2BSAA

Ferredoxin-nadp reductase (mutation: y 303 s) complexed with nadp
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
295
structure length
295
Chain Sequence
DVPVNLYRPNAPFIGKVISNEPLVKEGGIGIVQHIKFDLTGGNLKYIEGQSIGIIPPGVDKNGKPEKLRLYSIASTRHGDDVDDKTISLCVRQLEYKHPESGATVYGVCSTYLTHIEPGSEVKITGPVGKEMLLPDDPEANVIMLATGTGIAPMRTYLWRMFKDAERAANPEYQFKGFSWLVFGVPTTPNILYKEELEEIQQKYPDNFRLTYAISREQKNPQGGRMYIQDRVAEHADQLWQLIKNQKTHTYICGLRGMEEGIDAALSAAAAKEGVTWSDYQKDLKKAGRWHVETS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERREDOXIN-NADP REDUCTASE
publication title C-Terminal Tyrosine of Ferredoxin-Nadp(+) Reductase in Hydride Transfer Processes with Nad(P)(+)/H.
pubmed doi rcsb
source organism Anabaena sp.
molecule tags Oxidoreductase
total genus 88
structure length 295
sequence length 295
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2005-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 2bsaA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 2bsaA02
4AC9A 4AF7A 4TMXA 4N3GA 4Q7JB 4YALA 3I56B 1TUIA 3J81k 2EIXA 2VZLA 2GQFA 1G7RA 4LBYA 1F60A 1YJWB 3AVYA 2HCJB 4ACBA 4PGOA 1QGYA 1ZM4A 4PC3A 3MHPA 3CPWB 1M1KD 1VQOB 3W5UA 3ZBTA 3WYAA 2OK7A 3G6EB 3WBJA 3WNDA 1G7TA 1W35A 1N0VC 2B7BA 1H85A 2BM0A 2QTZA 2YWHA 3VO2A 1R5NA 4ZGQB 4RD0A 2ZITA 4U9UA 3AVVA 4M53A 5EMNA 1QGAA 4ZCLA 1KQSB 1M90D 1DDIA 1D8TA 3QE2A 1BJKA 1GR1A 4Y9RA 3OW2B 3W5HA 3CMEB 5AN9A 1VQNB 3ZC3A 1E63A 1QVFB 4FN5A 3CCVB 1JJ2B 1ZM3A 3FPKA 1EP3B 2QTLA 1GAWA 2HMAA 2J7KA 5HXBA 1WDTA 1EWYA 4NCNA 2X3UA 1EP1B 1VQ5B 3OZWA 4K1XA 5H5JA 1YITB 3JQQA 2BVNA 1YIJB 1TLLA 1H42A 2BF4A 1KK2A 1KTVA 1AMOA 3W2EA 2NPFA 4B3XA 4UAJA 3B78A 1BX0A 1EP2B 1IB0A 1QFZA 1B23P 2OK8A 3ZBUA 3P26A 2DEUA 2BGJA 1IJFA 4G1BA 2PMDA 2BN4A 1E62A 4PC7A 4J0QA 5THXA 4HE5A 4LBVA 4NBSA 1QUEA 1EFUA 3CMAB 2RC5A 2QA4B 3U6BA 1VQ6B 2BPOA 1VQ7B 3P27A 3ZZUA 2DETA 3QFRA 1QH0A 3WNBA 1K73D 1CNEA 2VNJA 2YWGA 1KD1D 4YAUA 1ZM9A 1ZUNB 1TVCA 3CD6B 1I7PA 3JQPA 1IJEA 1G7CA 2QMUA 4ACAA 3AGPA 3AGQA 2C78A 2QDXA 2R6HA 4M0LA 3FJOA 1NDHA 1FNCA 3AVXA 2CRVA 1QVGB 4IW3B 4DQKA 2D74A 2QN6A 3WNCA 4TMVA 3G71B 1Q82D 4LBWA 3VO1A 1E64A 1GO2A 4TN1A 3WBKA 3B82A 1R5OA 1FNBA 1QG0A 3CW2A 3AVWA 1HA3A 1EXMA 1N0UA 3LRXA 2VNHA 1ZM2A 1GAQA 3ES9A 1S0UA 4BPRA 4HE6A 1FDRA 4RD2A 4B44A 3OZUA 5TV2A 4P6VF 4B4DA 4MYUA 3I1FA 4RD6A 1OB5A 2YWEA 1KK0A 5DSZA 4LBZA 4TMTA 3W2FA 1OB2A 3QFSA 5GV8A 4ZV4A 3CCUB 1KK1A 1XB2A 2BGIA 1JB9A 3LVBA 3AVTA 3JQRA 4B47A 4TMZA 3OZVA 3AVUA 5GV7A 2YWFA 4Y7CA 1A8PA 3CCLB 5H59A 1W87A 1G7SA 2EFGA 1QFYA 2VYQA 4G5GA 2C77A 4MYTA 1VQKB 4RCZA 3W2GA 2RC6A 3ZZTA 2FX3A 3A1FA 1VQMB 3CCEB 1Q86D 1FRNA 1QUFA 1KC8D 3PENA 1FNDA 3VMFA 5TY0A 2GPJA 1GVHA 4YAOA 1N8RD 1FRQA 1YHQB 2OTJB 4G1VA 3CC7B 4P3YA 4TMWA 1Q81D 3CC4B 1W34A 1YJNB 4M4SA 1Q7YD 1SKQA 3OJXA 2PLFA 1S72B 4EH1A 4RD4A 1FNMA 4DQLA 3W2IA 1CQXA 1QFJA 4M1KA 4M2LA 3E20A 3B8HA 1D1NA 3MCAA 3E1YE 1UMKA 4ZGNB 5JBQA 4QFMA 4ZCMA 3MMPA 1R5BA 3QFTA 2QEXB 1JA0A 3QSYA 3U6KA 3WXMA 4Y9UA 4RJLA 3W5VA 2HDNB 2OTLB 3W2HA 1TTTA 2DERA 4H9GA 4QHYA 1J9ZA 1K9MD 3VNUA 1BQEA 2DY1A 3ZZ0A 1KJZA 4LC0A 1GJRA 1EFTA 3CCSB 2B7CA 2XNJA 1AIPA 3CC2B 4RCYA 1CNFA 1JNYA 3SJZA 1K8AD 2CNDA 3CB4A 1U2RA 1VQ4B 3VNVA 3CCRB 3WY9A 3LYUA 3OJWA 3CRZA 4B48A 1NJID 2AHOA 4AF6A 3V76A 1DDGA 1B2RA 4C0SA 4B43A 1VQLB 2PIAA 3U2QA 1VQPB 4RD1A 2XNCA 4YAFA 3CCQB 4ZCIA 1VQ8B 3CCJB 1QX4A 4R71A 2BSAA 4PC1A 2BM1A 3G4SB 1ELOA 1OGIA 2B5OA 1F20A 4F7DA 1EFCA 1XE1A 4C43A 3CCMB 4FWTA 2XEXA 1DARA 2DCUA 1YI2B 4YHBA 1JA1A 1YJ9B 5TR9A 2E1RA 2VNIA 1VQ9B 4FK8A 1D2EA 1DG1G 2BV3A 1KK3A 2BMWA 3QFCA 3CXCB 3I55B 1BX1A 5KSWB 4RD3A 4YAWA 1W2BB 1OGJA 5FA6A 1KRHA 3LO8A 1QGZA 1SM4A 4PC2A 4PC6A 2VNKA 4N3NA 4WQMA
chains in the Genus database with same CATH superfamily
1X2EA 3HXKA 1QHIA 1BHJA 3FOBA 2W2KB 4CMAA 1EWVA 2ANBA 2MSLA 3C45A 4JELA 2ZUBA 1QHEA 2ZPTX 5HQJA 2PSFA 3MBOA 3VH1A 3PXAA 2IHZA 4HNGA 1Z0AA 2C83A 4Y2SA 2YJGA 3H5TA 2GILA 4A9AA 1EAYA 2CN1A 4MVJG 3Q7TA 5TMPA 3H84A 2J33A 4Y6GB 4IXWA 4OXQA 2DHRA 1HQYE 4XUCA 1S02A 5DU2A 3W6ZA 2GFQA 1J9GA 3IDZA 1H4QA 3RT9A 1RRKA 3AHGA 4DR3B 1FPMA 1ZMOA 1EK0A 5E6TA 3AUJB 4RZSA 3RRBA 4B6PA 1MRZA 1BHSA 3F5FA 1VQOB 4FMPA 5D3MA 4KWIA 3VHLB 2AEFA 3CT6A 3I12A 1P0MA 3QQ5A 3GH1A 1MB2A 3QU4A 8ADHA 2WIBA 2PPVA 1R16A 1X7DA 3ROZA 1KBOA 4KXUA 4OLFA 3RUEA 1VPWA 1AM4D 1DUSA 1G19A 3SS7X 3U3DA 2VBUA 1D6SA 2WU1A 3I9NA 2RJ3A 3BWBA 3LQRA 4J0EA 4LXGA 1WMSA 4K6HA 4MUHA 2XB4A 4OXNA 1OT5A 4AY5A 4DTCA 5K8JB 2AZMA 1WTHD 4KMOA 3FF4A 3PFCA 1TNDA 5GTDA 4M1MA 3DH0A 4BMSA 1GNLA 4U3JA 4BE7B 1ECGA 3DKVA 3RK0A 3IUSA 5LL6P 4R1OA 2YIJA 1TCAA 1TLFA 1CQWA 1WP6A 1ID1A 4UBOA 4D8XA 2HV9A 1OJ7A 1O6GA 3ENKA 5JQGA 2O0KA 3BF8A 5BN4B 1F4LA 1F2DA 4NOLA 2PXCA 3G3EA 3HZZA 2IHUA 2J5RA 3JS5A 1B6GA 1SZDA 3NKFA 3PGA1 3TOCA 4B74A 1P8AA 3N8NA 3DE6X 3TNJA 5KYGA 4Q9DA 3ZIDA 1X8XA 2GCPA 4FOLA 5AHXA 2A5GA 2DPMA 3JQGB 1HSOA 3OPMA 2UUBB 5J2TA 3F46A 5EHNA 1J8QA 5JNVA 1EVKA 3W5HA 2QL7A 4IHQA 2FR8C 2WQ6A 2EW1A 3KT0A 2ZI3A 3Q7QA 2D5AA 3ZC3A 4KPGA 4NV0A 2VPYA 1U1GA 4U2GA 4X6XA 4UE6A 4XKJA 4ER0A 3DMTA 1US8A 3P2KA 3I9JA 2BONA 1C7EA 4Q48A 5SY6A 2NN3C 1J7KA 4MO9A 3WX0A 4GBMA 1LSOA 3G2KA 4LQ4A 1HL7A 1MOSA 1GAWA 2VHJA 3RVKA 2WHQA 5SV2A 2MMCA 3G59A 1DE0A 1MENA 4NCNA 1VECA 4CM5A 2YVUA 1W4ZA 1Z5ZA 1FDOA 5LZ4A 1ZVJA 1XQ6A 3LA6A 3SHVA 2O8VA 3MELA 2M6LA 2GM5A 3EQ7A 4ZQCB 3CURA 3JQFC 3OPVA 4Y0NA 1C9NA 1VGVA 4GI7A 4L9WA 4PRYA 3SJAA 4M49A 5DASA 4A8TA 5JAUA 5FLXA 2C5GA 4R41A 4FOOA 1M1YA 1QRSA 4Q05A 3FM9A 2ZRIA 2ZZGA 3G8BA 1TD9A 4J7CA 1VKOA 5CX1B 5IWCA 5EOVA 2PWZA 2V7GA 4PBTA 5JC8A 3SQXA 4YJGB 1GRQA 4AZ3B 4QPNA 4HLUC 1IMJA 1BW9B 4H7IA 3DTVB 2LWIA 2X7JA 1Q3KA 4B3XA 1Z2EA 2WHPB 1E9EA 4UXHA 4XUGB 1YULA 3UV7A 4AK9A 3NEPX 3LK6A 2NUAA 2IPLA 1PV4A 1WOSA 2QRQA 4GPBA 2ZS9A 4MGEA 3DAYA 1H2FA 4INOA 3UJPA 3OEYA 1Z7WA 3CU5A 3TNYA 1UWCA 2Z08A 2O8CB 1EDOA 2FUNB 1G16A 3GGJA 3PQ6A 2A8YA 4P7BA 5HF8A 1AKQA 3VSDA 4EARA 1ZO8A 1T5HX 1RYYA 3KHSA 4D8TA 4ZYWA 3IALA 3BD6A 3RTAA 2NVUA 4G1BA 5AI6A 3D6JA 2B99A 4YRMA 1T6YA 2P6RA 4X5OA 5IKOA 2CHEA 4NS1A 2K6GA 2DB3A 1WZIA 1YVRA 1NXXA 1W2HA 3BH0A 3KTAA 5EXSA 5F12A 1XMXA 3SZOA 5JMWA 2N1MA 3OU6A 3E4DA 4GVXA 4X3OA 4HWRA 4DM7A 3W4IA 3H1FA 5FQOA 4DCUA 3H0EA 4P3PA 4HVLA 5AKKA 4YJ2A 1ADBA 2I4TA 4OOXA 1NVXQ 1TUGA 3UC5A 1PT6A 4MV9A 5GQSA 2Z57A 2VDRB 2FRDA 3LBHA 4WZAA 2YXNA 1CR0A 5B7QA 2BGUA 3TOSA 1RC1A 4WKBA 5DNYB 2HFJA 4BB0A 2Y0BA 4EGQA 1ND5A 5C8DA 1K2WA 3SYNA 2D9RA 4ND4A 4DVGA 4U4AA 4D3SA 1R0BA 2O0HA 3OOSA 4GU5A 4PLYA 4Y3UA 1NJGA 4ARSA 3OF5A 4LOLA 5CR9A 1I2ZA 1LVHA 2CVOA 1VJCA 4UQOA 3SR4A 3J7AC 2WTMA 1X92A 3S4YA 5CCDA 1V25A 3KQPA 2GBGA 3CWZA 3ROXA 1ZH4A 3AGPA 3R6JA 3MCUA 2AUNA 2EZ8A 4IIJB 4ZIRB 1EZZA 4BQQA 3SX0A 4TSFA 1W29A 4OHYA 4RHFA 2Z2XA 4ZVQA 3WNZA 2HW8A 2HHCA 3QU9A 1RC0A 1CERA 1U02A 4MS1A 3NEAA 3SC3A 1FQOA 1QO0A 1P0CA 2NQ2C 1A5ZA 1WR8A 5LXTA 4IW3B 3OAAD 1JFVA 2ZSJA 1WSAA 4N5NA 4NIMA 2DPYA 4OBBA 4R83A 4F1WA 3JYNA 1QC5B 3RIHA 4C76A 3NH9A 2SCUB 2FSVC 2EEPA 3FWPA 1E7MA 1NW8A 2OXEA 2VDOB 1QJ4A 3FHJA 3D4PA 1P73A 4U6QA 1Y6GA 4KYIB 4CMBA 1GO2A 1H0HA 3QF4A 3STWA 2GZAA 3ENNA 3KJXA 2DVMA 1JEYB 5C1PA 5FOSA 1EGQA 4L8YA 4HNRA 1WG8A 4RLQA 1GWNA 5CVVA 1D3AA 1M2VB 3ZLBA 3KOOA 1QPBA 3B1XA 1MJNA 1SCJA 3AKCA 3GLKA 5A5DA 4FYKA 4BNDA 1N08A 1Z22A 1ZL2A 4MUFA 5U4XA 2OQ2A 3FVWA 3HA2A 2FG6C 1SCUA 3F98A 5TPZA 3DWFA 4M1ZA 5JJIA 1G9XA 3LQ4A 2O8NA 3PC8C 2YWCA 1E9BA 2PN1A 3QVUA 2C03A 2VOJA 4JVSB 5JH7A 1LRLA 1Y89A 2WJWA 2VF8A 3KT8A 4G5RA 1AY0A 1LDMA 1K27A 2H29A 2VEOA 3GBSA 5B30A 2M6RA 2Q2OA 1M66A 4CWAA 1P4GA 3R5KA 1QZ3A 3NBZC 3F2IA 1OYVA 5K0ZA 4Y6QA 4KO1S 3DE5X 4JR0A 5FBZA 1U4NA 1X77A 1LDNA 3M0EA 3UAWA 4FYIA 2OSVA 5L53A 5HIJA 1JL3A 1TYBE 5HBGA 3RRZA 5ESRA 5I8WA 3T4PA 3DMPA 3GN1A 3V2HA 1XVVA 1BYIA 4BFXA 4JJZA 4YQYA 2JJQA 3MJDA 3PSAA 1L2TA 3CEPB 3NE5B 1CXZA 1SHKA 1NVDA 1BVYF 4LQLA 3EODA 3KQWA 3RSQA 2CC2A 3AVTA 1ZOLA 4DDUA 3CN7A 3D5QA 3GGGA 3V9PA 2DPHA 1XP5A 2P9TA 2BFPA 1A95A 1V1RB 1XNGA 4BWGA 1L4YA 1D2AA 5K0TA 4WJKB 1VJDA 1N2GA 1WSWA 1MRNA 3BN3A 2LD4A 3TOZA 1DC6A 1DOZA 1G8MA 4G4SO 1JR2A 3TOXA 1J5EB 1ZWKA 1XJWA 3PRHA 4OMDA 4KPEC 2FWRA 1YJ5A 3IP6A 2NU7A 3U81A 1ECJA 1WPGA 4V0LA 1ABBA 3TZCA 3LS2A 5F51A 3F5DA 3FMPB 2PLRA 5BSMA 1HYBA 2OCDA 5TPWB 3UGQA 5K8IA 3GARA 2REQA 2OV1A 2GM9A 1L4FA 3M6AA 3U9TA 4CTNA 3DDHA 4B6GA 4XLAA 1DI0A 1WU8A 1L7PA 1V37A 2TMKA 3A1WA 3AUXA 3MINB 1LA2A 4NYIQ 4PBSA 2ZUSA 4WY8A 3QWHA 3I09A 3HJFA 7MHTA 1KH3A 4TYQA 1E2KA 4ZYYA 4OUDA 4ZMSA 1XQ1A 5A4KA 4R0MA 4JROA 4ND5A 4O0MA 3PJEA 2QU8A 4JOQA 4S35A 3A1UA 4UEQA 3MIIA 2WICA 4ZVMA 4EPRA 3PUZA 3M33A 1LPOA 4KN8A 3T7DA 1U65A 3IX7A 1JEDA 4WFQA 2QMQA 1GZ3A 2R44A 2ENWA 1EVIA 5E4YA 1Z7EA 4DAOA 1NI5A 3SNKA 1J00A 2V3VA 4G1UC 3K31A 4XGNA 5HJ2A 2V7TA 3ZEAA 4Q1AA 3IIJA 2H2HA 2OE2A 4XARA 4YT8A 1OI4A 1RTTA 3W90A 5L3SB 2J67A 4O2BB 2OWDA 4XX0A 2E5WA 4FGWA 5LXTF 2W8BA 4C0JA 3GLIB 2OB2A 1G20B 1NUQA 3RYFB 2QQFA 4J1NA 3O8RA 4PINA 1FP4B 1GVHA 5KQSA 1WY7A 2XVYA 4CEIA 4NULA 2YHIB 4LG1A 2EGHA 5AXDA 1PBNA 3ZGXA 1YL7A 3M5PA 4UTPA 2G3YA 4CMKA 1VI2A 3IQFA 2JLZA 2H5EA 2VP0A 1BXRA 2D00A 3N8DA 3KE8A 2ZAGA 1ODSA 4WA8A 5L7YA 4W5OA 4BJ3A 4EK9A 5JMTA 4CI0B 2O7RA 3PE3A 2XRMA 1P4RA 4M6WB 4P82A 2OHIA 4YH1A 1YONA 4KIGA 1LX6A 2JVKA 3IAEA 3PPVA 4R1QA 3SQOA 1YAHA 2YJNA 4FCCA 4TTQA 5LQRA 1XZMA 1E1NA 3IAM1 4AWXA 4ZEXA 4YUAA 1OZHA 2QXTA 2LGJA 3PTAA 4FR0A 5BVGB 3P45A 1ETUA 2BISA 2BR3A 5IYZF 4MULA 5LNK6 4B6SA 4P08A 5B3LA 1JZSA 1PSZA 2GTPA 3QEAZ 3GXBA 3EQ2A 3JRWA 3OX4A 5JVDA 4LCEA 2Y66A 4DR1B 3WDLA 4H3KB 4M2LA 5DWVA 2FFAA 2J5KA 1QR2A 3FPAA 4BO9A 2VJCA 3GNLA 4CM8B 3ESDA 3K2IA 2EYUA 1RBMA 1RQ7A 1Z0ZA 2P5SA 2R8XA 4NS4A 1YRLA 1DJQA 2X13A 3BIWA 3CZPA 3LRPA 1GQQA 3TZLA 2Y1LA 1WMBA 4NYMR 3TGPA 4U5XA 2G1AA 4LFBB 4PFJA 1W19A 1Z47A 1E2BA 4OQMA 5HGXA 3H16A 2IUSA 2P4UA 1QDLB 4QXMA 1XAJA 1PR4A 5K3EA 3PR2B 3HYTA 4OMUA 2XT6A 3BCDA 1WUYA 3ZUPA 1USWA 1AD2A 4D4JA 3L6CA 4FFBA 3WL4A 5J43A 3O7MA 5IT9A 1NZFA 3HDGA 1NNUA 1FYXA 2VUTA 1SQSA 2ZWMA 2H4JA 3RLIA 4QXPA 2ZUFA 3LDAA 4KQHA 3UFBA 4F93B 3AKDA 1AKNA 3C3CA 3GLQA 3R3HA 4HATA 4FKBA 3RVBA 1JNXX 1GVNB 1P5FA 4KOAA 3I9LA 5B1SA 3GRYA 1DKNA 1CJTC 5CLLA 4HYYA 5EZSA 1Z37A 4QVKA 4LWQA 5FLKA 3B70A 4L8FA 5KQRA 1NBIA 3AJ9A 4WZLA 1IHDA 2I22A 2I6FA 3R5XA 4FEAA 5ALYA 1G38A 2A1UA 4DABA 1IMOA 2DFNA 1EJBA 1M74A 1NQXA 1RWPA 2ISCA 3HB1A 3MMXA 3BWEA 5E1MA 5EHXA 1C80A 3HJTA 1Q3HA 2YJZA 2QN2A 3BY2A 4MROA 3TYXA 2YHSA 3LUHA 5FPYA 3FY4A 3N3BC 2YX1A 1FYVA 3GDFA 3ADKA 3CCRB 1DTSA 1YZFA 3OJWA 3E8SA 4YCNA 1CJCA 4U5QA 4WZAE 4DLNA 5DZSA 2OYCA 5HX7A 2VJAA 1W49A 1E2EA 2WNHA 3OE1A 2EX0A 2B30A 2FY8A 2VZ8A 3KWMA 1UK6A 5AHKA 3M8KA 2Z58A 3QTBA 4RMIA 4LYFA 1GTJ1 4HRVA 2H57A 3QX9A 2A5LA 4IX1A 3AP2A 5BUCA 3PQCA 1W9XA 2PMKA 2VNSA 1T34A 3O82A 4L07A 2PZMA 1RXEA 3MOIA 2C5LA 1N5RA 4ISCA 1GAXA 3MS4A 3AFNA 2RHWA 2W2PA 2GFIA 3E0XA 2IW3A 1QHNA 2JF0A 2P2ZA 4F4HA 4LPSA 5DO9A 1KJJA 5ARBA 2E48A 1GG9A 1JFFB 2DSNA 3OOWA 5BQFA 3QHAA 4JXJA 1NF8A 3I6ZA 2VYVA 2GK4A 1MIHA 2XTMA 2I6TA 3KELA 1OA1A 3DT8A 1A3CA 3BL5A 3BEOA 3EDYA 5TF4A 1VE9A 3GWGA 1TVKA 2P35A 2ZYAA 3D02A 3EAGA 1AQUA 5AP9A 4NK4A 2JGRA 2ZCUA 1B8PA 4AKGA 1YB7A 1YF3A 4DJJA 3ZE9A 4D3DA 2W83A 4F8JA 3KOWA 1DAOA 1N5DA 4L22A 5IAKA 2NU6B 1XZ8A 3TPZA 4AJ9A 1FXUA 2FDCA 1JEOA 4Y6SA 1DWUA 5DOVA 3NUZA 4IS3A 1VKZA 4C43A 3MSXA 1IRIA 4HXYA 4GQAA 4ZGGA 1IBRA 1OT3A 3BAZA 2ZXUA 5FR2A 2GH1A 1VG0B 2RKWA 2PD3A 5K99A 2I7CA 4KKXB 3JY6A 4FMDF 3NZEA 4TMYA 3I2FA 3GZTB 4NV3A 3O8OA 4EG4A 1OAAA 2C3YA 3ELBA 1CYDA 3ASPA 3A0RB 1AMNA 2CFSA 4RVNA 3IJRA 1BC5A 1WCV1 3LMKA 4J0IA 2IUYA 3JQ8A 3A7EA 1BOOA 4N54A 4ZT2A 3EH2A 4KR7A 1PL7A 3CZ4A 2W4MA 1KWKA 1RZRA 2I03A 4QOSA 1K97A 2DUNA 4C6RA 1CUCA 1P74A 4Q3NA 3ZWAA 3NDPA 5A6SB 3A9WA 2NUBA 4WXRA 3VVLA 1WKCA 4BQFA 1RMQA 1W2BB 3SJCA 4BLPA 5DNUA 1AA6A 5TT1A 5M3BA 1YVEI 1HLFA 3AF0A 2XCIA 4FC7A 4HNSA 3O47A 2BJVA 3Q11A 4BP1A 2REBA 1YE3A 3KJHA 2ZTSA 1OXBB 1L5QA 3BMQB 3WK9A 4JSRA 2ESRA 3D9QX 3PQ5A 3ROKA 5EWJB 1XV5A 4HEA6 1GLNA 1S2DA 2MSCB 2XJ4A 4OHUA 3DULA 4YALA 2HADA 2DUMA 3ONVA 2Y67A 4CKWB 4I6GA 1L5OA 3TLGB 3AY3A 3SIXA 2DWUA 2ZQ5A 2O9JA 1J2JA 1YASA 1OX4B 3AW9A 2OZVA 2VRCD 3EGWA 2P3SA 1C7RA 3BWMA 1WQ3A 2QSUA 1F60A 4OKNA 2XE8A 4P3NA 2D4AA 2YZ2A 3WC4A 2HCJB 2QE7A 1KO5A 2BKLA 1K6JA 3PFIA 1J2RA 3Q8LA 1Y7PA 4H2DA 3DL4A 1FMFA 1EZ1A 2PX2A 2EZ9A 5JAMA 3BEDA 4XONA 5T4BA 2F4VB 3E05A 3MWDB 3QOFA 1SC6A 3OWOA 3QVXA 1ZJWA 4FD2A 2VO1A 1NR7A 5BQPA 3HPRA 1ZKDA 4ARCA 1MFPA 4DV0B 1E6KA 1Z45A 4D79A 1E0SA 4EG5A 1EWQA 1Y7HA 1U9IC 2GZDA 4NATA 4RZ3A 1KIAA 4HNUA 4AN0A 2NTYC 1UKCA 2HX1A 2WMYA 4N0EA 4O4LF 4Q12A 4PZEA 4EDFA 1GGEA 4QOGA 5HTKA 3FJ1A 4F84A 1XTJA 3CEAA 1EHIA 3Q9LA 3LZ6A 1Z38A 4ZCLA 1N2ZA 1D2GA 3FYUB 2ODEA 2PKQP 3N7UA 121PA 4N7MA 3FAZA 4S0ZA 1D2RA 1UP6A 1D8TA 5D1HA 3R7SA 4YJ3B 2CJYA 3TNDA 3ZQKA 2X5OA 3DHEA 2A88A 3AY0A 5HZGA 2WF8A 3Q2KA 2CV0A 2I9KA 1SQ6A 2OOSA 3PV0A 4TXMA 3B53X 5CFLA 1X7XA 3P0EA 5EVJA 2NXNA 3AUKA 3HKEA 2WD7B 1L7EA 3ZY2A 1EUDB 5H68A 2K5UA 2P9CA 1SA0B 1LTHR 2HLHA 4OHOA 4MZXA 1Z0KA 5EJMA 1GHTA 2X8JB 4ZICA 3RJZA 4MTCA 4XDHA 1O95D 4BVFA 4JD5A 1P17A 5DGCA 1JJ2B 1U2SA 3OCZA 4J94A 4QJIA 4PN7A 3WJ7A 1U1IA 1O8CA 5ER9A 2PGOA 3M70A 1U0OC 3CLUC 4UTVA 5C3MA 1J09A 3ZI4A 2QUHA 3TG8A 2EKBA 3EXG1 3DLBA 1B0PA 5HE8A 3L6UA 3SK0A 1ORTA 2RG1A 3FTCA 2QG6A 2WWFA 2IOFK 1MOPA 1G21B 4GYYA 4IH1A 3DL2A 4LXHA 4RXUA 1LLFA 3TM5A 4E22A 4RTRA 3THYA 1AUQA 1KH1A 4N5LA 4X20A 4X63A 5BWNA 3ZVRA 1LDYA 2X4GA 4PX2A 1E77A 1ZJJA 4WXYB 5EIEA 5BY2A 4MPDA 4CVNA 1C7IA 1P0QA 2GERA 2Q4TA 4RPJA 4EDHA 3GB9A 8LDHA 2AUTA 3EMVA 1X0VA 3HSYA 3FCCA 1CIVA 1ENYA 4EVSA 3H05A 1Z8HA 2E87A 5AMXA 1Z0JA 2A2ZA 4JB8A 4CF4A 5BR1A 3TQHA 5A4IS 3ZNPA 3RUHA 4QKQA 2FN4A 1ZCJA 3PC6A 3RRXA 2BJWA 3VDQA 1ACJA 1PT5A 2W48A 2QW8A 3IT3A 4JUDX 4K87A 3FCSB 4HEJA 4OMCA 2FR1A 2HL6A 1EM8B 4NABA 1YRHA 5BN3B 5JSQA 5JZSA 1IJFA 2WD9A 1YVDA 4CCSA 3NXKA 5A4DA 5ELMA 3UT6A 3FDZB 3IUQA 3L7NA 4IDEA 1N2JA 4IDHA 1HX7A 1BFDA 1T4MA 4BV3A 4X1YB 2RB5A 4PLHA 3ZY3A 1GA4A 1VQ6B 1PYDA 3F1LA 3FHLA 4BBJA 5IM4A 3O8LA 1V11B 1JVBA 3NHJA 5L3RA 2XQJA 2UZ4A 2ZSUA 4TZKA 4GPD1 2X85A 4EI7A 5COQA 2HJSA 1F0PA 3E0QA 4ILEA 5TEVA 5IVIA 1DO0A 4IM7A 2HO4A 1AGYA 4RDCA 5KDLA 2VF4X 2EBUA 2FE1A 1ZD4A 2VEDA 5KSZA 3QIVA 2NUPB 2HNAA 5F4OA 1T4CA 1H3EA 5HIAA 4J75A 5IJWA 1OHHD 1N0HA 2JD0A 1J1ZA 4CUKA 3GFOA 1NX9A 4ID3A 1ZD3A 3KFXA 4CLOA 5J3JA 2ZB7A 3Q10A 4DIDA 4RJIA 4RHTA 1JIUA 1LI5A 2GNAA 3AHJA 1SJ9A 3GFRA 4DIFA 3ADCA 2VG8A 4W4TA 4FC6A 1WP9A 2DX7A 2CDCA 2YFYA 3FMIA 2HD4A 2QWXA 2ZWIA 3AF1A 2I76A 2IEBA 2VXBA 1N36B 2DR2A 1U1EA 3I4FA 1X1EA 3BMCB 4GH5A 3TJMA 1W1UA 2IIPA 4NJEB 2EG9A 5CGZA 5DXFA 6GPBA 1UR5A 2VDNB 3O4VA 4D41A 1QVGB 1E69A 1VA4A 1D1SA 4ZHQF 1GGMA 1G3RA 1XJCA 4GMKA 5G2OA 4AP5A 4GPTA 1EI9A 2FZCA 1I9GA 4MQFA 4N3BA 1KVTA 4EO4A 2ZJ6A 3EAFA 1PSDA 2X15A 5BYJA 1DS6A 1GNVA 4JP1A 3QW2A 1H6CA 4YN3A 4CQMA 4O0LA 4V3CA 5DW3A 4ZVUA 4ER6A 2WIDA 5JSFA 1K86A 1PV1A 2I87A 2VH1A 4TVKA 5CP8A 5IUJC 4AO7A 4EL5A 2JGNA 3VU8A 2O0LA 2H4HA 4A26A 1KMMA 3UJ3X 2PR7A 4EEZA 4RACA 3H4MA 1A9SA 4JQSA 2B92A 2ZBGA 3CISA 1UFVA 1EXMA 1Y63A 5HFJA 4I9FA 1OXVA 3PA8A 2V98A 3L0OA 2VNHA 1GL9B 3LRXA 1GTMA 3QVOA 4PZDA 1KAEA 2ONYA 5LMNB 4F45A 4MGZR 4N6NA 4XSHA 2WW8A 4QNMA 4UUPA 1LGYA 2HLNA 2XWPA 4TLAA 1HETA 4QGBA 3SEFA 1E9CA 3EZLA 5CYFA 3RKRA 1FP1D 2MDTA 2VTVA 2YQ5A 2ZIFA 3DZBA 5LZ9A 1GD1O 5REQB 4M8LA 3NH6A 4N18A 4DQUA 4UHJA 3UWMA 1KK0A 2Y05A 3JW8A 5JWOA 4RTMA 4BGVA 4OY3A 1NSFA 3U13A 2E18A 3M6LA 1DBPA 3GFSA 1I3LA 1UANA 3BNWA 1Z75A 1KP9A 1A2KC 1RRVA 5DHQA 1AX9A 3X1XA 2OC4A 4DA0A 1BQ4A 1ZD5A 1V5VA 4RF2A 2PL5A 1CP3A 1RAHA 4HSGA 2VSNA 4JEHA 1TI7A 4BBZA 3CRW1 4D8UA 2GEJA 5CCEA 1SB9A 5CM2Z 3JD2A 4F6LA 1PEAA 2F59A 3OQHA 4AMVA 2W6PA 3W4KA 1T2EA 4GEKA 5ILGA 3EFBA 1RWQA 3ZJTA 5TMBA 3ZQUA 3EWSA 4X66B 4EY3A 1CQIB 3ONEA 5EUBA 2IFTA 3K7EA 5E95A 2QB5A 1OVGA 2EFDB 1LSJA 2ZYVX 3HJRA 1E96A 2R86A 3EGVA 4JUBA 3T7CA 3WSVA 2BUCA 1G7SA 4BO5A 4NESA 4OCZA 1UMBB 3DNMA 3ZDCA 3GLUA 1DJPA 1J8DA 4I50F 5IHXA 5M34A 2J9YB 1QFYA 2HUNA 3T9DA 1EFPA 3I39X 5M04A 1FJ2A 5AUPB 2WT4A 2IPMA 2XB6A 3IR7A 2JI6A 3S5UA 3L1KA 2XUFA 1Y8QA 2H8KA 4M98A 1FMJA 1T9HA 1PK9A 4ESHA 4Y6OA 2J0UA 3KOMA 5T67A 4N65A 3FTEA 2A5DA 2R97A 5U4QA 2H9YA 3W9SA 3NPMA 4EYGA 3VOSA 4FIZA 2XHEA 4PFSA 3BJRA 1PJ6A 1MDBA 3H2SA 4FXOA 4WZZA 1WB6A 1IVSA 2BDEA 3SX2A 4H15A 2ZL6A 3IMKA 4CTMA 3CE9A 3D3EA 3LY7A 1XZKA 2XYVA 5GOZA 2JI4A 4INJA 4KVAA 2NO4A 4E51A 2CXOA 4ZHSA 4E7OA 3S2GA 4TS3A 5C8YB 5CB4A 1YKFA 3CN9A 3MB8A 3GRFA 1WOPA 1E8DA 2OHHA 4LZNA 4XOIA 1LF0A 2C2BA 4OQQA 5FTKA 4J8PA 1KZHA 5HDQA 2GA8A 4ROXA 1C8LA 1XX6A 2OAEA 4U7TB 4HADA 2G25A 1W75A 4AX8A 4URYR 1PGNA 4LJRA 3DCIA 2UU9B 3H2GA 4IS2A 3ZDRA 4WGFA 1M1XB 5E3HA 1KOJA 5JJBA 2V4UA 2FXVA 3ASRA 1ZONA 4Y2YA 5LMCA 2AEMA 1X7ZA 4P3YA 2C0PA 2NADA 1WOOA 2R1TA 3AWDA 4HDSB 4IDNA 3RV4A 4AAYA 5C81A 1DAMA 3HKDB 3D6TB 3P9ZA 3R5JA 4WZBB 2ILTA 1U2DC 4LXTA 2GUGA 4WSOA 1Z9BA 2ZBQA 2VHTA 2O19A 1U8UA 4OO3A 4QULA 4Z7QB 3LXRA 1WDMA 4G5QA 3UPUA 5FO0A 3EXEA 1T91A 5T3UA 5F4MA 1Q7YD 4C1BA 5BYAA 1OH5A 2Q5OA 3OQIA 2EQ5A 4D74A 1NU6A 4DZRA 2M2IA 1O5TA 1Q7TA 4LK3A 1HC7A 2HBZA 4EW2A 3B6MA 1G41A 1MQ9A 2HPHA 3R6KA 3I30X 4YDHB 3V2GA 2B2CA 3TQIA 3PT5A 1DIOB 2Q6IA 5CJPA 1QQ6A 2W6JD 2Z5VA 2VBIA 4X00A 3VPBA 4EY8A 1ESCA 1REQA 3NIFB 2RB4A 1CQJA 4LHZA 3QPBA 5JUWA 1EFRA 2IYZA 5B3JA 1XCPA 4R2XA 1LCIA 5FDFA 1T3ZA 1FIUA 1CUGA 3RV3A 1DG9A 5F98A 4JXZA 4GI2A 2PAFA 4HRAA 2PX8A 3MCAA 2ROQA 3UUEA 2NU9B 3QLJA 3LT5A 2Q7DA 1SHUX 4XLLA 4QFMA 1ACMA 2FQYA 2J9FA 2RHRA 3RVDA 3COJA 4C7OA 4MYSA 1DIRA 1NXPA 2C2GA 3SSMA 4Q6BA 4OKIA 4BJ6A 4BRZA 4R7ZA 2PZKA 2NNLD 4FGKA 1EMDA 4DR7B 4RJLA 2A33A 2FU5C 2R00C 2HDNB 1Z12A 1HF3A 5IFLA 1S2MA 2IEAA 1TTTA 4MLZA 4IG4A 5F1PA 4E2YA 2W98A 1FUEA 5A7HA 3TQCA 3KSAC 1ZW1A 4Q18A 3WRYA 1DPGA 4BGDA 3VUEA 5A0TA 5CLJA 2CD9A 2C29D 1E43A 5F3DA 4B9AA 1E99A 3ZCSA 1OBHA 3PLAE 2WIKA 3MTGA 4KIWA 3EBOA 3AG5A 4EBBA 1EFTA 1KYTA 1NG1A 4PE5B 4EFNA 5M7EA 4UZEA 3M3PA 1X70A 4YDQA 2PH5A 3CWQA 3P0FA 4XN3A 4JT2A 2AC4A 1I5RA 1E5QA 3FBGA 1JEQB 2JBHA 1GN8A 3O38A 2NXCA 3CNQS 2BFDA 5DX1A 1Y6JA 3CUWA 5HUHA 3GCWA 4A8HA 2KWIA 3BYZA 4GZ6A 2NTEA 1LNSA 2CDRA 5G4LA 5K0JA 3DWGA 3SYMA 4DBZA 2M6SA 4YEJA 4MB6A 3FPBA 1C50A 2B21A 4XVRA 1G4UR 5FOUA 3ZD9A 1EJ2A 2PLWA 2HA6A 2ZUTA 4ETMA 4ALIA 5JNLA 2RAVA 2AC2A 2VQ6A 4NYJQ 4AS1A 1UQUA 4H0NA 2R8ZA 1O2DA 2B78A 2C2WA 2GN0A 3V48A 3AFGA 4GFDA 5H82A 3L41A 3N0VA 4PLVA 1NT2A 1GL7A 4Q82A 3SC4A 1OREA 2GZMA 4F8YA 4MPJA 1A9XB 2H1SA 2AMYA 1UM9A 3X1ZA 1F8GA 5FX2A 3CCQB 2IU4A 1SD1A 4MIYA 4XXHA 4GMFA 4HUJA 5BQ5A 1JQ3A 4KACA 3RIEA 4EFMA 1Z63A 1N6PA 2GRAA 2XZDA 4FDLA 1AZWA 1Q6ZA 3IKMB 3PQEA 4EKNB 1AZLA 3ONUA 4KPUB 4GWKA 3X44A 2E4YA 3EB9A 1T9BA 4KUEA 1Q6YA 1A5BB 3R3JA 4PTZA 3KPJA 3RYIA 4B6FA 3AINA 2FJUA 1UXIA 1I36A 2WFZA 2WF5A 4JXXA 3UJ6A 3IXMA 3VPGA 1QTIA 1E0KA 2VF5X 2PZAA 2VHCA 4Y1RB 3VYSB 3LW7A 3QBVA 3EGDB 3LQYA 5ALXA 4A1OA 1YFLA 3GA5A 5K8VA 221PA 1ZD2P 2NAPA 2QVZX 3AYXB 1LY1A 3QX8A 3ENWA 4QHSA 4GHWA 4M0FA 4DB2A 2XEXA 1C81A 4PG4A 1H65A 1VP3A 4B7AA 3R3WA 4XWOA 3X43A 1E8MA 1OF1A 2FWMX 5AXBA 3PU6A 2J9XB 4HMQA 3OUZA 4XOUA 5C8XA 1FVHA 4HTAA 4B5LA 1ORIA 1U7XA 1OX6A 4OP3A 4RENA 2AD5A 1OZGA 2NYUA 3VNBA 1ADCA 2ORED 4E3WA 1BSVA 2D1FA 4ZN6A 3SE0A 3HP4A 3WK5A 2EQBA 2JJMA 3KE9A 4P4SA 4B0OA 1A88A 2TMGA 1JKFA 4BNHA 4EZIA 1VC2A 4YI5A 3WLLA 4WT7A 3JQ6A 3KQTA 2COUA 3ASTA 3N6RA 4H6XA 1O87A 4ZT6A 4M0DA 2G8LA 2Q62A 3GFVA 4QAQA 3HHPA 4LJAA 3AL2A 3L6BA 4IJMA 1AC5A 1Z5NA 5FA6A 3S1LA 2C4VA 3PHHA 3RABA 2XADA 4X06A 4G67A 3KHUA 4AJ1A 3HABA 1WQ1R 4PTYA 3QUBA 3DO8A 4EITA 3IBCA 4HVCA 3ZE2B 1B74A 2CXRA 1J22A 2G83A 4C03A 2OCLA 1KDTA 2ZWAA 1GKLA 3C85A 3S28A 4Z3KA 1YQQA 2X0RA 1U0JA 2OHJA 1EINA 2J5QA 5JQGF 1J8YF 1X0XA 3L7JA 4ZQHA 2ZANA 1JH8A 2R7KA 1J42A 2P65A 2OBFA 3PDJA 1BWQA 1D5WA 5BSTA 1YJWB 1NVEA 1YS4A 3A58B 2H63A 4F9EA 3CKLA 3CPHA 3PVDA 1G6KA 4ZPJA 1GIAA 1ETHA 2OR3A 1E2GA 4XQ0A 1JZTA 2NQTA 4Z9XA 3WLFA 4E07A 3FUUA 4TTTS 2C4TA 4C0QC 4KRYA 4RWEA 4UNSA 2HIGA 3DF7A 2VUSA 1K6MA 2FXIA 3BRWA 3IHWA 2WG2A 3IT2A 5EWLB 1MGPA 1NR5A 2SKCA 3LT0A 2P9JA 2C4MA 1IN6A 1R37A 1RKVA 2I1LA 1XUOA 1KI6A 2GJ9A 1JT9A 1MBZA 3IVCA 3O21A 3Q6NA 4JBLA 3LK7A 4HZUA 4Y2UA 1Y4DE 2QRVA 2WIJA 3HXOA 1E9SA 2CUTA 4ZT7A 2BH2A 4CF6A 2HQ1A 3CBQA 2VDKB 3DV9A 4YUVA 3P0HA 1RCUA 1HGXA 3ZJUA 1R0WA 4NOMA 3TIIA 1PJ8A 1AKEA 3C0KA 4XTRA 3DPIA 2WM2A 5I8ZA 2QMYA 1ZUHA 4IVRA 2BFEB 1S5PA 5FFMA 4ZGBA 5ALQA 3KSZO 1QFSA 4WINA 5AHWA 3ZEIA 3G0HA 1VMEA 2M1ZA 3B13B 2CFTA 3G9ZA 1IEVA 1VHQA 4YPFA 4BAZA 1YV9A 4BQSA 4DM4A 3TBFA 1L9KA 2I5PO 1AZSC 1VI6A 3ZDQA 3OW2B 3EULA 3FCOA 4G6ZA 3PGLA 1A50B 4UUBA 1WUHS 1OW3B 3K6JA 1HOXA 3OECA 1QIIA 4EKIA 5D1NA 1PKVA 2XSZA 2C8JA 5T4HA 1M2OA 1DO8A 3AUSA 2DH6A 4JP5A 1KYVA 2DLDA 2P30A 3EIQA 3TRKA 3WIEA 2FEXA 2YVAA 1RQXA 1NY5A 2A9JA 3HBNA 3LKVA 1L4GA 2W7TA 3X1YA 1B00A 2B82A 3L7IA 4X85A 3DMGA 1IZ9A 4BO4A 1T5EA 1O6CA 1OLUA 1SXHA 4IMPA 1I4LD 3H3JA 3GRAA 2JATA 4C88A 5KTOA 2A1IA 3OFSA 5T8KA 3FWNA 4MP3A 4BNWA 5AFSA 1UUFA 1WCYA 5D86A 2P7IA 4XYEA 3PPIA 1VLVA 3IDSA 2IY9A 4OOVA 1QOQB 3AI2A 1EP1B 1O89A 1PFGA 1YGYA 2QAGC 1Q84A 2DY0A 3Q6QA 3S70A 3LTNC 1V16A 4QJ5A 2BVNA 1YIJB 4G1CA 4KFCA 4U2CA 4X8MA 4YJ2F 4RH3A 1JDVA 3M49A 4JENA 1F38A 4II3A 1ZK0A 3LQEA 2B8JA 2X1MA 4DMKA 5H4HA 3L06A 4H16A 1C1HA 4D9KA 2VK2A 3DBLB 4MVJA 4MWEA 2QRLA 4UOQA 3E3LA 4CV3A 2LCFA 3IOBA 1KL7A 4ZQIA 4JYCA 2QVLA 2Z8ZA 1VE5A 4FFMA 4AZ0A 1RE0A 3PCTA 2Y1OA 3RASA 1B23P 3ZBUA 2NZXA 2DEUA 4DCNA 5BSGA 2BGJA 1UJ5A 2YXDA 2DSTA 3D0RA 2J41A 4XB2A 2QMZA 4M60A 3MFQA 2G7MC 5B3AA 1N07A 1RLMA 3SX4A 3VOAA 1O58A 1KPGA 4AB1A 3E9ZA 2WWYA 3MAGA 3VPAA 3MGGA 1EEHA 2E1PA 5T4EA 1A8SA 2F00A 1SUFA 3ZV4A 1FTQA 1M6VA 2A0KA 1NRIA 3AF6A 1T1JA 1HK7A 1I6WA 1XDWA 2BLLA 2ZSEA 1HE4A 4EW1A 4TYMA 3HCEA 4R2WA 2WFMA 1DBWA 3GA7A 5DNEA 1C4WA 1VL8A 3KR9A 4UOZA 2PZFA 1CPYA 2QRUA 2QTMA 3JVEA 2R1VA 1QHHA 2I54A 1KD1D 5FUBA 3QNMA 7AT1A 5KNCD 2D7JA 2D2FA 3A04A 1N9GB 1J6UA 4MOWA 2ZAMA 4RZUA 3IP5A 5BPFA 1IVNA 2QMHA 3OM1A 3HBFA 1TVCA 1DKQA 5E7JA 5ECGC 3RS9A 4ENUA 4EO7A 4KXWA 4KQ9A 1EU1A 2C9DA 4HQKA 3A35A 3VA7A 2BL4A 2XQFA 3C97A 3UFXB 5L40A 3H1PA 1IJEA 1LDEA 2MJLA 4FX5A 1XXLA 1FUUA 3DUWA 4B3MB 3I0NA 3NNSA 1JJBA 3UO8B 4ENPA 1DAPA 1YA6A 5JH7F 5LVAA 3L8CA 2ZT8A 2CYCA 2DPGA 4ZO4A 1UP7A 4C9BA 3PHCA 4NSNA 2VWHA 3GLVA 2HK8A 3JVIA 3I04A 3KALA 3W7BA 2JAPA 3FI0A 4ZCTA 2F17A 2ZAYA 3A05A 1GRVA 4MUXA 5EIBC 3V97A 4L9AA 5HCUA 2N0SA 1XYVA 3NJ4A 3QVGA 2CRVA 2C2HA 4XZ3A 3N5CA 5JYBA 3QK7A 4N03A 1NTRA 3DVSX 3GPDG 2NOAA 3HBLA 4BLOA 4KREA 1OYWA 4ZJYA 4Z4HA 3O95A 1M76A 1NVUQ 3D81A 1E64A 3GDGA 5EE5B 1UBRS 4DTIA 1L7AA 3EQ9A 1KO7A 5I7WA 1I8TA 4XKWA 3WBKA 1EGAA 2ACWA 3DDSA 1WDWB 2QW1A 3P9NA 3Q1KA 2I78A 3Q7SA 1R4AA 3OTGA 4B8ZA 4XGQA 3DS8A 3QXJA 4AO6A 5EZYA 6CHYA 2QUIA 4NCBA 4C3OB 3INTA 4ZZ1A 3F7NA 3W9UA 3H19A 4N49A 4CCYA 5FAXA 5JJ5A 5K3CA 3DZDA 3QIAA 1HA3A 5FPPA 1SWWA 3FFXA 2GM3A 1JSRA 1P29A 1HQDA 4JHXA 2PQMA 2Z2IA 3GEBA 4MRRA 1G8PA 4PICA 5AQ1A 2ZQZA 4JB3A 3JALA 3NT2A 5G3YA 1AKRA 3GUHA 1U2GC 2G7ZA 1VM6A 3IEPA 3LWBA 5CLFA 1XKXA 5LU8A 1K5DA 1OB0A 3WGZA 4P0TA 4D4LA 5BV8A 2XXAA 4KGZA 4OHRA 2GAAA 2JGFA 2BHRA 2JFQA 3LE8A 2AI3A 1IBLB 4KX5A 3S2IA 2X58A 4NU0A 3TIVA 3TQRA 1MRSA 1SO8A 3O94A 3WWZA 1R9MA 1CUAA 4BP9A 3TSWA 3NHRA 1MPXA 1U2TA 3PNMA 2W6NA 4TV9A 5IZCA 1PTJA 4Y6RA 1L1FA 3AEUA 4RKYA 2GN2A 4CG0A 1W5FA 3HU5A 1AZTA 1LW7A 3FNHA 3C7DB 3I1YA 3F8WA 2OBSA 4RESA 1L5KA 1QYDA 3SZUA 2PE5A 3BXHA 5TB5A 4XR6A 4GKVA 4QEZA 2QRKA 4RO0A 1P33A 2F9FA 4WDRA 3IFSA 4HXFB 3OX3A 2I4NA 1HLGA 5F77A 4CG2A 3PGMA 2YWFA 5JI2E 2PKQO 2V9CA 3IKVA 4OQNA 1R4NB 2Y4NA 2RH8A 1N5MA 5CLQA 1DX4A 4QQRA 1RXCA 1T2FA 3I6QA 1XU7A 2ZJYA 5B1IA 4KWCA 3KTOA 5LP6A 1TA4A 2IXEA 2HJVA 4RADA 1YDWA 4J1TC 1ISIA 1T4DA 2HLDD 3DLCA 2OV6A 2P2SA 1Y1PA 2L17A 2Q0XA 4TL9A 3LBAA 4UHDA 3W2GA 1K6IA 5FWDA 3GDWA 4O25A 7YASA 4QREA 5TARA 1LBHA 1USUA 1SBZA 1ZJZA 4RZQA 1R6UA 1N6RA 2QZJA 3MRXA 5IABA 1YB4A 3PNOA 3QLEA 4LC9A 1SQFA 2FW6A 4NBLA 1NW7A 3KDAA 1NRJB 2O8BA 4WERA 4R3NA 4QBTA 4OPVA 1ECPA 5ES4B 1QUFA 4AJ4A 4CLXA 4L8JA 1OFIA 4DLVA 2JFGA 3T5PA 3OQOA 1CX9B 4C30A 4I2VA 2C1EA 4AJIA 4BZXA 4L4XA 2HA7A 1BPLA 1T1EA 4D45A 3CZ5A 4WLFA 4DR2B 2C99A 2JI7A 3C14C 4KR0A 3HU3A 1G5HA 4PX5A 1WOYA 3X1DA 2UUCB 4LZZA 4K8RB 4XGIA 2VYNA 4DW8A 2MOKA 3DSRA 4FGSA 5AM2A 2FUEA 3BDVA 5A06A 1E7WA 2CHQA 2D1YA 2LPMA 3OE7D 3D7KA 3EG5A 3OOYA 2AJDA 4FI3C 3N1UA 5CB0A 1O0CA 3BY1A 4KPYA 3BD9A 3TTXA 4E13A 1IUPA 3CF6R 5GJVC 3ZK9A 3S55A 2RMKA 1VYUA 2JJ1D 2IV7A 2NSYA 2VHEA 3ZKWB 4CT0A 2W6ZA 3IPLA 4P5PA 4XTCS 5L3ZA 3CC4B 2OWEA 3VR6D 5IXSA 3N2KA 3RLFA 4DQXA 3R77A 2XGJA 1U90A 3NHKA 4MQEB 3A32A 1L7QA 3O90A 2IBMA 2PZBA 4J0GA 4M4SA 3KM0A 2YYZA 3EXG2 3BE4A 3QOXA 2QP4A 1GEEA 3N7TA 3R24A 4Z0NA 3AYZB 5AJWA 3CLSC 4YREA 2N47A 4MB2A 3UYLA 4AMYA 3HJCA 1NUUA 1VKRA 2BUAA 4O2AB 4AWAA 2P91A 3C6MA 4ZOAA 1FP2A 4UUAA 4U7HA 5A9SB 3I45A 5IKPA 3VTFA 4J43A 2C9CA 5LUAA 2AXEA 4TX1A 1GPAA 1N2OA 3D3NA 1JQKA 1IATA 5BQ3A 1E3JA 1NJ1A 2JVJA 3W3AA 1U5CA 3ZNNA 1KO1A 6ADHA 2AW3A 4G01B 1UMKA 3FMVA 4C4PA 1T3TA 3H2YA 4X07A 2FX2A 2O2XA 4FZ5A 3UW1A 2JJ2A 1YB5A 4IVQA 3E1SA 4XRRA 4IP0A 5GGYA 2NP7A 1T6ZA 2HIHA 1DIAA 2YWXA 3KCQA 3Q7PA 2W6OA 4CGZA 3AP1A 3HNPA 1RM0A 3KLOA 4KUGA 2GAFA 4MVJE 1JDUA 4ND8A 4GVPA 4PY2A 3WQRA 3PNLA 3OIWA 4HAOA 4URZR 3TRHA 3RM3A 2CWDA 3A70A 4JDPA 5JSUA 1V9CA 4PYLA 2Q2NA 3T94A 2HT1A 1F6WA 2P69A 3MC1A 4WCFC 3EIEA 3ZPNA 4JNCA 4MWDA 2JFZA 1N0WA 4ZOLB 4YXFA 2FK7A 4R31A 4DDKA 1YZTA 1PFKA 1P2VA 3NHSA 1BXZA 3TLJA 3ZIAD 1QAMA 5H81A 2PUVA 1AKUA 3ZHYA 1PNVA 1Q2XA 1G4HA 3L6DA 3QVKA 5TC4A 4Z7JA 2YZ7A 2BFCB 2CHVA 1S9DA 4UAGA 1BLIA 3SQDA 4Q3DA 3FUTA 3OU7A 1OIWA 4O4JB 3G0CA 2QJWA 3OPNA 3QE4A 4EYSA 2RGRA 1F3LA 1JHYA 2WTUA 1QCYA 1KQGA 4DVJA 1Y1LA 3CRZA 3P0JA 5C8ZA 1I1QB 4GWGA 1SELA 2W9XA 3M9LA 2J6IA 2ZRGA 4AIIA 5G4KA 3NMUF 3MGCA 3CX8A 1KJWA 1M2NA 5I7SA 5EFZA 3EK2A 1HLPA 3KXDA 2VQSA 1I8DA 1CR6A 1JPNA 4O2LA 3IT0A 3OZFA 4E31A 3DMYA 2Z5LA 2W70A 3UUWA 4PCAA 4DRZA 5BWLA 1QE3A 2OV2A 2H7YA 4NXNB 1E7RA 1B8OA 3GLHA 3CLUD 2B98A 3GJ7A 2AT1A 5CT8A 1OC4A 1M2WA 2R25B 4D3ZA 4HY3A 4CIAA 4HMOA 2QQGA 1EQ2A 1U5BA 3KYDA 5CAEB 4YQZA 3F7OA 5CGQB 2FZLA 4DV2B 5JPDA 3FB4A 1VE1A 4Q1BA 5JISA 4WOJA 4XUDA 1Z5OA 4YEDA 5L6MB 3RUIA 1RWOA 4AN1A 5HPYB 2HNKA 2ACEA 3EPLA 5I9LA 2G76A 1P4JA 1N6KA 4LOHA 4MMYB 1PS9A 3QHQA 2GBCA 3MUOA 3Q6MA 3THSA 5HS4A 4FM9A 2IXBA 5PGMA 1UP4A 3ZLJA 3UHAA 1PS8A 2H1OA 1VIDA 3TTUA 2CHFA 1A8HA 2H6EA 5CW2A 4EJ0A 3P9SA 2QBYB 2I1QA 3OKPA 4R84A 4DCGA 1R4MB 5K8UA 4FWTA 4RVOA 2BBOA 1NMQA 1SG6A 1PQUA 2UYYA 1JG1A 4RK5A 5CNJA 1YI2B 1F2UA 1MA3A 1YIOA 4N0QA 3TQOA 3V55A 3MPUA 2X40A 3QENA 4WZTA 3DEYX 3G2OA 3Q7EA 1ZQ1A 1TQ8A 1FBTA 1QS0B 4RHEA 1NW3A 2OAGA 4R9UC 1P6XA 1D9XA 5CVTA 1NF9A 2D3NA 4HLCA 2F43A 2ZYRA 4GLLA 3RJMA 2EEZA 1T1IA 5LYJB 4HDCA 2YVQA 3QFCA 3CXCB 2NIPA 3I55B 3ANMA 3K1YA 3KOUA 3S2EA 4BMCA 4BQNA 4RPGA 7REQA 2V6MA 3U80A 1SXJA 5EIXA 1GPMA 1E9RA 1C3EA 2YYYA 1IK6A 1QHSA 3KZNA 2DP4E 3L8EA 3LAWA 5I47A 5KJ1A 5E2IA 4JMQA 3UV3A 2X4LA 4IDGA 2IYLD 1OGJA 3FGPA 4WCDA 4INPA 2H8GA 2BTQB 4L15A 3RODA 2X3YA 1MC4A 4PF1A 5LQSA 3LCMA 3W1WA 3RU3A 3ML1A 1E5LA 4NENB 4EBFA 1D2NA 2VTBA 5ELXA 3UK7A 2VP4A 3DEFA 3GOQA 5G0TA 4Z4VA 1D0SA 2FPKA 1EUYA 4K2AA 3JWGA 2WPDD 4L73A 4Q16A 1THTA 5C4GB 3SOPA 4XWWA 1PAUA 1AHPA 3OM8A 2MIIA 1SEPA 1Z7GA 5EJ4A 1CLUA 2BI7A 6YASA 1L1RA 1GSAA 4E2ZA 2ZZMA 4DFDA 1LC0A 5LDHA 2EWWA 1ZIDA 1JAYA 3DBIA 5K3FB 3AVYA 3U37A 4D9MA 5JDCA 4ACBA 5EE3A 4DSTA 5LA6A 2CKDA 3S68A 2CYBA 1XNRB 4AQ7A 4OFWA 5BRNA 3TIXB 2G88A 2KSQA 2HGSA 1WD5A 5HXAA 3W5UA 4P5EA 1Y3DE 5CUQA 1ISJA 3NWEA 4M0EA 1JXOA 2WOOA 4OQFA 3TBHA 3EEOA 4JP8A 1WAMA 5IJ0A 1E2JA 5HSGA 4U9IS 5JSZA 2H1WA 1MXFA 3M3DA 3V8EA 2VBFA 2WFLA 4AZSA 3THXB 1E4EA 1POXA 3WYNA 1JR3A 2C94A 2CNKA 3PNBA 1DAKA 1YCDA 2XOXA 2OHFA 2QTZA 5F9FA 1IM8A 4TTSA 3QITA 5JXWA 3U26A 4JT4A 2A57A 4UAVA 5ALEA 4DMHA 3P32A 1R00A 2I99A 2LIVA 2VUIB 3QUSA 4LDJA 5IC6A 4DGQA 3FPLA 4DC9A 2QM8A 3FDXA 4G84A 1HR0B 4XPIA 4IJ5A 4OOEA 4I9GA 3UYKA 2X8AA 2BGWA 1XAIA 3PEUA 3BM5A 4FOSA 1I1NA 3N8IA 3U7QB 3VKVA 1M90D 4ZI7A 4P86A 4ARAA 4C3UA 4NXMB 2D1RA 4FGLA 3AVQA 1JEEA 4A92A 3A1TA 4D9FA 2CF4A 2A94A 1Q1GA 4OHMA 4PAGA 1L6IA 1M8GA 3H1AA 3WGIA 3BCRA 4GKAA 1T2UA 2WB4A 4OGWA 2Y0EA 3HYCA 4B79A 3NHYA 3RU2A 1EK1A 3GNTA 3N76A 3WIBA 3VR4A 3TZBA 3K32A 1O94C 2Q99A 4XYGA 1VQNB 1MVNA 5BMOA 1QVFB 3GIWA 3ED5A 1XC7A 2C9OA 1KMHA 3F3KA 1R2QA 4A73A 4G0VA 1AHIA 1AOXA 5AVKA 2ZCVA 4Q5IA 5C4IA 4GAEA 1TDJA 3ICEA 5FBLB 3T5TA 1RLTA 4MICA 4M1WA 3FPKA 3MXOA 3NANA 1MO4A 2OCBA 4A91A 5JCJA 1KBZA 4Z4YA 2IYUA 3DZIA 4JFAA 3TR0A 4IPTA 3NEJA 4N1AA 5DBGA 2ZTHA 1I9CA 4PSVA 1EUQA 3ETNA 1XU4A 1JIVA 1CIJA 1OLXA 1I18A 1YRWA 3D8BA 2F3PA 1QIMA 4RYLA 3DTNA 1TC1A 4K0KB 2IY7A 4PSKA 4DIUA 5IM4F 1KC1A 1PHPA 1U0HC 1VQ5B 5H5JA 3P4YA 3PXEA 4L7QA 1YTUA 4UC0A 1GCUA 2CLSA 2HI0A 4LY6A 3HCWA 3R7NA 4HDOB 2JFNA 3WMGA 2XWQA 3G5UA 5F2NA 1L4EA 1N8KA 3UJAA 1TZJA 3AJDA 1E9FA 4HAZA 4I5IA 1S8NA 1DBSA 1P4AA 3HCOA 3W2EA 3QVMA 3P7MA 4N4AA 4TXNA 5DH9A 5E6RB 5FYQA 4DWWA 3MUFA 1DPFA 3NAGA 4S1VA 3VXKA 2JGAA 2I9PA 4RM0A 2YW2A 2V96A 1TEVA 2IDJA 2P62A 3DBVO 4D46A 4DV1B 4D99A 1TEXA 2A9FA 2ZP1A 5KHAA 3L0SA 4IV8A 3WKAA 3REQA 1N25A 3SC2A 2C4KA 2OK8A 2HF7A 3HCCA 1RP7A 1W5AA 5KNDH 3O8NA 1BZYA 1P2UA 4ASUD 5AI5A 5A88A 1L8QA 1E2NA 3D2BA 3ZZMA 1CIPA 3HLYA 3M6XA 3NCTA 5DNAA 2OHOA 5FD8A 4MI3A 1VXRA 3O6VA 4LBVA 3NW9A 3P0RA 3C1UA 3FA2A 1QUEA 1EFUA 1JQDA 4QTTB 4RW0A 2GMWA 3IESA 3B7GA 4P7KA 3UH1A 3UA3A 5KNBD 1GLGA 1ZKMA 2ECQA 3R6TA 4RA9A 4GR9A 2ZXEA 3LDFA 4Q4AA 3W5JA 5HRAA 4TYYA 4E0FA 1USGA 1WU7A 3FB1A 3OZRA 3G79A 2YY7A 3QFFA 1QB8A 2F55A 4JLOA 2O5CA 5HWSA 1V3UA 3WNBA 3EZGA 1YFZA 4EB8A 1XT6A 2WYIA 2YWGA 2G1JA 4ZOQI 1M67A 3OT5A 2O2HA 1U31A 1KVUA 2OYRA 2R6FA 3DVAB 2NLOA 2ZRMA 1C2YA 1Z16A 3O8QB 4GF5A 1UJMA 4HN9A 2K2WA 5A5GA 4RSMA 3SJ7A 1ZH2A 1YKSA 3KZ1E 1RPJA 4G0MA 5FBRB 4BS9A 4G0YA 4GR4A 3IVRA 2YUIA 1ZITA 4MW0A 2HH9A 2W22A 3BFKA 1H2BA 1L5HA 3DYIA 1VSUA 3E6AA 4ETIA 5A89A 3E81A 1QE0A 3L5KA 5JAZA 1DZIA 4C5BA 2EKDA 4ZU3A 5IYWA 1A9ZA 1JS1X 4NJMB 2ZRJA 3GLHE 2X8KA 1WVIA 3IAXA 3GHHA 2OHXA 4K05A 4IGKA 2XWJI 1VG9B 2W37A 3TUJC 1IXYA 1SIUA 3ASZA 2D74A 3H4IA 2P9FA 4LCJA 4ND6A 4PPNA 4W7SA 1YRQA 1PR6A 4G0PA 4Y0VA 5BXYA 1V4BA 4X1OA 1Y3IA 1G5IA 4HMPA 2YNMA 1QGOA 2FWAA 4U0KA 3RTGA 4R3UC 4IICA 3RVQA 5AW2A 2HO5A 3AERA 3TVTA 2WTAA 3K73O 1TL7C 1P1JA 2FWIA 4L2IB 2OMKA 2JBAB 1ZU4A 3CLKA 1SXQA 1PFQA 5FCDA 3TRDA 3QU7A 4OK3A 4QASA 4MAAA 3JVUA 1V4NA 4KMMA 2W2NA 1FMLA 1VZ2A 2OGUA 3KP1A 4IWNA 3CVJA 5KIAA 4OHKA 2IE0A 1Z88A 3UVEA 5GVRA 1F8XA 4BZQA 3RFXA 1GU0A 3DOCA 3MCTA 3B3JA 1WDKA 1JGTA 1DAGA 2RKOA 2YCBA 4A8JC 2Q45A 5EYPA 3TSAA 1AO0A 4HE6A 1YUBA 2FMFA 3A6FA 4N5IX 4LWPA 2HMSA 2XIQA 1DCTA 1A98A 1WB5A 3LQKA 4DUGA 1NXVA 1YR8A 4W5HA 3UTCA 1JLLB 3TTYA 2CBGA 3QWIA 1QVAA 3STYA 1XRJA 3LGAA 4EUHA 5EIOA 3QXCA 3AFHA 1W2GA 1ZI9A 1KJYA 1H5QA 2REOA 1AXGA 2WSBA 3QFSA 3WL3A 3G1WA 1PS0A 4CN8A 4EG6A 2J4FA 1CETA 2JGIA 2FMIA 1UAAA 1TIKA 1A9YA 2EFYA 5C5CA 2NO6A 1TJ3A 1GRCA 3RWOA 2D2EA 4IIEA 5KOJA 4F6CA 5JSYA 1HDYA 5TGDA 1Z34A 1NLUA 4YBZA 5DTIA 2WWVD 5CB4F 1XQXA 3V34A 1UQRA 3CF0A 3VI4B 2XUAA 3NFRA 1A4RA 4B47A 3DE3X 3QPUA 3H04A 2V8OA 1Y6FA 3N28A 2XUIA 3ROFA 3CINA 1M6WA 5FWAA 1Y9EA 2JFOA 5GV7A 1D09A 2OBYA 1NVMB 4I8IA 4A36A 1H23A 4JS0A 4ID9A 3B9RA 3H94A 1RMTA 1G3QA 1X14A 3FAKA 3O73A 4CKBB 4F60A 1XDUA 3RROA 4CMIB 3Q3EA 2NM0A 2VAXA 4FKZA 1MPTA 1N1MA 3OTIA 3REFA 4RTOA 4GQBA 4JLBA 1DOHA 3DZHA 2OP1A 4LUCA 4PLPA 3EVDA 1Z15A 4YCLA 3NM4A 3UKOA 1H2YA 2UXBB 4WBSA 4BWYA 4C29A 2Z8YA 3HVHA 4QBGB 5E4FA 3R41A 2QEQA 4DPKA 5KOHB 3OJFA 2JZOA 3DFIA 3IAFA 3DONA 4O5AA 3OIGA 1BXGB 2ODAA 1ZVKA 3HEAA 1DBIA 1MP0A 3DQPA 3JTEA 5T64A 2I1WA 4ZZ2A 1DFIA 3HUUA 1CY7A 3JD3A 3SZ3A 1RCTE 4TKVA 4JQCA 1IHYA 1AKMA 3L04A 3PD7A 1KYYA 4F56A 2VP6A 4IMRA 3B36A 1P8JA 4J29A 4TL7A 4YRSA 2VBGA 5I9IA 3I8SA 3WO1A 3AEQB 1D2CA 2PKWA 2JC3A 1J2TA 4UEKA 2ZUDA 3BXFA 2PX0A 2B1GA 2EP7A 2Q8PA 3C1TA 1SK8A 3CLVA 4R9VA 2VPZA 4FHFA 3LQQA 3KT3A 4IR7A 4YAOA 1QZZA 3KPWA 3IC5A 1OXUA 3DAOA 2E4WA 2P2CA 4G85A 5CHYA 5EUMA 5K6AA 3A4VA 4MQMA 5AW0A 4KSYA 4B32A 1H6AA 3KZKA 4MW9A 4UM9D 1KEUA 9ATCA 5I9NA 1E5VA 2ZG6A 1MVOA 2EG5A 2J3DA 5EPUA 1E1MA 2GZHA 2AL7A 2ONCA 3C7AA 5ECWA 3EJ6A 3PQFA 5LBUA 3S8MA 1QIHA 1K63A 4UCFA 5TMDA 4V1CA 1GFSA 3IAS6 3UJHA 3DEKA 4UCWA 1E1QA 1JHRA 1XLUA 2HPAA 4UDYX 1NZJA 4RMJA 3SAJA 1S2OA 2PJUA 3SLNA 4IKOA 4I1IA 1B42A 1Z6AA 3HWWA 3FTQA 2GJPA 2ETVA 4WKGA 1QFJA 1UBKS 2C82A 1FBNA 4ZO9A 5EWMA 4MRMA 5IF3A 4EGSA 1OJLA 1DKMA 3HHEA 5EFOA 4KTTE 4MCAA 1K6XA 1U94A 4TS1A 4UHBA 4P54A 1KORA 5EINA 2VAMA 3NGLA 3ER9A 3MNFA 4YV0A 3QSYA 2W2KA 1DFGA 1N6IA 2AG6A 3DT6A 1SVIA 3L1UA 4INAA 5D5PA 5AVJA 1XRQA 4XVCA 1KWGA 4PXYA 3QLUA 4OYRA 1H1LB 2IU0A 2BCEA 5AJYA 1N6NA 3UOWA 2IT1A 2NSJA 1L5FA 1Z3IX 2LDBA 5K0CA 2YZNA 5KI6A 4EG0A 3Q8XB 2B6HA 3WLQA 3E3MA 2HRDA 2WZQA 4LVOA 3VNUA 4BE9A 4B4OA 1GXSB 4BN4A 4N01A 1U9YA 2P6NA 2BFFB 2I29A 3C5CA 5A9TA 2L82A 2PT5A 3PJRA 1EKXA 3NP9A 3GJTA 1UZLA 1V95A 3QOWA 3UKDA 4JV5B 4FR2A 1KFKB 4J07A 3B1JA 4U7FA 3ZWYA 1DUVG 1CNFA 4GLBA 1K8AD 2JARA 1N9ZA 3FGNA 4H6WA 4MQLA 5JCOA 3TPFA 1UAGA 4PO1A 3NJ8A 5BOSA 3DR3A 3OKFA 3IL2A 4PVDA 2GAOA 4X3CA 1Z4JA 5TVKA 5L9AA 5JEDA 1ZBQA 1U2RA 4CF7A 1TC2A 2VHVA 5ALLA 2WLTA 1ABFA 4GOKA 1E7YA 3PFFA 3OT1B 5JTTA 1G8YA 1MX5A 4RDHA 3B7PA 1KI4A 3QMVA 4X1IB 5F3WB 3C3AA 3TSZA 2CFIA 2A6PA 3G8YA 2CE2X 2WV9A 2Y1GA 3G0BA 4L5YA 5CVEA 5AT1A 4KOEC 4C0SA 4YRGA 5BN4A 5ICEA 3C24A 5LSAA 4LY3A 3PPYA 1W93A 3D7NA 1Q0RA 2B2NA 3H65A 2COKA 4NEGA 3TGWA 3KHKA 4JFRA 4QFCA 4GKJB 2PX5A 3GLRA 1SUBA 3JQGA 1IHMA 3Q88A 1OI3A 3D6HA 2NSHA 3BGIA 4MP8A 1IY0A 2EP5A 4ZALA 2ZSDA 3X1MA 2E4VA 5BVHB 1GDDA 3CLRC 4YDSA 3WNQA 3ZVMA 3CUTA 5I48A 2PSJA 4L5CA 1T3HA 1MB3A 1HDRA 4Y6LA 2JW5A 5HE9A 3HP1A 4RF4A 4ALMA 4XFKA 1NDUA 1C7JA 2FMTA 1OH6A 1GDHA 1GUAA 2K2QB 4WI1A 3SVLA 3JQBC 3KKEA 2J4DA 1T4GA 4Z4SA 4IUYA 2IEZA 2Q1WA 4XCQA 4YCJA 1RJWA 2PNJA 4BNJA 4TQ9A 2YOHA 4DEYA 3OH8A 4M3NA 1TPYA 2XUHA 3P52A 3F73A 1C4XA 4BLSA 1H0SA 2AJCA 1II0A 4PRZA 5EC8A 2XT9A 3P2IA 3CR8A 3R20A 4DMMA 4Z54A 2BHSA 5JE8A 3U3KA 5C7LO 5FBKA 1T2AA 1EFCA 3EHEA 3WVNA 5DSXA 3MXTA 2F64A 2H2GA 1C8VB 3S2YA 1OXMA 4LC1A 1ZLXA 1N3YA 3PWSA 1V3VA 2V7VA 4S3MA 5CX1A 4Z4CA 1XKLA 4W5TA 5TR9A 4EHKA 3PK0A 4YJGA 4AZ3A 1HG1A 3A4YA 1BW9A 3DTVA 2ZJZA 3KJGA 2WHPA 4H3HB 2EW8A 2E9SA 5FWNA 3DB1A 1NWCA 4QFDA 3NWBA 1O4WA 3W5AA 4FSXA 1UD2A 2BV3A 4A0FA 3L4JA 1KK3A 1KQNA 3RT7A 3W8NA 2Z30A 1FX0B 1GP2A 3AMVA 1N4DA 2JFHA 2ZYSA 1CRQA 3PHBE 4K9PA 5EA2A 5DCWA 5YASA 2WJYA 2O8CA 2ATEA 2FP4B 3NC0C 5IJXA 1BX3A 4K9NA 5KSWB 1K3UB 3SNHA 3F49S 2BF7A 1XROA 2QYHA 2HQBA 3CUVA 2RHTA 3RYHB 3Q85A 1HE8B 1XR3A 1MVLA 1KFCB 1PSWA 4GPAA 4NFLA 1R8SA 4BEVA 2MYTA 2GCGA 3RTCA 5JC1A 2NV4A 2VNKA 3CUEF 2WILA 5H1YA 1E6CA 2ID9A 2W43A 1UBOS 2R7NA 2VJPA 2XMSA 1TMOA 3OFJA 1BOFA 5LB4A 3V1LA 4X6LA 2HWYA 3A9TA 3S40A 4Q7JB 2B9EA 2NZJA 1U8XX 3BB3A 2CVQA 4R69A 5EERA 2PPLA 1MAAA 4J3FA 3JASB 3OSZA 4MQ5A 1PUXA 5JZMA 2KMLA 4KRGA 2B5WA 3I2YX 1QRAA 2FSSA 4LZJA 1HH4A 1JU9A 1YO6A 2QRMA 4P81A 2ZJ3A 5COAA 1IJBA 1H22A 4HBZA 5IK2D 3S99A 3I23A 2AOTB 4F2HA 2QUBA 1Q0QA 1JMKC 2RHJA 4WE3A 4XWTA 3EUEA 3RRJA 1A7UA 1G5TA 1MO2A 4FYMA 2LCIA 3MLBA 3BHIA 4O6VA 4HTFB 5T6BA 5DDIP 1H3FA 5MHTA 2R79A 3PC4A 1QH8B 4H6PA 3U4CA 4CIYA 2IODA 4G0QA 5A05A 2HEGA 2X4IA 4PC3A 1HQCA 3N70A 3KQVA 5EIBD 4X41A 3ZCVA 4R4JA 2C9ZA 1YZQA 1NRKA 4E5PA 1VI5A 4KR2A 1SUIA 4AN4A 2FP3A 1G3IA 1DADA 4IIJA 1YBHA 4V0QA 3WBJA 1U0TA 3RVPA 2V6GA 1J0XO 1D5CA 2GKOA 2X8WA 4ZT3A 1X1SA 2O2CA 2H5IA 5A3JA 3UGJA 5K0SA 2YFKA 1XLTC 2VC2B 2PUWA 1SD2A 1V47A 2EC5A 2IEGA 1QQ5A 1R6TA 3HY6A 2BM0A 1IN4A 2YWHA 2YS7A 5KBYA 1QF6A 4RX1A 4ZOEA 4QWWA 1U81A 4FE3A 1QC5A 2ZYDA 4OVKA 2SCUA 1DSSG 4U9UA 1XN1A 4XMYA 3CF2A 4Q3CA 3G7NA 4S1NA 1QGAA 1Q1EA 1UZAA 2GDZA 4G8BA 1TQ4A 1JEYA 1F8FA 3D4LA 2LVBA 4FR5A 5DE3A 1JTVA 2YQZA 5JCXA 1M2VA 4MW5A 2BFMA 3S7TA 4XWKA 1CUVA 1GR1A 4G36A 2HK6A 4MVJF 4Y9RA 4IFTA 2ZGVA 1LRKA 1Z4MA 3EA5A 1PF7E 3CMEB 1VHJA 5B7GA 4HWGA 1E7SA 2RJOA 5AJTA 4TXJA 4NFYA 3NOOA 1YHYA 2E6UX 3C74A 4QG7A 2AFHB 2YDYA 3H7AA 1JBEA 3KQQA 1P1KA 1Y9DA 2WP8J 2BEWB 2OP0A 4PO8A 4P3XA 4A2WA 2OYSA 2G28A 1VHLA 4UEWA 1SG0A 1H4TA 2AGVA 3O9MA 1Q20A 2BGNA 3RBAA 4RTKA 1ZXLA 5H16A 3ZDAA 5EUQB 5AM5A 5LM3A 1MUUA 4R5HA 2RIPA 2R2GA 2WYWA 2YY6A 2ZRHA 3ITKA 3QKIA 4PO3X 2VL7A 3AL0C 1JQLB 1SIWA 1DC3A 4TLMB 1GRRA 1QNLA 4DG8A 5FPHA 3N2IA 4RLFA 4EYQA 5IZ4A 5D2CA 4P8RA 1Q0TA 2KM1A 3VRHA 1RLUA 5TGTA 1PWYE 1TKRA 1XWIA 2BGRA 1FS4A 2ATCA 2NTNA 4PLWA 4P4NA 4PSDA 4TN5A 3SYTA 4RFVA 1PEDA 2A0YA 3JD1A 1RSZA 3PFBA 1XCMA 4H7DA 4HX5A 2PQ2A 3U4AA 2CV2A 2Z6UA 3EDOA 4U7PB 4MW2A 1EQUA 1NR1A 1V1RA 3EQ8A 4OOFA 2ZIGA 3LNTA 1BGVA 3T38A 2PL3A 10MHA 4E32A 2I6UA 2O2SA 5TQ2B 3GL9A 1U28C 2BW0A 3GJZA 4C7KA 4LRUA 3PX2A 4HWPA 1YOBA 5BSUA 2H16A 1X7WB 2P3LA 3HCAA 1ISPA 2YHAA 3I76A 3FYSA 3LP6A 5IP5A 3TH5A 4DCVA 3L93A 4P80A 5TPWA 4EJSC 3AFOA 1ULAA 5CYOA 5JFGA 3AM5A 3OD1A 1E62A 3MINA 4BVHA 3IKLA 2EFHB 1M8JA 2GD0A 3NS7A 2GDJA 1OR8A 4UREA 4NBSA 2X0DA 3N0XA 4QIHA 1VHTA 2CF6A 1RJDA 1VLJA 3CMAB 2QRNA 3R3VA 2RGXA 2QA4B 1KI2A 1ONOA 1VMIA 4D0RA 3NTXA 1JHDA 2UXCB 3W6NA 3LVRE 3T7KA 4L28A 4OB6A 1D1QA 3G85A 3QFRA 2D5CA 4GKBA 2ZAIA 4WK0B 1W88B 2DT8A 5LXTB 1K73D 2DYKA 3WB0A 1PJ7A 1CY1A 2X0FA 1GUDA 2IGBA 4C0WA 4UPVA 5LBIA 3ZWWA 2P6OA 4QDJA 4GRAA 2MYUA 2AV6A 5F7ZA 1ZUNB 1EB8A 4MEBA 5EZYF 1UK9A 3SFVA 3FN4A 4L0QA 1K1EA 3G9QA 2AWOA 4L6IA 5L3SA 2PUEA 1GILA 3AR6A 5JFOA 3CD6B 3PUIA 4R6WA 1I7PA 3VR2D 1F6DA 3DAFA 4B40A 1G20A 3RYFA 3GLIA 4ABTA 1KVQA 1FP4A 3UPDA 1WEKA 3WMXA 4N48A 4BNUA 3U7EB 1NN1A 1SUSA 2YHIA 2CSXA 5ALHA 3MN1A 1R6DA 3UZUA 4G3XA 4A2PA 2QT0A 4BKQA 4V0SA 2M98A 1CUBA 2X2EA 3VAYA 2XNSA 4BDSA 4BNXA 5J4KA 1IOVA 1UOPA 5JJLA 3AEYA 5DFAA 3ZV7A 3FJOA 3KB1A 1NDHA 1WABA 4M6WA 2UVDA 3O4RA 5K4AA 2V97A 4JJ6A 3W5IA 5IYZB 4UPDA 1ILEA 2EP8A 3IDOA 3WRVA 1P7WA 2F1MA 2H65A 3PS9A 4FGJA 5EIWA 2ZL7A 2PZEA 2JD2A 3H5NA 4OIFA 1QVRA 2HUPA 4FNAA 4N40A 5IH3A 5LZ8A 5THQA 3UCEA 5BVGA 1ZYUA 4P26A 4FQ5A 4TV9F 5CA1B 4WN3A 5AW8A 4Z5XA 5KQMA 3HC7A 2OOKA 1N1DA 4Z4TA 5CVUA 4NJOA 1XALA 4L9RA 4X3PA 3UUFA 2JPDA 5K03A 4D4IA 3ABZA 3LY8A 1RAIA 1GNTA 1L8LA 3ZZ1A 3HB5X 3NBAA 4FS8A 3GW8A 4XQFA 4QOHA 1ZISA 4FT4A 1UKYA 1XXHE 1NAHA 2XE6A 3D8HA 3RVLA 4CM8A 5B6PA 2CMDA 1USVA 2ZUEA 2BMEA 3AR5A 3WBFA 1GNQA 1QU2A 2IJGX 2Z8XA 1E4YA 4XLHA 1CY6A 1ZN2A 2FQQA 3W3ZB 1Y0BA 4YRNA 5HDBB 3C7CB 1G2PA 2IS4A 1HDZA 1KP3A 2XE7A 2WSLA 5CXQA 1FDRA 3R7BA 4A0QA 4K9LA 3V7UA 3LGXA 5EJ6A 4L85A 5LP6F 1ZHFA 1N34B 2Q7OE 3QELB 1HO3A 4GC5A 1SAYA 3KTFA 1GT6A 1F5SA 4KHZA 2Q8NA 4YT2A 4P1ZA 2YZMA 4M0MA 1NOKA 1NP3A 3WGJA 4R9NA 5EIFA 4TMTA 1KPIA 2GVDC 4PZLA 3RANA 4AF8A 3CTPA 1EWKA 4L0MA 2P6MA 4ZAZA 5BW4A 5HJ5A 2X2FA 4EI8A 3S27A 3QYPA 1V1JA 3E27A 3B3QA 3M2PA 3NM6B 3BL6A 2P9ZA 2BGIA 1GL3A 1HRKA 1RBYA 5GIOE 2QJRA 2W90A 3ZBPA 2YOGA 3PLNA 3FCUB 1W4LA 5TIIA 4QEDA 1NLMA 2ZZQA 1E0DA 1Y82A 1CU1A 2GLUA 1HBJA 2OBLA 2WKPA 3FSGD 3R0IA 4JJFA 2JLAA 4JP3A 3RREA 1I80A 2I71A 2OY0A 4PZZA 2VP5A 5M2QA 3T4EA 3KL4A 1USIA 2CEAA 4DMCA 1RP1A 3O0DA 2MWMA 1PJQA 5CFZA 3MJCA 3L4SO 3E9QA 2WJZB 5GWXA 3R3UA 3ZBQA 4M0PA 2V7QA 2XD9A 3GDOA 2OCIA 2XGGA 2DWCA 2XI4A 5ALMA 2GK7A 1PJCA 3B51X 3M4YA 1IVYA 1JJ7A 4QTXA 1WULS 4L27A 4MARA 3WV5A 4KUHA 3SFTA 1J20A 2VJYA 2ZREA 4WEQA 1RKUA 1WCIB 3ILHA 4RPKA 5CXXA 4AS3A 3VYVA 4CLHA 1KZLA 2QX8A 5JCPA 5HQ3B 3LSYA 4LRWA 2UZ1B 4G9GA 1JB1A 4NG5A 3ND5A 4JLSA 3CCEB 2VJQA 2B4YA 3HSKA 4YLGA 2CLLB 1TADA 2CD7A 1JFFA 2G6BA 2Q4BA 2E1BA 4OHFA 5HF5A 3TBKA 3ANSA 2CXQA 1C41A 1LS1A 2CLHB 2ZVQX 3D64A 4HVTA 5HF6A 1XDZA 3UJ7A 3FNGA 3Q3JB 1TO2E 1K28D 3UM9A 5IX8A 3PENA 1MABB 4R05A 4Z49A 3PEFA 2XB2A 1FK8A 1PR3A 1NUAA 3TW8B 4DV3B 4S1OA 2O59A 1ECLA 1HZJA 1OOEA 3K0EA 3IPAA 4KW7A 1H9BA 5CT6A 5I4KA 1JG4A 2NU6A 2J8ZA 2JFPA 1OKKA 2MYPA 2OZLB 3DOIA 3FPJA 2XA2A 3C6XA 4TTRA 4TWAA 1MLDA 3NVMB 2LBPA 4HGZA 1W8IA 5E1DA 3V8BA 4R2MA 1QIGA 4ZYXA 1TT7A 4TWJA 3M5CA 5IYRA 1RRPA 2C2MA 4GOLD 2PWAA 4LJ5A 5JS2A 4YY3B 2IHNA 2ZYWX 4Q03A 3TGLA 1NB0A 4AYTA 2IA5A 2VPQA 1MT3A 1Z2CA 3OX2A 2ZU0C 3V8PA 2WF6A 1YB1A 5AVUA 1CTQA 4OHZA 3DOJA 4EKEA 4CR7A 3LC2O 1SCKA 3P4XA 2F4NA 4XD7A 1BKYA 1SU7A 2WHYA 1R10A 1RD4A 3FLEA 4KE8A 3W2IA 1RZUA 3JXEA 4RQTA 2SKDA 4HH1A 3D3WB 1YZGA 3PC3A 2AYZA 3I9OA 1B0UA 4UM9B 1XDDA 2VRNA 5A6SA 1SBIA 4OHVA 4QQ8A 3TLEA 3G05A 4E5VA 2UYHA 3QUAA 1HYGA 1NL3A 1ZBDA 5DMHA 1ZW6A 4QVIA 2R8RA 4WFJA 2VBSA 2CJXA 5DXJA 1Y42X 2QRZA 1JKIA 2J5BA 4V0MA 3DLAA 5ES3A 4JCOA 4EJ6A 4IIGA 4IL5A 4AXBA 2O8EB 1O03A 1Q74A 2A84A 3BMQA 3B9BA 1DTWB 1YZHA 4H0CA 3ZDZB 1ZX1A 2ECOA 5EWJA 3ZHXA 2I2BA 2OGWA 4CKWA 4C6TB 5GONB 4F92B 3S8EA 1AVTA 2CNWA 3P97A 3FI9A 3TLGA 1ISFA 1VE3A 1VFNA 3W2HA 4LDNA 3KUDA 3GMTA 4R1LA 3L7KA 1OX4A 1QONA 4BIIA 1OFUX 3WRXC 3PDIB 4C78A 5JALA 2ZM5A 2IH4A 3WYBA 1XL1A 2FZVA 2IZ0A 2I6QA 5FEMA 4NAHA 2FF7A 4URFA 4JU8A 3U1TA 1YJ8A 1C8BA 1V3TA 2HRCA 3C2QA 3G49A 3TMYA 3F8TA 3GJXC 1PLLA 3NONA 3QGMA 1HT2E 4H77A 4XVQA 1XKQA 2IGTA 2K87A 2YV4A 5F5XA 3QEOA 3TQTA 2GN6A 1SEVA 1YA8A 3B1ZA 3I5AA 1S1CA 2XNJA 3MWDA 4RAQA 4C7XA 1I2DA 4LX8A 1MG5A 4QXRA 3LFHA 4YCBA 3T9FA 3G9TA 1NYQA 1V48A 4JUFA 4L4YA 5BOVA 4BP8A 3C6YA 4XWGA 2GXQA 5JAIA 3G5LA 4GP9A 4Z7NB 3ILYA 3MRVA 3Q39A 2Z83A 4X9XA 1E2IA 1E3EA 2BMDA 4YJFB 3PB3A 1OBCA 1C2TA 1PFYA 2ZR9A 9LDTA 3O3CA 1XQ9A 3HYNA 4R8KA 3A9UA 2M5SA 1UBCA 2HXGA 2YV1A 1NWHA 1NJID 3V4SA 3VM6A 2OBXA 3FVTA 4HFNA 2LKDA 2GS9A 1A77A 3HAGA 1O94D 2A35A 2OZKA 3EOBI 1KZ6A 1GYPA 2IYWA 2FA9A 3CMCO 3FYUA 4PGFA 2OC9A 3EVTA 1ZHHA 4YJ3A 3LBIA 1KRWA