TV2A 5F4OA 3V7AA 2BPOA 1W0KA 1RQPA 2YWGA 4KKTA 3H94A 4P25A 2PE3A 2HDNB 4E0FA 5TRDA 3OZUA 3OW2B 1VQ5B 4WZTA 5FA6A 5AN9A 3LVBA 3OEHA 5FO1A 5FL7A 4H9GA 3CXCB 4PAAA 1N0VC 2GPJA 4Z4WA 2XGJA 4YAFA 2DETA 2VBVA 5J35A 4N3GA 2CK3A 2KVOA 1UD6A 5DSZA 1FRQA 1QFJA 4HIZA 4RDJA 4B44A 1T6ZA 5E6TA 1QGAA 4WZKA 2X53S 4X7FA 3FJOA 4II2A 4AVZA 4ZGQB 3D26A 2WJYA 2X6WA 1S72B 1UMKA 1WOPA 3WNBA 1WOOA 3E1YE 1IJFA 1VHEA 4LBWA 3U2QA 1MRZA 2DERA 3ISXA 1IB0A 3CD6B 4Z4ZA 5IYNA 3GSIA 4XLFA 1ELOA 3CB4A 4XQFA 4RCZA 1GAWA 4XOPA 5HXBA 2PIAA 2QDXA 1YJWB 4NNJA 1WDTA 1W35A 5F4JA 2V7QA 3W5HA 4DNTB 3E20A 1SKYB 3OPOA 4X05A 4M1KA 1FNDA 1GR1A 4L8JA 4Z4VA 4GQNA 1FX0A 4XONA 4TMWA 4M2LA 4G1BA 4XR6A 3VMFA 4G7XA 1EP1B 2E1RA 2EIXA 3OP1A 3MCAA 3PVDA 3ZZ0A 3VNUA 4PABA 2R9VA 2Q6IA 1TVCA 4X8IA 2DCUA 4MYUA 2V31A 4UAJA 4P12A 2XZPA 1HVXA 3GIRA 4M0LA 2YWHA 2B7BA 4XN0A 1R5OA 3GVJA 4FWTA 1E63A 1NB0A 2DIEA 3CP8A 3LQEA 4C43A 5LMZA 1KK1A 3BCFA 3OJWA 4OPOA 1TUIA 1QGZA 4QFMA 1UD8A 3BY1A 1S4MA 3CCEB 4P6VF 1QUFA 4B4DA 1QGYA 1R5NA 3A1PA 3ONYA 3Q6QA 4LBYA 4QVJA 1UD5A 4UZUA 3I55B 3CCVB 4P1VA 1E79A 5BSYA 4YAOA 3GQBA 2CRVA 3ZBTA 4PGOA 2BF4A 2ZZGA 2BM0A 3P27A 1K28D 4HE6A 5A8AA 4ACBA 3CCRB 4QHYA 2JN9A 3U6BA 3Q6RA 1N05A 3MHPA 1D2EA 3SKBA 1JB9A 3A8JA 3ZIAA 4OOSA 5IYWA 2QTLA 1TTTA 4RD4A 3G05A 3Q38A 4C0SA 1J9ZA 2VNHA 1EFCA 4XLHA 1M1KD 3OW7A 3AGQA 1QG0A 4HE5A 1E64A 4RD3A 4RPBA 3A3BA 2F1MA 3CCSB 1JA0A 2AHOA 3ZZUA 1WORA 3BH4A 1N0UA 3LNNA 3OZVA 1T6YA 4JMQA 3WNCA 1PKVA 4FN5A 3T56B 3PA1A 4ZGNB 3WXMA 3OJXA 1KJZA 3JQPA 2FVGA 1XFOA 2ZL6A 4P3IA 1Q82D 2QN6A 2ZTGA 1B23P 1OGIA 3P26A 2VZLA 2VNJA 2BSAA 4B43A 2Q6KA 1BQEA 3OFNA 4Y9UA 5GV7A 2DOGA 4YXWA 1EFRA 1UD3A 4Y9RA 2CNDA 3W2EA 1W87A 2LZJA 4LC0A 1EP3B 2OBRA 4P22A 1XB2A 4B47A 4AC9A 4DK1A 2WZNA 1Q86D 4RJLA 3LO8A 4WWVA 4Z4TA 1XE1A 3G6EB 4XL9A 2D9RA 2GK7A 4YAWA 1V0EA 1WP6A
chains in the Genus database with same CATH topology
1G7TA 4G1VA 4TMXA 2EFGA 4NCNA 4B3XA 1K73D 3AVXA 3QFSA 1KK2A 1VQLB 4YAUA 3CC2B 2NPFA 1H42A 2XNCA 1W34A 3WNDA 4PC1A 3G71B 1ZM3A 3CMAB 1CNFA 4TMZA 2BVNA 4MYTA 1D1NA 3J81k 1U2RA 1YIJB 1W2BB 3SJZA 4N3NA 4J0QA 4BPRA 2BGIA 3CCUB 1KK3A 3AVYA 1DARA 3QSYA 5THXA 3JQRA 4F7DA 1I7PA 1IJEA 1AIPA 1QH0A 2OTJB 4K1XA 1EFUA 1KC8D 4PC6A 3CPWB 1GJRA 2QTZA 1H85A 1N8RD 4DQKA 1SM4A 1CNEA 3CRZA 2YWFA 1VQ4B 1VQ9B 2RC6A 2BGJA 3QFRA 4B48A 5JBQA 2B5OA 1Q7YD 3CMEB 2HCJB 1VQKB 3PENA 3WBKA 3W2IA 4TN1A 1VQ6B 4RD2A 2D74A 3ZBUA 4M4SA 1Q82D 1G7SA 1TLLA 5TY0A 1DG1G 2HMAA 4G5GA 5H5JA 1A8PA 3VO2A 3CCQB 4RD1A 4ZCLA 3W5UA 1OB5A 4P3YA 4TMTA 3U6KA 1ZM4A 2YWEA 3CC7B 3JQQA 2BN4A 1E62A 1VQOB 1YITB 1K9MD 3VO1A 2C78A 3CW2A 4DQLA 1YJNB 4U9UA 3AVTA 1KTVA 4YALA 2QMUA 5KSWB 4EH1A 1QFYA 2PLFA 2VNIA 3G4SB 1F20A 2QEXB 4ZCIA 2BMWA 2DEUA 1VQ8B 4PC7A 3W2GA 4PC3A 3CCJB 2VNKA 3AVWA 4ACAA 1F60A 4RCYA 1QFZA 3QFCA 1EXMA 2RC5A 3W5VA 1EWYA 3WBJA 1HA3A 1EP2B 2GQFA 3B82A 1FNMA 1R5BA 1JNYA 2PMDA 1KK0A 3W2FA 4IW3B 2OK8A 4AF6A 1ZUNB 4PC2A 1K8AD 1AMOA 4ZV4A 4AF7A 1NJID 1BJKA 1FNBA 1G7CA 3W2HA 1KD1D 2FX3A 1M90D 4Y7CA 3MMPA 3B8HA 4FK8A 1QVFB 2XEXA 4WQMA 3QFTA 3ZZTA 3AVUA 1VQNB 1DDIA 2BV3A 1CQXA 1ZM9A 1JJ2B 1QUEA 3QE2A 2X3UA 3WYAA 1NDHA 4RD6A 3CCMB 3CC4B 4YHBA 4R71A 3AGPA 1D8TA 2OK7A 1DDGA 1GO2A 1SKQA 4NBSA 1B2RA 2VYQA 2B7CA 3B78A 3WY9A 3OZWA 3FPKA 1VQ7B 1GAQA 2ZITA 1FDRA 4Q7JB 4LBZA 5GV8A 2OTLB 3CCLB 3I56B 1QX4A 1KQSB 4ZCMA 3I1FA 1EFTA 1KRHA 5TR9A 3VNVA 2DY1A 2C77A 1S0UA 2BM1A 3V76A 1BX1A 1G7RA 4RD0A 1FRNA 5EMNA 4M53A 1FNCA 1VQPB 1BX0A 5H59A 1OGJA 2J7KA 2R6HA 1YI2B 1JA1A 3ES9A 3ZC3A 1VQMB 1YHQB 1QVGB 2XNJA 2QA4B 1GVHA 1OB2A 1Q81D 3AVVA 4TMVA 1YJ9B 1ZM2A 4LBVA 5TV2A 2BPOA 2YWGA 2HDNB 3OZUA 3OW2B 1VQ5B 5AN9A 5FA6A 3LVBA 3CXCB 4H9GA 1N0VC 2GPJA 4YAFA 2DETA 4N3GA 5DSZA 1FRQA 1QFJA 4B44A 1QGAA 3FJOA 4ZGQB 1S72B 1UMKA 3WNBA 3E1YE 1IJFA 4LBWA 3U2QA 2DERA 1IB0A 3CD6B 1ELOA 3CB4A 4RCZA 1GAWA 5HXBA 2PIAA 2QDXA 1YJWB 1WDTA 1W35A 3W5HA 3E20A 4M1KA 1FNDA 1GR1A 4TMWA 4M2LA 4G1BA 3VMFA 1EP1B 2E1RA 2EIXA 3MCAA 3ZZ0A 3VNUA 1TVCA 2DCUA 4MYUA 4UAJA 4M0LA 2YWHA 2B7BA 1R5OA 4FWTA 1E63A 4C43A 1KK1A 3OJWA 4QFMA 1TUIA 1QGZA 3CCEB 4P6VF 1QUFA 4B4DA 1QGYA 1R5NA 4LBYA 3CCVB 3I55B 4YAOA 2CRVA 3ZBTA 4PGOA 2BF4A 2BM0A 3P27A 4HE6A 4ACBA 3CCRB 4QHYA 3U6BA 3MHPA 1D2EA 1JB9A 1TTTA 2QTLA 4RD4A 4C0SA 1J9ZA 2VNHA 1EFCA 1M1KD 4RD3A 3AGQA 1QG0A 4HE5A 1E64A 3CCSB 1JA0A 2AHOA 3ZZUA 1N0UA 3OZVA 3WNCA 4FN5A 4ZGNB 3WXMA 3OJXA 1KJZA 3JQPA 2QN6A 1B23P 1OGIA 3P26A 2VZLA 2VNJA 2BSAA 4B43A 1BQEA 4Y9UA 5GV7A 4Y9RA 3W2EA 2CNDA 1W87A 4LC0A 1EP3B 4B47A 1XB2A 4AC9A 1Q86D 4RJLA 3LO8A 1XE1A 3G6EB 4YAWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G7T A;  4G1V A;  4TMX A;  2EFG A;  4NCN A;  4B3X A;  1K73 D;  3AVX A;  3QFS A;  1KK2 A;  1VQL B;  4YAU A;  3CC2 B;  2NPF A;  1H42 A;  2XNC A;  1W34 A;  3WND A;  4PC1 A;  3G71 B;  1ZM3 A;  3CMA B;  1CNF A;  4TMZ A;  2BVN A;  4MYT A;  1D1N A;  3J81 k;  1U2R A;  1YIJ B;  1W2B B;  3SJZ A;  4N3N A;  4J0Q A;  4BPR A;  2BGI A;  3CCU B;  1KK3 A;  3AVY A;  1DAR A;  3QSY A;  5THX A;  3JQR A;  4F7D A;  1I7P A;  1IJE A;  1AIP A;  1QH0 A;  2OTJ B;  4K1X A;  1EFU A;  1KC8 D;  4PC6 A;  3CPW B;  1GJR A;  2QTZ A;  1H85 A;  1N8R D;  4DQK A;  1SM4 A;  1CNE A;  3CRZ A;  2YWF A;  1VQ4 B;  1VQ9 B;  2RC6 A;  2BGJ A;  3QFR A;  4B48 A;  5JBQ A;  2B5O A;  1Q7Y D;  3CME B;  2HCJ B;  1VQK B;  3PEN A;  3WBK A;  3W2I A;  4TN1 A;  1VQ6 B;  4RD2 A;  2D74 A;  3ZBU A;  4M4S A;  1Q82 D;  1G7S A;  1TLL A;  5TY0 A;  1DG1 G;  2HMA A;  4G5G A;  5H5J A;  1A8P A;  3VO2 A;  3CCQ B;  4RD1 A;  4ZCL A;  3W5U A;  1OB5 A;  4P3Y A;  4TMT A;  3U6K A;  1ZM4 A;  2YWE A;  3CC7 B;  3JQQ A;  2BN4 A;  1E62 A;  1VQO B;  1YIT B;  1K9M D;  3VO1 A;  2C78 A;  3CW2 A;  4DQL A;  1YJN B;  4U9U A;  3AVT A;  1KTV A;  4YAL A;  2QMU A;  5KSW B;  4EH1 A;  1QFY A;  2PLF A;  2VNI A;  3G4S B;  1F20 A;  2QEX B;  4ZCI A;  2BMW A;  2DEU A;  1VQ8 B;  4PC7 A;  3W2G A;  4PC3 A;  3CCJ B;  2VNK A;  3AVW A;  4ACA A;  1F60 A;  4RCY A;  1QFZ A;  3QFC A;  1EXM A;  2RC5 A;  3W5V A;  1EWY A;  3WBJ A;  1HA3 A;  1EP2 B;  2GQF A;  3B82 A;  1FNM A;  1R5B A;  1JNY A;  2PMD A;  1KK0 A;  3W2F A;  4IW3 B;  2OK8 A;  4AF6 A;  1ZUN B;  4PC2 A;  1K8A D;  1AMO A;  4ZV4 A;  4AF7 A;  1NJI D;  1BJK A;  1FNB A;  1G7C A;  3W2H A;  1KD1 D;  2FX3 A;  1M90 D;  4Y7C A;  3MMP A;  3B8H A;  4FK8 A;  1QVF B;  2XEX A;  4WQM A;  3QFT A;  3ZZT A;  3AVU A;  1VQN B;  1DDI A;  2BV3 A;  1CQX A;  1ZM9 A;  1JJ2 B;  1QUE A;  3QE2 A;  2X3U A;  3WYA A;  1NDH A;  4RD6 A;  3CCM B;  3CC4 B;  4YHB A;  4R71 A;  3AGP A;  1D8T A;  2OK7 A;  1DDG A;  1GO2 A;  1SKQ A;  4NBS A;  1B2R A;  2VYQ A;  2B7C A;  3B78 A;  3WY9 A;  3OZW A;  3FPK A;  1VQ7 B;  1GAQ A;  2ZIT A;  1FDR A;  4Q7J B;  4LBZ A;  5GV8 A;  2OTL B;  3CCL B;  3I56 B;  1QX4 A;  1KQS B;  4ZCM A;  3I1F A;  1EFT A;  1KRH A;  5TR9 A;  3VNV A;  2DY1 A;  2C77 A;  1S0U A;  2BM1 A;  3V76 A;  1BX1 A;  1G7R A;  4RD0 A;  1FRN A;  5EMN A;  4M53 A;  1FNC A;  1VQP B;  1BX0 A;  5H59 A;  1OGJ A;  2J7K A;  2R6H A;  1YI2 B;  1JA1 A;  3ES9 A;  3ZC3 A;  1VQM B;  1YHQ B;  1QVG B;  2XNJ A;  2QA4 B;  1GVH A;  1OB2 A;  1Q81 D;  3AVV A;  4TMV A;  1YJ9 B;  1ZM2 A;  4LBV A;  5TV2 A;  2BPO A;  2YWG A;  2HDN B;  3OZU A;  3OW2 B;  1VQ5 B;  5AN9 A;  5FA6 A;  3LVB A;  3CXC B;  4H9G A;  1N0V C;  2GPJ A;  4YAF A;  2DET A;  4N3G A;  5DSZ A;  1FRQ A;  1QFJ A;  4B44 A;  1QGA A;  3FJO A;  4ZGQ B;  1S72 B;  1UMK A;  3WNB A;  3E1Y E;  1IJF A;  4LBW A;  3U2Q A;  2DER A;  1IB0 A;  3CD6 B;  1ELO A;  3CB4 A;  4RCZ A;  1GAW A;  5HXB A;  2PIA A;  2QDX A;  1YJW B;  1WDT A;  1W35 A;  3W5H A;  3E20 A;  4M1K A;  1FND A;  1GR1 A;  4TMW A;  4M2L A;  4G1B A;  3VMF A;  1EP1 B;  2E1R A;  2EIX A;  3MCA A;  3ZZ0 A;  3VNU A;  1TVC A;  2DCU A;  4MYU A;  4UAJ A;  4M0L A;  2YWH A;  2B7B A;  1R5O A;  4FWT A;  1E63 A;  4C43 A;  1KK1 A;  3OJW A;  4QFM A;  1TUI A;  1QGZ A;  3CCE B;  4P6V F;  1QUF A;  4B4D A;  1QGY A;  1R5N A;  4LBY A;  3CCV B;  3I55 B;  4YAO A;  2CRV A;  3ZBT A;  4PGO A;  2BF4 A;  2BM0 A;  3P27 A;  4HE6 A;  4ACB A;  3CCR B;  4QHY A;  3U6B A;  3MHP A;  1D2E A;  1JB9 A;  1TTT A;  2QTL A;  4RD4 A;  4C0S A;  1J9Z A;  2VNH A;  1EFC A;  1M1K D;  4RD3 A;  3AGQ A;  1QG0 A;  4HE5 A;  1E64 A;  3CCS B;  1JA0 A;  2AHO A;  3ZZU A;  1N0U A;  3OZV A;  3WNC A;  4FN5 A;  4ZGN B;  3WXM A;  3OJX A;  1KJZ A;  3JQP A;  2QN6 A;  1B23 P;  1OGI A;  3P26 A;  2VZL A;  2VNJ A;  2BSA A;  4B43 A;  1BQE A;  4Y9U A;  5GV7 A;  4Y9R A;  3W2E A;  2CND A;  1W87 A;  4LC0 A;  1EP3 B;  4B47 A;  1XB2 A;  4AC9 A;  1Q86 D;  4RJL A;  3LO8 A;  1XE1 A;  3G6E B;  4YAW A; 
#chains in the Genus database with same CATH topology
 3KEW A;  2ZL5 A;  4OPS A;  1WOS A;  2NV4 A;  1G7T A;  3A3G A;  1I18 A;  3OAA A;  4G1V A;  2JDI A;  4TMX A;  2EFG A;  2JIZ A;  4NCN A;  3RY8 A;  3CMM A;  4B3X A;  4XNF A;  1K73 D;  3AVX A;  3QFS A;  1KK2 A;  1VQL B;  4YAU A;  3Q3A A;  2NPF A;  3CC2 B;  3LQ6 A;  3H9N A;  1H42 A;  4XLE A;  5A89 A;  4RPD A;  2V7T A;  2XNC A;  4OP7 A;  3T53 B;  4P26 A;  1W34 A;  3WND A;  4Z4U A;  4PC1 A;  2ZXH A;  3Q39 A;  3G71 B;  1ZM3 A;  4OOX A;  2QGG A;  2X0K A;  3CMA B;  3CES A;  1CNF A;  1YLO A;  4TMZ A;  2BVN A;  4MYT A;  1D1N A;  3BNW A;  2ZZQ A;  3J81 k;  1E43 A;  1U2R A;  1YIJ B;  1T6X A;  1UD2 A;  1W2B B;  3SJZ A;  2QE7 A;  1VHO A;  2XND A;  1VF7 A;  3GVL A;  4J0Q A;  1E3Z A;  4N3N A;  4BPR A;  2BGI A;  3CCU B;  5FO0 A;  1KK3 A;  2X85 A;  1W0J A;  3AVY A;  1DAR A;  2XZO A;  3QSY A;  5THX A;  2Q6O A;  3JQR A;  4F7D A;  1I7P A;  1H8E A;  1IJE A;  1AIP A;  1QH0 A;  2OTJ B;  2I1L A;  4RLZ A;  2C4U A;  2XZL A;  4K1X A;  3SLN A;  1EFU A;  1XQB A;  1KC8 D;  4PC6 A;  3CPW B;  1GJR A;  2QTZ A;  4X7D A;  3HAG A;  3OEE A;  4XM3 A;  3OOC A;  3PA2 A;  1H85 A;  1N8R D;  3OKX A;  2WJV A;  4DQK A;  2C5H A;  2VJI A;  3ZPN A;  1SM4 A;  4XD7 A;  1V5V A;  1WU8 A;  1CNE A;  1BPL A;  3CRZ A;  4B3G A;  2ZXI A;  3T51 B;  3ASQ A;  1I8D A;  2YWF A;  1VQ4 B;  4KKS A;  1VQ9 B;  2RC6 A;  2BGJ A;  3QFR A;  4B48 A;  5A88 A;  5JBQ A;  1WPC A;  5KW9 A;  2B5O A;  1Q7Y D;  3ONU A;  4TSF A;  5HZA A;  3CME B;  2HCJ B;  1UD4 A;  1VQK B;  5F4M A;  3PEN A;  3WBK A;  3W2I A;  2C5B A;  4TN1 A;  1WSV A;  4CQJ A;  1VQ6 B;  4RD2 A;  2D74 A;  1VLY A;  4M4S A;  1V0F A;  1G7S A;  1TLL A;  4ROX A;  1DG1 G;  2HMA A;  4G5G A;  4XKW A;  1A8P A;  5H5J A;  5TY0 A;  3VO2 A;  5HZB A;  3CCQ B;  4RD1 A;  4ZCL A;  3W5U A;  1OB5 A;  2WR8 A;  4X7E A;  2GJR A;  3CTA A;  2VJJ A;  4II3 A;  1Y0Y A;  4P3Y A;  2GRE A;  2F43 A;  4TMT A;  1T5E A;  2WZP P;  1PJ7 A;  5L46 A;  5IYP A;  2WPD A;  3WQZ A;  3U6K A;  1ZM4 A;  2YWE A;  3CC7 B;  2GK6 A;  3PUN A;  3A35 A;  3JQQ A;  2BN4 A;  1E62 A;  2WYR A;  1VQO B;  2V7V A;  1YIT B;  1K9M D;  2CBX A;  3VO1 A;  1RQR A;  2C78 A;  3OE7 A;  3CW2 A;  4DQL A;  3DDY A;  4FXU A;  1YJN B;  4U9U A;  3PUM A;  3AVT A;  1KTV A;  3KL9 A;  2VBT A;  4YAL A;  3FPP A;  1E1Q A;  2QMU A;  5KSW B;  4EH1 A;  3ASR A;  1OHH A;  4Z4R A;  1QFY A;  2PLF A;  2VNI A;  1YX2 A;  1NBM A;  4X0C A;  2Q6L A;  3G4S B;  1F20 A;  2QEX B;  4ZCI A;  2BMW A;  2DEU A;  3BY2 A;  2ZZE A;  1VQ8 B;  4B3F X;  4PC7 A;  3W2G A;  4PC3 A;  4YEL A;  1COW A;  3CCJ B;  1E1R A;  2VNK A;  3NE5 B;  3AVW A;  4ACA A;  1F60 A;  4RCY A;  2V7U A;  2OBS A;  4RDK A;  2F4N A;  4P6Y A;  1QFZ A;  3QFC A;  1EXM A;  4Z4S A;  2RC5 A;  5BSX A;  4DK0 A;  3R6K A;  1EWY A;  3W5V A;  3WBJ A;  1HA3 A;  1EP2 B;  2GQF A;  2X8K A;  1FNM A;  1R5B A;  3B82 A;  2X6Y A;  1JNY A;  2HLD A;  4QVA A;  2PMD A;  1KK0 A;  2ZBU A;  3BQJ A;  3W2F A;  4IW3 B;  3ASS A;  2OK8 A;  4AF6 A;  1ZUN B;  3AST A;  3SJP A;  4PC2 A;  4XLA A;  1K8A D;  2D3L A;  2WSS A;  1AMO A;  4ZV4 A;  1Q9S A;  4AF7 A;  1NJI D;  1BJK A;  1FNB A;  3ZBU A;  2OYN A;  1G7C A;  2ZTN A;  3W2H A;  1KD1 D;  2FX3 A;  3SEJ A;  1NRK A;  4Y7C A;  1M90 D;  1W9X A;  2OBT A;  3MMP A;  3B8H A;  3BCD A;  2C4T A;  3GVK A;  4FK8 A;  4DNR B;  4XLC A;  4XMY A;  1QVF B;  2XEX A;  4WQM A;  4Z4Y A;  1KZL A;  2P3M A;  3QFT A;  1IHM A;  3CPX A;  4KKU A;  3ZZT A;  1P4M A;  3AVU A;  1VQN B;  5IK2 A;  1DDI A;  2BV3 A;  1CQX A;  1ZM9 A;  1JJ2 B;  5B6I A;  1N08 A;  4XOT A;  4OPV A;  1QUE A;  2C2W A;  2ZZF A;  2F1L A;  3QE2 A;  4WZE A;  3A8K A;  4P9S A;  2X3U A;  4XOR A;  2JJ1 A;  4RM0 A;  2CW5 A;  3WYA A;  1NDH A;  4RD6 A;  3CCM B;  3CC4 B;  4G7W A;  3JU4 A;  2ZL7 A;  4YHB A;  4R71 A;  4QUZ A;  1HZE A;  3AGP A;  2GJK A;  1BMF A;  4P2N A;  1D8T A;  2OK7 A;  2W6I A;  1VJS A;  4YEJ A;  1DDG A;  1GO2 A;  2D3N A;  5CDF A;  4QV2 A;  1SKQ A;  2CC2 A;  4NBS A;  1MAB A;  1B2R A;  2VYQ A;  1PJ5 A;  2X6X A;  2B7C A;  3B78 A;  3WY9 A;  3SLD A;  4UZF A;  1E3X A;  1N07 A;  3OZW A;  4X07 A;  2V4D A;  3BC9 A;  3FPK A;  1WSR A;  2VBS A;  1VQ7 B;  1GAQ A;  2ZIT A;  1FDR A;  3ASP A;  2V7X A;  1OB0 A;  3VR6 A;  4Q7J B;  4LBZ A;  4X7C A;  5GV8 A;  2OTL B;  4ASU A;  2JJ2 A;  3CCL B;  1N06 A;  4RDL A;  1QX4 A;  3I56 B;  4XKV A;  1KQS B;  2V7W A;  4ZCM A;  1KMH A;  3I1F A;  1EFT A;  1NB9 A;  1KRH A;  5TR9 A;  3VNV A;  5FNZ A;  2GJP A;  2DY1 A;  4G6I A;  2DYI A;  2C77 A;  2W6J A;  5DN6 A;  1S0U A;  1PJ6 A;  2BM1 A;  3ZUG A;  3V76 A;  4XN3 A;  1BX1 A;  2M5S A;  1G7R A;  4RD0 A;  1Y0R A;  4WZL A;  2ZBV A;  5IYQ A;  1FRN A;  4Z1M A;  3R6J A;  5EMN A;  5FIU A;  4M53 A;  1FNC A;  1VQP B;  1BX0 A;  5H59 A;  1OGJ A;  4X06 A;  2J7K A;  1BLI A;  2R6H A;  1WTH D;  3CP2 A;  1YI2 B;  1JA1 A;  3ES9 A;  1H8H A;  3ZC3 A;  5IYR A;  3A8I A;  4UZE A;  3FKS A;  4TKO B;  5KNL A;  1VLO A;  5DS0 A;  1VQM B;  2Z6B D;  1YHQ B;  1QVG B;  2XNJ A;  4OOV A;  4TT3 A;  5HKK A;  2E1B A;  2QA4 B;  1GVH A;  1OB2 A;  1Q81 D;  2CF4 A;  3AVV A;  2VBU A;  4TMV A;  1YJ9 B;  1ZM2 A;  2XOK A;  4LBV A;  5J3O A;  5TV2 A;  5F4O A;  3V7A A;  2BPO A;  1W0K A;  1RQP A;  2YWG A;  4KKT A;  3H94 A;  4P25 A;  2PE3 A;  2HDN B;  4E0F A;  5TRD A;  3OZU A;  3OW2 B;  1VQ5 B;  4WZT A;  5FA6 A;  5AN9 A;  3LVB A;  3OEH A;  5FO1 A;  5FL7 A;  4H9G A;  3CXC B;  4PAA A;  1N0V C;  2GPJ A;  4Z4W A;  2XGJ A;  4YAF A;  2DET A;  2VBV A;  5J35 A;  4N3G A;  2CK3 A;  2KVO A;  1UD6 A;  5DSZ A;  1FRQ A;  1QFJ A;  4HIZ A;  4RDJ A;  4B44 A;  1T6Z A;  5E6T A;  1QGA A;  4WZK A;  2X53 S;  4X7F A;  3FJO A;  4II2 A;  4AVZ A;  4ZGQ B;  3D26 A;  2WJY A;  2X6W A;  1S72 B;  1UMK A;  1WOP A;  3WNB A;  1WOO A;  3E1Y E;  1IJF A;  1VHE A;  4LBW A;  3U2Q A;  1MRZ A;  2DER A;  3ISX A;  1IB0 A;  3CD6 B;  4Z4Z A;  5IYN A;  3GSI A;  4XLF A;  1ELO A;  3CB4 A;  4XQF A;  4RCZ A;  1GAW A;  4XOP A;  5HXB A;  2PIA A;  2QDX A;  1YJW B;  4NNJ A;  1WDT A;  1W35 A;  5F4J A;  2V7Q A;  3W5H A;  4DNT B;  3E20 A;  1SKY B;  3OPO A;  4X05 A;  4M1K A;  1FND A;  1GR1 A;  4L8J A;  4Z4V A;  4GQN A;  1FX0 A;  4XON A;  4TMW A;  4M2L A;  4G1B A;  4XR6 A;  3VMF A;  4G7X A;  1EP1 B;  2E1R A;  2EIX A;  3OP1 A;  3MCA A;  3PVD A;  3ZZ0 A;  3VNU A;  4PAB A;  2R9V A;  2Q6I A;  1TVC A;  4X8I A;  2DCU A;  4MYU A;  2V31 A;  4UAJ A;  4P12 A;  2XZP A;  1HVX A;  3GIR A;  4M0L A;  2YWH A;  2B7B A;  4XN0 A;  1R5O A;  3GVJ A;  4FWT A;  1E63 A;  1NB0 A;  2DIE A;  3CP8 A;  3LQE A;  4C43 A;  5LMZ A;  1KK1 A;  3BCF A;  3OJW A;  4OPO A;  1TUI A;  1QGZ A;  4QFM A;  1UD8 A;  3BY1 A;  1S4M A;  3CCE B;  4P6V F;  1QUF A;  4B4D A;  1QGY A;  1R5N A;  3A1P A;  3ONY A;  3Q6Q A;  4LBY A;  4QVJ A;  1UD5 A;  4UZU A;  3I55 B;  3CCV B;  4P1V A;  1E79 A;  5BSY A;  4YAO A;  3GQB A;  2CRV A;  3ZBT A;  4PGO A;  2BF4 A;  2ZZG A;  2BM0 A;  3P27 A;  1K28 D;  4HE6 A;  5A8A A;  4ACB A;  3CCR B;  4QHY A;  2JN9 A;  3U6B A;  3Q6R A;  1N05 A;  3MHP A;  1D2E A;  3SKB A;  1JB9 A;  3A8J A;  3ZIA A;  4OOS A;  5IYW A;  2QTL A;  1TTT A;  4RD4 A;  3G05 A;  3Q38 A;  4C0S A;  1J9Z A;  2VNH A;  1EFC A;  4XLH A;  1M1K D;  3OW7 A;  3AGQ A;  1QG0 A;  4HE5 A;  1E64 A;  4RD3 A;  4RPB A;  3A3B A;  2F1M A;  3CCS B;  1JA0 A;  2AHO A;  3ZZU A;  1WOR A;  3BH4 A;  1N0U A;  3LNN A;  3OZV A;  1T6Y A;  4JMQ A;  3WNC A;  1PKV A;  4FN5 A;  3T56 B;  3PA1 A;  4ZGN B;  3WXM A;  3OJX A;  1KJZ A;  3JQP A;  2FVG A;  1XFO A;  2ZL6 A;  4P3I A;  1Q82 D;  2QN6 A;  2ZTG A;  1B23 P;  1OGI A;  3P26 A;  2VZL A;  2VNJ A;  2BSA A;  4B43 A;  2Q6K A;  1BQE A;  3OFN A;  4Y9U A;  5GV7 A;  2DOG A;  4YXW A;  1EFR A;  1UD3 A;  4Y9R A;  2CND A;  3W2E A;  1W87 A;  2LZJ A;  4LC0 A;  1EP3 B;  2OBR A;  4P22 A;  1XB2 A;  4B47 A;  4AC9 A;  4DK1 A;  2WZN A;  1Q86 D;  4RJL A;  3LO8 A;  4WWV A;  4Z4T A;  1XE1 A;  3G6E B;  4XL9 A;  2D9R A;  2GK7 A;  4YAW A;  1V0E A;  1WP6 A; 
#chains in the Genus database with same CATH homology
 1G7T A;  4G1V A;  4TMX A;  2EFG A;  4NCN A;  4B3X A;  1K73 D;  3AVX A;  3QFS A;  1KK2 A;  1VQL B;  4YAU A;  3CC2 B;  2NPF A;  1H42 A;  2XNC A;  1W34 A;  3WND A;  4PC1 A;  3G71 B;  1ZM3 A;  3CMA B;  1CNF A;  4TMZ A;  2BVN A;  4MYT A;  1D1N A;  3J81 k;  1U2R A;  1YIJ B;  1W2B B;  3SJZ A;  4N3N A;  4J0Q A;  4BPR A;  2BGI A;  3CCU B;  1KK3 A;  3AVY A;  1DAR A;  3QSY A;  5THX A;  3JQR A;  4F7D A;  1I7P A;  1IJE A;  1AIP A;  1QH0 A;  2OTJ B;  4K1X A;  1EFU A;  1KC8 D;  4PC6 A;  3CPW B;  1GJR A;  2QTZ A;  1H85 A;  1N8R D;  4DQK A;  1SM4 A;  1CNE A;  3CRZ A;  2YWF A;  1VQ4 B;  1VQ9 B;  2RC6 A;  2BGJ A;  3QFR A;  4B48 A;  5JBQ A;  2B5O A;  1Q7Y D;  3CME B;  2HCJ B;  1VQK B;  3PEN A;  3WBK A;  3W2I A;  4TN1 A;  1VQ6 B;  4RD2 A;  2D74 A;  3ZBU A;  4M4S A;  1Q82 D;  1G7S A;  1TLL A;  5TY0 A;  1DG1 G;  2HMA A;  4G5G A;  5H5J A;  1A8P A;  3VO2 A;  3CCQ B;  4RD1 A;  4ZCL A;  3W5U A;  1OB5 A;  4P3Y A;  4TMT A;  3U6K A;  1ZM4 A;  2YWE A;  3CC7 B;  3JQQ A;  2BN4 A;  1E62 A;  1VQO B;  1YIT B;  1K9M D;  3VO1 A;  2C78 A;  3CW2 A;  4DQL A;  1YJN B;  4U9U A;  3AVT A;  1KTV A;  4YAL A;  2QMU A;  5KSW B;  4EH1 A;  1QFY A;  2PLF A;  2VNI A;  3G4S B;  1F20 A;  2QEX B;  4ZCI A;  2BMW A;  2DEU A;  1VQ8 B;  4PC7 A;  3W2G A;  4PC3 A;  3CCJ B;  2VNK A;  3AVW A;  4ACA A;  1F60 A;  4RCY A;  1QFZ A;  3QFC A;  1EXM A;  2RC5 A;  3W5V A;  1EWY A;  3WBJ A;  1HA3 A;  1EP2 B;  2GQF A;  3B82 A;  1FNM A;  1R5B A;  1JNY A;  2PMD A;  1KK0 A;  3W2F A;  4IW3 B;  2OK8 A;  4AF6 A;  1ZUN B;  4PC2 A;  1K8A D;  1AMO A;  4ZV4 A;  4AF7 A;  1NJI D;  1BJK A;  1FNB A;  1G7C A;  3W2H A;  1KD1 D;  2FX3 A;  1M90 D;  4Y7C A;  3MMP A;  3B8H A;  4FK8 A;  1QVF B;  2XEX A;  4WQM A;  3QFT A;  3ZZT A;  3AVU A;  1VQN B;  1DDI A;  2BV3 A;  1CQX A;  1ZM9 A;  1JJ2 B;  1QUE A;  3QE2 A;  2X3U A;  3WYA A;  1NDH A;  4RD6 A;  3CCM B;  3CC4 B;  4YHB A;  4R71 A;  3AGP A;  1D8T A;  2OK7 A;  1DDG A;  1GO2 A;  1SKQ A;  4NBS A;  1B2R A;  2VYQ A;  2B7C A;  3B78 A;  3WY9 A;  3OZW A;  3FPK A;  1VQ7 B;  1GAQ A;  2ZIT A;  1FDR A;  4Q7J B;  4LBZ A;  5GV8 A;  2OTL B;  3CCL B;  3I56 B;  1QX4 A;  1KQS B;  4ZCM A;  3I1F A;  1EFT A;  1KRH A;  5TR9 A;  3VNV A;  2DY1 A;  2C77 A;  1S0U A;  2BM1 A;  3V76 A;  1BX1 A;  1G7R A;  4RD0 A;  1FRN A;  5EMN A;  4M53 A;  1FNC A;  1VQP B;  1BX0 A;  5H59 A;  1OGJ A;  2J7K A;  2R6H A;  1YI2 B;  1JA1 A;  3ES9 A;  3ZC3 A;  1VQM B;  1YHQ B;  1QVG B;  2XNJ A;  2QA4 B;  1GVH A;  1OB2 A;  1Q81 D;  3AVV A;  4TMV A;  1YJ9 B;  1ZM2 A;  4LBV A;  5TV2 A;  2BPO A;  2YWG A;  2HDN B;  3OZU A;  3OW2 B;  1VQ5 B;  5AN9 A;  5FA6 A;  3LVB A;  3CXC B;  4H9G A;  1N0V C;  2GPJ A;  4YAF A;  2DET A;  4N3G A;  5DSZ A;  1FRQ A;  1QFJ A;  4B44 A;  1QGA A;  3FJO A;  4ZGQ B;  1S72 B;  1UMK A;  3WNB A;  3E1Y E;  1IJF A;  4LBW A;  3U2Q A;  2DER A;  1IB0 A;  3CD6 B;  1ELO A;  3CB4 A;  4RCZ A;  1GAW A;  5HXB A;  2PIA A;  2QDX A;  1YJW B;  1WDT A;  1W35 A;  3W5H A;  3E20 A;  4M1K A;  1FND A;  1GR1 A;  4TMW A;  4M2L A;  4G1B A;  3VMF A;  1EP1 B;  2E1R A;  2EIX A;  3MCA A;  3ZZ0 A;  3VNU A;  1TVC A;  2DCU A;  4MYU A;  4UAJ A;  4M0L A;  2YWH A;  2B7B A;  1R5O A;  4FWT A;  1E63 A;  4C43 A;  1KK1 A;  3OJW A;  4QFM A;  1TUI A;  1QGZ A;  3CCE B;  4P6V F;  1QUF A;  4B4D A;  1QGY A;  1R5N A;  4LBY A;  3CCV B;  3I55 B;  4YAO A;  2CRV A;  3ZBT A;  4PGO A;  2BF4 A;  2BM0 A;  3P27 A;  4HE6 A;  4ACB A;  3CCR B;  4QHY A;  3U6B A;  3MHP A;  1D2E A;  1JB9 A;  1TTT A;  2QTL A;  4RD4 A;  4C0S A;  1J9Z A;  2VNH A;  1EFC A;  1M1K D;  4RD3 A;  3AGQ A;  1QG0 A;  4HE5 A;  1E64 A;  3CCS B;  1JA0 A;  2AHO A;  3ZZU A;  1N0U A;  3OZV A;  3WNC A;  4FN5 A;  4ZGN B;  3WXM A;  3OJX A;  1KJZ A;  3JQP A;  2QN6 A;  1B23 P;  1OGI A;  3P26 A;  2VZL A;  2VNJ A;  2BSA A;  4B43 A;  1BQE A;  4Y9U A;  5GV7 A;  4Y9R A;  3W2E A;  2CND A;  1W87 A;  4LC0 A;  1EP3 B;  4B47 A;  1XB2 A;  4AC9 A;  1Q86 D;  4RJL A;  3LO8 A;  1XE1 A;  3G6E B;  4YAW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...