4ACAA

Crystal structure of translation elongation factor selb from methanococcus maripaludis, apo form
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
469
structure length
444
Chain Sequence
HMDFKNINLGIFGHIDHGKTTLSKVLTEIGFSAFKLENYRITLVDAPGHADLIRAVVSAADIIDLALIVVDAKEGPKTQTGEHMLILDHFNIPIIVVITKSDNAGTEEIKRTEMIMKSILQSTHNLKNSSIIPISAKTGFGVDELKNLIITTLNNAEIIRNTESYFKMPLDHAFPIKGAGTVVTGTINKGIVKVGDELKVLPINMSTKVRSIQYFKESVMEAKAGDRVGMAIQGVDAKQIYRGILTSKDTKLQTVDKIVAKIKISDIFKYNLTPKMKVHLNVGMLIVPAVAVPFKKVTFGKTEENIILNEVISGNEYAFELEEKVLAEVGDRVLITRLDLPPTTLRIGHGLIEEFKPIKDLNIKKEVLREGKVKIDKGRTVIDGLAQSKVAAEKLIGEEISIEGKDIVGKIKGTFGTKGLLTAEFSGNVENRDKVILNRLRRWG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSLATION ELONGATION FACTOR SELB
publication title Selenocysteine tRNA-Specific Elongation Factor Selb is a Structural Chimaera of Elongation and Initiation Factors.
pubmed doi rcsb
source organism Methanococcus maripaludis
molecule tags Translation
total genus 98
structure length 444
sequence length 469
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.190 Mainly Beta Beta Barrel Thrombin, subunit H translation elongation factor selb, chain A, domain 4 4acaA04
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4acaA02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4acaA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4acaA01
3WYFA 2PJZA 3ZD6A 5B30A 4D80A 5CDFE 2OCAA 2ZETA 2BSAA 4RD1A 2O8BB 3WP1B 1FQKA 2OILA 2W6JA 1W1WA 1D5CA 1YZLA 1Q82D 1R7RA 4P33A 1JBKA 4KCGA 4OQFA 5AUOB 1KGDA 1Q44A 3AVUA 4G1VA 3UXMA 3CLVA 4D0GA 4IVQA 5SZJA 4AIIA 4JIMA 3LWNA 3ZVMA 2WMNB 3VO1A 4Q7LA 4XWOA 1Z0IA 1A4RA 3LH5A 1GDDA 3FJOA 4KFUA 4MKHA 3T35A 2BVNA 2BGIA 2ODEA 3FFAA 4QM7A 1MRNA 1C4OA 1A5TA 1E2IA 1X86B 2H16A 1P75A 3TVDA 4CEJB 2FNAA 4YMWA 4TN1A 2GJ8A 1Q1ZA 4XTCS 1XJ0A 1SHKA 5KPJA 3CM0A 1MO5A 2QEXB 1R5NA 1PVOA 3VKWA 1R0XA 5EJEA 2EFEB 2YOHA 1GAQA 4MGKR 1IN8A 1XCGB 1GR1A 3UANA 1IQPA 1F5NA 4GZMA 5JBQA 1D9XA 5FPYA 1HURA 3VR3A 2XZPA 3OHMA 3RS0A 4NYMR 1M6NA 2HEIA 4JSTA 1D2EA 3K0AA 4CEHA 2RGEA 2KI5A 3AF1A 1CS4C 4JS0A 4US0R 1VCIA 2NTYC 1W4CA 3QOFA 2GK7A 4ZDIA 2I3BA 3I5XA 1Z5ZA 1UADA 3FMIA 3QUSA 3LVRE 3RRMA 4TL9A 4K81B 1PJRA 4DCSA 1WDTA 5C46F 2REBA 1UDXA 4MDEA 2P6UA 3THWA 4LBYA 3OE7D 4A8JA 3EW9A 5EUMA 1FNBA 3E1SA 4Z1MA 4QOSA 4KV9A 1YRBA 4R9UC 5J47A 3CMAB 3QEJA 3W2GA 3VKHA 4ESVA 5A5GA 3TQFA 3A58B 1MABA 1M1KD 2W6JD 3PITA 1O3YA 1ZMXA 3W5HA 1YIJB 1P3JA 2QM7A 3L43A 4AYTA 1FOEB 1OE0A 1TEXA 1T0HB 4LYAA 1YRAA 3D8BA 3G82C 4HE5A 3CWZA 4JLNA 1W49A 1Z6TA 1F6BA 3GLFB 1U9IA 2XITA 5DO9A 1KJYA 3TR0A 1ZBDA 3VU9B 3D6TB 4IRUB 3FMPB 1PUIA 1NMYA 1Z6GA 3VR1A 4C4PA 2FSFA 1KK1A 3ZIAA 4YHBA 4RZ3A 3C7KA 2WPDD 3U7GA 2IEYA 3QKSA 1OFUX 2GCOB 2CVHA 4B3DA 2PX0A 1XPRA 4B71A 2BM1A 1W4RA 1K5DA 4Y9RA 3Q85A 3EWSA 5JHHB 2IA5A 3B85A 4M1WA 2ZTSA 1KOFA 5J4LA 1SULA 2BCJQ 2XSZA 3IIMA 1LFDB 3ECCA 4PSVA 4Q7JB 2FV8A 3QG5A 2NQ2C 3RHFA 3B1WA 4HUQA 1G3QA 2XEXA 1DAEA 2C95A 2DFKB 3RWMB 2JJ8A 4B73A 1RZ3A 3TW4A 3UIEA 3VR2A 4Q4HB 3Q7PA 1QFZA 1Z83A 2GPJA 1N25A 4DJTA 2ZUBA 2CL6X 2E9SA 2J0UA 3LQQA 4TTQA 1P7CA 3KFVA 1E1RD 2RGNC 3SFVA 2C78A 2V3CC 2GJSA 1VQ5B 1KY2A 5L3QA 1I4LD 1L4UA 4YQFA 1Q1BA 3W6OA 4HZIA 4QNMA 2XXAB 3EZFA 4EPWA 5FOTA 2GZHA 2WWFA 3CCEB 4Z1MD 4D25A 3WBJA 1CF4A 4LHWA 4DLXA 5IRCD 2A2ZA 4URZR 4U7DA 2BIFA 3WNDA 2B5OA 2XNSA 3Q72A 1TX4B 1E96A 2AK2A 2NG1A 2VP5A 4KVGA 2QMUA 1EP1B 2OTLB 2P6NA 1EP3B 2H5EA 4LJAA 3NHAA 3GLFE 1E2PA 3HP1A 4JL6A 5K8LA 5CB6A 4TYYA 2YOGA 4M1SA 4US2R 3NH6A 1HYQA 5EMNA 3X1DA 2J7PA 2QMHA 2V54A 1JQLB 4OJKA 2EYQA 5JFGA 3X1YA 4BLSA 3CXCB 2IHBA 1XTKA 2Y8EA 4JLAA 4Q01A 3ND8A 4P4UA 1XWIA 3BOSA 4LJ9A 2D74A 1LTQA 1Q3HA 1ETUA 1GUAA 4W7SA 1FNMA 2CXXA 3OFNA 3QF7A 4POAA 4BPBA 1RJ9B 1GAJA 4N0DA 4OQMA 4QBFA 3RS7A 3H0KA 1TEVA 2DR3A 4F4JA 3TMKA 1MRSA 4IW3B 1GZSA 5JWHA 3KJHA 5L3SB 2C9OA 2Q6TA 4CVNA 5B58C 3I73A 3VHXA 1GSIA 2G3YA 4YONB 2V4ZA 1KNXA 1U0LA 1G7SA 2QG6A 1MKYA 1KKLA 5TVKA 1ZVQA 1CRPA 1GJRA 1FTSA 2EWWA 1G4AE 5DI3B 1PLJA 2FGKA 3DL0A 3K9HA 3PEVA 1ZJ6A 3FPAA 3QF4A 2X3UA 2V9PA 1WE2A 3AVVA 4NYIR 2JATA 3MWYW 3AVPA 1UDWA 2XOKA 3RSOA 3CCJB 5FOSA 1YKSA 1R0ZA 4NYMQ 4DC9A 4Z54A 2N1BA 1NIJA 1LF5A 1Z0KA 1GNPA 4KYIB 4PHTA 2VP9A 1XXHA 2GVZC 2VHTA 3IPYA 1G8YA 5TMPA 3BIFA 1QZXA 2AFHE 2QT0A 2IF2A 4YAFA 3AUYA 4LHXA 1N0UA 1OSNA 1KDTA 2NOAA 2LCFA 3SBDA 2IYUA 1IM2A 4BEBA 3U6BA 3A4MA 3B5JA 3SU8A 4L4UA 3O8CA 1DARA 4K1XA 2DBYA 2MMCA 2ZR7A 3WRYC 1CJVC 1ZNYA 4BZXA 2A9KA 4DLRA 5K8IA 2IXGA 3QQ5A 4B3GA 1M74A 5EP3A 2YJTD 1HH4A 4B44A 2J7PD 4F93B 1W36D 3G6EB 3R8FA 1DAMA 3AP2A 4K46A 4D4LA 4FWTA 3MHPA 2BKUA 3HYTA 4G5OA 4LSGA 4RKFA 3EPKA 5JWOA 1L2TA 1NJGA 4MQBA 4NE2A 1UMKA 1IBRA 3TE6A 3RSLA 3PV0A 4DXAA 2R44A 1M8PA 4GFDA 3EC1A 3I62A 1ZM7A 1H8HA 2P2LA 2OUKA 2WAXA 1EWRA 3ZD7A 1R10A 3IHWA 4EQ6B 2GJAA 2JLRA 4FMDF 4JLPA 2GF9A 2QMOA 1QX4A 4U9UA 2IK8A 2CL0X 1OH5A 4CEIA 1ZCBA 3SEAA 1R0WA 1ESNA 4LJ8A 3B9PA 1U0HC 4LPKA 1OGJA 4TQUS 5L8VA 3K0FA 4BLRA 5KO2A 4HE6A 4LHVA 4YMVA 1KMHA 4XIGS 4OBEA 1WBBA 4KSBA 2MSCB 1NLZA 2ZJYA 3NEJA 1CXZA 2ZRKA 1L8QA 2JLVA 4C2TA 1OT3A 1AS3A 2XOKD 2QUZA 2ZS9A 4B3FX 5CM9C 4B2PA 3MGCA 1AN0A 4CF7A 2GEDA 3LX8A 1SKYE 3W2EA 4C0HA 2O8DB 2F9MA 4HSEA 2WJIA 4PO9A 1NKSA 3KKQA 2KJQA 2OBLA 2ZRCA 2HMAA 4UXHA 1Q1QA 1R0YA 1UFQA 2BMWA 4XD7D 1UBFA 4Z51A 3U61B 1H85A 1KZGB 1ZM9A 2I1VB 1HT2E 1BQEA 2W2TA 2W83A 4A0RA 2FZLA 2QA4B 2HCBA 1N6HA 2RH5A 1RRCA 5C18A 4BFTA 1TU3A 2AWOA 2IXEA 1VHLA 1R4AA 4B3BA 3PEYA 4R7ZA 1OFTA 4B6EA 3DMNA 2IEZA 2BEKA 1O87A 3B1VA 1P6XA 3ZDQA 3KFXA 3CBQA 1TF5A 1S4QA 4WQMA 5D3MA 4MYUA 1NJFA 4RFSB 4IFBA 1JJ2B 1SXJB 4IDNA 2JA1A 4V0OA 3EIQA 3L82B 1I4TD 5L3RA 1AJEA 4G5GA 2CHGA 2QP3A 3ICQB 2DWOA 1Z47A 1NSTA 1FDRA 4B3CA 1LW7A 1T0JB 1KNQA 1A2KC 1KI6A 3ND9A 1UBCA 1OYWA 4R2IA 2ZSDA 5FL3A 4IXMA 1E69A 1T6NA 2ERYA 1E4YA 1FP6A 1JI0A 1QHYA 3KUCA 4QXAA 3QPVA 4KLZA 3OZVA 2HF9A 4MITA 4OHYA 5DIFA 3CX6A 2IYZA 3TAUA 5GV7A 3WMEA 2J59A 1G4UR 1N5JA 5JCZA 2V7QA 1J70A 1E9SA 1SXJA 2OO7A 4B32A 4JZKA 3B13B 1T9HA 2GXAA 3AKEA 3BERA 4ON9A 4MRVA 2EQBA 4XSHA 1W0KA 4PZZA 1HY3A 2BBSA 4AWXA 1W47A 3SOPA 5M04A 4D0NA 2Z4SA 4DRZA 1R8QA 1G8HA 4NCHA 2ZRDA 2Z5FA 2QRNA 4AG5A 1VCOA 2F9LA 4LHZA 2ECKA 2N46A 3PIRA 1F3OA 3GJ5A 3LA6A 4NYIQ 2ZE6A 1DO0A 2IUTA 4RY2A 5FTKA 2ZRMA 3K1JA 5FUWA 3QSYA 3TSOA 1SZPA 2Q0HA 1G5TA 4TMZA 3ZGXA 2PZFA 4XVQA 3I3SR 3W6PA 1N6IA 2AD1A 4NP6A 3TSZA 2OCBA 3L8ZA 2F3TA 4XSGA 4WA7A 4ARZB 4FD2A 4P3YA 5FPSA 3BB4A 3OAAD 2OXRA 1XB2A 1TF2A 1SXJC 1NN3A 4LK2A 4M9QA 1P61B 1LV7A 3MD0A 3SYLA 3C41J 5CLQA 4BE7B 5HKKA 4KFTA 1LNZA 2HDNB 1E6CA 2QTFA 4GSYA 4L15A 5CYPA 2DFTA 2ATXA 2FPKA 4PC1A 3OIVA 4M22A 1ZM2A 1L4YA 1GTVA 5E7MA 2J0SA 4NKRA 1S1CA 5KSWB 4A6XA 3ZBUA 3GEIA 1KAGA 1OH7A 1BKDR 3PCRB 4C7OB 2Z83A 4G1BA 4PXAA 2QN6A 1P2SA 2ZRIA 4E5UA 3W90A 4AYWA 2OHFA 2PH1A 3Q9LA 2QP4A 2ZU6A 1JXMA 2ODWA 5A0FA 4G1UC 1X1SA 2XX3A 4Q4JA 4EDHA 2OG2A 2X2FA 1G9XA 2A5FA 3GEEA 3RRNA 4F38A 4DB2A 4WXPA 2W0SA 3T5GA 3N5CA 4IXNA 1W48A 4URVR 4M0LA 4HZUA 4PANA 1NJID 1GM5A 1VHTA 4OL0A 4OK5A 421PA 3HWSA 5GV8A 5G40A 3GJ8A 1J2JA 2GCNA 2W6IA 1OB5A 4PC2A 1GKYA 3WYGA 1Q21A 4DEXA 4DSNA 2ZRJA 4AG6A 3GFPA 3CWQA 3CKLA 1IY0A 5B2ZA 1EFHA 1OIXA 4IOLA 1P4SA 2W2XA 3A4NA 5C4GB 4HAYA 1Z6YA 2RAPA 1S72B 4KU4A 1KSJA 5B64A 3I8SA 2YOFA 3MUFA 1SQ5A 4M8NE 1XEXA 5F9HA 3W8NA 1U0JA 3QEOA 2ZJ8A 2NIPA 5H8WA 4DEYA 4FIDA 3UWOA 4DDVA 5DH9A 5KDOA 3I55B 3TKLA 3GLGE 1YR7A 2ZSFA 4LBVA 3SJBA 1U8YA 3KXKA 4YMUA 4D4KA 4FMBB 2GNOA 2OK7A 3HU1A 4GOXA 3O47A 4PHFA 4KAXA 3QFRA 1KSGA 3W3AA 3TR5A 4YAWA 2QGZA 1YJ5A 5EP2A 2YWGA 2JJ1A 2PX3A 4URWR 4BZPA 4LJ4A 2I1QA 4KJZA 5KTYA 4JLVA 3G0HA 5KSPA 4EFMA 3RYTC 2PJRA 1VQKB 5JEDA 2VRWA 1PUJA 2VNHA 1KK2A 1OIWA 1R6BX 1TUIA 5TY0A 1DAFA 1NMXA 3BD9A 3LBHA 5DSZA 3LX5A 2H92A 3R7WB 4E03A 5EXXA 3CCVB 1PLKA 2H18A 1TNDA 2EIXA 1NBMA 1NDHA 4XH9B 5JJLA 1SVKA 4ZIRB 3ZBTA 2VF8A 4O25A 2ERXA 2IUSA 4TMTA 1DAGA 2W6ID 3X1XA 3SC3A 3T5DA 1VKJA 4ZDWA 3IKJA 4D6PA 1NVWQ 2Q9CA 1R2QA 5J4KA 2FE4A 5C4MA 4RZ2A 1OFHA 4WXRA 1NY5A 2O8FB 2XJ9A 1QVFB 4WZBE 4HLUC 3KJEA 1EX7A 1QHHB 4JKIA 1IJFA 4LI0A 1QG0A 1Q86D 3BAFA 3SJCA 5DN6D 5HTKA 3UMRA 1DDGA 3C14C 4L9WA 2ZS8A 1HE1C 1GRRA 1HQCA 3W2HA 1K8RA 2PZEA 1J7KA 5KDDA 1RPZA 4M9XA 3V9PA 3C5CA 4DLTA 3ZS9A 4Q4AB 1G3UA 2WKRA 1UKEA 3BC1A 3P4XA 3AVXA 2Z43A 4D26A 4AC9A 3AVOA 4P6VF 2C77A 1EG7A 1QF9A 4KBFA 2GAOA 2OBNA 1QHNA 1X1RA 1D2NA 2B21A 1TQ6A 2GVDC 2VHUA 3BFVA 4C30A 3T15A 5JSZA 5HZKA 4AKGA 1M7BA 2EFDB 2R6AA 3TUJC 2V1XA 4XTRA 4LV6A 4EAQA 4MKGA 3HU2A 2BBTA 3BBPA 2BGJA 2WOJA 2ZITA 1WXQA 1VCMA 4E22A 1MO4A 1RRGA 4YMSA 3N70A 3HPRA 4JVNA 2JJ1D 2D3WA 2QI9C 1G6HA 4A15A 4P4TA 2RHMA 1UBGA 2IYWA 3I32A 2LWIA 4QM6A 1E0JA 2XAUA 3GLHA 4QBIA 1DAKA 1BYUA 4YAUA 1E9CA 1W4AA 1S1MA 3Q5DA 1W4BA 2ODNA 5CK4A 5L3VA 1S9HA 3IEVA 1W87A 1C9KA 4WOPA 1ZCAA 4GBMA 3THXB 2RMKA 4JMPA 2NZ8A 4B48A 2CHVA 3FHCB 2LP6A 3UMSA 4AKHA 1Z3IX 2J87A 1E99A 1ZIOA 3H2YA 3A6PC 3GJ7A 3KZ1E 3NIBA 2D62A 1B23P 521PA 1NBMD 4EFNA 1G64A 1RVDA 2VHCA 5CDFA 3QJYA 2JLUA 1KO7A 2XTZA 1W5SA 4L5BA 1BOFA 2ZAOA 1RYFA 4TQ9A 5FUYA 5KU1A 3PUXA 5EE5B 2C04A 1CU1A 3PENA 1JAIA 4NHOA 1FL9A 5EXSA 4CW7A 5BN3A 2IF0A 3FOZA 2CEAA 1EFTA 4XWKA 1E0AA 4G5RA 1XJQA 1QG2A 5JLJA 3FHTA 3QBTA 1K6MA 2QT1A 3AUXA 4XWAA 4DKXA 3PXGA 2MMGA 4IOMA 1D6JA 4PC7A 3HU3A 3U3JA 1E2NA 1MR3F 1QH0A 4M1YA 5SZHB 4C0QC 4HUTA 1D2MA 2ZE5A 3D31A 3RS5A 1ZYUA 3ZVLA 2G0TA 3NHBA 3NTUA 1KI1A 1E4VA 2PZGA 3S1AA 1FPMA 3NC1C 1AQYA 3CO5A 2RHDA 3A37A 3SQXA 2PMDA 3BJIC 1BYIA 1JALA 4Q9JA 1OFIA 3VQTA 4M9ZA 5GJWC 4DCNA 1G41A 2FSHA 4IHQA 4KFSA 3K0AB 1CJMA 1M7GA 1ONBA 1ZC3A 4GOKA 4CEHB 5DE3A 3K0CC 4PPQA 2WPDA 4M1OA 3ES9A 4LZZA 1U81A 2MSDB 1JNYA 5KNCA 3AF2A 1AZSC 2F1JA 1UPTA 5KPDA 3CRRA 4FN5A 4CIDA 4PC3A 3NC0C 2QBYA 3R9XA 1LY1A 4YDHB 2FZ4A 4EPTA 2OV2A 1UBEA 2PEYA 4BPRA 4L9SA 1KDPA 2P65A 4DT1A 2IS4A 3THWB 2BWJA 4A8JB 3VFDA 1MOZA 1E2DA 2C5LA 4OHVA 2P0EA 4TLAA 2XNCA 1US8A 3KQKA 1KQSB 2KBEA 1MABB 2XZLA 1D8TA 2BV3A 2QAGB 4KODA 4MYCA 3UG7A 1II8A 4O2RA 1NL3A 3BB1A 4TSFD 3RVBA 1HTWA 2VNKA 1C1YA 2ZPTX 2C8VA 2IYXA 1E1RA 2OLJA 1VQ4B 5AUQA 2QU8A 4LYFA 1KO8A 1IN4A 3DOFA 4LY6A 3B8HA 1DPFA 2RGAA 3AP1A 3AV0B 3E5HA 2QQEA 2GWHA 4ITRC 4A0FA 1P9RA 1YZUA 3CH4B 3AVWA 1F2TA 5JRZA 1P5ZB 1Z07A 2WTUA 4HB0A 2C98A 2AWNA 2QAGA 3FE2A 4PPFA 2YYZA 4NH0A 4TTPA 3KQHA 3QKSB 3LDAA 4LYJA 4F92B 4A4DA 1E2GA 4NCJA 2H8KA 4QBHA 2DWPA 1PLLA 2EVWX 4TWZA 5AR1A 2P67A 2XB4A 4ACBA 3AVTA 4TLCA 1BMFD 1NMZA 3P26A 2AHOA 2NO9A 3L2OB 3UK6A 4KITB 3FHOA 1DTSA 2DFNA 3OJXA 4M2LA 2X19A 4I1UA 3LBIA 5J4YA 4TMVA 4HUQB 4B76A 3QI2A 2GESA 3K8YA 2Z4RA 2QP9X 3IQWA 3M0EA 1MV5A 4A8JC 2D2FA 4CGZA 1KDRA 1FMLA 4Q1EA 4OHXA 1DG1G 1XFAA 2WWWA 2UZ3A 1VQLB 1ELOA 3J81k 5LD2B 5KYKA 1VG9B 2J0UB 2CL7X 2CMKA 1TQDA 2QAGC 2QENA 3U4QA 1E64A 1QUFA 4C2UA 1GL9B 1E9FA 3V4FA 5L3QB 4LUCA 3RNLA 1P62B 1CR2A 4D0LB 4Y0AA 3ICEA 3GJ6A 2BMFA 1NVUQ 1OKKD 3SZRA 2IC5A 2AXNA 2ZM5A 4RFVA 5JI3E 1NG1A 4NPHA 1BJKA 1JAHA 1U9IC 5BN5A 2DETA 2ZXUA 5BWMA 3K09A 3JVUA 5EE0A 3GD7A 3A1WA 4ZPXA 3U5ZB 1WB9A 3WHLA 3RLFA 3BXZA 2IYSA 5THXA 2QL6A 1VQ7B 2ZYWX 1N6RA 1WF3A 2O0HA 3QPWA 4FMCB 4I81A 3BWDD 3SNHA 1I7PA 2D7CA 4RCYA 2ZE7A 3E1YE 1KO5A 3LVQE 1UKZA 1W36B 1J8YF 4KBGA 4QGFA 4MRNA 4F4CA 4YC7A 2VYQA 4GMDA 2HJGA 2R65A 3MWLA 1XCMA 4A2QA 1E3MA 1GNRA 3FKSD 1OH8A 1AA9A 5DI9A 4HAZA 3QFTA 3KQLA 1Z63A 1LF0A 4G0NA 1HT1E 1ZRHA 4OI1A 3RAPR 2CHQA 4ILEA 4H1UA 1AMOA 2IBMA 2R8RA 3FWYA 3PR1A 5TV2A 3CCRB 2CK3A 5TB5A 3AKYA 1RW4A 4A9AA 3VAAA 2QSYA 3KKMA 3VX4A 4OQLA 4US1R 1I4DD 4CT5A 5LD2C 3KQUA 2FJUA 3TH5A 4HLCA 4UNSA 2C2HA 4JBWA 2XB2A 4G01B 2GF0A 2ZI3A 1BX1A 1IN5A 2O8CB 1FUKA 3CCLB 1KJWA 1COWD 1XD8A 1VQ6B 3BH7A 2PLFA 3AH8A 3IILA 4V0KA 1E2QA 3CX7A 5HCNA 3QF4B 3HYRA 1ZAKA 3RANA 2OTJB 4OKSA 1JA1A 2BKEA 2REOA 2JDIA 2QPOA 2W00A 2ZJAA 1GKIA 4HDQB 4JYBA 1RKBA 5IDVA 2J7KA 3O8RA 4B43A 5G3YA 1W2GA 3HPQA 3OF5A 3U44B 2YV5A 5A4JA 4QJ4A 1DAHA 2FSGA 1XXHB 2GJ9A 4DSOA 3WP0A 2VSFA 4EUNA 1XMSA 2ZE8A 5GADl 1CR0A 1TL7C 4D82A 2O8CA 2IXFA 2ZJOA 1W36C 2IHYA 2KWIA 4UAJA 1XX6A 4M21A 5FOXA 1X3SA 1OH6A 2OSBA 4HB2A 4UXIA 3ZC3A 1GG2A 2OBMA 2RKOA 1GWNA 2WWHA 2YC2C 3LLMA 5KSOA 1TU4A 2ZJBA 5JWRA 2CE7A 4XVUA 4KSCA 3IQXA 1EK0A 1V43A 1TUEA 3W34A 4BZQA 2QZ4A 3W3ZB 4B47A 4DLUA 1ESMA 3M1IA 3U44A 1BS1A 1Z0AA 2FFAA 4HB3A 5SZIA 5FTMA 2QTHA 4DDUA 3CR7A 4E09A 2UVQA 2YNMA 3MG9A 5CB8A 621PA 1XMJA 3F8TA 1T8TA 3QFCA 3A1TA 5FBVB 3L0OA 5FOUA 3HJNA 5EXTA 3FPKA 2AL7A 1KSFX 2DERA 1F60A 1NSFA 1TADA 5HR5A 3IUYA 4XD7A 4Q47A 4LYHA 2DEUA 3LRPA 4IDQA 1SVSA 3EIEA 3PUZA 2IWHA 2B7CA 3EASA 5SZKB 1V5WA 3CUEF 1SVOA 2CK3D 3Q3JB 4BWYA 3SQWA 1Q57A 1SQRA 2A5JA 2J3EA 2ZU0C 1W2HA 3RS2A 2DB3A 2BBOA 1QVAA 1FX0A 3L0IB 1XF9A 5F3WB 4CEIB 2ZRNA 3EX7C 3DM9B 4JBYA 3KKNA 3SYKA 4UJ5A 3K0FB 2HYDA 2ZVQX 1Z22A 1G17A 4AKEA 1KMHB 2V6IA 4OK6A 4Q21A 5IK2A 3R9WA 3KUDA 4TL7A 5H1YA 4WIAA 3QXCA 1E2JA 2JDID 4Q1AA 1P9NA 2WJVA 3UPUA 1Z6XA 1XEFA 2A30A 1AS2A 4GP6A 2PCJA 2GDJA 3JVVA 2GA8A 1HA3A 1IXZA 4JYCA 3BRWD 4HB4A 4A92A 3KKOA 1FNDA 1F2UA 1KZ7B 2O0KA 3E2IA 3HDTA 2SHKA 3V76A 1KI2A 2V55B 5JMTA 3MJRA 1G8PA 2BC9A 4PO8A 2KSQA 4DLYA 4PQYA 1ZU4A 3WRXC 3LW8A 1YJWB 3WMGA 1H65A 4GI7A 2JLWA 2C03A 3GLIA 3MAAC 2ZRPA 4DVGA 4HLQB 4YMTA 1Q22A 1TQ2A 2RGDA 5LDDC 3B2EA 1EFRA 1YZGA 2XGJA 4O0MA 2BMJA 5AJZA 3RC8A 5GJVC 4LJYA 2QNRA 2ZIAA 1UEJA 3TW8B 4MKFA 4ASUD 1LS6A 5D3MB 4IVRA 4XVRA 1ZINA 3DPUA 3QXXA 3SJAA 3CR8A 3CX8A 4A82A 2QM8A 2QRZA 3T12A 1CKEA 3FKQA 5FH9A 4LBWA 2HUPA 3ONWA 3OAAA 1ZD9A 2VQSA 5F98A 1VPLA 3HR8A 5KSZA 3P27A 4FMCF 3PUVA 4OI4A 4UNQA 1KI6B 1XTRA 2RCNA 5JJKA 1ZU5A 4JJKA 4IDPA 4P31A 2RC5A 1OXSC 4EPRA 3SI7A 3K53A 1HUQA 5JS8A 4YXWA 3TBKA 1ZNZA 2NO1A 3CCSB 1W0JD 5EZ6B 4TMWA 4UNPA 1ZNWA 1LVGA 3T1VA 2AK3A 3EZ2A 4QBGB 4ZDKA 2WOOA 4YLGA 4RZUA 821PA 3H86A 1XD2A 3T1OA 4ZDJA 5IK2D 4BQSA 2J0QA 2Q9AA 1JR3E 5EP1A 3F5FA 3CC4B 4TYNA 4LCBA 3QKUA 3QXJA 4FK8A 3WBKA 4HATA 4C0LA 2ZI6A 1Z2CA 1RC8A 3AVYA 3DOEA 3CZPA 1Y63A 2ZI5A 3U3OA 2ANCA 2RGXA 1WMSA 1E2EA 1WCV1 1N0VC 4C0BA 2V8OA 1EFUA 3P4YA 2YWEA 3IBYA 5DYIA 3GFTA 3GMTA 2W2VA 4PPNA 2GQFA 2FGJA 3SHFA 3U60B 1D1NA 1CRQA 2HF8A 1OGIA 3EPLA 4BLPA 2VA8A 5DYGA 5IF9A 5K8TA 3T1TA 2AD5A 1VYVA 2C9YA 1UM8A 2OAP1 5JECA 3EZ7A 4JLDA 2BM0A 3AB3A 4W5HA 1KI7A 3LY5A 4M4SA 1EFRD 1M1YE 3JQRA 2GRJA 4DQKA 2DFLA 4LJ5A 4BRWA 2JLXA 1X8LA 1Q1EA 3GJXC 1Q7YD 4NYJR 1G1MA 1RYHA 1P60A 2BHRA 2D7DA 4PSAA 5FUVA 2WKPA 1AQUA 1JB1A 3BH6A 5EZ5A 5KDLA 2QTVB 4CRWB 4QJ3A 3ZH9B 5BN4A 2G1KA 4RKEA 1FRNA 4PGOA 1G8GA 3ADDA 1XEWY 1DS6A 1E2LA 1S0UA 2ZAMA 2ZJ5A 2IW3A 1RRPA 1G7TA 2ZR0A 4Q4JB 3LO5A 1G5PA 1AKEA 1JR3D 4S35A 2FEOA 4CYMA 4RD4A 4YALA 1SXJE 1VIYA 1DADA 1RFLA 2FFBA 4EJSA 4II7A 4YXWD 4HZUB 3NG1A 4PX9A 1DBSA 1N5KA 4XJXA 4B2LA 1UJ2A 1K8AD 1EWQA 4QRHA 1KMQA 1NN1A 4XOIA 3W5IA 4JL8A 4WVFA 1N6KA 1XZPA 2JASA 5H59A 2HXSA 1KI8A 1A82A 3QXHA 3EAQA 2KBFA 4TLDA 3SE0A 1YQTA 2MSEB 3UKDA 5CK5A 1VG1A 1N0WA 3AF3A 1N5LA 1Z2AA 1G7RA 4U00A 2C9CA 4AF7A 1X6VA 1IHUA 3SS8A 1AM4D 3RWOA 1GILA 3EPJA 3P1JA 1TLLA 1XEXB 2GXUA 2VIIA 3U7HB 2DCUA 2X1VA 4P32A 2ZR9A 2ZSAA 3P20A 3QKTA 4QFMA 4NL4H 5AUPB 5CITA 1VECA 1L7VC 2ZRAA 2PLRA 3G5UA 1YJNB 3LFUA 2Q9BA 3F3YA 4B74A 3KTAA 3M6AA 1H42A 1IY1A 2R62A 2ZROA 3B78A 4DLZA 4OQXA 4J0QA 4HAVA 5DN6A 4ESHA 1JR6A 1NP6A 1WA5A 2OZEA 2BOVA 5TARA 1WBDA 3THYA 2VZLA 1IAQA 1OF1A 2YINC 3WXMA 4JVLA 3RDPA 2QY9A 1OXXK 3F0TA 3U3KA 2R6FA 4CDGA 1YZQA 1ODFA 1K9MD 3U7EB 4WBSA 3QG1A 2ZRHA 1KI9A 1I2MA 4EIWA 1OYYA 2GK6A 2GZAA 5JHGB 2CE2X 2XTMA 2PMKA 1FRQA 1U94A 2PT7A 1NNEA 2NZJA 1N6OA 4IJMA 1P9WA 4URYR 1MO3A 3B1XA 4KHZA 3QVVA 3QKRA 2WIBA 3VR5A 4URXR 1G21E 1YHQB 4JVMA 5TXGA 4BFZA 3W2IA 4RD2A 5C1BA 3VNVA 4MKIA 4QHSA 1EGAA 3DKVA 3TK1A 2X8AA 4ZI2A 4MYHA 4DBLC 1IOZA 1JECA 3E70C 5EE3A 4ERNA 2TMKA 1VG8A 4N0EA 4V02A 1G7CA 3TVTA 4Q1CA 3LVBA 1EX6A 3EARA 2NMVA 3ZZUA 1CJKC 1E9EA 1NRJB 1Z28A 2IYRA 2A78A 5FI1B 3V00A 2R6DA 4ABYA 1FW6A 3A4LA 2REXB 4KO8A 4Z8YA 4PQFA 4TLEA 1M34E 1W2BB 2P6RA 4OI2A 2OFOA 4HEJA 1Q0UA 5EE9A 4O3MA 4FCVA 1KRHA 1J9ZA 1YZTA 4B6FA 1GVNB 4UJ3A 1DO2A 2GBLA 1K73D 3BORA 4OHZA 3MSXA 1JJVA 3AF4A 1S96A 2G9NA 3K70D 5GJBA 5JSZB 2O8EB 2FH5B 4RVCA 5E95A 1GOTA 4Q9KA 3I5YA 1CR1A 1GKUB 1U90A 2WV9A 3DEFA 4GZLA 3T06B 3EA5A 1P72A 3ZZTA 1Z29A 2YVUA 4I1VA 4B2IA 2F43A 4RD0A 3N2EA 5JI2E 4P4SA 1KDOA 3CC7B 1MT0A 3GPLA 5E4FA 2IS1A 4NBSA 2WWXA 4LGMA 5FL7D 1A7JA 4V0ME 1OXUA 3GLHB 1ANKA 4Y9UA 1P2UA 4AURA 3T61A 3C16C 3TLXA 1YI2B 3LV8A 3FGNA 5H5JA 2O8EA 3NBXX 4FXPA 4GDFA 3OJWA 1OHHD 3B60A 5KNBA 4NYJQ 1RIFA 3T34A 4JT2A 3TJZA 1E0SA 3E20A 1WRBA 5J4HA 1KO1A 1II9A 4LHYA 4MRRA 3SDZA 6Q21A 2XZOA 3DHWC 3C5HA 1Q3TA 4V0NA 4Q03A 1BO6A 1QVGB 3LQRA 1GNQA 4RJLA 4Q18A 5FPTA 3NVAA 3W5JA 1ZIPA 3QE2A 2VP6A 5ANRB 1JPJA 3AGPA 2QGNA 3UATA 2CCKA 3GP8A 1XTJA 1E1QA 3CZQA 4KYUA 2ANBA 4F7DA 1GRQA 2IT1A 5J40A 2CLSA 2ZJ2A 4OJQA 4A0GA 3JQQA 4B3XA 2FEMA 4L16A 2WMOB 3UWKA 4AI6A 3LW7A 3ADKA 2OK8A 4I1OA 1TQ4A 4AKIA 3U3RA 3IPXA 2VP2A 5AJVB 2C99A 5CM8B 1OV4A 3U6KA 2WWYA 2OM2A 3DMDA 1E79D 2O5VA 4ZKEA 1E98A 4TSFA 1WQ1R 3ASZA 5EP4A 2ODBA 1CNEA 3S1AB 1W7AA 4IDHA 1XP8A 4N1AA 5C2JB 2WHXA 2CJWA 1VQ9B 2JLYA 2LKDA 2ONKA 3A1VA 3FDIA 3WY9A 1G20E 3I72A 1GVHA 4ZGQB 4F91B 4QJ5A 1N6PA 4A0HA 4DIDA 3AM1A 2ZYTX 2GXSA 1DVRA 2OCYC 4UNRA 1FNNA 4LRWA 1BIFA 4TYPA 2WAYA 4HAXA 2WZQA 3GJ3A 4IEIA 1SVIA 4B33A 3V4RA 3QNUA 4U5XA 1AK2A 1BMFA 4E07A 2QBYB 5IT5A 2FFHA 2JJ2D 1JB9A 1S2MA 2RGCA 2FX3A 4DT1B 2GJKA 3TRFA 2YWHA 3ADCA 1KC8D 2RB4A 3CRW1 2FWRA 5K8UA 3SN6A 2ZQ5A 1US8B 3X2SA 4QHYA 1R8SA 3ZLJA 4EPVA 1YITB 4RD6A 1II8B 2VEDA 1ZUHA 1CJUC 2NO7A 1XMIA 3AKCA 3G4SB 1G18A 2XNDA 4NDZA 5E7JA 1E1QD 2G77B 3B1ZA 1NLYA 3B1YA 3CCMB 5GJCA 2FOLA 2IX3A 4NCNA 2A7QA 2YWFA 3DZDA 3NWJA 2YHSA 1KK0A 1OKKA 2HT6A 2K5UA 1PZNA 4P0TA 2B7BA 4HDCA 2NO0A 3GEHA 2O8BA 3LBNA 1F2TB 3R20A 4C9BA 3O8BA 3DZ8A 4QGAA 1P73A 5F2EA 4JLBA 4GNKA 3IBGA 4QL3A 4Y7CA 1ZD1A 2ZUDA 4G5SA 4JL5A 3CRVA 1JA0A 3TUIC 3UMFA 1MO6A 3A1UA 3FB4A 4EKDA 4ACAA 4M1TA 4M1KA 3GCGA 1A1VA 4FCWA 1VQMB 1SHZA 2VTKA 1N6NA 2IYVA 1ZM3A 3EZ9A 2CNWD 3D7MA 1ZP6A 5AN9A 3PUWA 1T3SA 1NVXQ 4TQAA 1NKTA 4HDOB 3ZVRA 1CNFA 4BRUA 3VMFA 2JLSA 2XTNA 2ORIA 4GT1A 5LB2A 1W34A 5JZVA 3OZWA 1VQOB 1U98A 2QQ0A 5FTJA 5KNDA 3FKSA 1CIPA 1F20A 2J46A 4B35A 2R9VA 1XPUA 4CEJA 3ETLA 4LBZA 3AF0A 3JZMA 2CCGA 1VYTA 5CIWA 2YZ2A 4ZI3A 3WHKA 4ZCMA 3WNBA 4V0LA 4KLNA 3SYNA 2NO6A 2JLQA 4QC2A 2J5XA 2B8TA 3TIFA 2XJ4A 1B2RA 1P2TA 3W2FA 4GL2A 1CQXA 3U4QB 4D2IA 4ZCIA 3OIYA 4Q1FA 3L0PA 4DLVA 2FA9A 4KI0A 4N3GA 5BYKA 2PEZA 4KXFB 5EUQB 1A8PA 1IJEA 3PG5A 4MRSA 3DDCA 1COWA 4C0KA 4WZAE 1UEIA 1ZUNB 4LWZA 721PA 2H17A 5H70A 1G19A 2R6HA 1VG0B 2ZS7A 1TPZA 3REFA 4AF6A 2ASEA 4JKYA 3LXRA 4R2HA 1GFIA 3FFBA 4YDSA 4DSTA 3FMOB 2QE7A 2V6JA 4FMDB 4JBXA 4JJZA 5DNYB 3THOA 2XNDD 3DO6A 3U7FB 4Z8XA 3ZVNA 3VO2A 2I4IA 1N2CE 4F4IA 2FU5C 4TLBA 1YU9A 3OESA 1XNJA 1HV8A 4IVPA 2JIZA 1EESA 2RGNA 4JVSB 4DLWA 5KOYA 3G71B 3RC3A 3EPHA 1E0KA 4MUAA 4JSYA 3VX3A 1G6OA 1E9BA 2WJYA 3CIOA 1AGPA 4JT4A 4MGZR 4PSKA 4X8LA 2H1LA 3L0SA 2VNIA 4BUJA 3CD6B 5BW8A 1NN0A 3KB1A 4BGDA 4DZZA 5BQ5A 4IEEA 3PEWA 3VU9A 2R2AA 3GLFA 1R5OA 3PJRA 1XZQA 2EYUA 2ZI9A 1QDEA 1M90D 1G3IA 4OHWA 4PZLA 5JCPA 1T3LA 3ZQ6A 1P2VA 1CR4A 5CYOA 1XU4A 3TQCA 3IIJA 5J4VA 1KI4A 2F1RA 4URUR 5FBLB 2F1HA 4TTRA 3ZQJA 1A2BA 1G291 2GCOA 1XPOA 1E2HA 1TTTA 3WNCA 2VL7A 2OEPA 4IOKA 2Z0MA 1VMAA 1Y3AA 2H57A 2RC6A 2EFHB 4IDOA 3CMEB 5LBIA 3I8XA 3K09C 4Q00A 4QG7A 1HQYE 2QTZA 3AQ4A 4DCTA 2WJJA 3CPWB 4LV8B 3RS3A 2F7SA 2VNJA 3DVLA 2J45A 1S8FA 4MA4A 5JRJA 1GL7A 1OIVA 3QFSA 1DOAA 4RCZA 2FPLA 2OXCA 4W5JA 4Y0VA 1UKYA 1VDZA 2QPAA 3W5UA 1F48A 2EW1A 2P3SA 2VSXA 2ZYVX 2JAQA 2Q3HA 3FVQA 1N3BA 2UZIR 4UNNA 4WW0A 5FPHA 1NI3A 2WWGA 2GHIA 3BFKA 4Q4HA 5H68A 3UG6A 3X1WA 1K5GA 3NXSA 1FUUA 4Q66C 1GAWA 2BJWA 2JCSA 2QE7D 1Q81D 2BN4A 4QKQA 4NCKA 3KKPA 1SVLA 1AS0A 4K8OA 1FMJA 1QGAA 3W5VA 2FPMA 1GO2A 2J1LA 3CNLA 2VF7A 2DWQA 2D06A 2XXAA 3QXSA 1IY2A 4Q4LA 1CP2A 2J41A 3EC2A 4O2LA 1DEKA 2HJVA 3N2IA 1D9ZA 3K0EA 4IFEA 5KUTA 1IB0A 3EXAA 2JIZD 4AYXA 1U8AA 4LV5B 3ZIAD 4JLOA 2WKQA 5KSYA 4V03A 3CNNA 4GP7A 3IO3A 4NCIA 4FINA 2VBCA 5HPYB 4Q1DA 5AJWA 3PUYA 2ZSEA 2LKCA 3TNFA 3NEYA 2NPIA 1YJ9B 2J9RA 3EG5A 2VP0A 2OAQ1 1EXMA 3H1TA 1XDBA 2XSZD 3RRZA 3MJHA 1XMVA 5DHFA 5GVRA 1G3MA 3SFZA 1VIAA 3KX2A 2CNDA 2HV8A 1FX0B 4PFSA 4BLQA 3QPUA 5BXQC 5JS7A 1G3RA 4MYTA 4ASUA 3AEZA 3EIHA 3LAWA 1KJZA 1FQJA 2QSZA 3HR7A 4PPGA 2QA5A 1RJ9A 1T3HA 3REGA 1XE1A 3CRMA 4DSUA 2CLCX 2G83A 1QFJA 1KO4A 1OB2A 1CULC 2CDNA 5LPNA 2BBWA 4PHHA 1T91A 3IDQA 3VNUA 5L3SA 2R6CA 2IYLD 4DIEA 3H4MA 4D4MA 1GIAA 4DCVA 4A36A 1JQJC 1QFYA 1G5RA 4H1VA 1F2UB 4PO1A 3OZXA 3TUZC 4KFRA 3RRYA 3VR4A 1SKYB 5TDHA 1W0JA 5DI3A 1JXOA 2VYFA 2F6RA 3FYHA 3GJ0A 1DAIA 1XTSA 2OCPA 3ASYA 1YR6A 1XBTA 4D4JA 2VH5R 3AKDA 4ZCLA 3KQNA 3WYAA 1XXHE 1W46A 2FMXA 4LOAA 3GLIB 1FNCA 5FTNA 3ZYCA 2BMEA 4R71A 2CBZA 2VO1A 4Q7KA 4BLTA 5IHPA 2GEUA 1T5LA 2GTPA 3C4JA 4PZYA 1S3GA 1XCPA 4C43A 1OPXA 3LO8A 1W44A 2BDTA 1JEEA 3MWJA 4PC6A 5EQTA 5TR9A 4TZ0A 3H84A 3OFND 2R6GA 1W35A 1CJTC 2B8WA 3SHWA 2E1RA 5E3HA 3FTQA 4LPSA 4C3ZA 2ORWA 2P5TB 4PR0A 4BFSA 1QRAA 4HI0E 3MMPA 1SGWA 221PA 1NLFA 1OXTA 2WM9B 3O8DA 4AD8A 3TSWA 4DLSA 3CNOA 3EWAA 1FTNA 1VTKA 3DM5A 1E94E 4C0AC 3OIWA 4AK9A 3Q5EA 3VTKA 5E7IA 1LS1A 4Q5IA 2IWRA 1Z6AA 5FUXA 4BLOA 1CLUA 4C0SA 3C8UA 4X8HA 2G0NA 1DE0A 4EQ6A 1XD2B 2VHJA 5AJXA 1XRJA 4OK3A 2XNJA 2ZREA 4KVAA 2WJHA 4LC1A 1Q12A 2GAAA 1FP7A 1T5IA 2AKAB 3OW2B 1ZW6A 3BGWA 3K9LA 1JR3A 1QHIA 3MFYA 5ELXA 3R8CA 2NPFA 1IN7A 1UKVY 3LLUA 3LXXA 1S3SA 1JEDA 1Z0FA 5FI0B 4HAWA 1KTVA 1XTIA 1U2RA 3GLIE 3OE7A 2QAJA 2F3RA 5HXBA 3CPJB 5JEEA 3U2QA 4GMXA 2ATVA 5HE8A 2G6BA 2BJVA 1E32A 3AP3A 3QVUA 3CONA 4DHEA 2BMDA 2QROA 3I56B 2CRVA 2DY1A 3I92A 1IXSB 3GJ4A 1XD9A 4TZ6A 4RD3A 4DQLA 2O8DA 2FN4A 4PQRA 2GEVA 2FSIA 2AN9A 4DWJA 4B34A 1BX0A 2G88A 1Q20A 1TAGA 3DKPA 1YR9A 4Q9HA 5FTLA 1ZNXA 1SVWA 1IONA 1M2OB 2E87A 1VQNB 4GPTA 2O52A 4HLDA 1U99A 2QMEA 4ZGNB 3CPHA 1RRFA 3PVSA 1UF9A 2EWVA 1Z0JA 1H8HD 1JPNA 1R5BA 1U8ZA 4NU0A 5CIQA 1E9DA 2PT5A 3CH5A 3CPEA 3AGQA 2IYQA 3NBFA 3IHLA 5HCIA 1UAAA 2VPPA 1QHGA 4WZ6A 2ZUCA 1YHNA 4Q48A 4OYHA 1DDIA 3KDSE 1KAOA 2H7VA 4BFXA 4H9GA 4ZKDA 2ZVPX 3ZJYA 1AGRA 4IKEA 4EJSB 4PAOA 1NG9A 5JJIA 4RFSA 5F9FA 2WJGA 1J8MF 2OE2A 4PAQA 4TMKA 1VQPB 2RGBA 3CW2A 1KY3A 2O0JA 4FI3C 1SM4A 2CCJA 4TYQA 2ZANA 5P21A 1MH1A 1BH2A 4I99A 1W5TA 3BK7A 2ZYUX 3BFXA 4LJ7A 2WICA 1GITA 1GP2A 2D4HA 5EXPA 1J99A 2JGNA 3MCAA 3ADBA 2IUUA 1OW3B 2IS2A 1KD1D 1KIMA 1NVVR 3WMFA 3LD9A 3CRZA 4MGIR 2IYTA 3BH0A 3TGPA 3IGFA 3ZS8A 5DISB 4QGHA 3I1FA 1G8FA 1ZD8A 121PA 2F55A 3FMFA 1HEIA 4QHTA 3PQCA 2GZDA 3L8YA 3KTAB 3K70B 5G41A 2ZRLA 3GLGB 2BF4A 4A2WA 3CCQB 2OESA 4X8OA 1TMKA 5FFMA 2BEJA 5G3ZA 1T4GA 3RS4A 3U3MA 2HCJB 2ZRBA 3THYB 1E9AA 3QENA 3W9YA 2WSSA 2DPXA 3NBYC 4M53A 2ZI7A 3OIUA 4NONA 3QBVA 3KJGA 2AKYA 5GVSA 1N6LA 3EA0A 3KXIA 4ARZA 2NGRA 4DUGA 4BFWA 2EFGA 4DDTA 1FZQA 4EJSC 3X1ZA 4DDWA 1E9RA 1N8RD 5B57C 2EU8A 2GXQA 2ZJZA 1G16A 5CJ2A 4UKDA 5DLQC 3VR6A 3GLGA 4NTZA 2ORVA 4B75A 3I4LA 4TYWA 2A5DA 2WSMA 1NY6A 2B92A 4CZ2A 4QGGA 1EP2B 3QKRB 4UXJA 2OFXA 3VHLB 3SJZA 2WIAA 1VQ8B 2JLZA 2G1JA 2OT3B 5FL7A 5D3QA 1E2MA 3B7GA 1H8EA 2A5YB 2V7QD 3I61A 1SXJD 1IXRC 2PCLA 4MRPA 4C7OA 2HT1A 4LC0A 1YE8A 1Z06A 5HZHA 5FPKA 5LB4A 2AFIE 1W0KD 2B6HA 4EH1A 2QPTA 2Q3FA 1OHHA 5UKDA 1QBKC 2W0MA 4M1MA 3A36A 4R98A 2KE5A 4MUBA 3R9IA 2AXPA 3CF2A 4RSGA 1KK3A 4RZXA 3NKVA 5AUNB 1X8KA 1AZTA 2UKDA 4FCTA 4M9SA 3K9GA 4PHGA 2JEOA 4I4LA 5AK0A 4C0JA 1KI3A 3M4YA 3K70C 3KXLA 3D3QA 1NF3A 4GOJA 5J5CA 2N42A 3B82A 5FOVA 1QG4A 1JJ7A 4BFVA 1B0UA 4LJ6A 3OZUA 3T1QA 3TAHA 2ZRFA 3BE4A 2CLDX 2VLIA 4B4DA 4MDFA 3A1SA 1X8JA 5DHAA 4MH0R 5AWFC 5FBWB 2WWIA 2GETA 1CEEA 2QDXA 4WAUA 5HKKD 2QORA 2YKGA 4W5WA 5DGXA 2W58A 3IO5A 4MGYR 1S9DA 1ZC4A 3W8RA 2F43B 2ZRGA 2VSOA 1GRNA 2WSSD 1OJLA 4P4SB 2KB0A 2PL3A 1YVDA 1RE0A 1E79A 2GCPA 1ZM4A 2A5GA 3OEEA 4JLMA 4TT3A 2EFCB 2X2EA 3SR0A 4HLUA 1IN6A 4BECA 1QHXA 4FWIB 2Z6VA 2YC4C 4DUGD 2L0XA 2OLKA 4PAMA 4L8GA 4NMMA 4I1SA 4TL8A 4A1FA 5FBQB 4X8MA 5KHOC 4V0MA 2ONJA 3CRQA 2FFQA 4JLJA 1E2FA 1TF7A 1E63A 3A8TA 2ZSBA 1AKYA 4G3XA 4D81A 4DB4A 2X77A 1ZUIA 4BFYA 4CT4B 5AJYA 1KHTA 4IOJA 1PV4A 2IL1A 1YZNA 1N5IA 2QEQA 4Q19A 3IIKA 2HXYA 1NIPA 4A2PA 1OXVA 4ZO4A 1H8ED 3ZZ0A 2VP4A 2WBLC 4HAUA 3GQBA 4W9MC 3CCUB 3QE0A 3QY0A 1GL6A 3JQPA 4Q9IA 3OEHA 4S2EA 3QIAA 3B9QA 4EFLA 4PTLA 1AIPA 3EZ6A 2HLDA 2JJ2A 2CVFA 2BPOA 4Q9LA 1NBME 1E62A 1QGZA 1Z8FA 1NN5A 5FBRB 3R7WA 2V1UA 1CTQA 1XJCA 1II0A 1TVCA 1KKMA 3B6EA 4EPXA 1QVRA 3RABA 2GBLC 2AX4A 2J0VA 4FW9A 4ZIRA 3P32A 1YZKA 3NBZC 1QUEA 2IS6A 2A3RA 2QTLA 3K0SA 2FDCA 3JZAA 3KB2A 3KJIA 2Q21A 2ZEJA 1KYIA 3LNCA 3Q8XB 2PBRA 4AY2A 4BFUA 1WP9A 5CJPA 3NDBB 3W6NA 1VCNA 4YAOA 5FR1A 4EPYA 2CJWB 2O8FA 1Z0DA 5CLLA 3CC2B 1EFCA 2BCGY 1T8UA 3NDPA 4Q7MB 5HE9A 1QHHA 5BYJA 1NVVQ 3KL4A 2HYIC 4TMXA 3SBEA 3MRSA 4JLKA 4GRAA 5EE1A 3NH9A 2PIAA 1E2KA 2OFWA 3C15C 3PFIA 3BB3A 4TL6A 1VYUA 3CB4A 2D2EA 4Q4AA 1XTQA 1Z08A 1HE8B 3BS4A 1QHSA 3OEED 8OHMA 4TT3D 4DCUA 4A6PA 3MLEA 2CNWA 1FFHA 4F7WA 4OQNA 2VHQA 2F1IA 3CF6R 4Q02A 2FG5A 2P5SA 2IYYA 4G5QA 2ZI4A 4QNRA 1SVMA 4N3NA 2RGGA 3GFOA 2DYKA 1XEWX 1EWYA 4UQOA 4BASA 4HYYA 1CBUA 1J90A 1I2DA 4LDJA 3IEUA 3AVQA 1KSHA 4OI0A 2C96A 5G53C 3Q7QA 5FA6A 2GKSA 4BEJA 1YR8A 3GLHE 4U02A 4NZYA 2WVJA 2GILA 2Q3MA 3VKGA 1OLOA 4ZV4A 3PEUA 4LX0A 5FOWA 4Q1BA 1SKQA 2AR7A 3CF0A 2FF7A 3MWKA 1M7HA 5FR2A 3THXA 3OEHD 2DHRA 3K9NA 1DELA 1QGYA 3K0CA 1LB1B 2HLDD 1DG3A
chains in the Genus database with same CATH superfamily
3MJFA 1EVLA 3U8TH 1ENOA 3WL7A 4DY4A 1VP3A 1EP5A 3DMTC 3U4AA 3FDFA 3GA5A 1S81A 5F8XA 4KQKA 2XVXA 2I6FA 3FW1A 4UTXA 3N9IA 2RJ3A 3GMSA 1HAGE 2BGIA 1OVMA 2GM3A 3OF2A 4GECA 2FHPA 3QOWA 2UUYA 2E4XA 1O2KA 3VKWA 1JMKC 3HCDA 4ZMBA 3ZHVA 5EQJB 2IYEA 2HDWA 2I3BA 1PJRA 5FNZA 4CMGA 4BV3A 3S7ZA 5T8KC 1LPNA 4LBYA 1EK2A 1FNBA 3E1SA 3D5EA 2I7TA 1N2CA 4G0VA 4Z7JA 2JZCA 2YXDA 5BPEA 1D4AA 5BOVA 1F6BA 4D3SA 1TCUA 5DO9A 4K9OA 3FMPB 1GEGA 1NMYA 4I6GA 1KK1A 1BDAA 3HSSA 5AFZH 4D7FA 4O8ZA 4B09A 2A7XA 1CVIA 3D2AA 4RY8A 3RVDA 1VKZA 3VTFA 1ISPA 4Q7JB 4WH8A 1SOUA 1I1HA 1IM8A 3ST7A 5D2CA 1ZMOA 1NROH 4CM8A 4X8TH 5C7OO 4JN6B 2BR5A 1FONA 1RGQA 3R23A 4QJBA 4BN4A 1K97A 2WZBA 2AW3A 1RQXA 4PGHA 4BLSA 1GPBA 4LJ9A 3HY3A 5JBAS 4IIJF 2KX4A 2KCOA 1RJ9B 3FZNA 2IZ6A 3PHCA 4JYTA 1RJEA 4F4JA 1MENA 4KUEA 5ALZA 3S2UA 1UCYK 1QB8A 2CNOA 2IJOB 1FP2A 1BGXT 2FGKA 2R8BA 3AVVA 1LX6A 3AEUA 1D9IA 2A0XA 3V4SA 2DQYA 3EWNA 5JANA 1P74A 2FEKA 4YAFA 3L6CA 1PR2A 5DZSA 3NETA 1H93A 4LQLA 4L4UA 5DBHX 2JGKA 2AF4C 4HG2A 1CJVC 3FXAA 3W7BA 4RNCA 3IVCA 3QA3E 3KSUA 5I4CA 2PFGA 2Z9JA 4XQCA 4BNTA 3PV0A 4GOLD 1PPCE 1GJDB 1X1DA 3UMYA 3TKAA 4X44A 3OWXA 4HDSB 4LY3A 1FZTA 1UIRA 1H8DH 4DT4A 2QVLA 1MFZA 1EAYA 3NT4A 2ZRKA 1ZMLA 4I5EA 5MGBA 2XOKD 4OHUA 1W73A 3TN7A 3U7QB 3AR5A 2MINB 3AXSA 4BN0A 2BEWA 4FZJA 1KU0A 4XD7D 5IXJA 3T7TA 2B78A 4PSUA 3Q3YA 4G0UA 4CKWB 1JMVA 1RPJA 5C18A 4B6EA 2IEZA 1RRKA 3RUCA 3ACCA 3ZV7A 4B3TB 2ZSHA 4WQMA 4RFSB 2ZP0H 3TINA 4V0OA 3EIQA 2A6PA 4OHPA 4ED9A 3UJNA 2DWOA 4XAQA 2G17A 4R2IA 1V8OA 3KUCA 2ZJ6A 2Z98A 4MNYA 2ZB7A 5JCXA 1XLWA 1ZGHA 2GEFA 2ZNKH 1OSSA 1TZKA 1G3CA 3I2YX 3GHHA 1RVV1 1WB5A 1UXGA 3QRWA 1V41E 3LA6A 3P2MA 3LYHA 3G59A 3Q2OA 3ZGXA 1QSGA 1CIJA 4R8MA 2OCBA 5K0GA 4JJEA 1O94D 1O5AB 5FHRA 4W82A 2ADMA 2WA1A 3DT9A 1TRHA 1X7WA 5I9MA 3H5AA 4PZCA 1LNZA 1E6CA 4PC1A 3R24A 1Q83A 1G21B 5KSWB 1BKDR 4C7OB 2QN6A 4OIMA 3SKYA 1FYVA 5I7OA 1G9XA 1O35A 2UUKB 2JW5A 4CM9A 4NJEB 5KQMA 3HWSA 5G40A 3JALB 3OCJA 2QAIA 3WWPA 2OZLB 4IOLA 2CDRA 5L7TA 1S72B 1QIGA 2QX8A 2CLMB 1XEXA 1OLXB 3JALA 3RT9A 3EDXB 1YR7A 3F4BA 3OLZA 3G1TA 3SJBA 1ISSA 2VIWA 2W3IA 4MWTA 1K2WA 3M6FA 1RJDA 2PKEA 2ZFTA 3Q7EA 4YFVA 1HIAA 1O37A 4Z86A 3CH7A 1NI5A 3KVVA 3BDIA 3R0VA 3E8MA 3SPXA 1XLUA 1SPJA 1LW6E 3PF8A 2NX2A 3O8QB 5T6MA 3T5DA 1E7MA 4QU5A 4WXRA 1QV9A 2EP8A 5ALLA 3BDAA 2ZB4A 3E4CA 2OYSA 3W2HA 4JY7A 1J7KA 4DLTA 4OQDA 1TBQH 3AK4A 3AVOA 3ZHCA 3PLAE 1YQDA 2GBIA 1TQ6A 4IUDS 3O83A 3EYDA 2CDAA 3FPEA 3OPNA 1V0FA 1W4LA 2VDWA 3BBPA 1G2MA 1RRGA 1YOVB 5JBBS 3MS4A 4JVNA 5ED4A 1EOJA 3NS7A 2RHMA 1VBFA 2WDPA 1O1YA 1DAKA 5HCUA 1V8FA 1W4BA 4ZAYA 4EHHA 4WOPA 4FOUC 4H6VA 5F2OA 1SO8A 4HGOA 4G37A 2J87A 5IAGA 3H2YA 1MXHA 1B23P 1NBMD 2VHCA 5GPIB 3OZDA 1SHHB 1CHDA 4BJ3A 1L7OA 5BN3A 2OV6A 5ADVA 4C4ZA 2B61A 2QD3A 3PXGA 2MMGA 5JBIA 1V2ST 4HWTA 4RVOA 3SV8A 2ZFQH 1NPYA 1EFPA 1QE3A 3AUUA 5F5LA 3NTUA 1A5ZA 1FF9A 2DQZA 1VJ5A 4RMIA 5JXIA 1BE8A 1RTLA 3WLIA 2DBQA 4X7BA 1Z7GA 4LZZA 1RD4A 1UPTA 3RAFC 1B0EA 3FP6E 2W71A 3R9XA 4YDHB 4L9SA 3G2QA 4RDLA 1XKBC 2ACWA 3OZ7A 3UG7A 1NBAA 1II8A 3U4GA 2ZSIA 5T4BA 1YZUA 3GLRA 1F2TA 3TJUA 4BVBA 3MGBA 3Q3GE 3JR7A 2BLVA 2H5DA 1SHTX 4LYJA 4F92B 2FEWB 3V4OA 4B85A 2GKOA 3AVTA 2JGFA 1JEJA 1P2JA 3QI2A 1Q14A 4ZZ1A 3DEKA 2G5VA 1MV5A 3CEJA 3V3MA 2Y77A 1XFAA 3QEBZ 4NA8A 2WWRA 2XC4A 2W43A 2HK8A 2WU4A 5MF6A 1NVUQ 3SZRA 1REQA 3M7QA 1BJKA 1J0EA 4QXPA 3K09A 1YHYA 4ZPXA 3U5ZB 1ZJJA 3ONNA 1JDTA 3S55A 3GCOA 3SNHA 5E8EH 2H0AA 3SMQA 2XZDA 1T8MA 2GZMA 3I05A 4XB6B 1OH8A 1Y0RA 2Y0CA 4M7GA 1GG8A 1Z63A 1HT1E 2LNDA 5ENDA 4EGCB 3PR1A 4GZ5A 5DBGA 3AKYA 4HEQA 3VNAA 1GQOA 3FY4A 1AGNA 4MVJI 1UBMS 2CHUA 5LD2C 3RUIA 1NM5C 2O8TA 2C2HA 3CXUA 3L46A 4G01B 2VDQB 2CV0A 3HA5A 4V0KA 3D5TA 2C93B 2FPUA 2JDIA 2RD2A 3ZY2A 4DXHA 1W2GA 2YV5A 5J5AA 1BKSB 2WW8A 3BXEA 3P92A 3D2LA 2XLCA 3KQQA 4EUNA 5GADl 1TL7C 4D82A 2IHYA 1OH6A 3FLAA 1EFDN 4NAUA 2EZTA 1TU4A 1ZOLA 1ESMA 1Z0AA 5FTMA 4PLHA 5FBVB 4Q6WA 2QIPA 1I1QB 5LLDA 4CG3A 3ESBA 3BREA 4IO1A 3NOXA 2GFHA 2F64A 1ZRBA 2X5KO 3BUSA 2YIVX 4H3HB 1HXHA 2A5AA 3DFUA 4HGYA 5E6TA 4D96A 1R9MA 3Q3EA 2ZVQX 4E2XA 3UJ9A 1GBKA 4Q21A 3KUDA 5JD6A 1SKBA 2TRMA 4I2VA 4WK0B 3KUUA 3L6BA 5I25A 3UAIC 1XWWA 4MJLA 4DC1A 3QJGA 5A7GA 4FFMA 2IIVA 4ZKRU 3IPLA 3VB4A 1KI2A 3NZIA 4EWLA 4PS0A 2C03A 4XIYA 2E3JA 2QW8A 4I0WB 1GDQA 2RGDA 3BZBA 5EZSA 3HDGA 1BMMH 1FBTA 4UDWH 5B3AA 3H8SA 3TW8B 4NZPA 2TMGA 1IEWA 3JARA 3V4PB 3ZDZB 4UDNA 4RS4A 1MC4A 1USUA 4JJKA 5JROA 2X0KA 1GAEO 3VPGA 3NAMA 3M5OA 4TMWA 3FNFA 4ZDKA 3SKBA 1XD2A 3HVRA 1H4VB 1SSXA 4LF7B 5EP1A 4B2AA 2OCVB 1CO7E 1Z8GA 1JQDA 4C0LA 1WCWA 3CZPA 3PC8C 1L5VA 1N0VC 4HIZA 2QUJA 4AJPA 4F5EA 1ELTA 1T35A 2OENG 4BLPA 2EG5A 5LR6A 1VYVA 4JXZA 3EZ7A 3LY5A 4CV1A 4YAGA 1ZIDA 1LO6A 3L8FA 4TXHA 3WB9A 3JX9A 2R00C 3BH6A 2HOQA 4WHMA 1C0IA 4F8EA 4FLMA 4ZAXA 4W8OA 4URFA 1ELDE 1E2LA 5BV1A 2OBTA 1CHNA 2C97A 1GHWH 3PC2A 3LO5A 4O97A 1DADA 3Q8KA 5EGMA 1DBSA 4HOYA 1SGFA 4L72A 3OT1A 1PJ7A 3LHKA 3RVQA 3EVFA 3ZCUA 1PK8A 1T4UH 2C9CA 4JASB 3RWOA 1W1IA 3CEHA 3KV1A 4F4HA 3P1JA 2VNSA 3DVAA 3P5SA 1Z45A 1VECA 3AHIA 2R62A 2BLNA 4EUHA 2DPYA 1R4MA 4NF2A 4D3FA 4K9RA 5M2QA 3ZKAA 2QUHA 4TKZA 3AERB 2NTVA 3KHKA 2O54A 1KI9A 1LPZB 2ZIVB 4XYGA 3VR5A 2O7RA 3ENKA 3USZA 3W2IA 3F3MA 1YR3A 4ZREA 4FC7A 3TK1A 3A2KA 4DBLC 3N7AA 3O3NB 1LK5A 3I2KA 4DA4A 2DUMA 4QQNA 4X1IB 3ZZUA 3V00A 4IR7A 2MR6A 1VMIA 3A9SA 1XNHA 1IZZA 2FTMA 5LXTB 2FKAA 2FG6C 2ZDGA 4HEJA 4PGMA 2FRDA 4O3MA 4K5ZA 4B6FA 3JZ2B 2KMLA 4R54A 1NVMB 4OHZA 3KJZA 3VVCA 5E95A 3SU6A 5CHAB 2YWJA 1TGYA 4B2IA 1VE6A 1NVKA 5F52A 1A7JA 3OMWA 3TRDA 3T61A 2HVYB 1C9YA 5KNBA 1AUXA 3VPCA 1P80A 1II9A 1PS0A 3IUEA 4GPZA 1A9XB 4CTNA 1GL0E 1YCGA 1SLUB 1S6FA 4RNDB 4OJQA 4EKGA 2FMHA 3IDZA 2IYAA 2OK8A 2FESH 3F6UH 1HE2A 1HO3A 3IPXA 1SC9A 1CW2B 3TK5A 1Z16A 2NSDA 4N54A 3OT5A 5DG6A 4QE3A 2LCQA 2XQIA 3DMTA 4YJDA 3UZUA 4X92A 1G20E 3I72A 3RIEA 4L95C 4G0YA 4FYVA 3FZDA 5DYNA 3N75A 4DC0A 4LZNA 3ROFA 1H9IE 2FX3A 2PMBA 1IBSA 2ZUWA 2W98A 2FWRA 3LP5A 4TVOA 1NVBA 2VKTA 1XM1A 2I99A 3M83A 2JIBA 3RM2H 2XNDA 1F17A 2FOLA 2KCPA 3ZU2A 4MRAA 3G9ZA 2B7BA 2XVAA 1MQ8B 4CH8B 2XC5A 3R5JA 4JLBA 3KEQA 4JL5A 5T8KA 3MUOA 3I09A 4M1KA 2HK7A 2YXNA 2ZEBA 2CNWD 1ZGJA 4QD3A 2UZ1B 2DLCX 1OX1A 3BD8A 1HFWA 2TMDA 3FZEA 1XPUA 2XWQA 3IKLA 4ENVA 4PZUA 1XQBA 3BG4C 1VYTA 2J3IA 3FOBA 1DWEH 3VVLA 2B8TA 1USWA 2OYRA 2XJ4A 4GL2A 2SBTA 3O8OA 1OAAA 2VBGA 3HV2A 5BYKA 5ALGA 4KB5A 6GPBA 1FDIA 2J48A 5BN5B 5K9ZA 1R4NA 2RHOA 4YI3A 1D07A 1XDUA 4GPGA 4ZOLB 1HUTH 3ZVNA 3EIUA 3IKTA 5EJ8A 3LXMA 4KJXA 3SBXA 3IMCA 3TG2A 1EESA 2VYNA 3E22B 2ATEA 1JUDA 3Q6RA 4MUAA 1TUGA 1G6OA 1NFWA 1P7VA 1R5OA 4Z4WA 3ETJA 1BVRA 1HLDA 2ZPUA 3R4CA 3IIJA 3OX7U 5DP7A 1UCFA 4QOHA 2GCOA 3T7RA 1E2HA 5I45A 1PP4A 1CNMA 3ZVKA 3QZRA 2QNIA 3CPWB 4UTOA 3FR8A 1QH8B 2EEKA 1GTSA 2QPAA 3L33A 4CLDA 5AFSA 3TLOA 3ABSB 1XO1A 2BN4A 2F3CE 3JU3A 1F0RA 3UWIA 5B7NA 1HJ8A 2J07A 6PFKA 1U8AA 3SNEA 1BMTA 4LV5B 4EM6A 4ITVA 1JYFA 1VL6A 5AKGA 2AVDA 3OLVA 2D7JA 1LBQA 4LF6B 3IJPA 4R4JA 2W6QA 4UE3S 2NPIA 1YJ9B 2J9RA 1AHTH 1DFHA 3MJHA 4P2GA 2J9GA 1W59A 2I4LA 3PTZA 2C3PA 5LYJA 1KJZA 4DQVA 4LOKA 4IFTA 1XE1A 1VJSA 4JHLA 5LPNA 1EX9A 3DZGA 2HA2A 4ZZ0A 1ZD2P 1G5RA 1DU4A 3ICPA 4CR5A 1W0JA 4R8KA 2OCPA 1YR6A 4D4JA 3VNBA 3ANYB 5KQGA 2I6UA 4LOAA 5DX0A 1OZGA 3NHMA 4PO3X 5F76A 4PZYA 1UJ5A 4X3OA 4OUKX 1C1NA 3MWJA 3V1UA 3SHWA 2E1RA 4DR1B 1WS6A 4OXNA 4BFSA 4V3BA 1DUIA 4BO3A 2IU6A 1FTNA 3DNFA 2P3FH 3QU2A 1Y6FA 1QG6A 3FNBA 2IPXA 4XDZA 2IWRA 2XTTB 5FUXA 3WK7A 5AJXA 5FHQA 2AMQA 2A5KA 2GD1O 2NPFA 3IV9A 1S3SA 5DMXA 2XQKA 2QAJA 5REQA 5L6NH 4C22A 4XW2A 1TGBA 2G6BA 1TBZH 2ZPSA 4M36A 2CC2A 4XOPA 5DXAA 1TAGA 4Q9HA 1RKQA 2A1UB 4HD8A 3RSGA 2EWVA 5H4IB 1FE8A 1KKUA 1UH5A 1G8MA 1U5AA 3SP1A 1CE8A 2X40A 1U1FA 4CIAA 2HNKA 4HRXA 3WNVA 4EJSB 4ME6A 1ONPA 1XHEA 1PR3A 2VLBA 2VPYA 3OOSA 1DSTA 2Q1SA 1BH2A 3HJFA 4UTVA 1JAYA 1DBQA 4MVNA 1LBSA 4MGIR 4KWCA 4HNGA 1HEIA 1TABE 4R51A 5BRNA 2GH1A 3ZLTA 2TGTA 3GY8A 4M55A 3GLGB 3EGEA 4E2WA 3T1NA 4I4CA 3F5DA 1OWEA 1L7NA 2WI8A 4XVHA 5AKLA 2F3UA 2QB5A 3FTNA 4NFEA 4Y9SA 1V1MA 2IOQA 3TLMA 1NA5A 1AV6A 2EU8A 3GLGA 3ZTYA 2B92A 5I9SA 1NT2A 4CZ2A 3L0ZA 4UXJA 5FL7A 5CNIA 1SXJD 2HIMA 3PL1A 1M6WA 2FLRH 1N92A 1RHQA 5KECA 4C89A 1QBKC 2W0MA 2NN3C 2AOTB 5EG5A 1STOA 2AXPA 2R3SA 4M9SA 2JEOA 3I77A 3MU5A 2Y71A 1OTYA 3ONEA 1UBRS 5CBPA 3LE8A 1QG4A 3TAHA 1Z13A 4I9UA 1A0HB 4MDFA 4DLBA 1ZR4A 1X7GA 3F5MA 1CEEA 5FJIA 1PUXA 4YJ2B 4ZKNU 2OBBA 2FR0A 1W10U 1WX1A 4PLPA 1ZN2A 2DHCA 5TQ0A 4I1SA 4A1FA 3WBFA 3NAQA 1TF7A 3TOZA 1TM2A 1AKYA 3N8GA 4YP7A 1N5IA 5E2IA 2H2DA 2VP4A 2P35A 4QYTA 5FBRB 1RJGA 4AP5A 2WF5A 5J58A 1LTOA 3P32A 2P69A 1Q7TA 3AJ9A 1HJAB 3KJIA 3LPDA 4L4YA 4NESA 2HIAA 1RLJA 3W6NA 4XYEA 5CLLA 3CC2B 5E4TA 1P2GA 3TLJA 3CR3C 2PD4A 4E5YA 1BUIA 2VBSA 1VYUA 2Z4TA 3O2JA 1SZJG 5I9TA 2BFAA 3N1UA 4MWEA 1OP2A 3MN1A 1XE3A 3ZWXA 2YY5A 3TTSA 2E5WA 1BGWA 4G5QA 1T0BA 1NRIA 1QFKH 4Z4YA 4A1VA 1UAGA 2M6SA 2K2QB 4RA6B 2DKNA 1H6BA 4OSEA 4FEEA 4QLOA 5I7FA 4BCCA 3SV6A 5DCLA 3G85A 1L7PA 1OS8A 2PU5A 4XX0A 3WYFA 1ISMA 4MV8A 4X06A 5ALWA 3BM5A 1GMCF 1M8JA 2UYQA 1T8LA 3HXKA 3ZVMA 3MQKC 2PV0A 1MP0A 2H16A 1JTFA 3S70A 4Z4CA 3PX7A 2A9PA 1L1JA 1CY8A 4PFJA 2AUTA 2HM7A 4X3PA 2E37A 1KERA 1ADGA 4YLEA 3C8HA 1OC2A 4RULA 3UANA 1F5NA 3GVIA 2ZHEH 2OQIA 1VCIA 3IVMA 3R2JA 1EUDB 1QH9A 4JUCA 3U0BA 2ZIZA 2REBA 4PNZA 1PPBH 4M0KA 1K6XA 4KV9A 3OU2A 3E9ZA 3TQFA 2JIOA 2DBZA 1EAXA 1OE0A 1DAPA 2CHFA 5AMXA 2GZ9A 3D8BA 1J2TA 4HVCA 3M5LA 1JIJA 5PNTA 4KFCA 3EQ8A 2BFFB 3ZLUA 1K8YB 3U7GA 3NWEA 5IH3A 2PX0A 5TCCA 3CNBA 5M7EA 5BR7A 1W4RA 1E2BA 4EG3A 1XCJA 4BY9E 2ZTSA 2BCJQ 5BSFA 1P09A 3K9WA 3RHFA 5DBEX 3F9HA 3Q0TA 2BFFA 4G5XA 4O4IB 2AGEX 4N40A 4V2UA 2E9SA 1Y6ZA 1NM5A 2KLBA 2RGNC 2J0EA 1GJBB 5EIBD 5ICFA 1I2BA 4NSVA 4H6SB 5H3HA 3CVWA 3QX9A 2AS9A 1G30B 5AK4A 1IUKA 1E96A 2GAIA 1GI6A 1PE0A 4E5MA 5C0OE 2J7PA 5DCWA 1QH1B 1P0QA 3K8OE 1PWEA 1OI3A 4B3MB 3TI7A 1T1GA 3N2GA 1DKLA 1EBBA 1D3TB 1LVOA 2BDIA 4AY3A 5IS2A 1WZEA 5L3SB 4CVNA 3I73A 1AX9A 1Y89A 2OCIA 4QEKA 2WT8A 3BTOA 3C3JA 3FPAA 5F7JA 5LCXA 4RHFA 4VGCB 1ZQ1A 2OXEA 3MWYW 1ISHA 4Z54A 2G63A 4R1TA 4ETIA 3I9KA 2AFHE 5IVKA 1N0UA 3ZVBA 5KWEA 3A4MA 2PUBA 3S8EA 2C0PA 2HDOA 1DARA 2DBYA 4Z9BA 5FEUA 4G4IA 1VRVA 2Y9PB 4BZXA 3UY9A 2AGGX 3JASA 5H0IA 3R8FA 1U1EA 3IBSA 2BKUA 3RNOA 1ES9A 4I8DA 1PPHE 1M8PA 3LUCA 3V34A 3KAPA 2PT6A 3E2MA 4E06H 3EH2A 3C4VA 3KS9A 4RLZA 1Y7PA 2GF9A 1CZRA 1DDJA 1DLIA 5FCRA 1P1HA 1R0WA 4FQ7A 3VPKA 1S8AA 1LC0A 1QYWA 1CXZA 3FOEC 2VTBA 1GCUA 4RVFA 3B1KA 5IYTA 4TLMB 5CM9C 2JKHA 2QUAA 2UAGA 1Y4UA 4C0HA 4IGKA 3ZV6A 4ZCRA 2D0DA 4FR0A 4L75A 2HMAA 4UXHA 4MW6A 2F9OA 5HIAA 2YN0A 1VSVA 1KE2A 3SN8A 1W9HA 3PC8A 1TU3A 3QEMA 3SZEA 3B1VA 2BZ0A 4D9BA 3IMKA 1CX9B 2LE0A 1NXQA 2QP3A 2DUNA 1KNQA 4ZVSA 1NJ1A 2NUTB 2R00A 2PSHA 4J1YA 2CF6A 4OXYA 1AVWA 5GV7A 3ACBA 1PNOA 1J70A 1XLVA 4OHBA 3TO5A 1XX9A 1T9HA 5LYJF 5KOHB 4XNFA 4PZZA 2I7VA 3KWLA 3SV2H 1ORFA 2F3QA 1JSXA 3RUOA 1SCNE 3GJ5A 3UKJA 3ZI7A 4MDHA 2QGRA 2Q0HA 4ISIH 5MHTA 1T6ZA 1G37A 2XE6A 3T9DA 1T8WA 4Y0ZE 1UOEA 4EKYA 3KCNA 4LRSB 4WUVA 4BE7B 2OCLA 4LZAA 3OIVA 3O90A 5E7MA 2J0SA 4HEA1 1W14U 4I4NA 4E5VA 4S0ZA 4JEIA 1E4EB 4GNRA 4Q4JA 2X2FA 1MAVA 3RUEA 2WK1A 2H11A 1Y7HA 1U7XA 1D2AA 3C45A 1L5HA 4DSNA 1EFHA 1BT7A 1KSJA 2FZCA 2X0FA 2CBXA 3I53A 1SQ5A 5IFLA 4UAVA 4UVGA 4DMCA 2YJ4A 3K0BA 4FIDA 2WYUA 3QXGA 4HQRA 1I8DA 1ZXXA 1XN1A 1PT9A 1U8YA 3KXKA 4UD6A 5ALOA 3HM9A 1GFWA 3KB6A 3UUEA 1TPOA 3UJCA 5KTYA 3T3MB 2PJRA 5BQOA 3GCZA 4YOJA 1OIWA 4MDSA 1UD3A 1NMXA 4BTIB 4HNUA 1O77A 3KLPX 3LX5A 5JCJA 4E7OA 5HYVA 2WTNA 2C3OA 2VIVA 3A6EA 4FZRA 3B3AA 3UAWA 2IUSA 3VYWA 2VCEA 4GBED 3H6KA 3MJVA 1LPOA 1ZITA 1EX7A 2YW2A 1Q86D 1I6MA 1Z7WA 3HDYA 1MUEB 2XYPA 4DRXB 1QIKA 2VYVD 5KDDA 4V0SA 3WQSB 4B3RB 3VH1A 1Q2WA 3NWUA 1U31A 1XQVA 3WB2A 3USCS 4GVUA 3TQRA 1BTUA 4XTRA 2ORYA 1GGMA 1ZGBA 3W3AD 4DRXA 5FP0A 2GLTA 5HZMA 3EXEB 1C4V2 5D5QA 3I0NA 4BKPA 4YAUA 1GPKA 3G8BA 4UZUA 2NZ8A 4MWSA 3A7VA 1C8VB 4C7JA 4QPDA 5U9CA 5EE5B 3B20A 3QEKA 4RENA 4ZT5A 3ON5A 4LF8B 4RTLA 3AUXA 4UCXA 1MR3F 3OYPA 5T6DA 2WNIA 1IQJA 3TTTA 1FPMA 1T24A 3PR3A 4H1TA 2ON6A 1JALA 5BSTA 1WPQA 3Q40A 1P9SA 2FSHA 4M46A 4HH4A 5ARDA 4LY9A 4M1OA 3DR5A 4MV4A 4IINA 5KNCA 4MS1A 3ZE6A 2W4QA 4OKNA 4BPRA 1IWPB 2FEAA 2IS4A 3WFJA 4EB0A 4IQ4A 1UXIA 3I76A 3MMXA 1MMFB 1RWKA 2VZ8A 2QAGB 4MW1A 4MYCA 1TB4A 1KYXA 4YRAA 4AX9H 1C1YA 1HFJA 1QF6A 3IA2A 4O5AA 4Y10E 3SJ9A 4EGQA 1C2YA 3MI4A 5JRZA 4DIBA 3GF4A 2QAGA 3VGJA 3KQHA 3JRXA 2ZOSA 1I3MA 2QTRA 4DM7A 5K3FA 2HGTH 2AHOA 3AFGA 1GZVA 4B76A 1MMJN 1Q3XA 1E20A 4EGSA 4F3KA 5I9IA 2D2FA 3TSAA 1GCIA 4XUEA 1TRNA 1TQDA 1MQ5A 2ZYGA 3I1IA 3SQDA 1SXPA 3EOZA 2KCYA 2XNIA 2ZDQA 2QL6A 3LC1O 3OZRA 4I81A 1V2JT 3DDYA 4R8VA 3ZWWA 4F5DA 1GI9B 1TZMA 2OWDA 3U3XA 3BWBA 3IDOA 3B3GA 1GNRA 3RUDA 4HAZA 4MI3A 5CA0B 4H3SA 1XQWA 3C7CB 3RAPR 3TIGA 2YRFA 3D8TA 3RODA 3UJ6A 4OQLA 1R3DA 1I4DD 4AY6A 3UNRA 3RI3A 3C2QA 2O8CB 4LXUA 2ZJAA 5IDVA 3P2KA 3OF5A 3NNNA 3UAXA 3ROXA 4EL5A 2PRYA 3OY5U 1F6DA 1ZRMA 3FX2A 2O8CA 1F4VA 1YLOA 3ZC3A 5C1YA 5KSOA 3D3WB 5LQSA 3TFOA 4KOAA 3W34A 4CIYA 5ICGA 4G81A 3G0GA 4KTCA 5EXTA 4EHLA 1UBTS 1F60A 3T51B 3FLMA 5DP8A 5KJEA 1PSWA 3M7TA 4BWYA 5GONA 2ZU0C 4W9NC 4IZ6A 3FZYA 1HB0B 4ZYTA 1T3GA 5AH0A 1JRTA 1L8OA 1BHSA 4MQUA 1NNSA 5B5SA 1NS3A 2IBTA 5JE8A 1Z62A 4BXOB 2O57A 2C2OA 5BVGA 3AM3A 3VGPA 4QYIA 2BC9A 3VVBA 4LF9B 1SUAA 2WYRA 1VM6A 5IFKA 4G7WA 4AQYB 4KQXA 3H1GA 4KIGA 4C1BA 3UJDA 1OD6A 1TQ2A 4RVDA 4PQGA 2CJPA 5JCOC 4U9HS 4XVRA 1ZINA 4O4IF 5DNEA 5TF4A 3WJ7A 3CX8A 1WTGH 1DPGA 3EBLA 1RBMA 3ROEA 4UNQA 5DGHA 4EG6A 5KQLA 5JJKA 1EQ2A 1KMMA 5EZQA 1QB1A 3SU2A 1HQKA 4UD2A 2FLWA 5EZ6B 1TT5A 2WOOA 2GDEH 5EXLA 1PW7A 2FSPA 2BFBA 4KLRA 1VA5A 4MB2A 1XYYA 3QU7A 2PX8A 3ZHSA 3FPSA 3NBAA 1WMSA 5EJ4A 4DCDA 3SLNA 2XUFA 3ZJVA 4UVIA 4JENA 1TUBB 4WJZA 1ZOIA 3ROMA 4U32A 2BP7A 4XI9A 1P4HA 5ALEA 2DFLA 2BDUA 1RYHA 2Q3EA 3IFSA 4HDRB 2QTVB 4CRWB 3RS8A 3P2JA 2VDJA 5HOEA 4UTRA 5BUQA 3AJ8A 1R74A 4I4IA 1JR3D 2EX0A 2WPIS 1UD5A 1JT2A 3C3PA 4OXQA 1NO9H 4HDRA 4HPWA 2JASA 4CBNA 3GRZA 1J2UA 4LDZA 5THQA 1K3FA 1ZVMA 1P1JA 2FOBA 3IP1A 3RQSA 3U7HB 1KZ4A 5CFQA 4NL4H 1Z5OA 3KVOA 1YJNB 4KPUA 1GLGA 2ZROA 1RXSA 3N8NA 4IIDA 1TFRA 4K8BA 2D1FA 2VXOA 3LXUX 3DR3A 1MB4A 1TI7A 2IOFA 2G1PA 3QG1A 1YPHE 4N5LA 2FR8C 5G0WA 2OBQA 1F0YA 4W8HA 1NNEA 3SG0A 1ORTA 1JIRA 4KHZA 5CNJA 3RXBA 4JVMA 4WV3A 5IP5A 3FPJA 1QNJA 2C8ZB 3R5KA 4YJGA 1A9ZA 3GWGA 4MCJA 3I9FA 1SIUA 2OD3B 1RI4A 3HCEA 2Q2WA 3ZV9A 2QK4A 2C4TA 4R81A 2WA2A 3OE5A 3L77A 4OQYA 2SGEE 1DO2A 2I54A 3BORA 3PHJA 1RJWA 4Q9KA 5AM2A 4NMXB 1BBRK 3I5YA 3CMCO 4X00A 2QRVA 2FDRA 4RD0A 3CC7B 3I6IA 2P6OA 3GK3A 4CFSA 2B4QA 3RIGA 4A1OA 3SW2B 2YXPX 4RLQA 4DV7B 2SICE 4NYJQ 1V9CA 4L2IA 3BWYA 1K6EA 1X19A 3B3QA 1ZUD1 4DABA 3JTEA 1IQIA 3LQRA 1GNQA 3M9XA 3WADA 3ESQA 1W7GH 2VP6A 4FU7A 3MU0A 3SLRA 3ZVFA 3WQHA 2D6FA 4NGAH 1Y37A 4AKIA 3NALA 2C99A 3L5OA 2PWXA 4E7NA 1W0YH 4CR8A 3ISVA 3EVNA 5CHAC 1QTRA 2VIPA 4OQ4A 2C31A 1CNEA 2PYDA 1ID8A 3E1GA 2VK8A 4NU8X 2IODA 3VYRB 1UOQA 2G5TA 1CUAA 2BF7A 3PT9A 3PA8A 4YLUA 1TLFA 2HD4A 4EOGA 2FXVA 1BIFA 3GJ3A 3E8LA 2ZPAA 1K98A 1AK2A 5IT5A 3DOIA 5AOVA 2YWHA 2K0QA 3VYTB 1V35A 4L7VA 1C5KA 3FD8A 3JR3A 2VF4X 3ROGA 2DP4E 3EZXA 2VEDA 1ZUHA 1CJUC 3G4SB 2IX3A 1DWBH 4X6OA 1D6RA 1YJCA 5G4LA 4RDHA 3KSDO 4C9BA 3J7TA 2JFBA 1DPOA 3HKDB 2R85A 1OP0A 2ZJ0A 1TCAA 4EKDA 3A1UA 3VISA 2Z8XA 3M3SA 1XU7A 3F4LA 4WEQA 4LA4A 4GT1A 4B81A 4WFJA 1RFNA 3ETLA 3KJFA 1J5PA 3TW0A 2QN8A 4V0LA 5KTMA 2XEDA 2AV6A 2HJWA 4MUJA 1O5EH 4Q1FA 5WRFA 2Z1MA 1A8PA 3OTPA 2F9FA 4LWZA 2JB9A 4M8KA 3WQQA 3FANA 3BSWA 3ZTTA 2QE7A 1O3GA 4C7MA 4NATA 4DQDA 4RVNA 2KM1A 3DO6A 1MZVA 5JLAA 1O3LA 1HZEA 1MVLA 3GEDA 4O29A 2FOIA 2VOJA 2UWLA 2XW6A 2RGNA 4JVSB 3GGSA 4RKRA 8ATCA 4ENTA 1CZUA 4MGZR 1B2LA 3OY6U 5EIWA 5CUQA 2A4RA 2XMZA 5JYIA 1PJLA 2G71A 4CCAA 4EG1A 4TTRA 1KZ6A 1LX7A 1J8QA 1EAUA 2OV8A 1SBZA 2LDBA 4MA4A 4DV6B 2R0LA 1OIVA 1A3CA 5KC9A 1GSHA 4BB5A 5FPHA 1GGKA 4H7IA 3LOUA 1Q81D 3PTBA 4P12A 2IHZA 1U28C 4JJGA 4R0MA 1YDEA 1OU4A 4UAGA 2PRIA 1WPXA 5HMMA 5HPYB 1CBWB 2VF5X 3WGNA 3NEYA 1EXMA 4JMYA 3SFZA 1HLTH 1HCGA 4RDKA 1FQJA 1RJ9A 4A27A 3TDMA 1RZVA 1Z2NX 1OB2A 2X5NA 1SLXB 3CVVA 2FEQH 3E90B 3BAZA 2R6CA 4ID9A 1JQJC 2ODTX 4REOA 3MT7A 1F2UB 1GPZA 1P6QA 3TUZC 1RAAA 5HFNA 2X14A 2PGLA 5K8JB 3VBCA