5HXBA

Cereblon in complex with ddb1, cc-885, and gspt1
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
196
structure length
196
Chain Sequence
PIRLPIVDKYKDMGTVVLGKLESGSICKGQQLVMMPNKHNVEVLGILSDDVETDTVAPGENLKIRLKGIEEEEILPGFILCDPNNLCHSGRTFDAQIVIIEHKSIICPGYNAVLHIHTCIEEVEITALICLVDKKSGEKSKTRPRFVKQDQVCIARLRTAGTICLETFKDFPQMGRFTLRDEGKTIAIGKVLKLVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A novel cereblon modulator recruits GSPT1 to the CRL4(CRBN) ubiquitin ligase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords Eukaryotic peptide chain release factor GTP-binding subunit
total genus 27
structure length 196
sequence length 196
chains with identical sequence X
ec nomenclature
pdb deposition date 2016-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03143 GTP_EFTU_D3 Elongation factor Tu C-terminal domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 5hxbA02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 5hxbA01
1KK0A 4ZGNB 4LBZA 1D8TA 1QGYA 1UMKA 2DEUA 1GAQA 2YWEA 1G7SA 1EFCA 1TLLA 2YWGA 2HDNB 1VQPB 4RD2A 1GAWA 1ZM4A 3VNVA 2OK8A 3MMPA 3CMAB 3JQPA 2OK7A 1Q86D 2EFGA 1TUIA 4PC7A 3E1YE 2B7BA 4MYTA 2BN4A 3VO2A 2VYQA 3MCAA 4NCNA 2VNJA 3MHPA 5KSWB 3QFCA 4ZCLA 4BPRA 2VNKA 1H85A 2BGIA 1BJKA 3W2EA 1KK3A 4RD4A 3WNCA 1SM4A 1A8PA 1KQSB 4B43A 3W2HA 1J9ZA 5AN9A 3OZWA 1GR1A 1NJID 3U6BA 1QFYA 1EP3B 2DERA 1YJWB 1JB9A 4HE5A 1W2BB 3QSYA 2BM1A 4C43A 2VZLA 1QG0A 1TVCA 4M0LA 2BPOA 4M1KA 4B4DA 4RD1A 1U2RA 1CNFA 1KTVA 1IB0A 1W35A 1VQ5B 1FRQA 4N3NA 3PENA 3WY9A 1H42A 4K1XA 3CCEB 3AGQA 1QVFB 1FNMA 1ZM2A 4TMTA 4F7DA 1W34A 2B5OA 1OGIA 3W5VA 3OJWA 4UAJA 1XE1A 2BM0A 3AVXA 5THXA 3CW2A 2GQFA 2QTLA 3ES9A 4M53A 5FA6A 1ELOA 1QH0A 4RD0A 5GV7A 3ZBTA 1ZM9A 2BMWA 3P27A 4TN1A 4U9UA 4C0SA 2R6HA 1GJRA 3ZZTA 1DDIA 4QHYA 4RJLA 4IW3B 3VO1A 1WDTA 3CCQB 2XEXA 1YJ9B 4Y9RA 4N3GA 1E64A 4TMVA 1VQ7B 2GPJA 4AF7A 2ZITA 3B8HA 3WBKA 4RCZA 3U2QA 4M4SA 1YHQB 1D2EA 4WQMA 1QUFA 1EWYA 3G71B 1OB2A 3WNBA 5H5JA 4RCYA 1VQLB 2OTJB 5GV8A 3VNUA 4YALA 1M1KD 2PMDA 4FK8A 4YAOA 1AIPA 1EP2B 1FDRA 2QN6A 3OZVA 1SKQA 3VMFA 1QGZA 4PC1A 3CCMB 1QVGB 1Q82D 2QA4B 1R5NA 1DG1G 1KRHA 4B48A 2VNHA 3G4SB 1QUEA 2J7KA 4YAUA 4FN5A 4ZGQB 4ACAA 1S72B 4YAWA 3AVUA 1YI2B 3CCJB 3LVBA 3B82A 4M2LA 4Y7CA 3G6EB 4QFMA 4TMZA 2CRVA 2PLFA 1QGAA 1G7CA 1KK1A 1KD1D 1QFJA 3CCSB 1AMOA 1ZM3A 1VQ9B 2BF4A 3JQRA 4YAFA 1N0UA 4B47A 2RC5A 3QFTA 3JQQA 5TR9A 1N8RD 3QFRA 1JJ2B 1CNEA 2QTZA 2BGJA 2D74A 3CC7B 3ZZ0A 4J0QA 3CD6B 2E1RA 4PGOA 1Q7YD 2QMUA 4FWTA 1NDHA 4TMWA 2X3UA 3OW2B 1B2RA 1FNDA 4P3YA 2DETA 2YWFA 3CC2B 2QEXB 3I55B 1JA1A 3AVWA 2OTLB 4ZCIA 4G1VA 2RC6A 1JNYA 4AC9A 1G7TA 2CNDA 4YHBA 3W2IA 1E63A 1ZUNB 4PC6A 3ZC3A 1R5BA 1N0VC 1BX0A 3I1FA 4RD6A 2C77A 3U6KA 4LC0A 1F20A 1S0UA 3B78A 4ZV4A 1Q81D 2YWHA 1D1NA 1EFTA 1E62A 1VQ4B 5DSZA 3CMEB 2AHOA 3QE2A 4MYUA 4G5GA 5JBQA 1F60A 1YIJB 3W5HA 1R5OA 1KJZA 2QDXA 2XNCA 3E20A 4B3XA 5TY0A 1G7RA 1QX4A 3CCVB 4G1BA 4Y9UA 1K8AD 3CPWB 4LBVA 3WXMA 1IJEA 3OZUA 1JA0A 5EMNA 3CB4A 4EH1A 4LBYA 1IJFA 1GVHA 3I56B 4AF6A 1M90D 3SJZA 3CCUB 1QFZA 1DARA 2DY1A 3CXCB 1CQXA 2HMAA 1DDGA 3CC4B 3OJXA 2HCJB 1FNBA 2EIXA 3QFSA 1TTTA 3J81k 2VNIA 1I7PA 3WYAA 1VQ8B 5TV2A 4H9GA 1OGJA 2BV3A 3W2FA 3CCLB 3ZZUA 1KC8D 2BVNA 3CCRB 3V76A 1OB5A 2C78A 1K73D 2BSAA 4NBSA 4PC3A 4ZCMA 1YITB 1VQKB 4RD3A 3AVVA 3FPKA 4P6VF 1K9MD 3AVYA 1VQOB 4R71A 1VQ6B 1FNCA 3AGPA 2PIAA 2XNJA 4B44A 1W87A 1EFUA 1XB2A 1FRNA 2B7CA 1B23P 1YJNB 3FJOA 3LO8A 1EP1B 3ZBUA 1HA3A 1VQMB 5H59A 3CRZA 3W5UA 4ACBA 4DQKA 4Q7JB 4DQLA 2DCUA 4PC2A 2NPFA 1BX1A 1EXMA 1KK2A 3W2GA 3WNDA 1GO2A 3AVTA 4TMXA 1BQEA 2FX3A 3P26A 3WBJA 1VQNB 4HE6A 4LBWA 5HXBA
chains in the Genus database with same CATH superfamily
1KK0A 2ZZFA 2KVOA 4ZGNB 4LBZA 1D8TA 1QGYA 1UMKA 2DEUA 1BPLA 1GAQA 1PKVA 2YWEA 4L8JA 4P3IA 1YLOA 1S4MA 1G7SA 1EFCA 2YWGA 1TLLA 4QUZA 2HDNB 3PA1A 1VQPB 5HXBA 4RD2A 3BCFA 2ZTGA 4DNRB 1GAWA 1ZM4A 4QVJA 3VNVA 1E1QA 3ASQA 2OK8A 3MMPA 4TKOB 3CMAB 4X06A 3JQPA 2OK7A 2DOGA 2EFGA 1TUIA 2ZL7A 3OKXA 4PC7A 1Q86D 1WTHD 4X7DA 3E1YE 2B7BA 4X8IA 2Z6BD 4Z4UA 4MYTA 2BN4A 2VJJA 3GQBA 2VYQA 3VO2A 3ZIAA 1W0KA 3MCAA 4NCNA 2VNJA 3MHPA 5KSWB 2V7WA 3QFCA 3GVKA 2LZJA 4ZCLA 4BPRA 2VNKA 1H85A 1N06A 1BJKA 2BGIA 1KK3A 2WYRA 2ZZQA 4RD4A 3W2EA 3WNCA 2JJ1A 1SM4A 1A8PA 1NBMA 3BQJA 4Z4RA 1KQSB 3GVLA 4B43A 3W2HA 1J9ZA 5AN9A 3OZWA 1GR1A 1E79A 3OP1A 1NJID 3U6BA 1QFYA 1EP3B 3BCDA 5IYQA 2DERA 1VF7A 1YJWB 5F4OA 1JB9A 4HE5A 2VBSA 1V0EA 2ZXIA 3VR6A 3OOCA 1W2BB 3QSYA 2BM1A 4C43A 2VZLA 4P22A 3ONUA 1QG0A 1TVCA 4M0LA 2BPOA 2JJ2A 4M1KA 4B4DA 1VLYA 1U2RA 4RD1A 1CNFA 1KTVA 4XOPA 3A3GA 1IB0A 4FXUA 1W35A 1VQ5B 2VJIA 1HZEA 2WZPP 1FRQA 4N3NA 2HLDA 3A8KA 3PENA 3WY9A 1H42A 4K1XA 1UD2A 3CCEB 3AGQA 5IYWA 3GIRA 1QVFB 1FNMA 2CW5A 4XD7A 1ZM2A 4TMTA 2VBTA 2CK3A 1VHOA 2PE3A 4F7DA 2GK6A 1W34A 1V0FA 1OGIA 2B5OA 2V7QA 4QVAA 3BC9A 1Q9SA 3W5VA 2ZL5A 3OJWA 4DNTB 4UAJA 1XE1A 2BM0A 1W0JA 3AVXA 2GJPA 4TSFA 5THXA 3CW2A 2X6WA 2GQFA 2QTLA 3ES9A 1VJSA 2NV4A 4M53A 5FA6A 1ELOA 1QH0A 4RD0A 5GV7A 3ZBTA 1ZM9A 2BMWA 4Z4VA 2D3NA 2ZBUA 3CP2A 3P27A 1BLIA 3Q39A 4TN1A 2R6HA 4U9UA 4C0SA 1GJRA 5B6IA 3ZZTA 1DDIA 4QHYA 4RJLA 4IW3B 4RDJA 4UZEA 4P9SA 5F4JA 4XM3A 2DIEA 2Q6LA 4X7CA 2XNDA 3VO1A 5A8AA 1WDTA 5HZBA 3CCQB 4HIZA 3Q38A 2XEXA 5IYRA 4XLCA 4QV2A 1YJ9B 2P3MA 1KMHA 4Y9RA 4N3GA 4RPBA 1E64A 4TMVA 1PJ7A 4P2NA 1VQ7B 5A88A 2F43A 5FL7A 5FIUA 1UD5A 2GPJA 5BSYA 4AF7A 3ASSA 2ZITA 3B8HA 3H9NA 3JU4A 4X07A 3OE7A 4XLEA 3WBKA 3A35A 4RCZA 3U2QA 1RQPA 1SKYB 4M4SA 1YHQB 1D2EA 4WQMA 1I18A 1QUFA 1EWYA 3CMMA 3OEEA 3G71B 1OB2A 1PJ5A 3WNBA 4OOVA 1Y0RA 5H5JA 4Z4SA 2ZL6A 5FO1A 4RCYA 1VQLB 3CPXA 2W6JA 2OTJB 2WPDA 3CTAA 5GV8A 2V7XA 3VNUA 2FVGA 4YALA 3WQZA 3ASTA 4XL9A 1M1KD 2PMDA 4FK8A 4YAOA 1WSRA 1AIPA 1EP2B 1FDRA 2QN6A 3OZVA 4XORA 1SKQA 2CC2A 3VMFA 1QGZA 2C2WA 2C4TA 2GK7A 4PC1A 5LMZA 2X6XA 3CCMB 1MRZA 1WOOA 1QVGB 1Q82D 2QA4B 1E1RA 3Q6RA 1WORA 1R5NA 4X0CA 1DG1G 2QE7A 2F1MA 3FPPA 3ASPA 2VBVA 5L46A 1K28D 1KRHA 1I8DA 4X7FA 4PABA 4ASUA 4B48A 2VNHA 2M5SA 3G4SB 1VLOA 5KNLA 1QUEA 2ZTNA 2J7KA 4YAUA 2GREA 4ROXA 4FN5A 3ZPNA 4ZGQB 3GSIA 4ACAA 1S72B 4YAWA 3AVUA 1YI2B 4G7XA 3CCJB 4KKSA 3LVBA 4WZEA 4CQJA 3B82A 4M2LA 2WZNA 4Y7CA 3G6EB 5IYPA 2XGJA 1E3XA 2XZLA 4QFMA 3A8JA 1RQRA 2CRVA 4TMZA 2CBXA 2PLFA 1QGAA 1G7CA 1NRKA 2WSSA 3ISXA 4XNFA 1KK1A 3HAGA 1KD1D 1QFJA 1OHHA 4XKWA 3G05A 3CCSB 1YX2A 1AMOA 3LQEA 3FKSA 4XONA 3T53B 1ZM3A 1WSVA 1VQ9B 1N05A 2BF4A 3JQRA 3ZUGA 4YAFA 1N0UA 2JDIA 4B47A 2RC5A 3QFTA 5IK2A 4RLZA 3JQQA 5TR9A 2V31A 2V7VA 1N8RD 3SKBA 4DK0A 3QFRA 1P4MA 1JJ2B 1CNEA 1EFRA 2QTZA 2BGJA 2D74A 2WJYA 3CC7B 3ZZ0A 4J0QA 3KL9A 4Z4YA 3CD6B 3R6JA 3Q6QA 4P12A 2E1RA 4XQFA 4PGOA 2OBTA 1Q7YD 2QMUA 4GQNA 2ZZGA 3BH4A 4FWTA 1NDHA 2X53S 4XLAA 4TMWA 2X3UA 3OW2B 1B2RA 4AVZA 1N07A 2ZBVA 4P25A 4OOXA 2D9RA 4RDKA 3ASRA 1E43A 1IHMA 5F4MA 1WU8A 1FNDA 4P3YA 4Z1MA 3CP8A 1UD8A 4RM0A 2DETA 1T6XA 2YWFA 3LNNA 3CC2B 3A8IA 2QEXB 3SEJA 3I55B 3KEWA 1JA1A 3AVWA 3OPOA 2OTLB 3A1PA 4XKVA 4ZCIA 1VHEA 4YEJA 3LQ6A 4G1VA 2RC6A 1JNYA 4AC9A 5J3OA 2C4UA 1UD6A 5IYNA 1G7TA 4UZUA 2CNDA 4YHBA 3W2IA 5DS0A 1E63A 3T51B 1ZUNB 4PC6A 2X8KA 3ZC3A 1R5BA 4YELA 1N0VC 5HKKA 1BX0A 1T6ZA 2WR8A 3BNWA 3I1FA 4RD6A 2C77A 3U6KA 4LC0A 1F20A 1S0UA 3B78A 4OPSA 2X85A 4KKUA 4ZV4A 2R9VA 1T6YA 1Q81D 2YWHA 1D1NA 2OYNA 1EFTA 2W6IA 3CESA 4II3A 3PVDA 1E62A 1NB9A 4KKTA 4RDLA 2E1BA 5DSZA 1VQ4B 3CMEB 2OBRA 2AHOA 1V5VA 3QE2A 4MYUA 4G5GA 5BSXA 4NNJA 2ZXHA 1WOPA 4XR6A 4II2A 5JBQA 1NB0A 1WP6A 1F60A 1YIJB 2GJKA 1UD3A 3W5HA 1R5OA 1KJZA 2QDXA 2XNCA 3E20A 2DYIA 4B3XA 3SLDA 4DK1A 5TY0A 1G7RA 2VBUA 1QX4A 1PJ6A 2CF4A 1T5EA 3OW7A 4WZLA 3SLNA 4G1BA 3CCVB 4Y9UA 4OP7A 4Z4TA 3V7AA 1K8AD 1OB0A 3CPWB 2V7TA 1E3ZA 4LBVA 3WXMA 4Z4WA 3DDYA 1IJEA 3OZUA 1JA0A 1H8HA 5EMNA 3CB4A 3OEHA 4WZTA 4EH1A 1Y0YA 4LBYA 1IJFA 1GVHA 4XN3A 3I56B 3D26A 4AF6A 1M90D 4G7WA 3SJZA 2F1LA 3CCUB 3Q3AA 1QFZA 1DARA 2D3LA 2DY1A 3CXCB 1CQXA 1FX0A 1WOSA 2HMAA 5KW9A 1DDGA 4Z4ZA 3CC4B 3OJXA 3OFNA 2HCJB 5TRDA 1FNBA 2EIXA 2Q6OA 3QFSA 3BY1A 3ONYA 4B3FX 1TTTA 3J81k 2VNIA 1I7PA 3WYAA 1VQ8B 5TV2A 4H9GA 1OGJA 5A89A 2BV3A 3W2FA 3CCLB 3H94A 3ZZUA 1KC8D 4UZFA 2V7UA 2BVNA 4OPOA 4P26A 3CCRB 3GVJA 3V76A 1OB5A 4JMQA 5HZAA 2C78A 3R6KA 5CDFA 1H8EA 1W9XA 1K73D 1KZLA 2BSAA 4XLFA 4NBSA 4PC3A 4OPVA 2V4DA 2JIZA 4ZCMA 2I1LA 4E0FA 1YITB 1VQKB 1XFOA 3A3BA 4RD3A 3AVVA 2C5HA 3FPKA 4X7EA 2GJRA 4P6VF 4TT3A 4WZKA 5DN6A 4P1VA 1K9MD 3AVYA 1VQOB 4R71A 1HVXA 1VQ6B 1FNCA 3OAAA 4OOSA 3AGPA 2PIAA 5FNZA 2XNJA 4P6YA 4B3GA 4B44A 1W87A 2XZPA 1EFUA 1XB2A 2JN9A 4XOTA 5FO0A 3RY8A 4PAAA 1FRNA 2B7CA 1B23P 4G6IA 2XOKA 2XZOA 1YJNB 2Q6IA 3FJOA 3PA2A 3PUNA 4XMYA 4XN0A 2Q6KA 2ZZEA 4X05A 2C5BA 3LO8A 4XLHA 1BMFA 1EP1B 3ZBUA 1HA3A 1VQMB 5H59A 4WWVA 1MABA 3CRZA 3W5UA 4ACBA 1UD4A 2X6YA 4DQKA 4Q7JB 3T56B 4DQLA 2DCUA 4PC2A 2QGGA 3PUMA 2NPFA 5J35A 4RPDA 1BX1A 1EXMA 1KK2A 3BY2A 3W2GA 3NE5B 3WNDA 2X0KA 1N08A 1GO2A 2F4NA 3AVTA 1COWA 2WJVA 1WPCA 4TMXA 2OBSA 1BQEA 3SJPA 2FX3A 3P26A 4YXWA 3WBJA 5E6TA 1VQNB 4HE6A 4LBWA 1XQBA
chains in the Genus database with same CATH topology
1KK0A 4ZGNB 4LBZA 1D8TA 1QGYA 1UMKA 2DEUA 1GAQA 2YWEA 1G7SA 1EFCA 1TLLA 2YWGA 2HDNB 1VQPB 4RD2A 1GAWA 1ZM4A 3VNVA 2OK8A 3MMPA 3CMAB 3JQPA 2OK7A 1Q86D 2EFGA 1TUIA 4PC7A 3E1YE 2B7BA 4MYTA 2BN4A 3VO2A 2VYQA 3MCAA 4NCNA 2VNJA 3MHPA 5KSWB 3QFCA 4ZCLA 4BPRA 2VNKA 1H85A 2BGIA 1BJKA 3W2EA 1KK3A 4RD4A 3WNCA 1SM4A 1A8PA 1KQSB 4B43A 3W2HA 1J9ZA 5AN9A 3OZWA 1GR1A 1NJID 3U6BA 1QFYA 1EP3B 2DERA 1YJWB 1JB9A 4HE5A 1W2BB 3QSYA 2BM1A 4C43A 2VZLA 1QG0A 1TVCA 4M0LA 2BPOA 4M1KA 4B4DA 4RD1A 1U2RA 1CNFA 1KTVA 1IB0A 1W35A 1VQ5B 1FRQA 4N3NA 3PENA 3WY9A 1H42A 4K1XA 3CCEB 3AGQA 1QVFB 1FNMA 1ZM2A 4TMTA 4F7DA 1W34A 2B5OA 1OGIA 3W5VA 3OJWA 4UAJA 1XE1A 2BM0A 3AVXA 5THXA 3CW2A 2GQFA 2QTLA 3ES9A 4M53A 5FA6A 1ELOA 1QH0A 4RD0A 5GV7A 3ZBTA 1ZM9A 2BMWA 3P27A 4TN1A 4U9UA 4C0SA 2R6HA 1GJRA 3ZZTA 1DDIA 4QHYA 4RJLA 4IW3B 3VO1A 1WDTA 3CCQB 2XEXA 1YJ9B 4Y9RA 4N3GA 1E64A 4TMVA 1VQ7B 2GPJA 4AF7A 2ZITA 3B8HA 3WBKA 4RCZA 3U2QA 4M4SA 1YHQB 1D2EA 4WQMA 1QUFA 1EWYA 3G71B 1OB2A 3WNBA 5H5JA 4RCYA 1VQLB 2OTJB 5GV8A 3VNUA 4YALA 1M1KD 2PMDA 4FK8A 4YAOA 1AIPA 1EP2B 1FDRA 2QN6A 3OZVA 1SKQA 3VMFA 1QGZA 4PC1A 3CCMB 1QVGB 1Q82D 2QA4B 1R5NA 1DG1G 1KRHA 4B48A 2VNHA 3G4SB 1QUEA 2J7KA 4YAUA 4FN5A 4ZGQB 4ACAA 1S72B 4YAWA 3AVUA 1YI2B 3CCJB 3LVBA 3B82A 4M2LA 4Y7CA 3G6EB 4QFMA 4TMZA 2CRVA 2PLFA 1QGAA 1G7CA 1KK1A 1KD1D 1QFJA 3CCSB 1AMOA 1ZM3A 1VQ9B 2BF4A 3JQRA 4YAFA 1N0UA 4B47A 2RC5A 3QFTA 3JQQA 5TR9A 1N8RD 3QFRA 1JJ2B 1CNEA 2QTZA 2BGJA 2D74A 3CC7B 3ZZ0A 4J0QA 3CD6B 2E1RA 4PGOA 1Q7YD 2QMUA 4FWTA 1NDHA 4TMWA 2X3UA 3OW2B 1B2RA 1FNDA 4P3YA 2DETA 2YWFA 3CC2B 2QEXB 3I55B 1JA1A 3AVWA 2OTLB 4ZCIA 4G1VA 2RC6A 1JNYA 4AC9A 1G7TA 2CNDA 4YHBA 3W2IA 1E63A 1ZUNB 4PC6A 3ZC3A 1R5BA 1N0VC 1BX0A 3I1FA 4RD6A 2C77A 3U6KA 4LC0A 1F20A 1S0UA 3B78A 4ZV4A 1Q81D 2YWHA 1D1NA 1EFTA 1E62A 1VQ4B 5DSZA 3CMEB 2AHOA 3QE2A 4MYUA 4G5GA 5JBQA 1F60A 1YIJB 3W5HA 1R5OA 1KJZA 2QDXA 2XNCA 3E20A 4B3XA 5TY0A 1G7RA 1QX4A 3CCVB 4G1BA 4Y9UA 1K8AD 3CPWB 4LBVA 3WXMA 1IJEA 3OZUA 1JA0A 5EMNA 3CB4A 4EH1A 4LBYA 1IJFA 1GVHA 3I56B 4AF6A 1M90D 3SJZA 3CCUB 1QFZA 1DARA 2DY1A 3CXCB 1CQXA 2HMAA 1DDGA 3CC4B 3OJXA 2HCJB 1FNBA 2EIXA 3QFSA 1TTTA 3J81k 2VNIA 1I7PA 3WYAA 1VQ8B 5TV2A 4H9GA 1OGJA 2BV3A 3W2FA 3CCLB 3ZZUA 1KC8D 2BVNA 3CCRB 3V76A 1OB5A 2C78A 1K73D 2BSAA 4NBSA 4PC3A 4ZCMA 1YITB 1VQKB 4RD3A 3AVVA 3FPKA 4P6VF 1K9MD 3AVYA 1VQOB 4R71A 1VQ6B 1FNCA 3AGPA 2PIAA 2XNJA 4B44A 1W87A 1EFUA 1XB2A 1FRNA 2B7CA 1B23P 1YJNB 3FJOA 3LO8A 1EP1B 3ZBUA 1HA3A 1VQMB 5H59A 3CRZA 3W5UA 4ACBA 4DQKA 4Q7JB 4DQLA 2DCUA 4PC2A 2NPFA 1BX1A 1EXMA 1KK2A 3W2GA 3WNDA 1GO2A 3AVTA 4TMXA 1BQEA 2FX3A 3P26A 3WBJA 1VQNB 4HE6A 4LBWA 5HXBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KK0 A;  4ZGN B;  4LBZ A;  1D8T A;  1QGY A;  1UMK A;  2DEU A;  1GAQ A;  2YWE A;  1G7S A;  1EFC A;  1TLL A;  2YWG A;  2HDN B;  1VQP B;  4RD2 A;  1GAW A;  1ZM4 A;  3VNV A;  2OK8 A;  3MMP A;  3CMA B;  3JQP A;  2OK7 A;  1Q86 D;  2EFG A;  1TUI A;  4PC7 A;  3E1Y E;  2B7B A;  4MYT A;  2BN4 A;  3VO2 A;  2VYQ A;  3MCA A;  4NCN A;  2VNJ A;  3MHP A;  5KSW B;  3QFC A;  4ZCL A;  4BPR A;  2VNK A;  1H85 A;  2BGI A;  1BJK A;  3W2E A;  1KK3 A;  4RD4 A;  3WNC A;  1SM4 A;  1A8P A;  1KQS B;  4B43 A;  3W2H A;  1J9Z A;  5AN9 A;  3OZW A;  1GR1 A;  1NJI D;  3U6B A;  1QFY A;  1EP3 B;  2DER A;  1YJW B;  1JB9 A;  4HE5 A;  1W2B B;  3QSY A;  2BM1 A;  4C43 A;  2VZL A;  1QG0 A;  1TVC A;  4M0L A;  2BPO A;  4M1K A;  4B4D A;  4RD1 A;  1U2R A;  1CNF A;  1KTV A;  1IB0 A;  1W35 A;  1VQ5 B;  1FRQ A;  4N3N A;  3PEN A;  3WY9 A;  1H42 A;  4K1X A;  3CCE B;  3AGQ A;  1QVF B;  1FNM A;  1ZM2 A;  4TMT A;  4F7D A;  1W34 A;  2B5O A;  1OGI A;  3W5V A;  3OJW A;  4UAJ A;  1XE1 A;  2BM0 A;  3AVX A;  5THX A;  3CW2 A;  2GQF A;  2QTL A;  3ES9 A;  4M53 A;  5FA6 A;  1ELO A;  1QH0 A;  4RD0 A;  5GV7 A;  3ZBT A;  1ZM9 A;  2BMW A;  3P27 A;  4TN1 A;  4U9U A;  4C0S A;  2R6H A;  1GJR A;  3ZZT A;  1DDI A;  4QHY A;  4RJL A;  4IW3 B;  3VO1 A;  1WDT A;  3CCQ B;  2XEX A;  1YJ9 B;  4Y9R A;  4N3G A;  1E64 A;  4TMV A;  1VQ7 B;  2GPJ A;  4AF7 A;  2ZIT A;  3B8H A;  3WBK A;  4RCZ A;  3U2Q A;  4M4S A;  1YHQ B;  1D2E A;  4WQM A;  1QUF A;  1EWY A;  3G71 B;  1OB2 A;  3WNB A;  5H5J A;  4RCY A;  1VQL B;  2OTJ B;  5GV8 A;  3VNU A;  4YAL A;  1M1K D;  2PMD A;  4FK8 A;  4YAO A;  1AIP A;  1EP2 B;  1FDR A;  2QN6 A;  3OZV A;  1SKQ A;  3VMF A;  1QGZ A;  4PC1 A;  3CCM B;  1QVG B;  1Q82 D;  2QA4 B;  1R5N A;  1DG1 G;  1KRH A;  4B48 A;  2VNH A;  3G4S B;  1QUE A;  2J7K A;  4YAU A;  4FN5 A;  4ZGQ B;  4ACA A;  1S72 B;  4YAW A;  3AVU A;  1YI2 B;  3CCJ B;  3LVB A;  3B82 A;  4M2L A;  4Y7C A;  3G6E B;  4QFM A;  4TMZ A;  2CRV A;  2PLF A;  1QGA A;  1G7C A;  1KK1 A;  1KD1 D;  1QFJ A;  3CCS B;  1AMO A;  1ZM3 A;  1VQ9 B;  2BF4 A;  3JQR A;  4YAF A;  1N0U A;  4B47 A;  2RC5 A;  3QFT A;  3JQQ A;  5TR9 A;  1N8R D;  3QFR A;  1JJ2 B;  1CNE A;  2QTZ A;  2BGJ A;  2D74 A;  3CC7 B;  3ZZ0 A;  4J0Q A;  3CD6 B;  2E1R A;  4PGO A;  1Q7Y D;  2QMU A;  4FWT A;  1NDH A;  4TMW A;  2X3U A;  3OW2 B;  1B2R A;  1FND A;  4P3Y A;  2DET A;  2YWF A;  3CC2 B;  2QEX B;  3I55 B;  1JA1 A;  3AVW A;  2OTL B;  4ZCI A;  4G1V A;  2RC6 A;  1JNY A;  4AC9 A;  1G7T A;  2CND A;  4YHB A;  3W2I A;  1E63 A;  1ZUN B;  4PC6 A;  3ZC3 A;  1R5B A;  1N0V C;  1BX0 A;  3I1F A;  4RD6 A;  2C77 A;  3U6K A;  4LC0 A;  1F20 A;  1S0U A;  3B78 A;  4ZV4 A;  1Q81 D;  2YWH A;  1D1N A;  1EFT A;  1E62 A;  1VQ4 B;  5DSZ A;  3CME B;  2AHO A;  3QE2 A;  4MYU A;  4G5G A;  5JBQ A;  1F60 A;  1YIJ B;  3W5H A;  1R5O A;  1KJZ A;  2QDX A;  2XNC A;  3E20 A;  4B3X A;  5TY0 A;  1G7R A;  1QX4 A;  3CCV B;  4G1B A;  4Y9U A;  1K8A D;  3CPW B;  4LBV A;  3WXM A;  1IJE A;  3OZU A;  1JA0 A;  5EMN A;  3CB4 A;  4EH1 A;  4LBY A;  1IJF A;  1GVH A;  3I56 B;  4AF6 A;  1M90 D;  3SJZ A;  3CCU B;  1QFZ A;  1DAR A;  2DY1 A;  3CXC B;  1CQX A;  2HMA A;  1DDG A;  3CC4 B;  3OJX A;  2HCJ B;  1FNB A;  2EIX A;  3QFS A;  1TTT A;  3J81 k;  2VNI A;  1I7P A;  3WYA A;  1VQ8 B;  5TV2 A;  4H9G A;  1OGJ A;  2BV3 A;  3W2F A;  3CCL B;  3ZZU A;  1KC8 D;  2BVN A;  3CCR B;  3V76 A;  1OB5 A;  2C78 A;  1K73 D;  2BSA A;  4NBS A;  4PC3 A;  4ZCM A;  1YIT B;  1VQK B;  4RD3 A;  3AVV A;  3FPK A;  4P6V F;  1K9M D;  3AVY A;  1VQO B;  4R71 A;  1VQ6 B;  1FNC A;  3AGP A;  2PIA A;  2XNJ A;  4B44 A;  1W87 A;  1EFU A;  1XB2 A;  1FRN A;  2B7C A;  1B23 P;  1YJN B;  3FJO A;  3LO8 A;  1EP1 B;  3ZBU A;  1HA3 A;  1VQM B;  5H59 A;  3CRZ A;  3W5U A;  4ACB A;  4DQK A;  4Q7J B;  4DQL A;  2DCU A;  4PC2 A;  2NPF A;  1BX1 A;  1EXM A;  1KK2 A;  3W2G A;  3WND A;  1GO2 A;  3AVT A;  4TMX A;  1BQE A;  2FX3 A;  3P26 A;  3WBJ A;  1VQN B;  4HE6 A;  4LBW A;  5HXB A; 
#chains in the Genus database with same CATH topology
 1KK0 A;  2ZZF A;  2KVO A;  4ZGN B;  4LBZ A;  1D8T A;  1QGY A;  1UMK A;  2DEU A;  1BPL A;  1GAQ A;  1PKV A;  2YWE A;  4L8J A;  4P3I A;  1YLO A;  1S4M A;  1G7S A;  1EFC A;  2YWG A;  1TLL A;  4QUZ A;  2HDN B;  3PA1 A;  1VQP B;  5HXB A;  4RD2 A;  3BCF A;  2ZTG A;  4DNR B;  1GAW A;  1ZM4 A;  4QVJ A;  3VNV A;  1E1Q A;  3ASQ A;  2OK8 A;  3MMP A;  4TKO B;  3CMA B;  4X06 A;  3JQP A;  2OK7 A;  2DOG A;  2EFG A;  1TUI A;  2ZL7 A;  3OKX A;  4PC7 A;  1Q86 D;  1WTH D;  4X7D A;  3E1Y E;  2B7B A;  4X8I A;  2Z6B D;  4Z4U A;  4MYT A;  2BN4 A;  2VJJ A;  3GQB A;  2VYQ A;  3VO2 A;  3ZIA A;  1W0K A;  3MCA A;  4NCN A;  2VNJ A;  3MHP A;  5KSW B;  2V7W A;  3QFC A;  3GVK A;  2LZJ A;  4ZCL A;  4BPR A;  2VNK A;  1H85 A;  1N06 A;  1BJK A;  2BGI A;  1KK3 A;  2WYR A;  2ZZQ A;  4RD4 A;  3W2E A;  3WNC A;  2JJ1 A;  1SM4 A;  1A8P A;  1NBM A;  3BQJ A;  4Z4R A;  1KQS B;  3GVL A;  4B43 A;  3W2H A;  1J9Z A;  5AN9 A;  3OZW A;  1GR1 A;  1E79 A;  3OP1 A;  1NJI D;  3U6B A;  1QFY A;  1EP3 B;  3BCD A;  5IYQ A;  2DER A;  1VF7 A;  1YJW B;  5F4O A;  1JB9 A;  4HE5 A;  2VBS A;  1V0E A;  2ZXI A;  3VR6 A;  3OOC A;  1W2B B;  3QSY A;  2BM1 A;  4C43 A;  2VZL A;  4P22 A;  3ONU A;  1QG0 A;  1TVC A;  4M0L A;  2BPO A;  2JJ2 A;  4M1K A;  4B4D A;  1VLY A;  1U2R A;  4RD1 A;  1CNF A;  1KTV A;  4XOP A;  3A3G A;  1IB0 A;  4FXU A;  1W35 A;  1VQ5 B;  2VJI A;  1HZE A;  2WZP P;  1FRQ A;  4N3N A;  2HLD A;  3A8K A;  3PEN A;  3WY9 A;  1H42 A;  4K1X A;  1UD2 A;  3CCE B;  3AGQ A;  5IYW A;  3GIR A;  1QVF B;  1FNM A;  2CW5 A;  4XD7 A;  1ZM2 A;  4TMT A;  2VBT A;  2CK3 A;  1VHO A;  2PE3 A;  4F7D A;  2GK6 A;  1W34 A;  1V0F A;  1OGI A;  2B5O A;  2V7Q A;  4QVA A;  3BC9 A;  1Q9S A;  3W5V A;  2ZL5 A;  3OJW A;  4DNT B;  4UAJ A;  1XE1 A;  2BM0 A;  1W0J A;  3AVX A;  2GJP A;  4TSF A;  5THX A;  3CW2 A;  2X6W A;  2GQF A;  2QTL A;  3ES9 A;  1VJS A;  2NV4 A;  4M53 A;  5FA6 A;  1ELO A;  1QH0 A;  4RD0 A;  5GV7 A;  3ZBT A;  1ZM9 A;  2BMW A;  4Z4V A;  2D3N A;  2ZBU A;  3CP2 A;  3P27 A;  1BLI A;  3Q39 A;  4TN1 A;  2R6H A;  4U9U A;  4C0S A;  1GJR A;  5B6I A;  3ZZT A;  1DDI A;  4QHY A;  4RJL A;  4IW3 B;  4RDJ A;  4UZE A;  4P9S A;  5F4J A;  4XM3 A;  2DIE A;  2Q6L A;  4X7C A;  2XND A;  3VO1 A;  5A8A A;  1WDT A;  5HZB A;  3CCQ B;  4HIZ A;  3Q38 A;  2XEX A;  5IYR A;  4XLC A;  4QV2 A;  1YJ9 B;  2P3M A;  1KMH A;  4Y9R A;  4N3G A;  4RPB A;  1E64 A;  4TMV A;  1PJ7 A;  4P2N A;  1VQ7 B;  5A88 A;  2F43 A;  5FL7 A;  5FIU A;  1UD5 A;  2GPJ A;  5BSY A;  4AF7 A;  3ASS A;  2ZIT A;  3B8H A;  3H9N A;  3JU4 A;  4X07 A;  3OE7 A;  4XLE A;  3WBK A;  3A35 A;  4RCZ A;  3U2Q A;  1RQP A;  1SKY B;  4M4S A;  1YHQ B;  1D2E A;  4WQM A;  1I18 A;  1QUF A;  1EWY A;  3CMM A;  3OEE A;  3G71 B;  1OB2 A;  1PJ5 A;  3WNB A;  4OOV A;  1Y0R A;  5H5J A;  4Z4S A;  2ZL6 A;  5FO1 A;  4RCY A;  1VQL B;  3CPX A;  2W6J A;  2OTJ B;  2WPD A;  3CTA A;  5GV8 A;  2V7X A;  3VNU A;  2FVG A;  4YAL A;  3WQZ A;  3AST A;  4XL9 A;  1M1K D;  2PMD A;  4FK8 A;  4YAO A;  1WSR A;  1AIP A;  1EP2 B;  1FDR A;  2QN6 A;  3OZV A;  4XOR A;  1SKQ A;  2CC2 A;  3VMF A;  1QGZ A;  2C2W A;  2C4T A;  2GK7 A;  4PC1 A;  5LMZ A;  2X6X A;  3CCM B;  1MRZ A;  1WOO A;  1QVG B;  1Q82 D;  2QA4 B;  1E1R A;  3Q6R A;  1WOR A;  1R5N A;  4X0C A;  1DG1 G;  2QE7 A;  2F1M A;  3FPP A;  3ASP A;  2VBV A;  5L46 A;  1K28 D;  1KRH A;  1I8D A;  4X7F A;  4PAB A;  4ASU A;  4B48 A;  2VNH A;  2M5S A;  3G4S B;  1VLO A;  5KNL A;  1QUE A;  2ZTN A;  2J7K A;  4YAU A;  2GRE A;  4ROX A;  4FN5 A;  3ZPN A;  4ZGQ B;  3GSI A;  4ACA A;  1S72 B;  4YAW A;  3AVU A;  1YI2 B;  4G7X A;  3CCJ B;  4KKS A;  3LVB A;  4WZE A;  4CQJ A;  3B82 A;  4M2L A;  2WZN A;  4Y7C A;  3G6E B;  5IYP A;  2XGJ A;  1E3X A;  2XZL A;  4QFM A;  3A8J A;  1RQR A;  2CRV A;  4TMZ A;  2CBX A;  2PLF A;  1QGA A;  1G7C A;  1NRK A;  2WSS A;  3ISX A;  4XNF A;  1KK1 A;  3HAG A;  1KD1 D;  1QFJ A;  1OHH A;  4XKW A;  3G05 A;  3CCS B;  1YX2 A;  1AMO A;  3LQE A;  3FKS A;  4XON A;  3T53 B;  1ZM3 A;  1WSV A;  1VQ9 B;  1N05 A;  2BF4 A;  3JQR A;  3ZUG A;  4YAF A;  1N0U A;  2JDI A;  4B47 A;  2RC5 A;  3QFT A;  5IK2 A;  4RLZ A;  3JQQ A;  5TR9 A;  2V31 A;  2V7V A;  1N8R D;  3SKB A;  4DK0 A;  3QFR A;  1P4M A;  1JJ2 B;  1CNE A;  1EFR A;  2QTZ A;  2BGJ A;  2D74 A;  2WJY A;  3CC7 B;  3ZZ0 A;  4J0Q A;  3KL9 A;  4Z4Y A;  3CD6 B;  3R6J A;  3Q6Q A;  4P12 A;  2E1R A;  4XQF A;  4PGO A;  2OBT A;  1Q7Y D;  2QMU A;  4GQN A;  2ZZG A;  3BH4 A;  4FWT A;  1NDH A;  2X53 S;  4XLA A;  4TMW A;  2X3U A;  3OW2 B;  1B2R A;  4AVZ A;  1N07 A;  2ZBV A;  4P25 A;  4OOX A;  2D9R A;  4RDK A;  3ASR A;  1E43 A;  1IHM A;  5F4M A;  1WU8 A;  1FND A;  4P3Y A;  4Z1M A;  3CP8 A;  1UD8 A;  4RM0 A;  2DET A;  1T6X A;  2YWF A;  3LNN A;  3CC2 B;  3A8I A;  2QEX B;  3SEJ A;  3I55 B;  3KEW A;  1JA1 A;  3AVW A;  3OPO A;  2OTL B;  3A1P A;  4XKV A;  4ZCI A;  1VHE A;  4YEJ A;  3LQ6 A;  4G1V A;  2RC6 A;  1JNY A;  4AC9 A;  5J3O A;  2C4U A;  1UD6 A;  5IYN A;  1G7T A;  4UZU A;  2CND A;  4YHB A;  3W2I A;  5DS0 A;  1E63 A;  3T51 B;  1ZUN B;  4PC6 A;  2X8K A;  3ZC3 A;  1R5B A;  4YEL A;  1N0V C;  5HKK A;  1BX0 A;  1T6Z A;  2WR8 A;  3BNW A;  3I1F A;  4RD6 A;  2C77 A;  3U6K A;  4LC0 A;  1F20 A;  1S0U A;  3B78 A;  4OPS A;  2X85 A;  4KKU A;  4ZV4 A;  2R9V A;  1T6Y A;  1Q81 D;  2YWH A;  1D1N A;  2OYN A;  1EFT A;  2W6I A;  3CES A;  4II3 A;  3PVD A;  1E62 A;  1NB9 A;  4KKT A;  4RDL A;  2E1B A;  5DSZ A;  1VQ4 B;  3CME B;  2OBR A;  2AHO A;  1V5V A;  3QE2 A;  4MYU A;  4G5G A;  5BSX A;  4NNJ A;  2ZXH A;  1WOP A;  4XR6 A;  4II2 A;  5JBQ A;  1NB0 A;  1WP6 A;  1F60 A;  1YIJ B;  2GJK A;  1UD3 A;  3W5H A;  1R5O A;  1KJZ A;  2QDX A;  2XNC A;  3E20 A;  2DYI A;  4B3X A;  3SLD A;  4DK1 A;  5TY0 A;  1G7R A;  2VBU A;  1QX4 A;  1PJ6 A;  2CF4 A;  1T5E A;  3OW7 A;  4WZL A;  3SLN A;  4G1B A;  3CCV B;  4Y9U A;  4OP7 A;  4Z4T A;  3V7A A;  1K8A D;  1OB0 A;  3CPW B;  2V7T A;  1E3Z A;  4LBV A;  3WXM A;  4Z4W A;  3DDY A;  1IJE A;  3OZU A;  1JA0 A;  1H8H A;  5EMN A;  3CB4 A;  3OEH A;  4WZT A;  4EH1 A;  1Y0Y A;  4LBY A;  1IJF A;  1GVH A;  4XN3 A;  3I56 B;  3D26 A;  4AF6 A;  1M90 D;  4G7W A;  3SJZ A;  2F1L A;  3CCU B;  3Q3A A;  1QFZ A;  1DAR A;  2D3L A;  2DY1 A;  3CXC B;  1CQX A;  1FX0 A;  1WOS A;  2HMA A;  5KW9 A;  1DDG A;  4Z4Z A;  3CC4 B;  3OJX A;  3OFN A;  2HCJ B;  5TRD A;  1FNB A;  2EIX A;  2Q6O A;  3QFS A;  3BY1 A;  3ONY A;  4B3F X;  1TTT A;  3J81 k;  2VNI A;  1I7P A;  3WYA A;  1VQ8 B;  5TV2 A;  4H9G A;  1OGJ A;  5A89 A;  2BV3 A;  3W2F A;  3CCL B;  3H94 A;  3ZZU A;  1KC8 D;  4UZF A;  2V7U A;  2BVN A;  4OPO A;  4P26 A;  3CCR B;  3GVJ A;  3V76 A;  1OB5 A;  4JMQ A;  5HZA A;  2C78 A;  3R6K A;  5CDF A;  1H8E A;  1W9X A;  1K73 D;  1KZL A;  2BSA A;  4XLF A;  4NBS A;  4PC3 A;  4OPV A;  2V4D A;  2JIZ A;  4ZCM A;  2I1L A;  4E0F A;  1YIT B;  1VQK B;  1XFO A;  3A3B A;  4RD3 A;  3AVV A;  2C5H A;  3FPK A;  4X7E A;  2GJR A;  4P6V F;  4TT3 A;  4WZK A;  5DN6 A;  4P1V A;  1K9M D;  3AVY A;  1VQO B;  4R71 A;  1HVX A;  1VQ6 B;  1FNC A;  3OAA A;  4OOS A;  3AGP A;  2PIA A;  5FNZ A;  2XNJ A;  4P6Y A;  4B3G A;  4B44 A;  1W87 A;  2XZP A;  1EFU A;  1XB2 A;  2JN9 A;  4XOT A;  5FO0 A;  3RY8 A;  4PAA A;  1FRN A;  2B7C A;  1B23 P;  4G6I A;  2XOK A;  2XZO A;  1YJN B;  2Q6I A;  3FJO A;  3PA2 A;  3PUN A;  4XMY A;  4XN0 A;  2Q6K A;  2ZZE A;  4X05 A;  2C5B A;  3LO8 A;  4XLH A;  1BMF A;  1EP1 B;  3ZBU A;  1HA3 A;  1VQM B;  5H59 A;  4WWV A;  1MAB A;  3CRZ A;  3W5U A;  4ACB A;  1UD4 A;  2X6Y A;  4DQK A;  4Q7J B;  3T56 B;  4DQL A;  2DCU A;  4PC2 A;  2QGG A;  3PUM A;  2NPF A;  5J35 A;  4RPD A;  1BX1 A;  1EXM A;  1KK2 A;  3BY2 A;  3W2G A;  3NE5 B;  3WND A;  2X0K A;  1N08 A;  1GO2 A;  2F4N A;  3AVT A;  1COW A;  2WJV A;  1WPC A;  4TMX A;  2OBS A;  1BQE A;  3SJP A;  2FX3 A;  3P26 A;  4YXW A;  3WBJ A;  5E6T A;  1VQN B;  4HE6 A;  4LBW A;  1XQB A; 
#chains in the Genus database with same CATH homology
 1KK0 A;  4ZGN B;  4LBZ A;  1D8T A;  1QGY A;  1UMK A;  2DEU A;  1GAQ A;  2YWE A;  1G7S A;  1EFC A;  1TLL A;  2YWG A;  2HDN B;  1VQP B;  4RD2 A;  1GAW A;  1ZM4 A;  3VNV A;  2OK8 A;  3MMP A;  3CMA B;  3JQP A;  2OK7 A;  1Q86 D;  2EFG A;  1TUI A;  4PC7 A;  3E1Y E;  2B7B A;  4MYT A;  2BN4 A;  3VO2 A;  2VYQ A;  3MCA A;  4NCN A;  2VNJ A;  3MHP A;  5KSW B;  3QFC A;  4ZCL A;  4BPR A;  2VNK A;  1H85 A;  2BGI A;  1BJK A;  3W2E A;  1KK3 A;  4RD4 A;  3WNC A;  1SM4 A;  1A8P A;  1KQS B;  4B43 A;  3W2H A;  1J9Z A;  5AN9 A;  3OZW A;  1GR1 A;  1NJI D;  3U6B A;  1QFY A;  1EP3 B;  2DER A;  1YJW B;  1JB9 A;  4HE5 A;  1W2B B;  3QSY A;  2BM1 A;  4C43 A;  2VZL A;  1QG0 A;  1TVC A;  4M0L A;  2BPO A;  4M1K A;  4B4D A;  4RD1 A;  1U2R A;  1CNF A;  1KTV A;  1IB0 A;  1W35 A;  1VQ5 B;  1FRQ A;  4N3N A;  3PEN A;  3WY9 A;  1H42 A;  4K1X A;  3CCE B;  3AGQ A;  1QVF B;  1FNM A;  1ZM2 A;  4TMT A;  4F7D A;  1W34 A;  2B5O A;  1OGI A;  3W5V A;  3OJW A;  4UAJ A;  1XE1 A;  2BM0 A;  3AVX A;  5THX A;  3CW2 A;  2GQF A;  2QTL A;  3ES9 A;  4M53 A;  5FA6 A;  1ELO A;  1QH0 A;  4RD0 A;  5GV7 A;  3ZBT A;  1ZM9 A;  2BMW A;  3P27 A;  4TN1 A;  4U9U A;  4C0S A;  2R6H A;  1GJR A;  3ZZT A;  1DDI A;  4QHY A;  4RJL A;  4IW3 B;  3VO1 A;  1WDT A;  3CCQ B;  2XEX A;  1YJ9 B;  4Y9R A;  4N3G A;  1E64 A;  4TMV A;  1VQ7 B;  2GPJ A;  4AF7 A;  2ZIT A;  3B8H A;  3WBK A;  4RCZ A;  3U2Q A;  4M4S A;  1YHQ B;  1D2E A;  4WQM A;  1QUF A;  1EWY A;  3G71 B;  1OB2 A;  3WNB A;  5H5J A;  4RCY A;  1VQL B;  2OTJ B;  5GV8 A;  3VNU A;  4YAL A;  1M1K D;  2PMD A;  4FK8 A;  4YAO A;  1AIP A;  1EP2 B;  1FDR A;  2QN6 A;  3OZV A;  1SKQ A;  3VMF A;  1QGZ A;  4PC1 A;  3CCM B;  1QVG B;  1Q82 D;  2QA4 B;  1R5N A;  1DG1 G;  1KRH A;  4B48 A;  2VNH A;  3G4S B;  1QUE A;  2J7K A;  4YAU A;  4FN5 A;  4ZGQ B;  4ACA A;  1S72 B;  4YAW A;  3AVU A;  1YI2 B;  3CCJ B;  3LVB A;  3B82 A;  4M2L A;  4Y7C A;  3G6E B;  4QFM A;  4TMZ A;  2CRV A;  2PLF A;  1QGA A;  1G7C A;  1KK1 A;  1KD1 D;  1QFJ A;  3CCS B;  1AMO A;  1ZM3 A;  1VQ9 B;  2BF4 A;  3JQR A;  4YAF A;  1N0U A;  4B47 A;  2RC5 A;  3QFT A;  3JQQ A;  5TR9 A;  1N8R D;  3QFR A;  1JJ2 B;  1CNE A;  2QTZ A;  2BGJ A;  2D74 A;  3CC7 B;  3ZZ0 A;  4J0Q A;  3CD6 B;  2E1R A;  4PGO A;  1Q7Y D;  2QMU A;  4FWT A;  1NDH A;  4TMW A;  2X3U A;  3OW2 B;  1B2R A;  1FND A;  4P3Y A;  2DET A;  2YWF A;  3CC2 B;  2QEX B;  3I55 B;  1JA1 A;  3AVW A;  2OTL B;  4ZCI A;  4G1V A;  2RC6 A;  1JNY A;  4AC9 A;  1G7T A;  2CND A;  4YHB A;  3W2I A;  1E63 A;  1ZUN B;  4PC6 A;  3ZC3 A;  1R5B A;  1N0V C;  1BX0 A;  3I1F A;  4RD6 A;  2C77 A;  3U6K A;  4LC0 A;  1F20 A;  1S0U A;  3B78 A;  4ZV4 A;  1Q81 D;  2YWH A;  1D1N A;  1EFT A;  1E62 A;  1VQ4 B;  5DSZ A;  3CME B;  2AHO A;  3QE2 A;  4MYU A;  4G5G A;  5JBQ A;  1F60 A;  1YIJ B;  3W5H A;  1R5O A;  1KJZ A;  2QDX A;  2XNC A;  3E20 A;  4B3X A;  5TY0 A;  1G7R A;  1QX4 A;  3CCV B;  4G1B A;  4Y9U A;  1K8A D;  3CPW B;  4LBV A;  3WXM A;  1IJE A;  3OZU A;  1JA0 A;  5EMN A;  3CB4 A;  4EH1 A;  4LBY A;  1IJF A;  1GVH A;  3I56 B;  4AF6 A;  1M90 D;  3SJZ A;  3CCU B;  1QFZ A;  1DAR A;  2DY1 A;  3CXC B;  1CQX A;  2HMA A;  1DDG A;  3CC4 B;  3OJX A;  2HCJ B;  1FNB A;  2EIX A;  3QFS A;  1TTT A;  3J81 k;  2VNI A;  1I7P A;  3WYA A;  1VQ8 B;  5TV2 A;  4H9G A;  1OGJ A;  2BV3 A;  3W2F A;  3CCL B;  3ZZU A;  1KC8 D;  2BVN A;  3CCR B;  3V76 A;  1OB5 A;  2C78 A;  1K73 D;  2BSA A;  4NBS A;  4PC3 A;  4ZCM A;  1YIT B;  1VQK B;  4RD3 A;  3AVV A;  3FPK A;  4P6V F;  1K9M D;  3AVY A;  1VQO B;  4R71 A;  1VQ6 B;  1FNC A;  3AGP A;  2PIA A;  2XNJ A;  4B44 A;  1W87 A;  1EFU A;  1XB2 A;  1FRN A;  2B7C A;  1B23 P;  1YJN B;  3FJO A;  3LO8 A;  1EP1 B;  3ZBU A;  1HA3 A;  1VQM B;  5H59 A;  3CRZ A;  3W5U A;  4ACB A;  4DQK A;  4Q7J B;  4DQL A;  2DCU A;  4PC2 A;  2NPF A;  1BX1 A;  1EXM A;  1KK2 A;  3W2G A;  3WND A;  1GO2 A;  3AVT A;  4TMX A;  1BQE A;  2FX3 A;  3P26 A;  3WBJ A;  1VQN B;  4HE6 A;  4LBW A;  5HXB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...