4ACAA

Crystal structure of translation elongation factor selb from methanococcus maripaludis, apo form
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
469
structure length
444
Chain Sequence
HMDFKNINLGIFGHIDHGKTTLSKVLTEIGFSAFKLENYRITLVDAPGHADLIRAVVSAADIIDLALIVVDAKEGPKTQTGEHMLILDHFNIPIIVVITKSDNAGTEEIKRTEMIMKSILQSTHNLKNSSIIPISAKTGFGVDELKNLIITTLNNAEIIRNTESYFKMPLDHAFPIKGAGTVVTGTINKGIVKVGDELKVLPINMSTKVRSIQYFKESVMEAKAGDRVGMAIQGVDAKQIYRGILTSKDTKLQTVDKIVAKIKISDIFKYNLTPKMKVHLNVGMLIVPAVAVPFKKVTFGKTEENIILNEVISGNEYAFELEEKVLAEVGDRVLITRLDLPPTTLRIGHGLIEEFKPIKDLNIKKEVLREGKVKIDKGRTVIDGLAQSKVAAEKLIGEEISIEGKDIVGKIKGTFGTKGLLTAEFSGNVENRDKVILNRLRRWG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSLATION ELONGATION FACTOR SELB
publication title Selenocysteine tRNA-Specific Elongation Factor Selb is a Structural Chimaera of Elongation and Initiation Factors.
pubmed doi rcsb
source organism Methanococcus maripaludis
molecule tags Translation
total genus 98
structure length 444
sequence length 469
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.190 Mainly Beta Beta Barrel Thrombin, subunit H translation elongation factor selb, chain A, domain 4 4acaA04
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4acaA02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4acaA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4acaA01
1N6OA 2RGCA 4JVNA 3K0SA 3U7FB 2IUUA 2XNDA 1Q12A 4DQLA 4TMKA 4B6EA 4QFMA 3G6EB 2J7PD 2REOA 2FU5C 1M74A 2GAOA 4PANA 4BEBA 1E94E 4TWZA 1GKIA 1GAQA 3LVRE 4AG6A 5E7IA 3Q5DA 4QXAA 2HT6A 2PX3A 3HYRA 3KFXA 5FPSA 4LJ7A 1G6OA 2GKSA 3THWB 1X6VA 5KNCA 1GO2A 2C03A 2K5UA 4AKIA 1XF9A 2CJWB 1GM5A 2F6RA 3AGQA 1AMOA 4A0HA 1Q0UA 4QGFA 2ZI5A 3SE0A 4RZ3A 1W36B 1T4GA 4BRWA 3QXCA 2IYRA 1UADA 3QUSA 4XTRA 2PZGA 4RSGA 2CE2X 4JYBA 1FZQA 1UBFA 3TVTA 3VAAA 1Q86D 1KO5A 1Z22A 3OIWA 4RFSB 4DRZA 4BPBA 3A4LA 4UNNA 1XZQA 1E62A 3RS5A 2VHTA 2QEQA 1OPXA 1I4TD 2ZR7A 5HZHA 1C1YA 1J90A 5KPDA 4ZDJA 1OXUA 4AK9A 4UNQA 4G01B 3W34A 2VO1A 1D8TA 1CEEA 3WHLA 5K8TA 5IDVA 1E4YA 3B13B 1NI3A 3WRYC 1XCPA 1YI2B 2CBZA 3SYNA 1L4YA 4A0RA 1Z6GA 4BZXA 1E0AA 4XTCS 1FQJA 3I92A 1KMHB 2GCOA 4W5JA 5FR2A 4DLUA 1R5OA 4LGMA 1MO4A 4F92B 3CCVB 4LUCA 3I8SA 1H85A 4DKXA 2OV2A 2Q3MA 4C0LA 1S1MA 5H70A 2CL6X 2VL7A 1Q3HA 1DAHA 1SXJD 1MO6A 2HEIA 3L8ZA 4MRNA 4NU0A 3TQCA 2QBYA 1Z0KA 1V43A 1Q20A 2FFAA 4QM7A 1J7KA 1II9A 3SNHA 5HCNA 3ZZTA 2J0UA 3UKDA 4GP7A 4B3GA 3T1VA 2V6JA 4G5SA 1QHHB 2BCGY 4XVUA 1UKYA 1XPRA 4HZUB 3K70B 3QFTA 2GRJA 1GUAA 3L0IB 4KI0A 4RZUA 4QBIA 4Q7KA 1EFRD 4EAQA 1E2LA 4P6VF 1GIAA 3X1DA 5FTMA 1XMSA 1PZNA 1DOAA 3AF2A 3ETLA 2ZR0A 2FGJA 1Z3IX 3ASZA 2EFHB 4BLOA 2OO7A 1ZYUA 2G1KA 2Z4RA 1US8A 3W6PA 1KMQA 1NBME 1HA3A 3GEIA 2OAP1 3KZ1E 5HZKA 1SVSA 3MSXA 5K8UA 1NSFA 2O8CA 4V02A 4DXAA 5L3SB 3H0KA 5FUVA 2IUSA 1E2KA 3KXLA 3DZDA 1YHNA 2EVWX 3CRZA 4UXHA 3GLGA 4GZMA 3BOSA 1P9RA 4DT1A 3GLIA 4D6PA 4HB0A 4KLZA 3S1AB 5JSZA 1B0UA 3QQ5A 5CM8B 5FR1A 4Q4HA 4IXMA 4C0JA 3A8TA 4Q18A 1QGAA 4W5HA 5HE8A 2P5TB 2GF0A 4LBWA 1BKDR 1DG1G 3ZQ6A 1WXQA 4AYTA 1FTSA 5DH9A 5FUWA 1UM8A 2KJQA 2ZRNA 1FNCA 2EFCB 4ZCIA 5JWHA 4XWOA 1N25A 2IYUA 2FEMA 1OIWA 3B1XA 3QXSA 2RGDA 3ADCA 1QHXA 3QPUA 1E9EA 3A1UA 2ZTSA 3NVAA 4JKYA 2FWRA 4U7DA 2CDNA 2AD5A 2JATA 1TQ4A 2QPAA 1JXMA 3TKLA 3ZVLA 4NYJR 3OIYA 2YZ2A 2OILA 3OEHA 4TMXA 3KXKA 4FINA 1NVXQ 3LW7A 1KKLA 1NBMA 3LD9A 4FWIB 1T91A 4F7DA 3ND9A 3IEUA 2ZYWX 3NC0C 5KU1A 1G291 1KJZA 4CEIB 2HV8A 2H18A 1A5TA 1JB9A 2NZ8A 4CEHB 4UKDA 4ZV4A 2J5XA 3PUWA 1SQ5A 1DS6A 1G7TA 2FG5A 5L3VA 1S3SA 1VQ5B 1ELOA 3QJYA 4CT5A 4HUTA 3PCRB 3LW8A 4F93B 1YJ5A 1GNRA 4IJMA 2R44A 4URVR 1E69A 2VSFA 2IEYA 4I1UA 3EA5A 1LTQA 4EQ6A 1VQ9B 2MSEB 3A4NA 4B74A 3OFND 3DMDA 2ZE6A 3U2QA 1M7GA 1R10A 4L5BA 4AKHA 4M9ZA 2NO7A 1W5SA 5CIQA 2HYDA 2V54A 5B2ZA 2XNCA 5IK2D 2QQ0A 4ZCLA 4US1R 3FHCB 4OQFA 2PT7A 4MRVA 3ZYCA 4C0KA 3M0EA 2QA4B 1Q81D 3IBYA 3U3MA 2CXXA 1R5NA 4MGYR 5AR1A 3OEED 1QVFB 4JBWA 2IYQA 3OE7D 1AZTA 1HURA 121PA 5IHPA 2CL0X 1NSTA 2G6BA 5TVKA 3DOFA 2XJ9A 1BOFA 2ZROA 1XJ0A 2D3WA 4IDQA 5EUQB 1P62B 2Q3HA 3QEJA 4QG7A 4PC3A 4LJAA 2ORIA 3THWA 1A8PA 1FL9A 1Y3AA 2ZE8A 4X8LA 1ZJ6A 2OE2A 1ZM9A 2CJWA 1FDRA 3ZS8A 3ASYA 1ZD9A 1OXVA 4G5OA 2O8EA 3TR0A 3EW9A 2QTZA 4R71A 3VFDA 3E1SA 1BO6A 2A5GA 2ATVA 5CIWA 3TLXA 1E2JA 3ADKA 1H8HD 3A4MA 4M22A 2XEXA 4E5UA 3ZBTA 4Q7LA 4DDVA 4NONA 4RFSA 3CF2A 1GP2A 3IO3A 4HAXA 5ELXA 1LF0A 1BMFD 2ZRKA 5E4FA 3R9WA 5TR9A 5BW8A 1IOZA 2P67A 1KJYA 2NPFA 2FOLA 2R8RA 3PV0A 2LKCA 3T12A 1OSNA 2C95A 3ZGXA 3LDAA 4CGZA 2AXPA 4QNRA 4RD0A 2WWHA 2REBA 1OIXA 3T34A 3CCEB 3X1WA 5J4HA 4JT2A 4Q1BA 3REGA 3FJOA 1XX6A 1KOFA 3R20A 2PCLA 2JEOA 1EP2B 2OFXA 4EPXA 4DSUA 1T3SA 2AWNA 3BERA 1KMHA 3TUJC 4D80A 5DHFA 1ZNZA 2AKYA 3THOA 2EWVA 2FDCA 4Q4JB 2CHVA 2PJZA 1LFDB 4E07A 3HR7A 2WBLC 4HYYA 2GXQA 2JLZA 3RS7A 4DB2A 4MITA 3LLMA 2O8FA 4KU4A 3DM9B 1Z29A 3B6EA 2QTLA 1P5ZB 4CEJB 2ERYA 2W58A 3T15A 1YKSA 1VMAA 1OXXK 4US0R 1ZU5A 3DPUA 4AC9A 2GJAA 3T1QA 3EZFA 2ZM5A 1P2SA 4A8JC 3QVVA 5AUQA 2AX4A 1DDIA 1JQLB 4ZPXA 2JA1A 2GXSA 2HLDD 4IRUB 3QFRA 2YV5A 2RGBA 4HZUA 1XJCA 1CR1A 3OZXA 5EJEA 1VQOB 1A1VA 4LY6A 4HLDA 3QPWA 4XIGS 3QXJA 2J46A 3CCUB 2TMKA 4L9WA 1P75A 1X86B 3IIKA 2EFDB 3VNVA 1G3QA 4G0NA 1EFHA 1NKTA 1B2RA 1VHLA 4A92A 1KK0A 2OTLB 3L0PA 2H7VA 1N3BA 2YVUA 3Q85A 5EE0A 4OHYA 1JR6A 1E2QA 1IN5A 4LHYA 3GPLA 2QEXB 1E2NA 2WICA 2IS6A 5L3SA 2QROA 5FBRB 2FEOA 1COWD 3SHWA 4DLXA 4QJ3A 5LB2A 4QM6A 4HB2A 4Z51A 1N6RA 3AF3A 1MO3A 4KV9A 4DC9A 2OXRA 2IUTA 2ZU6A 3K0FA 1TPZA 1K5DA 2J41A 3KQHA 3S1AA 4WXRA 2OCYC 3MMPA 2GXUA 2WSMA 1EWQA 2KBFA 1XEFA 3E5HA 1TQDA 1XEXA 4NYIQ 4E09A 3TSZA 3SHFA 2GDJA 4B71A 4BLRA 5C2JB 3N2IA 3EA0A 4JT4A 2PZEA 4BASA 1SKQA 3B5JA 2JLWA 2VHJA 2YHSA 3BB1A 1GTVA 2VP4A 3F8TA 1E3MA 2BDTA 3NBFA 1N6PA 2ZS7A 2WTUA 4WXPA 4FCVA 3JQQA 2BVNA 3FE2A 1RRPA 2VP5A 4G1BA 4HE5A 1S1CA 4Q19A 5FBWB 2GF9A 2R6DA 3V00A 3ZJYA 1JR3E 3TAHA 3UMRA 4YHBA 2FJUA 5KSYA 3QKUA 1RIFA 4ACBA 1KI6B 2JAQA 2PJRA 2F9MA 3V4FA 2ZVPX 4LJ6A 2JLQA 1N2CE 4BPRA 4E22A 4Q66C 3WBKA 1SVWA 3RHFA 1E79D 2KI5A 4IEEA 5CB6A 3UG6A 3WYFA 2J45A 3QE0A 5EP4A 4AF6A 2D62A 4HAWA 5A4JA 1XRJA 5CK5A 3CCSB 1KRHA 1TU3A 2ZUDA 1P9NA 1QFJA 1WF3A 1F2TA 4YLGA 1BQEA 2CCGA 4HLUC 1VG8A 2LCFA 4PAOA 3UPUA 4CEHA 4TYQA 3KXIA 4DCTA 1JAIA 3R9XA 1UPTA 2WPDA 2R62A 4C0SA 2ZRHA 3U3RA 1CRQA 1AJEA 1G41A 3G4SB 1VECA 4PXAA 4YALA 3QI2A 1RYHA 1Z0AA 3CCMB 2ODBA 3TR5A 1D9XA 4DSNA 2QTHA 4Q47A 2XGJA 1H8EA 3MAAC 3CRQA 4O25A 1WB9A 2EFGA 3KQNA 4XD7A 2D2FA 1ZUNB 3UXMA 4BGDA 4LYFA 2OCAA 1KO4A 3QE2A 1E32A 1MRSA 3N2EA 2QM7A 5DLQC 1S96A 1EX7A 4EJSC 4Z8YA 2CNWA 4NP6A 3KUCA 3GFTA 2ATXA 4PHFA 2D7CA 5FBVB 4K81B 1OFTA 2WSSD 2WJVA 3NC1C 4MYCA 4WBSA 4DZZA 2IWRA 3IPYA 4KYIB 3QVUA 4TYPA 3F0TA 2DY1A 2AWOA 4EIWA 1G9XA 5AWFC 2P6RA 1CTQA 1VQLB 4QJ4A 1XEWX 1II8B 4N1AA 4TMWA 2ECKA 1E96A 4AYWA 5JCPA 5C4GB 2E9SA 3E70C 3EPLA 2OBMA 1SKYB 1UDWA 4LJ4A 2Z6VA 2UKDA 1HE8B 2F43B 2GVZC 3T61A 1SGWA 1EGAA 2J0QA 4CF7A 4TN1A 2WV9A 1W4AA 4EPTA 1S0UA 3OZWA 2J87A 4QGAA 2WWYA 1W5TA 2GNOA 3DVLA 1Z07A 3OIVA 4A6XA 5HKKD 1BS1A 2RGNC 3LQRA 1Z0JA 4JVLA 4BFZA 3VKHA 4DQKA 1IY0A 1RJ9B 3L8YA 5E7JA 1A82A 3OESA 1D2NA 3GLFB 5EE9A 1P61B 1NIPA 4IDHA 2NO1A 1PLKA 2CLDX 2JIZA 1GDDA 4PPQA 4V0NA 4Q9KA 4TZ6A 4AI6A 1CQXA 4URYR 3F3YA 3MFYA 2FV8A 3K0AA 1XWIA 2PMKA 4TTRA 1Z2AA 3ZIAA 1ZC3A 2IA5A 4BFYA 1DO2A 4FK8A 2BJVA 4KJZA 3FOZA 1Z6TA 4OI2A 3GLHE 4XJXA 5TXGA 3K09C 2ZRMA 4MQBA 4Q1EA 1AN0A 3FFBA 4JYCA 4HLQB 1NMXA 1UJ2A 1GL7A 2V55B 3BH0A 4GOKA 4I81A 3K0CC 4BLQA 3DDCA 4PO8A 2YC4C 1DAGA 5H5JA 1YJ9B 4F7WA 2QZ4A 4A8JB 1Q21A 2XSZD 4CEJA 1ZM7A 1NLZA 4Q48A 1SXJB 3Q8XB 4KFRA 5BQ5A 3Q5EA 1MABA 621PA 2ZYVX 4L15A 2NMVA 2WMOB 1VHTA 1YR9A 3LX5A 5CB8A 1FNDA 3VR2A 4TSFA 2G1JA 3FTQA 4AD8A 4A2QA 1A2KC 2OCPA 4NMMA 3REFA 3NIBA 1M7HA 5EP1A 5GJBA 2X8AA 4M9SA 1AZSC 3FHTA 1F20A 1IONA 3N5CA 2BC9A 2RGAA 1NJFA 1AIPA 4JIMA 2V7QA 5GVSA 2DERA 3SYLA 4A2WA 1G16A 1TAGA 3LRPA 2IS2A 2V8OA 4OK6A 1EESA 3TJZA 5GVRA 3SBEA 5EMNA 1VG1A 3EG5A 4U9UA 2JLYA 2P5SA 2O0JA 2QAJA 2IC5A 4LDJA 2RH5A 1P72A 2A7QA 1W48A 2BBWA 2Z83A 4P0TA 1KNQA 1Z83A 5KTYA 3SJZA 2BM0A 3FB4A 2OBLA 1E1RD 3W8RA 2ZIAA 1WBBA 5H8WA 3OAAD 4A6PA 1EFCA 4HB4A 3RWOA 1QDEA 1VYUA 4BQSA 4FW9A 4GOXA 4DDTA 3E20A 3QF7A 2Z4SA 4EFNA 2BPOA 3T1OA 1AGPA 5CJPA 5KDOA 4F4JA 3LO5A 1Z47A 1NLYA 1Z28A 1G7RA 2Q21A 2VZLA 5KHOC 3WMGA 4O2RA 2VQSA 4TLCA 1FMLA 1KK3A 1KZGB 4YQFA 5C18A 2V1XA 1GVHA 4ZGQB 1NY6A 1KK1A 3C5CA 5G53C 2XB4A 3KQLA 1PVOA 2YWHA 2YKGA 3WP1B 4PGOA 1II0A 4ZO4A 2AD1A 3IHWA 3LA6A 3CPEA 3TSOA 1P7CA 2WVJA 3KUDA 3RLFA 3MWLA 5EXSA 1EXMA 4LV8B 2J59A 2R65A 1OLOA 3TW4A 1E9DA 3CXCB 3CRRA 3LBHA 1E1QA 3AF1A 3WRXC 4BLTA 2JLUA 3VKGA 4Q4AB 2ZRDA 4S2EA 2QMUA 3EPJA 1W0KA 4R98A 3IDQA 3IGFA 1KSGA 4JVMA 5B58C 1D5CA 1K8RA 5F3WB 2V6IA 2ASEA 4ZCMA 2GILA 2P0EA 4A1FA 5K8IA 2XTMA 1QF9A 3CB4A 4ZIRB 2O8DA 1VCIA 4B43A 4F4IA 1VCMA 4GI7A 2B7CA 4LV6A 3B8HA 2ZAMA 1CJKC 4LJ5A 3LBNA 4R9UC 5LD2C 4C2UA 2GZHA 2HYIC 2A5JA 2ZJYA 1Z2CA 5JS8A 3G82C 721PA 1KI2A 1EK0A 1YZQA 3GLFE 1N5IA 1NMYA 1ZCAA 2J1LA 3D8BA 3Q9LA 4ON9A 1R4AA 1DELA 3JQRA 3H1TA 2QP4A 5IT5A 2J0VA 3CH4B 3C16C 4IVPA 2P3SA 4BFTA 3SEAA 1N6LA 1E2DA 1NN5A 2GEDA 3X2SA 1A2BA 4HDQB 1CJMA 1N6KA 2QE7A 3SQWA 1EWYA 2WOJA 1CULC 4J0QA 2BBSA 4YC7A 4EPVA 3OW2B 1NL3A 4RKFA 3QFSA 2ZJ8A 4Q1DA 1WBDA 2YNMA 3KKOA 3M4YA 2YC2C 5BYKA 1UKEA 1Z5ZA 4AIIA 2GTPA 1J8YF 3K0EA 3UMFA 5TY0A 2J7PA 3M1IA 1W35A 5KOYA 1ZM3A 2RC5A 1II8A 1PUJA 1WP9A 3FMOB 1SQRA 4Y7CA 1GSIA 2DWOA 1SXJE 4L9SA 3KX2A 2KE5A 2MSDB 5AJWA 4KXFB 4DIEA 3O8CA 5EUMA 2C9OA 3U3KA 3U3JA 2CHQA 2OSBA 1W4BA 3PR1A 1EWRA 3TVDA 4OI0A 3ZD6A 4M0LA 1KI4A 1SZPA 3MJRA 2G0TA 1U8ZA 4JLOA 4KFUA 2KBEA 1KZ7B 3ADDA 1KD1D 4YMWA 2R6FA 4XVQA 4FXPA 4M1WA 4TT3A 4P32A 3GLFA 2IYXA 5E7MA 4QL3A 4JBXA 1B23P 1GILA 5CYPA 2DEUA 3L43A 4NKRA 4Q01A 1Q57A 1QHSA 1VQ8B 5J40A 4W5WA 2F7SA 1CJUC 2CNDA 4P4UA 2N1BA 5AJZA 4A2PA 5J4KA 2IBMA 3LO8A 4FMCF 2JGNA 1W7AA 4UJ5A 1BJKA 3A1VA 3GLGE 3DZ8A 3SOPA 3T5DA 1OXTA 3BFVA 4PHTA 3GLIE 1NJGA 3AKCA 3CNOA 3FFAA 1AS2A 3LY5A 5BXQC 1T9HA 2QRZA 4LX0A 5AUNB 1XPUA 4TL8A 2CCKA 4P3YA 4DLWA 2VSOA 4B47A 2DPXA 1E9BA 5KSWB 4JBYA 3A36A 4QHTA 3U7EB 1QVGB 3OHMA 4QGHA 3UK6A 3T06B 2BKUA 4HB3A 2FSHA 4KFTA 1LY1A 1IAQA 1NN3A 1SXJA 4B3BA 1Z6YA 4GFDA 4GT1A 5TV2A 4Q1FA 1QZXA 2FSGA 2HXSA 5HR5A 2FA9A 2UVQA 2BOVA 4B2IA 4B34A 4P4SA 1ZCBA 2ZI4A 2D4HA 3H2YA 4G1VA 1J8MF 2XZLA 1VCNA 3GJXC 1V5WA 2PH1A 3CLVA 1W2GA 1ZMXA 4PAQA 4C0QC 1E2MA 2WKRA 4A4DA 1TLLA 2VNJA 1KAGA 1JAHA 3VMFA 1M7BA 1M34E 5FBQB 1EFRA 3W2GA 2QQEA 2WWIA 4C9BA 1I7PA 2QM8A 3D6TB 3NG1A 1E0JA 2CLSA 2KWIA 3QKRB 4NL4H 3NWJA 1JJ2B 4Q7MB 2OUKA 3GJ7A 2JJ2D 4OKSA 4AKGA 3B60A 2WIBA 2O0HA 1VQPB 2RMKA 2QP3A 2GETA 3LNCA 3Q72A 3NHBA 4K8OA 2VP9A 2OBNA 1Z08A 2VHUA 5L3QA 2QPOA 2ZSFA 1JB1A 4MUAA 1ZNXA 4OHZA 1NG9A 1GL9B 2BKEA 1QHIA 3D3QA 2BMWA 2H8KA 4QKQA 2X19A 2C77A 1ZD1A 4LPSA 4C7OB 2R6HA 1XMVA 2GZDA 2MMCA 3VHXA 3LX8A 2HUPA 2OG2A 4GP6A 2CCJA 3B85A 1XD8A 2CHGA 1KQSB 3GEEA 5A0FA 4EH1A 5FOSA 1W0JD 2WAYA 1R5BA 3FKQA 4EDHA 1VIYA 4PR0A 1ZM4A 4C0HA 2WKQA 4PPGA 1U99A 5KSZA 3QFCA 4DSTA 1KHTA 2ZI3A 1W4RA 4A9AA 1Z0DA 3BBPA 2OESA 4X8MA 4TL9A 3DOEA 5FTJA 3H84A 1CLUA 1DEKA 4MA4A 4LBYA 4GDFA 3PEWA 1CJTC 3UIEA 1QGZA 1ONBA 1NBMD 4HLUA 3TSWA 4E03A 4NYMQ 1YRAA 2FZLA 2OM2A 1VQKB 4Q4AA 2YWGA 1E98A 4OL0A 4BUJA 3B1WA 2B8TA 2JDID 3O8DA 4QBGB 5EP3A 4NZYA 3KKNA 2C8VA 2FF7A 4YMVA 4FI3C 4OYHA 4Y9RA 5KSPA 2X77A 3CC2B 1T5IA 3IHLA 4JLMA 1YZGA 2NQ2C 3ES9A 1R2QA 2VIIA 4ZIRA 5BN4A 5LD2B 5B64A 1OKKD 2EW1A 2QAGA 3PITA 3AVVA 2F1IA 3I56B 3GJ0A 4I4LA 1QG4A 4MYHA 4PAMA 2H1LA 3IO5A 2OK7A 3X1ZA 2B92A 4FCWA 4KSCA 1IBRA 2EFEB 1EFUA 4WIAA 3AVQA 1MR3F 5FL7D 4HDCA 2P65A 2CLCX 3AVPA 1Q1QA 4M1SA 4LYJA 3I5YA 2VYQA 2ZSDA 3IQWA 3G0HA 2YWFA 4TYWA 2IS4A 3A1TA 4II7A 4Q9LA 1SM4A 4KO8A 1TMKA 3M6AA 4MUBA 2P2LA 1KKMA 1AGRA 2G3YA 5M04A 2C9YA 1CS4C 2AR7A 1IY1A 4MGZR 5IK2A 1ZNYA 1O3YA 3L0OA 1SVIA 3CUEF 1NVVR 4OQNA 2FSIA 4NBSA 2FFHA 3OEEA 3ECCA 1P4SA 2WJIA 3HR8A 4L16A 4CDGA 1N8RD 4B33A 3FHOA 5SZIA 3MWYW 3AUXA 3EZ2A 1W34A 4US2R 3U7GA 1OV4A 1OH6A 2FMXA 2XNSA 3BK7A 1IY2A 1F2UB 2RGNA 1P9WA 3EXAA 2VEDA 3NBYC 5DO9A 1OFHA 4JJKA 5EE3A 4Q00A 2B7BA 4NCHA 1E2HA 2BEJA 3PUZA 3TK1A 3B2EA 3QENA 2WMNB 1YR6A 2GK6A 3TE6A 2WWGA 1U2RA 1H8HA 4CRWB 2VNKA 2VP2A 3I73A 1X1RA 3EASA 4A0FA 1UEIA 3P27A 4PSKA 3B9PA 1NKSA 3CPWB 2GWHA 3W6OA 2GXAA 1BMFA 4HDOB 1OB5A 2IX3A 5EXXA 1E64A 1UBGA 3RS3A 4D4MA 3CW2A 1LV7A 4UXIA 2HT1A 4S35A 4OI1A 4DUGA 5JBQA 3PG5A 1N5JA 3IILA 4LYAA 4JL5A 3BXZA 1QHYA 2XITA 2NOAA 2HJGA 2RKOA 4Q1CA 2ODWA 1UFQA 1G3IA 3K0CA 4KHZA 2VP0A 4PFSA 2ZI6A 2IK8A 3MRSA 4JLAA 4MRSA 5EXTA 1P73A 1OH7A 4JLPA 4PQYA 4C0AC 3W5VA 2F1RA 2J9RA 2Q9BA 4OHVA 3TRFA 3TAUA 4MYTA 2GQFA 2ZUCA 1Z6XA 1KSJA 3W2FA 5GJCA 1F3OA 3DO6A 2FN4A 3SYKA 4LSGA 4LBZA 4QGGA 4EPRA 1E4VA 1QHHA 3FWYA 3L0SA 4URWR 2VHCA 1CNEA 3GJ8A 3CCRB 2E87A 3VQTA 1W1WA 1LS1A 3QNUA 3LXRA 4C30A 1Q44A 1Z6AA 3NBXX 4P33A 4Y0VA 2ANCA 3SU8A 2O0KA 1OFUX 2GEVA 3AP1A 2HLDA 421PA 3VO1A 1J2JA 1HE1C 1OHHD 4M1OA 4DCSA 4CIDA 1DO0A 3FMFA 3BB4A 1OGIA 3U6BA 3BGWA 3MHPA 1XXHB 2A2ZA 1YZNA 2J3EA 1NDHA 3QKRA 1E6CA 1GRRA 1XEWY 4FMBB 2RGXA 4NCKA 4X8OA 1FNBA 2D06A 3C5HA 4NDZA 1ETUA 1RZ3A 2GJ9A 4Z1MD 1QG2A 1I4DD 2EYQA 4IVQA 4LZZA 5FI1B 2PBRA 1HT1E 5JJLA 3AF4A 2XZPA 4UNPA 2QNRA 3GJ4A 2QGZA 1G21E 2REXB 2ZS8A 3CCJB 3AVTA 5JWRA 1COWA 1UF9A 1UMKA 4BLSA 1TEVA 4KVAA 2Q6TA 3TBKA 2OZEA 2ZI7A 4Q03A 4LWZA 4TQAA 1U0JA 1YIJB 1XTIA 2QN6A 2O8BB 2WAXA 1S4QA 1HT2E 3B7GA 1T5LA 1HV8A 4C7OA 3ZD7A 4PSVA 1FNMA 2XTNA 1G3MA 1GNPA 3SS8A 3HU1A 3TUIC 2ZRFA 821PA 1JA1A 5DSZA 5FA6A 3B1VA 4KLNA 5JZVA 4LC1A 4W7SA 2QU8A 3KTAB 3B82A 4U5XA 4XH9B 4N3GA 2PEYA 5TB5A 1MOZA 4IDPA 3WBJA 4JJZA 3EC1A 2ZPTX 1Z8FA 1KI1A 2I1VB 2QUZA 4URUR 3WP0A 2IYSA 2GPJA 2HCJB 4RD1A 2FPMA 2V4ZA 1RVDA 2ZVQX 1Q22A 3F5FA 2BWJA 4ACAA 1E2FA 3EWSA 1VG0B 4KBFA 4DEXA 2WJYA 4O0MA 1CU1A 2G83A 3TNFA 2P6NA 4IHQA 2ONJA 2IW3A 1P60A 3BWDD 4CEIA 1E79A 5E95A 1IB0A 5DN6A 3UG7A 2C78A 1F48A 5G40A 1KDRA 2IT1A 5EZ6B 2D74A 4Z54A 1KY2A 2XOKA 2YWEA 2OTJB 2BMJA 2JLSA 1MRNA 4MGIR 3QY0A 1FRQA 1DARA 1M90D 1QHNA 5KSOA 4BECA 1F60A 3MD0A 4NYJQ 4MYUA 3NEJA 1KYIA 3B1ZA 4Q5IA 2ZR9A 1TUIA 2XNJA 4LC0A 1E99A 2NO6A 1Y63A 5BWMA 4IDOA 1VQNB 3EZ9A 4F4CA 2A78A 3W2EA 3BH6A 4ILEA 4QRHA 2QY9A 4IOJA 4R2HA 4UNRA 1OT3A 4G1UC 1TTTA 2ZRIA 1H8ED 3R7WB 2H17A 1KO8A 2W6IA 3C4JA 1AS0A 1T3HA 2ZREA 2ZRLA 2OHFA 3CKLA 4BFSA 5G41A 1R0YA 2WWXA 4LCBA 1P2UA 1GITA 2ANBA 2EQBA 4RD6A 3BS4A 4XSGA 1JR3D 4OHXA 4WW0A 3NH9A 3FYHA 2AFHE 2AK2A 5CLLA 3RSOA 4C43A 3WXMA 1TQ6A 4NCJA 4PO1A 5L3RA 3CF6R 5C46F 4LJYA 3GJ5A 4IW3B 1VKJA 2WSSA 1CJVC 4Q7JB 2VA8A 2ZRPA 3ICQB 2CK3D 2CVHA 1KI9A 3ZS9A 2VF7A 4IKEA 1OF1A 1F6BA 1S72B 1JJVA 1L4UA 3QXXA 4TTPA 1MKYA 4CYMA 4C2TA 2YOFA 2ZSBA 1T8UA 4KSBA 1IQPA 4WA7A 2NTYC 2F1JA 2VSXA 1GR1A 1F2UA 4M2LA 2QDXA 1QUFA 1R6BX 1G5TA 3AKYA 5GJWC 4ASUD 2N42A 2F3RA 1N0WA 3R9IA 3CMEB 1NVVQ 1U8YA 2OLJA 1KAOA 1UKZA 2C99A 1XP8A 1JA0A 2RHDA 3ZC3A 3I61A 2W83A 2FGKA 3FPKA 2O52A 5HKKA 3SFVA 3DKPA 1QH0A 4JMPA 4RFVA 1I2MA 2BBOA 3P32A 4TLBA 1OXSC 5JMTA 1VDZA 2VBCA 4IFEA 1G8PA 1OYYA 5LB4A 2R6CA 4GPTA 1E9CA 4IEIA 5AJYA 3BH7A 4D4JA 3JZMA 4PC2A 3P4XA 4Q4JA 4X8HA 1XD2B 3KJHA 3HJNA 3B1YA 4MKFA 4DWJA 1S3GA 3HU2A 4DHEA 1X8JA 4JLDA 1JEEA 1Q1EA 5F9HA 3CIOA 4DEYA 2VLIA 2A5DA 1ANKA 5JI2E 1A7JA 1TADA 4H9GA 5DISB 4DSOA 2DFKB 1NF3A 2VF8A 4OBEA 1ZRHA 3GMTA 221PA 2QGNA 1W49A 3PXGA 1JJ7A 2QENA 4Q4LA 2XSZA 3G71B 2MSCB 4LJ9A 3AUYA 1ESNA 2HCBA 5FPHA 4PC7A 4YMUA 4RZ2A 2QBYB 2W6JA 2WZQA 3EPKA 2X3UA 3W3ZB 1TU4A 2V1UA 1M2OB 4B3FX 4MKGA 1HQCA 1WCV1 1KI3A 1X3SA 3T5GA 2FE4A 3IQXA 3GJ3A 4UQOA 3SN6A 2EWWA 2P6UA 1QX4A 2ZYTX 2ZUBA 4D4KA 4BFWA 3U44B 4Q02A 1R8SA 1DVRA 3CH5A 3VX3A 1UAAA 3NDBB 2FSFA 2Y8EA 5JEDA 3DMNA 5GJVC 2ZRCA 1VG9B 4V0LA 4BRUA 1WQ1R 1TF2A 2IXGA 3A1SA 3TUZC 3BORA 4K1XA 3VO2A 1US8B 2XJ4A 4N0EA 3HWSA 1BYUA 4B2PA 2QTVB 1IN4A 2PL3A 1GNQA 2RB4A 3PQCA 1PLLA 5THXA 3P4YA 4YMSA 8OHMA 1WRBA 1K8AD 2W00A 2O8BA 2BMEA 1G1MA 5SZKB 3OAAA 3CR7A 4OQXA 5DHAA 3U4QB 2DWQA 3X1XA 1CF4A 4BFVA 1N5LA 2J7KA 5CK4A 4L4UA 1G18A 3K9HA 4A15A 2GBLC 4ARZB 1IXRC 1AQUA 1S8FA 1KO1A 1MT0A 3BRWD 2BN4A 1FOEB 1KI6A 4AURA 3GQBA 4PQFA 2J0SA 3MCAA 1YZUA 2C2HA 2VP6A 3RDPA 5EQTA 1XCMA 1HEIA 4DLYA 1VQMB 2VH5R 1OB2A 4PO9A 4RZXA 1IN6A 1FPMA 4YONB 4BFUA 4YXWA 2JLVA 4V0OA 2RC6A 4BE7B 1D1NA 1F5NA 3K53A 4ZKEA 2X2FA 1T0HB 4TLAA 2F9LA 2R9VA 5F2EA 3FKSD 1CIPA 3I72A 1BH2A 2BSAA 1RFLA 4DLRA 1S9HA 4RD2A 3RYTC 3BD9A 2A5FA 2XXAB 4B48A 4GNKA 1SKYE 4C0BA 1EG7A 1VPLA 1LW7A 4U02A 1BYIA 3C41J 4B73A 3JVUA 1DG3A 3I8XA 4N3NA 1CRPA 3ZVMA 4A36A 3OJXA 3WMEA 3LVBA 1QFZA 4M1MA 3IUYA 4L8GA 1XCGB 4TQ9A 2ZI9A 2AFIE 2ZJOA 2PMDA 1NMZA 1XMJA 3OF5A 3SZRA 4EJSB 3UWKA 3DM5A 3LV8A 3I4LA 3AM1A 4JS0A 4LRWA 1ZW6A 2OLKA 5JFGA 5EP2A 1KY3A 3KB1A 4P4TA 2DFNA 4JL6A 1FW6A 3RS4A 4OK3A 5FFMA 1IN7A 3MWJA 4B32A 1CNFA 1NVWQ 4PZZA 3MLEA 3ZQJA 4GL2A 5GV8A 1RPZA 3TMKA 1QVAA 1NLFA 1P6XA 1ESMA 2A3RA 3WYAA 3FMPB 1WA5A 2JJ1D 2B8WA 3J81k 2ZJ2A 3AGPA 5J4YA 3MUFA 1GOTA 4M53A 1D6JA 4IXNA 1G19A 4LHWA 5EXPA 3VR3A 2XNDD 3PUYA 1NJID 3CONA 4BZPA 4TL7A 2AN9A 4F38A 2RGGA 2PLFA 1XTQA 3TQFA 5KO2A 3C7KA 3VX4A 4PC1A 5AJVB 1VTKA 2NGRA 1OJLA 2G0NA 4YMTA 3QSYA 1RKBA 1T6NA 2X2EA 3NTUA 1EFTA 1XJQA 2G77B 2CVFA 5J47A 2CE7A 4Q21A 2L0XA 1ZM2A 2F43A 4M9XA 1N0UA 2DB3A 3B9QA 1ZVQA 4PPFA 5B57C 3GP8A 1YE8A 2OAQ1 4D4LA 1M1YE 3NBZC 4FD2A 4OK5A 1G3UA 3QEOA 2A9KA 2XB2A 1NY5A 2ZYUX 1XZPA 2NIPA 1QVRA 4XWAA 1RJ9A 1ZIOA 1G5PA 4QJ5A 1W87A 3N70A 3IBGA 4DDWA 5DI3B 1DAFA 2O8EB 4QBHA 2HF9A 4ZDKA 4C4PA 3DHWC 2ZJBA 4FIDA 3A58B 4CVNA 4GMDA 5AUOB 2WJJA 4WAUA 4R7ZA 3BC1A 4TLEA 4Y0AA 3V9PA 4XVRA 5CDFE 1G5RA 1U98A 4TMVA 1LF5A 1G8YA 2RAPA 3CPHA 4MRRA 4TT3D 2ZSEA 1TUEA 2JJ8A 4QC2A 2IYVA 4WOPA 2WJGA 5A5GA 1G8FA 3RNLA 4DLZA 4DVGA 5CITA 4G5RA 4EPYA 3V76A 5LBIA 3AP3A 1XD2A 3W5JA 3NH6A 3SJCA 1LNZA 1CKEA 2CMKA 3RAPR 4DIDA 1U0LA 4WQMA 1XTSA 4TQUS 1JEDA 1PUIA 4LV5B 5TDHA 4DBLC 1A4RA 2ZRGA 3AVUA 4NCIA 3TH5A 3JQPA 5KYKA 4B35A 3MJHA 5J5CA 3UANA 1KGDA 2A30A 1XPOA 4A8JA 1R0XA 2NPIA 4IDNA 4FWTA 4EFLA 4MRPA 1FQKA 2KSQA 3THYB 3I32A 2DBYA 2GZAA 2HXYA 2H16A 1IM2A 3ADBA 3CRW1 3ICEA 1Q1BA 1KIMA 2O8FB 3PEUA 4AG5A 4OHWA 1JNYA 3HU3A 4HE6A 4RCZA 1KJWA 3MGCA 3QPVA 1G64A 3SDZA 3ZZUA 1AKEA 1C4OA 3I1FA 1E2EA 2WIAA 2WM9B 3HPRA 4I99A 3CZPA 1SVLA 1E9RA 2I4IA 2ZANA 5LDDC 3U60B 2MMGA 3BFKA 4DB4A 3GCGA 5CDFA 5JCZA 1LVGA 4YAWA 5FPKA 4JL8A 1WMSA 3U44A 1NRJB 4D0GA 3UMSA 5BYJA 1GZSA 2Z43A 2VPPA 3IKJA 3CWZA 2AKAB 3MWKA 5CM9C 4NH0A 2HJVA 1FUUA 1RW4A 3ZLJA 4URXR 3PJRA 3THXB 4IOMA 4NYIR 3SBDA 4Q9HA 1YR7A 2JJ2A 2C5LA 4TLDA 3AB3A 4TYYA 4EPWA 5P21A 4HATA 4OQLA 5FTLA 1GVNB 1U90A 1RRCA 1KDPA 1TQ2A 2DFLA 2ZE7A 1UDXA 2D7DA 1GAJA 1T0JB 3KJEA 3WHKA 4UXJA 1OH5A 3K0FB 3AEZA 2VYFA 3QXHA 3RABA 3U4QA 1AK2A 2IYZA 4W9MC 3LQQA 2GJSA 4LK2A 5CYOA 4AWXA 1P2VA 1JPNA 3OJWA 4ARZA 5H68A 1XEXB 5FPTA 4FMCB 3SC3A 1CXZA 1Q1ZA 2QTFA 5FL3A 4HI0E 2BEKA 1MV5A 2H57A 1FP6A 5FPYA 3BJIC 1FTNA 5D3MB 3AVYA 3VHLB 2GJ8A 3GFPA 1W0JA 1RYFA 3E2IA 5DYIA 2W2TA 3TGPA 3EX7C 1W44A 4B4DA 4ERNA 1YQTA 1VQ7B 1O87A 5KNBA 3I55B 1XFAA 4KYUA 5EE1A 2DCUA 1DAIA 4ESHA 3OEHD 5C4MA 3JZAA 2YOHA 4GZLA 2BGJA 2QPTA 1KDTA 2YINC 3FDIA 2BM1A 3HPQA 1QBKC 1L2TA 4G5QA 2KB0A 4RKEA 4QHSA 4B44A 4K46A 2OFWA 1T8TA 4NE2A 4JLBA 2XZOA 4HAZA 5KDDA 1E9SA 5DE3A 3SJAA 5LPNA 3W5HA 4WZBE 2XXAA 4JLVA 4RJLA 1YJWB 1VCOA 1XE1A 1HUQA 1Q3TA 1AQYA 1ZUIA 4MDFA 1RE0A 3NEYA 3P20A 1K5GA 4JZKA 1H42A 2JDIA 1J70A 1AM4D 1RC8A 1CR2A 2GA8A 5FH9A 3UWOA 1F2TB 2UZ3A 1PJRA 2UZIR 3VU9B 4EJSA 3CM0A 2WOOA 4KBGA 1OKKA 1Z06A 1FX0B 2QL6A 3HYTA 1HTWA 5JHHB 1U9IC 3LVQE 1G4UR 2H92A 4UAJA 4F91B 1U8AA 1X8LA 4KCGA 3OFNA 1D2EA 1HQYE 3LAWA 3BAFA 1YHQB 2O5VA 3ZH9B 2D2EA 4YAFA 2PT5A 4MGKR 5GADl 4CZ2A 5FL7A 1CR0A 4AY2A 4PZLA 5SZJA 4JLKA 3K9LA 1M6NA 5DYGA 4ZI2A 3CCQB 3WNBA 3CPJB 1SVKA 1W4CA 2EYUA 1UKVY 3QG5A 5KDLA 4Y9UA 2NO0A 1R7RA 2ZE5A 3AKEA 4I1OA 2AHOA 2XAUA 3HDTA 3OE7A 2ZEJA 1QFYA 2DR3A 3EIEA 5BN3A 2B5OA 5FTKA 5D3QA 3CRMA 5JECA 3CX7A 2VNIA 5AK0A 3R8FA 2IHBA 2ZRBA 4PSAA 4AF7A 1IXSB 4JLJA 4DCVA 4ZDIA 3BFXA 5G3ZA 2QMHA 5F9FA 2FNAA 1W2BB 4HSEA 1W36D 2FH5B 4UJ3A 2HDNB 3WMFA 2ORVA 4IVRA 2ODNA 4RVCA 4TTQA 4A0GA 4D82A 1UBCA 3EARA 1OGJA 1S2MA 5DI3A 3LLUA 1ZUHA 1KTVA 3NDPA 2IHYA 1QRAA 1XDBA 2NZJA 4KODA 5SZHB 3X1YA 3AF0A 1R0WA 2FX3A 3CX8A 3A6PC 3W2IA 1E0SA 3KKPA 1HH4A 4QNMA 4D26A 3CC7B 1VQ6B 1G6HA 4NCNA 1K9MD 4NHOA 3K09A 4TYNA 4Q1AA 1YZLA 5HTKA 2W2VA 2ZJZA 4UNSA 1XMIA 1G4AE 2GJKA 2GEUA 3KB2A 1MO5A 2QA5A 4DUGD 2EU8A 1VYTA 1JXOA 3CWQA 5FOUA 2BF4A 5FOTA 3DEFA 1G7SA 3RRYA 5JJKA 4B3DA 3K0AB 3FMIA 2PIAA 5H59A 1XTRA 3WNCA 1OE0A 2ZITA 1U81A 1L8QA 2PEZA 2W0MA 1SHZA 4IOLA 4ZGNB 2C98A 3CF0A 5DIFA 1KK2A 1DDGA 3UATA 3PVSA 3THYA 5FTNA 1IXZA 2Z5FA 4EUNA 1UBEA 5JI3E 1DE0A 2JASA 4MH0R 3CD6B 2E1RA 3W3AA 4LBVA 3RS2A 4DLSA 3P1JA 1ZINA 2B21A 1I4LD 2Q0HA 3CO5A 3RSLA 5JRZA 3K70D 4RD3A 1TL7C 2ZJ5A 1DAMA 4WZAE 1WE2A 4DDUA 3EIHA 1MABB 3IEVA 1N5KA 3VR4A 1SXJC 5TARA 2IYYA 1W46A 1SHKA 4FCTA 4RY2A 1JECA 1RRGA 2ERXA 1KDOA 1OHHA 2CEAA 1NNEA 1K6MA 3PENA 4G5GA 2YOGA 5EZ5A 1DPFA 1Q7YD 2QT0A 2CRVA 3CCLB 1T3LA 1E9AA 2QSZA 3BE4A 3BIFA 3THXA 2OK8A 4D25A 2FFQA 3LBIA 3SFZA 1G8GA 3O8RA 4Z1MA 4D0LB 4H1VA 4EFMA 4Q9IA 1YR8A 1LS6A 2GK7A 1NIJA 5K8LA 3U3OA 1ZAKA 5HXBA 2PCJA 4XOIA 2XX3A 4LOAA 1XTJA 1FNNA 4OI4A 3QBTA 1E9FA 3RVBA 3GLHB 4D0NA 1BIFA 2ORWA 2GBLA 4LYHA 1E2PA 1ZU4A 1OH8A 1DAKA 2X1VA 4QBFA 4RD4A 1HYQA 3U6KA 2FZ4A 5BN5A 3QKTA 5DGXA 3R8CA 2IYTA 3L82B 1G8HA 5FOWA 2SHKA 1U0HC 4EKDA 1D2MA 3CZQA 5D3MA 4BEJA 4XWKA 4KFSA 4D81A 3LXXA 4PHHA 5HE9A 1ZIPA 1KSHA 3QF4B 2DHRA 3D7MA 3RS0A 3Q3JB 5H1YA 3ZVRA 3EPHA 2ZETA 3KKMA 4PX9A 5J4VA 2C96A 3QBVA 3LWNA 1OIVA 1OYWA 1OW3B 1VYVA 2WHXA 4B3CA 3U7HB 3OZUA 1G17A 1YZTA 1VIAA 1WDTA 2RCNA 3KJGA 1FRNA 3I3SR 3LFUA 2DWPA 1AA9A 5DN6D 3T1TA 3E1YE 2ZRJA 3FVQA 4M21A 1JBKA 2XOKD 5F98A 2HF8A 5FUXA 2WPDD 5FBLB 1BX0A 3AKDA 2YYZA 4HUQB 2C04A 3IPXA 1L7VC 3W5IA 3KQUA 4YAUA 4O2LA 1GRNA 1J99A 4YDHB 5GV7A 1KSFX 3VU9A 1Q82D 3QKSB 1FX0A 1NVUQ 3SI7A 4DLVA 4XD7D 1K73D 2G88A 1JQJC 4TL6A 1YU9A 4PC6A 2XTZA 2O8DB 3I62A 4Z8XA 3VR1A 5KUTA 1M1KD 4MKIA 4YDSA 1IJFA 2Z0MA 4AKEA 3ZDQA 2BHRA 2C9CA 4NPHA 1DTSA 4JSYA 5TMPA 2Q9CA 2QAGC 2CNWD 2BIFA 3CBQA 1S9DA 2ZS9A 2W6ID 4ESVA 5FI0B 3Q7QA 4FMDF 4GMXA 2YJTD 1XB2A 1TVCA 2R6AA 3HP1A 3LH5A 3ONWA 1RRFA 4QHYA 3V4RA 3PEVA 4DLTA 2QG6A 5KNDA 2BMFA 2BV3A 1JR3A 1GG2A 4WZ6A 3KQKA 4B75A 3RC3A 1NN0A 1R0ZA 1D9ZA 2QI9C 2CL7X 4M1KA 3QIAA 5EE5B 3RRMA 2IXFA 4M1TA 1J9ZA 1U94A 4B6FA 4LHZA 1KI8A 3ZVNA 2I3BA 3A37A 1VQ4B 3WYGA 4KVGA 3W8NA 1ZP6A 2QP9X 2IS1A 1NN1A 3WNDA 2CK3A 4ZKDA 1E2IA 5AUPB 3DL0A 1IJEA 5DI9A 5JWOA 3H86A 5KPJA 3OIUA 1ZD8A 4RCYA 1E0KA 5IRCD 1H65A 1KI7A 4V0ME 2F1HA 3NHAA 1YRBA 2GCNA 2IL1A 2FPLA 2VRWA 2OFOA 5J4LA 3EZ6A 1TF5A 2G9NA 1QUEA 2F3TA 4ASUA 1CP2A 3VR6A 4I1VA 1OFIA 1TF7A 4D2IA 1YZKA 2BGIA 2WJHA 3W5UA 1KC8D 1BX1A 4JVSB 4P31A 1W36C 1XXHE 2JIZD 1ODFA 3CMAB 2RHMA 4LHVA 4KAXA 4B2LA 5CJ2A 3K9GA 1G7CA 5G3YA 2BBTA 2ODEA 2LKDA 4CT4B 4GSYA 2BJWA 3BB3A 3ZIAD 1N0VC 3VR5A 1Z63A 4ZI3A 2IWHA 4G3XA 3W6NA 5DNYB 3O47A 2ZJAA 3PUVA 4DCUA 2OCBA 2DETA 2OXCA 3ZZ0A 3FPAA 3GFOA 5HCIA 3SJBA 5ANRB 2AL7A 4ITRC 3OZVA 2Q3FA 2Q9AA 2LP6A 1I2DA 2GCOB 3EWAA 2PLRA 3NKVA 3CNLA 3QG1A 2IXEA 4JSTA 3NXSA 3TIFA 3AV0B 1FMJA 4I1SA 1XU4A 4KITB 2W0SA 2I1QA 3ND8A 2AXNA 2PZFA 2QT1A 5JS7A 5JJIA 3EZ7A 4OJQA 3AVXA 1FFHA 1QHGA 2ZRAA 4CW7A 1SULA 2NO9A 4V0MA 5JLJA 3SQXA 4YAOA 2IF0A 4V03A 3WY9A 1YVDA 1ZC4A 2BMDA 2IYWA 4TSFD 4A82A 3KDSE 2J0UB 3QOFA 1TX4B 2V9PA 2GVDC 4M9QA 4FMDB 1GKYA 1FUKA 2WKPA 3AQ4A 1EX6A 2DYKA 2W6JD 4JKIA 4BFXA 3CR8A 3PEYA 1XXHA 5CLQA 1N6HA 3RANA 1CBUA 2GAAA 1NG1A 4B3XA 4QOSA 4P4SB 3EIQA 5AN9A 5E3HA 1GJRA 4LI0A 2GCPA 1HY3A 4XSHA 3K70C 4Q9JA 2QSYA 2V7QD 4O3MA 1R8QA 3RRZA 1GRQA 3W2HA 4GRAA 2QRNA 3T35A 2WWFA 3AVWA 2JCSA 3GJ6A 4HAYA 4LJ8A 4WVFA 4BLPA 1SVMA 1IN8A 1TNDA 2QMEA 5FUYA 4PTLA 4HZIA 1UEJA 4OQMA 3EAQA 1NP6A 3K1JA 4OJKA 4TMTA 3A1WA 4ZDWA 1C9KA 2O8CB 2B6HA 2ZSAA 2RGEA 3C15C 3P26A 3IIMA 3O8BA 4URZR 5AJXA 3CNNA 3TW8B 2H5EA 5JEEA 4NTZA 4V0KA 2IEZA 1E1RA 1XTKA 3D31A 4H1UA 4PQRA 4DJTA 3PIRA 2R2AA 2ZU0C 3GLGB 4DT1B 4LHXA 1CR4A 3GD7A 3JVVA 4LPKA 3GLHA 5IF9A 1KNXA 3GLIB 5JSZB 4TMZA 2FPKA 3G5UA 1JI0A 1W2HA 4IFBA 1YITB 1JPJA 4Q4HB 4BZQA 5B30A 5L3QB 3KTAA 4GBMA 5C1BA 3DKVA 2GHIA 1Z0IA 1N6NA 3Q7PA 1GWNA 1EP1B 4N0DA 3AH8A 1E2GA 2DFTA 1PV4A 2NG1A 4TZ0A 2ZAOA 3B78A 2JLXA 1IHUA 1YJNB 4FN5A 4HLCA 2QMOA 1ZBDA 1E63A 1TEXA 1LB1B 3EC2A 3VNUA 3AVOA 521PA 4IOKA 2ONKA 5UKDA 4B76A 1QGYA 4HEJA 1DADA 2FFBA 3C8UA 1P3JA 3QF4A 4PHGA 3VKWA 1JALA 4NYMR 5FOVA 1EP3B 2PX0A 5HPYB 2LWIA 3PUXA 4C3ZA 4YXWD 3PFIA 3K9NA 1GL6A 1G3RA 1M8PA 2A5YB 2IF2A 3KKQA 3VTKA 4BWYA 2VNHA 1E1QD 3FKSA 4MKHA 6Q21A 2HMAA 4HAVA 1MH1A 3ZBUA 1W0KD 1FP7A 2VTKA 3KFVA 2ZXUA 3H4MA 1N6IA 2IYLD 1AS3A 4PPNA 1G20E 4HUQA 3CC4B 4DCNA 4R2IA 1X1SA 2QORA 1AKYA 4POAA 1PLJA 3SR0A 1DBSA 2WWWA 1GFIA 1GKUB 1U9IA 2GESA 2W2XA 1SVOA 2AK3A 2V3CC 3QKSA 1Z0FA 3U5ZB 2EIXA 3R7WA 2BCJQ 3C14C 1XD9A 1KO7A 2ZQ5A 3RC8A 5JHGB 3MG9A 4PZYA 2OEPA 2JLRA 2QAGB 4U00A 4EQ6B 1QG0A 1DAEA 4GOJA 1ZNWA 3FGNA 4M8NE 5FOXA 2F55A 4HAUA 1P2TA 1W47A 2N46A 3K8YA 3L2OB 4M4SA 5JRJA 3U61B 2OT3B 3GEHA 4M1YA 3W90A 4AYXA 3IIJA 3I5XA 2R6GA 3RRNA 1XBTA 4ABYA 2VHQA 5L8VA 2QE7D 3KJIA 2JJ1A 3AP2A 3KL4A 3CRVA 3W9YA 1XNJA 3RWMB 1GAWA 3CX6A 4JLNA 4MDEA 1X8KA
chains in the Genus database with same CATH superfamily
2FSSA 2P9JA 2IUUA 1WMBA 1HI9A 2W6ZA 4Y71A 3EPPA 3LVRE 1YOVA 5E7IA 2XE8A 2XHZA 2YNBA 3ZZ7A 4JCCA 3Q8MA 2IBSA 3NXKA 2K5UA 1RI5A 4A0HA 3AI3A 2WPIS 3P9PA 3QXCA 1UADA 2Z2XA 1XAGA 2O7SA 4DRZA 3LLSA 2JGIA 2JAPA 2QEQA 4RJKA 1I2ZA 4RBNA 4K6MA 3EXIA 5LM3A 2BD7A 1FZTA 3C87A 1HAPH 4CQJA 1XCPA 5BUZA 2LZJA 4YLYA 1UMAH 3EEOA 1I10A 4MV0A 1DIGA 1GDQA 5E7QA 3I53A 2BD9A 3LPMA 3ZZTA 2B30A 5K99A 2YXPX 3GO4A 2F1LA 3PV4A 5B2FA 4FETA 4Q7KA 1NPDA 4NA9H 5LQCA 3DMPA 4H6WA 4UTPA 4PFKA 1Z34A 3ZX5A 3W6PA 1BEEA 4FDLA 4HP8A 1ENZA 1PFXC 3FW1A 3CRZA 2K0QA 1B0UA 3WKDA 1GADO 2PHZA 4Q18A 2DWCA 1RLTA 1HZZC 4DLPA 4YOJA 1PF7E 5DH9A 1L5WA 1I2CA 4EUKA 3QXSA 1TO2E 4OO3A 3EDMA 5BOSB 2QPAA 7YASA 2OILA 2NQ8A 1SHYA 1OWOA 1GI2A 1R9MA 1XELA 1V7PC 4INOA 3PNSA 1JT9A 2TRSB 3B3QA 2ZJ3A 1XUFA 3FYDA 3M6FA 4F93B 4IJMA 4EQ6A 1YQGA 3V3TA 4DR7B 3QFHA 4K28A 3GVKA 1AKWA 2FWJA 4YP5A 5LU8A 1C2YA 1YUNA 3VB3A 1N2CB 4YCMA 1Y5UT 1R5NA 2XCOA 3QUMP 4I4TF 2JAHA 4I5FA 1JKMA 1NXVA 2D3WA 1H2ZA 2KLBA 2ORIA 1A8PA 2ZE8A 5H3LA 2HNTF 4R71A 2COEA 4CLXA 1G2LA 3A4MA 3DOJA 4A6DA 1ZRSA 1RQLA 4OMUA 4X65B 4ZT5A 1W8BH 2ZRKA 1OP8A 5DP8A 2C7VA 5ECYA 5I9LA 1PUXA 5GPBA 1VBKA 2Y3IA 4NA8A 3BY1A 2LGJA 3HJRA 4N49A 3TUJC 5DHFA 2ZIZA 3OFJA 1O0BA 2GD0A 2K7FA 2PE3A 2H1OA 3VSAA 3JASA 4DB2A 3G01A 3GIRA 2XY4A 3BX1A 3W0LB 1VMAA 3DPUA 1BBRH 1XLTA 4Q3KA 4PWYA 1A2CH 1JQLB 3V46A 4LKOA 2GXSA 2R96A 5IAAA 1CR1A 2HLPA 1VRWA 2C9MA 1XVMA 1XN4A 1BXKA 4WGGA 5A4MS 1Q19A 1XT6A 2HY7A 4OM9A 2EP8A 4GLBA 2R1TA 5GQSA 4ZQEA 4Z51A 1MO3A 1QP4A 5I4CA 1U28C 2ZFUA 1W4LA 3MHTA 1TJNA 3K1YA 3UEOA 2BDTA 5JUWA 3HCNA 1YIAA 4ZHAA 1PHRA 4JCOA 3Q76A 2VP5A 1P1FA 3F78A 5DV9A 4X63A 4DY4A 2FJUA 5DTIA 3C6YA 1S2GA 1UD2A 1Q0ZA 4PZPA 5JTTA 3PUJA 3QE0A 5EP4A 1GHZA 2GCHG 2MT9A 3CCSB 1CQIA 1FY1A 1P9NA 2JI9A 1BQEA 3I23A 1UJBA 3OD5A 1Y5NA 2IOYA 3AX6A 3HB1A 3B6ZA 1VECA 1GN9A 2ZUTA 3QU2A 3P8NA 2XGJA 4E31A 1XZ8A 5EODA 3BGSA 3QX7A 2XF8A 1NM6A 2ZL5A 1QDLB 3IAUA 3KUCA 3GFTA 5ERYA 4C4XA 2XYHA 3NC1C 4KQXA 3RYIA 1NT2A 5AWFC 3LIWA 1SGIB 3E70C 3SR4A 3TNJA 3PZBA 3JQFC 1M0WA 1Z07A 3VKHA 5J35A 4RK5A 3NT5A 2CLDX 2W4MA 3BRQA 1BTXA 3H1PA 4KRGA 3F3YA 4GZ5A 4CMGA 3MFYA 1IQIA 4QE3A 3QZQA 2NSJA 4HN4B 2I29A 1P17A 1Z6TA 2H48A 1Y5IA 2I9PA 4XJXA 1NI5A 4MQBA 3LLCA 1N6XA 3ZZ1A 4BLQA 4I81A 4GOKA 1JJBA 3K16A 3F74A 1G6Q1 1DMSA 3GUCA 3LY8A 4CCWA 4K8BA 2R1ZA 4L15A 1M1YB 4YTEA 2ZUSA 3KVYA 2IIQA 4QEDA 4M9SA 1G5QA 1L4NA 2GZ8A 1BWSA 2C0QA 2M6SA 4KKUA 3WLMA 1KXAA 2HJWA 3EY4A 4JMYA 2P9YA 5MGBA 1T32A 4YMGA 3TJNA 3PLNA 2SCUB 4B5LA 1K1NA 4H7JA 1K1LA 2OBLA 2H2GA 3W8RA 3EHDA 2ZIAA 1L8OA 1WBBA 4KXMA 2B94A 1Z8DA 4DDTA 5LDGA 4OCZA 3L7MA 1XTZA 4N54A 4F4JA 1V7QA 3LC3A 3MU8A 3Q77A 4PZEA 3SEJA 2YUTA 2AG0A 4XLAA 2EI6A 1SBNE 4TLLB 1CE5A 1A8QA 1ICIA 2PK3A 3IHWA 3K35A 1CS0B 2DKFA 1LLCA 4N5IX 3FTFA 5F8ZA 4I50B 1FI8A 1GJ7B 1D5CA 5E6SA 2XTMA 3I2JA 4FKZA 1XNRB 4ZI5A 3N28A 4IIFA 2JCYA 3GY7A 1A5SB 3FCYA 1YZQA 1UDRA 4CLOB 3PDCA 4EYKA 4ON9A 3UF0A 3A35A 2CT8A 3X2SA 1ZGGA 3I9NA 4QQFA 2QE7A 3DLHA 3V33A 5EWLA 2HB6A 1C2GA 1WBDA 2BLQA 1EVZA 4ZHQA 5CB4A 2P77A 4R40A 1ZM3A 3FMOB 1PUJA 3IFSA 2CMYA 3USES 3WWZA 4Y7CA 1QO0D 2DWOA 3DCNA 4N9WA 2MSDB 4EVQA 1A0HB 2AH5A 4GI1A 4XVQA 2GR9A 4QL3A 5A89A 2O7RA 5CYPA 5J40A 2CNLA 1GEGA 4P4UA 2NTNA 5K4HA 3K2UA 3IAS6 3FR7A 4E2FA 3A31A 2VSOA 1ODSA 4GL4A 4NBVA 5B4TA 4P83A 2BHLA 4EUHA 1EAWA 2X15A 1GGEA 1NRRH 2FSGA 4DMGA 2FA9A 1GDNA 4KTTE 4RXTA 1ZCBA 3CTAA 2D4HA 3QYJA 3P0IA 4XNFA 5KQMA 4EG4A 3FO8D 4JQYA 1E2MA 4A4DA 1ZN2A 1NZJA 4MV8A 2RH8A 2PHBA 1YFJA 2YHBA 1PDWA 1F06A 4QARA 1GVZA 5C53B 5E8JA 2HC9A 5L3QA 1V2MT 2ZSFA 1NG9A 4JMLA 2PW8H 1ARZA 4LTDA 2JIDA 3GA7A 3INYA 2CCJA 1GPLA 3B85A 4K6FA 4BV2A 4ALNA 2NTJA 3PE6A 2C29D 1G36A 2JRCA 3DOEA 3OF3A 1E3SA 3DSGA 3C3EA 1SG8B 4E03A 4QZVA 2CXHA 3UHAA 1I7QB 1Z4JA 3RMLH 3TEJA 1XA4A 2YJNA 4JC8A 2O6HA 4MCJA 3ES9A 5DKFA 3GJ0A 1QG4A 4HXYA 4JT8A 1ZRKA 2HDWA 2H7XA 4M1SA 4K9SA 1OD6A 3I5YA 1LK0A 4CUZA 4IINA 2G3YA 2FTMA 1YCPM 4WJZA 3MTYA 1XL1A 1BXZA 4OS2A 4DV5B 4NBSA 4L16A 1QC5A 5U4XA 4WZBA 4Q3AA 4MV9A 3FP7E 3U7GA 2FMXA 1JEQB 2DHDA 4YQZA 2PQMA 4ZT2A 2WF5A 4PSKA 1PT9A 3BXOA 2BAGA 5D7BA 1C5WB 5JBQA 3RXGA 1DSUA 2BEWA 1U0GA 2XITA 3UJCA 4P84A 4MVJM 5CEFA 2JFQA 3WWYA 4OHVA 1HMPA 3E9CA 4GVPA 3RVDA 2ZQZA 2NSLA 5B1SA 2VHCA 2L74A 2UAGA 3M5CA 2UV8A 3LWZA 1R5JA 4CIWA 4DV6B 3FCUB 3AP1A 1OXKB 3KEWA 3UHJA 4RADA 2Z2JA 1O2SA 1L5OA 3I8OA 1MAVA 2D2VA 3U6BA 3SU5A 3BGWA 3CZ4A 1RTFB 4DNFA 3URMA 5FI1B 3E84A 5AVYA 2ZS8A 1H0HA 2D1QA 4I8LA 1FRZA 1U0JA 5DYWA 3AK5A 2D2XA 4F5EA 2HCFA 1TZBA 3DO8A 1WOSA 1M72A 2Q99A 1C9MA 4KBFA 5JANA 2BWJA 3GEPA 5EIXA 3O2QB 4MTBA 2H5JA 3AFGA 1DS2E 3LK7A 2VJMB 1GARA 3C5VA 1PJLA 2YFHA 5KYXB 3B1ZA 1TUIA 2J9YB 3UJBA 1N7IA 5G1PA 4HNUA 4VGCB 5IJ9A 2FOEA 4LRXA 3MIZA 2R3YA 1V2WT 1O2PA 2UUCB 4FXGH 1P05A 1ARBA 2KS6A 4KVFA 2A9PA 3W7BA 1YL5A 5C8ZA 2W6OA 2SGQE 3LT2A 1A97A 1VKJA 1HORA 1V2HE 2OLGA 1Y42X 5ETJA 2BUCA 5ALEA 2VLBA 1QUFA 2X8LA 1SGFA 2QSJA 2N42A 1KXCA 5EJ1A 4RTQA 4ZMAH 1E6LA 2OBTA 2C99A 3GMSA 3OTGA 1ZK3A 4FX2A 1T2AA 1G63A 3E9RA 5J2UF 4NCAA 1H3FA 1NI4B 2WAMA 1C2MA 2UXCB 3RS8A 3RBXA 1XDZA 4RGVA 3N0XA 1YLCA 1E3LA 4OHOA 1MD7A 5JBCS 1UQRA 2FPWA 4MS3B 1O0SA 1LX6A 3KCNA 4ICIA 4W1PA 1SB9A 2ZZGA 4ROXA 1LQUA 5FX5A 1ESNA 4PC7A 4YMUA 2PMFA 2WZQA 2HREA 3KPVA 2OYSA 1M2OB 1YK1A 1IG3A 1C1MA 4NZ9A 1SJ9A 4EO7A 4GNRA 1JAYA 3RIGA 5AW1A 3G2HA 1Q15A 5JEDA 4R6WA 2QLTA 3HFGA 5TX7A 5FWNA 4JJ6A 3D6VA 3EQ8A 1HZZA 2Q27A 1Q11A 4B2PA 2QTVB 1S2OA 2GM4A 1GNQA 3KSDO 5LYYA 4XOPA 3FSGA 2OXTA 2EX0A 4YMSA 3MTIA 4UEOA 1K8AD 3S44A 4RFLA 5A8ZA 3X1XA 2HIMA 1ELBA 2BN4A 1O2WA 1PPEE 4PQFA 1YE3A 1P6QA 4MWZA 1VQMB 2J3IA 4RZXA 1D1TA 5KVVA 3LCRA 3QWIA 4GSOA 4H7FA 3VNSA 4BKOA 1U3FA 2KPOA 3QJ5A 4B48A 4MJXA 4GNKA 4MUKA 1I1NA 3KJFA 2YJ6A 4H6VA 4L8GA 4QDXA 2PMDA 1E37B 1GCUA 2FP4A 5FCKA 2NQTA 3SZUA 1ZW6A 5JFGA 4K7JA 1JIIA 3KB1A 4TRMA 4W9NC 4OK3A 4B32A 4PZZA 3QW4B 1A95A 1JDPA 2W8BB 5ICCA 2TGAA 2P2NA 5BYAA 1V11A 1XTQA 3IB3A 3DL4A 3C7KA 1A8IA 1PR0A 2CGAA 5DW0A 3NTUA 5J47A 2W6MA 1HMYA 1H22A 2VXCA 8ABPA 3IT1A 2JGAA 3V7NA 4PONA 3GSIA 3T4PA 1RJ9A 2QRLA 3VOTA 5CHYA 2C2XA 4O6VA 3TPFA 2CJIA 4CVNA 1D09A 4DAEA 4I32A 4UUOA 4DIIH 3UHOA 4TKUB 4ZAVA 4O4JF 5TF4A 3RNLA 3KS9A 4HK4A 2A35A 4WQMA 2WJ3A 2GH1A 1PUIA 3QBJA 4ASHA 2OHOA 3F6RA 2F1KA 1KRWA 3F6CA 3THYB 3IIEA 3CRW1 5I7AA 3UQVA 4YUYA 2R4QA 5FPQA 3D7KA 1OVMA 3MGCA 3FOFC 3B7PA 1P1IA 2I71A 3T3HA 4JI7B 2D3LA 4JL8A 1FVFA 3FBTA 4ER0A 4UHDA 4LXTA 1JYFA 1U28A 2A7HA 4IOMA 3AUUA 4NYIR 1NRKA 3BMXA 2IYNA 2JJQA 4BVGA 1GBFA 4N6NA 1ZD5A 3TK5A 1KZ6A 2ZE7A 1NTOA 3OPMA 3TW0A 3KKKA 4AWXA 2I91A 1P7ZA 2REQB 5HSGA 3SO3A 3U62A 16PKA 3DA8A 3GFPA 2W93A 4NZZA 4UCQA 5IYWA 5A9SB 2F9FA 4KTSA 2CXOA 5BYBA 3IAXA 3HPQA 1NRWA 5ESXA 4DV7B 4K46A 3R0FA 3RXJA 2BUAA 2SKCA 3EQ7A 4XEHA 4HBGA 2PFEA 5IAGA 3L8HA 3BQNB 5LL6P 3QHPA 3NEYA 3LF1A 2A84A 1MCTA 1JIJA 3INTA 1I3NA 4O2BF 3BZUA 1H6DA 2C20A 1WZUA 4H3KB 3KOZA 4I1PA 4ZVVA 4JOQA 1APBA 4NY1A 1PPHE 2VOJA 1UKAA 2PT5A 2XBXA 2J31A 1GQ2A 4QDTA 1N07A 3E4DA 1R7RA 2SBTA 1UPAA 2HQRA 1OZ0A 3EIEA 5BN3A 3U4DA 5HF8A 3G8DA 3CX7A 4M0FA 1UR5A 5L9AA 4JLJA 1OBVA 5G3ZA 2JHAA 3OPVA 2BDGA 1H2RS 1UXJA 1Z8HA 4N7RA 1XDBA 1YPLH 1YBAA 3PO1B 3X1YA 1ZUD1 1R0WA 4EG5A 4Y0ZE 3EAGA 1P9LA 3NUZA 2VQFB 4IJUA 1X7GA 5I4IA 3TPCA 4UTNA 3FI0A 4NNJA 1GZ4A 1YSCA 3SC4A 2PEZA 4HFMA 1ZSVA 4U4AA 3NS7A 5A2QA 2GZRA 1TTPB 5CT4A 4B6PA 3PMJA 1XQBA 2VIOA 1MABB 1C1PA 1L1RA 1Q1NA 5DNDA 5BY2A 4PIVA 4DNTB 1BQ3A 4U2BA 3P0RA 2AUNA 4D25A 5IFLA 3GYMA 3ZVAA 3O8RA 1LZKA 2CGEA 3UH0A 3M3HA 1Z2OX 2GCHF 1NQOA 3E5NA 1H23A 3KYFA 3WK6A 1TPOA 4ES6A 1CV2A 2M5TA 1XZBA 1W9MA 3MELA 2VPXA 4KW7A 4KPGA 1HNZB 1U0HC 4QG3A 4WUVA 4FS8A 1W93A 1X14A 1J00A 2G04A 2R79A 4RKWA 3B3GA 1XXFA 1HJAB 4G23A 4ZQBA 2MINB 1AF4A 1VCQA 2XXBA 4HBZA 3B48A 3FVQA 3CN9A 3LUGA 1T3TA 2C04A 3IERA 3DE6X 4YAUA 3VU9A 1QZZA 2H51A 2WRZA 4K87A 1K73D 4H3SA 1RKQA 5DTEA 1F5SA 3B38A 1M1KD 4YI3A 2CNWD 4FD3A 3PNLA 4MV3A 1DWUA 1K1IA 2HX1A 4KH0A 1JOUB 2WC1A 3I2YX 2BV3A 1GG2A 3RC3A 1NN0A 1D9ZA 5IM4F 3GDOA 4LHZA 5EGSA 1PSDA 4J0EA 4L2IB 2LBPA 3D7SA 1E0KA 4IDCA 1ZH6A 3M1YA 3BCUA 2F3TA 4I1VA 4BO0A 4M88A 2JIZD 1SCAA 5FCRA 4YP7A 1TFUA 3M36A 4UZSA 2IWHA 3VPDA 1I8TA 2ZJAA 4DCUA 2DPGA 3LM8A 4FVDA 1YC0A 1E1CB 1NBOA 3CZAA 4IY1A 3R7DA 2BDCA 4M55A 2PZFA 1YB4A 5JJIA 1PR6A 1FFHA 2B0FA 5JO9A 5JLJA 2BQ7B 1GGFA 3N7TA 2IYWA 1FUKA 4IQ4A 5JT1A 4JQZA 4FMPA 5B55A 1XXHA 1N6HA 2GAJA 1YRQA 4YAKA 1RYDA 3VHQA 1IXKA 1HFEL 1T8RA 4Q3DA 2I4LA 4YJHA 1BCRA 2NXEA 3RI3A 5K20A 4DJTA 1QIDA 3NXPA 4ZRDA 3GLIB 3JVVA 1QH8B 2VDWB 1YJCA 3FNRA 3Q7PA 4N0DA 3D49H 4DWWA 2NG1A 1USKA 3SU3A 1E63A 3GGGA 1M5TA 1JEJA 3H04A 2CV2A 4JOBA 1AXRA 4WVLA 3CZMA 3GROA 2RB5A 1JW9B 1TX7A 1G3RA 2EAUA 4O4HA 4QO8A 4KDFA 4A8HA 2HNAA 2DTEA 1P39A 4FBLA 5EMHA 2HOBA 1Z7EA 2WA2A 3ZV8A 1CZLA 1K68A 2WWWA 4BXOB 4C3UA 1NYTA 3OWXA 2ZQ5A 1NC1A 4DARA 3FGNA 2F55A 4LZWA 5JRJA 2EARA 2PQ0A 7KMEH 1JSCA 5B3AA 2OBRA 1WCXA 2OGZA 1XNJA 1ADFA 1CEYA 2MR5A 4MDEA 2IYEA 3E1GA 1EFDN 3LC5A 3FF4A 3U7FB 4R01A 1UOOA 2ZB2A 1F3LA 1VXOA 2FU5C 4BU0A 5CPFA 4F3NA 3D3WB 5AVJA 2YRWA 5JROA 5KNCA 1CW2B 5G0SA 4K40A 2ZI5A 3BBLA 1NUUA 2GVFA 3QUSA 1ST2A 4IQ8A 2EDAA 4HGQA 1E62A 1CVWH 1J90A 1PQ8A 4NBNA 3FVRA 3NWUA 1HVXA 3I9JA 3HN2A 1TJ3A 1JQKA 4XTCS 4GUAA 4QLBA 1HAYB 1V6AA 4DLUA 4XOTA 1AV7A 2FG6C 3ESDA 1U0OC 4BGVA 4WBNF 3VAYA 1O2HA 3BMQB 1AQLA 1LO6A 3QFTA 3MBIA 1IH8A 2Z3CA 3NUQA 2B9EA 5THQA 3OHPA 4CTOA 1Q7EA 1WTGH 1Y59T 1AQJA 5L7YA 2VH6A 3MSXA 3LC7O 4XM0A 2IEIA 3KP1A 1O3AA 4AWBA 4JZ1A 3DZDA 3N8HA 2EFJA 2JRLA 1U7PA 2YHIB 5A02A 5IAKA 1IHTH 4DJFC 3IQFA 4GQAA 3OCUA 1FQ3A 2A9RA 3L7KA 4WUTA 3IG6B 2EQNA 3SOSA 1MQ5A 1NVGA 4KH1A 3ZDZB 2JBWA 3ZCVA 3D0RA 3LRXA 1ESTA 1LTHR 3A1UA 4V3CA 1NONA 1AKVA 2PGLA 4KXLA 1OX4B 4D8TA 4D46A 2I67A 4WFQA 5DM4A 4F7DA 4JC4A 1TVEA 1E77A 1DQNA 1P31A 2C07A 3V4OA 1S3SA 3VDRA 4CT5A 2AA3A 1A69A 2R44A 4X54A 3VR0A 4URVR 4TTSA 2IEYA 4HX2A 3PRJA 1NW3A 3ZNQA 1QK3A 3L1HA 3JRWA 1M7GA 4J03A 4ED9A 1I3CA 3NBKA 5CVEA 1R4MB 2ZTGA 5KYVA 4FUTA 1M0EA 4AL4A 1MKWH 3GCHC 2C3YA 5LNK6 2XJ9A 4PTYA 1BOFA 5TS2A 1DWCH 4HDKA 4QG7A 1ELGA 2OHXA 4Q4DA 1T1EA 4F2GA 2OE2A 1ZM9A 2QTZA 1MAYA 3IC5A 1QE3A 1EZXC 3TLXA 3ADKA 2WUGA 4RFSA 1GP2A 3V3MA 5E4FA 1EOLA 3TXYA 2IJGX 3DTNA 3PD0A 3L33A 3CCEB 3K1TA 3MS4A 5ESWA 4UD6A 2PE5A 2GYYA 1Z4OA 1P57B 2ANYA 4M76B 4RF4A 1QP0A 5TQ2B 4QVKA 4JIGA 3U1VA 1LPMA 4CEJB 1ZD4A 2AW5A 5I9SA 1SD1A 4J0GA 3EZFA 1FW8A 1WTAA 4IRUB 3EBLA 3JAWA 5E2IA 4C5BA 2FUNB 2TGDA 1K06A 3AFMA 3QXJA 4WXIA 2P4SA 3HRIA 2OTLB 4Y79A 1V16B 4ZODA 1O3MA 1BMLA 3WNVA 3KTFA 4JITA 2NU9A 2HHCA 2QUIA 1PJ3A 4ESOA 3ROQA 1RXWA 1K5DA 1QS0B 1YHZA 4QXRA 5ULLA 4CG2A 1VJ9U 1RPAA 3H83A 4RMIA 4Q19A 3V00A 4H7HA 3UMRA 2H8GA 3HCPA 3IESA 10MHA 2DAPA 4KTCA 5AF9H 1SVWA 3ZTTA 4RNCA 1P12E 4X1YB 2PUVA 1TJYA 5EKXA 1QQ4A 1UZLA 4LMPA 4UD9H 1B43A 1WF3A 2EFYA 4JQOA 3KXIA 4W9NA 3HHPA 4PXYA 4FDUA 1G21A 3I05A 1V8FA 5GINE 3GZ4A 3Q9UA 1WPGA 3H05A 3GT4A 3UA4A 1R64A 3D4LA 4NFHA 1EX7A 1O34A 4EJSC 3MBKA 3U5TA 2VK8A 4BNTA 3KNXA 2A9OA 3C6ZA 4PNEA 1C14A 2PTCE 3L6OO 3I64A 3DW1X 1XU7A 4AYWA 3G7UA 3HUTA 2F43B 4YUAA 5CDTA 4QGAA 2H1WA 3OIVA 2RGNC 3T3EA 1R18A 2AFIB 4C89A 1NIPA 4PPQA 3L6BA 3ZJ4A 3JRXA 1XKTA 4UE7H 4F48B 1T1GA 4BAHB 3OKFA 3WK5A 2DOKA 1RBZA 5BORA 1AN0A 4IJKA 3K0CC 1DAGA 2Q4BA 1SXJB 3RJMA 3Q5EA 1VHTA 2PL1A 1YXMA 1MZPA 1A2KC 3A81A 3WB0A 3NIBA 1BJVA 1SAYA 2RGAA 1OLSB 2AUTA 2HQOA 3AESA 1KPGA 1G16A 1TAGA 4PYLA 3T9EA 4FYWA 3RSFA 1JIMA 2EXXA 1EESA 1LQDB 4U9UA 4D3ZA 5NULA 4GXTA 1V4NA 5LJIA 5TGDA 5KOJA 8GPBA 3FB4A 3C24A 1TYBE 3QF7A 1QGOA 2SFAA 5KMGA 2DX7A 2BPOA 4EFNA 3MJEA 1LDGA 2EKDA 1MV8A 4Z2YA 1OASA 2QYSA 1Z28A 5YASA 2JH9A 1FPHH 2WFLB 3K4PA 3WIEA 3U4MA 2XB4A 3AY6A 2AXQA 3EODA 2VCYA 2WU3A 2ZPRA 5EJ4A 5BSRA 3GB9A 3WP1B 3UJDA 3SAJA 3TSOA 1EXMA 6REQB 2J59A 1V47A 1NFRA 1XR3A 4TXNA 3EPJA 2J6BA 4YO9A 1Y34E 4K9QA 3N6VA 5E38A 3BGDA 1VCMA 2C8KA 2NXJA 1CJKC 1VHOA 1SVNA 3L92A 4DLAA 1EK0A 1NMYA 4IGDA 5AM4A 3JQRA 3AM3A 1UBSB 4BHTA 1NUPA 5GONB 2GEDA 3EAFA 1N6KA 4RA6A 3EVGA 3TZ6A 5TLSA 1NL3A 2WZDA 2C57A 3KKOA 4U2EA 1QFXA 3AFIA 1YZYA 1YIDA 2XMCA 3N99A 4BGEA 5FI5A 2WAAA 4HH3C 1U8UA 2IU4A 4XWGA 4X90A 4BEVA 1VYHA 4RV9A 2CHQA 5BUQA 4WY3A 5M29A 3TVDA 2RCEA 3ADDA 4YMWA 4M1WA 5CURA 3B89A 3GLFA 4LGVA 4G6IA 1VPVA 4QAJA 2DEUA 1T35A 5GMOA 2AF3C 3QWCH 2THFB 2JGFA 3EDCA 4V38A 1RC0A 1CX9B 2H9HA 3SV8A 1T9ZA 5SY4A 2GFHA 1WJGA 2GT1A 1NN3A 4BB6A 1UBRS 1SZJG 3DT8A 5C5EA 3EC7A 1CVRA 5D2CA 2D4AA 1A3BH 5E2BA 3SNKA 4MGHA 1TQ8A 1KETA 4BQPA 5EXMA 5TMBA 5EWJB 1A9XB 5A0CA 2O0HA 2QP3A 3O4GA 3FNHA 1RRVA 4C7XA 2X53S 1PJ2A 1TNHA 1C7JA 1ZGJA 1JWLA 2OV1A 4GYWA 2BKEA 3ZY4A 4FP9A 2H8KA 1QKJA 3NVKI 2WEKA 4M89A 4IJQA 5EKTA 1CLEA 2QRPA 4KKSA 1VIYA 2Q4RA 4PZUA 4I8KA 1MU0A 1BE6A 2HU5A 3GPDG 1Z0DA 4RKRA 5EHZA 4MA4A 3HLYA 2OGSA 4BO6A 1ONBA 4HLUA 3R24A 4OL0A 3HKBA 3ZE7A 3CH7A 4GGOA 3UFXA 3UA3A 2JCBA 1T5IA 2VIIA 4G8DA 4PLZA 1Z4KA 5BN4A 3X2FA 5JIBA 1A7AA 1THTA 4MICA 3UJPA 1XHEA 1FNIA 2XB9A 5GWXA 5JRDS 4NOJA 1ZISA 1YVUA 2CBGA 2ZDKA 4WIAA 3AVQA 5FL7D 1KJQA 3IUEA 3A0RB 2G6TA 1KDQA 2P65A 2BEUA 2QXGA 4ZKOU 1CUDA 4J1TC 5DT9A 2ZSDA 4II7A 2CV0A 3DULA 1AGRA 2GEKA 2GCIA 4R31A 2BZAA 3IMFA 3CG4A 5DGJA 2H11A 4YJ3F 4MNYA 4QREA 3KU4A 1H9BA 3F2HA 2PUJA 4PYQA 2VXBA 1F2UB 1QH9A 1X8XA 1L7NA 1CSEE 4XR9A 1X1RA 1A9SA 2QHXA 4DL9A 3W6OA 4LZ1H 4JJIA 3UUWA 3KE8A 4GKJB 1FP2A 4BLUA 4S35A 1GBJA 3UNQA 2PGXA 3AINA 1GHBG 1TO1E 2J5UA 4D3XA 4HN2A 3K2QA 4PLHA 1HDXA 3AY3A 4MRSA 1ZYOA 1PYTC 3ACBA 1AB9B 2CDAA 3STWA 1HYGA 2PMWB 3UW3A 4LBZA 1JQBA 1QHHA 4URWR 5BMVB 2FPZA 2E87A 4DA6A 3RB8A 3NFRA 2O0KA 3OZGA 1G8SA 5TGZA 2RKBA 1J2JA 1KEPA 2DBQA 4QULA 4KACA 4DZTA 1E36B 1GRRA 1FNBA 2GJ9A 3JR3A 4A26A 3MRXA 4R9RA 2REXB 1PKXA 5JYIA 3QE9Y 1TEHA 5CMLA 4Y1FA 1O2JA 4WXHA 1A4IA 5DNUA 3RWBA 2RE8A 1UBUS 3G7SA 3ZD7A 1XHFA 2I22A 3KQSA 4QQKA 4KLNA 2HDHA 2QUZA 4KKXB 4B3TB 1RVDA 1CZUA 5JZBA 3TGJE 3FNFA 3P9RA 3MCTA 4LCJA 2IW3A 1H0SA 5BSTA 5E6RA 4BECA 2JARA 4Z4TA 3A1EA 2IE0A 3ESAA 2CLHB 3BH6A 2BDIA 2ZL7A 4G1UC 3VNRA 1TTTA 2ZBGA 3KQEA 4AUMA 3I9FA 1TMGE 4CF4A 4BFSA 1PQ7A 4LCBA 4RF2A 5FNVF 2EQBA 4RD6A 4XSGA 2P0YA 4WW0A 2Q28A 3UO8B 3GJ5A 1N2EA 1IHPA 3QP9A 1QIEA 3QXXA 2KAIB 4UTZA 1FE8A 3SUDA 2ZSBA 2YFKA 1RLIA 1IMOA 3NHZA 2GBGA 1UMDA 2JETB 1UPXA 3WLOA 4TQGA 3PUNA 5CCDA 3VR6D 1SIWA 2BELA 4KMSA 2YY6A 5T5QA 4WKCA 5U9CA 4P98A 4L5YA 4G4GA 1G30B 1YR1A 3F4BA 4YQYA 1OYYA 3IIIA 2EKLA 3OLCX 3HU2A 4DHEA 4JWTA 3ZXUB 1A71A 1OCEA 5TCAA 5CRIA 4PLVA 2TPIZ 2XSZA 2W5UA 2BT4A 3AUYA 3FGPA 4NMWA 4H6SB 4IQFA 3W3ZB 4J16C 2ZFPH 3ZGLA 3CX3A 1UIMA 3P8FA 1DVRA 2QRUA 3SVZA 1QYDA 1UMBB 3KTOA 3ZUPA 4AJPA 4CKBA 1HUTH 4WMDA 4EITA 1OWIA 1K89A 2WMYA 5GGYA 3CR7A 1D2HA 1MKWK 3NWPA 4PLFA 3DCIA 4ARZB 4OPMA 2DQZA 3CESA 1FOEB 3CINA 4ID3A 2VP6A 3PDWA 3F7TA 3I9LA 3P9CA 3QWHA 2WVHA 4ABHA 3FKSD 1SGYE 1RLMA 2BSAA 1GBMA 4DGQA 1YRLA 1IQLA 3DMGA 4P53A 3PT5A 3KJZA 2DM6A 3GXOA 1EEHA 1ILWA 1Z4QA 2GZ9A 2OCLA 3WMXA 1W10U 1JWTA 1B16A 4LRWA 4D3SA 2ZKSA 3MWJA 1NRSH 1OWHA 3E0PB 2XC0A 5I9IA 2BEVB 3J81k 3QIVA 1G19A 2WI8A 1QYWA 1Y9AA 3MOIA 3O91A 4Q21A 4Y2YA 3IP8A 1RAFA 3SI4H 1F6DA 3AK4A 3LWDA 5JATA 3ZBQA 5IPFA 2WTEA 4AMGA 2MSLA 4XWAA 3IBGA 2OVBA 2QZSA 5AI5A 2O8EB 4C4PA 3H5CB 1TRMA 2NXWA 2RK4A 2OLEA 1WOPA 4MRRA 5EHGA 4OMCA 4A0QA 1GGKA 4EKNB 4EPYA 1TE2A 2W6NA 3O7WA 3K30A 4IS3A 1W30A 5EJ2A 1O3JA 4IDNA 1O8BA 2DBYA 1UBTS 3GN1A 4I33A 1F38A 1P80A 1YNOA 1SUIA 1YULA 1UCYE 2B9VA 4L78A 4I99A 3NOOA 1LSJA 3LUFA 3BDIA 4EVRA 4O03A 2J94A 4W8GA 3PWSA 2QD4A 4IBOA 4RANA 3E7PA 5FTLA 4U30A 2X7JA 1B41A 1RRCA 2IJD1 4YR9A 1KXFA 3WHKA 3U4QA 1C7EA 2JAOA 1GCGA 1RJXB 1XEXB 3DAPA 1CXZA 1ZVKA 1WUNH 5JARA 2QTFA 1C41A 5I25A 5FL3A 1KE1A 2W2TA 4WDRA 2NVUB 4GZLA 3AAUA 5C80A 3AHDA 1QE5A 3KD2A 1C0PA 3EG9B 1HUQA 4MDFA 3OJEA 3WB1A 3P20A 4ARAA 3T7JA 3VPSA 4NFYA 1U1GA 1EDEA 1G8KA 4Z99A 4EJSA 1OKKA 4EHBA 2QL6A 2CZGA 2YZGA 1HTWA 3KQBA 4DCMA 1G4UR 4DIHH 2H92A 5AO9A 2NU6B 2AH4X 1C4Y2 2ONZA 2MIIA 5F03A 3Q8KA 4I1OA 1Q91A 3L3TA 4O29A 1QFYA 2NV0A 3EYAA 4CM8A 4ZT3A 3HCBA 5CAEB 1NR5A 1TJ4A 1A96A 5JS6A 3MJFA 3IBSA 1U2ZA 1W36D 1RT9A 3U37A 3CGWA 3N2YA 5KOHB 4RVCA 5IJXA 4ZYLA 1E1KA 3TTVA 3BHIA 3QTVH 3CUSA 2ZGBH 4G7XA 4KB5A 2JEYA 2LCIA 1RZVA 5EIHA 5FLYA 4D26A 3OOSA 4G84A 4GRIA 2ZJZA 2VTDA 4DUGD 3PJGA