2BSAA

Ferredoxin-nadp reductase (mutation: y 303 s) complexed with nadp
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
295
structure length
295
Chain Sequence
b'DVPVNLYRPNAPFIGKVISNEPLVKEGGIGIVQHIKFDLTGGNLKYIEGQSIGIIPPGVDKNGKPEKLRLYSIASTRHGDDVDDKTISLCVRQLEYKHPESGATVYGVCSTYLTHIEPGSEVKITGPVGKEMLLPDDPEANVIMLATGTGIAPMRTYLWRMFKDAERAANPEYQFKGFSWLVFGVPTTPNILYKEELEEIQQKYPDNFRLTYAISREQKNPQGGRMYIQDRVAEHADQLWQLIKNQKTHTYICGLRGMEEGIDAALSAAAAKEGVTWSDYQKDLKKAGRWHVETS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERREDOXIN-NADP REDUCTASE
molecule tags Oxidoreductase
source organism Anabaena sp.
publication title C-Terminal Tyrosine of Ferredoxin-Nadp(+) Reductase in Hydride Transfer Processes with Nad(P)(+)/H.
pubmed doi rcsb
total genus 88
structure length 295
sequence length 295
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2005-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 2bsaA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 2bsaA02
4M2LA 1KK1A 3P26A 1D8TA 4R71A 3WYAA 1GO2A 4TMVA 4B4DA 5GV8A 5TR9A 2FX3A 1IJEA 3W5HA 2QTLA 4P3YA 3G4SB 3CCQB 3PENA 4RCZA 3SJZA 4TMXA 1Q81D 1KJZA 3B8HA 1EP3B 2OK7A 1BX1A 1G7RA 1GAQA 1OB2A 4PC1A 4PGOA 2QDXA 4M53A 1QFZA 2YWEA 2J7KA 1VQPB 4TMZA 2VNIA 1BJKA 1S0UA 4DQKA 1B2RA 2R6HA 3AVWA 2PLFA 1XE1A 3ZBTA 3WNCA 1GJRA 2BSAA 4K1XA 5KSWB 4BPRA 1FDRA 3CB4A 4C0SA 1ZM9A 2PIAA 1QVGB 1CNEA 1OB5A 3LRXA 1YHQB 3OJXA 3A1FA 2BVNA 4G5GA 3WNBA 5HXBA 1VQ9B 1QUEA 1EFTA 4TMWA 4B43A 2C78A 2HCJB 1M1KD 1EXMA 3B78A 3WY9A 1N0VC 2YWHA 1DARA 3QE2A 4LBWA 1G7SA 4IW3B 4M0LA 3B82A 1EWYA 5THXA 1VQNB 3W2IA 1NDHA 3W2GA 4N3NA 2CRVA 4RJLA 4F7DA 1W2BB 3CCEB 2OK8A 4B44A 2C77A 1W87A 3MCAA 3MHPA 1QUFA 1D2EA 1H85A 4ACAA 1EFUA 3MMPA 1VQ6B 2BM0A 2X3UA 2BGJA 4YAFA 3AVVA 3JQQA 3QFCA 3VO1A 4NCNA 2GQFA 2HDNB 3CW2A 4PC6A 4FK8A 1QGYA 4MYTA 3WXMA 4B47A 1CQXA 1SKQA 4ZGQB 1W34A 1ELOA 3OZUA 2VNHA 5JBQA 5GV7A 3WBKA 3JQRA 2OTJB 3WBJA 1EP1B 4FN5A 2EFGA 2BN4A 2D74A 5EMNA 3I56B 1E64A 2NPFA 3OJWA 4WQMA 1IJFA 4LBZA 2BV3A 2AHOA 3W2FA 1DDIA 1VQLB 2VYQA 3CMEB 4AF6A 1FNMA 3CPWB 3LYUA 1FRNA 3W5UA 1W35A 3ZZUA 1QFYA 1K8AD 3AVYA 3CD6B 2VZLA 1ZM2A 3VMFA 1QVFB 4Y9RA 4ACBA 4HE6A 1EFCA 1VQ4B 3W2EA 1YITB 1E63A 2EIXA 4RD2A 1NJID 2QA4B 3ZZTA 2BGIA 1VQMB 3CCLB 1FRQA 3VO2A 1KK2A 1VQ8B 3QFTA 4U9UA 4UAJA 2QEXB 1TUIA 4RCYA 3ZC3A 3OW2B 3FPKA 1J9ZA 2HMAA 1E62A 4TN1A 4LBYA 3E1YE 4B3XA 1KK0A 4G1VA 3G71B 1S72B 4QFMA 3ZBUA 3ES9A 3P27A 1YJNB 1GR1A 3G6EB 4YHBA 2VNKA 3CMAB 4P6VF 1GAWA 4TMTA 3CCVB 1KC8D 1KD1D 3LO8A 4Y7CA 3JQPA 2CNDA 1DDGA 1WDTA 3AVXA 1F60A 4Y9UA 4YALA 1VQ7B 1JJ2B 1N0UA 1VQKB 1KRHA 2B7BA 1QFJA 3AGQA 3E20A 5TY0A 2XNCA 1AMOA 1VQ5B 2BM1A 3CCMB 2RC6A 2DY1A 4Q7JB 3CCUB 1GVHA 3I55B 2RC5A 4H9GA 4PC2A 1EP2B 3CC7B 1KTVA 4YAOA 1U2RA 4RD1A 1QGAA 1F20A 1OGIA 5DSZA 2DERA 3CCSB 3LVBA 1DG1G 2PMDA 1CNFA 2XEXA 1TLLA 4ZCLA 1IB0A 3CRZA 2QN6A 1JNYA 1D1NA 1JA1A 1R5BA 1SM4A 1Q7YD 1AIPA 1TTTA 3OZWA 4M4SA 1JA0A 2YWGA 2E1RA 1B23P 4PC3A 4ZGNB 1R5NA 2B7CA 4QHYA 4B48A 1UMKA 5TV2A 4FWTA 1BX0A 5FA6A 1R5OA 4PC7A 4YAWA 2DEUA 4YAUA 2YWFA 1ZM4A 4EH1A 1QGZA 3AVUA 1Q86D 1N8RD 4M1KA 4C43A 1BQEA 3J81k 1KK3A 3QSYA 1I7PA 1JB9A 4RD0A 1G7CA 3U6KA 4AC9A 4NBSA 5H59A 1QH0A 3AVTA 2ZITA 3QFSA 4LBVA 1K73D 4J0QA 4ZV4A 5H5JA 2OTLB 3CC4B 3U2QA 1Q82D 1FNCA 2QTZA 3AGPA 1QX4A 2QMUA 1ZUNB 1YJ9B 4LC0A 3I1FA 3W5VA 2VNJA 4ZCMA 2BPOA 1QG0A 1M90D 1YI2B 2BF4A 1XB2A 4N3GA 3CCRB 2DCUA 3CC2B 1FNDA 4G1BA 3CCJB 1YJWB 1FNBA 3OZVA 4MYUA 3ZZ0A 5AN9A 3U6BA 3W2HA 3WNDA 3QFRA 1TVCA 1KQSB 2XNJA 1K9MD 3VNVA 3FJOA 1H42A 1VQOB 4RD4A 1OGJA 1A8PA 1HA3A 2BMWA 3V76A 1YIJB 1ZM3A 4RD6A 4DQLA 1G7TA 3VNUA 4ZCIA 3CXCB 4AF7A 2GPJA 2DETA 4RD3A 4HE5A 2B5OA
chains in the Genus database with same CATH superfamily
2C2WA 1KK1A 3CZMA 5AP9A 2VUTA 2AOTB 1UXHA 3CVJA 1V1RB 2XH8A 3U9SA 3BGWA 1MBZA 3UTCA 4MHOA 4UEWA 1C3LA 3CINA 1NL3A 4TMVA 1B93A 1MFPA 3QUBA 4PLVA 4D9GA 3KSAC 4ZCSA 3C87A 2WPDD 4WBNB 4BWYA 4KDCA 5HKKD 5JU6A 2EYUA 3COSA 3P8ZA 4PGMA 4PG6A 4ZAFA 4BOYA 3CCQB 1DIGA 2QJWA 4D6YA 2CMHA 1DIOB 5EI5A 4LQLA 2WU3A 2JLYA 1V43A 4I9HA 2E4VA 3B8HA 1U3VA 1XTZA 3JPYA 4C0WA 4EELA 5GIPE 2XJ4A 1BX1A 2ZZMA 4XNFA 2MINA 3TCXB 2ZRBA 4E33A 2ZLBA 1BE0A 1FMCA 1O9GA 4FINA 2JJQA 3OP1A 1EFVB 3SR4A 4E31A 4PC1A 3IA2A 1PG5A 4KIGA 3PEEA 2UYGA 4LJ4A 5AJXA 4EW3A 1H0KA 5FI5A 2FEWB 2D3LA 2JJ8A 5TQ2A 4LYDA 3HYRA 2WYWA 5KWVA 1ZK0A 3EDMA 5AI5A 1UKBA 1OZGA 1VXRA 4R8LA 3V7WA 2VTKA 3DAPA 3BFVA 4WZAB 4PPGA 4NONA 3PEVA 1D4AA 1QVRA 2FFBA 3CVOA 3KM0A 4DQKA 1Z06A 4S1VA 1G38A 3HKDB 1RSZA 2OBYA 3A6DA 4K1LA 4EW6A 5BP7A 3UXEA 1DC4A 4MR8A 5LYJB 4Q82A 3NXSA 5BR7A 1TT5B 2GA8A 2RSLA 1VHTA 3R5XA 5DNAA 5JSKA 5LBTA 3H94A 1MEEA 2ROQA 3H5WA 4JQOA 2NUTA 2DFVA 3T7RA 4Q4HB 1TVEA 1M2OA 1D4ZA 2H4JA 2BGRA 3VA7A 3L7OA 9MHTA 1QIGA 1KETA 3RUEA 3BXXA 1XVTA 4CV3A 2ZTUA 1CNEA 1GRQA 3T4EA 1DXQA 3DO5A 3Q8XB 2TYSB 2O8BB 2BFMA 4RKFA 5G0VA 1Z4MA 4GICA 2JA1A 3MJFA 4G23A 4QXOA 5GONA 3G7SA 3AL0C 1T5BA 1R8JA 1WUYA 2HQBA 3GA7A 4CDNA 3PTAA 3BQJA 2PX0A 4XQFA 1N3IA 5LZ5A 1L5GB 5KYKA 2KI5A 4A23A 1GILA 2DF8A 2ZPUA 2O07A 2NO4A 4YPOA 1D6NA 4R9VA 1ML3A 2WSYB 4JWTA 3UM9A 5LQRA 1E6LA 2WFLA 3CRQA 2QD1A 1FLDA 4ANFA 1N5RA 1XGKA 2AW5A 3KHUA 2H0QA 2QN1A 3QV1A 4PFJA 1V7PC 4C08A 1WXHA 2WM8A 1M1YB 1C3VA 3SJBA 2O5EA 3EXG1 2ZAOA 2W58A 4WERA 3SLKA 4DSOA 1TMKA 2PGIA 4M37A 1D5WA 1WPXA 2C42A 1K5DA 4MVCA 1VKZA 4W5OA 1FU8A 4C4SA 1UD6A 3LHFA 4U0KA 2HZ7A 3A1TA 3CEPB 1PNRA 1R4MA 3GP5A 5A88A 1J2EA 3BF8A 1SOAA 3WL6A 4G0ZA 3RU9A 5KYUB 3D7SA 4OF4A 1N2JA 4OO3A 4PG5A 3T95A 1A8IA 2GXAA 2C83A 1EFKA 3MLBA 4DV2B 4CR7A 3DZDA 4FEGA 4PLWA 4BZZA 4RABA 3BHIA 1ZCAA 4ZI5A 1E2UA 2BKXA 4BTVA 1TCAA 1QIDA 4JOQA 1VL5A 1HPLA 1XP5A 4BBPA 4EYEA 3UVEA 1PJTA 3L0CA 1DAFA 2BGJA 1E18A 5BT9A 3I0MA 3CNNA 2P4UA 2QVZX 4C3VA 3VO1A 3VNRA 3G13A 1HDZA 4G2NA 2GQFA 4KGXA 2CJWB 4ENSA 1HE3A 2BFWA 4GXTA 1K75A 1PAUA 3AC0A 1RRKA 3BA1A 4DMGA 4F86A 2PUCA 4B3GA 4HX2A 4TZ0A 1CZUA 4ZC1A 4LRUA 3N0XA 1IM5A 4X7MA 4KLRA 4OK5A 2R97A 1I6MA 4D3YA 2DKNA 4QUHA 4L2IB 1SHUX 4UDNA 2ZBVA 2Q6OA 1GZ4A 1L7PA 3K5IA 3TD9A 5H81A 3CUEF 5ED4A 1C41A 1PK7A 3BK1A 3CBQA 3F5MA 2LW7A 3AERB 1XLWA 2I9PA 3FSRA 4LV5B 5LUBA 1NXSA 4BX3A 1ZRHA 2WB4A 5LP1A 3NYQA 4WV3A 5G4LA 3FLBA 3NOQA 1Q1AA 1NRXA 3JQRA 4OGKA 4BP9A 3I37X 5FI0B 3HDJA 3KHKA 4FMBB 4MP6A 2X8BA 2Y8EA 1XWFA 3A2MA 3ZJ4A 4IX9A 5DW0A 1CFJA 2ZUCA 3V1MA 4DNRB 1FTWA 3VUFA 5BYAA 1V3QE 4GFDA 2QR2A 4BE7B 1NG9A 3DS8A 4E14A 5EMNA 1V8PA 4HEQA 3KX2A 4PTZA 5DKFA 1YQEA 5JHGB 2IYUA 2ZTVA 4L75A 4CIXA 5GINE 4UMEA 1C8BA 2IXAA 5KNDA 2WTEA 2IZ5A 1ICIA 4HH1A 1JXOA 5DYIA 3WISA 1Q1NA 3IP5A 1SXHA 2N46A 4BAGA 1DJPA 1KJWA 1RLIA 2PQ0A 3AUJB 4LTDA 3PXGA 1MO2A 3ZXIA 1SXPA 1EAMA 3TBKA 4QG3A 4Q48A 3TOXA 2A9KA 1RAAA 4KJZA 3DTYA 3WRYA 1SG6A 1CJTC 1YS1X 3HO8A 4DG9A 3BGDA 3OLQA 5F7ZA 2RGXA 3RJTA 1FRVA 3BM5A 3E9ZA 2BCEA 2MYUA 2O0JA 1VG0B 3L0BA 3SBEA 3DBHA 3I23A 4RETA 5B7NA 4G37A 1ZGAA 1B6TA 2AUNA 4YDHB 3DEYX 3THXA 4QJ4A 2EP5A 2VRNA 4B1FA 1M1ZA 3KTFA 3GFTA 3H5IA 5KREA 4AJ4A 3B6ZA 2AI1A 4YCMA 3DDNA 5IW8A 3B6MA 2VF8A 4YI5A 5AXAA 3KQKA 4RPJA 2YRWA 4C0AC 1CTQA 3DP7A 4M8LA 4N9QA 3K71B 3MQ2A 3HKDA 3LT4A 3JY6A 4HFNA 3C98A 3ND6A 5DH9A 3ROEA 2HPHA 1CJUC 2G3YA 2GTIA 4WZAA 5ALVA 2BMAA 3DEFA 1UBFA 4JXKA 1JMVA 4JJEA 4NEQA 3KHTA 5AWFC 1RYFA 4OTZA 2V7QD 4GZ5A 4F5YA 4P12A 4QKQA 2EQAA 1STOA 4JR0A 2QA4B 5GPBA 4P0PB 4C22A 4MW0A 2VHQA 3HFJA 1LPBB 4J16A 2C2OA 2BMFA 1WULS 2R6FA 4M1ZA 5KYXB 4G5QA 1L7RA 5C7IO 3E03A 3QFTA 1ZOSA 3TI7A 1VI5A 4B4KA 2HIHA 4UBIA 5A3RA 3BHMA 5IUNC 4O3MA 1TK2A 1XDUA 3AW8A 1XKTA 4WCFC 3KAQA 4LDZA 4E3WA 3FTEA 2F9FA 4W63A 5KINB 1C9YA 1RXVA 1XD9A 2GEJA 4IV8A 2RHTA 2WWGA 2CJWA 4JLVA 3CF0A 5GJWC 2JLUA 2UUBB 1VLQA 1HG0A 3LLSA 2IV2X 1TJYA 2R65A 1MJHA 2GNAA 4Z9FA 3DQPA 4Q03A 5I3CA 1YRQA 3D43A 4P1ZA 1G6HA 4ZPJA 2G63A 3GGJA 3N75A 4BNFA 2LZ0A 4YYEA 4P6VF 4GOKA 3CVWA 1XQ1A 4R41A 1BDJA 2B61A 1JQDA 2W37A 3EF1A 1GEEA 4D97A 3C1TA 1EZ1A 2REBA 4KIUA 3RHTA 2IXGA 4XIGS 5DW3A 3H3XA 2PUFA 5ARCA 1JHVA 4BEWA 3MQ4A 1GVNB 1XNHA 5EIHA 3OVMA 2G80A 2WHXA 3ZE7A 3QHPA 4H3SA 4Z4WA 1ABBA 2DHQA 5CM9C 3KQWA 1C14A 4JT2A 3SHQA 4MKGA 4DSNA 1BVHA 4P98A 1XDZA 1BHQ1 1E99A 1UZNA 2MMCA 3TLMA 3FCCA 2WMOB 3UT0A 4PV7A 5AOBA 1UOOA 1VTKA 1MUUA 4JJFA 5FCDA 3F6YA 3VGPA 4ALKA 4YALA 3IXMA 4EY5A 4HV4A 3PWKA 5HBGA 4R1SA 4GVLA 5FTMA 5I9SA 3WLMA 5I01A 4A15A 2A59A 5CW1A 1WW8A 1PEAA 2XZDA 3OP4A 1I6WA 4CMGA 2NYUA 2B7BA 4ML3A 4OXYA 3JALA 4MP8A 5CX1B 5HOQA 2GF9A 1EVJA 3I2YX 5DK6A 3KBOA 3HZZA 3CEAA 4JVMA 4UBNA 5DTQA 4RJIA 5EHZA 3CCMB 3ZWNA 3QXXA 4FFOA 1OBVA 4NJEA 4Y2VA 1SEPA 2O8EA 4I4TA 2WC1A 5LFAA 1FP2A 1VMEA 5EMJA 1T6YA 1B41A 4BV3A 1JDBB 3VC3A 4C2BA 3ZVMA 3TX2A 3BSWA 1MENA 3LS2A 1R6DA 2WD7B 3GVPA 3OZBA 3QWBA 4IHJF 2G4LA 3ZDYB 3VTAA 1T10A 3IAAA 1BFDA 2W2NA 3NHUA 3QG1A 4IXWA 4JXXA 1ZRNA 5J4YA 4RD1A 1F20A 1UJ2A 3FYUC 5EUBA 2V8BA 3IV6A 5IT5A 1UXKA 5CIYA 1T29A 3MHTA 3NHJA 3QMWA 2Q99A 2FLVA 1ADJA 3O8LA 4UZSA 2R48A 1Y7TA 3WJ7A 7ADHA 1VIYA 4HRYA 1XJWA 3H6GA 1LLQA 5LOVB 1Q0LA 2EZ9A 3KZCA 1HLGA 2YR0A 3A06A 4UDYX 2XEXA 3HSSA 4M99A 5D84A 3WDKA 3GGCA 1T4MA 2JLQA 3FHOA 3I9FA 4I3GA 1E79D 3SDSA 2BFOA 3WGHA 2P0EA 2YN0A 2PL5A 3D1LA 1U94A 4R01A 5BWCA 1NVGA 1PJ3A 1FX0A 3L0PA 2HEIA 3JWHA 2GF2A 2QZSA 4B4OA 4O29A 2IYPA 1KI6A 4IM7A 3OZWA 1GLVA 3WLJA 3PJFA 5F51A 5CFQA 4D0SA 4Y2JA 1JA0A 3WL7A 5ITVA 3ICEA 3N86A 5H80A 3FPPA 1YZYA 2FJUA 3Q0EA 2Q3BA 4B48A 4HG2A 5EKDA 2AX4A 3JAMA 1TFUA 3HTXA 4R98A 3T3OA 1Z6ZA 4G89A 1YJXA 4MCJA 3D8NA 4RV4A 3TRJA 3VO9A 3NE5B 5CLGA 4RY9A 2HF9A 3ORSA 4GEGA 1K6EA 2XZTA 4TN5A 3K6JA 4UHHA 4MULA 3OQ1A 3EZ6A 3GAZA 3FGOA 3MGBA 4MR7A 5BMVA 4QIHA 4YLGA 1EU1A 3F4KA 3F98A 4E5DA 2UVPA 3IT1A 3TSCA 1ZM4A 1A4IA 4B3CA 1LSUA 4OK6A 4KL8S 3MWEA 4WGFA 3F6SA 1JIIA 1OT5A 1FUYB 1KEZA 1NN1A 1ZBDA 4OMCA 1IUOA 4KGDA 3K6SB 2CXRA 2H4FA 5P21A 2CBZA 5FXMA 3ZJYA 3ZGLA 1AMUA 4X85A 3R7LA 3VR3A 3FOCA 1HM5A 2Y2VA 1UK9A 2QLNA 5J59A 4DCCA 3A0UA 3A9SA 5HJ7A 1Q91A 2AG6A 4A9AA 4RD0A 2MSEB 2VJNA 4O3FA 3HRHA 3G8YA 3L49A 3F9CA 3U4MA 5EHXA 2NXCA 1R8YA 2KS6A 1QH0A 2B1RA 5TARA 3PGMA 1E61A 3OM9A 1VMAA 3QY0A 4W1RA 1UJNA 4JNCA 1ZCJA 1Y6GA 1RJ9A 5FV7A 4R1NA 2OCXA 2ZIXA 2RDMA 2RG7A 1G21E 4URHA 5BY2A 3LNNA 1S3IA 3ZIAA 3JQAD 4MGZR 3WHKA 5FWXB 2X5JO 1MRZA 1GQ2A 3EW9A 3TN7A 1T0JB 2LD4A 1HYQA 4X06A 1JWBB 1HVXA 1TYZA 2JAHA 2OGUA 2WV9A 5B2ZA 3WGQA 1NVMB 2YV3A 2TRSB 3GLHA 1A88A 4FYIA 3Q85A 2QY9A 3GW8A 2ZKIA 2XPCA 4LC0A 4CT4B 4KACA 2XZPA 4AY6A 2AC2A 5EJFA 3K9LA 3CW8X 1Y3BE 1QIJA 2PSEA 1NUPA 2D2FA 4LMBA 2WIAA 4B0PA 5CXQA 3DYIA 4R3WA 1YF3A 1XG5A 4RK6A 2Q5CA 2RBEA 3R8FA 1OH5A 2XWQA 3MTQA 1X70A 2GHIA 4M9UA 3SSMA 3N0RA 4D45A 1TA4A 4FHGA 5DM1A 2Z2KA 4WBNF 2ASEA 1XB2A 1Q0HA 2PXXA 2X2FA 3QX7A 4YDQA 3F90A 4AZ0B 4KXMA 5GZ1A 2PRZA 3CCRB 4YQZA 5JAHA 4M8SA 3PD1A 3IA7A 1CERA 2V1UA 5KNCH 4BU1A 2R7KA 5ITZA 1AXGA 1W46A 1ZPDA 3TIVA 2B35A 3V3TA 3HCRA 1ENPA 2H2IA 1JF8A 3W8FA 3E48A 4D4MA 5B4UA 1Y6FA 2R7NA 4JU8A 4L4YA 4F9GA 4DDTA 5CFNA 2XNJA 3PF9A 5K8LA 1V0EA 3L7LA 4MV7A 1QZ3A 3CUWA 3ADDA 1H42A 4FTWA 4K9OA 4EGFA 3PJEA 4E4YA 3WYGA 4AKTA 4RD4A 3L9WA 3RRMA 3MUFA 5CVVA 2H1FA 1B73A 1ZK1A 5IZCA 2XJ9A 2C5LA 2P2GA 4TYYA 3V76A 5ULLA 4DJTA 1S1CA 3BWYA 5CH8A 3NHMA 1BMQA 4YAIA 4L8WB 4LXQA 4NDAA 1JALA 1RTTA 1Z37A 1G8SA 1W8DA 4GBGA 1W29A 4H60A 3CUKA 4Y6LA 3S7ZA 2WQ7A 3RSFA 2PX5A 5JCOC 1QIFA 2OORC 3WS7A 1KQFA 4MW9A 3BK2A 1E0SA 3I2KA 3QEMA 2M1XA 1SBHA 2DETA 2O5VA 4FYXA 1NA5A 1W5TA 3QWHA 4JL5A 5AHKA 3CWCA 1A2KC 4XB1A 3M83A 4E2FA 4FEAA 4G0MA 4BYGA 5AVUA 1QV6A 3CG0A 4M2LA 4O4JA 3WKAA 1UDBA 1FDOA 3LF2A 1LF5A 4YRSA 3EXHB 3H19A 3NNSA 3O7MA 3Q39A 2WWHA 4Y7DA 2DFDA 1FJGB 3MAJA 4U3JA 5EKUA 1Z62A 3T3HA 2RFLA 3ZX5A 1DXOA 4EGAA 1NOKA 2VBGA 2IUYA 4B6SA 1BVRA 1GNSA 2IZ0A 3OQIA 2IFTA 4BKOA 2WYVA 1P7CA 4LE1A 2J7PD 3FCOA 3C6KA 3IRUA 1DKUA 4IIEA 1VKRA 3SM3A 3ZHYA 4HNVA 4X8IA 1UD2A 2O3UA 2RHBA 4B80A 3SJZA 4DLRA 1Q81D 3DW3X 3PZRA 4QREA 1ZYUA 2XAAA 5EVCA 1YB5A 3E9NA 2I4MA 1LDBA 1AGPA 2X6YA 2VRCD 3IIIA 3KP1A 3ZHQA 3UO8B 4RULA 4PM4A 4YHHB 4HFRA 3RS5A 2V5AA 3EQ8A 4BGUA 4J9UE 2ORED 3VSBA 4EPYA 3L8MA 2NUAA 5FL7A 2QDXA 5I48A 1WMSA 4M53A 1C5KA 2ID4A 3FETA 4QFCA 4TSKA 1I6LA 5HCIA 3OCXA 3KTAB 1EVKA 5JD4A 2XHEA 1HE5A 4LI0A 2I4TA 1ECPA 5K0JA 1RYMA 3PUYA 2BHSA 4WBXC 5A5EA 2Q6VA 3K4QA 5JQGB 3LTEA 1J5EB 1BJKA 2I2DA 3L9XA 2NSJA 4E4RA 1JAZA 3OTGA 5A2GA 3RYCB 1UH5A 121PA 2G1UA 2Q8NA 3D5QA 3GXOA 2VA8A 3KYBA 2B82A 5DBFA 4EG6A 2JBAB 3UJ3X 1ODTC 1CY2A 2PGOA 3MT7A 4BZQA 4EI7A 2BW0A 2EL7A 2XV1A 1NVVQ 1E66A 1X74A 4OQEA 4R1UA 4JQSA 1WZNA 4NG5A 4M6WA 4NV1A 5LKRA 3COYA 4IMIB 3OLXA 3MAGA 3QY9A 3C5HA 4KVAA 3SVTA 3U9TA 2CJPA 4I9FA 4UEOA 5IFLA 1I7NA 5HCUA 4OH7A 3KSUA 2X0IA 3K73O 1PJZA 3DHNA 2BSXA 3Q88A 4JJIA 1AC5A 3LWZA 2IITA 3PPVA 1E1MA 1WTAA 1M1KD 1EXMA 2AJDA 4NX2A 1NJFA 4MQFA 4N41A 2QE7A 1Z29A 2C9OA 2W2LD 4WOKA 5L3SA 4TGLA 4NP6A 1CR4A 3ZYZA 4GPEA 4IHJA 1DARA 5IYPA 4RA9A 1LFDB 3V1TC 4E2XA 1DOAA 4GO1A 4LYAA 2OEPA 6PFKA 2CL7X 5BN4B 4WXHA 5B1SA 3EF3A 5IX8A 2EGHA 3IQIX 4HLDA 5F4OA 2DC1A 2IIVA 2OD2A 3OHMA 3W2IA 1J21A 1NDHA 3PXUA 3IB3A 4G5RA 4LHSA 1R0RE 4ZOCA 4BVLA 1TQ4A 5KCZA 1N2EA 5CP8A 3D26A 4HQLA 3P9RA 3ZWDA 1HBJA 2GBLC 1BG6A 4XKWA 2H2HA 2WQZA 3UV6A 2V0CA 3VZSA 4B31A 4ERXA 4F2PA 1Q3TA 5A0FA 4OSPA 5AI8A 1UPUA 1V11B 3AVOA 3VAAA 3WIUA 4GI3A 4H17A 3CMCO 2SHKA 3MJHA 2QDKA 3CUTA 1NT2A 1QWSA 1LU9A 1U2GA 2BHTA 5IBQA 2EKBA 2K87A 3EFHA 4DMRA 4YAGA 2ZCVA 4HDSB 4ATNA 1FRFS 5HCNA 4UNRA 3G9QA 5IKXA 2ZG6A 4LF9B 1X7HA 1E4OA 2J3KA 3H13A 1RHJA 2CVOA 1PSWA 2WG0A 1PR0A 3BB1A 3JQFA 4NFLA 5TLSA 3H2GA 3II6X 4AYTA 3KOZA 4F46A 4E13A 1XELA 1H94A 2FPMA 4QDXA 4R5MA 4HAZA 1CUBA 3GPIA 3F8SA 1EK6A 2H4HA 2RH8A 3KTOA 3UFBA 1MOZA 1FTQA 1R4MB 1KZ1A 1M7HA 1L7EA 2HWWA 3HKEA 1NV8A 1SD2A 4Q1DA 3WG9A 2W6QA 2QSYA 2V7WA 4BFTA 5EPEA 2HDNB 1MAAA 1WXQA 5MN4A 1SRQA 6GPBA 4MVJH 1ZU4A 3DOHA 4F9FA 2RHJA 3QVXA 5FBWB 1MHTA 1Q7BA 4D0NA 2CEAA 2VPZA 3A35A 1GXSA 4HDAA 3BIWA 1D2MA 4FFMA 4MQ5A 4RZUA 2X8AA 1CLUA 1FBTA 2HK7A 2QOEA 3G2KA 1YQGA 1FYXA 5JYEA 3S2ZA 4D9JA 4CTOA 1CQXA 1QYWA 5MDHA 4Y1RA 4NY1A 3TTTA 3WWEA 2NV2B 4NDNE 2PE3A 3M1IA 2OZLA 5CYFA 2XT9A 3ZJVA 4IG4A 3AQIA 3UG7A 2Y1WA 5KTRA 4OHFA 5KVSA 1XCPA 3E5RA 2BEUA 5ALSA 2RGDA 3DAYA 5JI2E 5HYVA 4DV6B 1KE2A 3IUNA 5I5EA 4FN5A 2QN8A 1L8QA 4I1OA 4QWWA 1GAJA 3B9RA 3PA6A 4CF3A 1JQ3A 2JGAA 3L1VA 1E64A 2Q3CA 5KAMA 1ZW1A 5BURA 3GJ3A 5K4GA 4C4ZA 3DV9A 1TCUA 2RHGB 1FUUA 5CDTA 3IQXA 3PQ7A 4MVXA 3P9YA 4F3YA 3U4HA 1EFPB 2ZBUA 3LKVA 5LQDA 3MS4A 1D0SA 3GEGA 1N0IA 4IIJF 3OE1A 1NASA 1SVWA 3OPOA 1E6CA 1Y8CA 1NZJA 2AR9A 3F3MA 4KMRA 5I7FA 5JVDF 5EQFA 1YB2A 3P9CA 3R0IA 2HDOA 2E9SA 3HQ4O 3I53A 4JCCA 5C7YA 5HZAA 1IBRA 1TKCA 2I1WA 3FG9A 4K9DA 4RBNA 3RRZA 4F0JA 1G5QA 1RYNA 3HPRA 4MGKR 1IHOA 4PVCA 4BVJA 6CHYA 4YN3A 1NONA 2GMWA 2YINC 3RREA 1VHEA 3AXSA 1Q74A 5DXFA 3ZPXA 4ZI7A 2PD6A 4TLBA 3ZWOA 2YZ2A 1N0HA 2C95A 2W0SA 3NRCA 3P9IA 5DIZA 2FF7A 3W5UA 1TMGE 3ELBA 5EFOA 3Q5GA 3MILA 4ZT2A 2OV3A 3TF5A 1TUBA 1ZNZA 4UZFA 1JLKA 5FWAA 3PA2A 1JSZA 1X1QA 2VBCA 5BW5A 3KSBC 2Y27A 4BLWA 1FFDA 3DT9A 3GAMA 1BMFA 3MBKA 2FMKA 3IURA 4ZQBA 4BLPA 4IXNA 1QHXA 2VDNB 3K6RA 1J0EA 4GKBA 5AW7A 4PYNA 1A4XA 4G9EA 4MPDA 2Q3MA 3GZNA 4YFVA 5HK9A 1NW9B 4E2YA 4DV0B 5J5CA 4C7KA 2JCGA 1MO5A 2YDYA 1P1RA 3QE3A 4MXDA 5AVVA 1ODSA 4RKYA 4Y9DA 1XJCA 1COZA 4ACBA 4WADA 1ILEA 1LJUA 1ZCZA 1SXJE 3F0TA 1CUYA 1E9AA 4X54A 3HFGA 3CUUA 3HGTA 1RXIA 5A89A 1WQ3A 2BZ0A 3VX4A 5HJ5A 3HKBA 4J1NA 5IJWA 4WKOA 1O5IA 3NV7A 2JIMA 3SXUA 2BGIA 2HHAA 3BH4A 2VF7A 2O7RA 1P61B 3K6KA 1M73E 4FFPA 1VI6A 1NKVA 1OFTA 2J85A 3DWEX 3LY7A 5DRYA 3SF8A 3SLDA 3CVVA 2V7BA 4I1YA 3S8MA 3PFNA 4KZKA 3V4ZA 1XKLA 1SUCA 4EJSC 2B9VA 2HJHA 1GZDA 3LDGA 3ZCXA 4EG1A 3LNCA 4EUHA 2XMDA 3NIFB 3HVIA 4RHUA 1S01A 3PPIA 3CWQA 3D2BA 3T0FA 2Z57A 2HU7A 1R16A 2Y0BA 4R7GA 3RR2A 2C5EA 3KZXA 3RNOA 1ZLYA 2FX2A 3ES9A 3P27A 1N8TA 1FTSA 4R2WA 4B9EA 2AOTA 5PNTA 1JL3A 1RVV1 1JFSA 1ML4A 5IAKA 4NCBA 3H99A 1RPAA 3WQQA 4I5EA 5IYNA 2K2WA 3HNPA 4ZU6X 3UGKA 2IU3A 3LDUA 3VDMA 1W59A 4DR2B 3HWX1 5LMCA 3JWGA 2E7ZA 1Z74A 2XXAB 1PGNA 4HGNA 2QLFA 3HJGA 2RHLA 2AE2A 4DQVA 1RBMA 2QZ4A 1KD1D 3WAKA 2UUCB 5T8KC 4ISBA 2CL5A 2GRJA 2R96A 4L02A 3RU3A 5J4HA 1I13A 5AVQA 4UOQA 5K0SA 3LPNA 3O8NA 5JJLA 1K5PA 1F1JA 4K86A 3D2CA 4P3KA 3MINA 2MSCB 1W1UA 1YOBA 3KKKA 3U80A 2J45A 1RWKA 1LVUA 1KQNA 1UXIA 4QPCA 1YQTA 2IUEA 4IDEA 4UDXX 1N05A 3ONUA 2YNMD 3HA2A 4GD3Q 2GZ1A 4H7EA 5DEOA 1F60A 3TW0A 5CU7A 4ZVKA 3JVEA 3HKCB 3DUFA 1R6XA 3HY3A 3WYFA 2IZOA 4HVAA 4ZK6A 5A1JA 1VRWA 5FI1B 5KJCA 2C5HA 1GZVA 1V6SA 4C87A 3VU1A 2OHFA 1HOXA 1VCOA 3IMCA 3B5IA 3LZDA 3N0VA 1O96A 3GB9A 2FZGA 3D02A 4ONEA 1H3EA 4L3VA 1YFJA 4JYMA 2O2SA 3TKYA 5E9AA 1X7XB 5A4FS 2VDUE 5BQFA 1GP2A 4A5SA 2ES4A 1I7LA 3INRA 3FRIA 1JXAA 5JS2A 2BFPA 3AJEA 1LTHR 1ZGHA 3H4IA 3OPMA 1O5TA 2D62A 3QKRB 3PE6A 3SS9X 3U1BA 3QLUC 1VBKA 4A03A 3G23A 2VK1A 3SMVA 2I4OA 4KXNA 3N70A 3IKMB 3NDIA 3PNVA 4GLBA 2P11A 1YC2A 3CNEA 3FMIA 4QM7A 1C2YA 3UMRA 3EFEA 4IO1A 4O2AF 1LV8A 3N76A 3P9XA 1SVMA 1CZLA 1QM5A 4TS1A 1O94D 2X86A 3E61A 4WOBA 3UW1A 4CR8A 3I62A 3RS7A 2CUTA 2VEOA 4UVGA 1QKJA 1NXOA 2WWWA 4S1PA 1THMA 3W5SA 1DC7A 3EA4A 3BICA 1TLLA 3ICWA 3AU8A 5AW9A 1VQ1A 5E95A 2LDBA 1B8PA 2YMLA 4R6XA 5AKEA 3T5AA 2A0XA 3CM0A 4M7OA 3NOXA 3D0KA 2DG2A 3BE6A 2VR1A 3R3ZA 5H4HA 2ODWA 2C3YA 3ETJA 4K7JA 4ND8A 3K09C 3AOGA 2JIRA 2YWGA 2MT9A 4UAUA 5DCUA 2RH5A 3UMVA 2WHPB 5HGXA 4BNMA 4ZGNB 2UZ4A 5JR3A 2GAAA 3GXBA 4OQDA 3FUCA 1WP9A 1P0FA 4PXSA 4E1BA 4QHTA 3V6LA 4KK3A 4KTTE 4F3TA 2BUBA 4TYMA 4UU7A 4WN9A 2GESA 1JR3A 4NU6A 4IDQA 4YK7A 4JWKA 1LPMA 1R5OA 2A5FA 4KQEA 2OO7A 4PYMA 4Z8XA 1G16A 3T5DA 1D1QA 3OEWA 3T3IA 3H3FA 3TLAA 3S81A 4OU5A 4XWTA 4E15A 4NZ9A 2JIZA 1FVOA 3JZDA 4B6RA 4EPWA 4EVRA 1NW7A 3BORA 1ND5A 4X1KB 5AHOA 2JHCA 5EMKA 1M8PA 4M86A 1DX9A 3CO5A 1O97D 5CPFA 4MKRA 1GPKA 1N9GB 2YYAA 4DE5A 1NRKA 2W00A 1JFLA 1NXXA 3DV0B 2JFUA 3OX1A 1PUJA 4ZT3A 5JIBA 1Z07A 4POOA 4C20A 4R1OA 4XTCS 1DPGA 3ZVKA 4NBSA 5H59A 4MPTA 4ALMA 2OTCA 5DGIA 5KWIA 1YULA 1JE1A 3NBMA 1Y42X 3SE0A 1ZO8A 3GCZA 5IJ9A 1WO8A 3WNQA 5LQCA 4OBBA 4H3VA 5CB4A 3VHLB 2PZJA 1GD1O 3ESZA 4CLXA 1CUWA 3R3VA 5AM1A 1PYDA 1S5PA 4KLNA 5KTKA 5IZ4A 2DFPA 3D8SA 2FPLA 2RGBA 3OC6A 3UK0A 2J59A 3EGXA 3IEXA 5IKMA 5BWLA 2OWDA 2J1LA 4DLWA 1C9NA 1PBNA 3NAQA 3QV2A 5D3KA 2HYDA 2Q1TA 4NJEB 3A2NA 4HTFA 3DEHA 2YOFA 4JSYA 4DLKA 2ZP1A 1BA2A 2F1LA 1RLMA 1UZUA 3CRW1 3C1UA 3FUVA 3KPYA 3PNMA 4NMXB 5EHGA 2D4AA 3GDHA 5H70A 5B5SA 4XIIA 2ZDQA 2YZKA 1V96A 3PUMA 3I28A 1QG0A 4P3XA 4HT3B 4U7WA 2XADA 4LOIA 1BWSA 3MA0A 3PQCA 3PHLA 4UM8B 1EE2A 3TNFA 4N3GA 1QIMA 1D7OA 1ZK3A 3M5PA 3NT2A 4I2NA 4Q9JA 1TI7A 3UMSA 5AW0A 2ZDHA 3MJTA 5TJ9A 1SKUA 2CKDA 1PVOA 1MVNA 4ZKEA 3UPDA 4OK3A 3DE5X 1T9HA 2G9RA 2ZB4A 5ALGA 4IJQA 3LHSA 3FGPA 3SHTA 2BFEB 2CDAA 4LHVA 5B3AA 2Y1KA 2ZS9A 3EIOA 4PLGA 4OAOA 4TLEA 1NRJB 4P7JA 3ZN2A 3QFRA 4FB5A 3RC8A 1AKYA 1KYIA 4RELA 4DHWA 1T8TA 1E9CA 3GOQA 4KYVA 2HA3A 5ALHA 1L5KA 1EBBA 2NNWB 4GR4A 3WR5A 3ERCA 4RWEA 4G4IA 1D09A 3IQEA 5GADl 2WAAA 2WJYA 4NBLA 1NATA 4MUXA 2XD4A 4ZPXA 3BYZA 1C7QA 5ELLA 2Y4NA 3VKWA 3L1KA 2JZNA 4HDRB 3C24A 4P5PA 4L4XA 4GM4A 1JQJC 4MEAA 4CF4A 2CMGA 4RD6A 5IJ9B 2VDWB 2RAPA 3HVJA 4TV9B 1M1UA 4YP1A 3U7QA 4F6RB 2F8TA 1XF1A 4DZZA 3K72B 4J1TA 3DJFA 2DUNA 1UUFA 3KQSA 3W7BA 3FB4A 4QT4A 4LYFA 1T9GR 1QOPB 2OENG 2B7LA 2WD8A 4OI2A 2BTQB 1C7FA 1A9OA 3EGXB 3Q11A 5JXJA 1DWOA 1KI1A 1OZAA 5PGMA 2DBYA 3ZEAA 1RC8A 2PEZA 5L8VA 4NAUA 1DFIA 1M2VA 1NULA 3IMGA 1UKEA 2VPXA 4MLCA 3TNDA 4TVOA 5C34B 1J2TA 3GVJA 1JR3E 5DI3A 2QHXA 1AQYA 1FSFA 1T1SA 4EZEA 2FPGB 5GV8A 4R9UC 1N25A 4PAQA 1U8FO 3RKRA 4K28A 4OQFA 3KL2A 1PZEA 5HNKA 4YO7A 1WHSA 1GZ3A 1JDBC 1P19A 3WLTA 1YASA 3CLHA 4WZZA 4A2PA 4Z4RA 5J9FA 1KSGA 1T2VA 5TIIA 5DNUA 2AZ4A 3CCFA 3KOXA 2HDHA 1F3OA 3MTIA 4HAOA 3TTXA 4Y2GA 1TJ3A 2C2ZA 1XTJA 2J6IA 3AP2A 3TIGA 1HLPA 3URMA 5KCMA 1FSGA 1U8XX 1OB2A 1X3SA 4GWLA 4W4TA 2IY9A 1WWKA 2OOKA 5FQOA 4PGOA 2WWIA 4FDLA 1RM0A 5ALIA 1CY8A 4BMYA 3O2NA 1O6BA 2Y1EA 1U9IA 3IHLA 5KZMB 2PUAA 2WHPA 3DV2A 1J0DA 2QYHA 2PQ6A 4KRGA 5CH3A 5ESDA 2B8JA 2FZEA 3LT2A 2YY5A 4I5GA 5HBRA 4D9BA 5I9IA 3KB8A 2EJVA 4RF2A 2GEKA 4JEUA 1GPNA 2HJVA 3FF4A 5LYJF 2GBGA 3AKDA 4TL7A 2OYCA 4IYRA 5KVAA 4Y2HA 1RMTA 1S6YA 1DOZA 2OE2A 2RKBA 1VF7A 2WIJA 3DFFA 3JW8A 4F38A 3DEJA 3TYXA 1FDIA 3IQFA 2NACA 4AFNA 1Z5NA 2CXXA 1XD8A 3PE4A 3KSMA 5DASA 3W7AA 4BQNA 5KSWB 1U6JA 1Z2DA 1RAIA 1CSEE 4MCIA 5BW4A 4MRSA 2VZ9A 2Q3FA 5KQRA 3ACBA 1ZM9A 3EVTA 1AX9A 1OXBB 5AKZA 5EZYB 1O6GA 3FZQA 4AMVA 3IIMA 1J90A 3E84A 3HCDA 3ZW9A 1UIMA 3GVKA 3FHLA 4Q9IA 5JSZB 2HRCA 1SXJD 1Z0AA 1TVMA 2ZIVB 1XNJA 3KEOA 4TMWA 4KQCA 3OAAA 4AZ3B 3AIKA 3VZBA 3SHVA 2VPIA 1EVZA 5K09A 3LCUA 1MXFA 3WY9A 1ZG3A 2ZR0A 3HBFA 2NYAA 2QL6A 1KPIA 1RQNA 2M32A 3Q7QA 4J03A 5AICA 5ENDA 1YBMA 3QENA 3FVVA 1KZ9A 3BH6A 4RTRA 5IPFA 4JK3A 1KFEB 1N1DA 1ZGCA 4UNIA 3EXIB 3F49S 2V31A 3EUFA 4YUXA 1NXWA 5CDFA 3FLEA 1TPZA 3UJ7A 2OCBA 2D2VA 2O8NA 3OF3A 1USUA 3EBPA 1E7WA 1GAEO 5AW1A 4MV5A 4RA6B 2AG1A 2P9BA 3T1QA 3QOFA 3GLGE 1R0CA 1HDXA 4G0NA 1OLSB 2OAEA 2EOAA 3KNZA 3NMUF 4X64B 4UZEA 4MIEA 1CXZA 4HO1X 2RAUA 1F6BA 3P2OA 2C03A 3CF4A 3JU3A 2YC4C 1BW9B 3GRFA 2ZYDA 5IJXA 1PVDA 2VBVA 3KWLA 5KKCA 3N3BC 4EA8A 3HXOA 4OB7A 1B0AA 4F2WA 1W87A 4RE5A 1YCGA 2FPPA 1WEKA 4URVR 2XODA 3P4YA 4IIFA 5AI6A 3UAYA 3AHIA 5B30A 2F4VB 1GQFA 2GD2A 4MEJA 4CM9D 2ZB2A 1W44A 1LBHA 3NR2A 4HFMA 2P1RA 5AVOA 4DA0A 3H4MA 4A0SA 3IAHA 2X13A 5HUQA 3TL6A 1Z8DA 4J1TC 2BH2A 4OPOA 3BMXA 3C7KA 5CG1A 5BNFA 1ZN9A 2G5GX 1GZ6A 2Z43A 4A8PA 4DC1A 4ZCPA 3LQ2A 1GPAA 4FHFA 3I8SA 4NCNA 4NOJA 4B2YA 1LDMA 2H4WA 2NV4A 1E3DA 2P68A 1GQYA 2I03A 2C97A 3H11B 3ZCVA 4LJYA 1X13A 4NATA 2E82A 1LRLA 2Z08A 5LMZA 3E4DA 4XCXA 3RRYA 5FJIA 4K3UA 5ICSA 1SUIA 3Q3HA 3QJGA 2ACVA 3U48A 2HU2A 4JBXA 5I3ZA 2QMZA 3PHCA 3RJZA 4H08A 1C1XB 1DC8A 5LKAA 5ES4B 3BWCA 1MJGA 1H0HA 3NBZC 5GMOA 3A9CA 3SBXA 1WOSA 4D5GA 2YZ7A 3A2LA 3DZGA 1MCZA 2HQ1A 4LMAA 1Z36A 2CXHA 1F8UA 3BWXA 1TC2A 1GPH1 4RA6A 3LXUX 4CKEB 1HLDA 3T5CA 1K4YA 2D74A 3IERA 4MNTA 5EL0A 4CDGA 2ZPAA 4IXTA 1ISGA 2G5TA 5IAGA 3UJ9A 2H51A 5DLYA 1Y4UA 2NZUG 4BYMA 2YJNA 5DSXA 1U7HA 4N9WA 3SKVA 3DO8A 4YJHA 1VQLB 4YMWA 4DWJA 2OBNA 3WWCA 4KSYA 4MCHA 1OH8A 1AHHA 2DWOA 1TJ5A 2XKJE 1W73A 2BOVA 3INGA 4J0GA 1ST2A 1VLLA 1Y5LA 2CZCA 1WPRA 2MYPA 2Y6VA 1J42A 2EDCA 4IJMA 4GBED 5DHUA 1AK1A 1G3MA 4CM3A 2IHBA 3HB9A 1BC5A 1OFHA 3LT1A 1U28A 5GJCA 3MPUA 1PYGA 2P2YA 2ZJ8A 2IJGX 2NLOA 1SG9A 1FRNA 1H2ZA 2NTYC 5MGBA 4M9CA 1EXDA 1YC5A 4YCSA 3QITA 4QDUA 5IYZB 2BD0A 1F4PA 2P4EA 3M5CA 4MS3B 4XZ3A 1V48A 1YR9A 1ZW6A 1S4QA 3V48A 2PSFA 1ZUWA 2C4VA 2EJWA 2WHQA 2YVKA 1ADYA 2CWWA 2PXAA 5BRJA 2WRZA 3OX2A 4UHFA 3HEBA 1VZ3A 2QZZA 4R1PA 2VZLA 4PLFA 1RHMA 2FKAA 5JSQA 3KLNA 3W5BA 3RFCA 4U7TB 3F2VA 1HZJA 4FEEA 1BMTA 1WCIB 1Z34A 1Z7EA 2DWPA 4U0JA 4CQMD 2ZIFA 3O8RA 4WZ6A 1KMMA 1PDVA 1WUKS 4LOKA 3E9EA 1XTBA 2Z56A 1Z4LA 2JGNA 4YJGB 4Y2TA 2UV8A 4HY3A 4RD2A 4JI3B 1M2GA 1IOWA 3C5WP 2PS3A 3M89A 3RADC 1JHYA 3DEKA 3S1AB 2PLNA 1SOVA 2P78A 4JBYA 5F1PA 4DAEA 1VQMB 2AG0A 3CCLB 4RTLA 2H9IA 3EARA 4K6MA 4RHCA 1JDVA 2VTBB 3QXJA 1LC0A 1V5EA 2A33A 5IAJA 4A91A 1DCFA 3DDYA 2BDTA 4EZBA 5DGTA 4ALJA 5C8ZA 3WGYA 4WFQA 3GH1A 4TKLA 4TUYF 2X2OA 5C8YF 1YQXA 3A1NA 3L7NA 3NHLA 2FZVA 3QXSA 3T8YA 3TTUA 1WSVA 3B52X 3QLTA 1D1PA 3K4PA 3FWNA 1UJMA 4MPJA 1ADFA 1PFWA 3BCRA 3DMTC 3HR8A 4YCJA 1AMNA 1HTTA 1T4CA 1UAGA 1HMPA 1N2ZA 1LGYA 1PFVA 4XPIB 1GUFA 4LZZA 2IHYA 3HJUA 5F3WB 1YE5A 3F7TA 1LNSA 4EI2A 1XMOB 3MB8A 3EZNA 2HJRA 2YBEA 3EIFA 4LOJA 3NIGB 4DOMA 4Z4UA 3DFKA 3DL2A 1VLMA 4GSLA 4TXMA 3UMBA 1JIVA 2EG9A 1KU6A 3X3HA 4A0FA 4GGMX 1T0HB 5A4AA 2FX5A 2JFWA 1LEHA 1W0CA 2AXNA 2YASA 4FR0A 2OQRA 1SJ9A 3BULA 4NQRA 3BXHA 3VKVA 4AP9A 4CNQA 1V35A 2XMBA 3S55A 4HH3C 1P0QA 1O8BA 4IVNA 4MVJI 5FOVA 3WBFA 3ZQKA 3EF0A 4Z3DA 4B3HA 3WKCA 3ZTYA 4DNQA 2VHZA 4TWAA 3K35A 1Y80A 2CNBA 3ZE1B 4QO7A 2GUGA 3LQ4A 1SKYE 2FSVA 5IJ0A 5JJBA 1VKHA 3IEPA 1JW9B 4CCSA 2K7FA 1T6ZA 4ZTUB 3WB2A 4I55F 3K1AA 4UQPA 4JBIA 5GVRA 1W36B 3M1AA 2CBXA 3FR7A 4OM8A 4ZVTA 7ABPA 3RT1A 4Z4YA 3FZYA 1IPEA 4OFZA 2GLTA 3K30A 4PFKA 2VUHB 3C4VA 5DT9A 2RK6A 1PGJA 4JQCA 4MJ3A 3JU4A 3MYYA 4RJJA 4DRZA 4Q7QA 1LRJA 4G7WA 1RS0A 3PIIA 4J6FA 3K0CA 1GNRA 4FSHA 4B85A 1NPDA 2EKDA 1DMRA 4WL0A 5FOUA 2ODAA 4Q7JB 5KSZA 3U7HB 2IXTA 2O4UX 2YXDA 3EIWA 1K6MA 4PX5A 2PX3A 4KLCA 2XVXA 2IUUA 1YKSA 3L1IA 1AUQA 4US2R 1CDZA 3OD1A 2DR2A 1AD2A 1WTCA 1NX9A 3LGAA 2YH2A 3BWDD 2TMDA 3OTQA 5ALEA 5A3SA 1N2CE 3RODA 4BO5A 3ZNPA 1DXHA 2PN1A 2X9NA 1KR2A 5CLQA 1YLOA 1OUMA 2OC9A 4S2UA 1M9NA 3V8VA 3I92A 5HVNA 3NV9A 1B43A 1NJGA 3BRWD 3JCZA 3ASRA 2RARA 3UMGA 1JNYA 3N2KB 2AJBA 3IEIA 4MWDA 2OBBA 5HW0A 3BBPA 1AIPA 2ODPA 3OTHA 4Y0NA 3ZK7A 5DBIA 1BU8A 2FP4A 1HMYA 2XQGA 3LLMA 1Q1QA 2OLKA 3CCCA 1MO4A 1YVEI 2A35A 2D8AA 3IDQA 3LZCA 4I9NA 2HLDD 2PVCA 1P2TA 1YBHA 1VBNA 4QULA 3GAFA 4URWR 3M5DA 4CU5A 3KSDO 1MAWA 2NO1A 4HZUB 1MOQA 5ALMA 1PWHA 2HSZA 2G88A 5G02A 3N2GB 3J7AC 3ZE9A 5TVKA 2F4NA 3CKMA 2AZTA 5EWLB 2XB8A 4DRXA 2X53S 4LX8A 2DE0X 4EG8A 5EP3A 1OIXA 1FP1D 1RWBA 1G4HA 3PJDA 2XUPA 5CCBA 3OBBA 2P2NA 1DEAA 4HDSA 4LSMA 2FVGA 1IVYA 3G02A 2ZT6A 4I2VA 2ZUEA 1XRMA 4XLCA 4R2IA 4W7HA 3TFQA 3KBBA 2DUWA 4EB0A 3R0ZA 3AIIA 4D3FA 3IP3A 1A2OA 1F48A 1RFLA 1JYFA 2HSDA 4J07A 2CCGA 2I6SA 3EIQA 2XE8A 4JLKA 1S2MA 1VYUA 4TLCA 9LDTA 3AVUA 5DLEA 1ID8A 4QDOA 3ZWAA 4FX2A 2CNLA 5AUNB 2A0KA 1OOEA 4KQJA 4C43A 3DT8A 2ZRCA 1Y4DE 1PWEA 3D6TB 1JB9A 2RHHA 3BREA 4YRCA 3X2SA 1V3VA 3MGAA 1C1YA 1EK1A 2G9VA 3ESDA 1KDZA 5BN4A 3A70A 1HR0B 2HPVA 2ZTLA 2GH1A 2IU4A 3BCUA 2EJTA 1V95A 3LA8A 3R6JA 2Q2WA 4HZIA 1OH7A 1VHOA 2L19A 1JJVA 4ENWA 3OQNA 1OC2A 1OKKD 2IS2A 2Y4OA 4DA9A 2VXYA 4ZOLF 3K0HA 3VOBA 3RSOA 1QX3A 3I01A 2NGRA 2HMVA 2RIPA 2DFKB 3WLFA 3ORQA 1JEDA 2F1HA 2HTFA 1W6RA 3L7JA 1Q82D 1IE3A 1NC3A 3V2UA 1Q3HA 2I2WA 4PPYA 3KT0A 1XA4A 1ZICA 3QMVA 1ZJJA 2VWGA 2NVOA 4YR7A 2DLCX 2C58A 1ECGA 2ISSD 2FW0A 5FPPA 4MRRA 1XAJA 3M6IA 3P2KA 3TJMA 4M9RA 3T7JA 1ZIXA 2B69A 3VC2A 2ANBA 1W4RA 2BHLA 3A4NA 2WKQA 3L0ZA 4I46A 4NEGA 2VNJA 1NJ5A 2GZAA 3OPYB 2Q27A 1D03A 4G5XA 4MS3A 1VKNA 4A73A 1T8WA 1OWPA 3U44B 2BFBB 1W85A 2FW7A 2PGJA 4GIBA 1V3UA 4GYKA 4JGBA 3K70C 2W43A 4FC6A 1KYWA 1QQ5A 1U98A 2FMTA 1P4GA 4ZVRA 2IYRA 4MYUA 3OQHA 1CS0B 3K8OE 4RMNA 3EULA 4ZJZA 4XLFA 2O7SA 4XQCA 4MUNA 1U2GC 4F72A 3WNDA 1RW4A 4IHQA 2D1FA 3QXGA 2RI1A 3PC8A 2IBMA 4CKZA 5K0FA 3AX6A 1CDEA 3EVCA 2EW1A 3O4JA 3PC6A 1JIJA 3C39A 4WESA 1NBWB 2REQA 3UCFA 4QPPA 3QPCA 4NSNA 1A5ZA 2IKQA 5DNDA 1YB1A 4CMEA 3R6LA 1FVHA 1O2DA 1ZS9A 4OA5A 4EX7A 2FEMA 2ZYIA 4BASA 2JS7A 2KX7A 5HIAA 2A14A 2G17A 3MNFA 1PDWA 2W6PA 5EZ6B 4BBZA 1ZKMA 2YIMA 3TECE 1YQUA 2GLUA 1GL6A 2Z3ZA 2PSSA 3DVAB 2IDMA 3M1YA 3NCHA 4BVEA 3PX7A 4PAMA 3K1YA 4JGIA 3LUPA 5IBPA 1E5TA 2E18A 4LVNA 4DK0A 2NZXA 2Q28A 5KMGB 1NW3A 3DNFA 4Q1CA 4MVJF 3TCNA 1VDZA 4LJKA 4OJQA 3ZY3A 2LDXA 4BJHB 4AY4A 1P7PA 3D5TA 4L4ZA 2PH1A 1X6VA 3MBOA 4BN5A 1EM8A 4OA8A 4X44A 3RIEA 2JVKA 2A4MA 2RG1A 5EE3A 4L8GA 2W83A 4B6OA 2HCTA 4G0UA 4XWAA 3TS1A 1C4WA 1Z18A 2WBLC 3RFUA 1OPRA 4CKCB 4U7DA 3MIZA 5CCXA 3QX9A 2O7NA 4G09A 2A1IA 3FHCB 2LVBA 5E1OA 3SSNA 3R9IA 4LDPA 2XR1A 4QFDA 4EKDA 4MEBA 1NUQA 4L95C 1M0WA 1J7JA 4MVJG 4CFYA 4WA8A 1X80A 1KJNA 3AR5A 3TLZA 5C5EA 4WN9B 2X9VA 3QYFA 3T0IA 3X1WA 2ZRAA 1A76A 4EQ6A 4RPCA 3MTEA 1DB3A 2P6MA 2WJGA 4GRIA 4MS1A 4B6PA 2A5GA 4AIRA 4G2TA 4JLWA 2DAPA 5ESXA 5ALOA 2RCYA 4DK1A 4JSRA 3IV9A 3EQ7A 5GZ6A 4BX2A 2OOSA 3E5MA 4QATA 1PT5A 4JLDA 1BKDR 1AGNA 4NFHA 4TS4A 4DT1A 5CRIA 3BZUA 4DXHA 3D31A 1UD3A 3BTUA 2SBTA 1DDOA 5F4BA 4PYLA 5JDCA 3A6LA 3OEYA 5EQDA 1L7AA 2BSAA 3WWZA 4E3ZA 2WF5A 4I1SA 1FQJA 2C2YA 3ISTA 1P4MA 2A67A 3RANA 2PIAA 3V8EA 2JL1A 4DKXA 1QVGB 1YR7A 2B5VA 4Z3KA 1QC5A 3HP1A 4XGRA 5COAA 1KRWA 1J8VA 5JASA 1UEIA 4IFBA 2P8JA 2EP8A 3H3JA 3KR9A 4QEKA 2HA2A 2ECQA 2JIZD 3N7AA 4PO8A 4G5GA 1P4HA 2WABA 1T1JA 2IV7A 1DAHA 4BX8A 2WLTA 3M4YA 5DOVA 2G82A 1ZMXA 3ELDA 4N7MA 4I9UA 3GN1A 1Q22A 5DISB 2YFYA 3AO0B 1F9EA 4HYYA 5HILA 2H5IA 2VT6A 2VYCA 1EFPA 3MT9A 2ZRDA 4OQZA 2DPLA 4HN9A 1VXOA 4RQUA 3B8EA 3RK1A 3AHFA 5H0IA 3HGMA 3BB3A 4FM9A 3S40A 5IM4F 5FLXA 1ZISA 3GLUA 3R5JA 3QPDA 3HACA 4N6OA 1BVYF 1FS4A 2EYQA 3WHLA 2WSIA 1P6UA 1NBME 1QZZA 2EGUA 2PRSA 3TLBA 3WYBA 3FKSA 1TU0A 3GT0A 9LDBA 2AOXA 2ZR9A 4YT4A 4LXHA 3VU8A 3LBFA 4DV5B 2JIPA 1E9EA 2F48A 3M2PA 4JLUA 1RJ9B 4AVZA 3P4UA 3OEEA 1M83A 1CLEA 2OQIA 2SICE 3I3OA 3OHSX 1LB1B 5DTRA 2DECA 5DHTA 2HF2A 1KP9A 5AM0A 2EJUA 4Z5XA 1XU4A 1V1JA 3H5LA 2Y0DA 3EZFA 2I8LA 3HI6A 2IKSA 4O2LA 5AW5A 1RP7A 2EG5A 1GQOA 1YFLA 4S04A 3T7TA 5FH9A 3WIBA 3MHPA 3G9XA 3UMYA 4CV2A 4V39A 2EZUA 3O75A 1BHSA 9ABPA 4XYGA 3SJUA 4RY8A 3DDUA 4TTTS 3VYVA 1PDOA 1QG6A 3AINA 3I2JA 4XJSA 1ETUA 3QQPA 4PO3X 2OXIA 3C7DB 1K6JA 3H16A 2A92A 3LBYA 5I4KA 4C04A 3VU9A 3SKBA 4C30A 1EBFA 2IYQA 1GU7A 2PSHA 3S1LA 2C4UA 4ZO8A 1DBIA 1XRLA 1Y9AA 4XR9A 1V9CA 4YO8A 3ZGVA 3I6ZA 3LW8A 3SEAA 5JBNA 3FZNA 1VLZA 1SZJG 4X93A 1ESDA 4MAFA 4P9SA 2M2IA 1LVHA 1JG1A 1NN0A 1RQ2A 2YY7A 3RYFA 4MQ6A 1A9ZA 1JR4A 4ZODA 1IBKB 1R6AA 3C4QA 4OLBA 3SFVA 3VSDA 2ZBEA 4G8JA 1RJEA 1WUJS 4C4OA 5FD8A 2R6ZA 2C98A 4UHBA 3GVCA 3IAUA 1E3WB 2WSMA 3R5FA 4EYQA 1I0LA 2GM5A 4ITVA 4DMHA 2I3GA 3VBEA 1L9KA 3LQRA 4NOLA 5ISMA 2GAFA 5AM4A 4E5UA 2QW8A 3DD5A 2EFGA 3GA0A 4LECA 3UV3A 2CLMB 2BHRA 2FE1A 1NQUA 2Z30A 4H59A 2F3SA 2X3FA 4K46A 1XZIA 2ACEA 2IYSA 1YD7A 3ENZA 2I6FA 1XUOA 2PWZA 2QVCA 2J9FB 2Z95A 4KRYA 3T5MA 2HDWA 4PXAA 3I8XA 3U60B 1NDQA 3KDSE 3ZY5A 1Y1QA 3KWMA 3HEAA 3QH4A 2HF8A 5I4BA 4IAOA 4ZZ0A 1KO8A 2UUOA 1JPNA 2CBGA 2FW6A 2CSUA 3X44A 5FUMA 4ER3A 5DMHA 1HFJA 4DLVA 2H18A 3A1WA 1JIXA 4IIJB 2GBLA 3K5PA 3ONFA 5AJVB 5LP6A 1JMYA 3DMFA 4TKVB 1WB4A 2NU7A 1NUAA 4XX0B 3K9FC 2IUFA 2OLEA 4AUEA 1XZGA 1SPXA 2GX6A 3ECCA 5IXSA 4MRMA 2DTXA 3WSTA 3P94A 4PINA 2IX3A 3HUTA 4CEJB 1P31A 2GVDC 3UMFA 1IJKA 1HKHA 3TB6A 4J49A 1NF2A 1GKYA 1A7KA 1HO3A 3IUPA 5KOJB 3LUJA 2NMVA 1WM1A 3A6FA 4IWNA 1M75A 3NJ4A 3R4CA 4L50A 1XDBA 4MH0R 4O4LA 5CLFA 3I5XA 2MSDB 3BGOS 4E12A 1RFGE 1YCFA 1VG9B 2YZNA 1V39A 5FBRB 1NW8A 4F91B 3B2NA 1DC6A 2REOA 1ZM2A 2V0GA 5DP2A 3V4OA 5IRCD 3G05A 3FPSA 5U1PA 2E3JA 4GXNA 3W9YA 4BO0A 5KOIA 1JX6A 1EFCA 4A3SA 1EK2A 2H7YA 2QXTA 1NJID 2AB0A 3Q9SA 4JENA 4O1MA 3GEDA 1SCBA 1MJGM 2AOWA 2FPGA 3HXKA 3MTJA 4O33A 2WE7A 2ZQZA 1RJGA 3O8OA 3TTWA 4AMZA 2JLZA 4CCAA 4TRJA 5JD5A 5F1KA 5HOEA 2Z6AA 4Y0VA 3DXFA 3KZNA 5EUMA 3OOSA 1BE8A 2F2TA 2HV8A 1ABEA 1B4DA 5EE9A 1HFWA 4M54A 1FW8A 4TM7A 1GXSB 3U13A 2GD0A 5IT4A 4N48A 3RVMA 2HMAA 2QMYA 4MW5A 3ADBA 5FBKA 1XAIA 4GLJA 1HE1C 1B6SA 3N87A 3F6EX 3T38A 3IX7A 4B3XA 3PF8A 1HT2E 1GLNA 5CVEA 1IQRA 3U4QB 2JLVA 1K3TA 2W2MA 3F74A 4V0NA 4C9BA 3MJDA 3I4FA 4IXMA 1ZD5A 3IIKA 3IOBA 1X7YB 3LDFA 4QUIA 4S0ZA 3RVKA 1WCYA 4Z51A 1N6OA 1GG8A 2IY8A 3MT8A 1AV7A 4ROSA 1A3CA 4U2DA 4BLUA 1F2TB 5JAQA 1T5DX 1YJAA 3T06B 3L93A 1VCIA 2H59A 4GMHA 4TQGA 1F06A 5EIBD 1GA4A 3EWIA 4ZT6A 2V4ZA 1ZD2P 2OWEA 5JJKA 4QOEA 4OIMA 2PD4A 3LVFO 3BN3A 4GHWA 1PTJC 1SUFA 1FQWA 1T3LA 2P6PA 3KQTA 1PK9A 5D5QA 1W4AA 1UODA 2BLLA 3GIDA 5E1DA 5EWLA 3WGUA 4BEBA 4BXOB 4IJVA 2ZRLA 4RJKA 4B3TB 1QO7A 4BEVA 5FV4A 1WZEA 2GXUA 4KVFA 4L6IA 4MUEA 4MQEA 2ZYTX 3VH2A 3KXDA 3LC2O 5DX8A 4E07A 2M5SA 3VNSA 5LDGA 2GR9A 2E2WA 1MIOA 4H1UA 2H08A 5FNVA 1SVKA 4J0JA 5JJCA 4CEJA 1XCLA 3IBGA 3L3BA 1I5RA 3KL4A 4UTRA 2I2FA 1MJFA 5AYVA 1CZOA 2WYRA 1BKSB 5AJUA 2E1BA 1UINA 4HWSA 4PSVA 2XOEA 4OFWA 2GA9A 2ZYAA 3Q2KA 4CIWA 3IS3A 3P32A 5EMMA 4OHZA 1QFMA 1PK8A 4HWGA 3SYNA 1G8YA 3ZHTA 4GOND 1U2DA 1S4MA 1H2BA 2PRIA 2Y0CA 2VBFA 2X41A 1PU2A 5ILQA 2MTBA 4OLHA 3WKDA 2O57A 4WJLA 1SK8A 2ZJ4A 1F2DA 1KEVA 1Y7IA 1YRHA 3R0JA 2HXGA 4JHXA 1CIPA 1ORVA 3ND5A 4MLZA 2JGFA 1GUBA 3FTPA 2C9CA 1B1CA 1U63A 3F78A 5ENZA 3R7FA 2AJCA 4ZRMA 3RYHB 3WGGA 3D4NA 4B0OA 1NRWA 1N5DA 3A6GA 1DIBA 3ZWKA 1KYVA 4C1BA 3SWWA 2BE9A 4HTFB 1Q0ZA 1NWHA 1Z5ZA 5FTWA 4KXXA 3HO6A 3Q6MA 2Z2IA 3H4TA 2PMDA 3EE6A 1CHNA 1ZH8A 5LIRA 5TMPA 4Q02A 1P1HA 1ADGA 2E4YA 2XE7A 2YWBA 4MR8B 3RVNA 3OIDA 2ZRJA 3TBFA 3RE1A 1Q7RA 2ZATA 2EZ4A 2IVFA 3HFSA 3ZNOA 3HN7A 3PNPA 3AF2A 4HXYA 6LDHA 2D5LA 1RRCA 4QOGA 4M4SA 2ODBA 3O8QB 3IE0A 4HDQB 1U7TA 3L04A 4PGAA 3SX4A 2BL4A 2Y92A 3IEMA 2ZTHA 4RE6A 4BPBA 2FDCA 3BRWA 2FSIA 4S24A 4J29A 4UVEA 1KR5A 3SZ3A 1T9CA 2CHVA 4L57A 1SUPA 4I66A 4UNPA 4ZFNA 3L5OA 4BGDA 2ZIUB 3DOIA 2C5AA 4UDOA 2A78A 3WQZA 5TGZA 3KQPA 2N3ZA 1VCHA 3VPDA 4NENB 1B8OA 5EWJA 1VGQA 2YV2A 2HFKA 2BH9A 1NJSA 4JELA 1TYEB 3UCXA 5CEJA 5AKKA 2LUOA 4ZYLA 1WCWA 4B3JA 5A9SA 1DXYA 3OE7D 1TC1A 3N8GA 4HAXA 5K0NA 3S2SA 5A8AA 4E5PA 2QTAA 3TBHA 3AUAA 5EWMA 4DLZA 4DUGD 1AQNA 3PD7A 4H0CA 2Q8QA 2XCSB 1GHTA 4V0MA 5LBUA 1AVTA 1LPAB 3AWIA 3EA5A 2J6HA 4IDCA 2Y1DA 4O2RA 4AO6A 1L5OA 3RV4A 1R64A 3ZK8A 5FX2A 2C2GA 1IOLA 2J9XB 2KW5A 4K8OA 3SIXA 2JN9A 1ULBA 4YXFA 5IAOA 4DY4A 2FMUA 5KTOA 1TZJA 2M9MA 5CDHA 2DH6A 3G2PA 1VHQA 3SBOA 4BNDB 1YDGA 1G7CA 4B2IA 1YK0A 1IUNA 4ZN6A 4L5CA 5K0EA 3WWYA 4JLPA 1Y5NA 4PQYA 2YXBA 1DIAA 2RJOA 3AV3A 4PWYA 2P9YA 3TQIA 1N3YA 1FEZA 1T3GA 1XU7A 2A9VA 2CXQA 2EFDB 3CT4A 3NAMA 4RVGA 4YRFA 4ROTA 5HKBA 2B83A 4AJ1A 2JLWA 2AC7A 3I5YA 1Q0PA 1U31A 5IP5A 1FU7A 5K2MA 2L18A 2PH5A 1ZU5A 3D9QX 3RHZA 1I2ZA 4JT4A 1R6UA 3VZQA 3Q8KA 3CA8A 3ODPA 1U4OA 5CYPA 4EG5A 2PD3A 2EBFX 2XA9A 1MOPA 2ADOA 1KY3A 2P27A 2QTZA 4M9QA 4KQHA 4M0MA 3FH0A 4N54A 5CJPA 5CNJA 3GFOA 1M34E 4FT4A 1NE2A 3FKQA 4MZDA 5LBIA 3UK1A 4NAVA 1Y37A 3PFIA 3IJ5A 1VA5A 3BMOB 4QARA 4W5JA 3FMFA 2GPAA 4WNCA 4R69A 2ZETA 3AHCA 4INJA 5JV5A 2IS4A 1P4AA 4DIEA 3GFSA 4LJAA 4MUFA 2J7PA 4QOHA 1C30B 4M1TA 4YJGA 5BSUA 2GN8A 3WDSA 4Z7NB 3V7YA 2HHLA 2QB5A 2GYYA 1OWMA 2NT4A 4GQAA 4MR9A 4BLTA 4C76A 4DB4A 3LL4A 4BNGA 2IXEA 5CM8B 4AP5A 5FTNA 4ETNA 4F96A 3LMKA 4H7IA 4G1EB 1PZGA 4H1VA 5CT4A 2Y77A 4QDJA 3CCJB 1S96A 2C0CA 3HNRA 3ND8A 3WGKA 1FNBA 1O94A 3E2MA 4FHDA 3UK2A 3WL8A 4QASA 5KS2A 3ZZ0A 2JFVA 3FAZA 4A1OA 4KRXA 4Q4HA 4AF8A 2PWBA 3NTVA 4D9HA 2NZWA 4DJ5X 5LSAA 2J48A 3RGGA 5D6OA 2NIPA 3GGOA 3O5AA 2A6PA 4YCCA 3IL2A 2V7UA 1EXWA 3VNVA 2GETA 3ISXA 3G9UA 4GP7A 4OV6B 3PR1A 4YJ2F 2FVYA 4HPXB 5EN4A 5LQAA 4HGOA 1F12A 2QTTA 3ZVNA 1QIEA 3WGIA 3K0AB 3RUFA 2A5LA 3F4LA 3O90A 5IULC 1CP2A 3QMPA 2O2GA 3ASQA 4NFYA 4I55B 3T5PA 1QU2A 1PEDA 2H4ZA 5M7EA 1LQTA 1NQAO 1Q0QA 2RGUA 3Q2OA 4YLYA 1Y3CE 3KKNA 1G7TA 1N77A 1I4OA 3Q2IA 4L74A 1RT9A 5B7GA 4RDLA 4MDEA 5BVHA 3UT5A 2IP4A 5K05A 3S8YA 4DUGA 1E9FA 1W52X 1WNFA 3CNBA 3JQGB 3VPAA 1PZHA 2H2DA 1GQSA 1W4BA 1UBGA 2P3SA 4AKSA 5K8VA 3HK2A 2V4UA 1R6BX 1GZHB 1H0RA 3C4JA 3LY8A 3OTIA 1XZDA 4ENTA 1C2TA 3VAZA 3HPQA 2QR5A 4R71A 4MX8A 3DUWA 4MROA 4EPRA 1F7UA 3WL3A 1V5IA 2Q29A 4LV8B 3UN1A 2BEUB 1D1SA 4XUEA 2ORIA 2DH5A 4BGVA 1P2GA 3DVAA 5DVZA 4CWAA 2VXCA 2I3DA 3ZJ5A 4P86A 1KSHA 2WLSA 4TZKA 4HX9A 2GCGA 2GSDA 2F90A 2PZKA 3FLMA 2VDOB 2HA6A 4A1FA 2W4QA 4NZOA 4EB3A 2WB2A 4HLCA 4DYVA 4NESA 1YHZA 4MR7B 2VP0A 2CY0A 1KJZA 2ZFUA 3BIOA 3M1LA 4Y2XA 1SUWA 2VJOA 3HRIA 3OIGA 1GRCA 3CX3A 1G7RA 4RDHA 2GS9A 2ZTMA 2G7MC 3PFFA 4C7VA 3F9IA 2HC9A 1QHFA 1TVKA 5HDQA 3WSWA 4QQKA 1YIOA 1SUDA 1Y5IA 1VCMA 3EIHA 3ET4A 2ZAMA 4L6CA 4DC0A 4H7KA 4QJ5A 3EPLA 1RAGA 2HLNA 1VLOA 3LUDA 2BEJA 2O5RA 1CY0A 4XWYA 4TVBA 1E3MA 1ODLA 1XPJA 1CJKC 3CY6A 1AUVA 3G5TA 4NHOA 1JJIA 3I4LA 1RAEA 2CLDX 1E6WA 4D4JA 2EEPA 1EQUA 4O0MA 1THTA 4I3FA 1N2CB 1KJQA 1ZMTA 3ZBTA 1D2AA 1U2PA 2J3DA 1FA9A 3NDRA 4FIZA 4OMUA 5C7LO 1ZR4A 1Z3CA 2A5DA 2PRYA 2C4NA 1QFXA 1Z2OX 1ZNYA 4YJHB 2W90A 3HL4A 4WINA 4Q7MB 4F1WA 3O8CA 2NG1A 3TOCA 1IRIA 2FSGA 1Q1BA 1US8B 3KOMA 4ON9A 5AJHA 4AIIA 2X5OA 3DB1A 1TZBA 3TLGB 2Q7XA 5KWJA 2WICA 1SNYA 4FU0A 4HEA1 2PS1A 3KD2A 1FNNA 1TTQB 2IW1A 4BUZA 3IKTA 1XD2A 1M5TA 2QL7A 4K6KA 3C15C 3HG7A 4EQZA 1UKVY 1GDHA 3DTNA 2QRLA 4CR6A 5HIIA 2OAGA 1YGYA 3T7AA 3LECA 5LOVF 2KM1A 3K8YA 1PKVA 5JS1A 4XMYA 5TF4A 1D4FA 1CX9B 4C3UA 1GZ7A 3ZDFA 4XLTA 4IDDA 1EM6A 2WNIA 4RS3A 4F5WA 4IG9A 1AHNA 1K7XB 5HR5A 4ND7A 3RT9A 1W1WA 2VL7A 2XBMA 1S2GA 2IVZA 4P4UA 1O9BA 4P80A 4MQLA 4Y3UA 4XA8A 1H2EA 3WOVA 5CVTA 1OWLA 4PQRA 1OI3A 2GCEA 3IUQA 3MJVA 1CQWA 2XVMA 4XWGA 5TDHA 4PZCA 1PYOA 1ZI6A 4AQ7A 1N4DA 4PX2A 3EW7A 1Z6GA 3ZZMA 3VPCA 1LTKA 2FRXA 2XCTB 1N32B 3EASA 2ZYUX 1OAAA 3ESBA 3W2GA 3FLAA 3GFVA 1O1YA 4Q15A 1G3RA 2JHGA 2X1LA 2XY4A 4M6WB 4KREA 1PS9A 1T9AA 1E7QA 2LRHA 5CDSA 2A9PA 3VVMA 3Q1LA 5TE9A 3U61B 2C0QA 1KMHA 3IHKA 4MQEB 3ZV7A 4F3RA 1SEVA 2PKEA 3GMIA 3K7EA 5L45A 1GFZA 3OPVA 4MWZA 3SQNA 1Z25A 1L4FA 3JQCA 2Q5IA 3KE9A 4JJAA 5DTJA 3AOEA 1OTHA 3C7CB 3SFZA 4KKUA 2ZIWB 1WX1A 4QNNA 1O95D 4PG8A 3CUSA 3OAAD 5F12A 5GWXA 4A6XA 3CURA 3WGJA 2PBFA 5LLTA 4CFSA 1X1RA 2E48A 3IUSA 2XWPA 2ZRKA 3Q3IA 4R3NA 3HJFA 2UVDA 1USIA 1NUTA 1M6NA 1KDRA 3GZTB 2BELA 1N2HA 3G85A 4NABA 5JCJA 3K5HA 2G70A 4OHRA 4E22A 4YP0A 1VFNA 2C00A 1AJEA 2YZMA 4PC6A 3BZBA 2BFCA 1PGQA 2EGGA 2YJZA 3OOHA 4DABA 6REQB 1CULC 1LBQA 2MHCA 1ES9A 1NW6A 1ZQ9A 4LYHA 5KI6A 4DBZA 3TGPA 2JLSA 1T26A 1NE7A 2Q07A 2YW2A 3BEDA 3ENVA 1OE0A 2O8VA 1H1LB 4QODA 3B7PA 1PWYE 4QYXA 4WTOA 3S1AA 3U3KA 4HATA 4E0FA 2CLOB 1SZCA 1O5OA 5JC1A 1SIWA 3HBJA 3IPLA 1FX1A 3SM9A 4EHLA 2FMIA 3N6VA 4DR5B 1VE3A 3TXYA 1QH9A 3W79A 3ZKAA 4FW8A 1A9TA 2FE4A 2H9AA 5T7BA 1Q7CA 4ZWNA 3P52A 4KDEA 2OXRA 4OHYA 4HHEA 4YV0A 3QU9A 2C2MA 4RIIA 4QDTA 1EZZA 5B1DA 3G5AA 3KRTA 1DQZA 3SYTA 5ICEA 1LQUA 1SHJA 3IXQA 4QXQA 3EPHA 4DWVA 3GHYA 2ZDGA 4NU0A 2AXEA 3VPXA 3SS7X 1YR3A 2PSJA 3PGXA 4OKIA 3W2FA 1O6ZA 1X87A 3B89A 4F4HA 2VT7A 2DY0A 1FL9A 5FAXA 1H9BA 4WLUA 3TOVA 1JI0A 1MKYA 4G81A 5F4MA 2OCGA 2AC4A 4LF4B 4Y6OA 5MFPA 1TIKA 2JFBA 2NSYA 3B12A 4HXFB 4WKNA 3ZDDA 1AV6A 2XKAA 4ZYYA 3DM5A 1RVDA 4S3MA 4BFUA 4CIVA 4D99A 4OQMA 2ZU0C 3IQHX 2O20A 2XQVA 4EATA 2GEBA 3CIOA 1FNMA 3R5HA 5BNWA 3QKSA 2UXDB 2OECA 4L8FA 4RFLA 1T2DA 2ZJ0A 1A98A 3AB3A 4IBOA 3LYUA 3T4PA 1RCUA 5IDWA 3BSSA 3JXEA 3TG8A 4LC9A 3EDOA 3V1LA 5M04A 3PCRB 3WZMA 4A0QA 1XAHA 2Z2YA 4JDUA 4LMRA 3QBTA 1G6OA 2X4GA 3I45A 1YZGA 4ZYVA 2ORYA 5K5EA 3OQOA 2YVAA 5FB3A 3PGVA 2SKEA 1CQPA 2AKAB 2H8KA 2HJGA 2R00C 3UHFA 2NUPB 5JPCA 5DNWA 1N36B 1G21B 2C61A 3ILYA 5JUWA 3A8JA 1JG6A 1MV5A 5JNVA 1NW5A 1TYDE 4H1HA 1O97C 2P8SA 2V65A 3L0IB 4JY7A 2PJRA 3C8ZA 5E2AA 5FHQA 2GEDA 2PJUA 3ISJA 4Y9RA 3NG1A 2B6HA 4KIFA 3USZA 1R5JA 2P9FA 1N5IA 3K4HA 1HY3A 3K16A 3ZHCA 4D8UA 4DEVA 3WO0A 4Z3OA 1DP4A 1X7YA 3PHJA 3K31A 4QDZA 2BI8A 2DXIA 3VYWA 2P35A 2A7QA 3DOCA 3HS3A 3PDUA 4KG7A 4NICA 1HQKA 4CLEA 2QM0A 3VNAA 5A06A 5JTUA 1PUXA 5KVQA 4G1FA 2KWIA 3EA0A 1CF4A 5TQVA 1TUIA 1T5EA 1G20B 3IVXA 3QGMA 3KDAA 2J3EA 3DOOA 1IM8A 1SUAA 4PZAA 5EXTA 4NZNA 1EUQA 5EERA 2AUMA 3TGWA 3PA1A 2B1IA 2HIGA 3HA5A 4CIYA 5DI9A 1WDMA 2FZ5A 2JLXA 1P3JA 3A7DA 2J5RA 2C2XA 3EB9A 3OBIA 3HVHA 4OGLA 4OJNA 4XLHA 4G1VA 4IQ0A 1OXXK 2QYOA 2JKYA 2WVAA 4Q21A 1R0WA 2PLRA 5D3MA 1WMAA 2FSSA 3GLIB 2FEAA 4RKWA 3F6RA 3WV4A 1K0FA 1OZ0A 3V8BA 4OU4A 3RNLA 4YV1A 1NVVR 1F6WA 4HAIA 4WOJA 1IZYA 5CITA 3VH4A 4Z8YA 5ANRB 5LQSA 3I9MA 3JYHA 1U80A 5LU8A 3H5VA 4N01A 4ZP1A 1Z5PA 4NJMB 3BFJA 2VCEA 5ALNA 5AXDA 3A0RB 4K88A 3FVTA 4E5YA 9GPBA 3ZOKA 5CFPA 4ZJUA 4LY0A 3GELA 1L7XA 4D92A 1QTNA 2BUCA 3PITA 4M49A 3ZCPA 2LIVA 4KXFB 1TKAA 5BN1A 1G9TA 1JIUA 1I3LA 2YS6A 5K3BA 2NSHA 1W88B 3WRXA 1L7VC 1CZNA 2Q2OA 2VUSA 1RQPA 3CSSA 1NDUA 3OF5A 3VQTA 1NZFA 1BPLA 2IRWA 3PNOA 3PT9A 4L5YA 1PTJA 2W4MA 2O2DA 3P96A 4H31A 4HAUA 4OSEA 4Y9UA 1KJ9A 5AK6A 5SZHB 1RKXA 1ZCFA 1P2UA 1WZCA 1JJ2B 3EG9A 4J7XA 1BLIA 1VQKB 1LWNA 3PFKA 5NULA 3RVBA 4ZQCB 3CTAA 4FE4A 4LQ4A 2UXCB 3PDJA 3QRWA 1Y63A 1P7YA 5IHXA 1Q0UA 3FJ1A 3G89A 2WAOA 3ABRB 2VBUA 2E5WA 3AY3A 5HRUA 3AM1A 1D3AA 1E3QA 2ID9A 2BMEA 2W2QA 3ML1A 5DT2A 3UB2A 2D2EA 5T4FA 2AF3C 2N0SA 3MGCA 1RE0A 3E23A 1Q15A 2QWXA 5EGNA 4LWOA 1UPCA 1P75A 1EUCB 3D6HA 3HADA 3ITNA 3KVRA 4DDUA 1FS5A 2WNHA 3TUJC 3U17A 1AKTA 1S02A 3OE7A 1KTVA 1YJCA 2BRUC 2AZDA 2OQ2A 2VHUA 1O7JA 4GMFA 1EHYA 1JG4A 1JSRA 3H05A 3QF4B 5F2KA 3F7OA 3S6JA 3W2TA 1H8EA 3K20A 1CPYA 4TXNA 1TM1E 4BO7A 5C46F 2I3ZA 3A58B 1AQJA 1UM8A 3IH5A 1ZKDA 2X8LA 1M3SA 3B1VA 2WJ4A 3GBVA 4FPXA 4JLMA 4EF5A 2ZSEA 5DM4A 5JS8A 5GOZA 3CRMA 3QBDA 4W1PA 5EOVA 4X62B 2KJQA 3FUXA 5G4KB 3H83A 1KO5A 4C0BA 3ZK9A 7REQB 4ZCLA 4DEYA 1YL5A 2FMHA 3DW1X 1UDXA 1K6IA 3CRZA 1FJXA 1ZD8A 3VOSA 3A9UA 2ZWMA 1FBNA 1DPFA 1SQSA 3I9OA 4AP6A 4EB6B 3D6AA 4U6QA 4YDRA 1YBFA 1VG8A 1YVPA 4LVUA 3EPPA 2DFNA 3B70A 2JEOA 1QF9A 3U3ZA 3SIPA 4RHTA 2FVXA 1GNQA 1YDHA 1Z2EA 2WZCA 1UT5A 3AONB 1XMIA 4HB2A 1HLFA 4M88A 3SPXA 3TRHA 5JEEA 5A4KA 2WIKA 5IDXA 2GDJA 4JYZA 4Q34A 4ND3A 4CW7A 4MTLA 1PGPA 1J39A 3IMEA 3AEUA 3G2JA 1C7EA 2CNKA 3F5DA 3AWDA 3LBIA 1QG4A 3M70A 4R5HA 4ZXFA 3WA7A 1BWRA 1XCBA 3EG9B 4OAPA 4H1TA 1FP7A 2MWMA 3IVGA 5D3QA 4FEYA 5E9WA 5F1YA 4DM7A 1QV7A 4GGOA 3OUUA 4N12A 3IE2A 4CEIA 1D2NA 5A71A 5BXQC 3FOBA 4OHPA 3WBBA 4Z1MA 2HJ9A 2J67A 2XYPA 1YNOA 4P31A 4MQMA 1L0BA 5K3FA 1PJSA 4EJ2A 4BJ3A 2YQZA 5ADWA 1YL6A 3GNQA 5KDOA 1TUGA 1BEEA 5AOVA 4EVIA 4HWPA 3RBVA 5AHXA 4DLPA 1ZH0A 3ZHSA 1U6KA 1GCGA 1Q57A 2O0LA 2QI9C 1USVA 2WFAA 3DULA 1SA0A 4H3HB 1SOUA 2AE1A 2XQJA 4LY6A 2W0MA 3WIDA 5IH7A 4M89A 3GLGB 1K92A 2YL2A 3LV8A 4D26A 1VJ0A 5BN3A 3OZGA 1BXGA 1MN6A 1YA6A 5BO5A 5AQEA 1XTPA 4DUPA 4XRGA 1XZCA 2QW1A 3DP9A 2ZM6B 2R4UA 3FD8A 1KVQA 1KC1A 1QFSA 3AVTA 4F6CA 2DHRA 1E1YA 3EODA 3S29A 1EPUA 4HQFA 1OZHA 2CLCX 3O31A 5JEDA 2GFIA 4PF1A 4RKRA 1BH6A 5KC9A 2JAQA 1MX1A 1QVAA 5DYGA 3GMSA 3QW2A 4J7CA 3TR0A 2HBZA 4AYWA 1OLUB 3FVQA 2OCPA 1USWA 2V9CA 1OREA 1YIDA 1UBNA 4BO1A 1SKMA 4MI6A 3AGPA 4ROXA 5A05A 4P25A 2C2BA 1Z08A 2QKYA 3LX5A 3OO0A 4AQYB 2X4LA 1WZIA 3CEJA 4XIFA 3D1JA 1PJ8A 3FTFA 5JXIA 4UBKA 1XXHE 1DLIA 1N6LA 1BS1A 2QV0A 2ZW9A 3L79A 4O6VA 2WVHA 2VCHA 2WUFA 1JXQA 4EUKA<