3OKXA

Crystal structure of yaeb-like protein from rhodopseudomonas palustris
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
159
structure length
156
Chain Sequence
b'DIRAGELASDWSGSPDAGVVFIGRIHTPWNRLKECPRHGRADGPVCRIEVFETWLPALAGIDDGTLLEVFYWLHRSRRDLLLQCPGDARGTFSIRSPLRPNPIGTSIARVDRRDGANLFIRGLDCLDGTPLVDLKPDRAEFMPLAPPKPGDFQVGE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords YaeB-like protein RPA0152
molecule tags Structural genomics, unknown function
source organism Rhodopseudomonas palustris
publication title Crystal structure of YaeB-like protein from Rhodopseudomonas palustris
rcsb
total genus 34
structure length 156
sequence length 159
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01980 TrmO tRNA-methyltransferase O
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.70 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 YaeB-like 3okxA00
3OKXA 1XQBA 2NV4A
chains in the Genus database with same CATH superfamily
4B3XA 3AVYA 1E1RA 4TN1A 2QMUA 2YWGA 2FX3A 4Z1MA 3OOCA 3ZZUA 1Q82D 1UMKA 2BN4A 3LQ6A 2OK8A 1GJRA 3MMPA 1VQMB 2BPOA 2X3UA 4YEJA 1EFUA 4XMYA 4LBVA 4M0LA 1Q7YD 1WSRA 1E1QA 4XORA 1EFRA 3G71B 1COWA 2C4UA 2V7XA 2VNKA 2GREA 1T6XA 2BGIA 1VLYA 1WOSA 2CNDA 2OBSA 4X8IA 1VQPB 1EP1B 1P4MA 5H5JA 2VZLA 3FPPA 1K73D 3BCFA 2RC6A 4XLFA 3WQZA 1R5BA 4RD0A 2GK7A 4B48A 2ZTGA 1EFTA 1IHMA 3NE5B 4PC2A 3CB4A 4DNTB 2V31A 1DG1G 3T56B 5TRDA 4BPRA 5DN6A 4WQMA 1I18A 1CNEA 2VBUA 3A8KA 4ASUA 4XLEA 1YITB 2BV3A 1I8DA 1YI2B 2Q6KA 4DQLA 3CC2B 1Y0RA 2X6WA 2ZBVA 3GIRA 4Y9UA 1VQ5B 3Q6RA 1V0FA 1AMOA 3GVKA 4YXWA 1G7TA 5FNZA 4HIZA 3ZPNA 3CCSB 2W6IA 5DSZA 5THXA 3ZUGA 5CDFA 3BY2A 1DDGA 2DETA 2JIZA 2I1LA 4DQKA 4ACBA 4TMTA 1BJKA 4UZUA 2D3NA 3RY8A 4XL9A 5H59A 3PVDA 1OHHA 1KJZA 3CCMB 3CMEB 3VO1A 4DNRB 4L8JA 1W87A 2D3LA 4P25A 2NV4A 3BQJA 4TMXA 4X7CA 2CRVA 2WYRA 3Q38A 4QHYA 1YJWB 3BCDA 3I56B 1S0UA 4G1VA 4RD4A 3D26A 4UZEA 5TV2A 1NJID 4P2NA 3I1FA 4H9GA 2Q6LA 3OE7A 2C2WA 1KK0A 2R9VA 2YWHA 3ZIAA 1M1KD 4EH1A 3WNDA 2WPDA 1D8TA 1KMHA 4AVZA 3GSIA 2QTLA 1K8AD 4HE6A 2EIXA 4G1BA 3BY1A 1H85A 3ASQA 2BM0A 2E1RA 1SKYB 3QFSA 3V76A 3CPWB 2BSAA 1EWYA 2ZXHA 1E3ZA 1HZEA 2QEXB 1TTTA 1JNYA 2AHOA 3WXMA 4RD1A 2V4DA 1W0JA 3OZVA 2XZPA 1SKQA 1B23P 2DYIA 4B4DA 3T53B 1DDIA 2D74A 3SJZA 5LMZA 2HDNB 3AGQA 4Y9RA 1G7CA 2ZZQA 1KK3A 2WSSA 3WBJA 3FJOA 3B82A 2X0KA 2B7CA 2ZL6A 1EP2B 1KK1A 4Z4WA 1V5VA 4LBZA 2PIAA 1NB0A 1QUEA 2XNDA 2GJKA 2GJPA 4X0CA 5TY0A 2CK3A 4ZCMA 4XQFA 4Z4UA 3CC4B 2JN9A 2ZZEA 1N0VC 3AVTA 3CP2A 2Q6IA 5DS0A 1GAWA 4K1XA 1ELOA 1NRKA 3P27A 4U9UA 4PC6A 1I7PA 1KTVA 4DK1A 1N08A 1E43A 4RPDA 2NPFA 5IYQA 4B3FX 1N0UA 1XFOA 2OTLB 3W2FA 2VBSA 4X7FA 4QVAA 4P26A 4Z4SA 5FL7A 4P3YA 1N8RD 4XLHA 3OJWA 3W2EA 5A89A 1KK2A 1Q81D 1SM4A 4TMVA 1YJNB 2QDXA 5A8AA 1XB2A 3E20A 4XD7A 1H8EA 5KNLA 5EMNA 1YJ9B 1H42A 4G6IA 2W6JA 4AF6A 1BMFA 3U6KA 4RPBA 1G7SA 3BH4A 1RQPA 4XKVA 3W2GA 1VQ6B 1HA3A 1RQRA 2LZJA 2XGJA 4ROXA 3OPOA 4Z4RA 3W2IA 1OB2A 4PC3A 2OBRA 2QA4B 4WWVA 5HXBA 3SLDA 2X85A 4OOVA 2DEUA 5KSWB 4XONA 3OW7A 2V7TA 1W9XA 1KD1D 1QVFB 1YIJB 2DOGA 4OOXA 3PENA 4WZTA 2RC5A 2C4TA 1V0EA 2Z6BD 4X7EA 3PUMA 4RDLA 2VJIA 2F1MA 4ZCLA 2OK7A 4XOTA 2Q6OA 3CC7B 2VNIA 3E1YE 4QFMA 4RCYA 3R6KA 4RCZA 3AVUA 3QE2A 4N3GA 4RJLA 1EXMA 3JQPA 3OP1A 4P6YA 2XZOA 3OZUA 4UZFA 1KRHA 1XQBA 3OJXA 1CNFA 4FXUA 4XLCA 3LVBA 1E62A 1K9MD 2R6HA 3MHPA 1WOPA 2F43A 3A8JA 4NBSA 4X06A 1UD5A 4XN0A 3CMMA 1VQKB 4M53A 1EP3B 2VYQA 4PAAA 1DARA 1PJ5A 1MRZA 1NB9A 2ZZGA 2VBVA 4RM0A 3ES9A 4XKWA 1MABA 5HZBA 3A1PA 1S72B 2BF4A 4X05A 5AN9A 1QH0A 1R5NA 1E64A 4WZEA 5B6IA 4RDKA 4B3GA 4RLZA 1UD8A 2PE3A 5J3OA 4PC7A 3VNVA 2WR8A 1FNCA 2V7WA 1JB9A 1E79A 3OEEA 4M1KA 3A35A 2J7KA 1YX2A 2E1BA 2WJYA 3FPKA 2BM1A 3OAAA 1QFJA 1R5OA 1UD6A 4XM3A 3W2HA 4XN3A 3BC9A 4YAOA 1VQLB 1W0KA 4M2LA 3B8HA 2XNJA 2YWFA 4YELA 3ASSA 1IB0A 1TLLA 2X6XA 1BLIA 1JA1A 1UD4A 1W35A 3QFTA 4C43A 2EFGA 4XLAA 2FVGA 1KQSB 2C78A 2JJ2A 4P1VA 1XE1A 1FNDA 1GO2A 2YWEA 4NNJA 4UAJA 1VHEA 3R6JA 4P12A 3WBKA 3OW2B 2HLDA 4J0QA 4KKTA 4RD3A 3Q3AA 4F7DA 1PKVA 1B2RA 3OEHA 4RDJA 1QFZA 3OFNA 2GK6A 3OZWA 2OYNA 1QGZA 4GQNA 4LC0A 4QUZA 2X53S 4TMWA 4Y7CA 3WNBA 4Q7JB 3GVLA 2X8KA 5KW9A 1ZM2A 2KVOA 4OP7A 2CF4A 2CBXA 1EFCA 2QTZA 4RD2A 4OPSA 4MYUA 2D9RA 3JU4A 3SJPA 3ONYA 3KL9A 1VQ9B 1T6YA 1GAQA 1QVGB 1E3XA 4OOSA 4TMZA 4AC9A 1WU8A 5TR9A 5BSXA 5HKKA 3WYAA 4WZKA 5FIUA 2XZLA 1OGIA 1N06A 4KKSA 4C0SA 1WP6A 3CCVB 1YHQB 2V7UA 2XOKA 4MYTA 2VJJA 1JJ2B 2GJRA 1OGJA 1BPLA 2C5BA 3G6EB 3U6BA 5FO1A 2WZNA 4HE5A 4KKUA 4YAWA 1IJFA 4CQJA 5L46A 2QN6A 3I55B 1GR1A 4G5GA 2DY1A 4OPOA 2F4NA 1VHOA 4P9SA 1NBMA 1WOOA 3VMFA 1ZM9A 4LBYA 1FRNA 2PMDA 4X07A 4WZLA 5HZAA 2CW5A 4N3NA 4X7DA 5GV8A 1VQ4B 2VBTA 3J81k 1BX0A 1FDRA 1Y0YA 5IYRA 2ZZFA 3CPXA 2WZPP 3VNUA 2DCUA 3SEJA 4XR6A 3ZZ0A 3CCQB 1A8PA 1FNBA 3W5UA 3PA2A 1WORA 1K28D 3CP8A 4PABA 1TUIA 1F20A 3Q39A 3FKSA 4ZGQB 2DERA 4YAFA 2WJVA 4B43A 4ZCIA 1S4MA 3QFRA 1IJEA 3W5VA 1VQ8B 3JQRA 1M90D 3H94A 4LBWA 5FA6A 1OB0A 4IW3B 1T5EA 1FX0A 4DK0A 1YLOA 1VLOA 2X6YA 4Z4TA 5FO0A 3A3GA 1G7RA 1ZM4A 1QX4A 3CW2A 5IYPA 3AVVA 3CTAA 3AVXA 3QFCA 1PJ7A 3WY9A 3ZC3A 2V7VA 3ZZTA 4TT3A 1WSVA 2BVNA 3ASPA 4P3IA 4Z4VA 5A88A 1U2RA 3HAGA 4M4SA 3QSYA 3W5HA 4PC1A 3A8IA 3ASRA 2P3MA 4II3A 1W34A 4RD6A 3T51B 3VR6A 1FRQA 4B44A 1H8HA 2GQFA 3LQEA 1FNMA 4Z4ZA 4QV2A 4YAUA 4G7WA 5F4OA 1QUFA 3G4SB 1W2BB 4XNFA 1KC8D 1QG0A 5JBQA 2GPJA 3H9NA 2C5HA 1N05A 1T6ZA 4E0FA 2ZXIA 2ZTNA 1WDTA 3AGPA 3B78A 1F60A 2DIEA 1Q86D 1BQEA 1D2EA 2XEXA 3ISXA 1NDHA 3ONUA 3GQBA 1QGYA 3GVJA 1N07A 3A3BA 1QGAA 4ACAA 3VO2A 3ZBTA 2ZL5A 1E63A 1VF7A 1JA0A 4JMQA 3CRZA 3CESA 3G05A 3Q6QA 3PUNA 4AF7A 1ZM3A 4PGOA 1AIPA 1GVHA 3SKBA 4XOPA 1TVCA 2PLFA 1VJSA 4G7XA 4TKOB 5IYNA 1VQOB 2QGGA 3DDYA 3PA1A 2BGJA 3U2QA 1WTHD 5BSYA 3CCRB 1VQ7B 2ZITA 4P6VF 2XNCA 4YALA 2VNHA 3MCAA 4FN5A 3WNCA 2V7QA 2B7BA 1UD2A 3V7AA 2BMWA 4FWTA 4TSFA 1HVXA 4NCNA 4YHBA 4B47A 1KZLA 2CC2A 4OPVA 5IK2A 3OKXA 2B5OA 1J9ZA 1OB5A 2M5SA 1WPCA 5F4MA 3CXCB 2HCJB 3CD6B 1ZUNB 1QFYA 1PJ6A 2JDIA 3CMAB 4P22A 2JJ1A 3ASTA 1Q9SA 3JQQA 3CCLB 4II2A 1CQXA 3KEWA 3ZBUA 4Z4YA 5F4JA 2C77A 5IYWA 1BX1A 2HMAA 3AVWA 4QVJA 2ZBUA 5GV7A 3CCEB 4FK8A 2OBTA 2ZL7A 5J35A 1VQNB 2QE7A 2F1LA 3LO8A 1D1NA 2VNJA 3BNWA 3SLNA 4R71A 3CCJB 4ZV4A 1UD3A 4ZGNB 2OTJB 5E6TA 3LNNA 3P26A 3CCUB
chains in the Genus database with same CATH topology
3OKXA 1XQBA 2NV4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OKX A;  1XQB A;  2NV4 A; 
#chains in the Genus database with same CATH topology
 4B3X A;  3AVY A;  1E1R A;  4TN1 A;  2QMU A;  2YWG A;  2FX3 A;  4Z1M A;  3OOC A;  3ZZU A;  1Q82 D;  1UMK A;  2BN4 A;  3LQ6 A;  2OK8 A;  1GJR A;  3MMP A;  1VQM B;  2BPO A;  2X3U A;  4YEJ A;  1EFU A;  4XMY A;  4LBV A;  4M0L A;  1Q7Y D;  1WSR A;  1E1Q A;  4XOR A;  1EFR A;  3G71 B;  1COW A;  2C4U A;  2V7X A;  2VNK A;  2GRE A;  1T6X A;  2BGI A;  1VLY A;  1WOS A;  2CND A;  2OBS A;  4X8I A;  1VQP B;  1EP1 B;  1P4M A;  5H5J A;  2VZL A;  3FPP A;  1K73 D;  3BCF A;  2RC6 A;  4XLF A;  3WQZ A;  1R5B A;  4RD0 A;  2GK7 A;  4B48 A;  2ZTG A;  1EFT A;  1IHM A;  3NE5 B;  4PC2 A;  3CB4 A;  4DNT B;  2V31 A;  1DG1 G;  3T56 B;  5TRD A;  4BPR A;  5DN6 A;  4WQM A;  1I18 A;  1CNE A;  2VBU A;  3A8K A;  4ASU A;  4XLE A;  1YIT B;  2BV3 A;  1I8D A;  1YI2 B;  2Q6K A;  4DQL A;  3CC2 B;  1Y0R A;  2X6W A;  2ZBV A;  3GIR A;  4Y9U A;  1VQ5 B;  3Q6R A;  1V0F A;  1AMO A;  3GVK A;  4YXW A;  1G7T A;  5FNZ A;  4HIZ A;  3ZPN A;  3CCS B;  2W6I A;  5DSZ A;  5THX A;  3ZUG A;  5CDF A;  3BY2 A;  1DDG A;  2DET A;  2JIZ A;  2I1L A;  4DQK A;  4ACB A;  4TMT A;  1BJK A;  4UZU A;  2D3N A;  3RY8 A;  4XL9 A;  5H59 A;  3PVD A;  1OHH A;  1KJZ A;  3CCM B;  3CME B;  3VO1 A;  4DNR B;  4L8J A;  1W87 A;  2D3L A;  4P25 A;  2NV4 A;  3BQJ A;  4TMX A;  4X7C A;  2CRV A;  2WYR A;  3Q38 A;  4QHY A;  1YJW B;  3BCD A;  3I56 B;  1S0U A;  4G1V A;  4RD4 A;  3D26 A;  4UZE A;  5TV2 A;  1NJI D;  4P2N A;  3I1F A;  4H9G A;  2Q6L A;  3OE7 A;  2C2W A;  1KK0 A;  2R9V A;  2YWH A;  3ZIA A;  1M1K D;  4EH1 A;  3WND A;  2WPD A;  1D8T A;  1KMH A;  4AVZ A;  3GSI A;  2QTL A;  1K8A D;  4HE6 A;  2EIX A;  4G1B A;  3BY1 A;  1H85 A;  3ASQ A;  2BM0 A;  2E1R A;  1SKY B;  3QFS A;  3V76 A;  3CPW B;  2BSA A;  1EWY A;  2ZXH A;  1E3Z A;  1HZE A;  2QEX B;  1TTT A;  1JNY A;  2AHO A;  3WXM A;  4RD1 A;  2V4D A;  1W0J A;  3OZV A;  2XZP A;  1SKQ A;  1B23 P;  2DYI A;  4B4D A;  3T53 B;  1DDI A;  2D74 A;  3SJZ A;  5LMZ A;  2HDN B;  3AGQ A;  4Y9R A;  1G7C A;  2ZZQ A;  1KK3 A;  2WSS A;  3WBJ A;  3FJO A;  3B82 A;  2X0K A;  2B7C A;  2ZL6 A;  1EP2 B;  1KK1 A;  4Z4W A;  1V5V A;  4LBZ A;  2PIA A;  1NB0 A;  1QUE A;  2XND A;  2GJK A;  2GJP A;  4X0C A;  5TY0 A;  2CK3 A;  4ZCM A;  4XQF A;  4Z4U A;  3CC4 B;  2JN9 A;  2ZZE A;  1N0V C;  3AVT A;  3CP2 A;  2Q6I A;  5DS0 A;  1GAW A;  4K1X A;  1ELO A;  1NRK A;  3P27 A;  4U9U A;  4PC6 A;  1I7P A;  1KTV A;  4DK1 A;  1N08 A;  1E43 A;  4RPD A;  2NPF A;  5IYQ A;  4B3F X;  1N0U A;  1XFO A;  2OTL B;  3W2F A;  2VBS A;  4X7F A;  4QVA A;  4P26 A;  4Z4S A;  5FL7 A;  4P3Y A;  1N8R D;  4XLH A;  3OJW A;  3W2E A;  5A89 A;  1KK2 A;  1Q81 D;  1SM4 A;  4TMV A;  1YJN B;  2QDX A;  5A8A A;  1XB2 A;  3E20 A;  4XD7 A;  1H8E A;  5KNL A;  5EMN A;  1YJ9 B;  1H42 A;  4G6I A;  2W6J A;  4AF6 A;  1BMF A;  3U6K A;  4RPB A;  1G7S A;  3BH4 A;  1RQP A;  4XKV A;  3W2G A;  1VQ6 B;  1HA3 A;  1RQR A;  2LZJ A;  2XGJ A;  4ROX A;  3OPO A;  4Z4R A;  3W2I A;  1OB2 A;  4PC3 A;  2OBR A;  2QA4 B;  4WWV A;  5HXB A;  3SLD A;  2X85 A;  4OOV A;  2DEU A;  5KSW B;  4XON A;  3OW7 A;  2V7T A;  1W9X A;  1KD1 D;  1QVF B;  1YIJ B;  2DOG A;  4OOX A;  3PEN A;  4WZT A;  2RC5 A;  2C4T A;  1V0E A;  2Z6B D;  4X7E A;  3PUM A;  4RDL A;  2VJI A;  2F1M A;  4ZCL A;  2OK7 A;  4XOT A;  2Q6O A;  3CC7 B;  2VNI A;  3E1Y E;  4QFM A;  4RCY A;  3R6K A;  4RCZ A;  3AVU A;  3QE2 A;  4N3G A;  4RJL A;  1EXM A;  3JQP A;  3OP1 A;  4P6Y A;  2XZO A;  3OZU A;  4UZF A;  1KRH A;  1XQB A;  3OJX A;  1CNF A;  4FXU A;  4XLC A;  3LVB A;  1E62 A;  1K9M D;  2R6H A;  3MHP A;  1WOP A;  2F43 A;  3A8J A;  4NBS A;  4X06 A;  1UD5 A;  4XN0 A;  3CMM A;  1VQK B;  4M53 A;  1EP3 B;  2VYQ A;  4PAA A;  1DAR A;  1PJ5 A;  1MRZ A;  1NB9 A;  2ZZG A;  2VBV A;  4RM0 A;  3ES9 A;  4XKW A;  1MAB A;  5HZB A;  3A1P A;  1S72 B;  2BF4 A;  4X05 A;  5AN9 A;  1QH0 A;  1R5N A;  1E64 A;  4WZE A;  5B6I A;  4RDK A;  4B3G A;  4RLZ A;  1UD8 A;  2PE3 A;  5J3O A;  4PC7 A;  3VNV A;  2WR8 A;  1FNC A;  2V7W A;  1JB9 A;  1E79 A;  3OEE A;  4M1K A;  3A35 A;  2J7K A;  1YX2 A;  2E1B A;  2WJY A;  3FPK A;  2BM1 A;  3OAA A;  1QFJ A;  1R5O A;  1UD6 A;  4XM3 A;  3W2H A;  4XN3 A;  3BC9 A;  4YAO A;  1VQL B;  1W0K A;  4M2L A;  3B8H A;  2XNJ A;  2YWF A;  4YEL A;  3ASS A;  1IB0 A;  1TLL A;  2X6X A;  1BLI A;  1JA1 A;  1UD4 A;  1W35 A;  3QFT A;  4C43 A;  2EFG A;  4XLA A;  2FVG A;  1KQS B;  2C78 A;  2JJ2 A;  4P1V A;  1XE1 A;  1FND A;  1GO2 A;  2YWE A;  4NNJ A;  4UAJ A;  1VHE A;  3R6J A;  4P12 A;  3WBK A;  3OW2 B;  2HLD A;  4J0Q A;  4KKT A;  4RD3 A;  3Q3A A;  4F7D A;  1PKV A;  1B2R A;  3OEH A;  4RDJ A;  1QFZ A;  3OFN A;  2GK6 A;  3OZW A;  2OYN A;  1QGZ A;  4GQN A;  4LC0 A;  4QUZ A;  2X53 S;  4TMW A;  4Y7C A;  3WNB A;  4Q7J B;  3GVL A;  2X8K A;  5KW9 A;  1ZM2 A;  2KVO A;  4OP7 A;  2CF4 A;  2CBX A;  1EFC A;  2QTZ A;  4RD2 A;  4OPS A;  4MYU A;  2D9R A;  3JU4 A;  3SJP A;  3ONY A;  3KL9 A;  1VQ9 B;  1T6Y A;  1GAQ A;  1QVG B;  1E3X A;  4OOS A;  4TMZ A;  4AC9 A;  1WU8 A;  5TR9 A;  5BSX A;  5HKK A;  3WYA A;  4WZK A;  5FIU A;  2XZL A;  1OGI A;  1N06 A;  4KKS A;  4C0S A;  1WP6 A;  3CCV B;  1YHQ B;  2V7U A;  2XOK A;  4MYT A;  2VJJ A;  1JJ2 B;  2GJR A;  1OGJ A;  1BPL A;  2C5B A;  3G6E B;  3U6B A;  5FO1 A;  2WZN A;  4HE5 A;  4KKU A;  4YAW A;  1IJF A;  4CQJ A;  5L46 A;  2QN6 A;  3I55 B;  1GR1 A;  4G5G A;  2DY1 A;  4OPO A;  2F4N A;  1VHO A;  4P9S A;  1NBM A;  1WOO A;  3VMF A;  1ZM9 A;  4LBY A;  1FRN A;  2PMD A;  4X07 A;  4WZL A;  5HZA A;  2CW5 A;  4N3N A;  4X7D A;  5GV8 A;  1VQ4 B;  2VBT A;  3J81 k;  1BX0 A;  1FDR A;  1Y0Y A;  5IYR A;  2ZZF A;  3CPX A;  2WZP P;  3VNU A;  2DCU A;  3SEJ A;  4XR6 A;  3ZZ0 A;  3CCQ B;  1A8P A;  1FNB A;  3W5U A;  3PA2 A;  1WOR A;  1K28 D;  3CP8 A;  4PAB A;  1TUI A;  1F20 A;  3Q39 A;  3FKS A;  4ZGQ B;  2DER A;  4YAF A;  2WJV A;  4B43 A;  4ZCI A;  1S4M A;  3QFR A;  1IJE A;  3W5V A;  1VQ8 B;  3JQR A;  1M90 D;  3H94 A;  4LBW A;  5FA6 A;  1OB0 A;  4IW3 B;  1T5E A;  1FX0 A;  4DK0 A;  1YLO A;  1VLO A;  2X6Y A;  4Z4T A;  5FO0 A;  3A3G A;  1G7R A;  1ZM4 A;  1QX4 A;  3CW2 A;  5IYP A;  3AVV A;  3CTA A;  3AVX A;  3QFC A;  1PJ7 A;  3WY9 A;  3ZC3 A;  2V7V A;  3ZZT A;  4TT3 A;  1WSV A;  2BVN A;  3ASP A;  4P3I A;  4Z4V A;  5A88 A;  1U2R A;  3HAG A;  4M4S A;  3QSY A;  3W5H A;  4PC1 A;  3A8I A;  3ASR A;  2P3M A;  4II3 A;  1W34 A;  4RD6 A;  3T51 B;  3VR6 A;  1FRQ A;  4B44 A;  1H8H A;  2GQF A;  3LQE A;  1FNM A;  4Z4Z A;  4QV2 A;  4YAU A;  4G7W A;  5F4O A;  1QUF A;  3G4S B;  1W2B B;  4XNF A;  1KC8 D;  1QG0 A;  5JBQ A;  2GPJ A;  3H9N A;  2C5H A;  1N05 A;  1T6Z A;  4E0F A;  2ZXI A;  2ZTN A;  1WDT A;  3AGP A;  3B78 A;  1F60 A;  2DIE A;  1Q86 D;  1BQE A;  1D2E A;  2XEX A;  3ISX A;  1NDH A;  3ONU A;  3GQB A;  1QGY A;  3GVJ A;  1N07 A;  3A3B A;  1QGA A;  4ACA A;  3VO2 A;  3ZBT A;  2ZL5 A;  1E63 A;  1VF7 A;  1JA0 A;  4JMQ A;  3CRZ A;  3CES A;  3G05 A;  3Q6Q A;  3PUN A;  4AF7 A;  1ZM3 A;  4PGO A;  1AIP A;  1GVH A;  3SKB A;  4XOP A;  1TVC A;  2PLF A;  1VJS A;  4G7X A;  4TKO B;  5IYN A;  1VQO B;  2QGG A;  3DDY A;  3PA1 A;  2BGJ A;  3U2Q A;  1WTH D;  5BSY A;  3CCR B;  1VQ7 B;  2ZIT A;  4P6V F;  2XNC A;  4YAL A;  2VNH A;  3MCA A;  4FN5 A;  3WNC A;  2V7Q A;  2B7B A;  1UD2 A;  3V7A A;  2BMW A;  4FWT A;  4TSF A;  1HVX A;  4NCN A;  4YHB A;  4B47 A;  1KZL A;  2CC2 A;  4OPV A;  5IK2 A;  3OKX A;  2B5O A;  1J9Z A;  1OB5 A;  2M5S A;  1WPC A;  5F4M A;  3CXC B;  2HCJ B;  3CD6 B;  1ZUN B;  1QFY A;  1PJ6 A;  2JDI A;  3CMA B;  4P22 A;  2JJ1 A;  3AST A;  1Q9S A;  3JQQ A;  3CCL B;  4II2 A;  1CQX A;  3KEW A;  3ZBU A;  4Z4Y A;  5F4J A;  2C77 A;  5IYW A;  1BX1 A;  2HMA A;  3AVW A;  4QVJ A;  2ZBU A;  5GV7 A;  3CCE B;  4FK8 A;  2OBT A;  2ZL7 A;  5J35 A;  1VQN B;  2QE7 A;  2F1L A;  3LO8 A;  1D1N A;  2VNJ A;  3BNW A;  3SLN A;  4R71 A;  3CCJ B;  4ZV4 A;  1UD3 A;  4ZGN B;  2OTJ B;  5E6T A;  3LNN A;  3P26 A;  3CCU B; 
#chains in the Genus database with same CATH homology
 3OKX A;  1XQB A;  2NV4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...