4ACAA

Crystal structure of translation elongation factor selb from methanococcus maripaludis, apo form
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
469
structure length
444
Chain Sequence
HMDFKNINLGIFGHIDHGKTTLSKVLTEIGFSAFKLENYRITLVDAPGHADLIRAVVSAADIIDLALIVVDAKEGPKTQTGEHMLILDHFNIPIIVVITKSDNAGTEEIKRTEMIMKSILQSTHNLKNSSIIPISAKTGFGVDELKNLIITTLNNAEIIRNTESYFKMPLDHAFPIKGAGTVVTGTINKGIVKVGDELKVLPINMSTKVRSIQYFKESVMEAKAGDRVGMAIQGVDAKQIYRGILTSKDTKLQTVDKIVAKIKISDIFKYNLTPKMKVHLNVGMLIVPAVAVPFKKVTFGKTEENIILNEVISGNEYAFELEEKVLAEVGDRVLITRLDLPPTTLRIGHGLIEEFKPIKDLNIKKEVLREGKVKIDKGRTVIDGLAQSKVAAEKLIGEEISIEGKDIVGKIKGTFGTKGLLTAEFSGNVENRDKVILNRLRRWG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Selenocysteine tRNA-Specific Elongation Factor Selb is a Structural Chimaera of Elongation and Initiation Factors.
pubmed doi rcsb
source organism Methanococcus maripaludis
molecule tags Translation
molecule keywords TRANSLATION ELONGATION FACTOR SELB
total genus 98
structure length 444
sequence length 469
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.190 Mainly Beta Beta Barrel Thrombin, subunit H translation elongation factor selb, chain A, domain 4 4acaA04
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4acaA02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4acaA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4acaA01
3FYHA 1ANKA 1XCPA 2WPDA 2D74A 4WBSA 5JWOA 4JLNA 4DRZA 2C9CA 2GCPA 821PA 2OEPA 4HUTA 1NMZA 1XJCA 3NBZC 4JVNA 4A8JB 1YZUA 4XD7A 1W44A 4MKHA 2A30A 2AFHE 2WSSA 1T3HA 3WYGA 3X1ZA 2GZDA 2GKSA 4Q7JB 3B1WA 5CB6A 4HDOB 1VG1A 1HT1E 3OIYA 1N6NA 4YAFA 4QFMA 5J4VA 2D4HA 5G53C 3H2YA 2OHFA 3B1VA 4EAQA 3OJXA 3RC8A 1CJTC 2ZANA 1QGYA 1WXQA 1OXTA 5E7JA 2G1KA 3SYKA 1W36B 4JLDA 5FBLB 1FTNA 3S1AB 3W9YA 4OJKA 2C2HA 1VCOA 3W90A 1U8ZA 2QE7D 2BMDA 2REBA 3FMOB 4ABYA 5BYKA 1PLLA 4PX9A 4DLRA 5CB8A 4AYTA 3I73A 3PUYA 4TL7A 2BEJA 2JASA 3PQCA 1P60A 2G83A 2HF8A 3A8TA 1DADA 1R0ZA 2NIPA 3KB2A 4DXAA 3SYNA 5D3MB 1P9NA 2ZRAA 4B35A 2OCPA 2CJWB 1CR0A 1OHHA 4ZDIA 2DERA 2ZETA 4FXPA 2GK6A 3ZQ6A 4OI2A 2GTPA 2JJ2D 2OUKA 1CJUC 4Y9UA 1FX0B 3NH6A 4NTZA 4NPHA 2PL3A 4LBYA 1BH2A 5B30A 4LJYA 5GJVC 5CM8B 1OXUA 2N46A 3QBVA 4URXR 1HH4A 3DO6A 4PSVA 3F8TA 3FKSA 2WAYA 4JL5A 3OJWA 1SVKA 2Q6TA 1CXZA 4JZKA 4CT5A 4N3GA 3ZJYA 2OAP1 4L4UA 4WZ6A 1KJYA 3VR2A 2DBYA 2RAPA 3NDBB 3CCMB 1JR3A 4G1VA 2PLFA 1NSTA 1Z0IA 3C41J 5EUMA 4BRUA 1ZIOA 4KI0A 4NL4H 4P32A 4QHSA 1BQEA 1RZ3A 3ZDQA 2ZREA 5ELXA 1JXOA 1SVOA 3SJAA 1II9A 4D2IA 1DARA 5UKDA 3W2GA 5TARA 2SHKA 1YRAA 3W8RA 3SJCA 4BFZA 2O8BB 4C4PA 4TL6A 2WZQA 3VU9A 1DTSA 1QHSA 4M8NE 3FPAA 4M1KA 2C04A 4PC1A 2J87A 4R98A 2QPOA 1QZXA 4RZXA 2XNDD 1Z22A 3CONA 2OK8A 1KI2A 1R6BX 3GLHE 4NYJR 4ZDJA 1XRJA 3VR4A 3HU1A 4ARZB 4TZ6A 3SHFA 3CX6A 1H8ED 1ZYUA 2XNDA 3THWB 3LW8A 3RS5A 2C03A 3D8BA 1IN4A 2BF4A 3UG6A 5C46F 4IFEA 2IWRA 5K8IA 5KTYA 2AXNA 3VX3A 3LVQE 1XMVA 2ZJ2A 3UATA 4QG7A 4P0TA 2GEUA 1OB5A 2LKCA 3K53A 2IXFA 4KVAA 4PPNA 1GVNB 2CL0X 4QXAA 1KSGA 4QBGB 2CBZA 1F2UA 3K0FB 2IYSA 1XXHB 4TLCA 3QG5A 3VAAA 1TEXA 3D7MA 1GL6A 1JPJA 1KRHA 5FR2A 3I32A 5LB2A 3B6EA 3QFTA 1VQMB 3U44A 3F5FA 1J8MF 3B13B 3K9NA 1U8AA 1Z0DA 2A5YB 4D25A 4MGYR 1E9EA 3N5CA 1W35A 3HPQA 2QZ4A 1QFZA 3T15A 1KK3A 5DO9A 1A5TA 1D2EA 3BAFA 3EZ9A 1QHNA 3TE6A 1JA0A 4MYHA 1GOTA 2C8VA 3FWYA 1R5OA 2HJGA 2GXSA 4B3XA 3CKLA 4Y9RA 1Z63A 4M1OA 2FDCA 3QXCA 3V00A 1ZAKA 2OILA 3REFA 1W87A 1OIVA 4NP6A 2ONKA 2YINC 4UNPA 2ODWA 5JEEA 3CMAB 3A1UA 4GZLA 4BUJA 1FQKA 4LC1A 4KFRA 2CK3A 3W5HA 3A4NA 1DDIA 2ZRCA 2KBEA 3GCGA 4ZPXA 4ERNA 4Q48A 4ZIRB 3W3AA 4PZLA 5D3QA 2B7CA 1TLLA 1WF3A 1XJQA 2GZHA 1GL7A 521PA 1J7KA 3AUYA 1M8PA 5L3SB 2MSDB 4DT1B 3IPYA 1QGAA 3ZIAD 4CF7A 4LPSA 3VNVA 2PZEA 4Q1CA 3OHMA 2DFLA 1R5BA 3X1XA 1GAWA 5KNDA 2NO0A 4NYIR 5FTLA 5B2ZA 1A4RA 3FTQA 3HP1A 2WWYA 1I7PA 2FPMA 1YZKA 2JLVA 1G7TA 2C78A 1FPMA 4DLSA 2CXXA 1FDRA 2NPIA 2KI5A 1OXVA 2NO1A 4RD3A 1YJ9B 1L4YA 3MWLA 1XTRA 1AS2A 5DN6D 721PA 1GJRA 3CPWB 2OFWA 4B2LA 3IQWA 1OJLA 2XB2A 2EFDB 4TMVA 4I1VA 5AK0A 5IHPA 1NBMA 1T8UA 1SXJC 1TUEA 2WJHA 3T1TA 1IY1A 2QMEA 1TNDA 3EARA 5FI0B 4OHZA 5C2JB 3GMTA 1R8SA 3K9HA 4LSGA 1DAKA 3DMNA 4V0ME 2HYIC 3THWA 2J0UA 3VKHA 3RDPA 3I1FA 1TQ2A 5KSZA 3TKLA 3KQKA 4BPBA 1PUIA 8OHMA 4NHOA 1ZM2A 3FPKA 2H17A 2R9VA 1KAOA 1CNEA 4QGGA 4DLXA 2EWWA 1LB1B 1DELA 3WBJA 3BGWA 2ORVA 4QNMA 4JMPA 2FH5B 2KJQA 3PUVA 4B3CA 4BZXA 2VSOA 4PAOA 3OEHA 3NHBA 2FFHA 1O87A 4KJZA 1RJ9A 3GJ7A 3IHLA 3MMPA 1E2GA 3LX8A 3GJ5A 4KFTA 3ZD7A 1U98A 2F1HA 3QENA 1OFTA 1NBME 4TL9A 3QI2A 4Q4AB 4BZPA 1IXRC 1HTWA 1KY2A 3U44B 1M74A 2V3CC 5CK4A 2C77A 4YDHB 3VHLB 2DPXA 4RVCA 3CF2A 2RB4A 3LQRA 3EIEA 4QBFA 1A2KC 3R8CA 3KQNA 3NEJA 4N1AA 1FTSA 1Z07A 1ZRHA 1W4RA 3SE0A 1SKQA 2CHQA 2VBCA 1XEFA 1AA9A 3CUEF 3V9PA 3VKWA 2QP4A 5M04A 1RPZA 4G5RA 4LYJA 3IGFA 2ONJA 2AL7A 5EXXA 4NYIQ 1OE0A 2MMCA 3AVWA 3QVUA 5DYIA 4X8LA 1BX1A 1KDRA 4JLBA 4HI0E 4C0JA 3R8FA 3AUXA 1JALA 1UKVY 3DEFA 1XXHE 4NMMA 4Q4HA 1CNFA 3ZYCA 4CEIB 4N0EA 1N6LA 4M1SA 2YNMA 1SXJD 2ZYTX 3IO5A 3CCJB 2GESA 2DFNA 4MRPA 5EE3A 3W5JA 3ADKA 2E9SA 2JCSA 4URUR 4HAYA 5JHHB 2BEKA 2PCLA 2PEZA 4CZ2A 2F6RA 1DG1G 3C8UA 4A0FA 2JDID 2FZ4A 3Q85A 2CNDA 3ZVNA 1XTIA 1S72B 1RYHA 2J0VA 3JVUA 4C0LA 4D82A 3EG5A 1R2QA 4FWIB 2BC9A 2WWIA 3E1SA 4GOJA 5DNYB 1XZPA 3GFPA 4IDOA 4O25A 3RHFA 4YMUA 2O52A 1JA1A 2YWFA 3QXHA 2JJ8A 2PT7A 2W0SA 4X8MA 5JRJA 2KB0A 3GJ4A 2WJGA 3LWNA 1GTVA 2DWQA 5HR5A 3A4MA 3R20A 3A6PC 1GKIA 4UKDA 5FPSA 1E69A 2O8DB 1P62B 2C99A 4TMKA 2PH1A 4GDFA 1SVLA 4Y7CA 3F0TA 2ZRLA 3AKEA 5ANRB 4RZ3A 3EWAA 3WMFA 4B2IA 4ZIRA 4ZDKA 2R44A 4TMXA 4QL3A 3PEVA 2Y8EA 4RY2A 5SZKB 1W34A 3MSXA 1NN3A 2AFIE 1N5JA 2BJVA 1QFYA 3TSOA 5AJXA 1JJ7A 3QXJA 5LBIA 1XE1A 1DAMA 1Z6AA 1E9DA 2G0NA 3CF6R 2XZOA 5KYKA 3GLGB 3MWYW 1KSHA 3KXIA 1JECA 3UWOA 1UBGA 3KQUA 3B1XA 1N2CE 4QBHA 3P4YA 4DB2A 4OHYA 2WTUA 4OQMA 3B82A 2N42A 5EXTA 1VQ8B 1NJID 1KO5A 2ZEJA 4V0KA 4MRSA 3K0CA 4BFYA 3VO2A 4HUQB 3PITA 1VECA 2F55A 2RGGA 4LJ8A 3DPUA 2O8CB 4DDVA 1F60A 5JEDA 3GJ3A 1NY5A 5KDLA 4DQLA 4M1YA 2JIZA 4QC2A 1G3QA 3KJEA 1PV4A 2HDNB 2ZU0C 2IUTA 1R0XA 4P4TA 3L82B 4HAZA 2ANBA 1JR6A 3RSOA 4C0BA 4TLAA 4F7WA 2ECKA 1FNCA 1II8A 1BX0A 4PZYA 2OT3B 1E4VA 3CRW1 3G6EB 5KOYA 3FB4A 3AVUA 1E79A 5DIFA 2JLZA 2XJ4A 4B3FX 1G64A 3AM1A 4UXJA 4LGMA 5JJKA 1G20E 1QHYA 5FTMA 1G4AE 4PPQA 1GR1A 4YLGA 2X1VA 5FBWB 2QL6A 3T1OA 5EP4A 1JAHA 4IOMA 4JSTA 4ZKEA 4JSYA 1MO5A 4KLZA 2EVWX 1EWYA 1QVGB 1XNJA 3W2FA 4XVRA 1ZUNB 2OCBA 4DWJA 2TMKA 3EC2A 3BORA 4Q9HA 5CITA 5CYOA 1TADA 4EJSA 2AX4A 5AJZA 5C4GB 4BASA 1PVOA 1NN0A 2G0TA 2GVZC 2JLQA 1U94A 2NG1A 2KE5A 1J99A 2GBLC 3IBGA 4IOJA 1JQJC 3SFVA 4S35A 3GLHA 1U9IC 3OIWA 1HE8B 121PA 1B2RA 4C30A 2XTMA 1VQLB 3ZBTA 4HZUA 5GJCA 1F2TA 3AEZA 3EAQA 4Q4LA 3KFXA 3ZZTA 5EE1A 2NOAA 1ZJ6A 2ZVPX 2VP2A 2WWHA 2IUUA 1MKYA 5IK2A 1NSFA 2QTZA 4FCVA 4UNNA 2ZAOA 4DZZA 1N5IA 2QPAA 1F6BA 3TSWA 3WRYC 4EFLA 4U02A 5H59A 1UEIA 4N3NA 4LZZA 1CTQA 5L8VA 3Q3JB 4IRUB 4RD1A 4QGFA 1K5GA 4YMVA 4BFSA 1CR1A 1LS6A 1ZMXA 1OB2A 2RGNA 5IF9A 2YOHA 1TQ6A 1RKBA 3LXXA 2VP5A 2ZRGA 3HR7A 3MWJA 2W0MA 2JLSA 1SVSA 3AKCA 2O8CA 1QGZA 3EWSA 3P1JA 2ZRMA 1XMJA 2REOA 1UF9A 4FINA 3PUZA 4MYCA 4AKHA 3CCEB 3W2HA 4IDNA 1G18A 2VYQA 3NWJA 2QBYA 4A36A 5DI3B 4DDUA 5BQ5A 1W47A 2BV3A 3HU2A 3LNCA 1QUEA 2QI9C 4BLSA 1W4CA 2GWHA 2P0EA 3KUDA 2ANCA 4DLTA 4PANA 3QIAA 2J41A 1NN1A 1G21E 2LP6A 3QEOA 4EJSC 1GM5A 1RFLA 2UVQA 4EKDA 3C14C 3VX4A 4B3GA 1VTKA 1KOFA 1XTSA 3B60A 4AKEA 5BW8A 4YMTA 2V8OA 3MJRA 1XCGB 1IQPA 4IVPA 2OV2A 3QG1A 4FMBB 2FV8A 2WJVA 2FWRA 3B9QA 3GJ8A 2QN6A 1CU1A 1OKKA 2W2TA 2ODNA 1YJ5A 1RE0A 2AWOA 1AK2A 1G5PA 1HV8A 3THXA 1GRNA 2P3SA 4OQXA 2OXRA 3EA5A 3FMIA 1QH0A 3U7FB 4ESVA 4WZAE 2ZQ5A 1OH7A 1MOZA 1WMSA 1KZ7B 5J5CA 4F4CA 3Q72A 4C7OA 3AVQA 3UPUA 4PXAA 2IUSA 2BCGY 2K5UA 3UMFA 2CCGA 2IF2A 5CIWA 1M1KD 5HKKA 2F3TA 2FGJA 4RFSA 1IY0A 3HDTA 2CK3D 5H5JA 2QM8A 3VQTA 2FFBA 3IEVA 4EH1A 4ZV4A 4BWYA 2QEQA 2RH5A 4Z51A 2GJ8A 2QGNA 5JJIA 3SYLA 1M7HA 3KL4A 1W7AA 2BIFA 4M4SA 1BMFD 1WBDA 5JJLA 1A1VA 4PQFA 4KSCA 4DEYA 1FRNA 3RANA 4U7DA 2G1JA 4M21A 4IOLA 1H42A 1CBUA 2QDXA 3AVOA 1CIPA 5DLQC 1V5WA 1AM4D 3P20A 4GMXA 4NCJA 3A4LA 5HE8A 2FFQA 2KBFA 1KGDA 3U3MA 2QQ0A 1ESNA 4YXWA 4TQUS 4O3MA 2OXCA 2XNSA 5KPJA 3OESA 3QFRA 1K6MA 3K9LA 4Q1EA 5TMPA 1P72A 4GP7A 4PAMA 1YZLA 3TR0A 4C9BA 1SVWA 4DB4A 1G9XA 3PFIA 5DISB 2BDTA 2IYVA 3ZS9A 2BGIA 4WZBE 3W6OA 2F7SA 1W2BB 4BEJA 3W6PA 2UKDA 4Q7LA 1GZSA 1H8HD 1F5NA 1YJNB 3KXKA 1OH6A 2H18A 4QJ4A 5BN5A 1E2HA 3ZBUA 2IXEA 4GBMA 1E2LA 1NIJA 3TUJC 4MUBA 3WMEA 5JBQA 4IDHA 3BH0A 4KODA 5E3HA 2VTKA 1Q22A 1AS0A 2OSBA 2OCAA 2XXAA 3R9IA 4Q1BA 4MDFA 1N6HA 1R7RA 5EE9A 4DLVA 2WPDD 3CCRB 3RWOA 3QE0A 2RGXA 1Q21A 2MSEB 4RZ2A 2RGDA 4EPRA 2QG6A 4QBIA 5JFGA 1IOZA 1DAIA 4YAUA 3I55B 1ZU5A 4OK3A 4JLJA 4DSUA 5IK2D 3U3RA 2P65A 1TAGA 2CVFA 2Q9CA 1L4UA 1P2TA 3QF4B 4MKFA 2D2EA 4Y0VA 1BIFA 1Z2AA 1BYIA 1U0HC 3K09A 3OF5A 4B34A 4E5UA 1IJEA 1NRJB 4XTRA 1G5RA 1D1NA 1G17A 4OI0A 1QVFB 1E2KA 1T91A 2ZRHA 4AC9A 5JCPA 3U4QA 1DEKA 3BOSA 1CF4A 4U00A 4GZMA 4W7SA 2HT6A 3WYAA 4PC2A 2QU8A 3Q5DA 1S4QA 2VA8A 3TUIC 3C16C 4OI4A 2ZAMA 2OK7A 4LYAA 2WOOA 4EFNA 4TT3A 2ZJZA 3NVAA 4EQ6B 3EPLA 3U2QA 4C0KA 2IW3A 4ZKDA 1W0KA 2CVHA 4NCIA 1Y3AA 2QTHA 4LK2A 2XSZA 4H9GA 4II7A 2JJ1D 5C18A 4TN1A 1US8A 2XOKA 2RGEA 1JPNA 3NC0C 1MRSA 3DKVA 5DI3A 5EE5B 1IXZA 1JR3E 3EX7C 1E1RA 1Z3IX 3KB1A 4PAQA 3X2SA 3VKGA 1K8RA 2XSZD 3TVTA 4DUGA 1P75A 1KJWA 4TTPA 2WJIA 3SEAA 1Z5ZA 4F7DA 4IEIA 1XJ0A 3VR1A 4YQFA 3O8DA 4DCNA 3IPXA 4RCYA 3E20A 2YC4C 2WKPA 3CH4B 2CEAA 4DHEA 1ETUA 2BVNA 3VNUA 5E4FA 3CR8A 4UJ5A 3RRYA 1ZC4A 2AD5A 1DAEA 4UAJA 3WHLA 1E9CA 1XTQA 2JJ2A 2QY9A 4NKRA 2BN4A 3EPKA 1GNPA 2V9PA 3NKVA 1EXMA 1CR4A 2A9KA 2FNAA 2PLRA 2R6DA 3LBNA 2OO7A 4EPWA 6Q21A 4OHVA 4QNRA 4D80A 4WVFA 3DOFA 2DCUA 1VQPB 1Q1QA 1HYQA 4H1VA 3ONWA 3DMDA 4JYBA 3RLFA 4DSNA 1W36D 3QVVA 4MKIA 3SJZA 5IRCD 4DCSA 2VLIA 1W2HA 3EZ6A 5CYPA 3CMEB 4LBZA 3M6AA 4HB0A 5L3SA 3GLGA 2ZSFA 1UMKA 1K8AD 1L2TA 3I56B 1SKYB 2GXQA 1IJFA 5FL3A 2BBWA 1KDPA 5THXA 1T0HB 2ZJBA 3P4XA 1U0JA 2GCOB 4QM6A 4LYHA 2H92A 3E1YE 1VYTA 2OBNA 4UQOA 5FBQB 5SZHB 3SOPA 2DB3A 1XTKA 3A1WA 3U3JA 2YOGA 1JAIA 1KO1A 4Q1FA 3SHWA 2PEYA 3TNFA 1VG9B 1IM2A 1VG0B 2YWHA 5KSWB 4G5QA 4ZI3A 2VSFA 3I92A 1U8YA 3SFZA 4H1UA 4M9ZA 1JBKA 1QBKC 3VR6A 4AURA 3KKMA 1XF9A 1Y63A 4Z8YA 4DBLC 3CWQA 1XB2A 3TQCA 1E99A 1Z0JA 2DR3A 5H8WA 4US2R 2ZJYA 4Q18A 3TRFA 4BFTA 3ADCA 3ADBA 4DDWA 1NN5A 2ZJ8A 1W48A 4Z1MD 1ZINA 4P4SB 4IVQA 1E32A 1FMJA 4LJ6A 2Z6VA 1T5IA 4B3BA 2JGNA 1XP8A 4PHTA 1YR6A 4A92A 1XEWY 2HCBA 4MKGA 1YR9A 3Q7PA 4JYCA 3CC2B 4OK5A 2V1UA 1OYWA 3AP3A 3IO3A 1AKEA 2EFHB 3DHWC 4FIDA 4JVLA 4OBEA 4LBWA 1GITA 2VL7A 4IHQA 4R2IA 3ZQJA 2VSXA 3TUZC 1GL9B 2GCOA 2R8RA 4A0GA 3OFNA 3WBKA 2IYXA 1P4SA 4HAWA 4IDPA 5KSYA 1PZNA 1BS1A 1G3MA 2H8KA 4MITA 1OFHA 3A58B 2FMXA 4QGHA 5GVRA 4RCZA 1TVCA 1VIYA 4CEHB 1QG0A 1UBCA 4B74A 2QAGA 3IEUA 1ZM4A 2ZSAA 3H84A 2ZYWX 1GAJA 2ZJOA 5FOTA 2B92A 2P5SA 4POAA 1G8HA 2UZIR 2Q0HA 2ZI3A 3B5JA 3QNUA 3CC7B 2R6CA 3ICQB 1OFUX 1YE8A 2B7BA 2ZRFA 1FP7A 1KI3A 4TL8A 1VQ5B 2F1RA 1BKDR 4HEJA 1XMSA 2QMOA 2ZJAA 3IHWA 2D2FA 1XD8A 3UKDA 2VYFA 3PUXA 1OSNA 3KXLA 5TDHA 1YZTA 3LRPA 2CLCX 2HV8A 3MGCA 1FNNA 3HU3A 4W5HA 1OH8A 3AB3A 2DFTA 2NO9A 3L0OA 4E22A 3I8XA 2J3EA 2NPFA 3QKUA 2QM7A 2C96A 2BCJQ 2X19A 5CK5A 1L7VC 4A1FA 4DCUA 1G8FA 1EFUA 2PZGA 5LPNA 3G4SB 1X8JA 2JLWA 4CIDA 5JZVA 3ZS8A 4G5GA 1KDTA 3FFAA 2XTNA 5J4LA 1SULA 3LH5A 1MH1A 4GOXA 2P6RA 4A2PA 4OYHA 3B8HA 4CEJA 4ITRC 4TYYA 3PEWA 1K73D 3SZRA 4O0MA 2ATXA 2ATVA 4G1UC 2Z5FA 3VO1A 3CF0A 4BRWA 3CM0A 2O0HA 4LX0A 3UIEA 1OGJA 2QP9X 2ZIAA 5B58C 3TW8B 3CZQA 1AZSC 1MABA 1BYUA 2VP4A 3LD9A 3KFVA 3U4QB 3I8SA 5AUOB 1SQRA 3CLVA 3B2EA 3L2OB 2GETA 1ZP6A 1E98A 4FMDF 3TR5A 3SS8A 2A5DA 2ZRBA 1JEDA 5G40A 3TVDA 2BWJA 2RGAA 3Q7QA 3WMGA 1U2RA 2FSIA 3RYTC 2PMDA 2DWPA 3QOFA 1DBSA 1Q44A 4OHXA 2R65A 1ZIPA 2QGZA 2A7QA 2GCNA 4KVGA 1GNRA 2PJRA 1COWA 1IN7A 1AS3A 1DPFA 1RRGA 2NO6A 1IN5A 3THOA 4PC6A 1CQXA 1GNQA 2BMEA 4HDQB 5FOSA 3RS2A 4K8OA 2F3RA 1SHKA 2ZR0A 4P31A 1ZUHA 1FX0A 3JQPA 4TMTA 2VP0A 3LBIA 5B64A 4W5JA 3HYRA 4BLOA 2OAQ1 2J7PA 1I2DA 2QAGC 2VZLA 2I4IA 2W2XA 2GAOA 4A82A 1V43A 2VNIA 1OW3B 4A8JA 3UG7A 4WW0A 3FJOA 1VQOB 1KSJA 1OXSC 4B6EA 4EPTA 3SI7A 2QEXB 3EA0A 3LO5A 4MGIR 1P2SA 2P67A 2YWGA 5E7MA 1G1MA 2IS4A 4IVRA 3PEUA 4ACAA 2VHUA 1S3SA 1MT0A 2IEZA 1KKMA 3WY9A 3LQQA 4JLVA 3U7EB 2W00A 2REXB 4FK8A 1MO3A 3CBQA 4YC7A 4WOPA 1VYUA 1D8TA 3QFCA 3MRSA 3LA6A 2WJYA 1S1MA 3RWMB 1QHIA 2IA5A 4W5WA 1EESA 3R9WA 4OK6A 2ZI6A 3K0CC 1JB1A 3GLIA 1S8FA 4ZGNB 2QMUA 1KAGA 1NVXQ 3GPLA 3V4FA 5FH9A 2BMWA 1YI2B 4NU0A 4A0RA 1W46A 2BBTA 3L0IB 2AKYA 4HAXA 1XEXB 1FL9A 1FOEB 1E2FA 2YV5A 2DWOA 3ND8A 2DFKB 3B85A 4Y0AA 3A1TA 4BFXA 1J90A 2PBRA 3QUSA 4CEJB 1FNDA 1Q3HA 2KSQA 1KI1A 4CEHA 3GLFA 3RRZA 3PR1A 2DYKA 2CHGA 3EC1A 1NL3A 2WM9B 2ZYUX 4DJTA 4TYQA 3LAWA 4AKIA 5SZJA 2XEXA 3AP2A 1NDHA 3NBXX 3K70C 3E2IA 1ELOA 4YAWA 4KBGA 1KY3A 3K70D 2XB4A 3FMPB 2GNOA 1IN6A 3VMFA 2H16A 3C4JA 4GSYA 3MD0A 2JEOA 1YIJB 4B43A 3M4YA 1NVWQ 2AWNA 3GJXC 1DVRA 4HZIA 3BE4A 5KHOC 1M34E 1CR2A 3RS3A 3T1QA 1TL7C 4A2WA 3AVXA 1QF9A 3QKSB 1J8YF 1VQ4B 3AF4A 3VFDA 2VHJA 2W6IA 3RAPR 1EGAA 1VCNA 4JKYA 3FVQA 2IYTA 3TSZA 2GRJA 1GSIA 1CLUA 2FE4A 2IYWA 3H4MA 1GRQA 2H7VA 4ILEA 3QKRA 1LF0A 1EP2B 4IXMA 2ZS9A 4NCHA 3K0AA 4TSFA 2OFXA 1DO2A 4LUCA 2D7DA 3DM9B 3OE7D 2R62A 3AF1A 1F2TB 3T5GA 5KSOA 3PUWA 4L5BA 5A5GA 2L0XA 5EMNA 4GMDA 5CJPA 1GFIA 3BD9A 2F1JA 4NZYA 5TR9A 1EFRA 1YZGA 3V4RA 1KK1A 1UFQA 3CW2A 2ASEA 4FWTA 1IHUA 1Q20A 2OZEA 2Z43A 3NC1C 4KBFA 3O8RA 4KYIB 4LHXA 4TYWA 3A1SA 3N2IA 3REGA 3BFKA 1RRFA 4OQFA 2VH5R 4AWXA 4DQKA 3RS0A 1OH5A 2CRVA 5AUQA 5K8TA 3SDZA 2OESA 4BZQA 4DLWA 2HXSA 3DVLA 4Q21A 1SHZA 3QJYA 4U9UA 4I81A 3G0HA 1N6KA 2XAUA 4BLTA 1XX6A 3IUYA 2IT1A 3LXRA 4RFSB 3X1YA 2YVUA 2X8AA 1X8LA 2OTJB 4RD6A 1QG4A 1VIAA 2A78A 1D2MA 3HJNA 3R7WB 3QKSA 3LVBA 1HQCA 2PJZA 5LD2B 2ZSEA 4WXPA 4YMSA 1ONBA 1FMLA 2YZ2A 5GV8A 1YVDA 3OEED 3ZIAA 1X6VA 1Z0FA 4PC7A 5JRZA 2FEOA 3P27A 3QBTA 3LFUA 2CE2X 2AKAB 1KI9A 5F3WB 2J45A 3TAHA 1N5LA 1P3JA 1U99A 1RW4A 3G82C 3TIFA 4ZCIA 2Q3MA 5EXSA 3TGPA 3BB3A 1E64A 2O8BA 1WBBA 1R5NA 1E1RD 3QY0A 1R10A 5AJYA 2QTLA 3D6TB 3GLFB 2IF0A 2WJJA 3TH5A 2CL6X 1Z06A 1XXHA 2GVDC 2ZUDA 4JLOA 2CCJA 3GFOA 4KHZA 1YZQA 4MRNA 1S2MA 2JAQA 2P6NA 2VQSA 3RVBA 4GI7A 2XTZA 4KYUA 4R71A 5KU1A 4MDEA 4Q47A 3ND9A 4YMWA 2XOKD 4IFBA 1E96A 5J4KA 1UEJA 2ZUCA 3L8ZA 1GRRA 4LV6A 5HXBA 2OBMA 2WVJA 2FU5C 3AF0A 4K46A 1XZQA 2FSFA 1LY1A 4NDZA 2W58A 2H1LA 4M1WA 3SR0A 1X8KA 4URWR 3T35A 1N8RD 1XEWX 5F9HA 5JSZB 3LVRE 2G9NA 4V0NA 1EP1B 3B1ZA 5LB4A 1E9FA 4IEEA 4PFSA 5FOVA 2HLDD 5P21A 5EE0A 1P61B 1NG9A 2FA9A 1N6PA 3TMKA 2F9LA 5B57C 1KNXA 3K9GA 4AK9A 3IIJA 4X8OA 3SNHA 4GRAA 1II8B 1KI8A 4ASUA 1KTVA 3K8YA 2EFEB 1KYIA 5TVKA 3U7HB 1E1QA 4UXHA 5K8LA 1FQJA 1FW6A 1MR3F 3AF3A 2RGBA 1RVDA 1UDXA 4RFVA 4Z8XA 3BFVA 3NBYC 2QUZA 1BO6A 4CT4B 4D0NA 1SKYE 1UKYA 4XOIA 3LY5A 1E1QD 4AG6A 3IQXA 2FEMA 2QNRA 1AZTA 2FG5A 5KNCA 3WXMA 3NXSA 3ZH9B 1NKTA 4LRWA 4URYR 2IHBA 5EP1A 3W6NA 4KAXA 1FUKA 2GBLA 2EFGA 1K5DA 1NI3A 2ZRIA 2BOVA 3L0SA 2YWEA 5IDVA 4MYUA 1GILA 4JT4A 4GP6A 1UPTA 1QFJA 3BBPA 3CX7A 1N0UA 1TF7A 4XJXA 5J47A 4A4DA 5FL7D 2WOJA 1GP2A 5EXPA 4F92B 4AYXA 1TU3A 2IBMA 1JQLB 4Q9LA 5BXQC 2FX3A 1S1CA 2YYZA 5EP3A 4UNSA 1JI0A 5AR1A 3QE2A 4LV5B 2HMAA 1H8EA 5IT5A 2XGJA 5JWHA 1JNYA 1UKEA 2QENA 4DLZA 2WAXA 2X2FA 4OI1A 1JJVA 4I1SA 4CGZA 4CVNA 1QVRA 1OKKD 1ZNZA 2I1QA 4E03A 3OAAA 4YHBA 3EZFA 1FUUA 4MRRA 3TAUA 3MHPA 4XWOA 1KI7A 2WKQA 1BMFA 2ZI4A 5JHGB 1IB0A 1W4BA 4PZZA 2AXPA 5FTNA 2ZSBA 3FKQA 2FPLA 5GADl 3LX5A 1WDTA 3CCSB 2ZE8A 4V02A 2ZRPA 2IYQA 2VF8A 2V1XA 3FHTA 3U3OA 1EG7A 1P6XA 4BFWA 4FCWA 1WE2A 4TQ9A 4P6VF 2VHQA 1N6IA 4Q9IA 4D4LA 4JT2A 3ZZ0A 4FCTA 5JS7A 3AV0B 1XMIA 2ORIA 4LBVA 1D5CA 2ZSDA 3I62A 3H86A 2IYZA 1Q7YD 1KMHB 1LVGA 1Z8FA 2CLSA 2WMNB 1OIWA 2Z0MA 3TW4A 3CIOA 1ZCBA 1B0UA 4RKFA 4YDSA 4DIEA 2FSGA 4ACBA 5FI1B 2D7CA 2PIAA 1MABB 4JS0A 2P2LA 1P2VA 1OT3A 4MA4A 3CO5A 4UNQA 4LJAA 2A5FA 4YXWD 1NP6A 2CJWA 4KSBA 2DEUA 2BMFA 3SJBA 3U6BA 2VHCA 4CDGA 4NE2A 4FMCB 2FZLA 2PT5A 2EQBA 2XNJA 1KMHA 3BIFA 2Q9BA 3EASA 2ZRDA 5FPHA 1YJWB 1YITB 3NTUA 4EPXA 5CDFE 3O47A 4AY2A 4HE5A 2IX3A 3UMRA 2AHOA 2ODBA 4NCKA 1DE0A 4IKEA 1H8HA 1M90D 3BK7A 2AN9A 4XWKA 1UAAA 3CRMA 1G8GA 3KJGA 4D4KA 5DN6A 3RRMA 5KDDA 2QT1A 2IC5A 2JIZD 4F38A 1LTQA 4PO9A 1JR3D 1BJKA 4L16A 4M9QA 2ZS7A 4JIMA 4HLQB 3N2EA 3GEHA 1DAGA 4JVSB 3W8NA 1HA3A 3SQXA 2DY1A 4B4DA 1G291 2F43B 2D62A 4DC9A 2C9YA 2QE7A 3QKRB 2D06A 2JJ1A 2AD1A 5HCIA 5EJEA 1SVMA 1TPZA 3TBKA 1W2GA 4MGZR 1UJ2A 2CNWA 4HE6A 4AF7A 4JBWA 1P2UA 2VNKA 1I2MA 4C0SA 3N70A 3NEYA 4TT3D 5AJVB 5J40A 1AGRA 1E9RA 1KNQA 2NTYC 4M22A 2QBYB 3W5IA 1I4DD 1ZU4A 4BLRA 1O3YA 3JZAA 2GK7A 5FUXA 3ZVLA 2WICA 4EPYA 2F1IA 1M7GA 4JLMA 4Z54A 2IWHA 1WRBA 2QAGB 1KK2A 2AK3A 5KO2A 3U5ZB 1D9XA 1OF1A 2GHIA 5JLJA 4LJ9A 3CPHA 4DCTA 5HKKD 1G7RA 2HUPA 2JLXA 5HTKA 4GL2A 4DUGD 3FMFA 4JLAA 3B9PA 4LDJA 3BB1A 3SC3A 1G19A 3ZC3A 4DSTA 3LBHA 3FFBA 2QMHA 4PTLA 3UWKA 3VR5A 1J2JA 4R7ZA 5JCZA 1DAFA 5DH9A 2QORA 1WP9A 2Q3HA 3BC1A 1YRBA 1GWNA 4EDHA 4WA7A 2OE2A 4URVR 3I3SR 4FD2A 1EFHA 3QEJA 3QXXA 1KK0A 1T3SA 4DCVA 4HB2A 3KKPA 3CZPA 2ZRKA 4HZUB 1NMXA 3ZVRA 4NBSA 1KI4A 2P5TB 4F91B 4G01B 3KQHA 3IDQA 4L15A 2D3WA 2PZFA 2G6BA 4D6PA 4S2EA 3P32A 4YAOA 3AF2A 5SZIA 1EK0A 4DVGA 4HDCA 1RYFA 221PA 1HT2E 3BERA 4L9SA 3CPEA 2GEVA 1ZW6A 5JECA 3K09C 5AJWA 1RIFA 2QSYA 2VHTA 2EW1A 3CWZA 2A3RA 2HYDA 1OGIA 1HURA 5CLLA 1DG3A 1XBTA 3GP8A 4IW3B 3CD6B 1QUFA 3QKTA 3G71B 4KFUA 1IXSB 4Q4JA 2C98A 1G7SA 4NH0A 2CE7A 1FFHA 3KDSE 4PC3A 3MLEA 1HQYE 4US0R 5G41A 1FNMA 1A2BA 1QG2A 3W2EA 2XX3A 1ZD1A 2GEDA 2GJKA 3JZMA 3I5XA 2NMVA 4V03A 3QQ5A 4OKSA 1S96A 1ZNXA 2IYYA 3W34A 2G3YA 2ZE6A 2V7QD 3O8BA 3VHXA 4PSAA 5FPYA 4WQMA 1G5TA 2JLRA 5DI9A 4OJQA 3U7GA 4DT1A 4XD7D 1EFRD 3HYTA 2JATA 1OIXA 2RC5A 4TMZA 2OCYC 2FJUA 4C2UA 3B78A 1NG1A 5CM9C 1CJKC 2CMKA 2BPOA 3GFTA 2FF7A 2ERYA 2W83A 3FHCB 4Q19A 2IXGA 2J0QA 1W4AA 3PJRA 3W2IA 1SXJE 2IEYA 2EYUA 2RCNA 3SU8A 2J46A 2O8EB 1X1SA 5H70A 1Q0UA 5FTKA 3CRZA 1A82A 1D9ZA 2FGKA 5CIQA 3TJZA 1QDEA 1AIPA 2Q3FA 2QRNA 2GILA 4F93B 4RZUA 2GJ9A 1VQKB 1GDDA 1M6NA 3KTAB 4AIIA 3PENA 1S0UA 3K0SA 4PHHA 2X3UA 4KO8A 3EPHA 1P7CA 2FPKA 4FMDB 3TK1A 1T4GA 5EQTA 1Q1BA 1MO6A 5FTJA 3U6KA 1U81A 4BFUA 2ZU6A 1WA5A 1US8B 2EU8A 1QVAA 3KQLA 3ADDA 1W36C 1VHTA 1XEXA 1CKEA 3C5HA 1HE1C 1YZNA 2F43A 1VQ7B 4OL0A 4A6PA 3GLIB 4PQYA 3AGPA 2AR7A 1CJMA 2GZAA 4F4IA 1I4TD 3OZUA 1TQDA 1GO2A 4BLPA 1P9WA 2WHXA 4DKXA 3CNNA 1ZVQA 4B3DA 4ZI2A 4TZ0A 5FOUA 1TQ4A 5FBVB 2V4ZA 3V76A 1N5KA 3IKJA 4M0LA 2OG2A 5E95A 2NZJA 3KX2A 2V6JA 4CEIA 1QHHB 2PCJA 4I1UA 1QRAA 4MGKR 4HAUA 1YU9A 1SXJB 2NO7A 4R2HA 4TQAA 1ODFA 1RRPA 4PO8A 3K0EA 4QOSA 5FOWA 3AVVA 5DSZA 1GVHA 4QKQA 4AI6A 4C0QC 1OXXK 1IY2A 1ZNWA 3BB4A 1QHGA 4OQLA 5FFMA 3IIKA 4ZCLA 4NYMR 2RMKA 5CLQA 2RHDA 4F4JA 1GUAA 3HR8A 4TLDA 2XXAB 3KKOA 4QHTA 1F20A 3W5VA 3OW2B 1VCMA 5FPTA 2WWFA 1ZCAA 3NBFA 2QA5A 4OHWA 3OEHD 3AVYA 2Z4SA 1Z0KA 3WHKA 2RGNC 4MUAA 4D26A 2V55B 1N3BA 3RS7A 1U0LA 1T5LA 2ZI7A 3QFSA 2ZYVX 3UMSA 1COWD 4TLBA 3PG5A 5DE3A 3KJIA 1QHHA 3L0PA 4XVUA 1Q12A 3FE2A 1A8PA 4IJMA 1ZUIA 4M9XA 5KSPA 3THXB 3CCUB 2DHRA 4ASUD 4EFMA 4MH0R 4BGDA 2OLJA 1P5ZB 2J7PD 2BKUA 1RC8A 2O5VA 5FUYA 2PMKA 2ZE5A 2HXYA 4NCNA 4NONA 1ZC3A 1KO8A 1XFAA 2FSHA 2WWXA 4B73A 1NMYA 1DO0A 2WWWA 3AVTA 2HJVA 5FL7A 3CPJB 1E6CA 3RC3A 2BJWA 2ZXUA 1R0YA 1E94E 1W1WA 2XZLA 4WXRA 3H1TA 1VQ9B 1XU4A 1KO4A 1ZD8A 4HATA 1H85A 3F3YA 1I4LD 4C3ZA 3AKDA 3L43A 4XTCS 1M2OB 1KJZA 2BBOA 1W0JA 1XDBA 2IYRA 2VO1A 2ZRNA 4ZDWA 4BQSA 2VPPA 3IILA 1C4OA 4LJ4A 2R6HA 2GF0A 2HCJB 4AG5A 4CRWB 1XD9A 3DKPA 4C2TA 4URZR 2QPTA 4M1MA 2VIIA 5GVSA 4Q66C 3S1AA 2XNCA 1SGWA 4E09A 1Z6GA 3SN6A 4J0QA 3M1IA 4PR0A 3SBDA 2R6AA 1E62A 1X3SA 2ZJ5A 5C4MA 1X1RA 4G5SA 4UJ3A 1J70A 4KLNA 2ODEA 4TWZA 4GT1A 1VHLA 2C5LA 1EWRA 2QT0A 4BE7B 3B1YA 3Q9LA 2ZITA 5FUVA 2ERXA 3D31A 1UBEA 1G7CA 2IK8A 2QTVB 1GG2A 2R6FA 3THYB 1N6RA 5J4YA 2VF7A 2B21A 3WYFA 1G8PA 1Q1EA 1VMAA 2WWGA 3PV0A 5TB5A 3UXMA 4UNRA 2O8FB 1E9AA 5FOXA 5L3VA 4I4LA 1N6OA 3H0KA 1E63A 1E2EA 2EYQA 2IS2A 1XWIA 5GJWC 4Q00A 1TX4B 4LCBA 3X1DA 621PA 2E1RA 1IONA 2ZR7A 3CRQA 3WP1B 1GIAA 1GKYA 1IN8A 4FW9A 5TV2A 2E87A 2HEIA 2WIBA 2BBSA 1F3OA 4FN5A 4O2RA 3AH8A 3T06B 3O8CA 4QJ3A 4B44A 1EP3B 1VKJA 4LJ7A 3E70C 3MWKA 2W6JA 1JXMA 3JQQA 3T61A 3PCRB 4GOKA 4A2QA 1E2PA 2GQFA 1TF2A 3DZ8A 1HUQA 2EIXA 1NF3A 2IL1A 3TLXA 4TTQA 4KCGA 4D4MA 5LD2C 1T8TA 4QM7A 1Q81D 1LS1A 3DOEA 2CL7X 3EXAA 1DAHA 3LDAA 3T34A 1E9SA 2RGCA 3LLUA 3VU9B 2VNHA 3KZ1E 1ZM7A 4RKEA 4Q7KA 4R9UC 1NVVR 3OE7A 3LLMA 3Q5EA 3NH9A 5HZKA 2YC2C 2YHSA 1G8YA 1Z6XA 2MMGA 4JJKA 1NBMD 3PIRA 4P33A 5AN9A 3R7WA 3CH5A 1E2JA 2J1LA 4Q9KA 4LI0A 5AUPB 4DEXA 1J9ZA 3PEYA 1UADA 4A0HA 1BOFA 3PVSA 3D3QA 2GDJA 1T9HA 3AVPA 2JA1A 2PX0A 2Z4RA 2CLDX 2ZS8A 3C5CA 1S9HA 3OFND 4Q9JA 4HYYA 2QQEA 1G3RA 3MCAA 1LFDB 3AGQA 4TMWA 3CNOA 4FMCF 2HF9A 3I61A 1N0WA 2ZI9A 5EZ6B 4B2PA 5EZ5A 5HE9A 2ZVQX 1YQTA 4MQBA 4BLQA 3CR7A 2WBLC 1U90A 3EIQA 1K9MD 4HLCA 1NVVQ 4HB3A 1TEVA 1W5SA 4RSGA 2Z83A 2OTLB 4JLPA 3BJIC 1VDZA 1UM8A 2RC6A 5F2EA 2GJSA 1FRQA 4EPVA 3QPVA 2O8DA 5BN3A 4HLDA 3L8YA 1NY6A 3THYA 3BH7A 1YR8A 2FOLA 5DHAA 4QJ5A 4ARZA 4LHWA 1KKLA 5FR1A 4JJZA 1KC8D 2QAJA 5EUQB 2P6UA 1G16A 1E0SA 1G3IA 5TXGA 5TY0A 4BECA 1P9RA 4N0DA 3FOZA 2J7KA 4XIGS 3U60B 3E5HA 2J9RA 4ZGQB 3K0FA 4XSGA 2KWIA 1KO7A 5E7IA 1GAQA 1PJRA 2WV9A 4A8JC 2JLUA 2G77B 3EIHA 1L8QA 1YKSA 4C0AC 4EJSB 4PGOA 1LW7A 3OIUA 2PX3A 1CRPA 1PUJA 5JMTA 1KI6B 3TQFA 3MAAC 3ZZUA 3CXCB 4PPFA 1FNBA 4X8HA 1E2IA 1X86B 3VTKA 4G5OA 4KFSA 2A5GA 3CNLA 1Z29A 2QROA 3CCQB 3GJ6A 1KMQA 4JBYA 3DL0A 1TF5A 1QHXA 3AKYA 2VNJA 4GPTA 1OHHD 2ZE7A 1YR7A 2OLKA 5BYJA 2XZPA 4KU4A 1DOAA 4LYFA 3RS4A 1OPXA 2OFOA 1VQNB 4MRVA 4PPGA 1VG8A 1T3LA 3KUCA 1E2QA 1YHNA 2N1BA 3PXGA 4DDTA 4Q1AA 1AMOA 1SZPA 4B71A 4A6XA 2X2EA 1RRCA 1E9BA 4YALA 2R2AA 2JDIA 2GPJA 1Q1ZA 3MJHA 1G3UA 3SBEA 4ZO4A 1NNEA 3QXSA 4IOKA 4Q7MB 1A7JA 1FZQA 3UK6A 2C9OA 2V6IA 2ZR9A 5L3QB 4C43A 2V54A 3EW9A 3FGNA 1IAQA 1SXJA 4LOAA 4HUQA 4W9MC 4B75A 2B8WA 4G1BA 3OZXA 1Q57A 2YJTD 2QP3A 4L9WA 3K1JA 1XD2B 1TUIA 4IDQA 3CCLB 4PHGA 1W49A 4JVMA 4A9AA 3CB4A 2ZROA 2ZRJA 1NKSA 3WNBA 4AD8A 1S9DA 3EPJA 4CYMA 3OZWA 3MFYA 2NQ2C 1NLZA 1ZNYA 2ZTSA 1RJ9B 1VPLA 3CRVA 1JB9A 2GJAA 3ZLJA 1R4AA 3C7KA 5FA6A 4QHYA 1E4YA 4Q4AA 1D6JA 2ORWA 2BMJA 2CHVA 1VYVA 2I3BA 5FBRB 4DSOA 2J0SA 5DHFA 3WP0A 1Z83A 3C15C 1XPOA 4D4JA 2G88A 4RJLA 1VCIA 1YHQB 4B47A 5D3MA 3I72A 4Q01A 2ZM5A 2J0UB 2WKRA 5CDFA 3J81k 3BRWD 5DYGA 421PA 2W2VA 3B7GA 4Q4HB 5CJ2A 1ZM9A 5C1BA 1M7BA 1WQ1R 2BKEA 2CCKA 3GLFE 3CC4B 3EZ2A 2IHYA 4Z1MA 5A4JA 1B23P 3ZVMA 1KQSB 1N25A 1XD2A 5JSZA 3R9XA 1AN0A 4LY6A 4TYNA 3QPWA 3ASZA 4B48A 1UDWA 4DIDA 5BN4A 3OEEA 3T5DA 2BM0A 1AKYA 1GKUB 4JKIA 4BEBA 3GLIE 2WSMA 3ZGXA 1CEEA 1SQ5A 3WNCA 1UBFA 2GF9A 2JLYA 1EFCA 1E2NA 2QA4B 3M0EA 4G0NA 1AJEA 3KJHA 4EUNA 3QSYA 3KKNA 1KD1D 3RSLA 3W3ZB 1E0AA 4LHYA 3CRRA 4PSKA 2I1VB 4NYMQ 1IBRA 4LJ5A 5FUWA 1CJVC 3UANA 3ZD6A 5L3QA 5KPDA 2DETA 1JEEA 2VP6A 3AQ4A 5GJBA 3OZVA 4GNKA 3GJ0A 4EIWA 1E79D 3W5UA 4LHVA 2IYLD 3GD7A 5JWRA 4HLUA 3DDCA 3I5YA 1WCV1 1R8QA 3FDIA 4G3XA 1E0KA 3JVVA 4LPKA 5KDOA 4PO1A 3GEIA 1CP2A 4U5XA 5F9FA 3LO8A 2XJ9A 4LV8B 2GAAA 3SQWA 1MV5A 1W0KD 5GV7A 4AF6A 1KSFX 2RHMA 5BWMA 4M53A 2CDNA 1AQYA 4C7OB 1KI6A 5EP2A 4AYWA 4Q4JB 2LWIA 3RRNA 3BXZA 4V0OA 1Q3TA 1PLJA 2IS6A 4P3YA 2F9MA 1EWQA 1VQ6B 1LF5A 3JQRA 1D2NA 3DM5A 1QX4A 2HLDA 1Q86D 3A37A 3K70B 3IIMA 1II0A 2O8FA 4A15A 1G41A 2RKOA 2ZI5A 2Q21A 3IBYA 2OM2A 4P4UA 3GEEA 3ECCA 3GLGE 2A5JA 4LWZA 1S3GA 3P26A 2H57A 3QF7A 3CX8A 4I1OA 4UXIA 1XPUA 4C0HA 3LW7A 2W6JD 3CCVB 1Z6YA 1KHTA 1AQUA 4P4SA 4B6FA 3NG1A 1C1YA 4M1TA 4D0LB 1E3MA 2YKGA 4KV9A 3AP1A 1EFTA 1KZGB 1AGPA 2FN4A 4MYTA 2VEDA 2IS1A 2EWVA 1N0VC 4AKGA 1NIPA 4PHFA 1Z2CA 3T12A 2FFAA 2C95A 1XTJA 3KKQA 5KUTA 1E2MA 1F2UB 2CNWD 2QRZA 3KTAA 5AWFC 1XPRA 1DDGA 2OBLA 3MG9A 3OIVA 3NHAA 5JI3E 4Q02A 1PLKA 2UZ3A 3I4LA 4QRHA 1R0WA 2QSZA 1OV4A 2O8EA 1SM4A 1WB9A 1M1YE 1CRQA 4D0GA 5G3YA 4XSHA 1T6NA 4FI3C 1U9IA 1OFIA 3ICEA 2QTFA 1E0JA 1UKZA 4M2LA 4JL6A 4KXFB 4JL8A 4WIAA 2VP9A 2YOFA 1ZD9A 3FHOA 5H1YA 4TTRA 2Q9AA 1Z47A 1G6HA 4V0MA 2LKDA 4IXNA 5AUNB 4RD2A 4HB4A 3K0AB 1SVIA 1Z0AA 3QPUA 4QGAA 2H5EA 2O0JA 2X77A 3FKSD 2B6HA 2B5OA 4HLUC 5DGXA 3U3KA 3WNDA 5KNBA 1F48A 4LC0A 1NLYA 2A2ZA 2J5XA 3HPRA 4TLEA 2WIAA 4DLUA 1W0JD 1NJGA 4US1R 1DS6A 4PQRA 1HEIA 2BHRA 2O0KA 2NGRA 5A0FA 2EFCB 1CS4C 1XCMA 3BH6A 1ZM3A 2LCFA 2BM1A 4HAVA 5JI2E 4O2LA 4WAUA 4B32A 3LV8A 2BSAA 5F98A 1P73A 2HT1A 3ASYA 1ZBDA 1EX7A 2NZ8A 5H68A 4K1XA 4I99A 3ES9A 4XVQA 1HY3A 3X1WA 5HPYB 1KDOA 1NLFA 3HWSA 4JLKA 1W5TA 4XH9B 2VRWA 1CULC 3VR3A 4BPRA 4B76A 2J59A 4GFDA 4Q5IA 4DLYA 3EZ7A 3T1VA 3U61B 3RABA 1EX6A 1G6OA 1LV7A 1MO4A 1G4UR 4K81B 4TYPA 4Q1DA 4LHZA 2IYUA 3OAAD 2GXAA 4YONB 1E2DA 4ZCMA 1Z08A 2BGJA 1H65A 1TU4A 3BFXA 3MUFA 4ON9A 1NJFA 1Z28A 2AK2A 1KIMA 2V7QA 3RNLA 1OYYA 4JBXA 2GA8A 4B33A 4Q03A 4D81A 5J4HA 5JS8A 4NYJQ 4EQ6A 1Z6TA 3G5UA 3Q8XB 3ETLA 1MRNA 4KITB 1JJ2B 3NIBA 4BFVA 3BWDD 4V0LA 1TTTA 3GQBA 1LNZA 3A36A 3GLHB 5K8UA 4L8GA 1ESMA 1TMKA 2B8TA 4HSEA 2GXUA 2WSSD 3NDPA 2R6GA 5L3RA 5LDDC 4RD0A 1OLOA 4M9SA 5G3ZA 4CW7A 1T0JB 3DZDA 4RD4A 3QF4A 2ZPTX 4OQNA 5HCNA 1FP6A 4ESHA 5HZHA 2MSCB 4TSFD 2WMOB 1NVUQ 5FPKA 4XWAA 3BS4A 2XITA 1C9KA 3WRXC 2W6ID 2ZUBA 3A1VA 1Q82D 4E07A
chains in the Genus database with same CATH superfamily
1XCPA 2NVOA 1FXWF 1JVNA 3A6LA 4WCDA 1WMBA 4UQPA 2THFB 1ZSYA 3ZEIA 1EFAA 3ZE0B 1CJTC 2QF4A 1N4DA 1QYVA 2VJJA 5E7JA 1LC3A 2ZZQA 4BX9A 3LU9B 4GWLA 3GZTB 3AESB 3L7AA 4TM7A 4UDNA 2D3LA 4Z9BA 5D3MB 3HJGA 3GCHC 3NIFB 2JJ2D 3TVJB 4RSHA 3RVQA 5C31A 3FOBA 4PGMA 3QBVA 1E0FD 1B8NA 3DO6A 5ARBA 2Q28A 3RY8A 3ILSA 1MU0A 1Z34A 3RVKA 1IJBA 3C41J 5EUMA 3SC6A 1BA8B 3SJAA 3BSWA 1GLGA 4DG8A 3D1JA 2OO5A 4P6YA 1QIFA 3B3GA 3A6GA 3LNNA 1U0RA 1ZK0A 1E77A 3RS5A 2BW0A 3PT9A 3RYIB 5E38A 1NXVA 3F0OA 2JK1A 3ZVFA 1RTTA 3D49H 3BG4B 2ODYB 3DOHA 4MPTA 2CBZA 4QO7A 4PBTA 1TEXA 1D4PB 1LPKB 5JNUA 1X3LA 5I01A 1A5TA 4CMJA 3ELWA 3FPJA 3GRFA 3D02A 1PT5A 3E9QA 4RVOA 4PWZA 5DTJA 2B69A 2Q4EA 4NBNA 2JVKA 1JJFA 4ETIA 2UYQA 1Y6GA 1Q31A 3EGXA 4E13A 3SN8A 4ESTE 3E7DA 3R23A 4NHEA 1P19A 3GOVB 1H6BA 2C9DA 3HNPA 4HTFA 1NFXA 1JWAB 1M8PA 4P5EA 1OTYA 5CA0B 4LPSA 4WY5A 3VNVA 3JYPA 3I2KA 4XA8A 2V9CA 1R5BA 2EG9A 4FGUA 4RX1A 1KWGA 3HCCA 1Z5OA 1E9VA 4OPOA 5A6VA 2E55A 1FPMA 1V47A 1OJLA 4AG2A 3ICVA 1XAGA 1TFUA 4ZK6A 1PJCA 5GNDA 2Q99A 4JZIA 3C6ZA 3O4FA 1XAHA 3AUKA 1L1JA 2XBUA 9ATCA 3ZW9A 1RJ9A 3RYHB 4DZRA 3E4DA 4CMHA 4TL9A 2Z8YM 3DKIA 1KY2A 4M8IA 4OV6B 1AGNA 3AC0A 2VDQB 1ZVJA 7GCHF 4D9FA 1FTSA 5BMVB 3HXTA 3BMXA 2CHQA 4JFAA 1B1CA 1PPFE 3OFSA 5ALSA 3HFRA 1EZSC 4GKKB 1CQJB 4YNBA 1FVXA 2Z6QA 1HLGA 1X87A 3G8DA 3HKIB 2J98A 1DG1G 1B6SA 2CNDA 3CISA 1HDXA 4I08A 4C0LA 3EG5A 3L6BA 2WG2A 2WWIA 4JU8A 1BHQ1 4MTBA 1XZPA 5JU6A 4BAQB 3N0VA 2X8LA 2YXPX 1Q2UA 3UA4A 2OINA 3LHDA 3N6VA 5L7WA 3NPSA 4WT7A 1SWWA 2X22A 5AI6A 3NB0A 3AM5A 4IINA 3ZH2A 5KVQA 1KOGA 4XEHA 5JTUA 2A0UA 3GLGB 1C4KA 5EKTA 5ECYA 4QBHA 3FCAA 3TL3A 4PG8A 2WTUA 1QGDA 1FFEA 2FX4A 2WD8A 1A7UA 3AY3A 4TTIA 3LPRA 4LQ4A 3DQZA 3DO5A 3CUVA 4GEKA 1GI4A 2GN9A 2OT3B 4PLFA 1ORTA 1V95A 1A8HA 1K1MA 4B3FX 2WAAA 1IHXA 3ESQA 4C4OA 2QLLA 2W3IA 2QL9A 4JSTA 3AXSA 3ZZDA 1QVGB 1QRTA 4ZJZA 1C3OA 4G4SP 5AM2A 1PVOA 1BWPA 2CT8A 2R6ZA 3ZDEA 3IV7A 3G2OA 3P2EA 4RGBA 3WRYC 5E2IA 5H59A 3PDJA 1UEIA 4TGLA 3PBKA 4IMQA 3LUFA 4BFSA 1LS6A 4ZXYH 2NX2A 2WU4A 2ZRGA 5CCDA 2Y2VA 4D9HA 3QV2A 4XKJA 2E85A 1AU9A 4DCDA 4CKCB 1G18A 2QBYA 1EAXA 1WTAA 2FX6A 2D1SA 1UZUA 3NYRA 3TGLA 1UXIA 4E21A 2YMMA 2BDYA 1RKVA 3UMJA 1M72A 2BX3A 1XTSA 1A5HA 1YJXA 4IVPA 3MVEA 1OZ0A 2F83A 1WXHA 2W2TA 3BEOA 2ZXHA 4IUYA 3THXA 2FP3A 1JRTA 2P3SA 3LSYA 3MT9A 4DCPA 4PRZA 3GCXA 5CIWA 5DT2A 3LIPA 3CLUD 3OQIA 2FFBA 3KWLA 1TB4A 1W7AA 2BIFA 3EIWA 2QHXA 4GHWA 4YT6H 5CVCA 1CIPA 4WZAA 2DAPA 1KGDA 2FLBH 3OO1A 1WOYA 4KL8S 1AKVA 3ZGYA 1AOXA 2YXBA 4C9BA 4NWLA 2WUFA 3N74A 3W6PA 1XZJA 1GZSA 2JCYA 1PPHE 3NRBA 4GBMA 2BTCE 3LS2A 1ZJJA 2QB5A 3F7TA 1SOUA 1A1SA 3L8MA 2Q3CA 2MSEB 4EPRA 5DP3A 2ONZA 2YRFA 2EBUA 2FPPA 2BD3A 2ALVA 3U3RA 3EZNA 1X0XA 1T8NA 2O57A 1E3IA 2ZCUA 3ORRA 4IYRA 4ND2A 5HQTA 4AGKA 5IAJA 3ENWA 2VK8A 3HMKA 4W7SA 1V4NA 3M5CA 1CGHA 2OK7A 3SXPA 1C5LH 2CLFB 5GXPA 4S1PA 3ZHTA 1K0FA 3L4BC 5ENVA 4H9GA 3T52A 3ZZ8A 4YUVA 5DGIA 2WJAA 4DDMA 1E1RA 3PLRA 1Q7EA 1Y0BA 4I32A 2CLLB 4PRLA 2IDMA 2Z94A 4Y8XA 4W5QA 1WWKA 3CR8A 1EVYA 3E35A 1DAEA 1ACLA 3WHLA 2I6TA 4MIYA 3NKVA 3LBNA 1CR4A 1NE2A 2VJMB 1RRVA 3DOFA 4FUEA 3DQQA 1P06A 1HYQA 1YACA 1V11B 1ANCA 3IULA 4LBZA 3AI7A 5TQ0A 3D1VA 1KEEB 1T0HB 3P4XA 4Z4RA 1PQWA 1HE5A 2H92A 4UQOA 3VKGA 2OYRA 1G5FA 1KO1A 5D86A 3V3TA 1GZDA 2CXNA 3JPWA 3NWPA 4RPLA 5EU8A 3VI3B 2MCFA 1MHPA 1IXYA 4MP6A 4RF3A 2QR3A 2RH4A 2CBXA 2ISQA 3RPEA 1TRKA 5GM2A 4BWGA 2O14A 2OQRA 4I3HA 4YRDA 4R5HA 1AGYA 2XB8A 5TQ0B 4JVLA 2KCAA 2FZWA 4R2IA 2ONYA 1H0HA 2HQOA 1BTOA 3SHCH 1P4SA 1UBTS 4Y1RA 4UTVA 4QGHA 1TVCA 4AWBA 1QG0A 2D1FA 3L46A 2HWKA 4QXPA 1OFUX 2Z2KA 4ETMA 3GJTA 1VA5A 1KI3A 3LY8A 4H6VA 4HK4A 3PUXA 1ORRA 3HM2A 1OU0A 1P18A 4I6EA 1TIBA 3ZHXA 1HZJA 1GGKA 2ZULA 2X13A 3FETA 4KOEC 3NKFA 1XRQA 2VNTA 3FVRA 4Z99A 3IAXA 1IUOA 2XQKA 2QG4A 5FWYB 1K1LA 5AESA 3B1KA 2PH7A 3MD9A 2HVYB 5CHYA 2D0OB 4Y0ZE 1SB8A 1QV6A 4RENA 1M1NA 3T41A 4R8KA 1P0MA 3ZQUA 1M0EA 3E0PB 4FMDF 3OKPA 1G6Q1 1YNSA 3TVDA 3EIFA 3IURA 4WE3A 1DBSA 4KVGA 3LDUA 2CGAA 4AFSA 1G2LA 5FOSA 2AGVA 4X41A 1ZXXA 2LZJA 2GM9A 2W2XA 4A82A 2H1FA 3P9CA 3FJOA 1OXSC 1R0RE 1VLYA 2ZSHA 3O8OA 2W00A 4GMGA 4FK8A 3H65A 1EESA 1P2KA 4X5OA 3TJOA 4PZCA 1ODIA 3RTBA 2QTAA 1S6YA 4ZOLF 1Q3HA 2ADFA 4ALKA 3ESDA 1DSUA 4QVGA 2ZYUX 5IMBA 2VZ0A 2HRCA 1NDHA 2Y4OA 2AG0A 4N82A 5ARDA 4LQDA 3E6PH 4IWXA 2GCEA 2EJVA 4GYYA 1DX9A 4HZIA 1ZI6A 2K7FA 3HNOA 1F0TA 3Q8MA 2X58A 3QKRA 4DA9A 3K0AA 2OFXA 3DM9B 1F2TB 8GPBA 4ODIA 3VC3A 3ZHZA 2DTEA 4KBFA 1HOXA 4N49A 1RS0A 4LHXA 1DGQA 1DKMA 2H1UA 1TYBE 3WQSB 2OESA 2VJIA 3TW0A 2P4EA 2FYTA 1V2HE 3N1UA 5HRCA 1TC1A 4YT7H 4WXPA 4G0QA 1U11A 4QOFA 1I10A 4AS2A 1JYEA 4WFKA 1V3UA 3O8LA 3G82C 2Q3MA 3KETA 2AF4C 2IYEA 3B8JA 1NX9A 4ARVA 1S2MA 2HMYB 3ZIUA 3F3BA 2ZI2H 1VXRA 3GAMA 2H1WA 2FU5C 1GAXA 3DUWA 5B7NA 3NWUA 1EA7A 5EHGA 1KMMA 2FW6A 4V0NA 1N6XA 5TC4A 5EOVA 2FA9A 3NM5A 4K2YA 2XUDA 1CRLA 1FQJA 1K7XB 1Z68A 2AEMA 4CT4B 4PCLA 4MRMA 4D9KA 4WERA 4JUFA 1P4JA 3TQOA 3HATH 4L07A 4RHUA 1BCRB 2PV7A 3DD2H 4IQ0A 1UMBB 5K4HA 1S1CA 2Y6UA 2BQ7B 4F2GA 3MCTA 3A9CA 1V6DA 4P12A 1QVRA 3RMLH 3GGPA 4WKPA 1KERA 3DBRA 3TAUA 1EPTB 4AG1A 4HG6A 3T3IA 3CCSB 2ZRPA 4YRPA 3D64A 2W6NA 5DNVA 4YMLA 2ZDHA 4D4LA 3E7PA 4FCTA 4K7JA 3F46A 3TSAA 3DE4X 3R1IA 2J94A 4POOA 3PXEA 2ZK7A 2M1ZA 2PIAA 1Z17A 2OGSA 5WRFA 5C51B 1SZJG 1Z8NA 3DWIA 2BFDA 1BA2A 1I6KA 2YMPA 2FZLA 2XNJA 5LQRA 3BF6H 5JZBA 4IUDS 1VJSA 4IZHA 1H9BA 2ODBA 5C7LO 2AN9A 2Z8XA 5KDDA 2RHCA 3LGAA 1LTQA 4BDSA 3QZQA 1J42A 4P1ZA 4AZ0A 3DZGA 3BULA 1EX1A 4UM9D 4QBKA 3GNQA 2R00A 5JE8A 2I8LA 2I6UA 1U2DA 2R11A 1XO1A 4JBWA 5AJVB 2DQKA 3GA5A 3DR3A 4J0GA 4OAPA 4JBNA 4RTQA 3CZRA 4DCTA 1YL5A 1BXGA 1QH1B 3ZY3A 2ZT8A 1RU3A 3OP1A 3LBHA 2QMHA 1Z5PA 2P2CA 4IO0A 3S44A 1SGQE 3FB1A 2BDBA 1ZGAA 4E94A 2RCYA 3TTUA 4DCVA 3U4AA 4I50A 3BJZA 4DRXB 4F91B 2UYOA 2ZIEA 3G89A 221PA 3QQPA 4FYWA 3LT3A 4TV8B 2EW1A 4PBSA 2FLWA 2PSXA 3FROA 4XE5A 2AGIX 4XJTA 3RASA 4P2NA 1LXCA 1ISPA 3JZMA 4DDHA 3BMNA 4G5FA 1WUHS 1S96A 1ZNXA 2IYYA 5FPYA 2JLRA 4OJQA 4DT1A 2I91A 3HYTA 5I4BA 4QTYA 1X14A 2PUQH 1KEPA 3IX7A 2ERYA 4HGQA 3N86A 3TL6A 2CF9H 4IICA 3ZDAA 4TQGA 3FZYA 5B1DA 2BI8A 4DY6A 5JCOA 4Z4QA 3ZQKA 1BDAA 2EU8A 1YD7A 1VHTA 3RYFA 3SI4H 1C3XA 4N5DA 1G0OA 4DKXA 1P9WA 4ZCTA 5K3DA 2NTVA 4B3DA 1VCHA 2YUIA 1VKYA 2ZWIA 4J0IA 5HP4A 3WDMA 3O75A 3QVXA 1KYXA 1JHYA 1ZGHA 4QKQA 3RRBA 4BNKA 1P12E 3IIKA 2BMVA 4AMVA 3OPQA 1RQPA 1ENPA 3RJMA 2XQGA 4D26A 2ZP1A 3ODDA 1OWOA 2Y1FA 2JHGA 3LOUA 4K5QA 3PLBA 4ASUD 1VBMA 1EA5A 3GOHA 1RWBA 1RC8A 4O5AA 4EHLA 4A0QA 1QBGA 1HEYA 4TYMA 4UEWA 3ZY4A 2HKIA 1PR0A 3WIVA 2DM6A 4B7AA 3SIRA 4IQGA 1S85A 1J1UA 3SHAH 3ET4A 3WICA 4MLZA 1U7OA 3GBVA 4HGRA 4BP9A 1I7SB 4OGYA 2D8WA 1WSDA 1TVEA 2JGAA 3DD1A 3PMHB 1X1RA 4TWZA 3TFQA 1ABFA 4NIMA 4ZHQB 2XOXA 3GQVA 1Q11A 5D85A 3OTGA 2OVFA 4JZYA 3W4JA 2WWGA 5FOXA 1N6OA 4TTTS 4DCGA 2YIJA 3OJFA 4GICA 4RQUA 1GKYA 2V5VA 2WIBA 1GJ5H 3AH8A 1X80B 3VB6A 1YJAA 1VKJA 4BTLA 4A2QA 4R1MA 4IGEA 3NOXA 1VL8A 4WKOA 1U0SY 4YA6A 6ESTA 1QHEA 1WEHA 1NLMA 3Q4GA 4JB8A 1QCCA 1GHTA 2X5NA 4LISA 4WGFA 1M6EX 4NEGA 3WY8A 3P0EA 3AGQA 3I61A 2OBBA 4DLPA 2H2WA 4EUSA 1V2ST 1Z1IA 2HRDA 2ZVQX 2EQAA 2IQ5A 5AVRA 1V2UT 4JLPA 5BNZA 1X1AA 3L8YA 4MQLA 3NIGB 3HVKA 2GOYA 4QJ5A 4ARZA 4JJZA 5T6FA 1G3IA 2ZJ6A 1P9RA 4N0DA 1O3IA 3SAJA 4LOLA 1IIRA 3H2JA 4JI5B 1XQVA 3KSUA 4FJ1A 3GYMA 1N32B 4J1QA 4WLVA 4G5OA 3EEYA 1SR8A 2QROA 3OQHA 1D3QB 3BC9A 1KMQA 4ISCA 4FS3A 4JBYA 2OWEA 3AM3A 4YWJA 3ROQA 3ZGVA 4QUZA 2N1BA 1H5NA 4QREA 4JEIA 3E9EA 2VYCA 2DT5A 3P92A 5CT8A 5I7HA 4XGRA 3K1JA 4ISIH 3DEHA 1JWBB 2B8JA 4JVMA 4U4AA 2AN3A 5KTRA 5CLFA 3G8YA 1DJMA 4WACA 2J9XB 3H5LA 3MI4A 1T32A 3L5KA 5BN3B 1EVEA 4DR1B 4PX2A 4BP3A 2FFRA 4UHBA 3B7PA 5CXUA 2WE8A 1ZM9A 2IHYA 1J14A 3KTFA 3IAHA 4IHAA 4M76B 4O4LF 2YXDA 2QN9A 2AFIA 5J2TB 3OEEA 3D8UA 1WPCA 5L6LB 2Q2OA 3ELUA 5HQ3A 4CCYB 1KEUA 5TJXA 1G1AA 2JANA 3A7YA 4GI2A 5AO9A 2WVGA 3WLAA 5KTKA 1R8QA 2XJ9A 3WISA 1U5CA 4R81A 2NADA 3H9NA 5DM1A 4NBUA 3PUMA 1DEXA 5KTTA 4E5KA 1QX4A 2HLDA 4J75A 5ES4B 3IIMA 3NLLA 4Z9AA 4DLNA 2DUJA 1S84A 3GRRA 2ZGJA 2QTVA 1FSZA 3RW9A 3UZUA 1QJCA 2G7ZA 1BXRB 2W6JD 1VMEA 4DTCA 1HC7A 2OLGA 4B6FA 1MX5A 4KTCA 4YT5A 3F1SB 2QV7A 3RS8A 5FCRA 4XLTA 3ENNA 1J5EB 1AGPA 2EWVA 3H17A 1NIPA 1SC8U 3RFXA 2EDAA 4LRSB 4QRHA 1R0WA 2O8EA 3OI7A 1CRQA 2PMCA 3JY6A 5B4UA 2JI8A 4MULA 2YOFA 1RLMA 4INOA 4V0MA 1G6HA 5JRDS 4AS1A 1K5HA 1Z0AA 3IVMA 2C8KA 5DGXA 1EXNA 3L92A 3FFWA 3GPBA 2WIAA 1D4FA 1N2CA 4UQLA 3UCFA 5A0FA 1CS4C 3T8YA 5FPPA 1R6TA 5DTRA 3ISTA 4O4IA 5H68A 1E2BA 4D92A 3OLCX 5DP4A 5KC9A 3ZTTA 2OXSA 3UB2A 1V11A 3AI1A 2JHCA 1FFGA 4XCXA 1TGSZ 1R6XA 2BGJA 3RNLA 1Z28A 1M73E 4WADA 1IQIA 3DE0X 5LOVA 3G5UA 1K08A 1PP4A 3BWDD 5EFOA 4PLZA 5DLDA 2FXRA 3GLHB 1ESMA 2AOVA 1OPRA 1YJBA 3D4PA 2PKYX 1T0JB 5C17A 4FS8A 4BV8A 4CTNA 2WMOB 5FPKA 3Q38A 3BWYA 2A45B 3IP5A 2HK6A 4X2WA 3GT3A 2AOXA 4JLNA 821PA 1TJ3A 1D2GA 5SICE 1YZUA 4MYSA 3V80A 1YZHA 4RMJA 1O6BA 4E2WA 1YFZA 3B1VA 2XCIA 4JQCA 4GQNA 3OIGA 3BXFA 1S6FA 3BMCA 1UJ1A 1BTUA 3H7OA 4XQ0A 4B3RB 2AMDA 3AERB 5BW4A 4XB2A 4C2AA 2DULA 3KB2A 3ERCA 2CN0H 4EB8A 3VM6A 1OHHA 5GZ6A 1CJUC 1VI6A 2EATA 1UC9A 2IKSA 3FIJA 3FKSA 3IOYA 4QRDA 5CT6A 4HWGA 5HF8A 3M9WA 2C7OA 4RXMA 4AUEA 2G9ZA 2PWPA 4JX8A 1JXOA 1DARA 3W2GA 5AKEA 5HMAA 1ZLRA 3SJ7A 1KVSA 1KWKA 1LRLA 1T9BA 1SSXA 3M3DA 3KALA 5IVHA 4HGPA 2Q6GA 3N2KB 4TZ6A 2Y67A 1XHLA 1K0UA 2EARA 3G68A 4K26A 2HPAA 4BX8A 3PA8A 3UWMA 3VX3A 2LNCA 4KQEA 4QG7A 3F6SA 2I65A 4JB3A 1X15A 1V2OT 3LGUA 4RDLA 2IJGX 3B3QA 1T13A 1ETSH 5BSYA 2WF5A 1C3OB 4LXIA 5F7XA 3MH5A 4MW2A 3BTVA 5L7YA 4ZOAA 2RHHA 1QIMA 1W93A 2FWWA 4A03A 3HY3A 3AFOA 2A59A 1FQKA 1UPBA 4L8LA 3A4NA 2GCTB 4BGIA 1GBMA 3G8BA 2PX5A 1TLLA 2XBWA 3GGGA 3T95A 4R3NA 4J7AA 1WV0A 2GK4A 1YZKA 2C78A 2BSXA 4BTUB 5LA6A 2OFWA 1QYCA 3IJRA 4JJGA 2VNAA 1MG5A 2QX4A 4ZXPA 3DFUA 3RLYH 3DMNA 4GBGA 1OWPA 1QO0D 2QD3A 4Q12A 3TZCA 1AFQC 4MINA 4JMPA 3O8QB 2RGUA 2O8LA 4AFQA 2OLEA 3MMPA 1E2GA 1ZH4A 5K09A 3HWWA 5CFOA 1MD7A 4LVUA 4B45A 5K0BA 2YNMD 1F92A 1GBLA 1O3CA 4EG5A 3A1PA 3JRWA 3NEJA 3KRTA 3TGJE 1BG6A 1C1DB 1VL0A 3FF1A 3D7SA 3TCKA 1VL1A 1J0BA 4FSDA 3PKJA 1FK8A 1OLUA 1XXHE 3M3HA 3FJYA 2IKQA 4WKNA 1KY4A 3ZZCA 2ESTE 3ETHA 5LZ8A 2J0VA 4AOQA 4WLOA 5F35A 3GFPA 2G07A 1M1XB 1X7DA 5ICSA 3LWNA 4RTKA 2BD4A 1JDUA 2B4QA 2PKQO 4KO4S 1UJCA 4YROA 5J63A 5C1YA 1NUPA 1W34A 4K1EA 3MINA 3CJQA 5KYKA 1JECA 2DOGA 4AJEA 4CJXA 2R1VA 4D97A 1X1QA 3LUHA 3AL0C 3LY9A 1O89A 3HYCA 2FN3A 4LJ8A 1ZO8A 1F60A 1RQ7A 1S02A 2D1TA 5K0GA 1CA0C 4G0WA 2HFKA 1FNCA 1BX0A 2HZ7A 1P77A 5FKJA 1SA0A 2PMFA 4JKOA 4YRQA 4H7PA 1UMBA 1VGCB 1E3LA 2VI5A 3VYTB 4X85A 1P1RA 4FJ0A 4TKUA 5ESTE 3G1UA 1Q7RA 5JVDF 2E0IA 4O2BB 3OIWA 1HE8B 2QTNA 4S12A 2XTMA 4D8TA 4X8IA 3H6KA 1O5BB 2W7TA 3LGWA 5J59A 1PPCE 4UNNA 4YQEA 2LPRA 4N3NA 1E3WA 4P82A 4RD1A 3DNFA 1L1NA 4YEJA 4OG2A 4Q05A 3MWJA 4LTDA 3PDIB 1MAHA 2ZRMA 3VPDA 3PUZA 3CCEB 3DLAA 5BQ5A 5ICCA 3R5XA 2AJTA 1JPVA 1NAIA 2L18A 3LNCA 2P0EA 4ZVQA 1BWSA 4Z7OB 1UMAH 1GM5A 8KME2 3C14C 3HO1A 2V8OA 5JARA 2Z98A 2DH5A 3GJ8A 3W9BA 1IULA 3LA8A 1GRNA 1WS6A 1F12A 4H7HA 3VTFA 3RKUA 1OI2A 1WMSA 2R0QC 3LCUA 4PXAA 4H6SB 2IUSA 2OYCA 2F1OA 1ZUWA 1XNRB 5EXDA 2IF2A 1V0EA 2C3UA 4GX5A 4KELA 1G37A 4M55A 2C00A 2GJ8A 4MIKA 1X2BA 2FYRA 1BWRA 3TS1A 4NCJA 3M82A 2ZAGA 3A4LA 2FFQA 5C1XA 2ECPA 5EJZA 3L7MA 3F98A 4DC0A 4P84A 3QVOA 4I4TA 1GJ4H 1CJSA 1Q0TA 1SVWA 2AG8A 3BXGA 5DISB 3PFIA 1SGFG 5LWQA 4O2AA 2WYGA 1LWOA 3U40A 3DYIA 2DUUA 3NAZA 5GINE 2I9PA 3TUJC 3MRVA 3ZHRA 2Q07A 3JR3A 3FPEA 2XXAA 1R7RA 3DP9A 4QFCA 1C3VA 4BAHB 3EUAA 2Q5JA 4FHEA 1NB9A 1XKLA 5LJIA 1TAGA 4QDJA 1Z2AA 1BYIA 3KQ5A 1U0HC 2BM9A 5COQA 4F55A 1WD5A 1N1GA 1NRJB 3A25A 4XTRA 2O4UX 1KVRA 4OI0A 1T91A 2ZRHA 5JCPA 5KYYB 4D9EA 1CF4A 1E5TA 2HEGA 1YMVA 1KZHA 4EECA 2NUTB 4TT3A 4ZEWA 4QLAA 4B6GA 1E89A 4FN4A 4FGKA 2B4AA 1Z8JB 1JR3E 3SZNA 3G85A 3SUFA 1ETUA 4BS9A 2QY9A 5A0BA 2HQ1A 2V9PA 4CMGA 4HUJA 1ZZEA 2DCUA 1C9TA 4HTAA 5DULA 4J3JA 1W36D 4DCSA 3PPXA 5AQEA 1MJFA 5TPWB 1VQ1A 3TXXA 4FYYA 2YIVX 2W2PA 1T9DA 3PTBA 1A0LA 5T7BA 4DA8A 3CJRA 2GA9A 2DB3A 1K28D 2LV8A 4TV9F 1JAIA 1X9HA 3DMTA 1VG0B 5KSWB 2R8XA 3L7CA 2H2DA 1EYZA 4WCFC 3RVMA 2P93A 3CMMA 5H8WA 1I7LA 2DR3A 4Q9DA 3ADCA 3ADBA 5AW5A 2QXJA 2G4UA 3TIVA 4BO1A 2CLKB 3ISVA 3AP3A 5LDGA 5JZMA 2BM2A 4WOBA 3ULKA 2WSLA 2R85A 5KSYA 1PZNA 1TM1E 1LQUA 1L4DA 1BU8A 1GNTA 4XORA 4GVUA 4AMYA 2HI0A 1EXDA 5F23A 3K73O 1DQZA 1R0BA 1BKDR 3NP9A 4EKGA 1OSNA 1EB1H 5TDHA 3CESA 3PHIA 1U3CA 2ZR8A 4MS3B 3V8EA 4AZ3A 3L6EA 2Q1WA 2BTOA 2QR2A 3STTA 3Q3CA 2IJOB 3PLNA 1G8FA 1JQDA 2O07A 3VBCA 3V8RA 1GQSA 5JZVA 2Q5QA 2Y4NA 1KDTA 5J4LA 3RMNH 5KX5B 1HOTA 1F3LA 1U4NA 1RC1A 3PEWA 4J1TA 1YIDA 4X1OA 1IQNA 1NASA 5BUSA 3QK7A 1NXQA 2UVPA 3TG2A 5B58C 3NCHA 4DNPA 3I8SA 4QFBA 3PXBA 1E98A 3H2ZA 5HRUA 2VK1A 3LDGA 5J58A 1U2RA 2F9FA 1R12A 1TM3E 4G63A 5HCUA 1K9SA 4K9MA 2BMEA 1H3EA 3HUEA 3U49A 1GGVA 3QLTA 1OW3B 4B6EA 3CY6A 2J09A 1OWKA 4YRRA 3SF8A 3T7TA 3WRVA 4G9EA 4DLKA 2IEZA 3LQQA 3DC7A 8LDHA 1G9TA 2YVAA 4MVJM 1YPJH 1VYUA 4R1TA 2GAIA 2D7JA 2IA5A 3GLIA 1YE3A 3ZLVA 3HDQA 2DWOA 3EQ6A 1BGWA 3R6TA 2PAAA 3KZMA 2OMEA 3NETA 1LV8A 2Y0BA 1U0GA 4TYQA 2XEXA 5AXBA 4F96A 1KY3A 3L0DA 4OLAA 3DXXA 4UZSA 3WSWA 4GSYA 4KR3A 4CIXA 1YVPA 1K6JA 5BWNA 2CB0A 6ABPA 4WK0B 3HZOA 1J1ZA 1CLUA 4ZZ2A 2DOKA 3IL2A 5FB3A 1EP2B 1O3GA 1Z13A 3T5GA 1JUDA 2L0XA 5CJPA 1QGOA 3F6EX 4MVXA 3TLAA 1BXRA 1UFQA 2V4DA 1ESEA 3NV9A 4OQFA 1W581 3HJTA 3OM1A 1NVTA 1SMFE 3QJYA 4LNUA 2CXPA 1GDHA 2H85A 4ECAA 3PIDA 2R1TB 3V42A 3HCRA 3IXQA 3D7LA 1YVDA 4R51A 3P27A 1TYZA 3NYIA 1EGHA 2AJCA 1N5LA 1RACA 1P3JA 1Q1GA 1AMHA 1ODKA 4H15A 3QY0A 4CBOA 2CL6X 2XMBA 2WF9A 3SXUA 3N59A 1X8KA 2R1ZA 3T35A 4I86A 1XEWX 4G8JA 1TZBA 1QCPA 3LVRE 1D03A 4DBVO 2FEQH 2STBE 4HDMB 3S2YA 3EBOA 1DZIA 3K9GA 2WKWA 4L8VA 4TV9A 1UWCA 3H5OA 2ENUA 1GMDG 2J6IA 3LQYA 3ER6A 1YRYE 2O2JA 1HRTH 1SKYE 3K8QA 4EKYA 1KYWA 4NABA 4HADA 4XPIB 3GUHA 3NUZA 1VIVA 3IG6B 1V8DA 4L72A 1QFJA 1NMQA 1V4BA 1OFUA 1TF7A 4JYMA 5B3AA 3UA3A 1T5EA 3ABQB 4CF5A 2KW5A 3TW8A 4B5KA 4LG1A 2FX3A 5F8ZA 3D3NA 5AR1A 3QE2A 3SLKA 2ZIZA 2Y77A 3SUEA 1H9AA 3C48A 4DLZA 4CGZA 1XXDA 2JETC 4U1RA 3SXUB 1IB0A 5AI9A 3J80A 1KC3A 3SHVA 1C7RA 4V02A 3V4VB 3OPYA 5LOVB 1LDMA 3Q6MA 4INLA 4JS0A 5I8WA 2A5KA 2E18A 4DIMA 1QFXA 3G2QA 3S7ZA 4YXWD 5H3CA 4XDEA 3ZVCA 4HI3A 4NS1A 1H6CA 2ASUB 4L51A 3QVKA 4MV1A 5KYNA 2TGTA 1JG4A 1NDUA 4J6EA 2Y27A 1UAAA 2QT1A 2Z9LA 2JIZD 5B1IA 1JHOA 1MH0A 3W8NA 2Q0QA 3W1WA 4H7FA 2AD1A 3AEYA 1O3AA 3DV0B 1NQTA 3ANSA 4C0SA 3STXA 4AX4A 4ZVNA 3KSMA 3PXXA 2QUJA 3B9BA 3L49A 4DV3B 4IDCA 4EARA 4CKZA 1KZLA 1V35A 1SXGA 2F4NA 1NW8A 4LJRA 1IOEA 1ACJA 4BX2A 5JCZA 4KN6A 1I0LA 4NPCA 3EE7A 4BEVA 3C8ZA 3H5VA 4CM4B 4GSOA 4URVR 4G8BA 3QEJA 2XF2A 4EUKA 4NBSA 3BQMB 4UBKA 3PFHA 3LLVA 3IKLA 1D3PB 3P32A 2ZBQA 1S2GA 5C8YB 2IV7A 8AT1A 3OC6A 3IQGX 3MNBA 5BUQA 1XBTA 1E3JA 4AJIA 3GZNB 1BTPA 1NLUA 4UFNA 1QKIA 1EBBA 3SY8A 1M8KA 1FFHA 4KBYA 4DSAA 4YMIA 1BJUA 1QG2A 4RDIA 3EUWA 4HP8A 3I5XA 3EA9A 5JAMA 3A8BA 1A71A 2G3YA 3SDSA 3G13A 1G5TA 5DI9A 2N0SA 4TMZA 4LJSA 3MYWA 3A4VA 4LTMA 5C5OA 1E1LA 1U3FA 4B9EA 2DT8A 1TX7A 2OCVB 3QWCH 4DW8A 4MQAA 2RCNA 2J46A 3HKCB 1SXHA 1I6LA 1FFBA 4GYKA 3ZY2A 5AI8A 4RQTA 3UHJA 1DBWA 4N3AA 4FMDB 8GCHG 3WLKX 1T4GA 1CZKA 3QHQA 1MO6A 1GRVA 4U32A 1QVAA 1EEHA 2QGRA 4X8UH 2J67A 1HE1C 4YR7A 4L02A 2GZAA 3UY9A 4N12A 3ETNA 4MJLA 1ZVQA 4Q3LA 1TQ4A 1Z4QA 1OROA 5A7HA 5FAKA 2XVXA 2NO7A 4NVRA 4HNHA 5FOWA 2JKYA 4X7BA 5CLQA 5F5XA 5BNFA 3MCZA 3UHPA 3Q3IA 3HR8A 3V7FA 2NSHA 4QXQA 2J48A 4OQDA 5F1OA 1JXPA 4U2CA 3E9DA 4U2EA 1K22H 3WHKA 2RGNC 1OPHB 1TE0A 1E92A 1F0RA 4MX8A 3DUFA 2W48A 2IELA 1X9IA 4IH1A 4EKEA 5AW3A 4WV3A 1AQJA 4W5NA 1DFHA 1PR4A 1ZN7A 4BZWA 3RCBA 1XU4A 2FMJA 2D1QA 4G5XA 1C1RA 2WJ6A 4F9FA 3GMDA 2LNDA 1PX0A 4JXXA 1UP7A 4IIXA 2IIBA 2AZTA 2VIIA 2H0RA 3S1AA 4P3PA 5KWJA 2IPNA 2ORED 1FS4A 4TZKA 2OD7A 3BREA 1VSTA 5FUVA 4YFVA 1JHPA 1LQTA 3RIEA 5A5DA 4I4NA 5GIPE 1WV7H 4IKPA 3UXMA 5TB5A 3K6KA 4I4LA 3OU2A 1R5JA 4K8RB 3LONA 3BK2A 3BJRA 2IZOA 3AZOA 1SZCA 2C4VA 1E6UA 1YKTA 3HDHA 5FCDA 2O7QA 2QMZA 1HUQA 3R40A 3MWIU 7REQA 1AHPA 4I31A 3EXAA 3WK7A 3GA7A 1VHJA 3OLVA 1DHRA 3FI9A 1P0QA 3O73A 4RF2A 1DXYA 3AMVA 2Z4RA 3OFND 5JMOA 1SY7A 4FOLA 3QBEA 3DTVA 3CR7A 1SG6A 4B5LA 4FPXA 3KSAC 2VINA 4EPVA 4JELA 1YR8A 1NB0A 4RQBA