4ACAA

Crystal structure of translation elongation factor selb from methanococcus maripaludis, apo form
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
469
structure length
444
Chain Sequence
HMDFKNINLGIFGHIDHGKTTLSKVLTEIGFSAFKLENYRITLVDAPGHADLIRAVVSAADIIDLALIVVDAKEGPKTQTGEHMLILDHFNIPIIVVITKSDNAGTEEIKRTEMIMKSILQSTHNLKNSSIIPISAKTGFGVDELKNLIITTLNNAEIIRNTESYFKMPLDHAFPIKGAGTVVTGTINKGIVKVGDELKVLPINMSTKVRSIQYFKESVMEAKAGDRVGMAIQGVDAKQIYRGILTSKDTKLQTVDKIVAKIKISDIFKYNLTPKMKVHLNVGMLIVPAVAVPFKKVTFGKTEENIILNEVISGNEYAFELEEKVLAEVGDRVLITRLDLPPTTLRIGHGLIEEFKPIKDLNIKKEVLREGKVKIDKGRTVIDGLAQSKVAAEKLIGEEISIEGKDIVGKIKGTFGTKGLLTAEFSGNVENRDKVILNRLRRWG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Translation
molecule keywords TRANSLATION ELONGATION FACTOR SELB
publication title Selenocysteine tRNA-Specific Elongation Factor Selb is a Structural Chimaera of Elongation and Initiation Factors.
pubmed doi rcsb
source organism Methanococcus maripaludis
total genus 98
structure length 444
sequence length 469
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.190 Mainly Beta Beta Barrel Thrombin, subunit H translation elongation factor selb, chain A, domain 4 4acaA04
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4acaA02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4acaA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4acaA01
1Q3TA 2R6FA 5JHHB 4ITRC 3HU2A 4QGGA 3P27A 4Z8XA 1S8FA 4BGDA 1IB0A 1E9EA 4HUQB 2IS2A 2X1VA 1OB5A 1EESA 4R71A 2VP5A 4FIDA 2C99A 4ZPXA 3K9LA 1W0JD 4PHTA 4B4DA 1DAGA 1F5NA 5KDDA 2V6IA 3ADBA 1CXZA 4MKIA 4PC1A 2C5LA 2RC5A 4UNRA 2EFGA 1B23P 1YZNA 3IUYA 4OK5A 1T3SA 1ZJ6A 2J5XA 2H17A 1U90A 3ND9A 4JT2A 4LCBA 2JLYA 2O0KA 3SJZA 4XD7D 4Q4AB 2FV8A 3IQXA 4HB4A 2R2AA 3UPUA 2O5VA 1G7SA 3HR8A 2VRWA 3HWSA 5J4YA 5EQTA 1TF2A 1N6RA 1Q1QA 1UDWA 5FR2A 4RCZA 1T9HA 3ADKA 3EC1A 3CRMA 1U0LA 4GT1A 1HURA 3T35A 1HA3A 2V9PA 1IN7A 4GOJA 2D4HA 1S3SA 3DKPA 4JLDA 5CM9C 2OM2A 4PHHA 1KI6A 4XTCS 5G40A 4DSTA 1JECA 1II8B 2A7QA 4M8NE 1JEEA 1HE1C 3ETLA 4BZXA 4Y0AA 2BM1A 4HUTA 1OH5A 5DSZA 5C4GB 3I56B 3CCJB 1ZC3A 2H1LA 5JSZB 3U61B 3QY0A 3JQRA 4NYJQ 4IFBA 1T5IA 1G17A 5EP3A 2NMVA 2DB3A 2B8TA 2IUUA 3U6KA 4Y7CA 3RSLA 1KY3A 2MMCA 5GADl 4JBWA 4OQFA 2WJGA 4KVGA 4N3NA 1DAHA 3TAHA 2ZXUA 2X3UA 3A1TA 3MG9A 3OE7A 4FCTA 1RRPA 3EARA 3PEVA 4C0LA 4YMVA 3F3YA 4A15A 4Q1FA 2P65A 3L0OA 4KVAA 3MWYW 3CWZA 1COWD 3CNOA 3A4NA 4MRNA 4LWZA 1A5TA 2G9NA 2Q21A 2PX3A 2JLVA 4ZGNB 1NSFA 2VNIA 5BWMA 3MRSA 4DB2A 4D25A 2GA8A 1N2CE 1VHLA 1QHYA 1W0JA 2P6NA 2VLIA 4KAXA 4OJKA 2HLDD 2A5YB 2DPXA 4PQYA 4PPQA 4G1BA 3PEUA 5EE0A 3U2QA 4URXR 1BX1A 5SZIA 5CK4A 1EWQA 5JZVA 2JA1A 3EXAA 4ERNA 4XD7A 3X1WA 3CW2A 3Q7QA 3S1AA 2WZQA 2IT1A 4MGYR 1LY1A 4P32A 4NZYA 1CR0A 1R5NA 2ZR7A 1U2RA 3ICQB 1SVSA 4OHYA 1G16A 2IYTA 3GLGE 3SC3A 2IF0A 1AS3A 2ZI9A 4LHYA 3QOFA 1UBCA 5FPTA 1KI1A 5KNBA 1UADA 1LS6A 2NO0A 1KAOA 2FFBA 3LY5A 2PZGA 2GNOA 5CLLA 5AJYA 2R8RA 3QKSA 2QROA 5FPHA 1YZUA 1KAGA 5H1YA 4B3BA 5FBQB 4HB0A 5EMNA 3BB3A 1GG2A 3V76A 4A2QA 2GCOB 4N1AA 4TQUS 1OT3A 1ZCBA 2ZRNA 3CH5A 3THWB 3CNLA 3BE4A 4Q9IA 4D2IA 2SHKA 2VF7A 1T3HA 3A1WA 3A1VA 4PSAA 1P5ZB 4WZBE 2ZJYA 4I1SA 1TUEA 3LW7A 3GPLA 4IW3B 4KXFB 4B2PA 1Q12A 3CKLA 1R4AA 3J81k 3W34A 4S2EA 4C0HA 3OAAD 4P31A 1COWA 4DC9A 3GFTA 3MUFA 1V5WA 3C15C 4O25A 4Q7KA 2ZM5A 2W58A 4FI3C 1EX6A 3UMFA 2FPLA 3AV0B 4FCVA 1QHHA 4QNRA 5FUVA 4B3DA 5AK0A 3AF4A 3FFAA 3V4RA 1Z3IX 4ESVA 1YITB 1J8YF 4G3XA 4AKHA 4BQSA 4DWJA 1VIAA 3D7MA 4URUR 1VQPB 3KL4A 1QFYA 4XTRA 1S1MA 2LKCA 5CK5A 3C8UA 1NN0A 2ORIA 4B6FA 1E4YA 4EFMA 2WWIA 3TR5A 4RD4A 2LCFA 3NC1C 1JJ2B 3BAFA 2C03A 2HJVA 5JCZA 4B74A 1AJEA 4PSKA 5D3MB 221PA 4RFVA 1XWIA 1IBRA 4UXHA 1JXOA 4NL4H 5KDLA 4RZUA 1I2DA 1Z83A 3PIRA 5KPJA 1EWRA 1CJMA 2GF0A 3W2FA 3K70D 4UKDA 3VTKA 2ZE7A 5DN6D 1GM5A 4RD6A 2AWOA 5HE9A 3AB3A 2GBLC 1S2MA 3EIHA 4S35A 1SVWA 3LXXA 5HCIA 2EU8A 1M1KD 3E2IA 5AUNB 4E09A 2LKDA 4UJ3A 2GEUA 3CX8A 3A58B 3HU1A 4M4SA 3BERA 1N0UA 4GMDA 4LJ5A 3U7FB 1YHNA 2ZS7A 2ZSEA 3LVQE 1BOFA 4B75A 4WXPA 2O52A 4JS0A 1XTJA 4BE7B 2OBMA 3K0SA 3BH0A 1SZPA 3AVPA 1QVGB 3AVTA 2PCJA 3UG6A 2B8WA 2WM9B 3LVBA 1D2NA 2AWNA 5LB2A 3PQCA 3VR3A 4EH1A 2F55A 2JAQA 4CT5A 3TUZC 5BQ5A 4BPRA 2W00A 3OAAA 1VYUA 2G83A 2JEOA 2FH5B 3VR5A 3PUVA 5KSPA 2OBLA 1M2OB 1NJID 5EZ6B 2O8CA 3HPRA 3FYHA 3MFYA 2RGEA 3KB1A 3R9IA 3LO5A 3GJ6A 1JEDA 1Z0IA 4OYHA 2WWWA 1K5GA 2RGAA 1NG1A 5FOUA 1PLLA 3MJHA 3TNFA 2QRZA 4LJ8A 4IRUB 4A0GA 3NH6A 2XNCA 1JQJC 2MSDB 4WA7A 2A2ZA 2GZAA 3WNDA 1E9AA 2OV2A 4Q01A 2YC2C 2ZI7A 3TW8B 3Q5EA 3W5UA 4CEJA 1R2QA 1TAGA 1ZBDA 4TYWA 3ZLJA 2FMXA 1WCV1 4IXNA 2J0UB 1E98A 4OHZA 3DO6A 2N42A 1D8TA 3LAWA 2E9SA 5TB5A 2JATA 4RKEA 1R0ZA 1MH1A 3U3OA 1QG4A 1VG9B 3KX2A 3EWSA 4YLGA 3L43A 2VF8A 4Q1CA 4M1KA 3L0IB 4LK2A 5DN6A 3ZZTA 1D5CA 1BJKA 1NBME 2DHRA 3WHLA 1W36B 4BFUA 2WIBA 5L8VA 4F7DA 2ODWA 5AN9A 1Z5ZA 4HZIA 3SFZA 3B78A 5IRCD 1ZP6A 2C04A 2J0VA 1KO8A 4RSGA 2RB4A 3RRYA 2G6BA 2XTNA 4PC6A 1OLOA 2VHCA 2ZVQX 3LRPA 4OI0A 4DLVA 3GJ4A 3QE2A 2JLSA 1NJGA 1NVWQ 1OPXA 4Q4JA 2R6CA 2ZAOA 4DDUA 3CMEB 1NMZA 3M1IA 2A5JA 4D0NA 2ZRHA 2F1RA 4G5OA 2PBRA 1GJRA 1QGZA 1XEXB 2P2LA 3IIKA 4OQMA 3SBEA 1N6OA 3U3JA 4ARZB 1HV8A 1RRCA 2PL3A 5CYPA 5K8TA 1FL9A 1W49A 2GK6A 1LFDB 4F4CA 4N0EA 3SNHA 4P4SB 4EKDA 1UMKA 3T1OA 1YIJB 3U4QB 3AVVA 4IOKA 1JQLB 5FL7D 3CCMB 3PUWA 2IWHA 3AQ4A 4LC1A 5KNDA 3QNUA 3FPAA 3ZD7A 4W5HA 2HMAA 1O87A 1Z47A 4B48A 1E99A 1I4LD 2CDNA 4M9XA 3TQFA 2O8FB 2PEZA 4PPGA 4DCVA 4D6PA 3WMGA 2GTPA 1G7TA 1NDHA 2O8EB 1KRHA 4IVQA 3WBJA 5DYGA 1ZVQA 4C43A 3HDTA 5AR1A 1U98A 2L0XA 5BN4A 1W4CA 1QVFB 4TQ9A 5CIWA 4C4PA 1ZM9A 3TLXA 2VYQA 1HEIA 3KFVA 4YAFA 3N2IA 4QFMA 1S4QA 3JVUA 2QMEA 1MR3F 3I92A 1CKEA 3NHAA 1Q81D 2CL0X 2BPOA 2HEIA 2QQEA 2MMGA 4YMTA 3CF0A 1ZINA 2D7DA 5A0FA 2G1JA 3Q72A 3GLGA 3W5VA 3WYFA 4B32A 3AGQA 4DSUA 1Q20A 5JJLA 2CBZA 4A82A 5L3RA 2Q9CA 2WJVA 4EPWA 1R0YA 4CRWB 3L0PA 1GKUB 3EZ9A 5E4FA 1IXZA 4C30A 1S1CA 4PFSA 3VR4A 1WP9A 2PMDA 1F2UA 2F1JA 4FMDB 2ZRAA 2FSFA 1DE0A 2NZ8A 4Y9RA 2VP6A 4A0FA 3K0AA 1G64A 5C1BA 4R7ZA 4PTLA 3RWOA 4CYMA 1EXMA 3DZDA 1I4TD 4ZV4A 1N5JA 4JL6A 4LJ4A 4BPBA 2IS4A 2QT1A 3K0CA 4PR0A 2EIXA 3R9XA 5B57C 3FMPB 3DMDA 3VKWA 1QG0A 3TW4A 4F93B 1VQOB 1KYIA 4MQBA 3MCAA 3QFCA 1M90D 3JVVA 4R2HA 1KO5A 4B2LA 4KI0A 5FL7A 2QMUA 2QY9A 4D80A 5AUOB 1W7AA 2QTVB 3ZDQA 2R6HA 1Q44A 2PH1A 5KOYA 2VSFA 3GEHA 1WB9A 1U94A 3BRWD 1QX4A 3KZ1E 4MUAA 2NO1A 2H92A 4M1YA 4NYMR 4EJSB 2UZ3A 1F2TA 2DCUA 2Q3MA 4GDFA 3TBKA 1K73D 5FBLB 1XEFA 4HZUA 3B1XA 1JXMA 4WVFA 5AJXA 3TVDA 1IQPA 1WMSA 1E2MA 5JRJA 5H5JA 2QGZA 3FFBA 1U9IA 2ZU6A 3MAAC 2FG5A 1GITA 3SYKA 2QAGB 3CUEF 1IONA 3Q7PA 1SQ5A 2IHBA 2AR7A 1BO6A 1FPMA 1YRBA 1FP6A 3IPYA 3N5CA 5IT5A 2XTZA 3UATA 5FTLA 1YZTA 4QGFA 5FUYA 5CLQA 1MO6A 5JECA 2FN4A 2X19A 2AXNA 3CX6A 1CIPA 2WKQA 4OJQA 4Y9UA 1W87A 1ZW6A 3WYGA 3KUCA 4Q47A 1KKLA 1RVDA 4I99A 5J40A 2ODEA 4AG5A 4G5SA 2YOGA 1NBMD 1SVIA 2REBA 3RHFA 2BV3A 4KFRA 3TE6A 4AKIA 5CM8B 1TQ4A 1OV4A 1L2TA 3VNUA 5GV8A 2J7PD 1DARA 4HB3A 4JKYA 2JJ2D 4LPKA 2FEMA 1G20E 1FNDA 1Z29A 1X8KA 2VSOA 2KWIA 2OTJB 2WKPA 1ZUHA 1XD9A 1CTQA 3RS4A 2P3SA 1VDZA 2ZRMA 4O0MA 4YMSA 4ZO4A 2OXRA 4Y0VA 5DYIA 5L3QA 2GCPA 3EG5A 2ZPTX 4NCHA 5M04A 4M21A 1OYWA 2DWPA 3EZ7A 3CX7A 3KB2A 1G19A 1NMYA 4LGMA 5FI0B 4HYYA 2CCKA 2VHQA 1J9ZA 1D2MA 2X77A 4NCKA 3KKQA 3TAUA 4PC2A 1YR8A 4U9UA 2QM7A 1Q82D 4D4JA 3CC7B 4HAVA 121PA 2ZU0C 2QI9C 1P9NA 2C9CA 4UNPA 3R8CA 3KQLA 3IO3A 3D3QA 5KSWB 4RVCA 1DAFA 2IXGA 3TVTA 4BLQA 2GAOA 3VNVA 2W0MA 4DHEA 2ASEA 3D6TB 3OHMA 5KSYA 4QBIA 1VQKB 4PAMA 3BIFA 4LJYA 4NYIQ 4D0LB 3QXHA 3QFRA 5JEEA 1XFAA 1VKJA 4JL5A 5KYKA 5J4KA 3KTAA 4HLUA 3AVUA 2OUKA 2V7QD 3LV8A 2WWYA 2IYXA 1DEKA 3RABA 4KCGA 4ZDKA 1XJQA 4K1XA 3R7WB 1BYIA 4B3CA 3I8XA 1ONBA 4NDZA 2WOOA 1NNEA 2QSZA 3VX4A 1N5IA 1G8HA 1G21E 2PIAA 2PCLA 4DCTA 1IOZA 4IFEA 2CK3D 2OK8A 3X1DA 4TMZA 1K8AD 1NBMA 2FSHA 5FOWA 5IDVA 1NI3A 1HT2E 3CCVB 2GF9A 2GXQA 4NPHA 4PXAA 2OXCA 2J7PA 3OZUA 1P6XA 4DLRA 2CHGA 3P4YA 5TMPA 1D2EA 4HE5A 2HJGA 5UKDA 1O3YA 3BB1A 4KITB 3LX5A 2WWXA 3TUJC 2QP4A 5EE1A 4PHGA 2D3WA 1SXJB 5JJKA 5GJVC 4AWXA 1FZQA 2VNHA 1OFHA 1JALA 2JCSA 3NVAA 1NG9A 2FGKA 4HUQA 4YMWA 2KB0A 1W5SA 2JLZA 3P20A 3SYLA 2P6UA 1YVDA 1BMFD 1KI3A 2OZEA 4UQOA 5SZKB 1GRNA 5CYOA 2JLUA 3WRYC 4PAQA 3VU9B 3PV0A 4NHOA 5FBWB 1J7KA 2CLSA 1VQ8B 1G6OA 1ZIPA 5EE9A 2VBCA 4P3YA 3BS4A 1CS4C 3SOPA 2YWFA 1ZC4A 1KNXA 4WW0A 2W83A 1S9DA 3SQXA 1E2IA 3FPKA 4FWTA 1AGPA 4Q4AA 4QL3A 2XB2A 1GVHA 5L3QB 1I4DD 4JLVA 2WJJA 2MSCB 3VO2A 2A5DA 2QE7D 4P33A 1P61B 3IEUA 3KKMA 2WMOB 3JZAA 3DM5A 4D81A 1TLLA 2BSAA 3FMFA 4ZDWA 1G3QA 3VKGA 1EFCA 1Z63A 1ZM2A 2XEXA 2VHTA 1IY2A 3W90A 4B3GA 1LF0A 1KY2A 2ZITA 2QG6A 5ANRB 2YWHA 1GTVA 2V7QA 2Z83A 1E64A 2QEXB 1QF9A 4PAOA 1CR2A 3I61A 5JWHA 1UEJA 4RFSB 5B64A 2IX3A 3EIQA 4BFYA 5JSZA 5J4VA 2VIIA 3CRQA 4Q1BA 2RHDA 1D9XA 2CLCX 3FE2A 1W2GA 2CK3A 4PO8A 3FGNA 4POAA 1X6VA 3KXKA 3L8ZA 1LW7A 1ZD9A 1VG1A 3IKJA 2ZRGA 1GL7A 2NPIA 2REOA 1NKTA 1UF9A 2RHMA 3GLHB 4NP6A 1FDRA 1XCPA 4DLUA 4KSCA 4DDWA 3SDZA 4QBHA 5L3SB 1UKEA 2PT7A 4QRHA 2VHUA 4JVMA 3EWAA 2EWWA 3WHKA 1W4RA 2QRNA 2R9VA 1KSHA 3GLFB 3EW9A 3IIMA 1E2QA 4TLEA 1J90A 821PA 2YNMA 1BMFA 2ZI4A 3QEOA 1Z07A 5DI3A 3K1JA 2C77A 1M8PA 3AM1A 4AYWA 1N6LA 3K70C 4AYXA 3O8CA 3LW8A 1ANKA 4HEJA 4V0ME 1Z6GA 4BLSA 1E32A 2H7VA 2VSXA 4LC0A 1XMVA 2H5EA 1QHIA 2IYZA 2QE7A 3OF5A 5HTKA 2DR3A 4Q9KA 4CEIB 1JR6A 5AJWA 4MGIR 4TZ0A 1KQSB 1E1QD 2ZI6A 1EP3B 1P3JA 1P62B 1PUJA 2ZS9A 3LLMA 4Q1DA 4BASA 5DIFA 1E9RA 1FTNA 4Q48A 3VHLB 4LBZA 4KV9A 1H8ED 1Q1EA 2OAP1 1YJ9B 5EXSA 4WIAA 3NBYC 4E03A 1DO0A 2DFLA 2GCOA 2O8DB 3GEIA 2O8BB 3TRFA 2Q9BA 2NOAA 4MKFA 3QF4A 2ATXA 3THWA 2QSYA 4BFSA 1YZGA 4CEHB 3I5XA 3ZD6A 3A1UA 4PHFA 2E1RA 1RYHA 1TF7A 1U0HC 5J47A 3T1TA 2RC6A 3THYA 1RW4A 2JDID 5JS8A 1ZNYA 1E62A 4BZPA 1TU4A 4RD2A 4W5JA 5H68A 2VP4A 3Q5DA 1UEIA 1HTWA 2JLWA 4A2PA 4IDPA 2QN6A 2GK7A 4B47A 1XP8A 4ASUD 4Q1AA 5CJPA 4IEIA 4B2IA 4EIWA 3U60B 2ZSDA 3RRMA 2AK3A 3BOSA 1Q3HA 1XTKA 1CJVC 1S3GA 5GVRA 2A30A 1TQDA 3K0FB 3MGCA 1E2LA 2A5GA 4FXPA 4KYUA 4Q7LA 3FJOA 4WQMA 3MWJA 2IF2A 4UNSA 3KXLA 3PENA 4QKQA 3X1ZA 5TVKA 3CBQA 1LB1B 5TXGA 2CHQA 4DCNA 2WJHA 1WBDA 1OGIA 1G8FA 2ANCA 3AP1A 3GCGA 5LD2B 1IN5A 1VECA 3BORA 1XPUA 4RJLA 2BDTA 2ZETA 1RIFA 4IEEA 3VX3A 4NU0A 4DSNA 1GVNB 5D3MA 1XTIA 2H18A 3SZRA 4DUGD 4EDHA 2Q9AA 2AFIE 5DI3B 4LBWA 5G53C 4HAZA 1E1QA 4GRAA 3OJWA 1EX7A 3BBPA 4DKXA 1B2RA 4JLPA 3GLIB 3TJZA 4KFUA 1H8EA 2ONJA 3I55B 1SVKA 1Z0KA 1W36D 2F43B 3K0CC 1UFQA 2FZLA 1Q21A 3JQPA 2E87A 3PUXA 4I4LA 1NVVR 1X86B 2WJIA 3ADDA 2ZTSA 2PJZA 4TMXA 3EX7C 3NBFA 3SEAA 4EPRA 4ZI3A 4TYPA 1YU9A 2RGDA 4JVLA 3BK7A 5TDHA 2IYUA 4Q19A 2V8OA 1TNDA 2AD5A 3WNCA 3AKCA 3QVVA 4KBGA 2DFTA 2BMEA 5HPYB 3PXGA 2JDIA 4GBMA 3M0EA 3U7EB 2ERXA 2IXEA 2ZSAA 5FBRB 5FUXA 3RC3A 1E0AA 1ZIOA 2WJYA 2Z43A 3THXB 2ZRDA 5EXXA 1NN1A 3M6AA 4HDQB 4NCIA 4DCSA 1H42A 2FSIA 4QHYA 2JGNA 3FB4A 1G8YA 3VO1A 1US8B 2Q6TA 3N2EA 3QF4B 4TLBA 5LB4A 4B73A 1VG0B 1IAQA 4ASUA 4BUJA 2XXAB 1XDBA 4F38A 3E20A 4PQFA 2XJ4A 1U9IC 5JFGA 3K0EA 3P32A 3THYB 2CRVA 1KI7A 4JT4A 2BIFA 4ABYA 3OJXA 3E1YE 2ZI5A 4B35A 4DVGA 3EASA 4IOLA 1HT1E 1QHSA 4YQFA 1N25A 2FNAA 1FRNA 3HYTA 5FTNA 4OI1A 2UKDA 5J4LA 4YDSA 3CO5A 1DAKA 1M6NA 3NC0C 2CVHA 1EFRD 1R7RA 2BF4A 2WMNB 1DPFA 1WQ1R 2DBYA 2ZYWX 5AWFC 2GPJA 2G77B 2NO7A 2ZIAA 1Z6AA 5C4MA 2BC9A 2IYYA 4DUGA 2DFNA 3UG7A 2CCGA 4DLYA 4G5GA 2J0UA 2GILA 1W2BB 5DNYB 2WVJA 2HLDA 1E2PA 3FVQA 3V00A 3AP2A 3QI2A 4BFXA 4P6VF 1KTVA 2OK7A 4C0AC 2YJTD 4DSOA 3ZS9A 3BFKA 2ZANA 4IDQA 3BGWA 2DWQA 5E7MA 1K6MA 4G01B 2G0TA 4NCJA 3IDQA 1SHKA 4WZ6A 3ZJYA 1VYVA 4PGOA 2Z6VA 4LJ7A 5DE3A 4JVNA 3RANA 4ZCIA 1OGJA 1VQMB 1AZSC 1JAIA 2BOVA 5F3WB 2D7CA 3E5HA 3HU3A 3RSOA 3EC2A 3QG1A 4EPTA 1CRQA 3SFVA 3KQUA 4HI0E 1TADA 1TX4B 3AKYA 1RRFA 3EA0A 4A9AA 3RAPR 2BHRA 3PCRB 3CM0A 3TQCA 2YOHA 4DQKA 4GP7A 1SXJE 1W1WA 1E2FA 3GJXC 2ECKA 4KSBA 3T1VA 3SQWA 5H8WA 2QMHA 1XEXA 1WBBA 1QRAA 3NDBB 1W34A 4NBSA 1D9ZA 2ZRPA 3T12A 1QVRA 4ARZA 1TQ2A 3FWYA 1E0KA 1VQ4B 4JBYA 3C5CA 1GSIA 3V4FA 4FCWA 4YAWA 2H57A 4P4SA 4V0OA 4B33A 1VG8A 4D4LA 5JI3E 1Z08A 2F6RA 1SGWA 3U4QA 2V3CC 4L4UA 1Z0JA 4A8JB 1LTQA 2H8KA 1DTSA 1KO1A 4HAYA 5FI1B 5G3ZA 1P9RA 4URZR 1F60A 1OH7A 4C0QC 4IHQA 5E3HA 2A78A 2XOKD 4HLUC 2JIZD 2CHVA 3H4MA 4JLJA 4LX0A 2OE2A 4KJZA 1VYTA 2O8FA 1EFRA 2P6RA 2GEVA 4KFTA 4CGZA 3RRZA 4IXMA 4AF7A 4W5WA 1VQLB 2F1HA 2O8EA 1HQCA 1PZNA 4KBFA 5FTMA 2BGJA 1YR7A 5E7JA 1G7CA 5C18A 2GJSA 2GRJA 3TIFA 1KK3A 2AN9A 4V0MA 4DLTA 2AL7A 4G1VA 2P0EA 1IJFA 2YV5A 2BMWA 1ZNWA 3QXJA 5C46F 2G1KA 2XNDD 3MWLA 4D4KA 3CCQB 3SU8A 5H59A 2RGGA 1OXSC 3LBNA 1P72A 2NIPA 4GOXA 2QPTA 2YWEA 5FH9A 2QP3A 3MJRA 4QG7A 5EE3A 2B92A 4F4IA 1E2GA 1ZM7A 1VPLA 4Q7JB 3GLHE 1I2MA 4KLNA 1UAAA 5FOVA 2OCBA 1SM4A 2ZJ2A 4YDHB 4BEJA 4CDGA 4DEYA 5KDOA 4NTZA 4FK8A 3ASZA 5EE5B 1NL3A 1KKMA 4MYUA 2C96A 3CD6B 2ZR0A 3QPVA 4L9WA 3GLFE 3R8FA 1E79D 1OB2A 1VQNB 2DFKB 4OHVA 1GNPA 2ZJ5A 2WBLC 3SHFA 2D62A 1II9A 1BIFA 4B71A 4JL8A 2CE7A 3WMEA 1Z8FA 2I4IA 3AVXA 2QBYA 3ZYCA 3IBGA 4N3GA 3FMIA 2XZPA 1FUUA 4XWAA 2N46A 2FFHA 4NE2A 2RGNA 1RRGA 4K81B 4Q18A 3A36A 3AGPA 4CT4B 2VEDA 3IIJA 4V02A 4DLZA 2WPDD 2N1BA 2XOKA 1WF3A 1NKSA 2JIZA 3DHWC 3VQTA 4EJSA 1KGDA 4FMBB 1ELOA 2Z0MA 3NBXX 3WNBA 1NJFA 2FFAA 3CCSB 1XBTA 3AUYA 2O0JA 4XIGS 2EWVA 2ZYTX 4B34A 3B13B 4U00A 4BLRA 4DJTA 2BKUA 1XNJA 3ASYA 4AG6A 2XNJA 1E9DA 1NLFA 2CJWA 2HXSA 1LV7A 2OESA 2WV9A 3QEJA 4YMUA 4B3FX 2W2VA 1CLUA 3PUZA 1N6NA 3CPJB 4L5BA 2QAGA 2GWHA 2R6DA 4PC7A 1KO7A 1TEVA 4EPYA 3F5FA 2OLJA 4C9BA 2CCJA 4P4TA 1RPZA 1FW6A 1ZCAA 2XNDA 3CH4B 1KMHB 3LDAA 3T61A 2NTYC 1E2NA 2P67A 4NKRA 4XVRA 3SS8A 1KSFX 4LBVA 1FNMA 5FPKA 3AKDA 1EP2B 1DDIA 1A2BA 2XSZD 1VCIA 1NLYA 3SBDA 2ZVPX 3B60A 3L8YA 4HLDA 1W48A 3VHXA 5AUPB 2Y8EA 1E2JA 4B6EA 2QEQA 721PA 2XTMA 4JJZA 4BFTA 4BEBA 5DO9A 1E79A 1AKYA 2P5TB 5EUQB 4TYYA 3RS0A 1KHTA 2GEDA 2NQ2C 1FUKA 4M1TA 1FQKA 2IYSA 3P26A 4LV5B 4URVR 2FOLA 1GP2A 2HCJB 3KJEA 5FTKA 1A1VA 5K8LA 3OZVA 1NVXQ 1F3OA 2A3RA 4FMDF 2GZHA 1SXJD 4GP6A 1R5OA 4LJ9A 4DDTA 2R44A 5AUQA 1MV5A 1PVOA 3KUDA 4TMWA 2G3YA 3EZ2A 1K8RA 4KHZA 5LBIA 2WICA 3IHLA 2I1QA 1X3SA 2B6HA 2WPDA 2XAUA 1KD1D 4TL9A 3PEWA 3LX8A 1C4OA 3RLFA 4PZZA 3C4JA 3O8BA 3EAQA 2QAJA 2HT6A 3ZVNA 2QBYB 2OT3B 4PO9A 1GR1A 3QBTA 1EWYA 3A6PC 3LXRA 5TY0A 2B5OA 2FWRA 2LWIA 1E2DA 4JIMA 3GLIE 1JA0A 3ZS8A 2ZRKA 4OHWA 2FZ4A 4G5QA 3FTQA 2WOJA 4GSYA 4AF6A 4MYCA 3CC2B 1CR4A 1T91A 3B82A 4GPTA 1PLJA 2ZRLA 2RH5A 1XTSA 4Q7MB 3ZVRA 2J1LA 1XTRA 1E9BA 3LO8A 2XB4A 2VZLA 4KYIB 4EPXA 2B21A 2WSMA 4Q00A 5H70A 4GL2A 1Z22A 3W3ZB 4D26A 1JPNA 3DZ8A 4M0LA 3R7WA 2CJWB 5JLJA 3QKUA 4HE6A 1DADA 2ORWA 3F8TA 4FW9A 1JA1A 1XPRA 2XSZA 1G6HA 4MRVA 5B2ZA 3CR7A 3W8NA 1P2VA 1CR1A 1Z28A 2Z5FA 4DCUA 3OZXA 4LPSA 3UKDA 1XD2B 3DM9B 1LVGA 4NCNA 1YQTA 3QENA 4QHSA 4I81A 4FMCF 1R6BX 3BJIC 3LFUA 2C95A 2ZQ5A 3OIUA 4GZMA 1Z0FA 4F92B 1LS1A 6Q21A 1G4AE 1XB2A 1GNRA 1HE8B 1DG1G 4IKEA 2WSSD 3FKSD 1XXHB 4DIEA 1FNCA 1UBGA 2ERYA 2FPMA 1SXJA 1M7HA 2ODNA 3K9HA 5EXTA 4BRUA 4XVQA 5FPYA 1D6JA 3ADCA 2EYUA 3AP3A 1OJLA 1S72B 2D74A 3QKRB 2XGJA 2ZE8A 1E96A 3RS2A 3RRNA 4EPVA 3GEEA 3H1TA 2ZREA 3VU9A 1JJ7A 1XMIA 2VTKA 3QE0A 4HSEA 1J99A 4KO8A 4MA4A 5HCNA 1QHGA 3FMOB 1A4RA 3PEYA 1KK0A 2CE2X 1KMQA 5BXQC 1TMKA 1DOAA 1TF5A 5JWOA 1W46A 3K9GA 4V0KA 4I1VA 1T6NA 4YAOA 2OFOA 3GD7A 1BQEA 1ZM4A 4ZKEA 3Q85A 1JJVA 3QPWA 5E95A 3RS5A 1GO2A 1KO4A 3A8TA 1IM2A 4P0TA 4UXJA 3FHTA 1XCGB 2QQ0A 1P2TA 1QFJA 1FMJA 5EXPA 3VR2A 4IVRA 4Q02A 4DIDA 5B58C 1Y3AA 3T34A 1GAJA 3DEFA 4IDNA 3R9WA 3BWDD 1A8PA 3IQWA 4C0JA 5A4JA 2QDXA 1YRAA 4LHZA 5G41A 1W4BA 5J5CA 5G3YA 1KI9A 3FOZA 4BZQA 4HLCA 4B3XA 4RFSA 2GHIA 1UDXA 4JLAA 3TSZA 4LHVA 1JAHA 2V1UA 5EUMA 3ICEA 2YINC 2ZUDA 1E6CA 2VA8A 4N0DA 1BKDR 2GJKA 2VP2A 2ONKA 3GJ3A 2FJUA 1OYYA 3OESA 1RC8A 5AJVB 3GLHA 3ZIAD 2VNJA 3CCRB 1M34E 1ZYUA 3LD9A 2ZRCA 3EZFA 4M53A 2O0HA 4GOKA 2BGIA 3ZBTA 5L3SA 1IJEA 3KQNA 3UMRA 1X1SA 4CVNA 2WSSA 2HV8A 3FKSA 3H84A 4FWIB 2EFHB 5BYJA 3TH5A 1GKIA 2B7BA 1G3IA 5TARA 3AVQA 3T06B 2A9KA 3GLFA 2W6JD 3TKLA 1SKQA 4ACBA 1Z6XA 1YR6A 3G0HA 1F6BA 1R0WA 2ZUCA 3NHBA 5DHFA 3NWJA 3IHWA 3SI7A 1VIYA 2GZDA 3CB4A 4JLMA 4US1R 3TK1A 2ANBA 2JJ2A 5JEDA 4MITA 4GFDA 4PZYA 1OFTA 5FR1A 4LI0A 2OBNA 4V03A 2ZJBA 4Q1EA 4ZGQB 5FFMA 5FOXA 1AQYA 3W6PA 2W0SA 1W36C 3A4MA 1G1MA 4PC3A 3BFVA 4C7OB 5KU1A 1M1YE 2F9LA 2QM8A 3CPEA 2GXAA 1RKBA 1Z0DA 3QSYA 1EK0A 1BX0A 3ECCA 1W44A 3UIEA 1JBKA 1XEWY 4C0SA 2JLXA 4JYBA 4Q4HB 1FNNA 1M7GA 4CEIA 1YZLA 2BEJA 2VL7A 2RAPA 4EQ6B 1IXSB 4NONA 4LOAA 3UANA 4PPFA 1XX6A 4M2LA 2AKAB 2HYIC 3MHPA 2H16A 1FOEB 3QKTA 3E1SA 2QPAA 5DISB 1UBFA 3CIOA 4JMPA 1E2EA 5JBQA 4URYR 1IY0A 2KI5A 2O8DA 2C2HA 2O8BA 1Z6TA 1Q0UA 4US0R 1H65A 1FX0B 2ZJOA 2VP9A 4G0NA 4TL7A 5EP1A 4CEHA 2ORVA 3CCEB 2OG2A 4E22A 2YKGA 1X8LA 2PT5A 5B30A 1VQ7B 3IO5A 2AHOA 1VQ9B 2ZUBA 1W47A 4FD2A 1CF4A 5CB8A 4JKIA 3K09A 2Q3HA 3DVLA 3ZIAA 3W5HA 1XEWX 1KJZA 4PSVA 4R9UC 4LRWA 3SJCA 1IXRC 4X8LA 2EYQA 2FGJA 1G7RA 1II0A 2BMFA 1GAQA 3QQ5A 5C2JB 1GDDA 3NTUA 4NH0A 4BLPA 4HDOB 3WP1B 1XMJA 1MO5A 2V54A 5K8UA 3T5GA 1KC8D 2Z4RA 1G8PA 2W6JA 5FUWA 2V6JA 4D4MA 1JB9A 4RY2A 4RZXA 2JASA 2CL6X 3K0FA 1X1RA 3K9NA 5CIQA 1QVAA 4LHXA 5J4HA 3VR6A 4U7DA 1ZMXA 1JR3D 3WMFA 2ZR9A 3L0SA 4V0NA 4MDFA 4LBYA 2OCPA 4DZZA 1C1YA 1N6KA 1P4SA 3RC8A 1DVRA 3ES9A 1GOTA 2P5SA 1JPJA 5KSZA 4PPNA 1RZ3A 1ESNA 3LBHA 4MKGA 4ZIRA 5KUTA 3OW2B 4MKHA 3W5IA 2VNKA 2WHXA 4LV8B 3BFXA 3G6EB 3I8SA 1P60A 2MSEB 2ZE6A 4JSYA 1SKYB 2J59A 4R2IA 4AIIA 3GLIA 4A92A 2AD1A 4RD3A 3AKEA 4A1FA 2F43A 1CULC 4TL6A 4CZ2A 4ZI2A 3GJ5A 3ZZ0A 5IK2D 2JLRA 3K8YA 2F7SA 1LF5A 1OF1A 4JZKA 1OFIA 1NP6A 1CU1A 2QL6A 3NIBA 4PZLA 5HKKD 1Y63A 4OBEA 2RGNC 1A7JA 1G291 1D1NA 1OHHD 1L7VC 4B76A 5F98A 5CB6A 3KQKA 3WY9A 2JLQA 4YXWD 2WKRA 4EJSC 2GJ8A 3TGPA 3ZVMA 4AYTA 3VKHA 4JLOA 4QBGB 4TSFD 4TLDA 1US8A 4WAUA 1NRJB 2B7CA 1MKYA 1QHNA 1SVMA 4L8GA 2XXAA 3W2GA 3RS3A 421PA 1J2JA 2ZRJA 2IS6A 3B2EA 2EQBA 1Z2AA 2CNDA 3NXSA 2QAGC 4A0HA 4KU4A 1N6IA 3LH5A 4IDOA 1UKVY 5FL3A 2XZLA 5BW8A 1J70A 4HATA 4A0RA 1JR3A 1IY1A 3EIEA 2DEUA 1TVCA 1N8RD 3B9QA 1W2HA 2R62A 5DHAA 4ZCMA 3O47A 1R0XA 1P2UA 2IK8A 3L82B 2HT1A 2QA4B 4CW7A 1XTQA 1Q86D 2OILA 4BLTA 3GFOA 4NYJR 5F2EA 4HDCA 3WBKA 1L4UA 1P73A 1T3LA 5DLQC 3V9PA 1NVUQ 2ZJZA 4WXRA 2KJQA 3GJ0A 3GP8A 1RJ9B 2PJRA 4C2TA 3PR1A 2GVDC 5KHOC 3DL0A 1OFUX 4HLQB 3W5JA 4ZKDA 3C14C 1XU4A 5FTJA 2WTUA 3ZBUA 1EFUA 2K5UA 4Q5IA 3THOA 3CCLB 1TU3A 3I72A 1Q57A 3AH8A 3ZQ6A 1AMOA 1GZSA 3BB4A 4MRRA 4V0LA 2UZIR 3I5YA 1ETUA 1HH4A 5IK2A 1FQJA 5FOSA 4A4DA 4ZIRB 3X2SA 3RWMB 1ZRHA 2CXXA 4G5RA 1G3UA 4MDEA 1KZ7B 1CQXA 5HKKA 4PQRA 4OI4A 2YZ2A 2A5FA 1T5LA 4TTQA 4OHXA 2GVZC 1CJUC 3PUYA 1OHHA 3PFIA 4Q21A 2BEKA 4Z1MD 1XXHE 4H1VA 4HAWA 5BYKA 3G5UA 5P21A 4XWOA 4QHTA 1KK1A 3H0KA 4M9ZA 4YXWA 1SHZA 5FA6A 4L9SA 2Q3FA 4OKSA 2EVWX 1ZUNB 1DAMA 1FFHA 2VH5R 2NO9A 4TSFA 2BM0A 3ZGXA 4TMVA 4LV6A 3PVSA 1UKYA 1SVOA 4II7A 4DT1A 4TTPA 2QPOA 1E1RD 4IVPA 2CEAA 2IUSA 4YC7A 2J87A 3VMFA 4F4JA 2PX0A 3TMKA 3U44B 2GAAA 4A8JA 4KLZA 5GJWC 2QZ4A 3B1ZA 3CNNA 2YC4C 1VCMA 2TMKA 2OO7A 5KO2A 3D8BA 2F3RA 2WAYA 5BN5A 1Q7YD 3CPHA 1NVVQ 3B5JA 4IDHA 2OAQ1 1P7CA 3EPHA 2QUZA 4AK9A 3QXCA 4EFNA 2PEYA 1R5BA 3MD0A 2ZJ8A 2GCNA 4IOMA 4A2WA 2REXB 4AURA 3B85A 4BRWA 4XWKA 1MOZA 2ZAMA 4MYTA 3LQQA 1ZNZA 3OEED 4GI7A 1SQRA 1OXTA 3W2IA 2EFCB 4ZCLA 1FMLA 4MUBA 2G0NA 1G5PA 1T4GA 3CR8A 2QTZA 3I1FA 1A2KC 3CRZA 4WBSA 2BCJQ 5IF9A 1E0SA 1QFZA 2FF7A 2ZE5A 1N3BA 2BBWA 5LDDC 2VP0A 2IYQA 1N0VC 1P75A 4A6XA 3CZPA 2ZS8A 4M1OA 1SXJC 2W6ID 3LLUA 4H1UA 4BFWA 5DI9A 3DDCA 1KI6B 1UBEA 1JNYA 1H8HD 4QM7A 4G1UC 5THXA 2X2EA 1QZXA 3OIWA 2QA5A 4Z1MA 2DWOA 3SYNA 2C9OA 1W35A 3F0TA 3T1QA 3G82C 1Q22A 4X8MA 1PJRA 2EFDB 3VAAA 4URWR 4Q9JA 1N6HA 4ZDIA 1VHTA 2QU8A 3CCUB 3KKOA 4JSTA 3Q3JB 1MRSA 1OH8A 3C41J 5GV7A 2WIAA 1NSTA 3SR0A 1CEEA 2YWGA 1E1RA 4TYQA 2IYVA 4R98A 2ZYUX 3U7GA 4LZZA 2GETA 2BMJA 4I1UA 4CF7A 4QGAA 3KJIA 3A1SA 1KSGA 3O8DA 4QM6A 1QH0A 2RGCA 4ILEA 4XH9B 3B9PA 1QHXA 1DO2A 1N5LA 3W3AA 3ZQJA 4F7WA 1KDPA 4DT1B 3NH9A 1DAEA 1Z0AA 4UXIA 1YHQB 1QDEA 3C16C 3PITA 1DG3A 4C0KA 3DOEA 2IW3A 2BCGY 2RCNA 4ON9A 3CF2A 1KSJA 4LDJA 1QG2A 1UJ2A 1SULA 3OEEA 4JVSB 2QTFA 3S1AB 2WAXA 4OL0A 4C0BA 2ZI3A 3M4YA 3RDPA 2CLDX 1WXQA 1KNQA 1B0UA 1GWNA 5TV2A 2BBOA 4MRSA 2Z4SA 2QT0A 3GMTA 2FSGA 3GFPA 3NBZC 1KMHA 1WDTA 4AD8A 1ZU5A 1U81A 1AGRA 1TL7C 1OIXA 1U8YA 1ZU4A 3SN6A 2W2XA 2QP9X 2GJAA 2W6IA 3QKSB 3CWQA 4QJ5A 3LBIA 2AKYA 1QGAA 1H8HA 1OW3B 2HYDA 4KODA 4LJ6A 3W9YA 4C3ZA 5HXBA 1E0JA 4EAQA 5F9FA 2J7KA 1K5DA 1XMSA 3B1WA 3I73A 3RNLA 1XJ0A 1N6PA 1KK2A 3UK6A 1H85A 2IA5A 2D2FA 1PLKA 3QXXA 1BH2A 2HF8A 1RFLA 1XCMA 3ZVLA 5F9HA 1W5TA 2X8AA 2HUPA 5IHPA 3X1XA 3W2HA 2QENA 2XX3A 1E94E 4D0GA 2ZRFA 3RVBA 2OLKA 4IJMA 4UNQA 3BD9A 1GUAA 2AFHE 1NIPA 3A37A 3TSWA 2IWRA 3QBVA 4AKGA 4YONB 1G4UR 3NDPA 4JLNA 5KNCA 1KJWA 1NN5A 3CF6R 4O2LA 4BFZA 3U3KA 1OE0A 1OIVA 2GDJA 2LP6A 2V4ZA 3FHCB 3IPXA 4K46A 3H86A 3DMNA 4KFSA 1RE0A 1FRQA 5FPSA 3U7HB 1QGYA 4JBXA 1GILA 2IYWA 2J45A 2QORA 4QC2A 2CNWD 2OTLB 1TQ6A 1QHHB 3EPKA 1KI2A 1F20A 1DELA 1ODFA 2IBMA 5DGXA 3VFDA 2PZEA 3G71B 1AKEA 1SKYE 5BN3A 4RZ3A 1G18A 4OQNA 1AN0A 1XZQA 2RGXA 3LWNA 4Z51A 1XZPA 3LQRA 3AUXA 4DXAA 2IYRA 5AJZA 4QBFA 1KDOA 4O2RA 3B1VA 1GL6A 1MT0A 3EA5A 3KFXA 4Q9LA 1S9HA 4MYHA 2UVQA 1QBKC 3C7KA 4L16A 3K09C 1MO4A 1RYFA 3T15A 4Q9HA 5EP2A 4Z54A 2RGBA 2PMKA 8OHMA 3BH6A 2JJ1D 1MABA 3TUIC 1YZQA 4TLAA 1I7PA 4PO1A 4W9MC 1YZKA 1OXXK 1QUEA 2BBSA 1G5RA 2IL1A 2VPPA 3CC4B 1Q1ZA 3RS7A 3MWKA 4DDVA 4US2R 3CPWB 1XD2A 2IYLD 1IHUA 5E7IA 1FP7A 1T0JB 3QUSA 4TTRA 3EPLA 1T0HB 3B7GA 1FNBA 4DLWA 3KKNA 2XJ9A 3LA6A 3PG5A 4JYCA 3QFTA 1TUIA 4RKFA 1E2KA 1W4AA 3CONA 3DOFA 4LY6A 5LD2C 3I62A 1ESMA 3BXZA 4XOIA 5TR9A 3QF7A 1XXHA 1JI0A 2ZROA 5CDFE 3OIYA 1TPZA 2DYKA 4DBLC 1G41A 2J0SA 3QKRA 4TWZA 4YAUA 3ZC3A 4E5UA 5HZKA 1E4VA 1OSNA 5JMTA 2KBFA 2BWJA 3MLEA 3D31A 4ESHA 4EUNA 2ZSBA 2O8CB 2CNWA 3RYTC 4CIDA 5CJ2A 1WRBA 1EFHA 1S96A 2QMOA 2VHJA 2RMKA 2IS1A 4YALA 1VMAA 3OEHD 2FU5C 5EZ5A 2FDCA 1ZD1A 2YHSA 4Q03A 2R65A 2JJ8A 4AI6A 3B8HA 4ACAA 2KE5A 3U3RA 1CNEA 3L2OB 2W2TA 4TT3D 1KDRA 3I3SR 3B6EA 4MGKR 4CEJB 2CMKA 2WWGA 4DRZA 2OCAA 1N5KA 2FA9A 3DPUA 1W0KD 2I1VB 1TEXA 1SVLA 1KDTA 3W6NA 3CXCB 1VQ6B 3UWOA 2YOFA 4B44A 1OXVA 2ZEJA 2JJ1A 2NG1A 5D3QA 4JJKA 3K70B 4MGZR 2GKSA 3IBYA 1EFTA 3WYAA 4BWYA 1CJKC 2XITA 4M9SA 3QFSA 3SHWA 5GJBA 4M22A 4O3MA 2OSBA 3GJ7A 5ELXA 1AZTA 4X8OA 1KZGB 3QPUA 2J0QA 2HXYA 3Q8XB 1EGAA 2AK2A 2BN4A 1X8JA 2F3TA 3AVWA 1MABB 1T8UA 2C8VA 4Q4JB 3FKQA 3K53A 3IILA 4XSGA 5HE8A 2QNRA 1E69A 4NYMQ 4QJ3A 4DEXA 1OKKD 1M74A 1E9CA 4AKEA 4AY2A 4OK3A 1EP1B 4RD1A 1NLZA 4XVUA 4J0QA 1P2SA 2X2FA 3NEJA 3MSXA 1UM8A 1VQ5B 1R8QA 1CRPA 1MO3A 2FFQA 4BECA 2YYZA 1JR3E 2Q0HA 5KSOA 3QJYA 3QIAA 4WZAE 2FPKA 5HR5A 4C7OA 3ZZUA 4DLSA 1Z2CA 3UMSA 3OEHA 4GNKA 1IN8A 2IUTA 5A5GA 1XJCA 3EZ6A 4Z8YA 1VCOA 4QJ4A 5FOTA 4Q4HA 2G88A 3AF3A 2GXUA 3KJGA 2BKEA 3KXIA 4EQ6A 1AS2A 3MMPA 4TT3A 1KIMA 4W7SA 2KBEA 3SE0A 2IC5A 4YHBA 2D2EA 4FMCB 1W0KA 2BJVA 1QUFA 3TR0A 3NG1A 4QOSA 3AVOA 4TYNA 4MH0R 2PLFA 2XZOA 4HAXA 2WWFA 1CJTC 3O8RA 1FX0A 1R10A 2C9YA 5GJCA 3OFND 1DDGA 3Q9LA 2GXSA 2GJ9A 4U02A 4UAJA 3GLGB 4LUCA 1HUQA 4OQXA 2OEPA 4A8JC 1HYQA 2BJWA 4Q66C 4NMMA 1U0JA 4TN1A 2IEYA 2DY1A 2F1IA 1YKSA 5DH9A 2WWHA 3CLVA 2HCBA 4H9GA 3W6OA 4D82A 4FN5A 2CL7X 2RKOA 4XSHA 1F2UB 2V55B 2ZRBA 2VYFA 4LJAA 4Q4LA 3K0AB 1N0WA 3CZQA 5KTYA 3W2EA 4NYIR 1DAIA 1F48A 1HQYE 1G5TA 1L8QA 3LNCA 4BLOA 2KSQA 1OKKA 521PA 3AVYA 2GBLA 1XF9A 2BBTA 1G3RA 2PLRA 4A6PA 3R20A 3SJBA 2QTLA 4P4UA 1MRNA 3KQHA 3BH7A 5JS7A 3KKPA 1YJWB 3A4LA 1CP2A 1KI4A 4UNNA 4OK6A 5LPNA 5KPDA 1DBSA 4U5XA 3JQQA 3FDIA 4EFLA 4B43A 2OFXA 4ZDJA 3AEZA 1M7BA 1YR9A 2EW1A 1F2TB 3OIVA 2PZFA 5CITA 3ZH9B 2XNSA 3REGA 4LYJA 1V43A 1OH6A 1AQUA 1E3MA 2NZJA 4HZUB 1G9XA 1YE8A 1P9WA 3NKVA 4F91B 1U8AA 2OFWA 1DS6A 1FTSA 1Z06A 3B1YA 4DB4A 5JI2E 3CRVA 3WRXC 1G3MA 4I1OA 1IN6A 2D06A 1OXUA 4M1SA 4RZ2A 4TL8A 2ODBA 4GZLA 3CRRA 3H2YA 1ZAKA 1Z6YA 1PV4A 4WOPA 2NPFA 4LYFA 3C5HA 1WA5A 3P1JA 3OFNA 3VR1A 4GMXA 1E9SA 1U8ZA 4E07A 2AXPA 3E70C 1UKZA 1AA9A 1G8GA 1EG7A 2ZSFA 4JLBA 1AIPA 4QXAA 1AK2A 2J41A 3TSOA 3QXSA 3NEYA 4M1MA 5EP4A 2QTHA 5JCPA 1S0UA 5K8IA 1CNFA 1GRRA 3WP0A 1NMXA 1NY5A 5JJIA 2FE4A 2EFEB 4TMKA 2FX3A 2VO1A 1KJYA 2CVFA 4PANA 3QG5A 1XRJA 2OCYC 3CRW1 5GVSA 2VQSA 3QVUA 2C78A 1YI2B 1BYUA 2IHYA 3X1YA 4HB2A 2ZJAA 3N70A 3T5DA 2DERA 3DKVA 3CMAB 1NN3A 1C9KA 1HY3A 1CBUA 2OHFA 4XJXA 2HDNB 3AF0A 2I3BA 3GJ8A 3ND8A 1GAWA 2HF9A 3BC1A 4JLKA 3IEVA 4AC9A 1K9MD 4OQLA 1XE1A 5CDFA 1E9FA 5HZHA 3HPQA 2V1XA 4L15A 3U5ZB 3P4XA 1YJNB 1GL9B 5JHGB 3U6BA 1GKYA 1T8TA 3HYRA 1XPOA 1ZM3A 3HR7A 4M9QA 4RCYA 4MRPA 4A36A 1J8MF 1NIJA 1YJ5A 2DETA 1KOFA 1RJ9A 2ZYVX 4LYAA 2ATVA 2J9RA 5SZJA 3KDSE 4TZ6A 2NGRA 4QNMA 4TQAA 3I32A 1II8A 1JB1A 4FINA 1BS1A 3JZMA 5FBVB 1U99A 1AM4D 2NO6A 2R6AA 1Q1BA 1ZD8A 3I4LA 3WXMA 4DQLA 1A82A 1KI8A 4TLCA 3REFA 3UWKA 5JWRA 3HP1A 4LYHA 1XD8A 3U3MA 3KJHA 2BMDA 5L3VA 3KTAB 1AS0A 1GNQA 3EPJA 2GQFA 1PUIA 1UPTA 2F9MA 1VTKA 4BFVA 1VCNA 3THXA 2FEOA 3LVRE 3IGFA 1TTTA 4X8HA 1ZNXA 2R6GA 1GRQA 621PA 2J3EA 1GIAA 1NF3A 2QGNA 2YVUA 2C98A 3FHOA 3ONWA 2AX4A 4M1WA 1E63A 3UXMA 4RD0A 1WE2A 2GESA 5EJEA 3PJRA 1GFIA 2ZRIA 5SZHB 3OZWA 3W8RA 2IXFA 1R8SA 4IOJA 1E2HA 1LNZA 1NY6A 4TMTA 4HAUA 4OI2A 4K8OA 4LHWA 2IEZA 4UJ5A 1IN4A 3OE7D 3GQBA 2BVNA 3AF2A 4QGHA 3U44A 3AF1A 4DLXA 3SJAA 3G4SB 1ZUIA 4LSGA 1OIWA 5JRZA 4PX9A 2J46A 4C2UA 3HJNA 1L4YA
chains in the Genus database with same CATH superfamily
2Y81A 1Q3TA 3K4HA 4X8VH 1P4AA 4X7MA 4F2PA 1WO8A 4TXHA 2Z5VA 1ULZA 5DPAA 2C99A 5J2UF 1WHSB 4B4DA 1YZFA 2F83A 2HZ7A 1I01A 3JSXA 2J5XA 5DLPA 5CH8A 5JNUA 3D6HA 3IR6A 3EDMA 5K6AC 2E3JA 1E37B 2C7BA 2B1IA 3T4EA 5KOHA 1PNOA 1KI6A 5A09A 3FANA 1Y8CA 2R4TA 3J81A 3EE6A 4YRDA 5JVDB 4E0FA 2CKDA 4KIFA 1IY8A 2OHVA 2V7BA 2CMHA 2R11A 5K0HA 1QURH 4OQFA 3R4VA 2VWMA 5HX7A 1RSZA 4H4EA 3ZCVA 3F3YA 1J5XA 4KVAA 2FMJA 4BAGA 3CWZA 3ICVA 1GA4A 3HDYA 4LWZA 4MJXA 2ZAGA 4INAA 2E21A 4OBXA 5BNIA 1PF7E 1NXWA 2VZ8A 1H69A 1P3EA 3CJTA 4CREA 2PR7A 2FWAA 2XCOA 2QYTA 1SZCA 1L5FA 4Z4HA 1VC2A 3CW2A 3C3JA 5HKBA 2XUAA 3EIXA 3ZZBA 3CEJA 1SU8A 1V6SA 3B2NA 3H5RA 4P53A 2JCVA 5A2MH 2GZ8A 1ZIYA 4GAWA 1YZUA 1KAGA 5LA6F 1TIOA 1CHNA 5F51A 4JYUH 3OA0A 1JEQA 2I6SA 3GVLA 4DG5A 4MHTA 2DC1A 1A9ZA 4JIGA 3AERA 2O1XA 3DZKA 1T4CA 4Y2UA 3B38A 1CDZA 4DY4A 3J81k 3W34A 5BV7A 3GFTA 3MUFA 5CBPA 3TOXA 1SWWA 4X92A 2A67A 2G9UA 4FSHA 4F21A 4WF8A 3WAGA 1NATA 3OWOA 4URUR 3OY5U 3KL4A 2XWQA 2Q6GA 2WWIA 4PSCA 1OFVA 1R9MA 2HJVA 4BBPA 6REQB 4PGMA 5B6IA 2HA4A 3RAJA 1QIXB 2H0QA 3QA3E 4BB0A 4UKDA 1PKXA 2QZSA 3EQ6A 4RD6A 4YV1A 2FWBA 1BRBE 1E5QA 3A3GA 4IXDA 1TAWA 4RMHA 2H1RA 4IHAA 2ZS7A 2QL5A 1BOFA 5HIKA 1ZICA 4G4SP 3AVTA 3SLGA 1JU4A 4AJ2A 1B0ZA 4HX5A 5JS1A 4TN5A 1N2GA 1S2GA 4MVJA 3UJ9A 2WT9A 3JYHA 3I9V1 2RGAA 1VLZA 2VWNA 1PT6A 4PSDA 1HCGA 4WECA 1TEHA 1BVHA 2ZI7A 1PR4A 2D3NA 4U30A 1E98A 2PMFA 4IVNA 1BMAA 1J15A 2A92A 3USCS 4TRRA 5DN6A 1VSUA 1NM6A 1HX7A 5BMVA 1X0VA 4XZ3A 3TE7A 3BIXA 3NKFA 4Q4JA 5ALLA 3UJNA 1QKKA 3VRHA 1UMAH 2KM0A 3UFXB 3GJTA 3AU9A 4S1NA 1THRH 3VB5A 2V7WA 1LO6A 1UMKA 3ETHA 5F03A 3AEKB 2REQA 2P11A 1MB2A 3GHHA 1W7XH 3R6DA 4H60A 3E1XB 3E9QA 3ZVCA 1A9XB 5T6GA 3TLXA 3TZEA 4WGGA 2QMEA 5JB8S 3A8DA 2Z1MA 4OS1A 4OLHA 4B7CA 2C5EA 5KNCH 2J9FA 2YIJA 3GEMA 1F2UA 4JZIA 1XDWA 5C1BA 2ZUSA 4JI5B 1GZ7A 2ISQA 2AN3A 4YMIA 5HZGA 4F93B 3UJ8A 1V2TT 3WL3A 5U4XA 4Y67A 2CFSA 1N8SA 2R6HA 3IEXA 3SLDA 3D7KA 1DIAA 2H92A 4KPEC 4RHUA 4C7KA 1Y3WA 2OGZA 5HCUA 1SG8B 1MUUA 1TO2E 1NLUA 4ZXPA 1SKUA 4WXHA 1YRBA 4QYSA 2XYRA 5IXYA 2EATA 4RLSA 1XKBC 4B5KA 2XTZA 1V2VT 3WVNA 1J2UA 4QGFA 2XDWA 3H9GA 3INRA 1TX8A 4CLRA 3VH4A 2J4FA 4HGNA 3A86A 2BFBA 2HX1A 1EQUA 4P3KA 4JKYA 5HRUA 4JNKA 1AVGH 1Z62A 4PWZA 2KWIA 2RK4A 1Y0RA 4GPIB 1DHRA 4EMBA 1XRQA 1NMYA 5FI0B 3L3BA 4NAHA 2EX0A 1SCUB 3EIFA 1Q82D 1DWBH 2DE9A 1XUOA 5FKJA 1P9NA 5GPIB 3OC0A 1JJAA 5FRDA 3UK7A 2IXGA 1RGQA 2YDYA 1BBRE 1N1LA 2VAVA 1JKJB 2R5WA 5J35A 4YV7A 1KZ4A 2PFKA 3KTAA 2JHFA 4KCGA 2V65A 3LDHA 2Y0DA 3E1GA 3OZCA 2PIAA 5ALWA 2VA9A 1K8AD 2WT4A 1K63A 5CCXA 3F6UH 4Y2GA 4PZDA 2CHGA 1PSZA 5TMPA 1ZO8A 2D0DA 3L7JA 1ONPA 5GJVC 4X7BA 5IBCA 5JRDS 1JILA 3PA2A 4LTMA 1AGXA 1BMFD 1KOGA 3QVLA 1GRNA 3S7KB 2P75A 5FBWB 4D4HA 2Z2KA 4P3YA 1MAUA 4WW0A 2D2IA 3FPKA 2NUTB 1C2EA 1OOKB 5AHRA 5CHAC 5L3QB 2O2JA 1C9TA 1P61B 1YKTA 4BVLA 3MINA 1XMNB 2BSAA 1HORA 4UFPA 3MU1A 3JR3A 1KAHA 2Q4EA 1WV7H 4CI9A 3BTOA 3FD8A 4PLGA 4AJPA 2W22A 4NC9A 4OXYA 1ONNA 3EIQA 1PUXA 1MTVA 4POAA 5JAMA 4O2AF 5HYOA 3HB0A 5KQPA 4QBHA 5L3SB 4NZ9A 1P81A 1W4RA 4OQ4A 5LP6C 1M2VB 3OKPA 2WABA 1C1MA 2I1WA 2QW1A 2FI4E 3LUKA 1YIAA 1L5KA 3QEOA 3ZWQA 1QO0D 4AWAA 4LMBA 4PU0A 1Z6GA 1VITH 3D59A 3ZNQA 4U2DA 5AJWA 4MGIR 4YT6H 1KQSB 5EEGA 4LSMA 3FXAA 4XQEA 5A7GA 2VXYA 3J80A 4WXEA 2O8BB 3HBFA 5CA0F 2A88A 1NUPA 3VZDA 3H83A 1R6TA 1WVGA 2IHZA 2Z6UA 3HJRA 3DBHA 3ICPA 4PLPA 4L8JA 1V7PC 4BNFA 4XQFA 4TUYF 1F2DA 2DT8A 5BV8A 4B3SB 1XNQB 4ZCNA 3FDZB 4D9IA 1WCZA 3K0FB 2BW0A 3QFHA 5GM1A 3GOVB 3FJOA 2IF2A 5AOVA 1K98A 4ZVTA 1OGIA 3AP1A 3GCGA 3TPZA 1XPUA 5AH0A 1VXRA 4PGFA 5T41A 1V7CA 4IEEA 2D0IA 2AMJA 5D3MA 4IDAA 5LYJA 1MFZA 1SUCA 1YQDA 3KPJA 4INZA 3N2KA 1EXVA 3C1TA 1UAYA 1Q0QA 4UFOA 3T3OA 1ABBA 1A5AB 4RX1A 4K8YA 1XZBA 3ZDEA 4LK3A 4UHHA 1PNTA 3QVVA 3PXGA 5I48A 1F8GA 1X19A 3Q6NA 5KOJA 1GD1O 3D0RA 3QF4B 2HK9A 3DWGA 1M2OA 2X85A 1U9IC 4LW8A 4WY8A 2MR5A 4UCXA 4MI3A 2O5RA 3RREA 3S9BA 3VB3A 4GUXA 3NC0C 3A2NA 5HW0A 2GPJA 3HZHA 5C8XA 1Z6AA 1UXJA 4N5HX 4HZGA 3FVQA 1PK9A 4BFXA 4V1CA 4NFYA 4P6VF 4YP9A 1YCHA 2Y99A 3DL4A 1R0RE 1MC1A 2OUIA 1JMVA 5CE1A 3SS7X 3ASRA 4F04A 3OQ1A 4HI0E 3EA0A 1KPHA 3CM0A 1WB6A 2Q1TA 3GT3A 3TX2A 4D4IA 3F2IA 2YFHA 4L5YA 4NI5A 4DWWA 4FCWA 2BTEA 4SGAE 5JI3E 2IQIA 1BAPA 4QPCA 3UFBA 1KVTA 4E94A 3R5JA 1MD7A 4DGJA 3RBXA 3Q3VA 3RNOA 1VYTA 3L9WA 4KFTA 3N1UA 2O8EA 4W5WA 3MWIU 3CJRA 3FHJA 1N5OX 4M9UA 2ZK7A 3OTHA 1I13A 3AUAA 2IODA 3VPBA 2HO5A 1RCUA 2DZDA 2VRNA 5DU2A 3QTTA 5H59A 3FWHA 1EDBA 4IKPA 1ZM7A 4L4SA 3V7YA 2VWHA 2FE1A 1N7JA 2OCBA 1TYDE 1NVFA 1AD2A 1EM8B 2D62A 4QXOA 4B71A 3WIBA 1PS8A 4GXQA 5KEIA 3DDNA 2B4RO 4XWAA 4PPYA 4ERXA 2ODAA 7AT1A 3K2QA 4ZJPA 3C6MA 4R1SA 3ST7A 4CMKA 1QTFA 1W85B 4INLA 1M2JA 1ZJZA 2VUHB 3EHEA 1B4DA 3I1YA 5C1PA 2C20A 1RS0A 4W7IA 5EJ5A 1XG5A 2QUBA 1YBHA 3RXRA 3U4AA 2D1SA 2VS1A 5I7VA 2R0KA 3NK8A 1JAYA 4MWZA 1XTBA 4C4OA 2PU7A 2YJ3A 1I8DA 1I9GA 3DUFB 2GEDA 2Q5FA 1F3OA 2LNCA 3GZJA 5F4ZA 1EFAA 2EXXA 3B7WA 4DNQA 4CR6A 1K6EA 3ZVNA 2MYUA 5LKAA 5TF0A 2B5OA 1PPHE 3PFBA 3ONUA 2UAGA 4IUDS 4UNIA 3ZVAA 4TSKA 2IJD1 3RK4A 1IC6A 3F47A 4EPXA 4D26A 3GBSA 4EA9A 2QZZA 2ADFA 3D4IA 4RA6B 1V4VA 2ZAYA 2RB5A 5JQGA 4NIWA 1P0PA 5DTRA 3UTUH 5E3IA 4L3WA 3PDIA 4CLXA 3FM9A 1R6BX 3NTVA 5C94A 4Y6QA 2EYUA 5KYTA 2D74A 4RHEA 2OBRA 4IMZA 1NBWB 2VTKA 3QK1A 3V8MA 3T6KA 3HU5A 4ZCPA 4RNCA 4XRRA 3E7DA 1KO4A 1IM2A 1XCGB 4KOAA 4FKZA 3T34A 1BMMH 4IDNA 3BIOA 5DPMA 2FJ0A 4FJ1A 3RAEC 5AFSA 2GJGA 1KI9A 4ZYLA 2BZ6H 2X13A 5NLLA 4XPZA 3NRCA 3MIZA 5FHQA 4ZT6A 1MQ5A 3GLHA 5PGMA 2R25B 5CAEA 1M67A 3BQJA 1SOTA 2GCIA 1U6JA 2GMTB 4K7JA 1IJKA 3IURA 4OAQA 2NLOA 3GRKA 3JYPA 4GIBA 1NY22 5FR1A 1ZG3A 1KDVA 2O3JA 3W6PA 3JZ1B 3ICCA 1WL8A 1TIPA 1JTVA 1SKBA 1W44A 1BFKA 2ADMA 3KLMX 2VC2B 5ILQA 3VBCA 2WC1A 4JDUA 4DY7B 3IDZA 2D8WA 2IH4A 1YB5A 1MFPA 1NR5A 2ZJOA 1OI4A 5EP1A 1R50A 4J1SA 4P5DA 4DLLA 4Y2VA 1O0BA 1X94A 4N9WA 3K09A 3DL7A 4BCDA 4XRNA 4X97A 2DBZA 3MAGA 1G3BA 5K8UA 1DQPA 1G8PA 2A84A 1T29A 1J9EA 3USZA 1YLCA 5KSZA 1MCVA 3I30X 1O08A 1WY7A 1O39A 2QLMA 2J59A 3TDKA 2WV7A 3HRHA 3SUDA 2F1OA 4JZDH 3KYGA 4AUKA 3SYJA 4EJ0A 4O63O 2D1JA 2ECOA 5F98A 5BPEA 2GM5A 3EZLA 2RK3A 1FMTA 2IELA 4BTLA 3MPOA 1EBUA 3HCBA 1Z2AA 1I1HA 2CNDA 2QAAA 3ZCSA 3OOEA 3ETGA 4HATA 5IYZB 4K5QA 2P4EA 2FI3E 3PWTA 1O94A 3T51B 5G0WA 4CW7A 3GFOA 4NYJR 5AK5A 5L7YA 4FJ2A 1K22H 2JFYA 3GZNA 4PYJA 3MZ0A 5FTJA 1AFQB 2KCAA 3U1BA 2F67A 4GI2A 1USKA 4IV8A 3FLBA 4MB0A 4I2VA 2R85A 1T5DX 3URKA 1DMRA 1FQJA 5DP3A 4DT4A 4YR9A 1ADBA 4PQRA 1NYLA 1CJUC 1N5MA 1QGUA 5CB4B 3KT3A 2BD3A 1FY1A 3MO3A 1VA4A 5A8AA 1SVOA 4KXNA 5ULLA 2CEAA 4MW6A 4A8JA 5GJWC 1UT6A 1C5KA 3RJZA 5BW5A 2X4IA 3P9NA 3PE3A 3RQSA 1O9GA 2WHRA 2GCNA 4A2WA 2OR3A 3ZDCA 1M8FA 1PJLA 1ECLA 4CQNA 5FLKA 1FBTA 2ZE5A 3PV4A 2GCHG 1EX9A 5LMUB 1UBEA 2FWMX 4HTFB 2W6CX 1PTJC 4Q3LA 3T94A 3ZY4A 2HD4A 1NSTA 1ZIXA 4UFEH 4D8WA 2PWXA 4BNVA 4LQCA 1QKJA 2WWRA 5C8VA 4XH9B 4PBSA 3RYHA 4WDRA 1CUJA 1U3UA 3DAOA 1GPJA 1O2KA 3F68H 4C08A 4Z4EA 5CX1B 4X2YA 2WM3A 4F9EA 4QO8A 4MVNA 1IY9A 3DA8A 2W6IA 4QJ5A 1GI6A 1IN1A 3ZZ7A 4EAQA 3DB2A 1L0BA 1N2BA 2WPHS 2C5AA 3QXXA 2G17A 4MVCA 5JD6A 4HMQA 3RVBA 1SXQA 3WGUA 2UZ1A 4IDDA 1GBDA 2HALA 4TWYA 4HYQA 5EKDA 4EOGA 3F9CA 1DELA 3OZRA 3RYIB 2X3YA 1XZQA 3EISA 3RXDA 4XIYA 3LQRA 1Y7TA 2SNVA 1MT0A 1B2LA 3OHSX 3A9SA 5TQ2B 2YMMA 1Z16A 3DMYA 4UBKA 4YJHB 2XNKA 1O5BB 2HWUA 3SJOA 3EFHA 1ZGIA 3Q15C 1GVLA 5T64A 2E85A 4GCHF 3KKNA 3PG5A 1E2KA 2CV2A 3VOBA 2GZ9A 1IHXA 5F1PA 1TPZA 4DBLC 5GZ1A 3FVVA 5EESA 5JMTA 4RTPA 3OLXA 1GPH1 5JARA 1HDTH 3NFRA 1PJBA 2QN5T 5DTQA 3Q7IA 1XCOA 2C2WA 4Y6PA 4ISBA 1GJ8B 3K1AA 4ZKOU 3BSYA 2H63A 4WLVA 4L2IA 1MT3A 3WYAA 2H7XA 3FZGA 1C0PA 2OSBA 3QPUA 4N47A 2J0QA 4C3UA 1H3EA 2QUAA 3AVWA 3X1KA 4Z53A 2WD9A 3HVIA 2Y1DA 3GCNA 3OU7A 4AKEA 4U5QA 3WJAA 1ISFA 2GWRA 1ULSA 1X77A 3OBIA 2YYZA 4BNLA 2W98A 1Z2CA 2NXNA 4PLWA 3NHPA 1HO3A 4DPKA 1MAYA 4U2CA 4MQMA 2JD2A 5FX2A 1KFJB 5B7QA 2ATCA 3KOXA 2ORED 2CUTA 2MIIA 4FN5A 3JQBA 2ZRBA 4IH9A 2FSSA 4DHWA 1PJ4A 3L01A 3RDZA 3NIFB 3F6RA 3WJ2A 3F3BA 1QXSA 4A6PA 4Z4RA 5M29A 3N28A 3FTNA 4F3NA 1VCQA 1U7TA 1DJNA 2OFXA 2IQ5A 1N57A 3A6HA 4A27A 2E5LB 5AVSA 4L27A 4RK6A 3REGA 1HDIA 2NACA 3TK9A 3S2SA 3O4HA 3ZZ3A 2LXNA 3PX3A 4I1OA 5J2TF 1TNGA 3V8QA 1Z6YA 1GPWB 1B15A 3RFCA 1F7UA 5K2MA 1PWXA 2O4UX 3LIWA 1AA9A 3GA0A 3TLEA 1LPNA 2OZPA 3GWZA 5IJ9B 3QVUA 4JYPA 4HCJA 4RDKA 2YMSC 1LNQA 4ZTBA 1HY3A 4RU1A 2C83A 2RDEA 3S0NA 3PGJA 2W2OA 1ZR0A 1GAWA 3BC1A 3I2FA 1UJ4A 3CMMA 3V33A 2ZT7A 4IIVA 1YJNB 1S3FA 4B84A 3OY2A 1M8JA 4QPZA 1NIJA 3BHJA 3EHDA 1YHZA 1GG9A 1B8OA 3ABSB 5LOVA 1M6VA 1WDMA 2VP3A 3KALA 1DKLA 1F3LA 4AS3A 4HQFA 3B2QA 2FYQA 1GNQA 4X3OA 1EEHA 4DE5A 4I33A 1UP7A 2R6GA 1E92A 2H1IA 5EJEA 4Z49A 2AS0A 2JZCA 4TWIA 2G5NA 3HCWA 3ZGOA 1LLQA 4F9FA 1A3CA 2VPYA 4CT0A 4PX9A 4ITRC 3P27A 1S8FA 1IB0A 5CHYA 3O0DA 4X93A 1YGCH 4CV2A 3ZZ6A 3OTWA 1B23P 3QE3A 3HXKA 3UAZA 1XDGA 2GN4A 2H11A 1L6IA 3KQPA 2O5VA 4DUPA 3HR8A 1IATA 2RHHA 3M6WA 2E89A 4OGFA 1XR3A 1NTPA 4BQEA 2D4HA 5LQSA 4J0KA 1B7XB 3WJ1A 4O2BF 5AYVA 1NRQH 2R5FA 3I56B 3CF4G 3M5NA 3VR6H 2A0XA 2IFTA 3E2PA 4Y7CA 1KY3A 4XSVA 1UD4A 1DAHA 1GJ9B 4R6XA 1DKRA 2BFEA 3L8EA 2P65A 2X0EA 1COWD 2QRQA 4GI3A 3TIGA 3A4NA 4ITUA 1A1RA 1W0JA 5EE0A 3PEUA 3TCXB 3S2EA 3EXAA 2HFKA 2WZQA 4MGYR 4BRSA 5EPOA 1YOBA 2G09A 1CBWC 3HY6A 2FTMA 4P1VA 1D5WA 3VB4A 2GNOA 5FV4A 2F1KA 2QY6A 1RKXA 4AX8A 4LFBB 5FI3A 3BB3A 1DFGA 1GG2A 3GFFA 2OY0A 2GCOB 1QL7A 2BHNA 1YPEH 4TQUS 3OE5A 5CA1A 4QDTA 1TUEA 5SYNA 3IFSA 3WWEA 3PHJA 4C0HA 3D26A 2GM9A 4J0EA 1EJNA 1DC5A 1GN9A 3NTXA 3CVWA 2B4YA 2RI0A 1Q0RA 1A27A 3FFAA 4HGYA 4FUEA 3FAKA 1QS0A 2YN2A 4DJEC 4LSZA 3C87A 1XT6A 2GDZA 3C74A 4B4OA 4WZEA 4C89A 1E7SA 1NW6A 1IBRA 1DWEH 4UXHA 1JDSA 2FW8A 4X7DA 1TJPB 3RSFA 4IQFA 1SVWA 1XU9A 3WA7A 1NVGA 1HDZA 3O9ZA 3RASA 4P58A 4MPVA 3BH0A 5K0EA 1D2NA 3QMMA 3KOOA 4RPCA 2W26A 4Z0TA 1HGXA 1SFRA 5FWYB 1DAPA 3MFYA 2BY8X 2ZCVA 1QB9A 2GCGA 2BXUH 1LBQA 2GQ0A 4Y1RA 4Q01A 4CEJA 4J91A 4N6GA 3PC6A 3SQEE 3LAWA 2CF4A 5ALUA 2NADA 4ER3A 1O2PA 4F8JA 4NENB 2DHRA 1RWXA 2Z9BA 2RBKA 3NB0A 3PD7A 2VHCA 1VITG 1NVWQ 4D0NA 2ZRHA 1LGYA 16PKA 1DMSA 1W49A 3TJNA 4BAUA 1JJIA 2HNTC 3H18A 4BAOB 5C7YA 4KE9A 4CTJA 1BPLA 5KNDA 1HDYA 3QNUA 2OLGA 5L4SA 2AS9A 2BLOA 3LGTA 4M9XA 1Y8QA 1FW8A 2XYVA 4DIBA 3GDSA 5DYGA 5BN4A 5A9SA 2J94A 4WOKA 2VYQA 4KXXA 3A9RA 2EW8A 1CKEA 4LZ1H 3SX2A 3CF0A 1E5XA 4K60A 1IZYA 1QJCA 1VPWA 2CBZA 3EZ9A 3SEFA 2ZIWB 4CG3A 5HF8A 1P8AA 2X0IA 1C1HA 1ZRSA 5CDTA 4PR0A 1U02A 2ETXA 3WO0A 1M90D 1Y5AT 5FL7A 4KI0A 1C5MD 5CVTA 4M1YA 2BFFA 4KIUA 3QPBA 2IXTA 3PZRA 3R9KA 1WR8A 5B58T 4R54A 2OORC 3LMKA 1K7EB 1V0EA 3A1FA 3SYKA 1IONA 3FW1A 4Z7NB 4K6HA 5ECGC 3C8HA 3BX1A 1YBWA 3T5MA 1NQAO 4I99A 4MINA 5HUHA 1UZNA 4DKJA 1M76A 3VZBA 3MK31 4FP9A 4FIZA 5BMOA 1VP3A 1V5EA 2PUHA 2BGLA 1DARA 5LUAA 2FEMA 3A4TA 3UJ6A 2BD8A 2F9VA 1AQ6A 2O4CA 3S2FA 1J0BA 2XKKA 3RXKA 4MW1A 3FWKA 4L8LA 3RS4A 5GY7A 4ZO4A 1DZ3A 4J03A 5DYIA 2AJ8A 4BMPB 4M21A 4LGVA 2ZC9H 3UGJA 5ICEA 1SUSA 4IJQA 1XN4A 3M1AA 1KDYA 2NVUB 1BVUA 1P2GA 5KSYA 3TTXA 3BIFA 3F6EX 2X23A 3ZHUA 1SELA 2OGUA 2RHCA 4NOKA 3O1HB 5KTKA 3O03A 4I9FA 1C9DB 4YT8A 4V2UA 4MS1B 1G8HA 3TSAA 4RGYA 1VMEA 3FWZA 4R0VA 1J24A 4NPAA 4EL0A 3COWA 1T2DA 4U01A 1E89A 3VU0A 4KITB 4G07A 2P30A 5K3EA 2RH9B 2KB0A 3ZZ5A 3RG2A 1N3YA 1ZCFA 3ITIA 5I7UA 3O9VA 1HJAC 3SOPA 2YWFA 4JROA 2ZIEA 5KEDA 1WV0A 3S7ZA 2Y66A 1EOLA 4ZO6A 2XYHA 2A5DA 1QCYA 1FLNA 4XCQA 4FOSA 3IEUA 1K9SA 1G3QA 4FKMA 5CGQB 4B3GA 1QH1A 2QG6A 3LVFO 4LNUB 3CUYA 4GPGA 3TG8A 4GPBA 1J07A 1QK3A 5KHAA 3MH6A 4OA8A 3QY9A 1LPGB 2FYRA 2EQNA 4XGQA 5BQOA 2AERH 1DWCH 4R2LA 5CLIA 2GYWA 4DLUA 3N6VA 1GY8A 4Y8VA 2I67A 2VUSA 1T8YA 2GPWA 2QRNA 4QOGA 5E2BA 1I0IA 3PVDA 2H4YA 5HZMA 4Y0YE 2Q3LA 3N7EA 3X43A 3LHFA 2CGEA 1CUAA 4AJ9A 1O3BA 2Z30A 2H7VA 2AHME 2XD9A 1HXHA 5HTKA 3SZLA 1LSSA 5U9CA 4Q1DA 1P3JA 1JQKA 1PUJA 2Y27A 4C76A 3KYJB 3W79A 1BA2A 4DXHA 1WNFA 4FEAA 2JBAA 4U63A 2O8DB 3THWA 3L77A 2GCEA 4CEHB 4Y6DA 1GGDC 5JDUB 4FN4A 3NTOA 3WK9A 1QR2A 4BZPA 4H42U 4AN7A 2F9PA 5JAUA 4IO0A 4IDPA 2FOBA 4B47A 2WMYA 1AHTH 3IDFA 1SBCA 2FUEA 1K6XA 1GA1A 3MGCA 4KYUA 1UBRS 4Q7LA 2W2NA 5TVKA 1RJGA 3W7BA 2PAFA 4Q12A 3P95A 2BGRA 2NWNA 4TXMA 3PXCX 4DSNA 4XYEA 2QLLA 1P11E 5LYYA 2P9FA 1FDPA 4JLWA 4YRMA 3EVFA 3G8YA 2KAIA 2E87A 4I4LA 3WLNA 4EPRA 4IIJB 5K7SA 5IW8A 2ZZNA 3L49A 5K0SA 1QOZA 3N2EA 4ASUA 4BUJA 3P9QA 4A2CA 4FVBA 3E1YE 2ZI5A 1JDBB 4PN3A 4OI1A 2ZTLA 2ZECA 1DPFA 2ZIAA 3PCTA 4LISA 3WK6A 4DOMA 3B53X 3OYPA 3E3MA 3DTVD 5EWJB 4HQOA 1C7EA 1KTVA 2PU5A 4ZT3A 4C0AC 1PX0A 1M8GA 1I5EA 4IS5A 2DWQA 3RXBA 4YELA 3ZJYA 4L51A 3H3FA 2BX3A 2AC2A 3AR4A 3HU3A 1U4NA 3RSOA 2V7EA 3ONYA 3QWAA 1KRWA 2IYFA 4X8SH 3MIIA 3T7SA 4BNRA 4ZAWA 5H8WA 4E5VA 4HRXA 2XKAA 1JWBB 4ECAA 2AGEX 2FLRH 2XCSB 3AT1A 4Y2QA 4IFIA 1E5TA 3PRYA 5BV2P 2C8WB 1M72A 2QI9F 4GMFA 4FUQA 1LTQA 1WF6A 4HH4A 1P9RA 1IPHA 4IHQA 4Y8YA 5KWJA 3HFGA 1GKLA 1EFRA 3W7VA 4O4HF 3MGKA 1F0TA 2UYQA 3LL7A 4KIJA 1G7CA 4IQ4A 3S5JA 2IHNA 2OHGA 2EKBA 2O2SA 4E6EA 4WFKA 3EQ7A 3GJQA 4NIXA 4YDHB 2WFLA 5IJWA 5E8JA 2C96A 3W4IA 5L3ZA 3TZKA 1GPKA 2WBLC 1II9A 1SGIB 4YDRA 2E2WA 2JHPA 2XZPA 2BELA 2O6HA 4QRDA 1RRGA 4LDNA 5BWNA 3NTQA 2CYBA 1SZDA 1WF3A 3RVLA 2DOKA 4QTYA 5DBIA 2ZTXA 2FFAA 3M3TA 5ENDA 1E9DA 2Q5HA 1BHSA 1DG9A 1Y4DE 5CT9A 4LOYH 2P9EA 4BVEA 1GGKA 4LZWA 1BXRA 1EQAA 5KYWA 1WCXA 3AKDA 2GDEH 1I6MA 2NU2E 3QWCH 2XB9A 3IKMB 4B6EA 1ZD4A 1VCWA 4EDFA 1FUKA 1M54A 4S1TA 1NVXQ 2XUKA 4R6WA 4CR8A 5DYNA 3F4BA 4D9GA 4TMWA 1EVQA 2QL7A 3SKXA 1KEPA 1L8OA 1AVXA 1J17T 2B99A 2OQUA 3BXXA 5JAQA 1K7SN 3N8GA 3JX9A 5CDHA 4Z99A 3SLRA 5FAKA 3I01M 1T91A 4R1LA 3IH5A 2ZRLA 2RH5A 2JBWA 3TL6A 1EUDA 1OJ7A 5ALFA 1V3VA 2WT8A 2NM0A 4HE6A 5BSWA 2XSZA 4IJ5A 3NAMA 5KC8A 5JCOC 4N8EA 3M4NA 5B7GA 4I81A 5T7BA 4KH0A 1D1TA 1Y1QA 2ERYA 4IICA 3K9HA 1JQEA 2VTBA 2HF2A 1LZLA 3ADCA 1NONA 1LDBA 1DCKA 2ZUWA 3WDKA 1Y1SA 2P2SA 4NESA 3JD1A 4P9NA 3NU1A 1I2CA 4NFEA 3HUFA 4Q02A 1GBTA 1OLSB 1YUMA 4RMNA 1CQPA 3RIHA 2OZKA 1O2HA 2BLVA 4UM5A 2VH0A 1GFZA 1QTRA 4L8YA 4EHDA 3VBEA 1RQGA 1H1DA 4DCJA 3RUCA 2BGTA 1HGTH 3A11A 5C32A 2OYCA 2C59A 4XLZA 5JSHA 1FJ2A 2BGIA 1R6UA 3QWBA 3TH5A 5KYVA 4FWIB 2EFHB 2H6MA 1RQXA 1YR6A 2KR7A 2Z2YA 5CEFA 3GUZA 3I5MA 4V03A 4Q1EA 1DY9A 4H7HA 2PD3A 1M1ZA 3OUTA 3QLPH 3GVPA 3IA7A 4QUDA 1JBKA 2PLNA 5E2AA 1W0CA 3HJUA 2FN7A 1EE9A 5B12A 1NVMB 1FTQA 5IAJA 5KVQA 2VP9A 4G0NA 1S2DA 4OSEA 5DIZA 3AFMA 1B93A 1CF4A 2TMDA 3L0DA 2LBPA 1VLMA 2IDKA 3LGAA 1KJZA 2X9LA 3JZDA 3NBQA 3WP1B 4LGYA 1XMJA 1F0YA 3RU2A 1JB9A 3FSRA 3N53A 3SYRA 4IMRA 4QXRA 3ZY2A 4B3TB 3A87A 3RHSA 4DZZA 1NI4B 1N6KA 1G66A 1JPJA 4E30A 3KDPA 4TTAA 3GVKA 1YJCA 3OIGA 3N07A 3STVA 5DK6A 3KYBA 3AKEA 1H9BA 3U48A 1U8EA 1KZHA 1TU0A 1G291 4ABGA 1LPZB 3DMPA 4H7JA 3BE6A 3QI7A 1ZPCA 3Q9UA 1YFKA 2FETA 2W4IA 1US8A 1MKYA 1A61H 5DHRA 3QKWA 3JALA 5J2UB 1Q83A 4KXLA 3BCSA 3B9QA 3WWOA 4ZCMA 3IP3A 2HT1A 3ZZ8A 3A1CA 5F2EA 2ZUEA 5DRTA 4F96A 2EP7A 3HUEA 1RJ9B 3BWYA 2PP6A 4WFJA 4COOA 3A6ZA 3ZBUA 2GFHA 3A8BA 5DWVA 2K5UA 1XCLA 2PN1A 4XDEA 4PLVA 1EFVA 2HPHA 4MICA 1ETUA 4A4DA 3E9EA 1V2MT 3E9CA 3ZZ4A 2FX2A 4UDXX 2WD8A 4KQCA 2VB0A 1C5SA 4JC0A 4CR5A 3IBSA 1Q6YA 2WKWA 2A0UA 4C5AA 4KGDA 4KLZA 2EZ9A 2OOSA 2GV6A 4ENUA 3TD6A 1E3XA 3F90A 3ZHCA 3H0EA 3OOJA 3CLRD 4LDAA 2HWXA 1U8TA 3N7OA 1OXTA 2NTJA 5ALPA 2PUFA 5DK1A 3GRUA 2YL2A 4LOHA 5H83A 5LA6B 3RTBA 1U9YA 4A1XA 2ZVDA 4JI3B 3ZWVA 3MQ2A 2W42A 3LLUA 4HGRA 4BBZA 3DDCA 1JNYA 5CXXA 5EPEA 8GPBA 2EFDB 2IOTA 3WLTA 1ECJA 1G20B 1MRSA 4LZZA 4GQBA 1S6HA 3OCZA 4V1CI 2FW1A 4L95C 2DUJA 3W3AA 3EXG1 4RPJA 1ZJYA 1OTHA 3FTPA 2DBRA 1TOAA 1TUBB 4XWWA 1AB5A 1WXQA 4MRSA 2P5UA 1OX4B 2AF3C 5B4TA 3I9MA 4P4GA 1ZU4A 2ZTYA 2DMRA 3FN4A 3CWQA 4KODA 2FN3A 4EUFA 3H09A 2IA5A 2D2FA 4TKMA 1WPQA 3WGOA 2X8AA 3X1XA 3RTDA 4I8KA 2ZRFA 3BCUA 4AJ4A 3M49A 5EFZA 3QBVA 3O31A 4MXDA 3U3KA 4KFSA 2OCDA 1QHHB 3EPKA 5DGXA 2GD0A 4GLFA 5AKZA 3AUXA 1A5GH 3A06A 4MYHA 3LGSA 3C2QA 5KTPA 2ZFPH 2W37A 1E5DA 3WLSA 2KQUA 3RF6A 1P1IA 1UVPA 3BTTE 3R4CA 1QMGA 1FP7A 1BCUH 3H9EO 3SSAA 1UFOA 3DOCA 1BOOA 5ERGB 4ZAFA 4ZN6A 1BDBA 5EHIA 5HZKA 1IULA 1E4VA 4JQYA 2JFUA 1N2CA 1YAJA 3A4YA 3NVDA 1KR2A 4FFVA 4NARA 1T2AA 1SZJG 1Z4QA 3MB5A 4YALA 1NQWA 4G86A 5MGBA 3RGGA 5BXYA 4L9AA 2KE5A 1XZHA 1BB0B 1ZMJA 4PBRA 1GG6B 3CHYA 3H9UA 1N5KA 2FA9A 1W0KD 2DVMA 3CXCB 1KS9A