3OKXA

Crystal structure of yaeb-like protein from rhodopseudomonas palustris
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
159
structure length
156
Chain Sequence
DIRAGELASDWSGSPDAGVVFIGRIHTPWNRLKECPRHGRADGPVCRIEVFETWLPALAGIDDGTLLEVFYWLHRSRRDLLLQCPGDARGTFSIRSPLRPNPIGTSIARVDRRDGANLFIRGLDCLDGTPLVDLKPDRAEFMPLAPPKPGDFQVGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords YaeB-like protein RPA0152
publication title Crystal structure of YaeB-like protein from Rhodopseudomonas palustris
rcsb
source organism Rhodopseudomonas palustris
molecule tags Structural genomics, unknown function
total genus 34
structure length 156
sequence length 159
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01980 TrmO tRNA-methyltransferase O
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.70 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 YaeB-like 3okxA00
1XQBA 3OKXA 2NV4A
chains in the Genus database with same CATH superfamily
1F60A 1VLYA 4Y9UA 3WXMA 4AF6A 4F7DA 2VBSA 3ASSA 5CDFA 4J0QA 1NDHA 4XMYA 2RC5A 5AN9A 3MMPA 1QVFB 1AIPA 4ZCMA 5A89A 4M2LA 4X8IA 3H9NA 1RQRA 3E1YE 4WQMA 5J35A 4RPDA 3JU4A 2ZTNA 3T56B 4Z4RA 2HDNB 1JJ2B 3OW2B 1OB2A 2JN9A 4M53A 3SJZA 3CD6B 1VJSA 1JA0A 3PUMA 1Q81D 4RJLA 5J3OA 1QVGB 1VQ6B 3Q6RA 1Q82D 1DDGA 5IYRA 1KK0A 1H8HA 2BGIA 3G4SB 1UD8A 2OBSA 2W6IA 4M4SA 1H85A 2QDXA 2QE7A 3WNDA 4QV2A 3KEWA 4K1XA 1KK3A 4XLFA 4MYUA 4Z4SA 3H94A 3CCJB 1R5BA 2B7BA 3BY2A 3BCDA 4RD2A 3AVYA 4RM0A 1E79A 2QA4B 1WDTA 3Q38A 3CXCB 1E1QA 3SJPA 4KKSA 3GVJA 1BQEA 4HIZA 1K8AD 1CNFA 2DY1A 1QX4A 3FJOA 3ASTA 3OW7A 1V0FA 1GVHA 4NBSA 4ASUA 1GO2A 1U2RA 2GQFA 1W87A 3Q6QA 4XLCA 4Z4YA 1KD1D 4QFMA 4TMZA 1VQLB 1WSRA 2XOKA 2XZPA 2D3LA 1YLOA 4UZEA 4YAWA 2PIAA 5FIUA 2DCUA 1N8RD 4UAJA 2QEXB 3Q3AA 2BPOA 5BSYA 3A3BA 3I56B 3FPPA 2Q6IA 4TMWA 2XNCA 1I18A 1EFTA 2X8KA 1BPLA 1QFJA 1UMKA 1B23P 4C0SA 4HE5A 3ZZ0A 3GVKA 3I55B 1VHEA 3VMFA 4G5GA 2VNJA 3ZC3A 3QSYA 4OPSA 3BNWA 1R5OA 3P26A 4PC3A 4TKOB 1OGIA 4M0LA 3W5HA 1KC8D 1QGAA 4PABA 2C77A 2DIEA 4XLEA 3AGQA 2I1LA 3AVXA 2ZL5A 1YI2B 4B3GA 4G7WA 1WPCA 2C5HA 1E43A 2GK7A 2OBRA 2WYRA 4NNJA 3AVTA 1VHOA 4PC6A 2QN6A 2X0KA 4XQFA 3W2HA 4P1VA 4B47A 3ZUGA 2QMUA 1Y0YA 5A88A 3OOCA 2XZLA 3Q39A 4XNFA 3RY8A 2CF4A 1TUIA 4X06A 2ZZEA 3QFTA 1TVCA 1VF7A 2XNDA 1DARA 5E6TA 5TV2A 1XFOA 1CNEA 4ACAA 4XR6A 2C5BA 4Z4TA 3LVBA 2OBTA 2R6HA 3VO2A 1YJWB 5GV8A 4ZCLA 5HKKA 1EFRA 1COWA 1EWYA 1G7CA 1W0KA 2YWEA 2BVNA 3JQQA 4QUZA 3CCRB 4IW3B 1BMFA 4FN5A 4RD1A 3ZPNA 1QG0A 3HAGA 2XEXA 2VNKA 1QFYA 1PJ5A 2ZZFA 5LMZA 4WZLA 1TTTA 2BSAA 3AVUA 4R71A 3GVLA 4L8JA 3WBKA 2BN4A 1EP1B 3MHPA 1VQPB 3CC7B 2BGJA 5KSWB 2M5SA 4P2NA 2ZITA 4B3XA 4YELA 4DNTB 5B6IA 4QHYA 2V7XA 1VQ9B 1YHQB 1Q9SA 4UZFA 1UD3A 3W2FA 2D74A 4PGOA 3WYAA 2VNHA 1DG1G 5H59A 5JBQA 3T53B 1HA3A 1W2BB 2F1LA 3VNUA 4DQLA 3VNVA 5THXA 1SM4A 4ACBA 4DNRB 1QGZA 1VQ7B 2PMDA 1EFUA 1E1RA 1CQXA 3LO8A 3WBJA 4TMXA 4CQJA 3LQEA 1NJID 4ZGNB 2VNIA 4P12A 1XQBA 1W34A 5HZAA 4XLAA 1NBMA 5IYPA 2WZNA 1RQPA 2X6XA 2KVOA 3QFRA 1WOSA 4X07A 1IJFA 3SLDA 4P22A 2D9RA 3U2QA 3CCVB 2DEUA 1T5EA 2CNDA 4P3IA 3OFNA 3CCSB 1N0VC 2YWGA 1N0UA 4XKWA 3ASQA 4B44A 2Q6LA 1GAWA 1IHMA 1EXMA 2OTJB 2V7QA 3A3GA 3GSIA 3CB4A 4KKUA 1HZEA 3A35A 2DETA 3OEEA 5F4MA 2OTLB 5F4OA 4II2A 4YALA 2EIXA 1M1KD 1WU8A 4B43A 1KTVA 4RDLA 4RD0A 1T6YA 2QTZA 1E3XA 2VBUA 3R6KA 2V7WA 2GJRA 2LZJA 2NV4A 5KNLA 1EP3B 1QH0A 4RDJA 3OZVA 4RD3A 4XONA 1T6XA 3ISXA 4B48A 2GREA 3FPKA 3WQZA 2JJ2A 4TN1A 3OJWA 4G1BA 2EFGA 2HMAA 3A8JA 2BM1A 1NB0A 4M1KA 2ZL6A 1V0EA 3BCFA 2ZBUA 4LBYA 3ZZTA 3BQJA 2HLDA 2QGGA 3V76A 4XLHA 2JJ1A 4JMQA 4Q7JB 1WSVA 1IJEA 4ROXA 5GV7A 1VLOA 4B4DA 1JNYA 4YAUA 3OKXA 1VQ8B 1B2RA 1XB2A 5IYWA 4E0FA 3VO1A 4XN0A 1QUFA 4X05A 2Q6KA 5TY0A 2GJPA 1UD6A 2PE3A 1SKQA 2F43A 2NPFA 3ONYA 2C4TA 4RD4A 2Q6OA 5TR9A 3OAAA 4BPRA 4X7CA 4X7DA 1W9XA 3CP8A 3G71B 3E20A 4YXWA 2WSSA 1NRKA 4N3NA 1Q7YD 4PC7A 3W2IA 2DYIA 3KL9A 1VQOB 4ZGQB 1KJZA 5A8AA 2VZLA 4YEJA 5DSZA 3CCMB 1K28D 3GIRA 1Q86D 3R6JA 1FRQA 5FO1A 5FO0A 1HVXA 4G7XA 4P9SA 3CW2A 3OJXA 1FX0A 3QFSA 1KZLA 2E1RA 4Z1MA 3T51B 3B82A 2P3MA 3OEHA 4AF7A 4C43A 1J9ZA 3QFCA 2D3NA 2VBVA 3ASPA 4II3A 3U6KA 2J7KA 1WOOA 4DK0A 4H9GA 1YJ9B 4RLZA 4FXUA 1YIJB 4P26A 3FKSA 3OP1A 2WR8A 3NE5B 3PUNA 3CPXA 3OE7A 2V7VA 1BX1A 1KMHA 4YHBA 1D1NA 4YAFA 1QFZA 3CTAA 1G7SA 4MYTA 2OK7A 4ZV4A 3CMMA 1N06A 4WWVA 1W35A 3WY9A 2OYNA 3A8KA 5IK2A 2E1BA 2F1MA 4OPVA 1E3ZA 4FWTA 1VQNB 1F20A 2AHOA 3WNCA 5FA6A 1T6ZA 2X6YA 3W5VA 1KK1A 2BMWA 3SEJA 1WTHD 2WJYA 5IYNA 1I7PA 4OOVA 1ZM9A 1JB9A 2ZL7A 3A1PA 5DN6A 3SKBA 2JIZA 2BF4A 1XE1A 1G7TA 4FK8A 2GJKA 1V5VA 4X7FA 3I1FA 3CPWB 1E64A 3J81k 1D8TA 1VQ4B 3SLNA 4XM3A 2X6WA 3PA2A 4B3FX 1VQKB 1ZM3A 1W0JA 4XL9A 3CC2B 3ES9A 3QE2A 4AVZA 1NB9A 3CRZA 1FNDA 5F4JA 1VQMB 3CCQB 1BX0A 1FNCA 4HE6A 3CCLB 1I8DA 2ZZQA 4Y7CA 1FRNA 1AMOA 4ZCIA 4TSFA 2XGJA 1OB5A 2V4DA 4TT3A 2ZXIA 3PVDA 3ZBUA 5HXBA 2V31A 1OGJA 4P6YA 3CMEB 2B5OA 1PJ6A 1OB0A 1M90D 1PKVA 1MABA 2HCJB 4Z4VA 2OK8A 3PA1A 2GPJA 4OP7A 2X85A 4RCZA 3ZBTA 3W5UA 1VQ5B 4Z4ZA 1SKYB 3D26A 2XNJA 4PC2A 4XOTA 1N07A 4G1VA 1G7RA 3CC4B 1E62A 1KRHA 4P25A 5FNZA 3VR6A 1TLLA 4X0CA 2WPDA 4LBZA 2ZBVA 1PJ7A 2FX3A 2CRVA 3A8IA 4AC9A 2ZTGA 2C4UA 2ZZGA 2C78A 4RD6A 3LNNA 1A8PA 2BM0A 2F4NA 3ONUA 3CESA 1S72B 2VJJA 3OZWA 4XORA 3JQPA 2QTLA 2RC6A 2B7CA 4Z4UA 3G6EB 2PLFA 1K9MD 4WZEA 4OOXA 2CC2A 4XD7A 5BSXA 3CCEB 4YAOA 5H5JA 1YX2A 3CCUB 5FL7A 5L46A 3ASRA 4UZUA 1D2EA 2YWHA 2VYQA 1N08A 3AGPA 4GQNA 4XN3A 4QVJA 2WJVA 1GJRA 2CK3A 4PC1A 3DDYA 1UD2A 3G05A 3V7AA 1WOPA 5HZBA 5IYQA 1OHHA 4NCNA 4WZTA 3JQRA 1YJNB 4LBVA 2VBTA 4XOPA 1QGYA 1BJKA 1ZM2A 2CBXA 4DQKA 3BY1A 3W2GA 5EMNA 3GQBA 1R5NA 2X3UA 3B8HA 3CMAB 5TRDA 4EH1A 1WP6A 1GAQA 3AVVA 1IB0A 4N3GA 1S4MA 1ZM4A 4KKTA 2W6JA 2X53S 3ZZUA 1KQSB 4PAAA 4RPBA 1QUEA 1S0UA 4XKVA 2DERA 4TMTA 1E63A 1FDRA 2DOGA 3MCAA 3CP2A 3AVWA 1H42A 2VJIA 3OPOA 4U9UA 3PENA 1JA1A 2GK6A 1DDIA 2C2WA 1EFCA 1FNBA 1UD5A 2YWFA 4WZKA 3OZUA 1MRZA 4DK1A 2R9VA 4LC0A 2Z6BD 1KK2A 1K73D 4RCYA 2ZXHA 4X7EA 3BH4A 5DS0A 3U6BA 2WZPP 4Z4WA 3W2EA 1N05A 3ZIAA 1YITB 1H8EA 4P3YA 2FVGA 4OOSA 4TMVA 1Y0RA 1BLIA 3WNBA 3P27A 4OPOA 4RDKA 1FNMA 1EP2B 2BV3A 2V7UA 2V7TA 2CW5A 4Y9RA 1ZUNB 4QVAA 4P6VF 1UD4A 4G6IA 3B78A 5KW9A 2XZOA 3LQ6A 2JDIA 1GR1A 1P4MA 1ELOA 4LBWA 3BC9A 1WORA
chains in the Genus database with same CATH topology
1XQBA 3OKXA 2NV4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XQB A;  3OKX A;  2NV4 A; 
#chains in the Genus database with same CATH topology
 1F60 A;  1VLY A;  4Y9U A;  3WXM A;  4AF6 A;  4F7D A;  2VBS A;  3ASS A;  5CDF A;  4J0Q A;  1NDH A;  4XMY A;  2RC5 A;  5AN9 A;  3MMP A;  1QVF B;  1AIP A;  4ZCM A;  5A89 A;  4M2L A;  4X8I A;  3H9N A;  1RQR A;  3E1Y E;  4WQM A;  5J35 A;  4RPD A;  3JU4 A;  2ZTN A;  3T56 B;  4Z4R A;  2HDN B;  1JJ2 B;  3OW2 B;  1OB2 A;  2JN9 A;  4M53 A;  3SJZ A;  3CD6 B;  1VJS A;  1JA0 A;  3PUM A;  1Q81 D;  4RJL A;  5J3O A;  1QVG B;  1VQ6 B;  3Q6R A;  1Q82 D;  1DDG A;  5IYR A;  1KK0 A;  1H8H A;  2BGI A;  3G4S B;  1UD8 A;  2OBS A;  2W6I A;  4M4S A;  1H85 A;  2QDX A;  2QE7 A;  3WND A;  4QV2 A;  3KEW A;  4K1X A;  1KK3 A;  4XLF A;  4MYU A;  4Z4S A;  3H94 A;  3CCJ B;  1R5B A;  2B7B A;  3BY2 A;  3BCD A;  4RD2 A;  3AVY A;  4RM0 A;  1E79 A;  2QA4 B;  1WDT A;  3Q38 A;  3CXC B;  1E1Q A;  3SJP A;  4KKS A;  3GVJ A;  1BQE A;  4HIZ A;  1K8A D;  1CNF A;  2DY1 A;  1QX4 A;  3FJO A;  3AST A;  3OW7 A;  1V0F A;  1GVH A;  4NBS A;  4ASU A;  1GO2 A;  1U2R A;  2GQF A;  1W87 A;  3Q6Q A;  4XLC A;  4Z4Y A;  1KD1 D;  4QFM A;  4TMZ A;  1VQL B;  1WSR A;  2XOK A;  2XZP A;  2D3L A;  1YLO A;  4UZE A;  4YAW A;  2PIA A;  5FIU A;  2DCU A;  1N8R D;  4UAJ A;  2QEX B;  3Q3A A;  2BPO A;  5BSY A;  3A3B A;  3I56 B;  3FPP A;  2Q6I A;  4TMW A;  2XNC A;  1I18 A;  1EFT A;  2X8K A;  1BPL A;  1QFJ A;  1UMK A;  1B23 P;  4C0S A;  4HE5 A;  3ZZ0 A;  3GVK A;  3I55 B;  1VHE A;  3VMF A;  4G5G A;  2VNJ A;  3ZC3 A;  3QSY A;  4OPS A;  3BNW A;  1R5O A;  3P26 A;  4PC3 A;  4TKO B;  1OGI A;  4M0L A;  3W5H A;  1KC8 D;  1QGA A;  4PAB A;  2C77 A;  2DIE A;  4XLE A;  3AGQ A;  2I1L A;  3AVX A;  2ZL5 A;  1YI2 B;  4B3G A;  4G7W A;  1WPC A;  2C5H A;  1E43 A;  2GK7 A;  2OBR A;  2WYR A;  4NNJ A;  3AVT A;  1VHO A;  4PC6 A;  2QN6 A;  2X0K A;  4XQF A;  3W2H A;  4P1V A;  4B47 A;  3ZUG A;  2QMU A;  1Y0Y A;  5A88 A;  3OOC A;  2XZL A;  3Q39 A;  4XNF A;  3RY8 A;  2CF4 A;  1TUI A;  4X06 A;  2ZZE A;  3QFT A;  1TVC A;  1VF7 A;  2XND A;  1DAR A;  5E6T A;  5TV2 A;  1XFO A;  1CNE A;  4ACA A;  4XR6 A;  2C5B A;  4Z4T A;  3LVB A;  2OBT A;  2R6H A;  3VO2 A;  1YJW B;  5GV8 A;  4ZCL A;  5HKK A;  1EFR A;  1COW A;  1EWY A;  1G7C A;  1W0K A;  2YWE A;  2BVN A;  3JQQ A;  4QUZ A;  3CCR B;  4IW3 B;  1BMF A;  4FN5 A;  4RD1 A;  3ZPN A;  1QG0 A;  3HAG A;  2XEX A;  2VNK A;  1QFY A;  1PJ5 A;  2ZZF A;  5LMZ A;  4WZL A;  1TTT A;  2BSA A;  3AVU A;  4R71 A;  3GVL A;  4L8J A;  3WBK A;  2BN4 A;  1EP1 B;  3MHP A;  1VQP B;  3CC7 B;  2BGJ A;  5KSW B;  2M5S A;  4P2N A;  2ZIT A;  4B3X A;  4YEL A;  4DNT B;  5B6I A;  4QHY A;  2V7X A;  1VQ9 B;  1YHQ B;  1Q9S A;  4UZF A;  1UD3 A;  3W2F A;  2D74 A;  4PGO A;  3WYA A;  2VNH A;  1DG1 G;  5H59 A;  5JBQ A;  3T53 B;  1HA3 A;  1W2B B;  2F1L A;  3VNU A;  4DQL A;  3VNV A;  5THX A;  1SM4 A;  4ACB A;  4DNR B;  1QGZ A;  1VQ7 B;  2PMD A;  1EFU A;  1E1R A;  1CQX A;  3LO8 A;  3WBJ A;  4TMX A;  4CQJ A;  3LQE A;  1NJI D;  4ZGN B;  2VNI A;  4P12 A;  1XQB A;  1W34 A;  5HZA A;  4XLA A;  1NBM A;  5IYP A;  2WZN A;  1RQP A;  2X6X A;  2KVO A;  3QFR A;  1WOS A;  4X07 A;  1IJF A;  3SLD A;  4P22 A;  2D9R A;  3U2Q A;  3CCV B;  2DEU A;  1T5E A;  2CND A;  4P3I A;  3OFN A;  3CCS B;  1N0V C;  2YWG A;  1N0U A;  4XKW A;  3ASQ A;  4B44 A;  2Q6L A;  1GAW A;  1IHM A;  1EXM A;  2OTJ B;  2V7Q A;  3A3G A;  3GSI A;  3CB4 A;  4KKU A;  1HZE A;  3A35 A;  2DET A;  3OEE A;  5F4M A;  2OTL B;  5F4O A;  4II2 A;  4YAL A;  2EIX A;  1M1K D;  1WU8 A;  4B43 A;  1KTV A;  4RDL A;  4RD0 A;  1T6Y A;  2QTZ A;  1E3X A;  2VBU A;  3R6K A;  2V7W A;  2GJR A;  2LZJ A;  2NV4 A;  5KNL A;  1EP3 B;  1QH0 A;  4RDJ A;  3OZV A;  4RD3 A;  4XON A;  1T6X A;  3ISX A;  4B48 A;  2GRE A;  3FPK A;  3WQZ A;  2JJ2 A;  4TN1 A;  3OJW A;  4G1B A;  2EFG A;  2HMA A;  3A8J A;  2BM1 A;  1NB0 A;  4M1K A;  2ZL6 A;  1V0E A;  3BCF A;  2ZBU A;  4LBY A;  3ZZT A;  3BQJ A;  2HLD A;  2QGG A;  3V76 A;  4XLH A;  2JJ1 A;  4JMQ A;  4Q7J B;  1WSV A;  1IJE A;  4ROX A;  5GV7 A;  1VLO A;  4B4D A;  1JNY A;  4YAU A;  3OKX A;  1VQ8 B;  1B2R A;  1XB2 A;  5IYW A;  4E0F A;  3VO1 A;  4XN0 A;  1QUF A;  4X05 A;  2Q6K A;  5TY0 A;  2GJP A;  1UD6 A;  2PE3 A;  1SKQ A;  2F43 A;  2NPF A;  3ONY A;  2C4T A;  4RD4 A;  2Q6O A;  5TR9 A;  3OAA A;  4BPR A;  4X7C A;  4X7D A;  1W9X A;  3CP8 A;  3G71 B;  3E20 A;  4YXW A;  2WSS A;  1NRK A;  4N3N A;  1Q7Y D;  4PC7 A;  3W2I A;  2DYI A;  3KL9 A;  1VQO B;  4ZGQ B;  1KJZ A;  5A8A A;  2VZL A;  4YEJ A;  5DSZ A;  3CCM B;  1K28 D;  3GIR A;  1Q86 D;  3R6J A;  1FRQ A;  5FO1 A;  5FO0 A;  1HVX A;  4G7X A;  4P9S A;  3CW2 A;  3OJX A;  1FX0 A;  3QFS A;  1KZL A;  2E1R A;  4Z1M A;  3T51 B;  3B82 A;  2P3M A;  3OEH A;  4AF7 A;  4C43 A;  1J9Z A;  3QFC A;  2D3N A;  2VBV A;  3ASP A;  4II3 A;  3U6K A;  2J7K A;  1WOO A;  4DK0 A;  4H9G A;  1YJ9 B;  4RLZ A;  4FXU A;  1YIJ B;  4P26 A;  3FKS A;  3OP1 A;  2WR8 A;  3NE5 B;  3PUN A;  3CPX A;  3OE7 A;  2V7V A;  1BX1 A;  1KMH A;  4YHB A;  1D1N A;  4YAF A;  1QFZ A;  3CTA A;  1G7S A;  4MYT A;  2OK7 A;  4ZV4 A;  3CMM A;  1N06 A;  4WWV A;  1W35 A;  3WY9 A;  2OYN A;  3A8K A;  5IK2 A;  2E1B A;  2F1M A;  4OPV A;  1E3Z A;  4FWT A;  1VQN B;  1F20 A;  2AHO A;  3WNC A;  5FA6 A;  1T6Z A;  2X6Y A;  3W5V A;  1KK1 A;  2BMW A;  3SEJ A;  1WTH D;  2WJY A;  5IYN A;  1I7P A;  4OOV A;  1ZM9 A;  1JB9 A;  2ZL7 A;  3A1P A;  5DN6 A;  3SKB A;  2JIZ A;  2BF4 A;  1XE1 A;  1G7T A;  4FK8 A;  2GJK A;  1V5V A;  4X7F A;  3I1F A;  3CPW B;  1E64 A;  3J81 k;  1D8T A;  1VQ4 B;  3SLN A;  4XM3 A;  2X6W A;  3PA2 A;  4B3F X;  1VQK B;  1ZM3 A;  1W0J A;  4XL9 A;  3CC2 B;  3ES9 A;  3QE2 A;  4AVZ A;  1NB9 A;  3CRZ A;  1FND A;  5F4J A;  1VQM B;  3CCQ B;  1BX0 A;  1FNC A;  4HE6 A;  3CCL B;  1I8D A;  2ZZQ A;  4Y7C A;  1FRN A;  1AMO A;  4ZCI A;  4TSF A;  2XGJ A;  1OB5 A;  2V4D A;  4TT3 A;  2ZXI A;  3PVD A;  3ZBU A;  5HXB A;  2V31 A;  1OGJ A;  4P6Y A;  3CME B;  2B5O A;  1PJ6 A;  1OB0 A;  1M90 D;  1PKV A;  1MAB A;  2HCJ B;  4Z4V A;  2OK8 A;  3PA1 A;  2GPJ A;  4OP7 A;  2X85 A;  4RCZ A;  3ZBT A;  3W5U A;  1VQ5 B;  4Z4Z A;  1SKY B;  3D26 A;  2XNJ A;  4PC2 A;  4XOT A;  1N07 A;  4G1V A;  1G7R A;  3CC4 B;  1E62 A;  1KRH A;  4P25 A;  5FNZ A;  3VR6 A;  1TLL A;  4X0C A;  2WPD A;  4LBZ A;  2ZBV A;  1PJ7 A;  2FX3 A;  2CRV A;  3A8I A;  4AC9 A;  2ZTG A;  2C4U A;  2ZZG A;  2C78 A;  4RD6 A;  3LNN A;  1A8P A;  2BM0 A;  2F4N A;  3ONU A;  3CES A;  1S72 B;  2VJJ A;  3OZW A;  4XOR A;  3JQP A;  2QTL A;  2RC6 A;  2B7C A;  4Z4U A;  3G6E B;  2PLF A;  1K9M D;  4WZE A;  4OOX A;  2CC2 A;  4XD7 A;  5BSX A;  3CCE B;  4YAO A;  5H5J A;  1YX2 A;  3CCU B;  5FL7 A;  5L46 A;  3ASR A;  4UZU A;  1D2E A;  2YWH A;  2VYQ A;  1N08 A;  3AGP A;  4GQN A;  4XN3 A;  4QVJ A;  2WJV A;  1GJR A;  2CK3 A;  4PC1 A;  3DDY A;  1UD2 A;  3G05 A;  3V7A A;  1WOP A;  5HZB A;  5IYQ A;  1OHH A;  4NCN A;  4WZT A;  3JQR A;  1YJN B;  4LBV A;  2VBT A;  4XOP A;  1QGY A;  1BJK A;  1ZM2 A;  2CBX A;  4DQK A;  3BY1 A;  3W2G A;  5EMN A;  3GQB A;  1R5N A;  2X3U A;  3B8H A;  3CMA B;  5TRD A;  4EH1 A;  1WP6 A;  1GAQ A;  3AVV A;  1IB0 A;  4N3G A;  1S4M A;  1ZM4 A;  4KKT A;  2W6J A;  2X53 S;  3ZZU A;  1KQS B;  4PAA A;  4RPB A;  1QUE A;  1S0U A;  4XKV A;  2DER A;  4TMT A;  1E63 A;  1FDR A;  2DOG A;  3MCA A;  3CP2 A;  3AVW A;  1H42 A;  2VJI A;  3OPO A;  4U9U A;  3PEN A;  1JA1 A;  2GK6 A;  1DDI A;  2C2W A;  1EFC A;  1FNB A;  1UD5 A;  2YWF A;  4WZK A;  3OZU A;  1MRZ A;  4DK1 A;  2R9V A;  4LC0 A;  2Z6B D;  1KK2 A;  1K73 D;  4RCY A;  2ZXH A;  4X7E A;  3BH4 A;  5DS0 A;  3U6B A;  2WZP P;  4Z4W A;  3W2E A;  1N05 A;  3ZIA A;  1YIT B;  1H8E A;  4P3Y A;  2FVG A;  4OOS A;  4TMV A;  1Y0R A;  1BLI A;  3WNB A;  3P27 A;  4OPO A;  4RDK A;  1FNM A;  1EP2 B;  2BV3 A;  2V7U A;  2V7T A;  2CW5 A;  4Y9R A;  1ZUN B;  4QVA A;  4P6V F;  1UD4 A;  4G6I A;  3B78 A;  5KW9 A;  2XZO A;  3LQ6 A;  2JDI A;  1GR1 A;  1P4M A;  1ELO A;  4LBW A;  3BC9 A;  1WOR A; 
#chains in the Genus database with same CATH homology
 1XQB A;  3OKX A;  2NV4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...