4ACAA

Crystal structure of translation elongation factor selb from methanococcus maripaludis, apo form
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
469
structure length
444
Chain Sequence
b'HMDFKNINLGIFGHIDHGKTTLSKVLTEIGFSAFKLENYRITLVDAPGHADLIRAVVSAADIIDLALIVVDAKEGPKTQTGEHMLILDHFNIPIIVVITKSDNAGTEEIKRTEMIMKSILQSTHNLKNSSIIPISAKTGFGVDELKNLIITTLNNAEIIRNTESYFKMPLDHAFPIKGAGTVVTGTINKGIVKVGDELKVLPINMSTKVRSIQYFKESVMEAKAGDRVGMAIQGVDAKQIYRGILTSKDTKLQTVDKIVAKIKISDIFKYNLTPKMKVHLNVGMLIVPAVAVPFKKVTFGKTEENIILNEVISGNEYAFELEEKVLAEVGDRVLITRLDLPPTTLRIGHGLIEEFKPIKDLNIKKEVLREGKVKIDKGRTVIDGLAQSKVAAEKLIGEEISIEGKDIVGKIKGTFGTKGLLTAEFSGNVENRDKVILNRLRRWG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSLATION ELONGATION FACTOR SELB
publication title Selenocysteine tRNA-Specific Elongation Factor Selb is a Structural Chimaera of Elongation and Initiation Factors.
pubmed doi rcsb
source organism Methanococcus maripaludis
molecule tags Translation
total genus 98
structure length 444
sequence length 469
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.190 Mainly Beta Beta Barrel Thrombin, subunit H translation elongation factor selb, chain A, domain 4 4acaA04
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4acaA02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4acaA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4acaA01
2BKUA 2QNRA 2JLRA 3AF2A 5HCNA 4OQLA 4FIDA 4A0FA 3BFKA 4F93B 4DQLA 1TEVA 1EX7A 2H16A 4URXR 2IUTA 1P72A 2P6NA 1HV8A 1AS3A 5B57C 5JEDA 3BS4A 4LJ8A 4WZBE 2O0KA 3WBKA 1G5RA 3LO5A 4AI6A 2EFCB 1JBKA 5UKDA 1YR6A 3Q8XB 3K70D 2E1RA 4NKRA 4D25A 3B78A 2ZRIA 4HB2A 1II0A 4M9QA 4DKXA 1HT2E 3I1FA 2OESA 1AS0A 2QGNA 3E1SA 5E4FA 3PUWA 4QG7A 3TUJC 4ZDKA 4ESVA 4CEIB 5KNCA 1G41A 2CNWA 4TSFD 3O47A 2BMFA 3E1YE 4QGGA 1YI2B 1CKEA 5BN5A 1G7CA 1SXJE 1W0KD 2GCPA 4Q9IA 2VF7A 3O8DA 3OIUA 3SJAA 2QDXA 4V0OA 3AKDA 2X2EA 1EP2B 3JVVA 2J59A 3QEJA 4D4MA 1CR4A 3ASYA 4P33A 5DN6A 1NKSA 3WHKA 2ZJ8A 1UEIA 4MKIA 2IYZA 2GILA 4QGAA 4EQ6B 3QFRA 3CH5A 1EFTA 4WOPA 4F4IA 1FQKA 3TBKA 3I5XA 2F9LA 5TB5A 2XB4A 4FMDB 2SHKA 4JLAA 4OK5A 1BJKA 2ORWA 4KI0A 1P7CA 3FPAA 1KI4A 4WA7A 4CGZA 5A4JA 3RRNA 2FN4A 1SXJB 4LV5B 4F38A 4ZGQB 1CR1A 2VSXA 5B30A 1NN3A 1IJFA 1TF2A 3THYB 1BX0A 1GM5A 2NMVA 1N0WA 5GV8A 1JXOA 2WJHA 3QFSA 4C7OB 1OFUX 4ACAA 2ZUDA 3K70B 1T4GA 2A7QA 3OZXA 4QBHA 2KSQA 1VQ9B 2GETA 2IK8A 2Q0HA 3IILA 4Q9KA 1XTIA 1N3BA 4X8LA 3WXMA 4TTRA 4LCBA 4B44A 2ZI5A 3TR5A 3L0IB 4PC3A 5TR9A 3B1YA 2F1RA 2DY1A 4EIWA 3TSOA 3WRYC 3H86A 4P3YA 3A1TA 1WBBA 3FYHA 1DOAA 4KV9A 4C2UA 1W87A 1QHNA 3GJ6A 5CK5A 5H8WA 1D6JA 2Q9CA 3UK6A 1OFHA 2ZYWX 3AVXA 3IPXA 5AJVB 1EXMA 5E7IA 5G53C 1KK0A 4PFSA 2BM0A 4KFSA 1G6HA 4TMXA 3HPQA 4FK8A 4QL3A 3SOPA 3KQKA 2PBRA 4YONB 1JR6A 2DFLA 1KY2A 1CR0A 4XVRA 2O5VA 3HDTA 1E1RD 2R6GA 1F60A 1KI6B 4HZUA 2A78A 1P9NA 1N0VC 2NOAA 3SE0A 1R0ZA 3WMEA 4DSUA 3EPJA 3U44A 4BZPA 3BWDD 3EZ7A 4LRWA 4OHZA 3SDZA 1E3MA 4GDFA 2WPDA 1G20E 4ASUA 3W2IA 1R4AA 4BRWA 4XWAA 3GLGE 3BH7A 3GJ4A 2BHRA 3WNBA 1FNCA 4B74A 4DXAA 2BIFA 3BXZA 1FRQA 1AMOA 4ZDJA 5FFMA 5AWFC 2GK6A 4GOKA 2GVDC 2JJ2D 1LF0A 4KSCA 2ZPTX 2AD1A 1T5LA 3TK1A 3AF1A 1YZQA 3B85A 1AKYA 4D4LA 3ONWA 3CC2B 2DWQA 3MD0A 4BEJA 3KKOA 3THXB 1DS6A 3FPKA 1GZSA 5JI3E 3GJ0A 1NVWQ 1E0JA 2NGRA 2VNIA 5ELXA 1T0JB 1WDTA 2F1IA 2HJVA 3SJBA 2ONKA 2RGNC 4MYUA 2OFOA 3EASA 3QKRA 2OG2A 1DAMA 5FTNA 1D2EA 3IIKA 3K9NA 3GLGB 5CYOA 2HF9A 4KODA 3W2GA 1MABA 3WMGA 1GAWA 1AN0A 2VL7A 4RVCA 5LD2C 2C9OA 5DI9A 3AVQA 1ZCBA 4LV8B 1AJEA 5JSZA 2ERXA 1ZC4A 2LWIA 4JLKA 1BS1A 4YMUA 4LJ6A 5E3HA 1P9RA 1CU1A 2QAJA 2VZLA 3NIBA 4JZKA 1JXMA 5H1YA 1KKLA 2O8DB 2IT1A 1DAGA 2XXAA 1YKSA 1YQTA 4IEEA 3BB3A 1X1RA 4LK2A 5EP1A 1H8ED 4A0GA 1US8B 3IIJA 4Q5IA 3PEWA 3LVQE 2CK3D 2BJWA 3K9HA 1M34E 4R9UC 4HLDA 2V6JA 4D0NA 2ZRBA 4PC2A 2OCBA 5BN3A 5DLQC 1UKYA 4US0R 5LB2A 3UMSA 2BMDA 4YAFA 1J9ZA 5AJYA 3UXMA 5J4LA 4NE2A 3OZVA 2WMOB 1JQLB 2Z0MA 1IY1A 5AJWA 3Q7QA 1S72B 4Z54A 3U2QA 4QXAA 4EPYA 1FX0A 4LGMA 4BUJA 3MFYA 3NDBB 3IIMA 5DE3A 3THWB 2WKQA 2RC6A 4LI0A 5AUNB 1QHYA 1D9ZA 4BEBA 2FFQA 4FMCF 1G5TA 4NMMA 1VQLB 2PLRA 4EJSA 1CNEA 2Z4SA 4YQFA 1A4RA 1KRHA 3TRFA 3WP1B 2A9KA 1VQNB 2JLXA 1W7AA 2ZVQX 4RY2A 1SHKA 4EFNA 4W9MC 4JVNA 4GSYA 2ZI6A 3PVSA 1VQ4B 1ZP6A 3AP2A 1JJ7A 1ZMXA 3R8CA 1RRFA 2FU5C 5SZKB 2GJSA 2ZJAA 3ZD7A 3Q9LA 5FPHA 2H57A 1TUIA 3BGWA 2XNDA 2IS6A 2O8EA 5L3SB 3CKLA 3H84A 3C5CA 1EESA 1A8PA 1H85A 2IA5A 2C9CA 3GFTA 2RKOA 3QXSA 1SQ5A 1OHHD 1HE8B 1N6RA 2ZTSA 4PSAA 1Z22A 2XOKA 1E98A 3I55B 1K9MD 2P6UA 3NC0C 2XTNA 2YINC 4K8OA 1FNBA 2W6JD 3RANA 2QE7D 3OIYA 3TQFA 3V4FA 2ZANA 3W9YA 3WNDA 1BKDR 2GNOA 3DEFA 3UMRA 4Q1DA 1EWYA 2JLSA 3SR0A 1XJ0A 1NMZA 3DPUA 3QXHA 5IK2D 4WVFA 1IB0A 2JIZD 2N1BA 3NWJA 2PZFA 4UJ5A 5E7JA 2WMNB 4HB4A 1M1KD 4MRRA 4MYCA 1M1YE 421PA 2ZEJA 1QF9A 1R0YA 2CJWB 5J4YA 4OJQA 3ZQ6A 1W5SA 1YHNA 3R7WA 2RGCA 2DB3A 4IDQA 4DLVA 1EG7A 2D2EA 2J3EA 4KYUA 2C04A 2O8BA 1XJCA 3BBPA 1N6KA 2ZR9A 3ZC3A 2ZYVX 1M2OB 5HPYB 2WIBA 3K09C 1DBSA 1D5CA 3KXIA 1B2RA 3LAWA 5AJZA 1OFTA 3CPJB 1V43A 3FB4A 1GKUB 1LY1A 1S4QA 2UVQA 3K1JA 3I72A 1G21E 2FSHA 2IWRA 2GWHA 3CPEA 1GOTA 2Q9AA 2FGJA 4JKYA 1V5WA 4LWZA 2ANCA 4Z1MD 1BMFA 5BQ5A 2DFKB 1DPFA 4BE7B 1E4VA 1GR1A 2G9NA 4DC9A 5DI3A 2PIAA 1ZW6A 4A6PA 1GIAA 3ZIAA 2MMCA 4AY2A 1GKYA 3WBJA 4O2LA 4DCNA 4ABYA 1UBEA 2JLWA 1OW3B 1XD8A 2LCFA 1JAHA 4A1FA 2F55A 3ZJYA 4ZCIA 4F92B 3HU2A 2B5OA 5IF9A 1W36B 1XZQA 1Z08A 4G0NA 4B75A 4A15A 3HYRA 3S1AB 3RS4A 1FL9A 4TSFA 1E9RA 1U8YA 3B7GA 2BMEA 5DNYB 1CTQA 1L8QA 1W0KA 2V7QD 4L8GA 3PUXA 1AGPA 1QG0A 4OL0A 4Q7JB 4P31A 2ZRMA 2VSOA 5DHFA 4DCSA 2QI9C 2GBLC 1DARA 1E2HA 1HE1C 2HMAA 4QC2A 3RVBA 1ZCAA 1VYUA 4OQMA 5EP2A 2VTKA 2PMDA 3EIQA 3LV8A 3MSXA 5EP3A 1W2HA 2Q6TA 1SKYB 1CJVC 2QP9X 4HAUA 2AKYA 5G3ZA 3VR1A 3C16C 4NPHA 2OXCA 3AVVA 4P4SB 5HE9A 3EC1A 3CNOA 4CVNA 5J4VA 3FJOA 1Q82D 3RNLA 1AA9A 2WM9B 2GZHA 2O52A 1HYQA 3PEVA 4V0ME 4B2PA 1UBCA 2Z4RA 3L0SA 2ZR7A 1HEIA 2ZRAA 3PV0A 2YWHA 4YXWD 2ZE7A 1P3JA 1FTNA 3ZZUA 1T8TA 3QKSB 4Q4LA 4EUNA 1K5GA 5SZJA 2DFNA 2NZ8A 4Z51A 1EFRD 2BBTA 4QNMA 4US1R 3TSWA 2FPLA 1QGZA 3GMTA 3HWSA 1TTTA 5TXGA 4KVAA 1E2JA 1Q0UA 2HJGA 2IEZA 1TQ4A 4UXJA 4EDHA 1Z6YA 4IFBA 1EWQA 1OV4A 4BZXA 3HP1A 1O87A 1M7BA 2CBZA 2ERYA 3IEUA 5DO9A 3AB3A 3K0AA 3VMFA 4HYYA 5KHOC 2ZM5A 2FPKA 4NYJR 2W6ID 3EA0A 5FOUA 3FDIA 5FPKA 1W35A 2RGNA 3RSOA 4WQMA 5JHGB 3LBNA 2V55B 1JJVA 3A4MA 5AJXA 5KOYA 2A3RA 1JEEA 1JECA 2ZI7A 2QL6A 1E1QD 4Q9HA 2QQ0A 1NVXQ 4QBIA 1CF4A 1ZD8A 1N2CE 2RC5A 1VQ8B 4JIMA 2IUSA 2MSEB 1D9XA 2W0MA 1CS4C 2REOA 4ZIRB 3AUYA 2GDJA 1XD2B 3WP0A 4AWXA 5AR1A 2X77A 3P1JA 1YR8A 3SN6A 4DLYA 1RW4A 4CF7A 2XZPA 3LVBA 1UKEA 3NC1C 1RYFA 4ILEA 5HTKA 4KAXA 4QHSA 3MWJA 1MR3F 4HATA 1R5BA 2Y8EA 2RGEA 2ZETA 3KKQA 3EZFA 3CCEB 2A5DA 4PSKA 3FKSD 1OB5A 2ASEA 3FMFA 1Q1BA 2Q3HA 1ODFA 1KJZA 2JJ2A 2NZJA 4ARZB 4XH9B 1H8HA 1K8RA 1YZUA 5TMPA 2AL7A 3GEEA 1VIAA 3GPLA 3OZUA 2AK2A 3KFVA 4IRUB 2OLKA 3WY9A 4AF7A 2FA9A 2V6IA 3RSLA 3A6PC 4JBXA 2AFHE 3GJ8A 5THXA 3GLHE 1OFIA 2IS2A 1NLZA 3ICQB 4N1AA 1NBME 1P73A 1E2FA 4AIIA 4NYIR 5EP4A 2NO7A 2QENA 3KJGA 2IYLD 1BYIA 4P32A 1ZC3A 3CF6R 4CRWB 1NKTA 2R44A 1XTQA 1GNQA 4L16A 3Q5EA 1K6MA 5A0FA 1GJRA 1G3UA 4LHYA 1JA1A 3QBVA 2OFWA 5FPTA 1GVHA 3TAHA 2PEYA 2IXEA 4MKGA 4Q4JA 5EXTA 4G5GA 2CVHA 4RZXA 4TQUS 3MLEA 4DLUA 2ZRLA 4OI0A 2GCNA 3LFUA 3AVPA 4HUQB 2CMKA 3GLHB 1ZUNB 4GFDA 4I1OA 3R8FA 4JL8A 1CJKC 1H8EA 4H1VA 5D3MB 1OGIA 2RMKA 1ZAKA 3QF4B 2CK3A 2PMKA 4P4UA 5EXXA 4TYQA 4A8JA 4ON9A 1LS6A 1TF5A 4D6PA 3D3QA 1ZBDA 1HY3A 3OJXA 5CJ2A 4QJ3A 1UEJA 1E69A 2NO1A 2QTLA 2VLIA 4GNKA 3VQTA 1NMYA 1KI7A 2QTHA 2R6AA 5CLLA 5CJPA 2QMEA 4HE5A 4QRHA 2W2XA 4M1YA 1MO4A 1MOZA 2IWHA 2YHSA 3LX8A 2BMWA 1DG1G 4G01B 1IM2A 3SJCA 1NLYA 2J46A 2FF7A 2FSIA 4EPRA 2HLDD 5JRJA 3T5DA 3M4YA 5L3RA 5KO2A 2PJRA 4DHEA 1TAGA 3VHXA 2GAAA 3NKVA 2PCJA 3U4QA 3K09A 4TQ9A 4JL6A 4NCJA 2WOOA 3PITA 2ZQ5A 3CPWB 1RRCA 1BOFA 3DOEA 3B9QA 4KU4A 1N6LA 4HLCA 5KSYA 4ZPXA 2Z6VA 4RJLA 3BIFA 3AVOA 1E2PA 4NH0A 4M9ZA 2J41A 4ERNA 4LYFA 2F43A 4LC1A 4B3XA 3U3RA 4B73A 1W49A 1ZRHA 4XVUA 2VP9A 2IUUA 2FSGA 1OHHA 1M90D 4HAYA 2O8FA 2VHQA 4AKEA 4C0QC 3R20A 4TLBA 1BO6A 3OEHD 5KDLA 3O8BA 3KB2A 4LHVA 4FWTA 3I8XA 3UMFA 5B58C 4PPNA 1XEWY 2IHBA 3QJYA 3CRMA 3CRRA 2YOFA 2P5TB 1QHHA 4BFVA 1KHTA 3ZZ0A 4KFTA 4MITA 4WBSA 3RABA 5IK2A 5HKKD 4C0BA 3F0TA 5GV7A 1F2TB 1YIJB 3L8YA 4DB4A 2XNJA 3QIAA 3QVVA 5HCIA 3T1QA 1P60A 5CLQA 2QT1A 1OE0A 2VRWA 5CM9C 4CEHB 3EX7C 1Z0FA 4JT2A 2NPIA 3R9XA 4FMDF 1OJLA 1II8B 3QENA 2BBOA 3QNUA 3TQCA 2YZ2A 1D2NA 4PPGA 4IJMA 4RFSB 2AXPA 2C77A 4UNQA 4YAOA 4HAZA 4F4CA 1W2GA 3C15C 5K8TA 2GA8A 1S0UA 4N3GA 3U7GA 2WIAA 3UANA 2BF4A 1IXSB 2GCOB 4AC9A 3W5VA 2XGJA 2XJ9A 4GZMA 2AFIE 4Z1MA 1J8YF 1R6BX 2QBYB 2PH1A 1PLKA 4Q1EA 3A58B 1LV7A 1ESMA 1UDXA 4R98A 4HLQB 4Y7CA 3AVTA 1XRJA 1GWNA 3QXJA 1NN1A 2BVNA 2PX0A 4JLVA 3CZQA 1E0AA 2J0UB 1MH1A 3AKCA 3JVUA 4Q21A 1P4SA 1TADA 2ODBA 1ZM2A 2RGGA 1DEKA 1Z0KA 3HU3A 3AGQA 2KJQA 4OJKA 4B6FA 4XD7D 4PX9A 3N5CA 1U2RA 2QA4B 1N6NA 4RD2A 5FI0B 2OK8A 1A7JA 3GEIA 3ND8A 4C43A 1N6PA 2FGKA 2TMKA 1ZNWA 4DEYA 4DLXA 2QMUA 4JT4A 4EKDA 4AKIA 4H9GA 3NHBA 4EJSC 1NN0A 2BOVA 2PX3A 2ZVPX 2GXQA 4JSTA 1QX4A 3B8HA 4Q47A 4OI1A 1OSNA 2JASA 5K8LA 3LQQA 4DLRA 4Q03A 4TT3D 1G3IA 2VA8A 4N3NA 2F1JA 2IS1A 2ZU0C 4WXRA 2Q21A 3K0FA 4TZ0A 3THOA 2H18A 2WAYA 1FX0B 3DZDA 3AP1A 2QT0A 1EP3B 1SXJD 4L4UA 1TPZA 3QPWA 3PR1A 4G5OA 2AKAB 2OLJA 3EZ2A 3U3KA 3IEVA 4IVPA 3W8NA 5GJCA 3BJIC 2REBA 2QTVB 3DDCA 4BECA 1ESNA 1JQJC 3CMAB 1P61B 3B5JA 4NYJQ 3I56B 4NP6A 1JA0A 4Q4AB 4DT1A 4LBYA 3MGCA 3OIWA 4BFYA 4DSTA 2HXYA 1EFRA 2BJVA 3RDPA 4M9XA 4UNPA 1XEFA 3KX2A 2CL6X 4Q1CA 5DYGA 5EE9A 2J7PD 2QMHA 3ZYCA 2ZXUA 2HDNB 3P20A 3VR2A 1Z3IX 1KMHB 3RWOA 3LH5A 4C0KA 2KI5A 2GTPA 1E4YA 1MO5A 1E9FA 2VP2A 4L9WA 4RD0A 1KI8A 1Q44A 2OO7A 2ZUCA 4AYTA 4LBZA 1VG8A 1S1MA 3K9LA 3BAFA 4Q1FA 5BYKA 1E79D 1KYIA 3VU9A 2W83A 1H42A 1E1QA 1XXHE 4PZYA 1E0SA 1CR2A 4MGKR 5SZHB 1GITA 2VH5R 721PA 5GJBA 4LX0A 5C46F 1IJEA 4IOLA 3UG6A 4C3ZA 2ANBA 4FW9A 2YWFA 1W47A 4PHFA 1RJ9B 5KSWB 1N5JA 5EMNA 4WXPA 2C03A 2OAQ1 4RZ3A 2OXRA 4LJ9A 1AZSC 1KMQA 1IONA 2DEUA 1W0JA 2YVUA 2BEKA 4AD8A 2IXGA 3SYNA 3C7KA 4MGZR 1FNNA 3EZ9A 3F8TA 1B23P 2ZJ2A 3K70C 1KO4A 2JJ8A 2GAOA 4KVGA 2D2FA 2XB2A 3T1OA 3CZPA 3FKSA 5B2ZA 5CDFE 1XXHB 1NL3A 3AF4A 4NYIQ 3TVTA 3X1WA 5C18A 2IL1A 4PC6A 3O8CA 2ZJ5A 4FXPA 3NDPA 4DCUA 4MUAA 5EJEA 2F3RA 4QHTA 3RC8A 5KTYA 1VTKA 2CL7X 4GP7A 1WB9A 3GJXC 1EFHA 2GF9A 2ZYUX 3CNNA 3CX6A 3JZMA 1J90A 1XMJA 5KSZA 4Q4HA 4I1UA 1ZM4A 1LTQA 3R9WA 2HEIA 1A82A 1QUEA 1VQ6B 2JDID 3IBYA 5IDVA 1GTVA 2D7DA 4G1BA 2R6DA 2IW3A 1UBGA 3CRQA 4F7WA 3VKHA 3BORA 2DPXA 3T61A 3Q85A 3TSZA 5DSZA 1YZLA 1IBRA 1IY2A 4Q9LA 1M7HA 2ZJBA 3K0CC 3UWKA 1DG3A 1U0LA 1NSTA 1XTKA 4B35A 4DUGD 1KI3A 3W8RA 3TAUA 1S2MA 3OESA 2GF0A 3A4NA 2HT1A 3AGPA 3AM1A 2RHDA 3OAAD 2OHFA 5IHPA 1T3LA 4C0LA 4Q66C 3LO8A 3W6NA 4PHTA 1R0XA 1Z0JA 3QXXA 3G71B 4DWJA 4JVMA 4B47A 3EPKA 3EXAA 2G83A 3LBIA 5EZ5A 3ADKA 2ZSFA 3R9IA 1T0HB 3QPVA 5J5CA 2W00A 3OIVA 5IRCD 2I1VB 3OFND 2VNKA 3GP8A 3QF7A 4D81A 4BZQA 3NG1A 1FPMA 2YKGA 3AF3A 4GMDA 2R6HA 1U0HC 3VNUA 1J99A 3BE4A 1KTVA 5FL3A 3UATA 4OQNA 3U3JA 1IN8A 4IEIA 4B71A 4PSVA 1E96A 5FTJA 2KBFA 3EWAA 2B21A 2ZU6A 1OH6A 4Q48A 4D80A 1KK2A 5C4MA 3CXCB 1YJ9B 1XF9A 4DDUA 1VECA 1QDEA 1OGJA 5IT5A 5H59A 1II9A 1Z5ZA 2P67A 3HU1A 1WXQA 3KQNA 2XTMA 1DTSA 3KXLA 5E95A 1KO1A 1XTJA 4ITRC 5KNBA 1JNYA 1UAAA 1W4RA 3QI2A 4GL2A 3E5HA 3TE6A 1X6VA 4GBMA 4TL6A 1XCMA 4CEJA 1AK2A 2IX3A 1JR3A 3L0PA 4DSOA 1WP9A 4R71A 3B82A 2GEVA 3QFTA 4B33A 4BLRA 3SHFA 3T5GA 4DDVA 1SVLA 3T1TA 3U7EB 4I81A 5FOTA 5LD2B 2VIIA 3GLFA 1R0WA 1ZNYA 2PZEA 2V54A 5FUYA 4A6XA 2YYZA 2JEOA 1HTWA 2BWJA 3B1XA 3PUZA 1QVFB 2C96A 1MV5A 4PO8A 5JHHB 3C14C 4ZI2A 2UZ3A 2I3BA 1K8AD 1C4OA 1DE0A 1W4AA 1G291 2WICA 3AKYA 2ZE8A 3LW7A 1EGAA 2H17A 1RIFA 3GQBA 4MUBA 2QAGB 2J9RA 1COWD 3FE2A 3IKJA 2OM2A 1G7SA 3EAQA 4Q01A 1MRSA 3I3SR 3NEJA 4V0NA 1VCOA 5G3YA 3SFVA 1SVOA 5HE8A 1NG9A 3W90A 4GOJA 2V9PA 4DLZA 1ZNZA 1CJMA 5FBLB 2CHGA 5FUWA 2C9YA 2NIPA 2ZS8A 3M6AA 1ONBA 1Q1ZA 5FR1A 2WJVA 4B34A 1GO2A 2GVZC 2WJGA 4M1MA 4LHWA 2QTZA 3K8YA 3U7FB 3ZVLA 1K73D 3GLIE 4PAOA 2GK7A 2GJKA 2IYXA 1E32A 1NSFA 4NCKA 3V76A 4C0JA 4TYWA 1Z6GA 3G4SB 3ZVMA 3ZZTA 3CCRB 4HB0A 3KJEA 2ZSAA 4KYIB 4URZR 1G18A 1DO2A 1XJQA 3DM9B 4YMTA 5JS7A 3KZ1E 3QXCA 3MUFA 4QGHA 4C0HA 2QEQA 3W5HA 3A37A 1TMKA 1YHQB 4HZIA 1E63A 1W36D 1PV4A 2CEAA 3ADBA 4YAUA 1Z8FA 1X8KA 1XD9A 2RGAA 4CEIA 4IW3B 2GHIA 2EFGA 1BH2A 1P2SA 3I32A 2QA5A 3RC3A 4A8JC 4E5UA 1T5IA 1YZTA 4FI3C 3EARA 2J1LA 1XEXB 3T1VA 4WIAA 1M6NA 4GZLA 2EYUA 2B6HA 1QVAA 1ZVQA 1WA5A 1E9DA 3GLIB 1GNRA 3CF0A 1UFQA 5DGXA 1QHXA 3ADCA 2MSCB 3Q7PA 1E2KA 3QY0A 4R2HA 1XDBA 4JLJA 2FV8A 3TW4A 1OT3A 1Z2CA 2OBNA 4NZYA 5BYJA 2YWEA 2I4IA 1DAHA 3W6OA 3OJWA 4EQ6A 3MMPA 1UJ2A 1MKYA 4L5BA 3WRXC 1L2TA 4B48A 1CNFA 2CRVA 3DHWC 1QZXA 1J2JA 3G0HA 4TT3A 4BLOA 4N0EA 1Z29A 2OZEA 2BEJA 4Q7MB 3W2FA 2ZAOA 4LJ7A 3KTAB 3I5YA 1Q1QA 4YC7A 1VG0B 1CJUC 3WYAA 5TARA 4MDFA 1NMXA 3QE2A 1VCMA 3UWOA 1SXJA 4O25A 4CEHA 3EIHA 3PG5A 2FH5B 1YVDA 2QG6A 3DZ8A 2O0HA 3LNCA 4N0DA 4A2QA 2JA1A 1QHSA 2ODNA 3QG1A 5GJWC 3T34A 4D4JA 3A1VA 1E2DA 3LQRA 4PZLA 4S35A 4AYXA 1L7VC 2A5GA 3QPUA 4X8OA 5F9FA 5H70A 1SKYE 3U3MA 4RKFA 3AKEA 2WWXA 2WAXA 4ACBA 4NCIA 3BERA 4KCGA 3NXSA 2J7PA 1VQPB 1G19A 1TU3A 3EC2A 3G5UA 1YR9A 2FMXA 1VYTA 1J7KA 5KSOA 1N6HA 4G5RA 1NRJB 1AQYA 3P32A 1KI9A 2R8RA 2BSAA 5KDOA 2ZI3A 4TMZA 3MHPA 1K5DA 1VHLA 3W6PA 5KDDA 2O8FB 3WYFA 2FZLA 1OLOA 5C2JB 4L9SA 3CH4B 2RCNA 3UPUA 4UNNA 5FI1B 2OV2A 3W5UA 1GILA 5EE5B 4IDOA 5EE0A 1AZTA 3TKLA 1RPZA 1KI6A 5FBWB 5H5JA 2OUKA 3ADDA 1N5LA 1C9KA 3AVYA 1EFUA 4TTQA 4UQOA 3VR6A 4B76A 4NYMR 3K0CA 4MKFA 4MYHA 5TY0A 2ZRHA 3ETLA 5FTKA 4URVR 4P4TA 2P65A 2H7VA 3M0EA 1G64A 3O8RA 3VTKA 2X8AA 3SI7A 4V02A 1T8UA 1R5NA 4IXNA 3CRW1 3FWYA 4NTZA 4MGYR 3FMPB 3JQQA 1BX1A 4V03A 1UKVY 3N70A 3X1ZA 2R6FA 3THXA 3CWZA 1G8PA 1QFJA 3H1TA 1FMLA 2ODWA 3TR0A 4EFLA 1PZNA 4PQRA 4Q18A 3HYTA 2V4ZA 3CRZA 1OIXA 4FMBB 4POAA 4QKQA 3VO2A 4MRNA 5FTMA 2DBYA 5KSPA 1KAOA 2JLUA 4BFSA 2ODEA 3GLGA 1VQKB 4UXHA 1AQUA 1W44A 2FFAA 2R9VA 3RWMB 4F91B 5K8IA 1UF9A 2WJIA 2CNWD 4OI2A 4Y9RA 4D82A 3VO1A 3CCUB 1MRNA 2O8CB 3IGFA 2AD5A 4HDCA 4PQYA 3CX7A 5LPNA 4XTCS 2ZSEA 4KO8A 4C30A 4A9AA 2CLDX 1E1RA 5JCZA 1NNEA 2O8DA 1L4YA 3PXGA 3UKDA 1NIPA 1ZJ6A 3KKNA 3MJRA 1IHUA 3CC4B 2QU8A 1Z6AA 4ZKDA 2EQBA 2HUPA 2XAUA 1NBMD 1R8QA 2ZJOA 1XTSA 4MH0R 1US8A 1NDHA 4O0MA 4LHXA 3DOFA 2EW1A 3ZS8A 4DIEA 5KUTA 1U9IC 4BGDA 4C0AC 3FVQA 1KGDA 2HCBA 2DWPA 2FSFA 2QSZA 4K46A 2WWGA 2C2HA 2BV3A 1QVGB 2VP0A 1OYYA 1SM4A 3W34A 2WWFA 4YMVA 1XZPA 2Z5FA 1NF3A 1YRAA 1RYHA 3OFNA 4FCWA 4O2RA 4U00A 2JJ1D 3F5FA 5FBVB 2ZRFA 3C5HA 1F5NA 5BW8A 2VYFA 3C41J 3PUYA 3SS8A 1ZD9A 2BCJQ 3TVDA 4OBEA 2ZSDA 3AVWA 2C5LA 3DKVA 2HV8A 4OHVA 1X3SA 2KB0A 2QQEA 5EZ6B 1YJNB 3CIOA 1TEXA 2BKEA 4M1SA 4M21A 2CHQA 2IBMA 3PFIA 3G6EB 1YZGA 4WW0A 1MO6A 1T3SA 4BRUA 2QPTA 1ZM7A 1FW6A 3MAAC 3RS3A 2QP4A 1AGRA 4RKEA 1WCV1 2ZJZA 2VSFA 3CONA 1O3YA 4AF6A 5L3SA 4D0LB 2X3UA 1G3RA 1NVVR 5CIWA 1W2BB 4IDHA 2H5EA 1Q86D 5AUPB 3REGA 1X8JA 2ZI9A 4JVSB 4JLMA 4QOSA 3T12A 1KDPA 1DELA 1MO3A 3BC1A 3CC7B 2QZ4A 2F6RA 1FNMA 1KC8D 3PUVA 3C8UA 4JJKA 4BWYA 1GG2A 1U8ZA 1VPLA 3H4MA 3CLVA 4GRAA 2VP6A 4EPXA 3SU8A 2BCGY 1KK3A 1AM4D 1XEWX 2HYDA 1NG1A 4KFUA 4ASUD 2ZR0A 3I61A 1XPRA 3X1DA 4Q1BA 1LVGA 4C2TA 3BD9A 4NBSA 2CJWA 1PLLA 2FX3A 3E2IA 1COWA 4PHHA 1OXXK 4W5HA 2ONJA 3A8TA 2WSMA 2DFTA 2QROA 5EE1A 2BMJA 2QRZA 1I7PA 3L43A 4TMTA 4G3XA 1AS2A 3U7HB 2NQ2C 2ATVA 1XCPA 2QPAA 1VYVA 3GEHA 2B8WA 2AK3A 3L0OA 5L3QA 2N42A 2V1UA 1KDOA 3HR7A 2YJTD 2YOHA 1XFAA 3F3YA 1UPTA 2EVWX 1IQPA 4M9SA 1IN7A 5TV2A 5B64A 2X1VA 5CM8B 3PENA 4QHYA 1UBFA 2NO6A 3DO6A 4NU0A 1R2QA 4KHZA 1FP7A 1I2DA 1YRBA 2VQSA 4HDOB 2OTLB 4HE6A 1P6XA 3CRVA 4DJTA 4ZDIA 2FPMA 2PCLA 1SVSA 2RGBA 1QGAA 1XNJA 1IN6A 4TMWA 5KU1A 3U6KA 2QSYA 1CLUA 2B7BA 2G0TA 1U81A 2W6JA 5FBQB 2RH5A 2QE7A 2DR3A 1QGYA 1SVIA 2NG1A 4WAUA 4HZUB 5C1BA 3KQLA 3S1AA 2HT6A 3TGPA 5LDDC 5FPYA 4LZZA 3U44B 1D2MA 4US2R 3A1WA 1OPXA 4QM7A 2WKPA 4RCYA 1OF1A 2JIZA 2W2VA 3L2OB 3LA6A 3PJRA 1OXTA 1P62B 4JLBA 4EH1A 1CBUA 2G0NA 1CEEA 2J5XA 3DVLA 4ZI3A 3CWQA 5HR5A 2KWIA 5GVSA 4G5QA 1NN5A 3DMNA 4U9UA 2B92A 3U3OA 1G6OA 5F98A 1QFZA 4CZ2A 2R65A 1Z6TA 2OAP1 2E87A 4O3MA 2IYYA 3CD6B 2PJZA 3RS2A 3CM0A 2WWYA 5C4GB 4P4SA 3PCRB 3LBHA 2C8VA 1KKMA 2OE2A 4K1XA 3LXXA 4II7A 5FPSA 4AYWA 5CIQA 4CT5A 2ZS7A 2VHUA 1GL6A 2ZREA 3QKRB 4IFEA 3I73A 2DWOA 5J40A 2CCGA 4Q9JA 5JWHA 1MABB 2YWGA 3QKSA 4A0HA 2VHJA 2GXUA 3TUZC 2BGJA 1P2UA 3EZ6A 5KNDA 1UKZA 3AUXA 1J70A 5JSZB 1N25A 2CXXA 4Z8YA 1GRRA 1VG1A 3U6BA 121PA 1A1VA 1VQOB 3AF0A 3AP3A 3OE7D 5FR2A 2GXAA 3CR7A 4YMWA 4LDJA 2CLSA 5EXSA 4LBWA 3K53A 1E0KA 1C1YA 1VHTA 4V0KA 4OHXA 4HDQB 1Q3TA 3A36A 2XXAB 4JL5A 4A82A 4KLNA 1RRGA 1SZPA 2Q9BA 2XOKD 5DISB 3RLFA 3FHCB 4PO9A 1GNPA 2IYSA 1TU4A 4V0MA 4IVRA 1P2VA 2ORIA 2V7QA 3MWKA 1X1SA 3ZGXA 4NYMQ 1JPNA 4HLUC 4IKEA 4OHYA 1FQJA 1A5TA 4PZZA 1G3QA 2FOLA 2RB4A 2V1XA 3CF2A 4TL8A 1PUJA 4JMPA 3A1UA 2AN9A 5CK4A 1E9BA 1G7RA 1P9WA 4ZIRA 1OH8A 1DDGA 1KSJA 3CUEF 3E70C 2XTZA 1BIFA 1XD2A 1JPJA 1U0JA 2ZAMA 2FZ4A 2AXNA 4KITB 2V8OA 1AIPA 2QM8A 4TZ6A 4MRSA 5JWOA 3VFDA 2GXSA 3OF5A 3IHLA 4BFXA 4EJSB 2VF8A 4IDPA 1AKEA 1WE2A 1Z6XA 4BLSA 2IYUA 1U9IA 2IS4A 4GMXA 4PC7A 2C95A 2G88A 3VNVA 2NO0A 4YXWA 1OB2A 1N8RD 4YALA 1OKKD 3CMEB 5AK0A 5EE3A 2C98A 4DSNA 5CITA 4IHQA 3SNHA 3Q5DA 3SBDA 4ARZA 1OH5A 3ZLJA 5AN9A 1Y63A 3K9GA 1IAQA 1BMFD 2ZITA 4ZV4A 2O8EB 3C4JA 4IOKA 1R10A 1S1CA 3ZIAD 1FOEB 2Q3MA 4LJ5A 4JKIA 4LYAA 1F20A 3VR3A 5HXBA 3AVUA 3QFCA 3IDQA 2HYIC 4LJ4A 4M1TA 4Z8XA 2BDTA 2W6IA 4R7ZA 2XNCA 4XSHA 2OCYC 1SKQA 2EFHB 1G8HA 2J0SA 4W5JA 3KXKA 4QGFA 2YNMA 5DIFA 3QG5A 4M53A 3B1VA 4TLDA 1P2TA 1JALA 3KUCA 4URWR 2FWRA 4DBLC 2JLYA 2OK7A 2XX3A 1KI2A 2J45A 3LLUA 4QJ5A 4OI4A 4JVLA 4EPTA 1YITB 2J0VA 1HQYE 4CT4B 4P6VF 5LBIA 1ZU4A 1Z06A 4G1VA 3DMDA 3IUYA 1E9AA 4G5SA 1VDZA 3BB4A 4DIDA 5F3WB 4LC0A 4XVQA 1ZUHA 3D7MA 2D62A 4BFWA 2J0QA 1WF3A 1E99A 4CDGA 4OKSA 4GPTA 2VNHA 3B6EA 4R2IA 4M0LA 1SXJC 5JJIA 4HUQA 2VYQA 1NJFA 1QG2A 3GLHA 2W0SA 3R7WB 4C9BA 1YU9A 5JI2E 2Z83A 2WJYA 2G1KA 1U8AA 1NBMA 5D3MA 2UZIR 2GJ9A 2O8BB 1GAQA 2F1HA 4X8MA 3I92A 3QF4A 4BFTA 4FD2A 1X8LA 3SYLA 1JB9A 1Z63A 1NP6A 4QBFA 5KYKA 3MWLA 3CW2A 3N2IA 5A5GA 4HAXA 2AHOA 5M04A 4PHGA 1FNDA 4QM6A 1IXRC 6Q21A 4UKDA 3WHLA 5L3VA 5FOXA 2OCAA 1Z2AA 4OK6A 1Q22A 4LSGA 1GDDA 2VHCA 3BH6A 1QRAA 3I8SA 4URYR 3Q3JB 5DI3B 2JJ1A 3W5IA 4RZUA 1VCIA 4UAJA 2QORA 4ZDWA 2IXFA 3EPHA 5FUXA 2LP6A 2UKDA 4QFMA 1NVVQ 1E6CA 1KSFX 4TMKA 1KY3A 2FFHA 1TQ2A 1JI0A 4LHZA 1ELOA 1XB2A 1KSHA 4OK3A 2JCSA 1KO5A 3ASZA 1SGWA 4Q7LA 1EFCA 1Z0AA 1ZU5A 3BH0A 2JLVA 1PUIA 4KBGA 4TLAA 1GSIA 2BBSA 2R6CA 4RD6A 4PPFA 1QVRA 1Q57A 1YZNA 3MRSA 2IC5A 2IEYA 4AKHA 2AWNA 1NY5A 2R2AA 2ZJYA 2F3TA 2YC2C 4CW7A 1QHIA 3FHOA 2CNDA 1LFDB 3LD9A 4RFVA 1E2QA 4Y0AA 1QFYA 1DADA 5D3QA 4W7SA 1XMVA 4IOMA 4LBVA 4NCHA 4TTPA 4PC1A 3T15A 4LJAA 2DETA 3U61B 2WBLC 2A5FA 5CB8A 2ZROA 3LXRA 4B3GA 1PVOA 4A92A 4DVGA 1F2UA 3SQXA 1ZINA 4Q19A 4W5WA 5JBQA 1F2TA 3KKPA 3QQ5A 4GT1A 1T9HA 3SEAA 2XNSA 3NEYA 1VCNA 2GEUA 4YDHB 1Z83A 4FCVA 4GOXA 2IYVA 1HQCA 2N46A 3KJIA 3X1XA 2YOGA 4B32A 5FL7D 3KUDA 3B2EA 2FG5A 2HLDA 1II8A 1H8HD 4NONA 4BLTA 3NBFA 4QNRA 1A2KC 4RFSA 5EXPA 4C7OA 4B3BA 1ZNXA 1RVDA 3W2HA 1GRQA 2IHYA 2IF0A 4GI7A 3JZAA 3LVRE 4M1KA 4CIDA 1KO7A 1DO0A 1IN5A 4B4DA 2QN6A 1QG4A 3K0AB 2GCOA 4MKHA 4FN5A 3I4LA 2EFDB 4J0QA 3NTUA 4KLZA 3X1YA 2JLZA 2GRJA 1G7TA 1RE0A 1XP8A 4E07A 1WMSA 4LYHA 2QBYA 3OZWA 1IN4A 1G4UR 1NIJA 4DLTA 2C78A 1E2NA 2MSDB 1CRQA 2H1LA 2WV9A 3BFVA 3KQUA 1LNZA 3CO5A 3GJ5A 2FDCA 3CCQB 4DDWA 4KBFA 2GJ8A 2J0UA 1W1WA 1XMIA 2ZRCA 1XU4A 2PEZA 3OEHA 2WSSD 4IXMA 5DHAA 2VO1A 1KDRA 3KL4A 3OEED 2X19A 1F48A 4TLCA 3BK7A 4AG5A 2WTUA 3ND9A 4TL9A 1S8FA 4LV6A 3IO5A 3RRMA 1KDTA 2JATA 2QAGC 3NHAA 1I2MA 2FEOA 3KFXA 1N6IA 1JB1A 4A4DA 1NY6A 4MA4A 5HKKA 4ZCLA 4QJ4A 1GKIA 1F6BA 1W46A 2CL0X 4HLUA 1X86B 2LKDA 1N0UA 2H8KA 4OQFA 4DLWA 4ESHA 1DDIA 1DAIA 1U94A 2QGZA 1KZGB 4UNSA 4AURA 2P3SA 5AUOB 1SHZA 1OXUA 2F7SA 4BQSA 3FTQA 3J81k 1ETUA 3ECCA 2D06A 1EWRA 1HH4A 4HEJA 1FUKA 1SVMA 3SFZA 2BPOA 2F9MA 2MMGA 5TVKA 1S96A 1G8YA 4A0RA 1W34A 4IVQA 5G41A 3QKUA 2WZQA 2CCJA 4B3FX 4HI0E 2ZIAA 4MQBA 4JBWA 5JMTA 1E2MA 4A2PA 3ZVRA 3E20A 3VX3A 3Q72A 2ZE5A 3FFAA 1HURA 2BM1A 2HF8A 3A1SA 5KPJA 4Q4AA 4YMSA 1IOZA 1QH0A 2ZRPA 1XBTA 3IPYA 5JZVA 5CYPA 3VKWA 4Q00A 2YC4C 2G6BA 2PL3A 4EPWA 3U60B 3AH8A 1ZUIA 4RD3A 3RYTC 3UIEA 2ZYTX 1Z0DA 3OE7A 1SULA 3U5ZB 2EFEB 4XWKA 4Q4JB 3QEOA 4H1UA 1KMHA 2RAPA 4C4PA 1BQEA 4XD7A 1KI1A 4RCZA 4NDZA 4MGIR 4D26A 1A2BA 4NCNA 4URUR 1E9EA 2OFXA 1SQRA 2P2LA 3ZVNA 1FP6A 4HSEA 4FWIB 2VNJA 5JEEA 2L0XA 1E9CA 4TMVA 1ZD1A 2X2FA 4Y0VA 3VHLB 1Y3AA 5ANRB 1OIWA 1XTRA 3GCGA 1GUAA 4A8JB 3V9PA 5J47A 1H65A 2IYQA 1DAFA 1U98A 1KD1D 4DQKA 2WJJA 4DCVA 2XJ4A 2ZE6A 3RS7A 3TLXA 3VX4A 1RC8A 4KXFB 3OHMA 1ZM3A 3TIFA 1RJ9A 4YAWA 2PZGA 2W2TA 1HUQA 3CCVB 2EU8A 1TL7C 2BC9A 1SVWA 1U90A 3P4YA 2AX4A 3V00A 1GAJA 5CB6A 4EAQA 1CIPA 3SJZA 4Y9UA 4UJ3A 3CB4A 1W4BA 1W48A 2IYTA 3D31A 4LYJA 5JRZA 3GJ3A 1D8TA 1KJWA 1Q7YD 3TW8B 2OTJB 5FUVA 1CXZA 4EFMA 3THYA 5KPDA 2ZS9A 4LUCA 2RGDA 3U4QB 4ZCMA 4BPBA 1T91A 4DZZA 3EIEA 3RS5A 2QMOA 1E64A 2CVFA 2E9SA 2QTFA 5L3QB 1I4LD 1OKKA 1VIYA 1XXHA 1W36C 5BWMA 4DRZA 5HZHA 2WWHA 1XPOA 3TMKA 2RHMA 1N6OA 4A36A 2XSZD 1DVRA 2NO9A 2WKRA 3AV0B 2PT5A 3CX8A 3L8ZA 4NHOA 2IF2A 4BFZA 1Q12A 3CCMB 2GJAA 1G17A 3CR8A 1KK1A 2F43B 1W4CA 4YHBA 3MG9A 5EUQB 4BPRA 221PA 2C99A 2ZUBA 3TJZA 3B13B 3FMOB 3HR8A 1I4DD 2A2ZA 3LLMA 3V4RA 4DEXA 1TUEA 1Z47A 5DH9A 5AUQA 4Q1AA 4M1OA 1E79A 3D6TB 1UMKA 1VMAA 4JYCA 1U99A 1CRPA 1Q20A 4XOIA 3LY5A 1HA3A 3FGNA 3K0EA 2NPFA 5CDFA 2EIXA 2OBLA 1QHHB 3PEUA 5JJLA 3ICEA 3KB1A 4I1VA 4CYMA 1FDRA 1IY0A 3P4XA 2B8TA 2ZI4A 2PLFA 2G1JA 1UDWA 4S2EA 3SBEA 5BN4A 5F2EA 621PA 1L4UA 5FTLA 2GPJA 1E2GA 3K0SA 3LWNA 3ZBUA 3ZD6A 1KJYA 1Z0IA 2GEDA 4HAWA 3EWSA 4FMCB 4F7DA 1KAGA 3EG5A 2ECKA 2B7CA 2JGNA 2LKCA 1F3OA 2WVJA 4AKGA 5JS8A 4LOAA 5GADl 3WYGA 1XCGB 4HUTA 3IO3A 4AK9A 3B1WA 4E09A 821PA 4M2LA 1R7RA 1GL9B 1HT1E 3FMIA 1E9SA 3W2EA 3QUSA 3CBQA 1Q3HA 2OT3B 3D8BA 3NBZC 4UXIA 3VR4A 2A5YB 4FCTA 4TYPA 4I1SA 4LPSA 5G40A 4D0GA 1QUFA 1CJTC 1G3MA 3T06B 3RRZA 1VKJA 1G16A 2FEMA 1M74A 1RZ3A 2XZOA 1G5PA 2WHXA 1S9DA 1YR7A 5EQTA 3REFA 3SYKA 3ZBTA 2JDIA 3PEYA 2VBCA 4LY6A 2XZLA 1NJID 2FFBA 1ZM9A 2XITA 2CE2X 1TF7A 2FNAA 4M8NE 3KJHA 3BFXA 3GJ7A 5DN6D 3NVAA 2CLCX 3W5JA 3LW8A 1J8MF 5H68A 1ZIOA 1Q1EA 3B60A 2HCJB 3FKQA 4I99A 2Q3FA 4DUGA 2DYKA 4AG6A 3ZS9A 1RRPA 4HB3A 4PAQA 1TVCA 3OAAA 1SVKA 3JQPA 5FBRB 1OYWA 2D3WA 5K8UA 4XTRA 4U5XA 3K0FB 2CDNA 3LDAA 3L82B 2GESA 3IHWA 5EUMA 4XIGS 3A4LA 1W0JD 3GFPA 4JJZA 4PANA 4RD1A 2QAGA 1BYUA 3THWA 5P21A 2QEXB 4D2IA 5FH9A 3FHTA 3BOSA 2K5UA 1FUUA 3ZH9B 1DAEA 1T3HA 2BN4A 5JECA 1YJ5A 3X2SA 4BFUA 4DT1B 2D74A 1S9HA 5FL7A 1WBDA 2P0EA 2QP3A 1N5IA 2QPOA 4KJZA 3ZDQA 1KO8A 1G8GA 2P5SA 3VKGA 4OHWA 1NJGA 1NVUQ 2G3YA 4A2WA 3NBYC 3QSYA 2GQFA 1KOFA 3H0KA 1R5OA 2IYRA 3QBTA 4TYYA 4X8HA 1KQSB 3KQHA 4B6EA 5FOWA 2GZAA 4RSGA 3RAPR 4DCTA 3M1IA 3QKTA 1PJRA 4B2LA 4XWOA 2VPPA 1LS1A 1E2EA 1UADA 1LB1B 1B0UA 4PXAA 4U02A 4C0SA 3RRYA 3VU9B 4JLOA 5FOSA 3WNCA 4OQXA 5HZKA 1GP2A 4E03A 3H2YA 3WMFA 1NLFA 2DCUA 4TLEA 2ZRDA 3P27A 4L15A 1TNDA 3AQ4A 5SZIA 1XEXA 3SHWA 3UG7A 1VQMB 4YDSA 2PT7A 2WSSA 2D7CA 2WPDD 1R8SA 3IBGA 3OEEA 4RZ2A 3T35A 2I1QA 3GLIA 4GP6A 2A30A 1RKBA 2ZRJA 4TYNA 3HJNA 3EPLA 2AWOA 1ZYUA 2REXB 5J4HA 4BLQA 1OXVA 5GVRA 1YJWB 3BB1A 3SC3A 1KIMA 1KSGA 3ZQJA 2WWIA 1CULC 4TQAA 5L8VA 4FINA 4MRPA 1MT0A 1N5KA 1QBKC 3TNFA 1E2LA 1FFHA 1XWIA 3EW9A 4BASA 1P5ZB 2DHRA 4M22A 4NL4H 5F9HA 2BBWA 4PPQA 3JQRA 521PA 4UNRA 2V3CC 1M8PA 2RGXA 3ES9A 3FFBA 4E22A 3KTAA 3KKMA 1XPUA 3MJHA 4ZO4A 1CP2A 4PAMA 5TDHA 2J7KA 4JLDA 1OXSC 5LB4A 2ORVA 4OYHA 3W3AA 4Q4HB 3KDSE 4BLPA 4JBYA 4JYBA 4WZAE 1ZIPA 1KNQA 4WZ6A 5JLJA 3GD7A 2AR7A 2VHTA 2OCPA 3G82C 3B1ZA 3VAAA 3P26A 1ANKA 3SQWA 3CCJB 1Q21A 4B3DA 1GVNB 2HXSA 1GL7A 3TUIC 4MRVA 2ZRKA 4DDTA 2J87A 4U7DA 1LW7A 1JR3D 1KZ7B 1FZQA 3PIRA 4TWZA 1OH7A 3LX5A 2QUZA 2GKSA 2QY9A 4PR0A 2OSBA 2JAQA 1FTSA 4LJYA 2KBEA 1I4TD 1TQ6A 2CHVA 3DM5A 3QOFA 3BRWD 3N2EA 2VP4A 4PGOA 3AEZA 3MCAA 1LF5A 2DERA 4XSGA 2ZRGA 3FOZA 3IQWA 4Q7KA 2OBMA 8OHMA 1EK0A 1VG9B 2G77B 4DB2A 2FJUA 4JLPA 2R62A 4QBGB 4M1WA 1NI3A 3TH5A 1M7GA 4JLNA 3VR5A 1DAKA 2ZRNA 1TX4B 4IDNA 3CPHA 4PQFA 1WQ1R 1JR3E 1T6NA 3OW2B 1F2UB 1VQ5B 1Z28A 4IOJA 1G1MA 1YZKA 2KE5A 3QE0A 1FMJA 1E2IA 4F4JA 1CQXA 2GBLA 1PLJA 3GLFE 1JAIA 1G9XA 2IYWA 2EYQA 4TL7A 3W3ZB 1FRNA 1W5TA 2QRNA 4V0LA 3QVUA 4ZGNB 5J4KA 3HPRA 2P6RA 3RS0A 4MYTA 2JLQA 4JS0A 4P0TA 1XMSA 3RHFA 1YE8A 5DYIA 3PQCA 3LRPA 1P75A 2XNDD 1Z07A 2O0JA 1OIVA 3GFOA 4LPKA 2ATXA 1XE1A 3B9PA 1G4AE 2D4HA 4MDEA 1GRNA 3NH6A 1JJ2B 4EPVA 1RFLA 2EWWA 4B3CA 4B2IA 4CEJB 1TQDA 3DKPA 4RD4A 2H92A 2XSZA 4ZKEA 5JCPA 5FA6A 4PTLA 3DL0A 4K81B 3I62A 5JJKA 2Z43A 4HAVA 1QHGA 1IXZA 4I4LA 2BGIA 3CNLA 4PO1A 2NTYC 3GLFB 4KFRA 1G8FA 3NH9A 1EX6A 1JEDA 5BXQC 3MWYW 2O8CA 1GFIA 2VP5A 2FE4A 2ZSBA 3EA5A 1EP1B 5FOVA 3CCSB 2CE7A 2W58A 4KSBA 4XJXA 1E94E 1UM8A 4JSYA 5E7MA 2A5JA 5JFGA 1E62A 1XX6A 3IQXA 3NBXX 4G1UC 3CCLB 3SZRA 4DLSA 2WOJA 2VEDA 2CCKA 2WWWA 2OILA 2QM7A 2YV5A 1VQ7B 1S3SA 4D4KA 5JWRA 1TLLA 4B43A 1KNXA 2OEPA 2EWVA 4YLGA 4M4SA 1WRBA 2GZDA 5GJVC 2XEXA 1Q81D 4Q02A 1D1NA 4TN1A 1S3GA
chains in the Genus database with same CATH superfamily
4ENPA 3M9WA 2IE0A 2JGKA 3OLVA 1FYFA 2FOXA 5L53A 1S2OA 5BSFA 4LGYA 4XYMA 1XTZA 2XRYA 1YCDA 2OESA 4MO2A 4G1CA 2VDMB 2XY4A 1FNIA 2BMFA 1ORRA 4DNQA 4AW9A 1BFDA 4ND7A 3COZA 1CR4A 4IBOA 3SJ9A 1XN1A 2ZJ8A 4JYTA 5DNDA 1V2LT 1NX9A 3EMBA 3RAJA 2XOXA 4JLAA 1BJKA 2ORWA 1VZ2A 5C8VA 3NASA 4D3XA 3EIFA 1NN3A 4MAAA 2WUGA 3ZQKA 4GOND 5BRAA 3EDOA 3DPSA 1IDN1 2YJ3A 4E06H 1FY3A 3L0IB 4X8VH 5CMXH 4EG4A 4FQ7A 4BNYA 4P3YA 5CK5A 5H8WA 2Q5JA 3PD1A 3F4KA 3FN8A 1EJ6A 3D1LA 5I01A 4R1OA 1YQUA 3M3HA 4W1PA 1U3TA 3C97A 2ZIEA 1KI6B 3SZLA 1PS9A 5IJ9B 4F5YA 1XLUA 2PMFA 2OGWA 1F9EA 2ZWMA 3UUWA 3WX0A 4P4LA 1QQ4A 3RYHA 1TMYA 1WBGB 5EQRA 5BT9A 4D8YA 3WLPA 4MW6A 2HBRA 1BXGB 2YIVX 4ZAVA 5FA8A 4GVPA 1YKTA 3CESA 2VNIA 4X0WU 1ZMNA 1GG8A 2G5CA 4MYUA 5FTNA 2R7MA 1G6Q1 2HF9A 1GAWA 2VL7A 5LD2C 4RVCA 4RY8A 4R0IA 4ZYUA 2RH9B 3H04A 3BSSA 2GUWA 5I47A 2RHCA 4D3ZA 2D5BA 5H1YA 1DAGA 5ESXA 1LDYA 1TB6H 4FN4A 3VOTA 3IKMB 3FPGA 4PHCA 1HAZB 4P3XA 1SQGA 2BI8A 4HLDA 2V6JA 1T24A 3B7WA 4EY6A 2BMDA 1H6BA 2WG0A 3A26A 3O74A 3Q7QA 2ZBFA 3QYPA 4UHDA 2PPLA 1UBLS 3D2BA 1DWDH 4Z0PA 4BJ6A 1ICIA 4BO3A 2ZVQX 2HJ9A 2AE2A 3H8SA 2BLWA 1SY7A 4W1RA 1UC9A 2R2WU 5L3SB 2RA3A 5IMSA 3QLVC 4NIWA 3IVRA 2EQAA 5GWZA 1KE2A 3W9YA 2HPAA 2EF0A 3DYVA 1NDQA 3QXHA 2BX4A 3VV3A 1D1SA 1S3FA 1QF9A 1R0YA 2CDCA 1EXVA 4IDQA 4PBSA 2ZYVX 1DBSA 2O20A 1GZ7A 3VH3A 2FSHA 4ZQFA 4MA0A 2KMLA 2YS6A 2Q3JA 1GR1A 3KALA 2YVQA 1H9LB 2GS9A 1POXA 4YRPA 4DV3B 2JGMA 3U7QA 1RABA 5J43A 2DQYA 3HO6A 4FEEA 1CB7A 2VHYA 1RHRA 2EKPA 1P2MA 4W8OA 3KJZA 2V9ZA 2HMAA 1XZAA 2HQRA 3TAXA 3LV8A 3GHHA 1XVVA 3KZMA 2QP9X 3KZCA 4P4SB 2OXCA 4WDQA 3L4JA 1Q82D 2O52A 2GD1O 4R1UA 2NVUB 3ZZUA 1JSXA 4QNMA 4EMTA 4NK4A 1QGZA 1ZGZA 1U0BB 1MNQA 1H93A 1QB9A 1TQ4A 2CBZA 1UJCA 3K0AA 4RVUA 3O9ZA 4DZRA 1YC5A 4NENB 3PQ8A 2C7RA 1GPZA 5SYMA 2Q4EA 2YVLA 3OT4A 2RC5A 1PJPA 1Z39A 1FJ2A 4LHSA 3EVGA 2X77A 4DLYA 4YELA 4OHFA 1VGQA 1MR3F 1HE2A 4PSKA 4DV2B 1KJZA 5E1DA 2O1SA 2D1TA 3FPEA 2PXAA 3IR6A 3H6GA 3FSGD 1L4KA 1NOIA 2QOEA 4Q9AA 3JYQA 2ZYDA 2QRLA 4AP6A 4KR0A 4G09A 5DTQA 1WWKA 1UBNA 3PR3A 3TAHA 2EGHA 2HHCA 3COPA 4UFDH 1PG2A 4P8RA 2CMKA 5F33A 2RHLA 4F4HA 2CW5A 1AKMA 3FWHA 4IJWA 5AIAA 2CFRA 5EXXA 4HMOA 1WU8A 1U3DA 4VGCB 2HO4A 1I3OA 3AJEA 4K87A 2OHOA 2QMEA 4LDQA 3WIBA 4K2HA 1DB3A 1MO4A 4QSMA 1X1EA 3T7RA 1NUSA 1XF1A 1ZEJA 2G6TA 1B3BA 1M2JA 1OAAA 4EF5A 1M1XB 4QOEA 1L5RA 2GAAA 2ZIUB 1THPB 3LMKA 1TAQA 2IITA 2PZMA 1E2PA 4NH0A 1FTGA 1YCGA 1W0ZU 3RHSA 1BO6A 3O8BA 4DK1A 4Z4UA 3TTTA 1IJKA 4QUGA 4XWYA 5EMLA 3I9NA 3HHPA 3LQFA 4NHEA 3S2IA 4DV1B 4WMFA 3EIUA 4UUNA 1EA7A 3H2KA 1OJLA 3UPEA 1U7TA 3MBIA 1GZ3A 3OU7A 4D92A 3W79A 4BJHB 3EA7A 1EAYA 1DKMA 2AJTA 1C0EA 5DYNA 4CETA 2AFIE 5DF1A 2WHQA 1J8YF 1UZUA 2VJAA 4PG4A 4Q1EA 3A58B 1LV7A 4Y2HA 3WRWA 1AKNA 4G5YA 3NKLA 4OJKA 4JP2A 3DDZX 1IQIA 1IHMA 1P91A 4XOJA 4AKIA 4DLXA 3KTDA 2X3YA 2YWXA 4J0FA 3NHBA 3D23A 3FANA 1NN0A 2H4WA 1YB6A 4CV1A 3DJFA 2YV4A 1A0HB 1Z1JA 4F2GA 3LHFA 3AESB 1P5HA 4QREA 2DR0A 4NZ9A 1QZZA 2IH4A 4TWJA 4BECA 3SMVA 2ECFA 4KKSA 3GUCA 5AVQA 3KX2A 5DYGA 1W96A 2ZXUA 2CWDA 4FBLA 4PLYA 4CQJA 4X95A 3NBUA 1E4YA 4KTSA 3PXUA 2ZUCA 2OO7A 4LBZA 4GH5A 1Z62A 1J06A 4K69A 1B6SA 1E1QA 5SZHB 1GITA 5L45A 3ER9A 3QH4A 4RZ3A 1M9UA 5KWJA 1IHPA 1Y7PA 3K3PA 1RJWA 4EL5A 1W10U 4L8JA 1HTTA 5B2ZA 4ICIA 4DNFA 4NWKA 1YULA 1MW9X 3HKEB 4UVIA 3BKWA 2F8MA 1EFHA 3TZBA 3JZMA 4Q4HA 4E7RG 4Z0HO 4WZLA 2P0AA 2HU5A 2R6DA 1EUQA 3CRQA 4TLMB 1Q1GA 1YI1A 3EIXA 5J63A 3S2EA 1IY2A 4DQUA 2C4VA 3VDMA 3AGPA 4YAEA 1KVSA 4YTAA 3QXXA 5CT6A 2JJYA 2QXJA 5C67A 3EXAA 3CS0A 3R9IA 2W7SA 3I8OA 4PICA 5KTRA 1G9TA 3AJAA 2ZR8A 1E96A 4XYGA 4P0PB 1XKBC 5FUQA 1S85A 5IT5A 3TJRA 2CUNA 5GIBA 1X6VA 2TIOA 2C00A 2GD2A 1RD4A 5FF9A 2HPQH 4P5PA 1K86A 1GPYA 3BRWA 4HNHA 2B6NA 3LZDA 2QLNA 1IZ9A 4Y30A 2ZE8A 3E3OA 5C0UA 1JDBC 1OBCA 2OB1A 2CMYA 2AN5A 5E3JA 3ASVA 2R0LA 1GO2A 3FPHA 2FN9A 1TAWA 2RKBA 4GX0A 3SZ3A 1O38A 1U02A 2BGTA 3V34A 1RI1A 1Y8QA 3UFXA 2NU2E 3PNOA 3HJUA 1Z7KA 1DO2A 1XJQA 1KZYC 2ZTMA 4P86A 3W5HA 1F0UA 4WOCA 4A8JC 1HDXA 4JEUA 4S24A 2ZZFA 5F76A 2E37A 4P81A 2DHQA 3CF0A 4LMAA 2ZYSA 4R2HA 2YHUA 3R5XA 5DGDA 3T5MA 1MKYA 1JIUA 4AJLA 1QL9A 3H5CB 2OZEA 3SOZA 3B20A 3N2GB 1G9IE 3RS8A 2WRZA 3DEYX 1EVKA 1UVUH 2J9XB 2QG9A 4EW6A 3QG1A 3LUHA 4KREA 3QPUA 3GIDA 4NCIA 1N75A 4H6TA 2OMKA 1OKXA 3QDZB 1WG8A 4CQLB 3PLRA 5K0SA 2NU1E 5H9WA 4KGZA 4FEYA 3K1ZA 3PA8A 1LK5A 3UPUA 4GX2A 1BTZA 3TECE 1EFUA 3BHNA 3BYZA 2V5VA 3GG2A 5ES3A 4R1LA 4AJEA 3M0EA 1DGQA 3P9SA 4TMFA 3ZVKA 5EXLA 1ZRKA 1XL0A 2N1MA 2AYWA 2AVNA 2JIDA 3PGKA 3MJ4A 2TSYB 5KSPA 1Q74A 3AOEA 3ZZ4A 3TDNA 3EFOB 4XFQA 4KUEA 1WQ3A 3WI7A 3ATWA 9GPBA 1L4YA 4WT7A 3UT5A 5LJIA 3MJRA 1US8A 4ZVOA 2ZDHA 1AF4A 3ZI0A 1C2HA 1CY7A 2O2HA 3Q88A 1IM5A 3LC2O 2WWGA 2C2HA 4BCDA 5CNIA 3PC2A 1RYHA 1D6RA 4M99A 4BAZA 1HNXB 3ZDAA 3BHJA 2JHFA 2QQEA 4R9SA 1YJNB 5JD4A 2CBGA 2IBMA 1ZM7A 3U56A 4XZ3A 3E03A 3MJVA 1CS0A 1GCGA 1GPKA 1G3RA 5DASA 1P1BA 4S0XA 1KC8D 3NORA 1O3BA 5FPPA 3ZZ6A 3OPYI 2OXSA 5JTUA 4PNEA 1SQTA 5K0NA 3NI2A 1CRLA 1D7OA 1LVGA 1K1MA 3NM5A 2CBXA 6CHAC 3D6NB 1K8ZB 3FVRA 2OXEA 2H85A 1FX1A 3H1EA 3ASSA 4DMCA 1BWRA 4CMCA 4NFFA 1OILA 1UK6A 2A1TR 4E3ZA 4BB5A 3R5TA 5G4BA 1UM9B 3F3YA 1WU1A 1ZJJA 2TMGA 5DGCA 3DO6A 4UQLA 4LS3A 1R2QA 3O21A 4M9FA 1FP7A 1ZQ9A 3B6MA 3INTA 1B16A 1QGAA 3HN2A 2UWPA 2B2XA 1R4NA 1HJAC 2YX1A 1FVHA 2BT4A 4FQ8A 4P7GA 3U44B 3E1XB 4C0WA 2Y1GA 1TKBA 4A5OA 1VB5A 1E60A 4QGBA 5F77A 2Q1XA 4ZYZA 3Q3IA 3G23A 2FYRA 2W11A 4UHEA 4N3AA 2IYYA 1TK2A 2X0JA 5JZSA 1B6RA 3ZIDA 4HQOA 3BUSA 1AZ8A 1YQXA 1EB8A 4W7IA 3ZYZA 2I7CA 3QKRB 4L8WB 1XQ9A 3I73A 3LGVA 1O2PA 3UJHA 4MR7B 3NVDA 1A1VA 1L5OA 2QVLA 4DIBA 2WFLA 2FR8C 4KLNA 2X4GA 4IJKA 2XOKD 1THSH 1U2SA 3STXA 3C39A 2R8PA 3OTQA 4Y6SA 1F8XA 2PY6A 4YK7A 4ZK2A 5CH8A 2FOEA 2B4QA 3B23B 4QFBA 5K3OA 2WY2D 5ALDA 5K0CA 2GMTB 2V3WA 2BRUC 2C58A 2ZJ4A 4JXKA 1Z6XA 2IHVA 4GOMD 2J3DA 4GLBA 3PE4A 4CKEA 5AK0A 3EZLA 3MO3A 2GTBA 1AFQC 1QFSA 4OQEA 1N2CA 4RPCA 4YV2A 3M36A 4IOKA 5IYZB 3H2ZA 1XWWA 3ZNOA 3QFCA 5DXAA 3NHSA 4F4DA 1JG1A 1KC1A 3N8HA 1VL8A 2OYNA 1JALA 1I13A 3RLWH 3DLAA 1YITB 2PX6A 2FI3E 4BN5A 3V8PA 4EHFA 3R7WB 1QG2A 3GZNA 4RXMA 4M1ZA 5I48A 2XDWA 1QOPB 3EH2A 1X8LA 5F4JA 1NP6A 4YIHA 4K0RA 4FFBB 5H4GA 2W2LD 2VHCA 4EM6A 2IXFA 1VPTA 3SS7X 2JCSA 5KTOA 4BC0A 1Z1IA 4JXJA 3LPMA 1ZRMA 2F3TA 3NXKA 3PL5A 4V2IA 5I7AA 1I1NA 4JR1A 5F1PA 2PS3A 1EP5A 4TWYA 5JBQA 3KKPA 4Z4FA 2GEUA 5AI8A 4K3UA 1CZOA 2AI3A 1A2KC 2V31A 3HGQA 3VHRA 3V4OA 3QHAA 4TRMA 1TKCA 2HQSA 1QG4A 1M5UA 2PGJA 4JHXA 2O1XA 1SA0B 1IN4A 2D3LA 4I0WB 4C3UA 3Q7IA 3BFVA 4XM1A 5ALKA 4HXFB 3AIIA 4N49A 4AO8A 1A9YA 1A46H 1XEAA 3KL4A 1FK8A 4XB1A 5HS4A 1N0IA 3WGOA 5FNVF 2ZDVH 4N6OA 1JB1A 5IAKA 5HKKA 5EHQA 4FZVA 5H7XA 1U94A 1D6NA 4J9VA 4BQSA 1OWHA 3CS3A 1BU5A 7ESTE 1FRFS 1ZXBA 3W3AD 3M35A 2F9MA 2H2DA 4TS3A 4W99A 1PL7A 2ZIAA 5LPRA 3TQQA 3D4OA 3IX7A 3VU8A 1IOZA 1AMNA 1XBTA 1TU0A 4XLHA 4OB7A 1O3DA 3VH2A 1IOLA 4FHFA 4GM4A 4YCAA 5HIAA 3BMNB 4BMVA 5IXYA 4URUR 1SQRA 4PZPA 3RGGA 3GUZA 1I01A 5E0OA 1U28C 3MWFA 1R3DA 2VPQA 3M3VA 1JDUA 1PN3A 3WZ2A 3F90A 4EELA 1AY6H 4MI9A 3PX7A 1HZEA 4HQ6A 2J9NA 1F51E 3ITDA 3TIFA 1ID5H 4J1QA 1A7SA 4OJYA 3BWXA 5EHNA 2QZ9A 3CEJA 3OY2A 3HWRA 4B5KA 4ISCA 4KQCA 3U4QB 4JI0B 2K6GA 3VDRA 2E9SA 1I3NA 1GMHF 2HKIA 3CEMA 5G2OA 1W36C 1H9IE 2IDJA 6PFKA 4EVRA 5T4EA 1TJ4A 2D2DA 2ZTLA 1DIRA 2GF2A 4OKIA 3UJNA 1K89A 1XK7A 1QCCA 1U99A 1SD5A 1LX7A 2PK3A 4IQFA 4DNPA 3LJJA 4X6XA 3ELYA 1Y5BT 5EA2A 4EHHA 4D8WA 3VZBA 4TSRA 2A4OA 4YCCA 2ZPUA 1HMPA 1ZXXA 2W90A 3P95A 3CTMA 4G6ZA 5BSTA 2BR5A 1K6JA 4QYWA 1FV9A 2FEMA 1LRJA 1S9DA 1SKBA 1U5BB 3QBJA 3BGDA 2XITA 5T64A 4FUGA 3BFXA 3AUUA 1DWPA 4V39A 3UT0A 2CLOB 2UYHA 2FW7A 4K6OA 2PR2A 3ORQA 5FBRB 3H94A 1UXOA 1K8QA 2BMVA 3K0FB 2ZT6A 3LDAA 2OD3B 3L82B 3LCCA 3V1TC 3ZCUA 3UV6A 1T3HA 3FF1A 4B0PA 2CHEA 3TZHA 1XHFA 4LYYA 1NJGA 4Q2KA 5MDHA 4JQSA 1EH5A 1Z5UA 4KUGA 4PQGA 4G4GA 1MKWK 1NO9H 1JU9A 2M6SA 2R1VB 3RXPA 1R4ZA 5D1NA 1QBGA 5CBKA 3VNBA 3V8VA 4LDZA 1YL7A 2ZRJA 3V7FA 3QEMA 3T5FH 3QU2A 2OBXA 4OHOA 2BFMA 3QTBA 3T3PB 5L8VA 3TNFA 1E2LA 4XWGA 1S8AA 1U2DC 4K05A 2ZDNA 3FFBA 1DC3A 1DAPA 1DOZA 3FN4A 4TWBA 3T1NA 4BTUB 1TJYA 4WV3A 1LVYA 2ZRKA 3QVTA 4U7DA 2EKBA 3EPPA 4WI1A 3KZXA 3ZUPA 2OSBA 1A3BH 3LLSA 1MXFA 4Y0ZE 2VP4A 2WAMA 2OBMA 2G77B 4F97A 5JROA 3ZJTA 5SV2A 1NI3A 4MR9B 2JAUA 1DAKA 2P8OC 2MIIA 2OBRA 1YS9A 2AI2A 4JYMA 1BH6A 5DK1A 4IUYA 5CGZA 2WT9A 2XUJA 1MPXA 5FWAA 3FPJA 4FU9A 1MAYA 4V0LA 2R2GA 4ATNA 3HPRA 2R87A 3SU2A 5ALYA 4NFHA 3AJ9A 4ND2A 1SLUB 2PQ0A 3JWPA 4RD4A 1B8PA 5JCPA 3DL0A 3KPUA 1BDBA 3GGDA 5DU2A 4I4LA 5KYYB 1LHEH 1WMDA 2P11A 2PL5A 2A31A 5K2OA 3RVDA 4ISLA 3R5SA 3G2OA 2O8CA 4JWTA 5E0HA 4JSYA 4D99A 3ETDA 5JFGA 5GCHF 2PP6A 2WOJA 1GT91 2HNBA 2RK4A 2OILA 4OV6B 1TKRA 4IJQA 3FOBA 3N2YA 1F17A 3OX4A 3CT6A 3EQ7A 4MJLA 3D81A 2I67A 1T5BA 3BFKA 4DQLA 5ECYA 4CHAB 3G8YA 3TZ6A 3EXIA 3NB0A 2ZP0H 3ON5A 2G55A 1KZ6A 2PKAB 3HZOA 1NVKA 1K9VF 1DC7A 2JVKA 3B78A 1V71A 1CVLA 3I1FA 2VDPB 3EYAA 2A0XA 1UOOA 2HAEA 5KNCA 2CUZA 1KAEA 3PZBA 3EAJA 1P11E 3PQ4A 3ZLUA 3KDPA 2XMGA 2M5SA 4WZBB 3FUTA 4D4MA 1NKSA 4XM0A 3WHKA 4CM8A 2ZTNA 3EGXA 3OBBA 2ZF0H 5BMVB 3RXVA 4NMHA 3AUKA 1Z6QA 3URMA 1P7CA 1L8LA 3RRNA 2F3PA 2I6SA 3OY5U 4UCWA 4I8JA 1FU4A 3K9XB 3WZLA 4Z4IA 3TZLA 1VHWA 3TSOA 1V6CA 4P3PA 4Y71A 3FYHA 1KVQA 3UK6A 2H1VA 1ESEA 4U2FA 4M1QA 4HZUA 4BNLA 2A78A 2ZUSA 2NOAA 3WMEA 3F98A 4EI2A 1KSNA 4OHZA 3EBOA 3MMNA 3GJ4A 5HEKA 1T10A 3CZMA 4BNNA 3BIJA 3R44A 1ND5A 2JJ2D 5ALTA 3FB1A 3U17A 2C4UA 4JXZA 4RSMA 1E3JA 1XHLA 3RJ5A 2RGNC 2I91A 3OMWA 1YVPA 2X9NA 3NP7A 2PUJA 5EJ2A 5I9TA 7ADHA 4M6WB 1DT5A 1YJBA 2PRZA 1GPBA 2XXAA 4YT7H 4J03A 3N8GA 2P9ZA 4RV4A 2VP3A 5AICA 3T5AA 1WUJS 3K9BA 4OATA 2JD1A 3CXUA 2REQB 2EC9H 3KQEA 1WHSB 4NMMA 2Z4SA 1FSZA 5EXDA 1A4RA 1EWKA 1QHFA 5ALNA 4BB0A 4ZJZA 1CA8B 3VDNB 1RRFA 1CUAA 2FU5C 2J5KA 5FFFA 5KYXB 1F5LA 2ZGXH 5A3SA 3OJEA 3RUFA 1CUZA 2PA0A 2QTAA 4BLVA 2VXCA 2QUKA 4LXIA 3TQFA 1A1SA 3V4FA 1B76A 4B46A 3DPUA 5IK2D 2VBGA 1BT7A 4YIKA 4J0JA 1S81A 1NURA 5CLIA 2G9QA 3FYSA 4CF3A 4WL0A 3SU6A 2O8BA 3SUDA 1D5CA 3PQ7A 3ZZDA 4IXDA 4IXTA 2ODQA 2GWHA 1FLNA 2D13A 3U39A 4O4IA 1GBIA 2WZCA 2XC0A 4M88A 2PIAA 4A6PA 1W9MA 1GKYA 4BDTA 4ANFA 1TC2A 4IWNA 1L1FA 4DL9A 1JILA 4R1PA 2G9ZA 2Z9LA 1FL9A 3CH6A 3H1GA 4J4TA 1UD2A 1UINA 1UR5A 4RULA 3LIWA 4XORA 3LZCA 3RVJA 2VSOA 3RPEA 1HE1C 3RVBA 2BW0A 2ZGJA 3HUEA 4I4CA 1ZR0A 2YY7A 3Q1KA 4IPTA 1W2HA 4HJRA 4LKOA 2RHHA 2ZL6A 1WUTA 1YKGA 2XUQA 3KGPA 3RNLA 3MBKA 1U7UA 3AL0C 2YV1A 3OF3A 3QKSB 5GP1A 1RACA 4AY6A 5KNBH 4WY2A 2IEZA 1EUCA 1S84A 1Z6YA 1CHDA 4TRJA 1C9EA 3MFQA 3IEUA 4HADA 3VMFA 1WEHA 2W6ID 3OZCA 4TXNA 2F59A 3OPNA 5D5QA 5A9SA 4F55A 5LYJA 4H42U 4JC0A 1JG6A 2W0MA 3I4CA 2ZDQA 1DIBA 3T28A 3HB7A 3LVBA 5KW9A 5HTKA 1SCUA 1ZK3A 2BD0A 1RM0A 2I3AA 3D4BA 3FKSD 1ODFA 3FIUA 3H9CA 3P9RA 2FYQA 2AL7A 4YWHA 3RQIA 1Q15A 2V6IA 2BHSA 2C7VA 1NQUA 4O4HB 4DJFC 2QNBA 2MHCA 3CQ9A 1AUPA 1TDJA 3CISA 1HE5A 3SG0A 4K0KB 4D9HA 3KNXA 5EP4A 1SBWA 3U7IA 3B1JA 4CRWB 3LS2A 3K1TA 3IQEA 1JA1A 3PDIB 5FPTA 2FFJA 1FFEA 4WWYA 3KV3O 1S3IA 3GMSA 2LDXA 1P80A 2XVXA 2JLAA 1M2VA 5FBKA 4UUBA 1LPGB 4Q7XA 3EXEA 3ATKA 1TO6A 3D3QA 5J2TA 3BMCB 4QX6A 1PPCE 4GMFA 4E0BA 1M8KA 1U2TA 5IAEA 4DAOA 1K66A 4X20A 3LX8A 4MTCA 4AZ2B 4GKJB 5JRJA 3TW8A 4K9KA 2VDOB 4LQ4A 3PQDA 2HO5A 4JL6A 5DRYA 3DOEA 3B9QA 3ESAA 1C2FA 4Z4QA 2ZUTA 2APJA 4ERNA 2C8KA 2EDCA 4B3XA 4WNCA 4NZNA 2XW6A 2PWXA 4C0QC 3AY0A 4KGDA 2OBBA 5TRTA 2OC7A 1XEWY 4I1RA 5BP7A 1QGFA 4ABAA 3W8DA 3KEWA 1RCUA 4LDNA 4O1HA 2OY0A 1EVIA 1T2NA 3KBBA 3SHTA 2CD7A 4RFSB 1MZVA 4EATA 4C4XA 5HGXA 1K0FA 1IXSB 4JBLA 4DMFA 4P7JA 3QXJA 2UVPB 1TA9A 1VKNA 2EFJA 3A8KA 5JAOA 4DW8A 1J15A 2PH7A 5HFNA 4HHEA 2TMKA 4PGHA 2CUKA 4EJSC 1OSNA 4KXYA 3LU9B 1P0CA 1C7JA 4FILA 2PQ6A 4FU0A 5BSYA 3FZEA 3AB8A 2QRQA 5E8EH 3KRTA 1P61B 3IT1A 3VNQA 3ZXSA 1MB0A 5DNAA 3ZKWB 3JQAA 4LNUB 2J7PD 1SIWA 2NVBA 2HHHB 1JF8A 4C0KA 3N6XA 2F90A 4H35A 4EHKA 3DCNA 1VHDA 3I0ZA 4RPHA 1C1QA 2ZSIA 2PWYA 1IUOA 4IGEA 1IJEA 4OQZA 4F56A 1QYXA 2PGLA 5IP5A 5KSWB 1YI8A 2H65A 2OAQ1 4BRZA 5FWDA 1AVWA 4FBMA 3SYTA 3OD5A 3S40A 1ZJDA 4RXTA 5ESBA 4E05H 1FNNA 1B23P 3WDMA 4D8NA 5A8ZA 2R2MB 4KPUA 1PK8A 1WVGA 4FKMA 1IPHA 2JH3A 1T5HX 5EIBC 3GJXC 5AKIA 2Z9DA 3WGYA 2J6BA 1IK6A 1TPAE 3UJDA 4PLGA 4D9FA 4QEDA 4FDAA 1MCTA 3D4IA 1YUMA 4REQA 1M7HA 2FMKA 1J14A 1QV6A 4DUGD 3BL8A 3W8RA 3OESA 3RW9A 4ZT2A 3OAAD 1OTXA 2A94A 4C0LA 3UBMA 4OFBA 2G83A 4E4TA 3ENVA 1YBMA 3OIVA 1SGFA 4N6GA 1QVWA 3LQ2A 5AVXA 2O6LA 5BVGA 1GZ5A 4Y7AA 3MYRA 3F7OA 4B71A 1MTNC 3M1LA 1ZJ5A 4CLOB 5C4MA 5B3AA 1YJ9B 4IIHA 4JT9A 2WU3A 2ZECA 1G98A 1XELA 1Z5ZA 3HU1A 3CEPB 4DWOA 4N4AA 1AA6A 1O5AB 2OUAA 2C4KA 4R71A 3ZK8A 1E43A 3QFTA 3PWKA 3IBTA 3TOXA 3T1TA 1UKAA 5LP6B 3VJMA 2PZEA 3EQ6A 4XQGA 1C4OA 4WOKA 5KYNA 2SNVA 4TMYA 4QTUB 5B6OA 3T1HB 4Y2QA 3SF8A 3QUTA 2WQ6A 3R7BA 2W9XA 3CP8A 2GCEA 1Q1ZA 4B34A 4LSMA 1KH3A 1IBLB 3MELA 4BNUA 1IUPA 5FHRA 3IDOA 5CHEA 1UT8A 2IGBA 2PN1A 4DLBA 1MFPA 1Y1SA 2H1IA 3RASA 5T4HA 3WKEA 5ALQA 1BFKA 2C5AA 5D3ZA 4IW3B 1BH2A 1PR9A 1TB4A 3WK8A 4HYTA 2BD4A 1ZVQA 1WA5A 4CQMB 2CY0A 2JKZA 3NHKA 3SQEE 1FJSA 4NZYA 5ITSA 2XMCA 3W6OA 1DCFA 2BF7A 2EHDA 2E0IA 4G8JA 2CRVA 1AN9A 4RQTA 3SBOA 4D79A 4HTCH 3ZZ9A 1P6QA 3WYAA 5KREA 3QE2A 3UZUA 4LIPD 1P8VC 3EVEA 1ENPA 3OZDA 3PLKA 1TUBA 5K3CA 1ZMJA 3DZ8A 3SFTA 3NAQA 1QHSA 4XFKA 4C6TA 4N41A 4XJTA 4EWLA 4N9WA 4XPZA 5A8AA 2A5GA 2EBHX 3JD0A 2DKFA 3RXCA 4P6YA 2AR9A 4B81A 5EJGA 5DTMA 5FJIA 3W6UA 4L4ZA 1U2QA 1VHLA 3VUEA 5KDDA 3HBJA 3ZYDA 3WLTA 5TQ0A 4ENTA 5C2JB 4NJMB 2OV2A 2B82A 5EE5B 1JPVA 3P2EA 1VJ1A 1C9KA 3UEOA 4GI2A 3V80A 2X8WA 3D6AA 3LQEA 5CDHA 4NBVA 1HB0B 2IKSA 2ZJFA 3ORFA 1WTHD 3SI7A 3UJ6A 3GJSA 3PROA 1FAKH 1E1MA 1KJJA 1PZXA 2D00A 1I30A 3LSTA 4GHQA 1Z8DA 5FTMA 3ZU5A 1Y9EA 1EUYA 1AQUA 1UF9A 4ZHQB 3TCXB 2AD5A 4K2AA 4CR7A 4HFRA 4I4IA 1MTSA 2NU9A 3EEFA 3O9VA 4CV3A 4YRGA 3JQ8A 1U9IC 2XE8A 5AHXA 4IKOA 1RAEA 3GNLA 4OUDB 1H2XA 1QVGB 3JQFA 1F7UA 1ORHA 5ITWA 3TPZA 2ISQA 2VYFA 3FUUA 5J2UA 4ZVNA 3ICWA 4J0KA 4KTVE 2P41A 2IPQX 2ZQ2A 1J22A 1NVVR 2G71A 1GUBA 1SUBA 5AUPB 2Q8NA 4JLMA 5T4BA 4FHZA 1DY9A 4KG7A 3U13A 1C7FA 1V9CA 3KM0A 2WIJA 1FFGA 3JD4A 4ZQGA 2GO1A 4CG3A 2IPNA 5C34B 2ENUA 2ABWA 2UV8A 1ESDA 4X05A 1V7ZA 3UYKA 4GBGA 3FWZA 4Q3OA 2HHLA 2EVWX 3TIIA 2CJYA 5ENZA 1GLGA 4KHZA 2HWYA 2Q5EA 2O5CA 4HDOB 3NMUF 1QRXA 1TT7A 3C0KA 1RYYA 3C98A 2RH5A 3IA7A 3KQLA 4U7HA 2WWTA 2C9ZA 4LSZA 2W42A 1BRCE 4FJ0A 5JBBS 1WXWA 4NX2A 1XMOB 3KG2A 1CBUA 3L8GA 3AIKA 3MJCA 4ESTE 3DVLA 3NNDA 4XX0B 2YZMA 1EXWA 2P78A 4ARCA 5F98A 1UJ5A 4NSVA 2XCSB 3WGJA 3A4VA 1WETA 3CUKA 3WB1A 4A0HA 3ZY2A 2W71A 2FMFA 1I3KA 1WHTA 1DLKB 4CLRA 2Z9IA 3OWHA 1PDWA 3C1UA 4LDJA 3HWX1 3K53A 5JAHA 3AETB 5DPAA 3RIGA 3OZBA 4PYNA 3D43A 1X1SA 1PE0A 2UDPA 3C4VA 1UOPA 1E59A 1KOLA 1U0OC 1N2SA 3FLEA 3D6HA 3A1UA 6GCHG 2I3ZA 2HA0A 2Q6FA 3I2JA 4ZOAA 4MRSA 4LZOA 1IIBA 3OU6A 4KIWA 2DBQA 2IQIA 3N76A 4TZTA 2DU8A 5AN9A 4D6XA 3I2FA 4LJ5A 3BV9B 4ZQIA 4QQ8A 3QGNB 3UJ3X 5DIFA 2GM3A 4Y6PA 5FI5A 1X7WA 3GELA 2J0VA 3LC1O 5A3VA 2L19A 1X14A 3BMQB 1Y33E 1TC1A 5T7BA 1GBCA 4DUZB 4M0LA 4XCQA 4C9BA 2Z83A 4C87A 1ZR2A 4HG2A 4MIYA 2VT3A 4JYUH 3OEWA 2D1YA 4FD2A 1UC4B 4EF6A 3RU4D 1JHOA 3V0XA 3NEPX 4C4ZA 4WHMA 1KJIA 3RJTA 4UM7A 3OUZA 4WOJA 1KSFX 3IYLW 5KWVA 1KBOA 3OCJA 3O31A 3OUTA 2OPHA 3DZFA 4L0MA 4R51A 1YX2A 2J9YB 2E4UA 1P33A 3S70A 1FLEE 1P74A 3P0IA 2NM0A 1NQXA 2O0LA 4C2AA 3VR5H 3EBPA 2SGQE 4PZDA 1OLXA 1C9TA 1BVYF 2A5FA 3QTOH 3FNEA 3NR2A 4D9JA 1OAKA 1F2UA 3ZE6A 5ESTE 4W5WA 3U3XA 1X7HA 3D3KA 1ZI8A 3DLBA 4YDHB 4F4OC 1HAYB 2BDIA 3DZIA 4NONA 2CSUA 4M9CA 3GIWA 4B3BA 3TZQA 4Z6KA 5HJEA 3EIOA 2IHYA 3LVRE 1FFBA 4GQBA 2FZCA 3RBXA 3ERCA 4NOMA 3I4LA 2EFDB 4BU1A 1BTOA 1WSRA 4AG1A 3GJZA 1XV5A 1Z4PX 1J9CH 4UBNA 3DW3X 1PL0A 1V6SA 4PSCA 2DT5A 3ROPA 4UU0A 4NAVA 1E38B 3MMSA 3EMKA 1SHHB 2JS7A 4GP9A 4ZYVA 1KDTA 1CEQA 4L8FA 4NULA 4KIUA 1F9AA 1L0ZA 3PV2A 1MB9A 4FFRA 1R8JA 1TLDA 1WDKA 4G23A 1KZGB 4FOUC 1H1LA 4YO9A 3RLYH 2C61A 4YQYA 4IVQA 3GVLA 3QKUA 3OQHA 3K6SB 3CCFA 3IUSA 5G4KA 1AO3A 3UA3A 3WK6A 1W11U 2OGSA 1GADO 3AH8A 2NUTB 5E8JA 4JEHA 4ESOA 2ZGVA 2QIQA 3IQGX 3RV4A 2NSDA 5JAMA 1TM1E 2VRCD 1PBTA 4INHA 2V74B 1C30A 1GUAA 4X45A 2Y6TA 3RS7A 1WSAA 1F2DA 3M34A 2OBQA 3ND7A 1XP5A 5G1OA 3B70A 5DPMA 1AUXA 3GJ3A 4DY4A 1YR1A 2RGUA 4MW0A