4ACAA

Crystal structure of translation elongation factor selb from methanococcus maripaludis, apo form
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
469
structure length
444
Chain Sequence
HMDFKNINLGIFGHIDHGKTTLSKVLTEIGFSAFKLENYRITLVDAPGHADLIRAVVSAADIIDLALIVVDAKEGPKTQTGEHMLILDHFNIPIIVVITKSDNAGTEEIKRTEMIMKSILQSTHNLKNSSIIPISAKTGFGVDELKNLIITTLNNAEIIRNTESYFKMPLDHAFPIKGAGTVVTGTINKGIVKVGDELKVLPINMSTKVRSIQYFKESVMEAKAGDRVGMAIQGVDAKQIYRGILTSKDTKLQTVDKIVAKIKISDIFKYNLTPKMKVHLNVGMLIVPAVAVPFKKVTFGKTEENIILNEVISGNEYAFELEEKVLAEVGDRVLITRLDLPPTTLRIGHGLIEEFKPIKDLNIKKEVLREGKVKIDKGRTVIDGLAQSKVAAEKLIGEEISIEGKDIVGKIKGTFGTKGLLTAEFSGNVENRDKVILNRLRRWG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Selenocysteine tRNA-Specific Elongation Factor Selb is a Structural Chimaera of Elongation and Initiation Factors.
pubmed doi rcsb
source organism Methanococcus maripaludis
molecule tags Translation
molecule keywords TRANSLATION ELONGATION FACTOR SELB
total genus 98
structure length 444
sequence length 469
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.190 Mainly Beta Beta Barrel Thrombin, subunit H translation elongation factor selb, chain A, domain 4 4acaA04
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4acaA02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4acaA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4acaA01
5FPSA 2N42A 2ZU0C 1OB2A 1QVFB 3ADKA 1XFAA 3BH6A 1AKEA 4B4DA 1P72A 1Z6GA 3T5GA 4HLUA 4XD7D 4URVR 1VQNB 4TLAA 3QEJA 2GTPA 4IDNA 1CULC 1SVMA 3I56B 3K0CC 4DLTA 4XTRA 2DWPA 2GKSA 5FOUA 1UBFA 4FMDF 5FPYA 1N5JA 3G71B 3QBTA 1AZSC 3VFDA 5C18A 2GILA 1UKZA 5EZ6B 3QXCA 5G41A 2NTYC 3BB4A 2AWOA 3O47A 2Q9BA 1YRBA 1BKDR 4N0DA 2F55A 1GKIA 5G3YA 1XD8A 1ZIOA 3K09A 2YV5A 4PAQA 1P2VA 4Y9RA 4GZMA 2HMAA 3T1VA 1RPZA 4XTCS 3CMEB 1EFRD 4JLBA 3QPVA 2F1RA 1TU3A 1XEXA 3G5UA 1QGAA 2QTZA 1F48A 1M6NA 1XCMA 2BN4A 3VNVA 3FVQA 3TAHA 3N70A 4Q01A 2V6JA 4Q4JA 3N2EA 1GAQA 4JVMA 2OM2A 2XEXA 1R0XA 2ERXA 5EXTA 5KSWB 5TB5A 5JJKA 5HCIA 3PEVA 3E5HA 3O8RA 4A92A 3LD9A 4RZUA 1HE8B 4PPQA 3ZD6A 4N3NA 1E9FA 3CF0A 3AF1A 1XD2A 4BFYA 1QUEA 3PENA 4HAXA 1GRQA 4TMWA 5LB2A 3G6EB 4A8JA 3B5JA 3QXXA 1AS0A 1WRBA 2PZGA 4V0MA 2VP9A 3HR7A 3FFBA 1JNYA 4G5RA 1QH0A 4M9QA 3IGFA 3IQWA 3K0AB 3GLIE 1XRJA 2DPXA 3U5ZB 4HB0A 2E87A 1OH6A 2D06A 2EFEB 1Z22A 3QIAA 4CEJB 1P6XA 3CCMB 1LF0A 1W36C 4Y7CA 2OZEA 1ZNXA 4LGMA 5E4FA 1IB0A 1E1RD 1K9MD 2YOFA 4HB2A 2OG2A 3AP1A 3I3SR 3LVRE 1RKBA 2JIZD 2X3UA 3AVOA 4Q1EA 3RWMB 4DLYA 4KO8A 1W2HA 1D2MA 1DTSA 3T1OA 1Z6AA 2OCPA 1JB1A 5AN9A 3C7KA 4PC2A 2AHOA 2DR3A 3ZIAA 3QKRB 1CR4A 1E2GA 4S2EA 1OH7A 1KRHA 1E2EA 4LK2A 2QMUA 2X8AA 3GEHA 1SXJD 1W5SA 2I4IA 4GP7A 4AG5A 4CEJA 2QAJA 3U4QA 4F4IA 1ZU5A 2QT0A 4YXWD 4QJ4A 2DWOA 4LPKA 5BW8A 1W0KD 3WNDA 4CZ2A 4G01B 4Q47A 1SXJE 4A8JC 4IKEA 1DAHA 3K09C 3MJRA 3OAAA 4BUJA 2ANBA 4BASA 1D9XA 3KJHA 2J46A 2VO1A 2RGNA 3VHXA 1F2UA 4KSCA 4GBMA 5DI3A 1J2JA 3K53A 2QP3A 2ZRMA 2QI9C 2G9NA 3CH5A 4EFNA 5J4HA 3LX8A 4XVQA 5D3QA 2BSAA 1M8PA 3TRFA 3VU9B 2QY9A 2XNDA 3K9NA 3MSXA 5TXGA 1NG9A 1TQ6A 1VCIA 4MGZR 1SXJA 4NP6A 1WF3A 2CDNA 3BH7A 1R0YA 4W5HA 2V6IA 2FOLA 3Q7PA 3K70C 4UXHA 1R5NA 5BYJA 5KSYA 3GLFE 3GLGB 5C1BA 1XPUA 2PMDA 1J8MF 4UNNA 1Q0UA 4XWOA 3AH8A 3OIVA 4M1SA 1JJVA 2XNCA 1XEFA 4PPNA 5E7MA 5FA6A 3O8CA 1GRNA 1R4AA 3BGWA 5DYGA 5K8LA 2IHBA 1YZTA 5KTYA 3CB4A 1AZTA 4ESVA 3ZVMA 3SZRA 1L7VC 2CLDX 1OIXA 2JAQA 3KTAA 3LBNA 3A1VA 1Q1ZA 3U6KA 3ZVLA 2IYVA 3RLFA 2BMEA 3CC2B 1T91A 5EZ5A 2R65A 4CT4B 1WDTA 3PVSA 1TQ2A 2VRWA 4C30A 5JI3E 2OXCA 3WYFA 4QFMA 1P2SA 4HAWA 1E63A 3VKGA 2AK2A 2J87A 3B2EA 4L9WA 4NYMR 2XOKD 1J90A 1F20A 1S1CA 3SYLA 3TQFA 1E79D 2ZI6A 1NN5A 5AJWA 1QGZA 2BGJA 3BB3A 4ITRC 3FKSD 5GJWC 4RFSA 4ABYA 2LKDA 2BIFA 2VF8A 3OW2B 3SJZA 1KDRA 2WJVA 4RKEA 2QRNA 3I72A 2IYQA 3FPAA 1GAJA 5KSPA 1NIPA 3B1YA 1HT1E 2DHRA 5HZKA 4MYHA 1NKTA 1U90A 3VR4A 4H9GA 1XCGB 3QNUA 4QL3A 1G3RA 4OI1A 4DIDA 1QVAA 3IPXA 4IHQA 4TYWA 5KNCA 4HB4A 2NO0A 5AUQA 2O0KA 1NMZA 3KQUA 1IM2A 1JR3A 2GCOA 3I62A 2RKOA 2ZI3A 2FFQA 2ZE7A 4TWZA 3PUZA 3V76A 3CCSB 2GK6A 1QRAA 4JSTA 3RC8A 2B7BA 3EG5A 3OHMA 4B2IA 4YMTA 2OHFA 3BXZA 2DBYA 2I1QA 4N3GA 1I2DA 3DOEA 3IBYA 5J47A 2QTVB 3OZUA 1YJ5A 1FTNA 3W3AA 2XOKA 4RJLA 3BJIC 3CX8A 1Q12A 3QG5A 4LBWA 3BWDD 6Q21A 3OIWA 1S0UA 1PUIA 4PR0A 3W2GA 1E2QA 3PUYA 5J4VA 2IYSA 1E3MA 3FB4A 3CZPA 3KKOA 4TL7A 4CEHB 1T5IA 4BZXA 1TX4B 2AXNA 4NPHA 2OBMA 4OJKA 2ZRNA 2QA4B 4G1VA 3CC7B 4DSNA 1QHGA 1X8KA 1QDEA 1DDIA 3NBZC 4DEXA 3QENA 1AQYA 2ODWA 1EX6A 1NVXQ 2OFOA 4O2LA 3NBFA 4JYCA 1E0SA 1KK2A 4DCUA 4DUGD 3K70B 4QHYA 2HDNB 4KBFA 3TQCA 2IX3A 2P6RA 2CXXA 1E2LA 1G8FA 1U81A 3QJYA 3QFTA 1J9ZA 1WA5A 1N5LA 1DPFA 4DIEA 3MCAA 3DPUA 4KVGA 2W2VA 1LVGA 1NN3A 4DLWA 2GXQA 2NO7A 1NY5A 2G77B 3IIMA 4OHVA 4Z51A 3TUJC 1L4UA 1FOEB 1O87A 4PC7A 2CNWD 2KB0A 2OFXA 2C98A 5FUWA 2DFKB 3SBEA 5CITA 3IILA 1JB9A 5HE8A 5BQ5A 4A8JB 3OEED 4YAFA 4GFDA 3ZDQA 1FX0B 1Z06A 2EVWX 2GCOB 2ODNA 2QDXA 1QHYA 1SHKA 4BPRA 2FJUA 3DEFA 3A37A 4K1XA 3TJZA 1RVDA 1HE1C 1YIJB 2H57A 3TUIC 1Q1EA 1G19A 1EWQA 2IUSA 1BX1A 2XTNA 1TQDA 1N2CE 3LW7A 5IDVA 2YOHA 1G7SA 1DOAA 4B47A 3FMIA 1OYWA 3CF2A 4YC7A 1YZQA 2F1HA 3K70D 2BBTA 3I73A 4IVQA 4KSBA 3A36A 2VSXA 3JZMA 4QG7A 1FQJA 1C1YA 2PX3A 3P4XA 5AWFC 1RW4A 3B8HA 4M4SA 1ZYUA 2VYFA 4PPFA 2ATVA 3AF4A 5TY0A 4E5UA 2C5LA 1NVVQ 4BFVA 3MMPA 1S9HA 3D6TB 2QNRA 1KZ7B 4HLDA 1M7GA 4JS0A 4R7ZA 2GZDA 4OI0A 1OH5A 5KNDA 3MG9A 4TMKA 3SJBA 1US8A 1XCPA 3EC1A 4M9XA 4GNKA 4JLJA 1A1VA 3VKWA 1VQOB 5HZHA 2RGEA 1P9WA 1JA0A 2X77A 2BM0A 2F7SA 3JVVA 4TN1A 2PH1A 2VNJA 1NIJA 4ZCIA 1JR3E 1IAQA 3HU1A 3G0HA 2JDIA 3QF7A 3A1WA 2RGCA 3AVWA 2GDJA 1Z5ZA 1IN6A 1WP9A 4HAVA 3AEZA 2IS1A 1KO4A 2QMHA 2GEUA 2X1VA 4FWIB 1N6NA 5LD2C 2OT3B 3QPWA 2GBLA 2QP9X 2G88A 1YITB 1CNFA 2QQEA 4JSYA 1DG1G 4UNPA 4OQMA 3N5CA 3CNLA 5AR1A 4BFZA 3A6PC 5F98A 4K46A 4V03A 4EIWA 3K9HA 4PC1A 4MUAA 4CF7A 3B1VA 1SKQA 4D25A 1U0HC 4ZPXA 1GRRA 5K8UA 2C9CA 2QG6A 1KDPA 3H2YA 3W3ZB 4KVAA 2PJZA 1TTTA 1CKEA 1SGWA 2V55B 3TLXA 5F2EA 4BPBA 4AY2A 2J0UA 5D3MA 1U98A 4D2IA 2ZR9A 1XXHA 2VP6A 1AK2A 1YR7A 2ZVPX 4I1OA 1BQEA 3E1YE 2VHJA 3QUSA 521PA 2NGRA 1UEJA 4MITA 3U3KA 3I8XA 3CIOA 3RABA 4US1R 5CIWA 5EE3A 4P4TA 3W8RA 2Z4RA 2WWXA 2G1KA 2WWFA 4F91B 1VHLA 2ZI4A 4LYFA 2B92A 3KKQA 5JWOA 2GF9A 3PITA 3A4LA 3KQLA 3M0EA 4DLSA 2JEOA 2WHXA 3LFUA 5EP4A 4EPTA 2SHKA 3A4NA 3L8ZA 4FINA 4A0FA 2ZRIA 2NIPA 5FI0B 3KKNA 4CEHA 1KI4A 5K8IA 2P67A 1W36D 2C78A 4NTZA 5H1YA 2AK3A 2A7QA 4FN5A 3W34A 1T0JB 4DEYA 3NBYC 2ZSFA 1XTJA 3R9WA 2IA5A 1XWIA 3FE2A 4A82A 5DN6A 4B43A 5BYKA 2W6ID 2VHQA 4DLUA 2WICA 3CCEB 4Z8YA 2R6FA 4BLSA 3T1QA 1OFTA 1K6MA 3ICQB 3P26A 3FKQA 1DADA 2G6BA 4BWYA 5L3QB 1EFRA 4NHOA 4PHGA 1N25A 5JSZA 1GNRA 4UNSA 5LBIA 4MRVA 2WSSD 3K0AA 2VSOA 3CH4B 4XWAA 3KB1A 2D74A 4ERNA 1W44A 1OXUA 1W4CA 3T61A 1A5TA 2IHYA 4AD8A 4TZ6A 1W0JD 1EWRA 1GZSA 3D7MA 3EC2A 3LBHA 2ZM5A 4N0EA 2FGJA 5KU1A 1XXHB 3PEUA 3TMKA 4G5SA 1ZAKA 4CEIA 4F4CA 1G3IA 4G5QA 1AS3A 1ZP6A 1T8UA 2ZRKA 3S1AA 3IIJA 4ZDWA 3D3QA 4EPYA 1E2JA 3LQQA 3L43A 2CE7A 2JLYA 5JSZB 3K1JA 1P5ZB 2JLXA 4QBHA 4US0R 1AJEA 2O5VA 4R2IA 1QZXA 2JJ2A 4V0ME 3IIKA 1B2RA 2FF7A 3K9GA 4ZKEA 1ZC4A 2WJGA 2GBLC 4FI3C 4Q66C 3SJAA 1KAOA 2ZR7A 2QT1A 1GL6A 2R62A 1IY2A 1RYHA 4D4KA 5BWMA 1XZQA 4QGGA 1MABA 1AMOA 1E9CA 4OQLA 4RD1A 3CW2A 1Z3IX 1ZMXA 1R10A 1N0VC 3G82C 3UG6A 1X86B 2F6RA 1KI6B 2W58A 4YAOA 2LWIA 4LHWA 1IQPA 4D4MA 4TT3A 4GP6A 4JLMA 1GOTA 3W5IA 4R71A 5DNYB 2WIBA 2XXAB 1WCV1 3A1SA 2ZRGA 2FE4A 2REXB 5CB8A 1KDOA 5H8WA 4EQ6B 3W5UA 2XNJA 3VX3A 2JJ2D 3BD9A 4JJKA 1E79A 4MRSA 1E1RA 4C0HA 4Q7LA 1E9RA 1IXRC 5KUTA 3L2OB 2NOAA 3N2IA 1TVCA 4FW9A 2V54A 2WPDA 2QSZA 1GDDA 4JMPA 4KYUA 1G8PA 2DFNA 1E0AA 3NXSA 4MYTA 1XP8A 4XOIA 2X2EA 4TLDA 2H8KA 5FBWB 2B8TA 3SHFA 2OCAA 2R6HA 3F5FA 3IUYA 2CHQA 4TQUS 4TMZA 3BIFA 3LO5A 3VTKA 3BAFA 4IFBA 4AYTA 4LJYA 4NCIA 5FBRB 3BBPA 3HPRA 4JL5A 3KQKA 4Q4HA 5JJLA 1QX4A 1AGPA 1AM4D 4QNMA 4HDCA 3WYGA 1NL3A 4MRRA 3RWOA 2O8CA 5FOSA 1M7HA 1NY6A 2VPPA 3AM1A 3KXIA 3MJHA 4PGOA 1VIYA 2R9VA 2AN9A 3QQ5A 5BN5A 3RRZA 2JLZA 2ZRLA 1YKSA 4A9AA 1T3SA 5CK4A 1YI2B 5AJZA 4EPWA 5EE5B 5HXBA 2Z0MA 3EXAA 3TBKA 4I4LA 5B64A 3HWSA 3NH6A 2G0TA 4KFUA 1G3UA 4B73A 5B57C 3B82A 3KDSE 3KZ1E 4BEJA 1BYIA 1QG0A 4ASUA 3L0SA 1KGDA 4UKDA 4BZPA 1Q3HA 1YZKA 2OEPA 2XB4A 3WNBA 3M1IA 4DHEA 3KFXA 2H18A 5JFGA 5GVRA 5EXPA 2ZYVX 2RCNA 4DKXA 2ASEA 1DBSA 1UBGA 3L0IB 3T35A 2QQ0A 1COWA 3AVYA 1AS2A 2CCKA 5AUOB 5JEDA 1SHZA 4RY2A 5CDFE 1UKVY 1GKUB 4U5XA 1OFHA 3ZJYA 3B1WA 4BLQA 2DWQA 1PUJA 4LC0A 2RC5A 1OXTA 3PCRB 4AKGA 4DQKA 5EE9A 2CNWA 1E64A 1Z0IA 4PO1A 4C0JA 4DLXA 5HKKA 1BO6A 4B3XA 2DETA 4O2RA 5KNBA 3ZS9A 2ZSEA 4W9MC 4Y9UA 2QSYA 1Y63A 1ZM3A 3OEEA 2D2EA 5EE1A 2J59A 2OK8A 2VL7A 3CR7A 2AX4A 5FPTA 2Z83A 4MGIR 3SJCA 4O3MA 3AV0B 3OZXA 2H16A 5AK0A 4L16A 1S9DA 2FV8A 1GL9B 3CCRB 2PL3A 1G9XA 1A2KC 2P2LA 3IQXA 2BC9A 4EH1A 2IXEA 4HAZA 1YJNB 2QGNA 2IEYA 1VQ6B 4LC1A 2YHSA 3JQQA 5F9FA 4HYYA 1JR3D 2HXYA 4B6EA 1KI7A 3CCVB 2AD5A 2QBYA 1W5TA 1FTSA 4DDVA 4ARZA 4RD0A 1HV8A 4UQOA 3SFVA 4IDPA 2H1LA 2ZAMA 1CNEA 1Z0FA 1XJCA 4Q7JB 4C0AC 4CEIB 4LY6A 5M04A 2GXUA 1K73D 3JVUA 4IDHA 2CE2X 1R8SA 4S35A 1UBEA 2ZJBA 4DUGA 2FU5C 1NBME 4KBGA 2P65A 1WXQA 5DE3A 3BORA 1Z0AA 1NVUQ 4KLZA 1ZW6A 1KK3A 2PZEA 2V8OA 4Q4LA 4X8OA 5E95A 4B74A 3FFAA 4E22A 4YDSA 3U3OA 3UK6A 3BB1A 5DLQC 1XTIA 2R44A 3FDIA 3PV0A 5E7IA 1DAGA 4Q4AB 2OCBA 1F3OA 2HEIA 3X1WA 3TR0A 1Z28A 2PEZA 3U3MA 1M90D 3RSLA 3UMSA 3B6EA 3L0OA 5KYKA 2C04A 3GJ0A 2IS2A 2XJ4A 1GTVA 2PJRA 4KYIB 4OHXA 4LCBA 1W4BA 2V7QA 3NBXX 4OK3A 1LS1A 4XWKA 1W2BB 3DM5A 3KJGA 2O8FB 2WKPA 2ZS7A 4OK5A 4M9ZA 4OKSA 2AD1A 3GJ3A 2J0SA 2IUTA 2OBLA 4CDGA 1GNPA 1Z07A 3ADBA 4FIDA 3LBIA 1XMVA 4HE6A 1FMJA 4KFSA 5FR1A 1EP2B 5CB6A 1S8FA 2YWEA 3CZQA 3LX5A 2X2FA 1FX0A 1AKYA 1T8TA 1WMSA 1NN0A 2A5YB 1JAHA 2VP5A 3OF5A 3ZH9B 1BOFA 2IYUA 5AUNB 3LY5A 3KQHA 1G16A 2ZI7A 4URUR 2GJ8A 2I3BA 3LLUA 1P2TA 4QC2A 1ESNA 1JBKA 4W5WA 3VO1A 2QM8A 3CLVA 4HLUC 3U7GA 4R2HA 4MKGA 1CTQA 3DKPA 3QKUA 4LJ4A 2QBYB 1J99A 2RH5A 5DHAA 1NLFA 2W6JD 1D1NA 1OXSC 3JQPA 1ZD1A 1PZNA 4BZQA 2XXAA 3CO5A 2R2AA 5TV2A 2EQBA 4ZDIA 4UXJA 4TYPA 5AJVB 1ZUNB 1P9RA 1E62A 2FWRA 1H85A 4RFVA 1HA3A 5DSZA 4Q9HA 3THXA 3QVVA 3VR5A 1QHHA 4DQLA 1AGRA 4LJ7A 1KDTA 2IUUA 3FMFA 2AKYA 2MMGA 4HZUB 1ONBA 1XMSA 221PA 4AKEA 4YONB 4RKFA 1VCOA 3H4MA 2XB2A 4C7OB 3KXKA 1I4LD 4JVNA 2BKEA 2CK3D 4EQ6A 1KIMA 5L3SB 1A8PA 2IEZA 3PIRA 4PZLA 1ZNYA 3P4YA 4GT1A 2YZ2A 3NG1A 2BMFA 4Y0VA 5D3MB 3DL0A 2PLFA 5CK5A 2C99A 3QFCA 1VQ8B 1OE0A 2B21A 1X1RA 2WWHA 3U6BA 4D81A 4EDHA 4P0TA 2C96A 2KJQA 1IY1A 3CPHA 1TMKA 2V1XA 4LX0A 3R9XA 4TZ0A 2DFTA 1KKMA 3ZLJA 1II9A 4O0MA 4DJTA 4JT4A 1JEEA 4AURA 4U7DA 1NLYA 2BF4A 5DISB 3Q85A 5DYIA 1IN4A 2VHUA 4Z8XA 2A3RA 2D62A 3RYTC 1R5BA 5FBQB 3UXMA 3I92A 5EP1A 2ZRAA 4NCJA 4C0QC 4L15A 3LA6A 2WJHA 4YHBA 1KC8D 3WHLA 3B85A 1K8RA 3DMNA 5AJXA 3WNCA 4NCHA 4UJ3A 2QPOA 1CU1A 2FSIA 4QHSA 1XEWY 4I1UA 2ORIA 2QEQA 3T15A 4L8GA 2YVUA 3SI7A 1JPJA 4TYYA 2QU8A 3DO6A 2HCBA 4HB3A 1FNCA 3VMFA 1EESA 4Z1MA 2EFHB 4GOKA 1FL9A 4WBSA 4AKIA 1W36B 2ZJ8A 4KJZA 4B48A 2VNIA 4KHZA 1CJVC 5SZIA 1SXJB 1ZU4A 4HAYA 3TSZA 1AQUA 2HF9A 1UKEA 3CF6R 2GJAA 1G8YA 1R8QA 1VIAA 1SVWA 4RD2A 3HPQA 2PT5A 3QF4A 4LHVA 4KAXA 2B7CA 2D7DA 1E4YA 1WBDA 1BH2A 3GEEA 3ASZA 4HE5A 4IW3B 1NSFA 1S72B 3I8SA 3THYB 1Z83A 2ZXUA 2RGBA 3ADCA 3C15C 3AVQA 1E9EA 4MGKR 2IWRA 1KO5A 3SE0A 1Q21A 4FD2A 4EJSB 3PJRA 4FCVA 3QKSB 2NO1A 1BJKA 1G17A 1TADA 1Z08A 2IS4A 5K8TA 3LQRA 4Z1MD 1KKLA 1OSNA 2B8WA 2HJVA 1I4TD 4LJ6A 5A4JA 3SOPA 2ZUCA 4ZI2A 2J7KA 2PCJA 4TQ9A 4ZIRA 1XU4A 1FNDA 4DBLC 4MRNA 4PHTA 2A5GA 3RC3A 3GD7A 1L2TA 1XF9A 3K0CA 3NVAA 1PJRA 1II8B 1NNEA 4JIMA 1ODFA 3BK7A 3L0PA 4PQRA 1SXJC 1RRCA 2A30A 4QRHA 1QG4A 3EPJA 1GKYA 2WPDD 3MAAC 1GVNB 1CLUA 1S4QA 4TT3D 4JYBA 1R2QA 3VAAA 1TL7C 4JLPA 1E99A 3FGNA 3SNHA 3THWB 4LSGA 1GM5A 1XMIA 2FA9A 4OI2A 1XPOA 1Q44A 1XJQA 4TMTA 3GFOA 3WYAA 2GRJA 1JALA 3SDZA 2BVNA 2QPAA 3MWYW 2JIZA 4URYR 1Q3TA 2PZFA 4JBXA 1N6KA 4A0HA 5FI1B 4UXIA 1QVGB 4MKIA 2YINC 4B44A 1G4AE 1TAGA 1RJ9B 2CCGA 2YOGA 3EA0A 5JEEA 1IJFA 1QFJA 1FP7A 4Q1CA 3Q3JB 5LD2B 4TMVA 3PQCA 1YZGA 3A1TA 4F93B 4JKIA 4DSOA 1RIFA 4G5OA 2P3SA 1E6CA 2C9YA 2J1LA 1NKSA 1FRQA 4HAUA 2NMVA 2RAPA 3O8DA 4KXFB 3IBGA 4DSTA 1QBKC 4ACBA 3VHLB 1YZNA 4Q4AA 3UWKA 2BWJA 4AG6A 4B34A 4G1BA 1XX6A 1SZPA 2CL0X 2HT1A 3THOA 4CRWB 4EJSA 3Q5DA 4PAMA 1U0LA 3BERA 2OUKA 1RJ9A 2FX3A 1E2DA 1FNBA 4FMDB 2ZRDA 3NH9A 3H86A 1V43A 4DSUA 1VMAA 3R8CA 1HH4A 3EZ2A 2FNAA 2W2TA 2ZR0A 4GOXA 2XZPA 1GR1A 1X6VA 5H70A 1VQMB 3CRQA 4BQSA 1T0HB 4DCSA 5FR2A 1Y3AA 2ONJA 4WVFA 4DXAA 2ZE6A 5J40A 1KMQA 2EU8A 2ZSDA 1KSGA 1KMHB 2FSHA 4EUNA 4E07A 3LXXA 4P6VF 2Y8EA 3BFKA 5EXSA 1GWNA 1VG0B 1G64A 1W49A 5SZJA 3T34A 1H8HD 4P32A 3SQXA 1OT3A 2R6CA 1Q1BA 2JASA 2OE2A 4Q7MB 3EPLA 1IJEA 2ZSAA 3P20A 1DARA 3EIHA 2NPFA 2O8BA 1E0KA 3GLHB 4HATA 4C0BA 5JZVA 1Q1QA 2VSFA 2FEMA 1F2UB 2Q0HA 2XSZA 3WMGA 2IF0A 2Z4SA 1FW6A 3CUEF 2RGGA 5KDDA 1JECA 3Q9LA 2C9OA 3IHWA 1NP6A 4ZCMA 3Q7QA 4A36A 2CJWA 2XX3A 3NKVA 2P5TB 2ZSBA 1MV5A 4C43A 2XITA 1V5WA 4AWXA 2ZJOA 1QHHB 4Q9JA 2A5DA 4W5JA 4QNRA 5BN4A 4GSYA 1Z63A 4RSGA 1NJGA 1ZM7A 3W6NA 2JJ1A 2Z43A 4D4JA 3X1YA 1R0ZA 4LHXA 2XJ9A 3U7EB 3ZIAD 4B75A 1W34A 4NYMQ 4F7DA 3B9PA 3KQNA 1ZCAA 1G1MA 1US8B 1KK0A 1KSFX 3LRPA 4JL8A 2FH5B 3CD6B 2A5JA 2GJ9A 2PBRA 3ZZUA 1B23P 3ZC3A 1OF1A 4YXWA 1NVWQ 5DGXA 2IS6A 1ZUIA 2XAUA 1GIAA 3OIUA 3TVTA 1E9BA 5JWRA 2RHMA 2QGZA 5GJBA 1Q81D 2MMCA 3FHOA 4URZR 1E2HA 1MKYA 4Q48A 3CCLB 3GLGA 4NE2A 2AL7A 2J3EA 4TL8A 2VF7A 1BMFA 2D7CA 4UNQA 1MRSA 2WOJA 1OGIA 3CCUB 5J4KA 1Z29A 5CLQA 4KFRA 4JVLA 1Z0KA 1EX7A 5A5GA 5FOVA 3PUXA 3V00A 1N6PA 3RS2A 1LNZA 4BFXA 1G3QA 4ACAA 2BBOA 3MD0A 3UKDA 5IF9A 1EWYA 1CJUC 1ZCBA 2H17A 1VYVA 2NO6A 3CWZA 4FCTA 1FUKA 2GK7A 2W0MA 2J7PA 2XNDD 3AGQA 4AYXA 4UAJA 2ZANA 1E1QA 2PIAA 2O8EA 5EXXA 2DYKA 2QTFA 1OKKA 4C4PA 3BFVA 3EWSA 5CJPA 4HLCA 4K8OA 2JA1A 1AA9A 1DAMA 3W2HA 2BCGY 3QG1A 4BECA 3ADDA 3EZ6A 2JLWA 1H8EA 3R9IA 1E2PA 3IO5A 2QL6A 1KSHA 1P73A 1HEIA 2QTHA 2BBWA 4PSVA 1OHHD 1U8AA 1GSIA 1Z6TA 2B6HA 1U94A 2VP0A 3AF0A 4OK6A 2BJWA 2VYQA 3L8YA 2OLJA 4X8LA 1LW7A 3QF4B 4V0OA 4URXR 1O3YA 1DE0A 1L4YA 1G3MA 3UATA 2CNDA 1G7CA 1NBMD 4HI0E 2AFHE 4IFEA 4ARZB 3U7FB 2XZOA 1CIPA 2GJKA 2EFDB 3AKYA 4E03A 1C4OA 4KV9A 2IC5A 1ZUHA 5SZHB 4RD3A 3B1XA 4NH0A 1II0A 3W9YA 4BLTA 1SKYB 2C8VA 2QUZA 3AKDA 3F3YA 4LYHA 1I4DD 2QP4A 5KPJA 5FOTA 4OHWA 4FK8A 5JCZA 3NIBA 4TTRA 1ZIPA 1G7TA 1G41A 2FSGA 2W00A 3SHWA 1EK0A 2OILA 2WKRA 3HP1A 2FN4A 3PFIA 4OL0A 2XZLA 3SFZA 3IO3A 1ZM9A 1CRQA 4A2WA 4RZ3A 2V7QD 5JJIA 4OJQA 3BFXA 1XEWX 3CWQA 1U8ZA 3NEJA 3MHPA 1MO5A 3A8TA 3GMTA 4PO9A 4Q18A 1HTWA 4QM7A 1QFYA 3BRWD 2ZEJA 1GILA 4HUQB 3TR5A 3DKVA 5EP3A 3SS8A 4LV8B 3TK1A 1U8YA 3Q5EA 4ZGQB 1QF9A 1TNDA 2OAP1 1D8TA 3WXMA 5CIQA 3E20A 1GUAA 2IT1A 2WMOB 2P0EA 1KQSB 2IL1A 2UZIR 4YMWA 3SBDA 2ZJYA 3JZAA 2F9LA 1DAFA 2WVJA 3WMFA 2WWIA 3WBKA 2JDID 1G20E 1A2BA 2BEJA 2CMKA 5EUMA 2ECKA 5KHOC 4U9UA 2QROA 1WE2A 4M22A 4QKQA 1G8HA 4CGZA 3I5XA 2O8DB 4M1WA 2WJIA 4AC9A 3V9PA 1GG2A 4RVCA 4TLCA 3DZ8A 1PLKA 1RRFA 2V4ZA 1A4RA 4GOJA 4Q9KA 2J45A 1P3JA 4RCZA 3T12A 4B32A 5JLJA 2FPLA 2DY1A 5CJ2A 2GESA 2IYRA 1XPRA 4QBGB 4PFSA 5SZKB 4ZKDA 2BOVA 1XXHE 1W4RA 2ZRPA 4C2UA 1KI8A 4JBWA 1MO3A 1N0UA 4TL9A 5AJYA 5TVKA 1RZ3A 3AQ4A 3LWNA 4AI6A 4Q5IA 1YR9A 1EFHA 5JI2E 3AB3A 3F8TA 1D9ZA 2ZE5A 3DHWC 4JJZA 3RDPA 3PR1A 1ZNWA 1OV4A 2GCPA 2O0HA 5EQTA 2X19A 4CW7A 1FZQA 1KHTA 2CLSA 1KSJA 2HUPA 3Q72A 4BRWA 3OEHD 4QXAA 2DCUA 4WXPA 3MRSA 2QORA 3B78A 4DDTA 3MWKA 2ZE8A 4QJ5A 1CEEA 3J81k 3EWAA 5BXQC 4LJ8A 3WBJA 5IK2D 2F9MA 3FOZA 3I1FA 1Q82D 1VG8A 2KBFA 4P4SB 2R6DA 2RGNC 3RAPR 4P31A 3I32A 4M1OA 4Q4HB 1ZM2A 3KKPA 4C0SA 1EFUA 5THXA 4HEJA 3AVTA 1YJ9B 3ZS8A 2QTLA 2F43B 2GXSA 3U44B 3OJXA 2QAGB 1T9HA 1W7AA 1J7KA 3IDQA 1JJ2B 1KY3A 4YMUA 1EXMA 2W0SA 2IBMA 1YVDA 2AKAB 3FMOB 5LB4A 1SVKA 5FUVA 5KDOA 4XVRA 2OCYC 5EE0A 3GQBA 2ZJ2A 3ES9A 3A1UA 4V0KA 3QVUA 1LV7A 1UBCA 5P21A 1Q86D 1XTSA 2CRVA 1OPXA 1LF5A 4B3BA 5H59A 1DO2A 1NMYA 2CEAA 2P6UA 2ZYTX 1RRPA 1OLOA 3K0FB 1FDRA 2J0VA 2LCFA 2ZETA 1LB1B 1F60A 1XNJA 4XIGS 4IOJA 1SM4A 4G5GA 1K5GA 5CYPA 3GLFA 4ON9A 2QMOA 2W83A 4MDFA 1KJWA 3MWJA 1NLZA 4KU4A 2DFLA 2IXGA 1WQ1R 1KJZA 1F5NA 2VBCA 1S96A 1OH8A 4Q1AA 4QBIA 3NDPA 1FNMA 1WB9A 5FBVB 3QFRA 1N6RA 1XTRA 2PMKA 3W2IA 1G291 4KLNA 5FL3A 3EZ7A 4C0KA 3RS3A 4V0NA 1BIFA 2GETA 4PANA 5BN3A 1NMXA 2VP2A 2ZRCA 3THYA 2RB4A 4JZKA 2WSSA 1CJTC 4V0LA 3VR6A 4NYIQ 1N6OA 4EPRA 1P75A 3R20A 4A6PA 4LDJA 3AUXA 5UKDA 4KFTA 5HPYB 3VQTA 2PT7A 4AYWA 4EAQA 5HR5A 2C95A 3DM9B 1TF7A 3GJ5A 4P4UA 5KDLA 4A15A 4HZUA 2HLDD 2AWNA 4D4LA 4M9SA 3AVPA 5ELXA 1UFQA 3E1SA 2KI5A 2QZ4A 3UMRA 4MH0R 2DERA 1K5DA 2BDTA 1NJFA 4EKDA 2PX0A 1YE8A 2AFIE 5C4MA 3TUZC 3GLHE 3U4QB 2G3YA 4I99A 3RRNA 4G3XA 3A4MA 2ZI9A 4OQNA 5EUQB 3QFSA 2VIIA 1VECA 4M8NE 2OK7A 1D2NA 2IYTA 4YLGA 1QHXA 1WBBA 4ILEA 5JHHB 3LVBA 1OFUX 1VG1A 3AKEA 1FQKA 2ZPTX 4G1UC 4IDOA 1G6OA 1IBRA 3THWA 1GVHA 5GV8A 5J5CA 4D82A 4EJSC 5JMTA 4A6XA 2EFCB 4LYJA 2FPMA 2XSZD 1KZGB 1W0KA 3NTUA 1SQ5A 1YRAA 1NVVR 3NHAA 1ZRHA 2OO7A 1VTKA 3QXSA 1H8HA 4TSFA 4RFSB 1EGAA 4I1SA 3EASA 3SQWA 1ESMA 4MGYR 2MSEB 3BC1A 5L3VA 2G0NA 2BM1A 2YWHA 1KI1A 4K81B 2RGAA 1EFCA 2W6IA 3PXGA 4Q21A 4DLZA 3RS5A 1CF4A 5KSOA 2GCNA 1IHUA 1Z2AA 4MRPA 3OAAD 3AF3A 1VG9B 2P5SA 5F9HA 2MSCB 1BYUA 3GLHA 4GRAA 2F1IA 1SVIA 1JA1A 1KO8A 3ETLA 2CVHA 3RSOA 3FMPB 1OGJA 1QGYA 4JVSB 1E2IA 2QE7D 3W90A 5B2ZA 4IXNA 4NCKA 2QEXB 3TVDA 1UEIA 4MQBA 1Q57A 5F3WB 3X1XA 2RMKA 4JL6A 4TSFD 2JLRA 2ZS9A 1T3LA 3U3JA 1CBUA 1HQYE 2IXFA 1DO0A 4PO8A 5FTNA 4D6PA 421PA 1U9IC 3TW8B 3G4SB 1F2TA 1B0UA 2ODBA 2WV9A 2UZ3A 1NN1A 3K0EA 5L3RA 4DCVA 3UPUA 4IJMA 2YNMA 4BFWA 4NL4H 1TEXA 3VKHA 1HURA 1KY2A 1Z8FA 2VEDA 4D0LB 2ZU6A 1YU9A 1CJMA 1TUIA 4DDWA 2C77A 1KOFA 1AN0A 2BCJQ 2K5UA 4CIDA 4BEBA 5J4LA 1RFLA 2XGJA 4YMSA 4MYUA 2AR7A 2REOA 1W46A 5B30A 5TR9A 2WWYA 1KD1D 4TLEA 4NYJQ 2VLIA 2HCJB 5C4GB 4GDFA 1BMFD 3K8YA 3B13B 3KJEA 2NPIA 3FJOA 4R9UC 4QBFA 2Q9AA 1GITA 4L4UA 3TAUA 4IOMA 2GZAA 4II7A 2JJ8A 4QOSA 4L5BA 1CP2A 4D80A 3TH5A 1TPZA 2IYZA 3R8FA 4C7OA 2WKQA 4BLRA 4ZV4A 4ASUD 4FMCF 2WWWA 3FKSA 2F3TA 2VP4A 3ZBTA 2HF8A 2KWIA 2WAXA 2OXRA 3R7WB 4Q4JB 2JCSA 3MUFA 4Z54A 4DB2A 1SULA 3CCQB 3I55B 4Q9LA 2LP6A 1UPTA 4M0LA 3TSWA 3X1DA 2GWHA 2JATA 2O8FA 1KI9A 3IHLA 4PX9A 3I4LA 2OLKA 1DAEA 1JJ7A 4IEIA 5FTJA 1KO1A 3P27A 2WBLC 2ZTSA 1XE1A 2OSBA 4GZLA 5ANRB 1G5PA 1XD2B 1LS6A 4A1FA 2OFWA 5FOXA 4PSKA 2IWHA 2BMDA 2CL7X 2CHVA 4I81A 1DAKA 3OESA 4NDZA 3A58B 3NC0C 4V02A 4Y0AA 1SQRA 3BS4A 1W48A 4CVNA 4F92B 2EYUA 3OE7D 3EIQA 4EPVA 4Q02A 3SEAA 4ZCLA 3T1TA 4B76A 4YAWA 1JI0A 2O8CB 1XBTA 2ZRBA 2YYZA 3U44A 5GV7A 2A5FA 1G18A 2C2HA 2ZVQX 4MKHA 4US2R 5JECA 3GLIB 2FFAA 4KI0A 3K0FA 3T06B 1Q7YD 5CM8B 4URWR 3SU8A 2VH5R 821PA 4BLPA 3THXB 2NZJA 2WM9B 3LNCA 3PUVA 4LUCA 4OI4A 5A0FA 4B3FX 2E1RA 1E0JA 2VHCA 1E32A 1EFTA 3FPKA 5FL7D 4BRUA 1IN7A 1MO4A 2G1JA 1VQKB 1OIWA 1YZUA 4IVPA 5CYOA 2V3CC 3KFVA 4LOAA 1S3SA 1FMLA 2EFGA 2EWVA 3K9LA 3ASYA 5HTKA 1E4VA 3CR8A 2GQFA 3GP8A 1X1SA 4R98A 5FUYA 3GLIA 3ZBUA 2OESA 3R7WA 1IY0A 2VA8A 2ZRHA 3C4JA 4QGHA 2ONKA 2VNHA 4CYMA 2ZIAA 4B2PA 5JRZA 3U7HB 1F6BA 1TLLA 5TMPA 1DG3A 1SVOA 5DH9A 4TQAA 4HSEA 3CRVA 4KODA 3OZVA 1COWD 4ESHA 4IRUB 1U9IA 2EYQA 5HE9A 3O8BA 2FZLA 1DVRA 1TQ4A 3ZQJA 3B1ZA 4ZDJA 3W2FA 1LFDB 5EJEA 4BFUA 2Q3MA 8OHMA 2CVFA 4NBSA 3NDBB 4FWTA 3GPLA 4MDEA 2D2FA 3RANA 2V1UA 4YQFA 4YALA 3L82B 2ZJZA 3IEUA 1E98A 5HKKD 1U0JA 1YJWB 2QMEA 1VQ9B 2ZI5A 1NG1A 3AP2A 2CHGA 1XMJA 3QKTA 2FMXA 1T5LA 2ORVA 2FG5A 4EFMA 3CM0A 4B35A 4F7WA 1M2OB 1EP3B 3EAQA 4WQMA 2BMJA 3EZFA 1P61B 2UVQA 4NZYA 3OEHA 2YC2C 5EP2A 1VHTA 3CX7A 2ZRJA 1G8GA 3T5DA 1OYYA 4XH9B 4ZGNB 1DDGA 3LDAA 4AK9A 4JLNA 1IN5A 4M21A 2P6NA 2BJVA 3QY0A 5JBQA 3RVBA 2Q21A 3LVQE 4DDUA 3KTAB 3KJIA 3EPHA 3RRYA 1J70A 4BGDA 4XSHA 3AUYA 2XTZA 3M4YA 3ZQ6A 1E2FA 3P1JA 1CJKC 4AF7A 2H5EA 4UNRA 4PC3A 1HT2E 4RZ2A 1LY1A 3E70C 1U99A 2R6AA 3HR8A 2HXSA 3WP0A 1GFIA 1MRNA 4FCWA 1G6HA 3AVUA 3UMFA 4WAUA 2Q3HA 3QSYA 1S3GA 2FGKA 4WA7A 1FUUA 5DN6D 1KNQA 1F2TB 4F38A 4A4DA 3TNFA 2O0JA 2IYYA 3CONA 1FPMA 4P3YA 1IXZA 2GEVA 2N1BA 3CCJB 4PQFA 4M1KA 4DCNA 3CMAB 2C03A 1XB2A 5FTKA 3UANA 4X8MA 4TMXA 1FRNA 2ORWA 2WTUA 1QVRA 3QXHA 4PAOA 4WZ6A 5DIFA 2ANCA 2CLCX 5CM9C 3TW4A 3RNLA 2ODEA 1G5RA 3ND8A 3TKLA 5TDHA 4M1TA 4LBVA 1OXXK 4DLVA 3GJ6A 5E7JA 5JS7A 1IXSB 1YZLA 4XSGA 1W2GA 3DZDA 3TIFA 5GJVC 4XD7A 1XDBA 1VQ5B 4IEEA 1JXMA 5LDDC 1A82A 4B6FA 3W6PA 5KO2A 2ZUBA 5H68A 1SKYE 4C9BA 3SR0A 1FP6A 2GVDC 3C5HA 2BGIA 1MH1A 4QHTA 3HU3A 1G21E 3I5YA 1W35A 4Q1FA 2G83A 1Z6XA 3EPKA 2QN6A 3RRMA 3SYNA 1W47A 4PZYA 1JPNA 3GJ7A 1G5TA 2XNSA 4D0GA 2W2XA 1QG2A 1N6IA 2HV8A 3AVXA 1XD9A 1HYQA 2IYXA 1KI2A 3HDTA 4LBZA 3C5CA 3ZZ0A 3CC4B 3QE0A 1PVOA 5IK2A 4LHZA 2Q9CA 5L8VA 4B3DA 4U00A 4RD4A 3AKCA 3OFND 5JHGB 3GLGE 1R5OA 2CBZA 4WOPA 4A0GA 1H42A 3WP1B 1RYFA 1ZC3A 3CRRA 4AIIA 1ZVQA 1K8AD 1VCMA 3EARA 1Q22A 1OXVA 3AGPA 1XEXB 1Z0DA 1UDWA 2VZLA 2KBEA 1NSTA 4QJ3A 1MO6A 1YR8A 1VCNA 3VO2A 3ZGXA 3AVVA 4DVGA 3HJNA 1CR0A 1XJ0A 3KL4A 2KSQA 1NI3A 2BKUA 4OQXA 3B60A 4NU0A 2F3RA 3WMEA 4AF6A 4RD6A 3CRMA 3HU2A 4WZBE 1C9KA 4WZAE 4DWJA 3OJWA 2RGXA 5KOYA 1ZINA 3ZYCA 1CRPA 2OAQ1 3HYTA 2QAGC 3P32A 3ECCA 1T6NA 1JAIA 1X3SA 4LI0A 3OIYA 4C3ZA 2MSDB 3IKJA 4B2LA 1W0JA 1P60A 4QGFA 5FOWA 1P7CA 3DOFA 1KAGA 2QM7A 3KKMA 3QOFA 4HZIA 3W5VA 4XVUA 4A2PA 3IPYA 2B5OA 1TEVA 2WOOA 4HDQB 3REGA 3CXCB 2BHRA 2FFBA 2ZS8A 3BOSA 4DT1B 4JBYA 3SN6A 3QE2A 2R8RA 1W4AA 2EW1A 4B3GA 1E94E 4POAA 2WJJA 1CXZA 4C2TA 3GLFB 2ZYWX 3PUWA 3CRW1 2CJWB 3QPUA 2UKDA 3SYKA 3CPEA 2ZYUX 4MUBA 1YHQB 2HYDA 1BX0A 3IEVA 1D5CA 4O25A 4A2QA 4BFSA 1KI6A 4F4JA 2GAOA 4GMDA 3ND9A 1X8JA 1GO2A 3QKSA 4NONA 3FHCB 5JRJA 1KYIA 4LYAA 3I61A 5IHPA 3QBVA 2OTLB 5FBLB 1Q20A 3MLEA 4MYCA 4JLAA 3RS0A 3K0SA 4Q9IA 1N5KA 1E9SA 1Z6YA 3LH5A 1E9AA 2RHDA 3LV8A 4L9SA 2BPOA 4JLKA 5FTMA 3WHKA 2GXAA 2A2ZA 3CPWB 2AXPA 3ONWA 2GEDA 3FWYA 1I2MA 4A0RA 3NHBA 1JEDA 3DVLA 4IVRA 2V9PA 2QE7A 3ZD7A 1DAIA 3TGPA 2DEUA 5J4YA 3H1TA 1RE0A 1JXOA 1KI3A 1PLLA 2HLDA 4OQFA 3TE6A 2CCJA 1CR2A 2J0QA 2FFHA 5DI3B 4DB4A 1L8QA 1I7PA 1HY3A 1N3BA 1ZD8A 3UWOA 4LRWA 3AF2A 1W87A 1T4GA 1N8RD 4TL6A 1GAWA 5HCNA 5L3QA 1VYTA 3WY9A 4BE7B 2O8EB 4G0NA 1KK1A 4Q00A 1EP1B 2ERYA 4M2LA 2HT6A 4ZIRB 2WSMA 4TYQA 4WW0A 2JLVA 4GI7A 3H0KA 4FMCB 1OFIA 3MFYA 4P33A 4Q1DA 4BLOA 5E3HA 2REBA 5EMNA 2GJSA 2ZJAA 2J0UB 3E2IA 3QI2A 4PHHA 2IW3A 1M1YE 3DMDA 4OHYA 1Z0JA 2Q6TA 2GF0A 3GJXC 3TSOA 1TU4A 3AP3A 4MKFA 3PEYA 1G4UR 2YC4C 1HQCA 1J8YF 5FFMA 3X1ZA 3RHFA 3KX2A 4W7SA 3ZVNA 3W6OA 4HUQA 3KB2A 4GL2A 3OZWA 1YHNA 3F0TA 4C0LA 1PLJA 2GZHA 2WZQA 1ETUA 1H65A 4BFTA 5C46F 1S2MA 4LJ9A 4NKRA 1NJID 2N46A 4JLDA 5DI9A 2ZREA 3OE7A 4X8HA 4NMMA 3HYRA 3EIEA 4YDHB 3EW9A 4ZI3A 4LWZA 1FNNA 1QHSA 3CKLA 2GA8A 4GPTA 2BEKA 2D4HA 2JLSA 2EWWA 1UF9A 4LBYA 5FPKA 4B3CA 2F1JA 4TLBA 1D6JA 1N5IA 2EIXA 2IYWA 1TF5A 3C8UA 2O8DA 1Z2CA 2PCLA 1P4SA 2VHTA 2H92A 4Q19A 1XZPA 1MOZA 2ZROA 3NEYA 2JGNA 3GCGA 5H5JA 2LKCA 2IK8A 2O8BB 1Z47A 1KNXA 2QA5A 4E09A 721PA 4LZZA 3KUDA 3DDCA 1NDHA 1KO7A 2XTMA 3X2SA 4YMVA 2FSFA 3LW8A 4NYJR 1X8LA 2NG1A 4B71A 3U2QA 5JCPA 2Z5FA 1KMHA 1RRGA 1UJ2A 4IOLA 4Q03A 3FHTA 3CNOA 4M1MA 1MABB 3ZVRA 2VNKA 2R6GA 1MR3F 5IT5A 1EG7A 2RC6A 2GNOA 1GJRA 4PC6A 3BE4A 2WMNB 3LO8A 3C16C 1GL7A 5FH9A 2L0XA 1OIVA 1OW3B 4YAUA 4JT2A 3CNNA 3GJ4A 4WIAA 1CR1A 2ZUDA 1JQJC 3FYHA 1ZJ6A 3GFTA 2WAYA 1NF3A 3FTQA 4QM6A 4ZO4A 4D0NA 5FL7A 3CPJB 3D8BA 2J9RA 2YJTD 4IXMA 5JWHA 4LJAA 1R6BX 4JLOA 3UG7A 1E96A 4PQYA 2IF2A 3W2EA 3S1AB 1E1QD 1GP2A 3C14C 4PHFA 3M6AA 5GVSA 4OYHA 3EZ9A 1KJYA 3REFA 1OKKD 2ZJ5A 3SC3A 1TUEA 3ZZTA 2ZITA 4M1YA 3B9QA 5G3ZA 4OBEA 4DRZA 1IOZA 3W5JA 4Q7KA 1M1KD 3QKRA 1OB5A 1N0WA 2Z6VA 1U2RA 1H8ED 1GNQA 1HUQA 1ELOA 2ZQ5A 4UJ5A 1P62B 2NO9A 4KITB 1OHHA 2A9KA 4IDQA 5FTLA 3V4RA 1QFZA 1A7JA 3KXLA 1JQLB 3VR2A 1SVSA 3PG5A 4PXAA 1P2UA 1IN8A 1T3HA 2IYLD 4LJ5A 1JR6A 2VTKA 1LTQA 2OV2A 4M53A 5IRCD 1ANKA 3U3RA 2QRZA 1DEKA 3W8NA 3D31A 3WRXC 4B33A 2GVZC 1E9DA 2I1VB 3VR1A 4DT1A 2BV3A 3CRZA 2YWGA 2JJ1D 4TTQA 5C2JB 2J41A 5CLLA 2JLUA 1R7RA 3H84A 1QHNA 4DZZA 4P4SA 1DS6A 2BBSA 4D26A 2PEYA 3LAWA 1NBMA 1E2KA 1VYUA 2D3WA 4LPSA 5G53C 5B58C 4FMBB 1UM8A 2QENA 5DHFA 3VR3A 3NC1C 4DCTA 3UIEA 1W1WA 3WRYC 2KE5A 1VQPB 4HUTA 3JQRA 4OHZA 4FXPA 1IONA 5FPHA 4CT5A 1OJLA 5L3SA 5LPNA 2NZ8A 2FDCA 4LHYA 1R0WA 2A78A 3CX6A 3GEIA 4N1AA 4WXRA 1QUFA 5DO9A 5FUXA 2J5XA 1CQXA 3MGCA 1D2EA 4NYIR 4PTLA 4QGAA 2GHIA 4PPGA 2O52A 1TF2A 1VKJA 5KPDA 3V4FA 1MT0A 3QXJA 1G7RA 4GMXA 2WIAA 3QEOA 1KTVA 1VQ7B 3VNUA 1UADA 2F43A 4H1UA 4PZZA 1RC8A 2GPJA 2J7PD 2QAGA 1ZNZA 3U61B 4DC9A 4TYNA 3EX7C 2DB3A 2E9SA 4PSAA 621PA 4RCYA 2FEOA 1CS4C 4EPXA 2NQ2C 3B7GA 2OTJB 3KUCA 1E2NA 1SVLA 2WJYA 3ICEA 1S1MA 3LLMA 4DLRA 3VX4A 2RGDA 2W6JA 2FZ4A 4HDOB 4EFLA 3U60B 2Q3FA 3GJ8A 2HYIC 1AIPA 5JS8A 1M74A 1DELA 2CK3A 3OFNA 1ZM4A 1VPLA 2ZRFA 4TTPA 1P9NA 3CBQA 5GJCA 2ATXA 1VQ4B 4RZXA 5CDFA 3RS7A 2YWFA 2JLQA 1NRJB 3VU9A 1XTKA 2QPTA 4LV5B 1UAAA 2VQSA 4H1VA 1BS1A 3C41J 5G40A 4I1VA 2WWGA 3EA5A 1YR6A 1M7BA 5GADl 1E2MA 1VQLB 1XTQA 1UMKA 2GAAA 4J0QA 3BH0A 3RS4A 3LXRA 4ZDKA 2OBNA 4MA4A 5KSZA 3W5HA 2FPKA 1E69A 1PV4A 2CL6X 1FFHA 1ZBDA 1M34E 1UKYA 2BMWA 1YQTA 1QHIA 3GFPA 4U02A 121PA 4IOKA 3MWLA 1UDXA 1VDZA 4JKYA 1ZD9A 4KCGA 1II8A 3NWJA 4XJXA 1N6LA 4HLQB 5TARA 5AUPB 2TMKA 4AKHA 4JLVA 3PEWA 4LV6A 1N6HA 3Q8XB 2HJGA 2ZAOA 4Q1BA 2YKGA 2H7VA 4NCNA 2PLRA
chains in the Genus database with same CATH superfamily
2J9ZB 2W2OA 5EFZA 4L72A 4Z3OA 5FWDA 3NTOA 5I7AA 4MV7A 1GJBB 3NNSA 3AERB 2PG3A 1N5JA 4ZOAA 5EZ6B 1BA3A 4LTNA 2TGPZ 1IQKA 4VGCB 3R3GB 4A2CA 5JYIA 5IBRA 3T1VA 1Y42X 1E6KA 2VRCD 1YCPH 2VWMA 4R1SA 4DTCA 1DAOA 1QOPB 1P4HA 1EXDA 3A0RB 3ZD6A 1NSYA 2QUKA 3V80A 3VOAA 4Y7AA 1RJDA 3GZJA 2F8MA 2BUAA 4BAMB 4LYGA 1TGBA 3IQWA 3GLIE 2H29A 1P1BA 1FUJA 3IODA 3MWGA 3RMMH 4FZJA 5BSGA 1GHTA 3E5RA 3IMEA 4KO8A 1D2MA 2JZOA 1MXHA 3I05A 1P1RA 1KTTB 4S2EA 1L5KA 1VE7A 2I2BA 4Z53A 1C5YB 1FP2A 2P9JA 3KAPA 3DFIA 4IKEA 5K3OA 4OV6B 4NU6A 2VO1A 3ZY5A 2ZU5A 1XUIA 2CHFA 1G60A 2IKSA 3FYUB 5CT6A 1LPOA 4QT4A 4FM9A 3NATA 2CNBA 4DM4A 1SGFA 3D8HA 3F68H 3H9NA 3DONA 3GLFE 2WB4A 2ZBDA 1C1DB 4M1SA 3PFFA 1EUCA 1RBZA 3SZRA 4ES6A 4G8JA 4EMUA 4DPLA 1J1UA 1ZLRA 1T91A 1TZ2A 4O1IA 3INGA 1NASA 4QFMA 4CR7A 1J90A 1F20A 1S1CA 2OD2A 1KE2A 4E2XA 4OXRA 4RFSA 1KDRA 2HV9A 1J2TA 3RXVA 3HJHA 2H2DA 4TYWA 4DUZB 4ZVSA 2VJCA 3C3JA 4ZCSA 4TWZA 5SYMA 1BOQA 4WOBA 4KIJA 2VA9A 2Q3LA 3FDFA 4AFNA 3BTDE 5DU2A 4OB6A 3UGTA 1HRKA 2RSLA 1YZYA 3HJRA 3ZV6A 1FLVA 2FB9A 4MW5A 2FPIA 3KTFA 2WZCA 4M89A 3LIIA 3V3KA 3SLNA 4Z4UA 3EGCA 2QTRA 3AR5A 5K51A 2P4SA 4XNFA 3HB0A 3OEWA 3UJCA 1EASA 3MCAA 1S82A 4B3JA 1LVGA 3KQPA 3BXXA 1RQGA 1P1FA 1HTTA 1NXVA 2W2KB 2C98A 1JLKA 3F5SA 1E7MA 4G97A 3DEFA 3GAMA 3PYHA 4XL9A 2ID9A 2JD2A 4OB8A 2D6FA 2X2OA 2F1KA 1CPYA 4UE7H 3V1MA 3B6ZA 2I8CA 2IYOA 2QL7A 3GN2A 3USCS 3MMPA 3GX1A 2GZDA 1XHLA 3MG9A 1SRQA 1GHXH 2GYWA 3KDPA 5IDYA 1IIBA 3Q11A 4IYRA 5HZHA 4LZOA 2X77A 5K6RA 4TN1A 1JR3E 4FQ7A 1V4BA 1WPQA 2EJCA 4MLCA 4KLAA 4XIIA 3MMZA 1ZHPA 5K3DA 2X1VA 5CFNA 2QLMA 1D8AA 2B5WA 2PH5A 4KXWA 5IBPA 4MP3A 5CMLA 1GAEO 5F98A 5FP0A 4G2TA 2C97A 2HF2A 3AT1A 4ZPXA 4OJMX 4Q39A 4KVAA 1NI4B 5JSQA 1YR7A 2CXPA 1N78A 1QO9A 4US1R 4MQFA 2WWXA 3O82A 4K5ZA 3TTXA 5CR9A 3OCJA 4E4RA 2JEOA 1M5RA 4RIEA 3AG5A 4LISA 3IEPA 5DMXA 3O8OB 2I2DA 5EIAA 2HI0A 2HNBA 1UPAA 1KMIY 5F9MA 2O8UA 2VHQA 3E3MA 2WICA 3CCEB 4XDYA 3VZSA 3T1QA 1OFTA 4G36A 2MR5A 3L4KA 2NZ2A 5T4FA 3EVNA 1TKCA 4ABGA 1PU2A 3DEJA 3PIDA 3L1UA 1QNFA 4D9HA 1NDUA 4YCSA 1P0MA 2D3TA 2Y1XA 3D3QA 5IFLA 3ZX5A 3LQQA 3W5SA 2A2QH 1XQBA 4YMGA 1PK7A 5AKJA 4F21A 1RYHA 3F6PA 3GLUA 4OA5A 9ATCA 2JGDB 1R10A 2F6RA 1PSZA 1E92A 2ZB3A 2WAMA 4QUDA 1Q77A 1DOJA 1O57A 1S81A 1L1FA 3RC7A 3FNBA 2DPYA 1H9CA 4E1AA 2O2XA 3ZXUB 1R6UA 1JLHA 1PHPA 2WPDA 4IDBA 1WEKA 5DOZA 3O75A 1GNLA 3BIFA 4EYKA 1UKBA 4AMYA 2J48A 5GONB 3OM0A 3KQKA 5LA6A 5JJLA 2GPTA 3BREA 4HDCA 4QX6A 5J4SA 3KXIA 1J5EB 3SEJA 3ORHA 3VH2A 2PGAA 4EB3A 1HQKA 4NZPA 3T56B 2WSBA 5C7IO 3TBKA 4I4LA 3BMOB 1R0SA 4ZOLB 3FAKA 3WWZA 5K0FA 1N5DA 2HWWA 5GMOA 2O2DA 3OLWA 4ER6A 2FTMA 3T35A 5I01A 5AQEA 3WQSB 5JEDA 2OGUA 3HEAA 4JXZA 2CB9A 1ZDMA 5DW0A 4M60A 3EQ8A 3LCVB 1SKUA 1KZYC 1WKVA 4FFBB 1MV8A 4L4ZA 1Y63A 2Z1MA 2I6GA 1YPHC 5AK0A 5G1PA 1EEHA 2IPQX 1ZRNA 2IEYA 2V5AA 3RFTA 1KI7A 2OC4A 1FTSA 3GRCA 4RETA 1XJCA 1CUHA 2WJPA 4KBGA 1SXIA 1WXQA 1YC5A 1X42A 2Q5HA 5ADVA 5A06A 3M89A 1AFQC 1WZ2A 3R5TA 3NKLA 5BQOA 1LRKA 5ITSA 3VB3A 5TT0A 2O8FB 1IYZA 3PNYA 1NTPA 1DWUA 1E77A 3TTVA 4YDRA 1FX0A 1AE8H 5B7NA 1NN0A 4X6YA 5THQA 2IYUA 3LY5A 1NXPA 1C9PA 1N1DA 4IRMA 1TOCB 2HB6A 4UU0A 5KHLB 2M9MA 2F8SA 5DLPA 5HZMA 2R2AA 3DXFA 1B41A 5DSZA 1JJFA 3SU4A 2JIRA 2NSJA 3ZHSA 4OU4A 4IF6A 3PQ3A 4TV8B 4YONB 2F9UA 4DARA 5I48A 2XB2A 2ALPA 2CK3D 3UWPA 4ZO6A 3KM0A 3LLVA 1O34A 5H82A 3AI2A 2WWHA 3IG6B 2ZFUA 3PQ7A 3WLPA 3F3SA 3ASQA 1KDQB 4C7BA 3MSCA 5DYIA 1F0UA 5FBQB 1TI7A 4C0QC 3LYAA 4DV3B 5KZMB 3ORFA 2ONZA 1LBHA 2RDEA 5JAQA 3JYPA 1E8DA 4DRYA 3QGMA 4CFZA 5CBPA 3EG9B 1TBRH 1CJVC 3OJCA 1SXJB 2YFQA 2OB2A 3ZYZA 2BP7A 4C6HA 3AM4A 3RODA 1TPYA 4BNLA 2D7DA 5ADHA 4IW3B 1MB3A 3V8MA 2A1DB 2PMEA 3JR7A 3EMBA 4CF6A 3C2QA 1GQQA 3DDZX 1KKLA 3RR2A 3ZI7A 4WH8A 3C74A 4Y1GA 2Y0BA 4JIMA 4PQRA 3BK7A 4QRHA 3FGOA 3MJCA 1QDUA 2JGDA 2QLLA 4YXFA 3AF6A 2JH9A 3PD7A 1QTNA 4REQA 2AXEA 4A0HA 1VRCA 2C84A 5LBTA 1QVGB 1PZHA 3CW9A 1Q0RA 3Q3JB 4FFNA 2ATCA 1GR0A 4WJG2 2AMQA 3UEOA 3ZEAA 3O8DA 1AZZA 1R88A 3TH2H 4C03A 2PT9A 3AR7A 3THOA 3GAZA 4GWGA 4I1IA 1NU7B 4AECA 2GFHA 4DCSA 1W0ZU 1PFKA 4TWWA 3WICA 2EU8A 4R8KA 3FH0A 1KSGA 4B3SB 2Y8EA 3O8OA 2OE2A 2RKBA 5K05A 2R5NA 1BBRH 4CWAA 4RI0A 1VBMA 3FVVA 2XSZA 1SFQB 3B52X 3SQDA 3OC0A 2P2GA 1J25A 1JECA 1XP5A 2Y71A 4GSYA 4PGMA 1C1SA 4HY3A 2C1EA 4D8XA 3CGWA 2PBLA 4E5VA 4DNRB 3EXIB 3WXBA 4DA9A 4MV9A 4EG6A 3GC6A 1KXBA 1TDJA 4UEJA 2IS6A 3MT0A 1R0KA 2RHMA 5JH7A 6LDHA 1Q81D 1YA8A 1RWKA 1V2GA 4TL8A 3HSKA 2IZ5A 1M5TA 3OE4A 4BFXA 2YVKA 1VYVA 3R7LA 4YJ2B 4B17A 1TTHA 3H16A 2PIAA 3PQ6A 5BUSA 3HY6A 4UU8A 4DL9A 3VGPA 1JN0A 2Q3DA 3FD8A 3R9IA 3H11B 2FX2A 2ZUVA 2BBWA 2O0MA 2ODAA 3H9GA 4Y76A 3B20A 1V9LA 3V3MA 4MJ7A 4URXR 3LQFA 3RV3A 1CJSA 2FWJA 4YV2A 1CIPA 3F1SB 1C4OA 5L45A 2J5KA 3LH3A 1SKYB 2V3OH 1FSGA 1A46H 4FK8A 5INTA 1SQFA 4TTRA 3LHFA 1SR5C 2OILA 1C9YA 4G24A 2QTVA 3FPGA 3RUIA 1XLWA 3GMTA 1KH2A 3ENKA 2O2CA 4HUQB 3JQCA 4K60A 3CJTA 5DP1A 5IKOA 2IT1A 4H1TA 3V97A 4IQ4A 2WDPA 2GNAA 1WHTB 5EWMA 2ZJYA 4EA9A 1YPEH 2ZZFA 3DFLA 5EUMA 4B6GA 1LEHA 4PGGA 2ZFFH 4IICA 2FETA 2CF8H 4GOJA 4IDCA 2GOYA 3T12A 3UJDA 3VYSB 4AP5A 4QFDA 1C2TA 4RHFA 4QBGB 4K6CA 3TQTA 5MHTA 3USES 1XQ6A 3R6GA 2YNBA 2IDZA 3MS4A 1NVBA 5DYYA 1XDUA 2RBEA 2ZQ2A 5HVNA 3ISTA 3DHWC 1SQOA 2QXHA 3IE0A 3ZWWA 3B78A 3L84A 4U5QA 3K6ZA 1QVZA 4P31A 1WUJS 2QGRA 1SZDA 1JU9A 2GXSA 3NCTA 3IVAA 3F47A 1ATIA 3WW7A 2Q5EA 3GQBA 4HVLA 4IZOA 4JSRA 3GAAA 2SGFE 4NSYA 5CXQA 4CFYA 5I4KA 1WULS 1O9BA 2IEIA 2LCFA 1SM4A 2XBVA 3QNMA 3HFJA 3A7TA 3VPXA 1KJZA 3H5LA 1THZA 1HNWB 1G291 3MB5A 3FLMA 2GETA 4KLCA 1JT2A 1IQGA 1H4QA 1CJTC 1CY7A 4NYIQ 5M29A 2QZ4A 3DBHB 1XTVA 4PV7A 1EG2A 1N8NA 2SGEE 4KJXA 5JHHB 2NU4E 2WV7A 3D49H 1XVAA 1D0IA 1PTJA 2ZIZA 3ZZ1A 2JKHA 16PKA 1Z9BA 4ESTE 2CZGA 1DXPA 2EFCB 2MINB 2FPMA 4XVCA 3NHAA 2OO7A 3SM9A 4G5XA 1FS4A 4MGHA 1PPCE 4K0RA 3PXGA 1N75A 4O4LA 3TFQA 3PVCA 4A7PA 2J4DA 3TKYA 3RUEA 2WIDA 1XC7A 1EAUA 7LPRA 3T1YB 3GO4A 3TLGA 4PYMA 2GZMA 3UMMA 2GZ1A 4JL6A 1V9CA 2JFFA 2M2IA 2AERH 2NSDA 1U9IC 2UZ3A 2NAFA 1CJMA 1XTPA 2IGBA 3GY7A 5FWYB 1SKAA 2XTTB 4D9EA 3U4AA 1Z7EA 4TLEA 4BB5A 1TYBE 1YI0A 2F1LA 3IVRA 1B1AA 3VR4D 2GZAA 1JG3A 4XI9A 4D80A 2J67A 5B4VA 2C3MA 1Z38A 2YYAA 1L8XA 4JYUH 5KYYB 2J6HA 2FOCA 4Q9LA 1UOEA 3PXCX 3DNPA 1I3KA 1KI9A 4UM8B 3I4LA 1DAEA 2H1WA 2G36A 1Z8JB 2V03A 2WBLC 4GKJB 1PQ5A 4JP2A 3N75A 3F74A 2Y77A 3SHVA 4FR5A 5ETXA 2IZ6A 3T7EA 1ENOA 3BS4A 5CPFA 4NMHA 4EPVA 1XYGA 2RK3A 2O8CB 1KSNA 2PS3A 1WUIS 4I6GA 5DK1A 5JECA 2R4QA 3C3BA 4IDFA 5HQTA 4E2FA 5LN1A 3RC6A 4TLLB 3OT1A 2IU3A 1QQTA 1VKHA 1E0JA 2AGIX 5BSHA 3COYA 4Q2KA 3KCQA 4C0XA 5HTKA 4Q3DA 1QYDA 2BKXA 4I6EA 3CJQA 3GLIA 3K2BA 4QGHA 1VLYA 2IRWA 4YGXB 4GVUA 2A59A 1GZ4A 3CEHA 3ICVA 1Y9DA 1S2GA 4BO3A 3G6KA 1H4TA 4G63A 5G1NA 1MBQA 1MH9A 3TIGA 2V1UA 4BB0A 1Y3WA 1JSRA 2CHGA 4ZVQA 2FG5A 3CM0A 4DA4A 4C2AA 1YS4A 4RH0A 5IYQA 4X44A 2A57A 4XH9B 1TIKA 1TALA 4IC5A 1FX1A 2R48A 3LVQE 1UK6A 4F55A 3M4YA 2H5EA 4UNRA 4LF4B 4UFGH 2CDCA 4WA7A 5LNK6 5AFSA 5CCXA 4F38A 4HHEA 3BJRA 1KE1A 2Y81A 3JY6A 4A4DA 4A91A 5DEOA 3O9MA 1ABFA 2C03A 1HE2A 5LWQA 4JYTA 1QVRA 3FLBA 1QFXA 1GCOA 4UUQA 3A05A 4XGKA 4DYHA 4O8ZA 3C5HA 3GP3A 4M7RA 4QUGA 1BJTA 3SIPA 4Q3KA 2C58A 5I9SA 1CEQA 4Y2XA 1PQPA 2X58A 1N6IA 1INLA 3CC4B 5LWHA 1N8OB 1IBSA 1DHTA 3TBHA 5B5SA 2IOYA 1DKQA 4A0GA 2B2NA 1W85A 1EAXA 1SLUB 5C31A 3CRRA 3P9CA 1G30B 3NGLA 1VCNA 1JLSA 1TU0A 4DVGA 4RD6A 2PH7A 3IFSA 2RGXA 4JZEH 4N39A 1X3LA 4WH6A 5FBIA 5L9AA 2VI5A 4ZZ3A 3MJTA 2OQUA 2QM7A 1BOOA 4XVUA 3IPYA 2AG5A 3CQ9A 1YB5A 3DFFA 3E9MA 4K8RB 4Q7YA 2BLOA 2TPIZ 1KORA 4DIIH 1Y48E 1YHQB 3NYQA 3RK4A 3VHQA 5ILQA 1TCUA 1TKBA 1X7XB 4LYAA 5F12A 2QTAA 4R81A 4U8HA 1SBWA 1CZOA 1C0IA 4E94A 4ABAA 3U4CA 3EE6A 1PFUA 1V37A 4HL6A 3RYCA 3VKVA 1JDZA 5FLKA 3DVLA 2P1RA 4I2VA 2OCDA 4AQ7A 3O38A 4LYYA 5ALZA 2PUWA 3KKLA 1N3BA 2WJZB 4MVJM 4TL6A 1IVNA 4GGMX 2P9GA 5LKRA 3SSMA 4MLPA 4M2LA 1HFJA 4P33A 1E18A 1KPIA 1M1YE 4QOGA 3C1OA 3C6XA 2ZJFA 2X6RA 3F0TA 2XUZA 4XZ3A 2D0PB 2VKQA 1TPPA 4LXTA 3ZR4B 4U2DA 1VI5A 3ROMA 5L6NH 5CTJA 4TLBA 1U0GA 3ICWA 1Y7PA 4CUZA 3C8UA 4I5FA 5DJ7A 3BHMA 4V0QA 2XUQA 3B23B 4XDEA 1SBTA 2EAUA 3CTPA 4A8PA 2FSFA 1P91A 3WGNA 1S8NA 2BD8A 3P19A 1X8LA 3EXHA 3CNOA 2PX5A 3I9V1 3LO8A 4XUCA 3LZDA 3VDMA 4ZO4A 2PJUA 4D0NA 4URHA 2YJTD 4IL5A 4YVFA 1NHGA 5EJ9A 1USKA 4X97A 4PHFA 4GDMA 3REFA 3VU8A 3WL8A 5LP1A 1M1KD 1UKAA 5T3UA 4BVEA 5HK8A 1C5UA 3AUFA 4HMPA 3JATA 1OGYA 2A9KA 3HCBA 1VF7A 1OZHA 4FFMA 1I5RA 4BJ3A 4M53A 3G01A 5EZYB 3LOXA 4FYKA 3CINA 4E5SA 1EWVA 2OMKA 4BJ1A 1LPGB 1AXEA 5IBQA 3VR3A 5B6PA 3JQRA 3R3SA 3J7AC 2C9BA 5LPNA 4R8VA 2P2SA 5DO9A 1LDYA 1CVIA 3CLSD 2GHIA 2HCRA 3TNJA 4HRXA 2A14A 3AEYA 3VNBA 2GPJA 3PMBB 1JQKA 3EA7A 2QB5A 5D85A 2RI1A 3OCXA 4BYGA 3DMTA 3L33A 4RXTA 2Q3FA 1CHOF 1AIPA 4PAGA 2IOFA 1YFLA 4AN0A 1VPLA 3N7TA 1P9NA 1K68A 1ZZZA 3CUVA 3RS7A 1NUHA 2CD7A 4CMEA 4W9RA 5G40A 3EA5A 1MBMA 4X54A 5KYGA 4X5OA 2X8JA 2C5AA 1HWYA 4IRXA 3FR7A 3LXRA 1Z74A 3W5HA 3R0QA 1M34E 3FYCA 3GSIA 3MWLA 4KCGA 4HLQB 3THRA 4QAJA 4Y6DA 2FP4B 1ZNQO 1OQAA 2VSQA 1SVMA 4HDNA 2V97A 3QBTA 3VFDA 5I3CA 2QVYX 5G41A 3FCYA 3ZHVA 4CLRA 5G3YA 4DEVA 1X0VA 1XD8A 4GD3Q 1TGSZ 4M83A 5GINE 4DMHA 1M6NA 2BN4A 2FWBA 2G40A 4TS3A 1RWBA 2I66A 4BV3A 3E5HA 4X1NU 2WHPB 3DV0B 1ESEA 4I4TF 5ECWA 2E1BA 1UK3A 1GRQA 3G5MA 4QGSA 2C7VA 2FUG6 1AS0A 5CHBA 1XRJA 2E18A 1EIWA 3DBOB 2VBIA 3T9CA 3AVOA 2X3UA 5TX7A 2H9HA 2G07A 4I7EA 4H6PA 1WZEA 3SXPA 2Q3CA 1T9KA 5JALA 4AG5A 2Q4RA 1CDEA 1QP8A 2HJRA 1D3PB 4RKQA 2ZIXA 1AUXA 2F00A 2JHAA 3DZHA 5IYZB 1V45E 4L74A 2UYGA 2X6TA 3VU9B 5TXGA 5AW1A 3NU1A 1VCIA 1OYOA 4MW6A 4X1KB 5E7MA 4UCWA 3BGWA 5THKA 1P3CA 1RJGA 1RAAA 1EDDA 5C1IA 2Q6IA 3WE7A 3D3WB 4MMXB 3RLFA 4BO6A 1TQ2A 1L7XA 2AK2A 2YMLA 3SYLA 1HAZB 3ZGVA 2F1MA 5DXJA 1YQQA 4NDNE 1E36B 1MIOA 3P5SA 4MYHA 4H9GA 4LZLA 4WZTA 3LKVA 4ZT6A 5AUQA 1YUMA 4IWNA 1O2JA 3PUZA 3EG5A 2UWPA 3O7MA 1QS0B 5KNDH 3OZUA 4OQQA 2FR0A 3N2LA 3BWDD 3SK0A 3W4KA 3FB4A 3IQZA 4OJKA 2WDZA 5A09A 4UZFA 1HLDA 2XOXA 3B5EA 4G5FA 1K1MA 2QN3A 3N58A 2IX3A 2LW7A 2UV8A 1BXRA 1Z2EA 4B7XA 2A5AA 1MCZA 4KVGA 4YT7H 1FPQA 1HAIH 4MGEA 5IZ4A 5K8VA 4EMBA 4R69A 3HGNA 1JFFA 3NM5A 4HJRA 4NQRA 4B85A 4WRRA 2QHXA 1NTRA 4BU0A 2HJSA 3FM9A 3IELA 3NVMB 3SSNA 2I3AA 5BOSA 1SG6A 2PX3A 1S2DA 4I0WB 4PXYA 3R75A 2CF6A 3IAUA 1S02A 4ENSA 1S9HA 3KR1A 5AXDA 2J3JA 2I7CA 3LKWA 2PKRA 3PXBA 2ZVJA 3JVVA 1UAYA 2QI9F 2MDTA 1QRSA 1SKBA 4YBZA 4M6WB 2L69A 3TXAA 4WZLA 2IP1A 4Z9BA 3E35A 4HCJA 1VSBA 1X19A 1HRDA 1YITB 1OAAA 1LI7A 1FTQA 5GIOE 2VT6A 4TKZA 5EQSA 3RYCB 3C3EA 3WIBA 5K0NA 2Q3JA 3UNQA 4H77A 1JKJB 2ANMH 2CFRA 1XCLA 1AQNA 3WLSA 1UEJA 2E3JA 3BTGE 5BQXA 3A4LA 5ALQA 4GLLA 3TINA 3NIGB 2Q62A 4ND7A 4PRZA 3G1TA 2P79A 3L8ZA 2PNJA 1UODA 4FEAA 4O3UA 3DVSX 4TTTS 3R9WA 4PX2A 3A1DA 1BMLA 5AKKA 1THGA 3TZQA 1A7SA 1U2GA 2QJFA 3DLHA 3W1VA 1KYWA 5FKJA 4AJJA 1N25A 5IANA 3UFAA 5HIAA 2WSSD 2QVCA 2C83A 2Q41A 4DDHA 5IXYA 1A3EH 2EFYA 1ZP6A 5IVDA 3LK6A 2ACEA 5DNCA 1QZXA 4ZKEA 1ZC4A 5KOIA 3HMKA 5B4TA 1P2FA 1MJGM 1LC3A 2FI5E 1PK8A 3OLVA 3CW2A 3TZKA 3G82C 5T6DA 1U7TA 1KI6B 1PE0A 3VC3A 2VF5X 1C4KA 4IPTA 5J3JA 3VI4B 5KOHA 1GWAA 4H4EA 5CB8A 1FLNA 1MG0A 4H6WA 3IT1A 1MCVA 4TTVA 4IV0A 1G5HA 1W9XA 3NXSA 1C9JA 1XP8A 5JZSA 2D2DA 1W7GH 3SHFA 5D6NA 1YDGA 1ZMBA 2HU8A 4YGYA 3BX1A 2OP1A 3DS8A 2GZSA 4PGOA 5HMLA 1LHFH 3GQVA 1OI7A 1YLNA 4IEFB 1T3SA 5CK4A 1PWXA 2ZYIA 5IAAA 4KDRA 4F9EA 1Y6QA 1U6QA 4RDCA 2JJQA 3C3DA 4R3UC 3N07A 4HWGA 2CLKB 1C2DA 2BFEB 1K9OE 5EGNA 3MWEA 5HX7A 1L2EA 1Z4MA 1RQ2A 3HUDA 2QSYA 2KVOA 3OEEA 5JAIA 2AX4A 2Z83A 2VHEA 4HS9A 1EK5A 1NVFA 4TY6A 2AJBA 3T0GA 1CY2A 5ALPA 1BW9A 3FPSA 1T9CA 2CXQA 4ATNA 4FUTA 2YX1A 1TMUH 3KO8A 2YUIA 1V7PC 1FY4A 2GXUA 4HFMA 4DUGA 3KKKA 3H2HA 2P65A 5IYRA 3BORA 1Z0AA 2PZEA 2Z30A 2ZIFA 2M1XA 3ZZ4A 4YEJA 3BQNB 1AVWA 4LMAA 1DUAA 3NXKA 4H27A 5TQ0A 4BX3A 3HJAA 2XYGA 1BU8A 1RI4A 2XJ4A 3HM9A 1Q0TA 1VL0A 3OM8A 5AVZA 2IUTA 3VZBA 1BLIA 4HR7A 3Q6MA 3FUTA 4QLAA 1YRQA 5AUNB 3ZU5A 5LZ2A 3ZUGA 4CR6A 4EO4A 2IS2A 4UBJA 1PL6A 2Z8ZA 4G0WA 1BMNH 2OQ2A 1JWTA 2EQBA 4G0VA 1LDNA 3O73A 4TYPA 3RT1A 2STBE 4I5GA 4DKJA 2JF0A 4CU2A 3L8CA 1VE3A 2PZJA 1CNMA 1GHWH 1P4MA 2FPWA 2JAOA 2BKEA 4F2GA 3PIRA 3MH7A 2GK3A 2L6OA 4IV8A 3QFCA 4BNGA 4NENB 1WSRA 2EZ9A 1RTFB 5HKAA 1VIVA 2BGMA 1MKXK 2QUIA 2C4MA 2J9NA 4JT4A 4HGCA 1EEXB 5BN5B 2JRLA 3RC4A 4R2LA 2VOEA 2AGVA 1YT5A 3E15A 1XUGA 2HFKA 4EHJA 5HFJA 1E7WA 4YCMA 1T9GS 3CSDA 1NC1A 5A7FA 2IP2A 4AJPA 3F6SA 3EGDA 3PC3A 2FKAA 1FL9A 3HCNA 1QK3A 4FNAA 3MU5A 3WJ2A 3RYFA 4ARAA 1WD7A 3TJMA 1YULA 1U3UA 4KQXA 1KPGA 5AW9A 1JHRA 3I2IA 1AQUA 4MV5A 2GM4A 5HBRA 2FW6A 5HRAA 4M1QA 4LF5B 1A9PA 3I8SA 2VSNA 3ZY3A 3GY5A 2YH2A 1KWGA 2CLHB 1LVOA 1AY6H 2HGZA 3LT5A 2NO1A 1G17A 4R9VA 3S1SA 3N5KA 4QEDA 4MRMB 4LJ6A 1IL0A 3H3XA 5IYZF 4UM5A 4H42U 2G5GX 4TQ9A 3AJ9A 2ZWMA 2YXNA 3WJ1A 1FAXA 2CLIB 4TT3D 1S4QA 3CN9A 2CZCA 5AKZA 3V32A 1GGHA 1Q7GA 4LSGA 2O9QA 3IE1A 2ZWOA 2FA9A 4MIYA 2VQEB 3D65E 1XJQA 2VZ8A 4II2A 5AW8A 1GU1A 2IVZA 1QL8A 3L8MA 4F60A 2QN1A 5EESA 2PZFA 3KPVA 5AKLA 3JQ9C 1U7PA 5JEEA 1K1LA 1KFCB 4U63A 1FYDA 1IOWA 1KGSA 3REQA 3M7TA 1QBKC 2CL0X 2WPHS 4MPJA 2WUDA 3PLKA 1VMAA 3R8CA 4JI7B 2XZPA 3LY8A 3S2FA 4D3DA 4KWHA 4TMYA 2ONJA 1N1GA 2ZSDA 3KLMX 4N40A 5EXSA 5H7XA 2YFHA 4ZO7A 2ORYA 5BUCA 3LUBA 4AGKA 2R7MA 3EIHA 3NAQA 3N9IA 1X1CA 1PWYE 1B74A 1JZTA 3I28A 3WMGA 1FW6A 3CUEF 3LS2A 3EXIA 1TD1A 3Q7QA 1TZCA 3P9YA 4PSUA 2XC5A 2ZR8A 5FQNA 4DMFA 4D9JA 1VJ5A 4QXRA 1W34A 2FZ5A 1OP0A 1P04A 1MX5A 3KQNA 3BMNA 4H6SB 2DR0A 3ZZUA 2NZYA 4D6YA 1QIXB 2JI6A 1MCTA 2YW2A 3SC2A 1R66A 2GZRA 1P9LA 2NVWA 4FGUA 3L49A 1HYHA 3FTCA 4C4YA 3PUXA 4KDCA 3M9XA 1FUYB 5JSYA 4ZEWA 1NBEA 3MMNA 5DNWA 3PNPA 1K89A 4C4PA 1J0BA 4HZGA 5KS2A 3W2HA 5K3AA 1NGSA 2FWIA 1O3OA 4MNYA 4I8IA 3FDJA 1U8AA 3BTKE 1GSIA 4BQPA 4K9LA 4X20B 3MQKC 3LOPA 1DFGA 2WVHA 2RI0A 2ANYA 3DMYA 3NW9A 4J94A 4W6ZA 1CS0A 1GBJA 4OHWA 2FN4A 2AFQB 2B2CA 1M1XB 3Q3AA 1KOJA 3U28C 4D79A 3T62A 4OJQA 4WTOA 3WMRA 2VQFB 1MO5A 2AR0A 5IJ9A 1HTWA 1IZ8A 1Z4NA 3U4GA 1XL0A 1MT3A 1V2VT 2W2KA 3CNRA 3WMFA 2JDID 2XI4A 4DT4A 1RVV1 4FDMA 2XWAA 4U9UA 1WW3A 2O2HA 3WK7A 1WE2A 4M22A 1U3WA 4RIFA 4CIXA 1V0EA 2NTEA 3E6PH 3MTBA 3F8SA 1BCRA 2HC9A 1O3DA 1P3JA 3H9QA 2Z08A 2LCQA 1QWSA 3R0ZA 5K3EA 4XYMA 5LP6B 3AB3A 4WL0A 3RXIA 1AGNA 1GPAA 4FOTA 4OIFA 1Q9SA 2X19A 1JR2A 1KHTA 3FDZA 3Q72A 1LVHA 4BATA 3UMYA 1ULAA 2ZTGA 1BMAA 1TA0A 4E7RG 1VC2A 4IQ8A 1DRVA 3IALA 3I1FA 2AOUA 4RV5A 4M1OA 4UBOA 4Q4HB 3UVEA 1YL7A 2Z9IA 1XWWA 3ZPXA 5FWAA 4YMUA 3VPKA 4BAKB 2IBMA 1YVDA 3FMOB 1G8SA 1YS7A 1SUWA 4GGPA 5IUNC 2DHCA 3EIOA 5EHQA 1SCNE 3I9JA 4HDSB 3AU8A 2Y93A 2VLBA 1WSAA 1BWRA 1BB0B 4IOJA 4DAOA 1SHTX 2QAIA 2IPNA 4WGGA 4JITA 4Y30A 4F6RB 2J3LA 1DFPA 4DA0A 4FYPA 3RWBA 1QNJA 2ZDMA 2O14A 2C57A 4DR3B 3QWIA 4ER3A 1SFRA 1ZGIA 3EJ6A 1PZFA 2XE8A 4KFTA 4CODB 2I78A 4HZUA 4L2IB 4B4WA 2FPPB 4LK4A 4UE6A 3U4QB 4P7KA 3ETDA 3A4MA 2ZI9A 4DQDA 2WEKA 4GHWA 3TSCA 3N1UA 1P44A 2KZ4A 4IDOA 4UVDA 2VGCC 1H0RA 1SBCA 2IFTA 3LC1O 1XZLA 1QJCA 4OKNA 3DAOA 5BW4A 4ZUHA 5IDKA 4TSFA 4HADA 1MBZA 3D4BA 3K1TA 1ESMA 2ZAYA 4GE3A 3UXEA 1P3DA 2OLEA 4MQMA 2GCNA 4MRPA 2IJD1 4TS9A 3MYYA 3BHJA 1L7QA 1F6DA 3NDIA 1ZD2P 2FLKA 2ZCHP 3S2GA 5L3RA 1I80A 1NB9A 2YRXA 2QUHA 4NL4H 5DP4A 1IHMA 2K5UA 5HJ7A 3HKCB 4Y79A 4P08A 4NYJQ 3V5NA 4R9UC 1J0CA 4QBFA 3HVKA 2PQ2A 2DBVO 3TH5A 3ZV5A 4WLEA 1J16A 2ZJ6A 1DC7A 1XGKA 3NIDB 3R7WB 4YWJA 5PTPA 4M0LA 2GO7A 2JATA 2W70A 3JALB 2R84A 2YBDA 5ABPA 4P7BA 3HB5X 1T8WA 1JWBB 5M34A 1I1QB 1QJ6B 5JB8S 1GMCF 3ITNA 5COQA 4ZCLA 4KPFC 4K2YA 1GKKA 3UGJA 4L1KA 2GT1A 5KINB 1KAQA 1RI5A 4RJIA 5BUQA 3TM5A 1GJ7B 3K0FA 3CYFA 5HJ2A 4BLPA 4LUCA 5EIYA 1G36A 3LLSA 1ESTA 1E1MA 3F6BX 4IVPA 3PDIA 3QVSA 3SSAA 2GD1O 4HWTA 3P0FA 3QYPA 4Z0NA 5E6UA 3G59A 3SDBA 3H1EA 1NVEA 1DVRA 5JV5A 3KSAC 4UDNA 1T6YA 4ERXA 4PCLA 3DOIA 5HKKD 3CE9A 1BCUH 2OC8A 2B9LA 4P86A 3RXEA 5AK6A 5DPAA 3TZCA 1M6WA 3DZFA 1G8GA 3PWKA 5HQJA 1ZPCA 3F49S 2FMFA 2OKGA 3PA1A 5DBFA 4XPIA 3LT2A 4RE5A 2W2LA 4NXNB 4CV1A 2IYYA 3AL2A 3CCJB 2C82A 3ZDCA 5EIOA 2LIVA 1O2DA 4RELA 2ODEA 3HACA 1WTCA 2VPWA 2ZUWA 4WY2A 2QT9A 4YPFA 3ZHQA 2Q2WA 2OGZA 5EJ5A 2ZJ4A 5AM4A 2H59A 1QRTA 4DV6B 3WRXA 3TRDA 4EVSA 3OBBA 1DQZA 4IHAA 4J7XA 5JH7F 2W2XA 2HV8A 3SWWA 3HDTA 5IK2A 4LHZA 4W6QA 1A2CH 4N5IX 3I53A 3T7SA 3D1VA 3TL6A 5LIPA 3EARA 1SOZA 5K3SA