3OKXA

Crystal structure of yaeb-like protein from rhodopseudomonas palustris
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
159
structure length
156
Chain Sequence
DIRAGELASDWSGSPDAGVVFIGRIHTPWNRLKECPRHGRADGPVCRIEVFETWLPALAGIDDGTLLEVFYWLHRSRRDLLLQCPGDARGTFSIRSPLRPNPIGTSIARVDRRDGANLFIRGLDCLDGTPLVDLKPDRAEFMPLAPPKPGDFQVGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords YaeB-like protein RPA0152
publication title Crystal structure of YaeB-like protein from Rhodopseudomonas palustris
rcsb
source organism Rhodopseudomonas palustris
total genus 34
structure length 156
sequence length 159
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01980 TrmO tRNA-methyltransferase O
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.70 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 YaeB-like 3okxA00
2NV4A 3OKXA 1XQBA
chains in the Genus database with same CATH superfamily
2Z6BD 4BPRA 2EFGA 3ASRA 3JQPA 3BC9A 1IJFA 3OFNA 5KSWB 1NRKA 3LQEA 2QN6A 3OZUA 4N3NA 1QG0A 4ASUA 3OZWA 2X3UA 3SLDA 3H9NA 1VQNB 2X85A 1YI2B 1N0UA 1BJKA 2D74A 4XLCA 4XQFA 1GO2A 4PABA 1EFCA 4QFMA 4YELA 4QVJA 4DNRB 1FNCA 1WSRA 2F43A 3QFCA 3CB4A 1VF7A 1WP6A 3ZZUA 4DK1A 1QFZA 4OPVA 4G7XA 1W2BB 2QEXB 5J3OA 3RY8A 1E62A 4RPDA 1G7CA 4RLZA 2BSAA 2GK7A 2FX3A 4YAOA 4M2LA 4FXUA 1T5EA 1UD2A 1D8TA 4Q7JB 4CQJA 4KKTA 2F4NA 2JDIA 3E1YE 4TMWA 3ZC3A 1UD8A 4EH1A 2XNDA 2BN4A 4XN3A 1E64A 2ZL5A 2AHOA 1FRNA 2VJJA 2VNJA 3GIRA 3PUMA 4RD4A 2JN9A 3OEHA 4DNTB 1IHMA 4TMZA 1BLIA 3CCSB 4ACAA 3WYAA 1E3ZA 3LNNA 4XOPA 2ZBVA 1HZEA 4M53A 1W9XA 2ZZFA 3CP8A 4TMTA 4OOSA 2OTJB 3I1FA 3R6KA 4RD2A 4P2NA 5IYPA 3BH4A 2CNDA 3H94A 1WORA 2GREA 4YAWA 5FIUA 1Q9SA 4P12A 2Q6IA 1ZM4A 1H8HA 2VBSA 3JU4A 3ISXA 4RDJA 4HE5A 2XZLA 1N06A 2WYRA 1N05A 4XKWA 3A8JA 4YAFA 3SJPA 4UZEA 3I56B 4GQNA 3WNDA 2QDXA 3CD6B 1KC8D 2V7VA 2OK7A 5JBQA 3U6BA 3AVUA 2Q6KA 5H59A 1PKVA 2F1LA 2V7TA 4WQMA 2V7UA 2OYNA 5J35A 3CCVB 2QE7A 2VNHA 2CRVA 1V0EA 1KQSB 1E63A 3GQBA 1FDRA 4RPBA 3BNWA 3KEWA 1PJ7A 2XNJA 2DEUA 2DERA 3B78A 4WZKA 2R6HA 3ZBTA 3CCJB 1VQ8B 2X6WA 4TKOB 5EMNA 3I55B 2BGJA 3SKBA 5KW9A 1W35A 4HIZA 4IW3B 4UAJA 5TV2A 3ZIAA 2XOKA 3PA1A 1SM4A 1QUEA 4OOXA 1S4MA 4NNJA 2HLDA 2C2WA 2VBTA 4XLFA 4KKSA 1VLYA 2WZPP 4R71A 2YWEA 2X8KA 3W2HA 1N08A 3VNUA 4Z4ZA 4RD0A 3CCLB 2PLFA 1J9ZA 3G71B 4G6IA 3ASQA 3OJXA 3QFTA 4PGOA 1JNYA 2D3NA 2F1MA 2WJVA 4QUZA 2KVOA 4RDKA 5GV8A 1VQ9B 5FO1A 1T6XA 3AGQA 3AGPA 1SKYB 3QSYA 3GSIA 4AF7A 1BX0A 1XE1A 2QA4B 3W2IA 3ES9A 2ZBUA 4B3XA 3BY1A 3ZZTA 2JIZA 3CC7B 2ZL6A 2X53S 4H9GA 3QE2A 4FWTA 1WPCA 2HDNB 4QV2A 1V5VA 2QTLA 3BCDA 3CCRB 1VQ6B 3MCAA 1YX2A 4Z4UA 4II3A 4Z4WA 4J0QA 4LC0A 3VO1A 1EP2B 1TUIA 5TR9A 4B3FX 4X07A 1KTVA 2OBRA 4QVAA 5LMZA 3OP1A 2Q6LA 3ASPA 4OOVA 4B48A 1DARA 3SLNA 4RJLA 1AMOA 1B2RA 4OPSA 1ZM9A 4C0SA 3ZBUA 4M4SA 1KK0A 3NE5B 1OGIA 3CMAB 1DDIA 3BY2A 5E6TA 1QUFA 1ZM3A 3AVWA 1WDTA 4YXWA 2QGGA 3PA2A 5A89A 1VQ5B 4FN5A 1YJ9B 3P26A 3CP2A 2B5OA 1ELOA 1SKQA 2B7CA 2CC2A 4YAUA 2XGJA 1G7RA 1UD5A 1VQ7B 4Z4VA 5H5JA 1B23P 3CTAA 4PC2A 4LBZA 1H42A 1WU8A 4PC1A 4TMVA 5F4JA 4ZCMA 2ZL7A 2ZXHA 1KK1A 3G05A 4XLEA 1XFOA 5THXA 5IYQA 2ZZEA 3GVLA 2JJ2A 2BF4A 1UD3A 4ZCLA 3ZUGA 4ACBA 4XOTA 3ONUA 3GVKA 2E1RA 4P6YA 2DCUA 1WOOA 3V76A 4P9SA 4MYTA 1QGYA 4XKVA 1F60A 4Z4RA 5FO0A 2VYQA 1UD6A 1W0JA 3AVVA 3LO8A 1WSVA 4G1BA 1DG1G 1YIJB 1NBMA 1KK2A 2ZITA 4WZLA 2VNIA 2BM1A 2XZPA 3WQZA 5IYWA 5AN9A 2XZOA 1PJ5A 3E20A 3V7AA 4ZV4A 4X7FA 3W2FA 2DETA 3ONYA 4L8JA 2D3LA 1U2RA 1I7PA 1UD4A 1QFJA 1EWYA 1OHHA 3OW7A 5F4OA 1RQPA 3FJOA 1ZUNB 4TMXA 5IK2A 4DQLA 1TTTA 2GPJA 2ZTNA 2W6JA 3B82A 3LQ6A 2I1LA 4TSFA 4X7CA 3PVDA 4X0CA 2GK6A 3WY9A 2B7BA 3JQRA 2C5HA 3AVYA 2D9RA 3JQQA 1VQLB 4QHYA 4RD1A 4XLHA 3W2EA 3FPKA 2WR8A 3CPXA 4Z1MA 3U6KA 1NDHA 3PUNA 1QH0A 1N0VC 1JA0A 1W0KA 3CPWB 5A8AA 1CNFA 4XN0A 5FL7A 3G6EB 2E1BA 3BQJA 1D1NA 1XB2A 5A88A 1HVXA 2HMAA 2OBSA 5DS0A 3CCQB 1I8DA 3WBJA 1G7TA 3Q39A 4TT3A 1VHOA 4LBVA 3U2QA 4B44A 3T53B 2YWFA 3A1PA 2ZZQA 1E79A 2RC6A 5B6IA 1F20A 4C43A 1G7SA 2M5SA 1VLOA 4RM0A 4DQKA 1K28D 4X7EA 3WBKA 3LVBA 1R5BA 1KJZA 3CC4B 1VQOB 2V7QA 2GJKA 3WXMA 3A35A 3T51B 4M0LA 4OP7A 4P25A 3OJWA 1EP1B 4X7DA 2HCJB 1TVCA 3OOCA 2V4DA 1IB0A 3FKSA 4PAAA 1JJ2B 5CDFA 2GJRA 1Y0RA 3Q6RA 3ZZ0A 3W5UA 1T6YA 3P27A 1OGJA 2Q6OA 3ASSA 4XL9A 4PC3A 2WSSA 3WNBA 1CNEA 3KL9A 3CCMB 3GVJA 4F7DA 2YWHA 1VHEA 3T56B 3FPPA 4XD7A 4WZTA 3OEEA 4LBWA 4NBSA 2DY1A 1WOSA 4M1KA 4ZGNB 3MMPA 4G1VA 4B4DA 3CCUB 1OB0A 1GVHA 1V0FA 3A3GA 3VMFA 2FVGA 1QVGB 1HA3A 3OW2B 2ZZGA 1FNMA 4N3GA 1OB2A 2DIEA 1Q7YD 4X8IA 4LBYA 2DYIA 3ZPNA 1QVFB 1EFTA 1XQBA 3VO2A 1QGAA 2VJIA 1DDGA 1YJNB 4AVZA 1FRQA 1COWA 1YLOA 2PIAA 1E1QA 2R9VA 1ZM2A 4Y9UA 4XMYA 4ZCIA 3VR6A 5HZBA 3Q6QA 4U9UA 2VZLA 3CESA 4OPOA 3VNVA 1Q82D 1M1KD 1K8AD 2PE3A 4RD3A 4YHBA 1EFRA 4P3IA 3WNCA 5BSXA 2JJ1A 4P22A 1E1RA 3CRZA 5TY0A 4K1XA 4PC7A 4P1VA 3CXCB 2P3MA 1QX4A 4RCYA 1S72B 1YHQB 4Z4TA 1CQXA 1R5NA 3OAAA 4P26A 3AVXA 2C77A 2VBVA 3A8IA 2BGIA 5FNZA 1PJ6A 4TN1A 3OKXA 1NB9A 4RCZA 1TLLA 3MHPA 3CMEB 4II2A 4P3YA 4PC6A 3AVTA 1YITB 4Z4SA 4ROXA 5L46A 1NJID 2J7KA 4G7WA 5BSYA 1JB9A 2CK3A 1FX0A 3W5HA 5IYNA 2GQFA 4DK0A 4UZFA 4B47A 4NCNA 2OTLB 2CW5A 2VNKA 3D26A 5GV7A 4KKUA 2CBXA 2XEXA 3W2GA 2V7XA 1H85A 2C78A 4Y7CA 4YEJA 3OPOA 5IYRA 2C4UA 2X6XA 4P6VF 1BQEA 1JA1A 1FNBA 2V7WA 3CMMA 2QMUA 3OE7A 1VQKB 2BVNA 1MABA 4AF6A 1WOPA 1BPLA 1YJWB 1WTHD 5TRDA 1N8RD 1RQRA 2QTZA 3R6JA 3HAGA 4B3GA 4JMQA 2BPOA 2WPDA 2V31A 1OB5A 5DN6A 4YALA 1Y0YA 2BMWA 2PMDA 2RC5A 4Y9RA 1K9MD 3B8HA 1KMHA 2NPFA 1VQ4B 2VBUA 3CC2B 1KZLA 2EIXA 2XNCA 4XR6A 4G5GA 4E0FA 2LZJA 3A8KA 1H8EA 5DSZA 3PENA 1S0UA 1M90D 1QGZA 2WJYA 5FA6A 3OZVA 1GAQA 2BM0A 3CW2A 1MRZA 1IJEA 1GJRA 2C5BA 4XM3A 1EFUA 1E3XA 1KRHA 1QFYA 1K73D 1KK3A 4Z4YA 1T6ZA 1EP3B 5KNLA 3Q3AA 2X0KA 4XNFA 1E43A 1N07A 1D2EA 1I18A 1UMKA 1BX1A 1VQMB 2C4TA 5HZAA 3ASTA 3DDYA 1W87A 3W5VA 2ZTGA 3A3BA 4RDLA 2W6IA 4HE6A 1BMFA 2YWGA 1EXMA 1VJSA 2BV3A 1Q81D 4UZUA 4ZGQB 5HXBA 3QFSA 3G4SB 2DOGA 2ZXIA 2OK8A 4XLAA 2GJPA 1W34A 1GR1A 4FK8A 1A8PA 2OBTA 4MYUA 1AIPA 4X06A 3Q38A 4XORA 5F4MA 1R5OA 4RD6A 3J81k 1Q86D 1NB0A 2CF4A 1P4MA 4WWVA 2X6YA 4X05A 4XONA 1FNDA 3CCEB 1VQPB 2NV4A 4B43A 3SJZA 3SEJA 4AC9A 2WZNA 4WZEA 3BCFA 5HKKA 1KD1D 1GAWA 3QFRA
chains in the Genus database with same CATH topology
2NV4A 3OKXA 1XQBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NV4 A;  3OKX A;  1XQB A; 
#chains in the Genus database with same CATH topology
 2Z6B D;  4BPR A;  2EFG A;  3ASR A;  3JQP A;  3BC9 A;  1IJF A;  3OFN A;  5KSW B;  1NRK A;  3LQE A;  2QN6 A;  3OZU A;  4N3N A;  1QG0 A;  4ASU A;  3OZW A;  2X3U A;  3SLD A;  3H9N A;  1VQN B;  2X85 A;  1YI2 B;  1N0U A;  1BJK A;  2D74 A;  4XLC A;  4XQF A;  1GO2 A;  4PAB A;  1EFC A;  4QFM A;  4YEL A;  4QVJ A;  4DNR B;  1FNC A;  1WSR A;  2F43 A;  3QFC A;  3CB4 A;  1VF7 A;  1WP6 A;  3ZZU A;  4DK1 A;  1QFZ A;  4OPV A;  4G7X A;  1W2B B;  2QEX B;  5J3O A;  3RY8 A;  1E62 A;  4RPD A;  1G7C A;  4RLZ A;  2BSA A;  2GK7 A;  2FX3 A;  4YAO A;  4M2L A;  4FXU A;  1T5E A;  1UD2 A;  1D8T A;  4Q7J B;  4CQJ A;  4KKT A;  2F4N A;  2JDI A;  3E1Y E;  4TMW A;  3ZC3 A;  1UD8 A;  4EH1 A;  2XND A;  2BN4 A;  4XN3 A;  1E64 A;  2ZL5 A;  2AHO A;  1FRN A;  2VJJ A;  2VNJ A;  3GIR A;  3PUM A;  4RD4 A;  2JN9 A;  3OEH A;  4DNT B;  1IHM A;  4TMZ A;  1BLI A;  3CCS B;  4ACA A;  3WYA A;  1E3Z A;  3LNN A;  4XOP A;  2ZBV A;  1HZE A;  4M53 A;  1W9X A;  2ZZF A;  3CP8 A;  4TMT A;  4OOS A;  2OTJ B;  3I1F A;  3R6K A;  4RD2 A;  4P2N A;  5IYP A;  3BH4 A;  2CND A;  3H94 A;  1WOR A;  2GRE A;  4YAW A;  5FIU A;  1Q9S A;  4P12 A;  2Q6I A;  1ZM4 A;  1H8H A;  2VBS A;  3JU4 A;  3ISX A;  4RDJ A;  4HE5 A;  2XZL A;  1N06 A;  2WYR A;  1N05 A;  4XKW A;  3A8J A;  4YAF A;  3SJP A;  4UZE A;  3I56 B;  4GQN A;  3WND A;  2QDX A;  3CD6 B;  1KC8 D;  2V7V A;  2OK7 A;  5JBQ A;  3U6B A;  3AVU A;  2Q6K A;  5H59 A;  1PKV A;  2F1L A;  2V7T A;  4WQM A;  2V7U A;  2OYN A;  5J35 A;  3CCV B;  2QE7 A;  2VNH A;  2CRV A;  1V0E A;  1KQS B;  1E63 A;  3GQB A;  1FDR A;  4RPB A;  3BNW A;  3KEW A;  1PJ7 A;  2XNJ A;  2DEU A;  2DER A;  3B78 A;  4WZK A;  2R6H A;  3ZBT A;  3CCJ B;  1VQ8 B;  2X6W A;  4TKO B;  5EMN A;  3I55 B;  2BGJ A;  3SKB A;  5KW9 A;  1W35 A;  4HIZ A;  4IW3 B;  4UAJ A;  5TV2 A;  3ZIA A;  2XOK A;  3PA1 A;  1SM4 A;  1QUE A;  4OOX A;  1S4M A;  4NNJ A;  2HLD A;  2C2W A;  2VBT A;  4XLF A;  4KKS A;  1VLY A;  2WZP P;  4R71 A;  2YWE A;  2X8K A;  3W2H A;  1N08 A;  3VNU A;  4Z4Z A;  4RD0 A;  3CCL B;  2PLF A;  1J9Z A;  3G71 B;  4G6I A;  3ASQ A;  3OJX A;  3QFT A;  4PGO A;  1JNY A;  2D3N A;  2F1M A;  2WJV A;  4QUZ A;  2KVO A;  4RDK A;  5GV8 A;  1VQ9 B;  5FO1 A;  1T6X A;  3AGQ A;  3AGP A;  1SKY B;  3QSY A;  3GSI A;  4AF7 A;  1BX0 A;  1XE1 A;  2QA4 B;  3W2I A;  3ES9 A;  2ZBU A;  4B3X A;  3BY1 A;  3ZZT A;  2JIZ A;  3CC7 B;  2ZL6 A;  2X53 S;  4H9G A;  3QE2 A;  4FWT A;  1WPC A;  2HDN B;  4QV2 A;  1V5V A;  2QTL A;  3BCD A;  3CCR B;  1VQ6 B;  3MCA A;  1YX2 A;  4Z4U A;  4II3 A;  4Z4W A;  4J0Q A;  4LC0 A;  3VO1 A;  1EP2 B;  1TUI A;  5TR9 A;  4B3F X;  4X07 A;  1KTV A;  2OBR A;  4QVA A;  5LMZ A;  3OP1 A;  2Q6L A;  3ASP A;  4OOV A;  4B48 A;  1DAR A;  3SLN A;  4RJL A;  1AMO A;  1B2R A;  4OPS A;  1ZM9 A;  4C0S A;  3ZBU A;  4M4S A;  1KK0 A;  3NE5 B;  1OGI A;  3CMA B;  1DDI A;  3BY2 A;  5E6T A;  1QUF A;  1ZM3 A;  3AVW A;  1WDT A;  4YXW A;  2QGG A;  3PA2 A;  5A89 A;  1VQ5 B;  4FN5 A;  1YJ9 B;  3P26 A;  3CP2 A;  2B5O A;  1ELO A;  1SKQ A;  2B7C A;  2CC2 A;  4YAU A;  2XGJ A;  1G7R A;  1UD5 A;  1VQ7 B;  4Z4V A;  5H5J A;  1B23 P;  3CTA A;  4PC2 A;  4LBZ A;  1H42 A;  1WU8 A;  4PC1 A;  4TMV A;  5F4J A;  4ZCM A;  2ZL7 A;  2ZXH A;  1KK1 A;  3G05 A;  4XLE A;  1XFO A;  5THX A;  5IYQ A;  2ZZE A;  3GVL A;  2JJ2 A;  2BF4 A;  1UD3 A;  4ZCL A;  3ZUG A;  4ACB A;  4XOT A;  3ONU A;  3GVK A;  2E1R A;  4P6Y A;  2DCU A;  1WOO A;  3V76 A;  4P9S A;  4MYT A;  1QGY A;  4XKV A;  1F60 A;  4Z4R A;  5FO0 A;  2VYQ A;  1UD6 A;  1W0J A;  3AVV A;  3LO8 A;  1WSV A;  4G1B A;  1DG1 G;  1YIJ B;  1NBM A;  1KK2 A;  2ZIT A;  4WZL A;  2VNI A;  2BM1 A;  2XZP A;  3WQZ A;  5IYW A;  5AN9 A;  2XZO A;  1PJ5 A;  3E20 A;  3V7A A;  4ZV4 A;  4X7F A;  3W2F A;  2DET A;  3ONY A;  4L8J A;  2D3L A;  1U2R A;  1I7P A;  1UD4 A;  1QFJ A;  1EWY A;  1OHH A;  3OW7 A;  5F4O A;  1RQP A;  3FJO A;  1ZUN B;  4TMX A;  5IK2 A;  4DQL A;  1TTT A;  2GPJ A;  2ZTN A;  2W6J A;  3B82 A;  3LQ6 A;  2I1L A;  4TSF A;  4X7C A;  3PVD A;  4X0C A;  2GK6 A;  3WY9 A;  2B7B A;  3JQR A;  2C5H A;  3AVY A;  2D9R A;  3JQQ A;  1VQL B;  4QHY A;  4RD1 A;  4XLH A;  3W2E A;  3FPK A;  2WR8 A;  3CPX A;  4Z1M A;  3U6K A;  1NDH A;  3PUN A;  1QH0 A;  1N0V C;  1JA0 A;  1W0K A;  3CPW B;  5A8A A;  1CNF A;  4XN0 A;  5FL7 A;  3G6E B;  2E1B A;  3BQJ A;  1D1N A;  1XB2 A;  5A88 A;  1HVX A;  2HMA A;  2OBS A;  5DS0 A;  3CCQ B;  1I8D A;  3WBJ A;  1G7T A;  3Q39 A;  4TT3 A;  1VHO A;  4LBV A;  3U2Q A;  4B44 A;  3T53 B;  2YWF A;  3A1P A;  2ZZQ A;  1E79 A;  2RC6 A;  5B6I A;  1F20 A;  4C43 A;  1G7S A;  2M5S A;  1VLO A;  4RM0 A;  4DQK A;  1K28 D;  4X7E A;  3WBK A;  3LVB A;  1R5B A;  1KJZ A;  3CC4 B;  1VQO B;  2V7Q A;  2GJK A;  3WXM A;  3A35 A;  3T51 B;  4M0L A;  4OP7 A;  4P25 A;  3OJW A;  1EP1 B;  4X7D A;  2HCJ B;  1TVC A;  3OOC A;  2V4D A;  1IB0 A;  3FKS A;  4PAA A;  1JJ2 B;  5CDF A;  2GJR A;  1Y0R A;  3Q6R A;  3ZZ0 A;  3W5U A;  1T6Y A;  3P27 A;  1OGJ A;  2Q6O A;  3ASS A;  4XL9 A;  4PC3 A;  2WSS A;  3WNB A;  1CNE A;  3KL9 A;  3CCM B;  3GVJ A;  4F7D A;  2YWH A;  1VHE A;  3T56 B;  3FPP A;  4XD7 A;  4WZT A;  3OEE A;  4LBW A;  4NBS A;  2DY1 A;  1WOS A;  4M1K A;  4ZGN B;  3MMP A;  4G1V A;  4B4D A;  3CCU B;  1OB0 A;  1GVH A;  1V0F A;  3A3G A;  3VMF A;  2FVG A;  1QVG B;  1HA3 A;  3OW2 B;  2ZZG A;  1FNM A;  4N3G A;  1OB2 A;  2DIE A;  1Q7Y D;  4X8I A;  4LBY A;  2DYI A;  3ZPN A;  1QVF B;  1EFT A;  1XQB A;  3VO2 A;  1QGA A;  2VJI A;  1DDG A;  1YJN B;  4AVZ A;  1FRQ A;  1COW A;  1YLO A;  2PIA A;  1E1Q A;  2R9V A;  1ZM2 A;  4Y9U A;  4XMY A;  4ZCI A;  3VR6 A;  5HZB A;  3Q6Q A;  4U9U A;  2VZL A;  3CES A;  4OPO A;  3VNV A;  1Q82 D;  1M1K D;  1K8A D;  2PE3 A;  4RD3 A;  4YHB A;  1EFR A;  4P3I A;  3WNC A;  5BSX A;  2JJ1 A;  4P22 A;  1E1R A;  3CRZ A;  5TY0 A;  4K1X A;  4PC7 A;  4P1V A;  3CXC B;  2P3M A;  1QX4 A;  4RCY A;  1S72 B;  1YHQ B;  4Z4T A;  1CQX A;  1R5N A;  3OAA A;  4P26 A;  3AVX A;  2C77 A;  2VBV A;  3A8I A;  2BGI A;  5FNZ A;  1PJ6 A;  4TN1 A;  3OKX A;  1NB9 A;  4RCZ A;  1TLL A;  3MHP A;  3CME B;  4II2 A;  4P3Y A;  4PC6 A;  3AVT A;  1YIT B;  4Z4S A;  4ROX A;  5L46 A;  1NJI D;  2J7K A;  4G7W A;  5BSY A;  1JB9 A;  2CK3 A;  1FX0 A;  3W5H A;  5IYN A;  2GQF A;  4DK0 A;  4UZF A;  4B47 A;  4NCN A;  2OTL B;  2CW5 A;  2VNK A;  3D26 A;  5GV7 A;  4KKU A;  2CBX A;  2XEX A;  3W2G A;  2V7X A;  1H85 A;  2C78 A;  4Y7C A;  4YEJ A;  3OPO A;  5IYR A;  2C4U A;  2X6X A;  4P6V F;  1BQE A;  1JA1 A;  1FNB A;  2V7W A;  3CMM A;  2QMU A;  3OE7 A;  1VQK B;  2BVN A;  1MAB A;  4AF6 A;  1WOP A;  1BPL A;  1YJW B;  1WTH D;  5TRD A;  1N8R D;  1RQR A;  2QTZ A;  3R6J A;  3HAG A;  4B3G A;  4JMQ A;  2BPO A;  2WPD A;  2V31 A;  1OB5 A;  5DN6 A;  4YAL A;  1Y0Y A;  2BMW A;  2PMD A;  2RC5 A;  4Y9R A;  1K9M D;  3B8H A;  1KMH A;  2NPF A;  1VQ4 B;  2VBU A;  3CC2 B;  1KZL A;  2EIX A;  2XNC A;  4XR6 A;  4G5G A;  4E0F A;  2LZJ A;  3A8K A;  1H8E A;  5DSZ A;  3PEN A;  1S0U A;  1M90 D;  1QGZ A;  2WJY A;  5FA6 A;  3OZV A;  1GAQ A;  2BM0 A;  3CW2 A;  1MRZ A;  1IJE A;  1GJR A;  2C5B A;  4XM3 A;  1EFU A;  1E3X A;  1KRH A;  1QFY A;  1K73 D;  1KK3 A;  4Z4Y A;  1T6Z A;  1EP3 B;  5KNL A;  3Q3A A;  2X0K A;  4XNF A;  1E43 A;  1N07 A;  1D2E A;  1I18 A;  1UMK A;  1BX1 A;  1VQM B;  2C4T A;  5HZA A;  3AST A;  3DDY A;  1W87 A;  3W5V A;  2ZTG A;  3A3B A;  4RDL A;  2W6I A;  4HE6 A;  1BMF A;  2YWG A;  1EXM A;  1VJS A;  2BV3 A;  1Q81 D;  4UZU A;  4ZGQ B;  5HXB A;  3QFS A;  3G4S B;  2DOG A;  2ZXI A;  2OK8 A;  4XLA A;  2GJP A;  1W34 A;  1GR1 A;  4FK8 A;  1A8P A;  2OBT A;  4MYU A;  1AIP A;  4X06 A;  3Q38 A;  4XOR A;  5F4M A;  1R5O A;  4RD6 A;  3J81 k;  1Q86 D;  1NB0 A;  2CF4 A;  1P4M A;  4WWV A;  2X6Y A;  4X05 A;  4XON A;  1FND A;  3CCE B;  1VQP B;  2NV4 A;  4B43 A;  3SJZ A;  3SEJ A;  4AC9 A;  2WZN A;  4WZE A;  3BCF A;  5HKK A;  1KD1 D;  1GAW A;  3QFR A; 
#chains in the Genus database with same CATH homology
 2NV4 A;  3OKX A;  1XQB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...