3W2FA

Crystal structure of oxidation intermediate (10 min) of nadh-cytochrome b5 reductase from pig liver
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
271
structure length
271
Chain Sequence
TPAITLENPDIKYPLRLIDKEVVNHDTRRFRFALPSPEHILGLPVGQHIYLSARIDGNLVIRPYTPVSSDDDKGFVDLVIKVYFKDTHPKFPAGGKMSQYLESMKIGDTIEFRGPNGLLVYQGKGKFAIRPDKKSSPVIKTVKSVGMIAGGTGITPMLQVIRAIMKDPDDHTVCHLLFANQTEKDILLRPELEELRNEHSARFKLWYTVDRAPEAWDYSQGFVNEEMIRDHLPPPEEEPLVLMCGPPPMIQYACLPNLERVGHPKERCFAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords NADH-cytochrome b5 reductase 3
publication title Elucidations of the catalytic cycle of NADH-cytochrome b5 reductase by X-ray crystallography: new insights into regulation of efficient electron transfer
pubmed doi rcsb
source organism Sus scrofa
total genus 76
structure length 271
sequence length 271
ec nomenclature ec 1.6.2.2: Cytochrome-b5 reductase.
pdb deposition date 2012-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
A PF00970 FAD_binding_6 Oxidoreductase FAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 3w2fA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 3w2fA02
4H9GA 2BGJA 1QG0A 1TVCA 4YAOA 1Q7YD 3I55B 4ACAA 3B8HA 4G1BA 3W5UA 3ZBUA 4PC2A 3ZZUA 1ZUNB 3CCQB 4TN1A 3LVBA 1W35A 2VZLA 1BX0A 3AVWA 2RC5A 1EFTA 4ZGNB 2CRVA 4Q7JB 2BPOA 3P26A 1VQLB 4YAUA 3CD6B 4QHYA 2HDNB 3B82A 1K9MD 1OB5A 1G7RA 1DDGA 1VQ9B 2PMDA 2GPJA 4HE5A 4AC9A 2C78A 2QEXB 4ZV4A 1E64A 4PC7A 2QTZA 1QVFB 1QGAA 2NPFA 1FDRA 1M1KD 1ELOA 3CB4A 2J7KA 3LRXA 3E1YE 3W5HA 1QGZA 4RD6A 1F20A 4J0QA 1SKQA 3CCVB 2XNJA 4PC1A 4RD1A 3CRZA 1YIJB 1XB2A 3ES9A 1Q82D 4ZGQB 1E62A 3I56B 2XEXA 1KJZA 3FJOA 1CNFA 4M1KA 3VO2A 1QFZA 5GV7A 2BN4A 4YHBA 4B3XA 1VQOB 3CC2B 1F60A 2DERA 3WY9A 3WXMA 3W2EA 5GV8A 2E1RA 1R5BA 5TY0A 3SJZA 1GAWA 2FX3A 4YAWA 4FN5A 2BV3A 1K73D 3JQRA 4Y9RA 3AVXA 3CCSB 1SM4A 4NCNA 1YJWB 3CPWB 4DQKA 1IB0A 1WDTA 4M4SA 4ZCLA 2HMAA 2EIXA 3CCLB 1U2RA 3WBJA 3WBKA 1KTVA 5H59A 3E20A 1A8PA 1G7TA 3G71B 1JA0A 3ZZ0A 1XE1A 1FNDA 4LBVA 1YITB 3CCUB 1OB2A 1QGYA 1VQ5B 2QDXA 1KC8D 1H85A 3QFRA 3W2FA 1EP2B 2VNJA 1H42A 2VYQA 1VQNB 3AGQA 3AVVA 1JB9A 1YI2B 2VNIA 4RD0A 3V76A 3CCMB 1B23P 1ZM2A 3MHPA 2B7CA 4N3NA 1VQKB 2VNKA 4AF6A 1EXMA 1DG1G 1TUIA 4Y7CA 4RJLA 3QFTA 1N0UA 1DARA 4G5GA 4B4DA 4MYTA 1KK2A 3W2IA 3JQQA 1KK0A 5DSZA 1IJEA 3WNBA 3ZC3A 1BJKA 2ZITA 1KK3A 1FRQA 2VNHA 1CQXA 2QTLA 2OTLB 2QA4B 2OK7A 3LO8A 4FWTA 3JQPA 5TV2A 1QUFA 4QFMA 1N8RD 1QFJA 1R5NA 4HE6A 4B44A 1I7PA 1G7SA 3CCRB 3U6BA 2YWGA 4TMXA 3OJWA 1FRNA 1VQ8B 3AVYA 1W34A 2X3UA 3A1FA 4BPRA 1S72B 1KD1D 3AVUA 4YALA 3CW2A 2BM0A 2PLFA 3CMEB 1TLLA 3CXCB 2AHOA 1KQSB 4M0LA 3CCEB 3P27A 1ZM3A 2BM1A 1FNMA 1EWYA 4ACBA 4R71A 4K1XA 2QN6A 3MMPA 1R5OA 2BF4A 1KK1A 1M90D 1NJID 3CC4B 3CCJB 1S0UA 2YWEA 4RD2A 1KRHA 1K8AD 1UMKA 4N3GA 1YHQB 3QSYA 2BSAA 2YWFA 3VMFA 1JA1A 3ZBTA 3B78A 4EH1A 1QUEA 3AVTA 1D1NA 3J81k 2BMWA 5H5JA 1Q86D 3PENA 2QMUA 3W5VA 2DCUA 3G6EB 5HXBA 4ZCIA 3CC7B 4TMVA 5FA6A 3OJXA 1ZM9A 2HCJB 1E63A 1QFYA 1GAQA 1AIPA 4TMTA 3VNVA 3MCAA 4FK8A 3AGPA 4DQLA 2OTJB 4PGOA 1CNEA 4C0SA 4RD3A 3OZWA 4M53A 1DDIA 4M2LA 2YWHA 4P6VF 3WNCA 4PC6A 4B48A 2C77A 4IW3B 2CNDA 4P3YA 3OZVA 2BVNA 1ZM4A 4UAJA 1JJ2B 4TMZA 3LYUA 4NBSA 1VQPB 1GVHA 4RCZA 5THXA 1B2RA 2B5OA 3QFSA 4MYUA 2PIAA 3WNDA 1N0VC 4ZCMA 1W2BB 1YJNB 4B43A 5KSWB 1VQ6B 2DETA 1FNBA 5EMNA 1GR1A 3QE2A 4F7DA 2XNCA 2B7BA 3VNUA 1GJRA 5TR9A 1IJFA 3WYAA 2RC6A 1VQ7B 4U9UA 1VQ4B 1EP3B 4Y9UA 4LBWA 2EFGA 3VO1A 2BGIA 3W2GA 4B47A 4TMWA 1EP1B 4LC0A 1QH0A 4RCYA 3W2HA 1JNYA 4AF7A 1J9ZA 3I1FA 3QFCA 3OZUA 2DEUA 1Q81D 3FPKA 1D2EA 4RD4A 3OW2B 1QX4A 1YJ9B 3G4SB 2D74A 5JBQA 1BQEA 2OK8A 5AN9A 1EFUA 1OGJA 2R6HA 4WQMA 1EFCA 1D8TA 1TTTA 1GO2A 1QVGB 1FNCA 2GQFA 3ZZTA 3CMAB 4LBZA 4C43A 3U2QA 1VQMB 2DY1A 4PC3A 1W87A 1AMOA 4G1VA 1HA3A 1G7CA 1OGIA 4LBYA 4YAFA 3U6KA 1NDHA 1BX1A
chains in the Genus database with same CATH superfamily
2I87A 13PKA 4RWEA 1YK1A 4FINA 5IVPA 3WWPA 3V7NA 3U3KA 4WL0A 1N5KA 4EGQA 3BMNA 4U2EA 3LRPA 5ARDA 3JD1A 2UVPB 4BCDA 3SKYA 3EGXA 3W5UA 1JSXA 2QUIA 4B6SA 1QHXA 3OE4A 1GGJA 2X76A 2XKKA 3TEJA 1F1JA 2WMNB 3RYFB 4COOA 1BVHA 2R751 4Q1VA 4TQAA 4U63A 1NRWA 3UQZA 4UXIA 3L0DA 4ZK2A 4QXMA 5JC1A 1P6UA 1S2DA 4LXQA 1RWQA 1ZD2P 2HB6A 1YI1A 2R8YA 4DLUA 2LP4Y 3GJRA 4QL3A 4JSRA 2HUPA 2ZXEA 5MN4A 1NKTA 4RPJA 1U7ZA 4AJIA 1DS6A 5C80A 1P2BA 2HJHA 1CEQA 4XRRA 3GDFA 2NO4A 1W1IA 1ZI6A 4NH4A 5IEBA 5AW2A 5A0VA 4GP6A 1XSEA 3TXAA 2HK7A 2C4HA 1UDRA 1O97C 1V5VA 2VQSA 4P4UA 5IYZA 3GFFA 1UBTS 4MQ5A 2P5YA 4C4XA 1HY3A 1H8ED 4BV2A 5T3UA 2FEKA 2R87A 4LJSA 1KMQA 3LM8A 4TKUB 1Q77A 2XGGA 5DS0A 3ZDRA 5B5SA 4WGGA 1CJMA 1T9HA 1E0SA 4UVHA 3ZHSA 3FI0A 4WASA 3STHA 1B6RA 2VDKB 5CJ2A 4DSNA 3FJYA 4FB5A 4HNQA 4ALKA 1JH9A 3V8PA 3QTBA 4AFNA 4ON9A 1XAGA 3ZHOA 3ERCA 3DBHA 1QHHB 2XCOA 1EQUA 1Y1PA 3QKRA 1NXVA 4BBZA 1F6WA 1EBFA 4PSUA 1FYWA 3ASQA 3ZDCA 3IGFA 2H11A 1ZK1A 3H5VA 3LC1O 3R7BA 2PUJA 3JYNA 4O5AA 6Q21A 2NTYC 4GMHA 1KI2A 4EBFA 4GPD1 4UHBA 1E3JA 2RHBA 3EXFB 3GT3A 3GHHA 4IIEA 3Q8WA 5F2EA 3VPCA 4CQJA 2A30A 5FWYB 4WZ6A 3RVSA 4Z1MA 4PC1A 2XMQA 4KO4S 5CJPA 4EJ2A 3UMFA 2EBFX 1YIJB 3SNHA 1X7ZB 3EXEA 1HE2A 4KV9A 4NECA 4WX2B 1TI7A 1Y8RB 2QTBA 2LIPA 4XCQA 5JY1A 2PD4A 4RLHA 3DNMA 1BHJA 4L6CA 2B20A 3GRAA 1M2WA 2AG8A 1BCRA 1VECA 1TPYA 2OMKA 1LQUA 4XUGB 4ESOA 4Q5IA 1DAPA 5LWHA 1YRWA 3HNPA 1JEOA 4M9QA 2DCMA 1MENA 4U3JA 3T1HB 5DX1A 3DHYA 4Z2YA 2AFVA 2HH9A 1N06A 4KIUA 4NJMB 1F60A 2WSSD 5ALXA 5FI5A 3W1VA 1UFVA 4KGVA 1PW5A 3ZXYA 2EKDA 4H1TA 2BEWB 3DT9A 1ZMRA 3EGVA 2CNLA 4KC0A 5HG0A 3WGTA 2QMQA 2DHCA 5EHXA 5HTKA 2W9XA 4MV3A 3C97A 5TY0A 3ZDDA 5CFZA 5TRDA 1JQLB 1NU8A 1XTVA 2BEKA 5E6RA 3LVFO 3D3KA 2O2JA 1W36D 1T24A 3UB2A 2LXNA 2WD7A 4E13A 4AMYA 2QRNA 1V9LA 5AP9A 4L9SA 3L7IA 1G60A 4EF5A 5LMNB 2GCOB 1EAYA 1VJRA 1XZKA 3KKPA 4HGZA 2JRCA 1R6BX 3AVXA 3RKUA 2O7SA 2XZLA 1PWZA 3CUVA 1XPUA 1PI3A 1U4NA 1YL6A 2VC2B 5BVHA 1F0NA 2G83A 3PLRA 2GNOA 1LLUA 4ARZB 5A4IS 5JMWA 3PE4A 4WY2A 1ULSA 1QB7A 1B76A 2QY6A 1E3QA 1ADBA 1SK9A 1Q16A 1GL6A 2NZVG 3C16C 2AC7A 3KPUA 1I6WA 5I4CA 2EIXA 5D85A 4C7XA 3NW9A 2AR0A 1VE3A 2FP4B 3URMA 3VC3A 1GCOA 3WBJA 1GLVA 3DNFA 3DDWA 4H7KA 5H59A 2NO6A 3FBGA 3GEPA 1JA0A 2C4MA 4YRRA 2ZSBA 4PSDA 4EW1A 4DV3B 1NUUA 1P0PA 3DD5A 5IZCA 3IOBA 3LCCA 1RM0A 4JA0A 4ZAZA 2AV6A 5TE9A 3WGIA 1R74A 1KI6A 3FTFA 1K8YB 3ZJ5A 1P2FA 2IELA 1GL7A 1MEEA 1NQOA 3OVMA 3TRFA 3SIXA 1CHNA 5F2KA 4W82A 2ONCA 2DP4E 3ADOA 3OOHA 4IY1A 3B1FA 1Z2PX 3WOVA 3KSBC 2L17A 4KQKA 2IKQA 3Q40A 1WE2A 2GM9A 4H3KB 3R0XA 4IICA 3X1MA 1FSSA 4CF7A 1OWOA 3UCXA 5HOEA 1MOSA 4P84A 5KNCD 3JYLA 1WY5A 2NTNA 1Y6JA 3DZGA 1BD3A 1GPBA 1WUKS 4G09A 2FWAA 1EDZA 1F2DA 1ZA2A 2JA2A 2BH9A 3BHMA 4AWXA 4RTJA 1E7WA 3OICA 1XFOA 3DEFA 3PQ4A 1ZGHA 3EPHA 4H0FA 2E4AA 5FPYA 1E1CB 2TMKA 3EA5A 2BHSA 4ENQA 3U16A 4HDRB 3LF1A 3QTTA 1G8YA 4HZGA 5K8IA 2E48A 4XD7A 3I5XA 1EXMA 1TK3A 3I4LA 2WZDA 4H7FA 3DOJA 1K06A 3IDSA 4K05A 2WTEA 4KXWA 5IZCC 4GVXA 4ZI7B 5BPHA 3FPJA 4NNJA 2P5TB 3LP5A 2A3NA 4CQMD 2O8FA 4MYTA 2FOXA 3K5WA 4AKEA 3L4SO 3O8QA 4HAYA 2HSDA 3QYAA 3TM5A 1WNFA 3CWQA 4L08A 4H4DA 4LRUA 1UD3A 2WA1A 4L75A 4YRFA 4KQFA 4KH0A 2DVMA 4MKZA 2CLEB 4D4JA 1DFIA 1IXYA 2NUAA 4LZZA 4YCBA 3FNGA 2ZSFA 4X7CA 1KMCA 2X40A 2ZITA 4WNCA 4IDCA 1U6KA 2IWHA 3W8EA 5TQ0A 3AQIA 1SVWA 4H7IA 4URYR 2JGEA 1UPTA 3IHTA 2X8WA 4NKRA 2VNHA 3Q6QA 1G6Q1 3ZDBA 4CMGA 3SKBA 4D02A 2QA4B 2A58A 2FDCA 2D7CA 4M6WB 3AR2A 2QI9C 3GNTA 1NF8A 4G5XA 3DMFA 3IEPA 4B73A 1W2HA 2AFIB 4LS3A 4TL7A 2VUTA 4BLUA 1BWPA 5TSDA 1KZYC 5IJZA 3I53A 5KWEA 4MQLA 1HLDA 2IH5A 2PUVA 2G77B 4XKWA 3KV1A 1R5NA 1K5DA 4Y2PA 1AMNA 5I7SA 2B1IA 2X53S 1COWD 1XTSA 2RHMA 2J6CA 1JPVA 4MMYB 4QAQA 4DIUA 5JCPA 5J2TF 1QRTA 3CUWA 1LSJA 5TMDA 4BNDA 4EY5A 1SIWA 2XT0A 4HC4A 5C5DA 2OUIA 3I0NA 4OAPA 3P32A 3IOYA 4FFWA 5DW0A 2R8RA 5EQFA 6ABPA 1ZAKA 4RY9A 1DUIA 1UDBA 2OO7A 1QHSA 4X0EA 3IT0A 4QFDA 3RBZA 4RPKA 5IF3A 2YUIA 2FPIA 1B0ZA 1NUAA 1RYHA 3WSVA 1FCJA 1UFRA 3FVRA 1IL0A 3GGGA 3IAS6 3SFZA 4PSCA 2WKQA 3IVAA 4Q3LA 2ZUFA 2I80A 2PZJA 4WRRA 5DEOA 1DCKA 1KQSB 1NDQA 2INGX 1U99A 1GQOA 3BILA 5HRAA 2IKSA 1G8JA 4MW4A 5FTWA 1N6HA 4PBRA 2CHUA 3T3EA 1FNMA 2DOGA 3OSUA 3VKGA 1D8AA 5IAEA 4GT1A 1QNFA 1O54A 3OJFA 3ILXA 3RRJA 3TG8A 3LY8A 3MMPA 2D0OB 1Y8ZA 3SXJA 4IIJF 2W2XA 2CHEA 1ATIA 1CZUA 3PFCA 3N2YA 1IOLA 2BCGY 3B9BA 4JVMA 1I80A 1W5BA 1SU7A 1KI1A 5GJWC 4FOOA 5I8PA 1IXSB 2AR9A 4NC9A 5EWMB 4AVYA 4UM5A 4EABA 3CVJA 4DADA 4XIIA 2OQIA 4FMCB 4KAAA 5I45A 1OPRA 1K8AD 2V0GA 2QGFA 1KJQA 4FCCA 4AYXA 4S35A 3ZCPA 4TTIA 1CFZA 3NXSA 3VVMA 1PFUA 3ANSA 4PLZA 2BSAA 2ZANA 2J3EA 3R7SA 1Q7CA 1A7JA 1XRSB 1XPJA 2PU5A 2VPWA 2VHEA 1L5SA 1L8QA 2NVOA 4MA0A 5DTEA 2VTEA 1IEWA 3TKLA 2ZYRA 3DV2A 4PGGA 3EEYA 3NZEA 2XGSA 4G0OA 2YCBA 4JBIA 2AI3A 3KLPX 2BRUA 2C2HA 4ZVKA 4KXUA 4YY3B 2YRWA 4EMSA 2Z08A 3GLQA 3AFGA 5A02A 2WWWA 1E98A 4EF6A 1S8AA 4MGIR 1Q86D 4URUR 2JFQA 2PVCA 2MSDB 3MD0A 5TT1A 5BN4A 3EXHB 4M1TA 3D26A 1I6MA 1ZAYA 5DCUA 2XYQA 5H9VA 2ZAMA 4JBXA 3QXXA 3WHLA 1SXJB 1THZA 2POCA 3MTIA 2J9YB 3W3AH 5BWOA 1Y33E 4JLWA 5J58A 5IH3A 3RARA 5EZ6B 4EATA 3PUNA 4F6RA 4JJ6A 2EQBA 3GVHA 3RTBA 3WFJA 1D4FA 1QP8A 2VBGA 4PZAA 5FA6A 4C7OA 2GFHA 2GF9A 3LBHA 3D6MA 1IRXA 1SK8A 1UJ6A 1IRIA 3NWOA 4XAQA 2FCAA 4YAJA 5DF1A 3G8YA 1A1SA 2NUPB 3Q2IA 2HGSA 1ZL2A 4ISBA 4QOJA 2QLLA 1SELA 1QG6A 4IUBS 3SDZA 5DM0A 2FZKA 5AVOA 4RM0A 5JZMA 4UMEA 2WYWA 2PNFA 521PA 2POQX 2X9QA 5KYXA 1TRHA 4E2YA 1CJBA 3LKDA 1T8SA 2UXDB 2QP4A 3GYBA 2YZGA 4TT3D 1XRQA 1FVXA 3TL3A 1O0CA 5MHTA 1I3KA 1XNJA 4ND1A 4DVGA 2GF0A 5TQVA 2EWVA 1XBTA 1E1QA 3KUDA 4OMFG 3UANA 1EUDA 4K9DA 4XOUA 1OLXA 3PKIA 3OZWA 3DCIA 3GLGA 2PS1A 1TAQA 1MA0A 2HQOA 3LPNA 2HCRA 4GOOD 1C8LA 3TLEA 2GERA 2QJOA 1HX7A 4FXUA 1J24A 4ZVPA 4DRXB 3ZCQA 5DJ5A 1CUCA 2HWYA 3N05A 2BD0A 3SR0A 5GY7A 1UWVA 2I8LA 5K3AA 3NEAA 2JEOA 2NV2B 2XQFA 3EEQA 3MW8A 2O0MA 3NUQA 1PR0A 4M36A 4PLYA 3UCEA 3WKAA 3WYCA 5K99A 4E31A 4EY6A 1OR8A 3TN7A 4OQNA 4BCCA 5HZHA 5IWCA 3CH5A 3U40A 3PLAE 3MWDA 2R25B 3FRHA 1PL8A 2B2NA 1CY8A 4GMGA 4A2WA 5LXTB 2L0XA 1U7PA 3K9QO 1ECLA 4TV8A 4WKPA 4X6XA 4MS3B 1L7QA 5EP3A 4B17A 1Y7HA 3KXDA 5THXA 2OB2A 2AJ8A 1E1YA 2P4SA 4G37A 3TQFA 4EYQA 1VCIA 2Q5FA 3ESZA 4GVPA 3COYA 2G9RA 3EWSA 3BUSA 4KRYA 2VEOA 2EW8A 2W2KB 3IQHX 3BWBA 1JF8A 3WA7A 4Y9SA 3T0GA 2PSDA 2B4RO 2HWWA 2VSXA 2ZJAA 5B4TA 1FFCA 2QQEA 4HLQB 1JPJA 1LS1A 1Z2OX 2FFRA 2VPPA 4QPCA 3WB1A 4F7DA 4OSOA 3T7IA 1TVMA 2YN4A 5C9ZA 3CF6R 4CMIB 3GVJA 2VN8A 4CI9A 1E2MA 1SVKA 3HU2A 5ITVA 2QVXX 2X23A 1A9XA 3OE7A 1BAPA 1WXXA 2CXUA 3C8DA 3RFVA 2IZ0A 2WNHA 2X7JA 3M5WA 4M8SA 5EVJA 4ZXFA 1C30B 3ESCA 3A4NA 3FPPA 2A5GA 3QFHA 4BFLA 1TQHA 3BMQB 2HA0A 1ZK2A 3QNMA 1US8B 4I9FA 3RYCA 5FQOA 3K94A 1LH0A 1TEVA 5JCJD 5F23A 4G0MA 2OVFA 3AHGA 4YJDA 4E09A 4LPKA 3K2EA 4RGBA 2QJWA 4GPIB 1PYOA 4JASB 1KSGA 3WKDA 1PIWA 1CY4A 2GCEA 2C5HA 3C1AA 4XWWA 3QFCA 3OZUA 4F9GA 3DQPA 2ZM6B 4RMIA 2XJ4A 2OG2A 2IW1A 3H9CA 4RZ3A 4BEBA 4DC1A 1NOJA 5FJIA 1FSPA 3C4QA 2FUKA 2A84A 2G63A 3ZS8A 4QFCA 2R1VA 3CH6A 4I4NA 3B3FA 4TXLA 1EEHA 1RYYA 5TQJA 2QDKA 4RYLA 5TGZA 2ILVA 4UQOA 3W7AA 1G6HA 2QX9A 4N0QA 3DZFA 1L7AA 3VYWA 1K8RA 1Q1EA 2I6TA 3T7RA 2MINB 2B1RA 1R0CA 3UF0A 5IVHA 4OXYA 2RBKA 4GZ6A 1NR1A 4US1R 2K5UA 2QTVA 1I10A 2QL5A 3LLVA 1K8XB 3ZLUA 4B83A 7GPBA 1N3BA 4R54A 2BISA 1NYRA 2CWDA 3D6UA 4WQMA 2FUG1 4YXWA 2O23A 1LBHA 5C8YA 2EQAA 3ZPNA 2HF9A 4Y2TA 4DXHA 1GITA 4XUEA 4H15A 5CCDA 1S2MA 3ZDFA 5MFPA 3ANNA 4MVWA 5GVSA 3DYVA 1WU8A 2HGZA 3TO5A 3MYYA 1CRPA 1U0EA 1G3UA 2GUGA 4DCPA 2JGAA 1QKIA 1TA9A 5DN6A 4K88A 4FZ3A 4M86A 2ZPAA 3Q6NA 2XTMA 3BXEA 4KGDA 4PC3A 1XVAA 4UASA 3EW9A 1UBKS 1QFXA 4N7MA 3I2HA 4JLAA 4LK2A 3HDTA 4CTKA 4HDNA 2WJVA 4OAQA 3AOEA 1QYWA 2VDQB 2NSLA 4FDVA 4JL5A 2AMJA 1SXQA 3RTAA 2D13A 1WV1A 2X4IA 1GPDG 1FU8A 4GPAA 2WT9A 2HU8A 2OBFA 4UHJA 1X2EA 5ETJA 3WLQA 3ZHQA 2V9CA 4DMHA 3OTIA 1MJHA 4YAOA 2WMOB 1Q7YD 4GYWA 1RAAA 5CGZA 2HQBA 2JJYA 3B70A 3QG1A 1E8NA 4LX8A 4RFSB 3MELA 5KTKA 2JDID 2O8DA 1GPWB 2XWSA 3JQBA 3FM9A 3KTAA 3KTFA 4YC7A 1Y82A 3RVRA 4CL8A 3O1HB 4J07A 4ZDKA 5CB0A 2AJTA 3OY7A 1SVSA 8AT1A 1NNI1 3VR2D 1ZUNB 1UFQA 5CAEB 3EFHA 4XX0B 3A0UA 2GLUA 1JZTA 1TA4A 1YB2A 2GHIA 3EIFA 1QWSA 3HBMA 3LC7O 4FVTA 4GXNA 3SP1A 3IP1A 3AEQB 2QTTA 3O4VA 4Y1FA 1C2TA 1KC3A 4C6TA 4ML3A 5C53B 3DR5A 1AKEA 3RSGA 4P0QB 3MYRA 2W98A 3SVTA 1N75A 3HVJA 4QELA 1LU9A 4ZV7A 1ORVA 2LTAA 2COKA 1JEQB 3AOEC 4Y2YA 1H2AS 4RADA 1FYEA 4RF2A 1RWKA 3I2KA 3ZWKA 3ZY2A 3VR3A 5JJ5A 4BFXA 5K0TA 2B99A 1KH1A 1EZ1A 3E3MA 3MC1A 3B3JA 1YRBA 2ID4A 3O0DA 1XEFA 1GEEA 3LPLA 3DT6A 4Q1AA 4MPJA 3BY2A 4AC9A 5EE9A 2O5VA 3I37X 4DGSA 2Q3EA 1TF5A 4EI8A 2GEFA 1RDFA 4INPA 4J8PA 3DDHA 4BNHA 4KQWA 1NXWA 4E4RA 1GRQA 1YC5A 1YCGA 4P2BA 3KJFA 4CIXA 2Q6KA 3DKPA 3QHAA 2R7KA 2HSGA 4L5IA 1UR5A 3GZNB 2I7TA 1E18A 1ZK3A 2G09A 5IC4A 5AKXA 3QWAA 5B2ZA 3V2HA 1YDFA 3LUJA 3BD8A 5ALIA 3KNZA 5AKYA 3E1YE 4YIHA 1CCWA 2W2VA 3FZQA 4L28A 1V11B 1CQIA 5DBIA 2Q9CA 4RK1A 5TPZA 1DV1A 3OFND 3EHEA 4OHKA 3TLZA 4R1QA 5DX0A 2AD1A 4KX5A 1Y8CA 1L7XA 2VDNB 3LUKA 1N5RA 1HFWA 1Y5MA 1ZVMA 2BZ1A 5KEIA 2JCBA 2OWDA 3B7WA 4REQB 1XB2A 4UQPA 4DV2B 4IUCS 1W9MA 5FYDA 5C3UA 1CDZA 3AR6A 3GFVA 4O2BF 3T7CA 3PD0A 3I56B 4RULA 5CK4A 5EESA 5CB4B 1BN6A 5A5EA 2Q45A 3F47A 2NSYA 2CDNA 3C6BA 4KI7A 4EPYA 5MN5A 3BRWD 3GJ5A 2J08A 1RJ9A 3PTZA 1JG3A 4KI0A 4L3VA 3M4XA 4NK4A 4J2TA 4POAA 2JLUA 2W2LD 4GVLA 1MH1A 2P41A 3VU1A 1Z5OA 2AJCA 4JMQA 4B3XA 1VQOB 2V3WA 1SUDA 1VIVA 3K9GA 3CPHA 2HV9A 3ABIA 1SOVA 4PHGA 4X7RA 5H8WA 3CNNA 2NT3A 3A4YA 5AI8A 4EKYA 1K66A 3S2EA 2PMBA 2OXEA 2X8KA 1AO0A 3EPKA 5ALHA 1ZN7A 3S2FA 4BE7B 1JHYA 3GUCA 4QICA 2IBSA 1G66A 1V4BA 3W5AA 1D4OA 2HJWA 1NF2A 4KPUB 3GGOA 2IIPA 3LBIA 1J25A 2G80A 3P9KA 2IDMA 5DGTA 2JLZA 3Q10A 1DI0A 4ZFNA 1XIVA 3G49A 2EWMA 1ODCA 3FTNA 4M21A 5IJAA 5HKOA 4DUPA 2IYVA 3L7AA 2CNOA 3GUHA 1U1IA 2O7RA 3FPFA 4OQDA 3SYLA 3IXMA 4BVBA 4XYLA 3GLGE 4C0BA 4YV7A 1J7JA 2G7MC 4OLFA 4DB2A 4E21A 1QMGA 3BD7A 3ZZMA 2EKBA 1P77A 1N2CB 3AKEA 4O02B 2EGGA 4U7JA 5EWLA 1W75A 1ETHA 4KJZA 3KJEA 3N0RA 4L0QA 4DDVA 4C07A 1CR4A 5THKA 5IRCD 2OQ2A 3HWWA 4JS0A 5BYBA 3HDGA 4Y67A 4EUSA 3IVGA 3OLVA 2JI6A 3J7TA 1NZDA 2IOFA 2BZSA 2YICA 2K6GA 4UBIA 1OGYA 1V3VA 4P0TA 1GM5A 3DV0B 1DZIA 3MJ4A 4H7PA 5A71A 3FKQA 2M1XA 1E99A 1GSIA 2Z9BA 3G2PA 4NPAA 4BB6A 2EL7A 2OCLA 1H85A 3L8ZA 2OLEA 3BS4A 2Z4RA 4AJ9A 2FJPA 3AL0C 4EY8A 5DBEX 1KEPA 1M9NA 1WUTA 2MYNA 3EASA 2IQ5A 3GUVA 4GM0A 4WW0A 1P4JA 1U11A 2ATXA 2R6ZA 2P3LA 4KSBA 2QR3A 4D3ZA 4E5SA 4ZTZB 3AXTA 3L7BA 4GQIA 2YNMA 1Z5GA 1XWWA 1SKYB 3ESDA 3PNVA 3WRVA 3FZYA 4NBKA 5LQUA 4A3SA 3CLUD 1RAHA 2TMGA 3BE6A 1WVMA 4AJKA 3BC9A 3F6PA 1PJ7A 1AS2A 2NYUA 3GD7A 4MOWA 5FOQA 1E2IA 3DAYA 3EXEB 4IOKA 3EQ6A 3FHLA 2Q0SA 1UBEA 2GK3A 5FR1A 3O3OB 5FBHA 2N47A 3OT1A 1DG1G 3LHIA 3SC6A 1MPXA 4MWDA 1GGFA 2W48A 1NV9A 2IF0A 3JQAA 3R7WB 4GM4A 2R6FA 2Z0MA 1AQYA 2I65A 1N2IA 2KVOA 1Q0RA 5I7HA 2H4WA 4FMPA 4U3JB 4M89A 3AJAA 4B35A 1HNWB 3G85A 1RLMA 3LDHA 2ZYTX 4B3CA 4KDEA 3ER8A 3KVVA 3PICA 4MQMA 4PZ9A 3D4OA 2GSDA 3U4QA 5BMVB 2YOFA 2EFDB 3SYRA 5AI0A 1P5HA 2IPLA 3AP2A 4PCVA 2O6LA 2ODTX 3SZUA 5FEUA 1A4RA 2Y1LA 3L93A 3NH6A 4MP3A 1T26A 3ASYA 4NBUA 4I6EA 1AF4A 4FEEA 4J0EA 5IUJC 5E6RB 4Q1CA 3F74A 5CVTA 1L4BA 1PQPA 2A5JA 3FLBA 1X3SA 2YNMC 1C7IA 5CM2Z 5DTJA 1JHZA 4MIKA 3DHEA 5EFZA 2DRIA 3HA5A 3WIBA 4N18A 4PYNA 4AXXA 4BRZA 4TYNA 2IEAA 4L8GA 2W43A 3BJMA 1L4NA 1VF7A 3UHOA 3D3NA 4MJ3A 4C7VA 4FYJA 4F60A 5BVHB 2UUAB 1U0NA 4LHYA 1F8XA 5FT9A 4ECAA 4DR5B 1JEAA 1DG3A 2FSVA 2GYVA 3JQDA 1OFUX 3P9RA 1QE5A 1CDEA 3TLYA 3BL5A 2W22A 1U7XA 5HK8A 1MO4A 3I04M 2UYGA 4NQRA 1T4BA 4WZBB 5COBA 5K8UA 1M6YA 1Z0DA 3G9UA 4R1PA 4YJ2A 3W8FA 1TKBA 3CNOA 5U4XA 1XQXA 3V1UA 1KY2A 3CURA 4MAMA 4PG8A 1XU4A 3MHTA 3C3PA 4AD8A 4JLKA 3PUHA 3Q6MA 2CUNA 3A1FA 3L79A 1M1ZA 3W2TA 1K6MA 4UOEA 1NSFA 5FORA 5FIUA 2OYCA 2OCIA 1NBHA 5EIFA 1SCKA 4KO8A 3O74A 1OH5A 1I3OA 2QY9A 3RTCA 3TL2A 4WA8A 5HTOA 3GH1A 1QO0D 3QKSB 2PUAA 1ODFA 3RSFA 1WHSB 1YA4A 4DLTA 1VIAA 1WZ2A 3HKDA 1E58A 2GZHA 3THRA 2X1VA 5GJBA 4BX3A 1DOHA 2QEQA 1JB1A 2ZYIA 3OQBA 3S40A 3T94A 2BM1A 4BNXA 3X43A 1I8TA 1KO8A 2EC5A 4NE9A 4XWAA 3ZQ6A 5LZ9A 1QP7A 2PK3A 2VIIA 1X8JA 4IZIA 4NLLA 4K1XA 2ZU6A 4H16A 1IEXA 1CU1A 4F8JA 1WULS 1HNZB 1DIAA 1NURA 2FSVC 1NE7A 3OETA 4DGQA 2GCPA 4G9GA 3FPSA 4YX9A 4MV9A 2XVXA 3CONA 3JWPA 4MUXA 1K92A 1KSJA 1HZJA 5E9AA 1AF7A 1D2MA 1OFUA 4WN9B 2JAOA 2D2IA 3FIUA 4BMPB 5A5FA 2YWEA 3HZHA 5FTMA 2VRWA 3KFLA 4C22A 2P6NA 1E3IA 3F97A 3F2IA 1E3EA 1RHKA 5KYUA 4YUVA 4S12A 1BFDA 1DIOB 3C1UA 3JTMA 3VVCA 3ULKA 2XSZA 2O8FB 3SM9A 3QQ5A 2Q6OA 1YHZA 2H07A 3AKYA 4FMBB 1J8FA 4RVSA 5DHFA 2VVTA 4HB3A 3K5PA 2VHTA 4L7QA 2R1ZA 4Z9YA 3RJMA 4LJ6A 4XJTA 2EP7A 5L51A 2ZYWX 3E35A 1Y34E 2IODA 4IWYA 4V0NA 5LIRA 2VJLA 3L0SA 2R7AA 3TB6A 1B0PA 4R2XA 3MJTA 3BA6A 4M9XA 3HAGA 3GBSA 2GZ3A 3H2BA 2NYRA 1RRPA 3B6JA 2BFDA 4QDKA 4IVPA 2AC4A 3SE0A 1W76A 2PU7A 4AUKA 3LP8A 3MCUA 5F1PA 5J43A 2DCUA 4LWQA 4I5FA 3ASUA 3KVOA 3T4EA 1WSRA 2H6EA 2V7EA 5K4HA 3EISA 3AG6A 4EB0A 5HKKA 1V3TA 3BL6A 4TMVA 1GGNA 4F4HA 3K6SA 1JUDA 5IYRA 1Y9AA 3L7LA 3EXG1 3ZCSA 1SGWA 3GDHA 4Q6BA 5BQ5A 2DHQA 2R68A 1E4YA 3CNQS 4W5NA 1HMPA 3TNFA 3TZKA 4H2DA 1UMBA 2Z98A 5L4LA 4ZDIA 3VISA 5EE5B 4RBNA 3WLSA 3CJTA 1JDTA 4BNDB 2WYUA 4I5DA 1GU0A 2R1UA 5IVKA 1B4DA 4K8RB 5I7OA 2PX0A 1CXZA 2VQ3A 5FD8A 1ZOOA 3KQUA 1OBFO 1WMDA 1BE8A 1TTHA 4V0QA 4OJYA 1PS0A 1V1RB 1FLDA 3C7KA 4LVOA 3UAVA 2HQRA 1M2VA 4II3A 4G9BA 5CLQA 3SHWA 1R27A 2C5LA 2PUTA 2EKZA 3LUFA 3WZLA 1MMFB 3OF3A 2OD7A 5I4BA 2BKAA 3KQVA 5FWNA 2C3MA 3PRJA 4PABA 1HDIA 2QP9X 2WG2A 2YVLA 1C7ZA 1H22A 1PUJA 3D4IA 2F8LA 1NL3A 4L50A 5A0TA 1M2NA 3AF2A 1PNVA 3U7JA 3W77A 4US2R 3WP0A 4JR2A 4CR6A 2BI7A 2AT1A 1LF0A 4W5WA 421PA 1IAVA 2CJWA 3REOA 3AUTA 2BVNA 5ECWA 4K7JA 2ZK7A 2ZTMA 3OZTA 1J5XA 4JLUA 2C9MA 3JQ8A 1M73E 3OZIA 9MHTA 2VUIB 4M8IA 1N34B 1VP3A 2IU6A 3MSCA 4K28A 3TD9A 5JSZA 4B3MB 4L8WB 1GVHA 2ZQYA 4FXOA 1GTRA 3EK2A 4ZT2A 4JBWA 4G7XA 4ZCMA 2MMGA 4PLGA 4UD6A 4JU8A 3D6TB 2HD4A 3F8SA 3A4TA 3LQ6A 2FJUA 3IKTA 2FOIA 4MINA 3OJ0A 3TTUA 2IYRA 4DMMA 2JFZA 2VXYA 3PHCA 1XXHE 3D9QX 3PCRB 4UCQA 3R6WA 1E3ZA 2ZUCA 4JOQA 4LRXA 1WD5A 4PV7A 3ICCA 4FZVA 1UXIA 2C84A 1WQ3A 3EQ9A 3LDGA 2NGRA 3L1HA 4RXUA 3HXPA 1CP2A 3L46A 3EVGA 1WLYA 2WRZA 4ZWNA 5LQCA 3OIFA 1L1QA 1TW2A 5D3KA 4ZQGA 1H9CA 1TYZA 5FI3A 2PXHA 2L19A 2GAAA 2IZ1A 1SR8A 5BN4B 4BCBA 2ROQA 2A9KA 1LPMA 3I32A 3LYLA 2H2AA 3UKOA 4B4VA 1KH3A 4L6AA 3C14C 3BRSA 1GTJ1 1V5FA 2ONYA 4J3FA 4TZKA 5K51A 3DLHA 3HJUA 2C3OA 1R6TA 2H4YA 2E4UA 5BSVA 3X44A 5KSPA 4QYIA 2PMKA 1AGYA 4WZAE 1J56A 3VVBA 2G1UA 3PDJA 4NCAA 3VX4A 4URZR 3SYTA 1Q81D 4P53A 1ZD8A 2HU5A 4U0JA 1JU9A 3W5SA 3E5NA 1YZNA 1WMBA 2GN0A 2QF7A 4BJ5A 3NWEA 4XOPA 5F4JA 1E3SA 1H0SA 2AD5A 2BMEA 4R8VA 3BXPA 3IIJA 3QWIA 3A37A 3FGZA 3VTFA 3VSDA 4EYOA 1GOTA 2HEIA 3A3NA 5A9TA 5G1OA 5IJ0A 3L8YA 5EE1A 1YJ9B 3HV0A 4C01A 3IFSA 5AVQA 4P2GA 5JBQA 3U09A 3A6HA 2CE7A 2V03A 2ZXHA 3EF3A 4HRAA 3LNNA 1Q91A 2X58A 4FEYA 4EA8A 2ILTA 4NP6A 1KRWA 5JXHA 1A9SA 1B0UA 2E7ZA 3FTDA 2Q7XA 4EMTA 1O5TA 4RFLA 4HVTA 5ALUA 5JSQA 1ZUD1 1QK3A 4X7EA 2R8BA 1FNCA 4UQLA 4YJGA 3L7DA 3WB9A 1PR4A 2Q41A 3DDYA 1NX6A 1SAYA 1TT5A 4FYPA 4JBGA 3V1LA 2GOYA 3OZDA 2VQ6A 1SU6A 4ZEVA 5A6SA 5KTPA 2EERA 1BPLA 1GN9A 1R1DA 4EGJA 2FR8A 1DBRA 2IDKA 3UK7A 1JDVA 3W3ZB 1RW4A 4BTEA 3MWDB 4IZHA 2EG5A 1G7CA 1ZVJA 5AM2A 4YPVA 1V41E 2LD4A 3DMDA 1ZC4A 3M2TA 3NHAA 3PRYA 5FOSA 5HKLA 1VHDA 2P9JA 1GNPA 4D9HA 1XXHA 4GAEA 2C1XA 4W5QA 5AK5A 1KZ1A 4TV8B 5AM5A 4EG4A 4HNUA 3LX4A 2VAXA 1F3OA 1USKA 4QX6A 4B76A 4CLXA 1LTQA 4D26A 3R9XA 4FMDF 4OHRA 4F11A 1ZNWA 1TVCA 3E22A 4U7DA 2VBVA 1BDJA 2PS9A 3COJA 4FQ8A 4MCAA 5JNTA 5BQPA 4BZXA 1VSQA 4V0LA 3ITKA 2H3HA 5A88A 3K20A 1ZA1A 2C2ZA 1YS7A 5DBOA 2HKIA 3R3WA 4I4IA 1YE3A 1DFHA 5JLJA 4YTEA 2CXPA 1J6UA 1VIMA 3GMTA 4MI3A 4AWBA 4CCWA 4OQPA 2AA3A 4WZAA 5DHTA 5EJ5A 2PEZA 2VPIA 1U5AA 2XBLA 4FFNA 4HDSA 4MJXA 4ZQHA 5F1YA 2WAAA 2ATVA 5EZSA 2Q2QA 4KHZA 3UJ3X 3UT5B 4DM3A 5ITSA 2W8ZA 3WKBA 4CKWA 3O83A 5JRJA 1V6SA 3HCCA 3HCWA 3OCXA 4XQCA 1PX2A 4CMJA 3BFKA 1F4VA 3HJBA 1ZG3A 2RHOA 2AS0A 1JI3A 1AXEA 2ZB8A 3A06A 1ZMBA 3MM4A 1G8AA 1P0QA 4FFPA 4PAMA 1QYVA 4PR0A 5ALQA 4DXAA 2UYCA 1X2BA 2NM0A 1ZUIA 2VYCA 5BYJA 4AP6A 3E5HA 4HFJA 3L9WA 1WZIA 4ZMRA 3IAEA 3NR2A 2QJFA 5DMHA 1E3WB 3TXYA 3JR3A 4DTCA 3ANXA 2HJGA 4IHJA 2WAOA 4UHCA 1XJCA 5A4FS 3IEUA 3TQSA 4KXNA 2GPJA 4HE5A 1EK2A 2J3KA 2PD6A 3A31A 3GX1A 3HSSA 1JTVA 2UZIR 2R1VB 1VLHA 3ZDYB 5KNDD 2MYPA 1C9KA 1JEYA 2W6IA 2ZIEA 4B3RB 3BTSA 1MX1A 5HRUA 2DKFA 3WE7A 1IVSA 3OPYB 4II2A 4JODA 2WKSA 2IS2A 1QP0A 1HORA 3NONA 5KJ1A 1UP6A 1LDGA 3HKCA 4KO2S 4KQ2A 5DNVA 1G5TA 2BFCB 4OHVA 5EJMA 3CN7A 2QTVB 2HJVA 2ZVQX 1TTPB 5DULA 3V9AA 3I8SA 3WB2A 4AECA 3FLAA 1MB2A 5BNZA 1A95A 3I3OA 2EAUA 1E7RA 2AKAB 3NO4A 4RD6A 4X5OA 3VHXA 2XMGA 3U80A 3JRNA 4UKDA 1GWNA 1H0RA 1WHTA 1U9ZA 5K0JA 3FUWA 1DEKA 1BE0A 2FSUA 3RFTA 4BVHA 1EKXA 3ES9A 3QOFA 4RA9A 5IHXA 3T7TA 1DJLA 1LBQA 1EXDA 1QV7A 5CITA 2GBPA 5FOVA 1PDWA 1E2GA 1IXRC 3GA7A 1G9SA 4IEFB 4HDNB 2AIRA 2DHEA 3RTGA 1KL7A 3N39C 3ZHRA 4BO3A 2A35A 3VO2A 1AS0A 1XRNA 2HFKA 2XQKA 3B1ZA 4ZQFA 5K0NA 4YV0A 4FX5A 1MIOB 5AVTA 1UBHS 3WDSA 3GN1A 4D41A 2ZCUA 3E0QA 5JH7A 3FF4A 2HU2A 3WKCA 1IB6A 1UCFA 3KB1A 4LQ4A 5DOZA 5CA0F 4GO1A 2XA9A 3CZ9A 2P8JA 4X1KB 1JXMA 5D8DA 1RSZA 2BMFA 4Z3KA 2P1ZA 2X15A 5C37A 4O0MA 3D3WA 3MOSA 5FRDA 4QKQA 2P5UA 5CDGA 2ID7A 1ZSNA 2Y4OA 3A6LA 1NYTA 3GEHA 2OGSA 4PAWA 4XIFA 4QUEA 2HT1A 4Q21A 3O8OA 4PLVA 4UHKA 2HM7A 4KQHA 3VC2A 4KPYA 1RHUA 1CJVC 1V71A 4S2EA 3DWIA 4XGQA 3LOPA 1DO0A 1N9KA 4E15A 1X1TA 1P7WA 3HR7A 3LT4A 2YV1A 5DBFA 5HZMA 3BJEA 1Q0UA 1FXSA 4DC9A 2EFEB 1YA6A 4LXGA 1IB0A 2VP9A 4F4IA 4BKQA 2XKAA 4UTOA 1WDTA 4LQCA 4FGLA 2OZLB 2J5KA 3AMVA 4M0FA 1YDHA 4H7EA 2XPCA 4HDMB 3VKVA 3FRIA 1UJBA 4AULA 2UAGA 4FKBA 3SKVA 4E6PA 1YZQA 3G5TA 1ZUHA 5MFZA 2ZJOA 3VZSA 4BJHB 2IIQA 3QK7A 5FBKA 4L78A 5HR5A 2QZJA 4IDQA 1QXSA 4QLAA 4YO8A 1MA3A 2AWNA 1E4VA 1P9LA 3ESAA 3PQFA 5HM8A 3B6ZA 3IT3A 2WWGA 4HAIA 1G7TA 1U7TA 1CK4A 3KVNA 1R12A 2JCYA 3JQCA 1ZGCA 1TPZA 5FBQB 1VHOA 1G8MA 3B20A 3CLSC 5HFJA 3UYKA 4EX6A 4XVQA 2TMDA 3HUFA 5BSUA 3CX3A 1QO7A 5KDDA 5IABA 3PDCA 4OQXA 1P4SA 3E3LA 1SQ0A 5CLJA 1Z2NX 2H2FA 4FNGA 4MVCA 3BWEA 1E1DA 2C3PA 4DABA 3IAAA 4YR7A 4MA4A 1IOVA 1KDPA 3AHFA 3NI2A 1IQPA 4GXTA 1QIEA 5CD9A 1VDMA 3MFYA 3O0TA 4IO0A 4O4HF 2VNIA 5CFOA 4Z8YA 1JHRA 5EGSA 2NU8A 1Y9EA 5F78A 2J45A 2X0IA 2WI8A 4KK4A 4CL3A 3T1NA 3FCYA 2VBSA 2YFKA 4KZPA 4E94A 5AH0A 3QE3A 4C6RA 2FK8A 2RI1A 4EGSA 3IEVA 2D4HA 3PXBA 4ZJZA 5DM60 4PF1A 1EG2A 2J5XA 4KNWA 3TQOA 4F84A 2IGTA 1ZH0A 1AHPA 1UWCA 4BZZA 3IVXA 3H1TA 1IY9A 4JLBA 2GA8A 1VA4A 2VDOB 4FOSA 3IBCA 4LZJA 1TUIA 1IUPA 4Y7CA 1IY2A 2X14A 3KZCA 2WP0A 4RHFA 4OBWA 3WYBA 4DLVA 4XASA 1G21E 1X74A 1DARA 2X5XA 1ZIYA 4JVSB 4ZCQA 4IH9A 4ESVA 1AQNA 3MTQA 4WY8A 2H59A 2ID9A 1Z4MA 2P91A 4JYAB 1V5IA 2YZNA 4FDUA 4AS3A 4DDTA 3H6GA 1RKQA 1ML4A 4NNOA 3DEYX 2I91A 3ACBA 2PMCA 5T4BA 5AW0A 2MDTA 4P0PB 1RRCA 1NY6A 5C1PA 2OAP1 5LFAA 4FFSA 1RABA 2YOGA 4D4HA 4NXNB 5JZOA 4RDIA 5AJVB 3BE5A 3HMQA 4GP7A 4BV9A 1Z2CA 4GX0A 2FW7A 2HOQA 4LVUA 2OK7A 1NIPA 2HAEA 1K88A 3JASA 2ICAA 3KJZA 1V8OA 5HFAA 3UJ7A 4E1AA 3UUEA 5EP1A 2WINI 2HR1A 3H4IA 3PYLA 1GRVA 1VL0A 3NHMA 3OCWA 5HZAA 3WMXA 5B7GA 3OQOA 3WQHA 3T0FA 3OX1A 1L5RA 4ZAYA 4DUGD 4F8EA 1ANKA 4JJ7A 2V6FA 1XD9A 2FH5B 2SHKA 8ATCA 5KVCA 2GAOA 5LKRA 4YHHB 1Z5NA 2NPOA 2REOA 1EVJA 2CLSA 4GW3A 2CYCA 3I3SR 1X94A 5EWLB 4XGNA 2XYVA 5HEKA 1YAHA 3FMOB 2BFFA 1YT5A 3GRCA 2K4MA 5K09A 2DLCX 1VQ8B 3A6ZA 2FPLA 3O4RA 2A5YB 1PT6A 3D8BA 4L9RA 1Z7WA 2HSWA 1P5JA 4RZQA 4EA6A 5HJEA 3RAFC 1LSSA 4F3YA 4KXFB 4JKYA 1Z29A 2WOOA 4MUGA 3CW2A 4O1MA 3U3RA 1FX0A 1J0DA 2NVUA 1Q0ZA 3IPLA 2RHGB 5CNIA 5AOCA 2KLHA 3DL0A 3DO6A 4C05A 3Q7EA 1XTRA 2HJSA 3DE4X 3NBXX 3ZG6A 3PVDA 4M1WA 2RARA 1YNOA 2ZIWB 4RY0A 3QU4A 2UU9B 4WXEA 1PT8A 2CFRA 2IIVA 4F72A 4HUQA 4TMYA 1C9NA 3L7JA 3O1LA 4J43A 1NR7A 2D1YA 4DKJA 4GC5A 4G2NA 1EYZA 3EOZA 2DECA 2ZSIA 4NG5A 2DHDA 1ABBA 4C0KA 1RHMA 4H59A 5IM4F 2J9ZB 1G21A 2ZXFA 1QIJA 2QV0A 3R2JA 3CUKA 2JF0A 5BQOA 2YHUA 6REQB 3B2QA 1VG8A 5TVGA 2AN3A 4MV4A 3GUYA 3TNDA 5CCEA 2G0AA 4QXPA 2XQIA 4EARA 1C1HA 3X1DA 1MQSA 2IHZA 2WF9A 5HUJA 3B3QA 1YB5A 4NAVA 2ZGVA 3DMRA 2Q7DA 3H1PA 4NBTA 2I1LA 1XZMA 5EJ9A 5I51A 2ZYHA 3JQAB 4JOBA 3AKCA 3GGDA 4HG2A 4RHUA 1VPDA 3HP1A 1D2RA 4ZQIA 1WCXA 2X6XA 1Y42X 4H1UA 1ZFNA 4QUAA 2G40A 4J0GA 5CTAA 3D1JA 4N76A 1XQBA 4ZZ3A 4Z4ZA 1X39A 3OMWA 4MPDA 4NV0A 4KR9A 7AT1A 4K2AA 1LV7A 1SQ6A 3CLTC 2BP7A 3CLRC 1N5JA 1R4NA 3FNBA 4HDOB 4TKZA 4JEIA 5J5AA 4AN0A 4I8XA 4LOLA 3K0AA 3SU8A 3U7QB 4D5EA 1T0UA 2N3ZA 3ZK7A 1D1NA 3SYMA 3GLRA 3ZV7A 1CULC 1MV5A 2G06A 3M83A 4LYJA 1IBMB 1C7RA 1XF9A 3FNQA 3K6JA 5E6UA 4YACA 4P36A 5AM1A 2CVPA 1NE2A 5K1ZA 5AFSA 4FEGA 5TPWB 1EHIA 1BN7A 2R5WA 3T1OA 1G5FA 2JGMA 3K0KA 1OJLA 1WNTA 4MKXA 4ZEXA 3KWLA 3V1TC 2JIZA 3NLLA 3QXHA 1N9ZA 4PO8A 1QS0A 5DYWA 2VZ0A 2ZBGA 5AWFC 4YMHA 3QVWA 1SCNE 3QNWA 4KQIA 3P7MA 4HMOA 1DRWA 3RRZA 3OJXA 2J3QA 4D7AA 4BGDA 1ZM9A 2W0MA 1K9VF 3Q7PA 2ZM5A 3HKBA 2GYYA 5P21A 2FZ5A 2QZ4A 3I8XA 4TS4A 4Z1OA 3I5AA 1NT2A 1ZIDA 1E5DA 1UZLA 2R79A 2PDAA 1JWAB 3HZOA 4HAWA 1JLKA 3SD7A 1Z0ZA 4FHDA 1Z88A 4EYGA 1LDBA 3DB1A 2GLXA 4NJEA 2JNWA 3OTHA 4NEHB 4BL5A 4WLEA 4C89A 1X8LA 2O8NA 2ZSUA 4XNFA 1UQRA 1DE0A 2XUFA 3D2CA 3D43A 3H11A 4IX9A 1D1SA 1HK7A 3JU3A 1I94B 1JHUA 4G1MB 3D7SA 1CUYA 2FQYA 4P6VF 4TGLA 3VPFA 3ZOZA 4KREA 3HKDB 3ONYA 2QSZA 4AMZA 4OB8A 4G23A 4L8YA 4Q4HA 3GP8A 3CC8A 2E89A 5HZGA 2V7QA 3USCS 2O2YA 1SVOA 3SC2B 4OYYA 5K8JB 3X1JA 1CR6A 3LT5A 1AJEA 3VOSA 5KREA 3IE1A 5C5CA 1GXSA 1QFMA 2AZXA 4EHLA 3T3HA 4X84A 2H1VA 2IPAB 3EF0A 4J2HA 4H1WA 1ZOSA 4H18A 3CVXA 4D9EA 2Z3WA 4I1PA 2KE5A 1L7MA 2NT4A 1II8A 5H4HA 3SDSA 3IP9A 2F3UA 3F7TA 1ULHA 5EAIA 4RHCA 3UW1A 4RO0A 5FTLA 3HJRA 1ZCAA 3PJFA 1N5LA 3QQPA 4FIZA 4DMKA 4YAIA 3BICA 5ILQA 3H4TA 2WVGA 4FCVA 4FLEA 5I4KA 1SA0B 4L4RA 2REQA 1UXOA 3RASA 1L4EA 1NVKA 2FOLA 3GCGA 1JBQA 3SI7A 4L74A 2XCRB 2E5LB 2ZIXA 4C0XA 3KEGA 4G97A 2Q3MA 1R2QA 4HPXB 4MPTA 5GZ1A 1WB9A 2EJCA 4WINA 3B53X 3VPDA 4XWOA 4HKTA 4PZCA 1OOEA 2BFWA 2FSFA 1FY2A 1WQ4A 3HBFA 3E15A 2J9XB 2XNCA 1CUSA 5GGYA 4CODB 2B7BA 5TJ9A 5A4KA 5J23A 2GXSA 3F3YA 2YXDA 1H65A 1PFWA 2I4TA 3IEXA 4MAFA 3TZ6A 3JWHA 2R4TA 3H05A 1TECE 3EZ7A 4R9NA 1LWNA 3S44A 2MSWA 3VPSA 1Z0UA 2QRVB 5JXJA 2BFDB 2PRKA 1ST3A 2JANA 4WFJA 2EFGA 1Y1TA 3CZCA 4N65A 3M34A 3GEGA 3DUWA 4R9RA 3QH4A 1DZ3A 4ZREA 4DR1B 2XCIA 3WLKX 2VHUA 5JJBA 3NHYA 4MUHA 1JL3A 1HQDA 4I1SA 2IVFA 3O75A 3K2IA 4MLZA 1SXPA 3TFWA 3K6SB 1L4MA 2NZWA 2XVYA 3AR9A 1QKKA 5FX2A 4XPIB 1ZCZA 2E37A 4IFEA 4MR8A 4TZTA 2ZJ1A 3NALA 4K9MA 2B2XA 4LE0A 1LFDB 5DW3A 1P7CA 2KS6A 1T2NA 2BEVA 3ZVLA 1AK2A 1J8QA 1SBCA 2AE2A 4J90A 3GCXA 3V00A 3I9FA 1JHQA 2JASA 1RQ7A 3H5RA 1UBJS 2FDXA 3PYXA 1DEAA 2OAGA 5EPEA 1AKNA 1PZMA 2YUTA 2R96A 3O3MB 3THSA 3VDQA 1OAKA 1R0KA 3F9CA 2J4CA 1D1PA 2J8ZA 1A5SB 1THGA 1M2VB 3CTPA 3HU1A 4LY0A 3UMCA 3MMXA 3IEIA 4IWXA 4XYGA 3TI7A 3F5SA 3SNKA 2RHDA 3IKJA 4QRHA 1WWKA 4YP1A 4AJ2A 7REQB 1TQDA 1KNQA 1LI7A 5CVCA 3ZIDA 4MP8A 1MJFA 1XDBA 2CYBA 3RCBA 1RXWA 1A2KC 3ONVA 3EQZA 2P2GA 3UJHA 1I4TD 3ZEIA 2PHZA 2MHCA 2QRQA 4IUDS 2JRLA 2I6UA 4QDZA 1EFPA 1PEAA 5EPUA 5CNJA 3P5BA 1C1YA 1I1HA 3RS0A 2O59A 2GPNA 5EJGA 1L7EA 3VU9A 4MVXA 1IXKA 4KR0A 1HA3A 3QPBA 1OLUA 3H2IA 4NYMR 1DAEA 4G1UC 2OG1A 4LCBA 4TL6A 4WOCA 3C5VA 4R3WA 3PUVA 4QBTA 3UTDA 4MTCA 1BFKA 4ZTBA 2HMVA 2IHVA 4ZHSA 1VI6A 4MI9A 3BMOA 4D1YA 2OM6A 1N6PA 3HHPA 2AVDA 2RB5A 4N9QA 1A04A 5KAPA 5J47A 2O19A 3IV6A 4NE2A 1AV7A 3I76A 5ERGB 5K3FA 5TMEA 3AESB 1EWVA 1M2JA 5K5EA 4P1ZA 4IH1A 3A1EA 5F3DA 1RT9A 3H3FA 3HJHA 3KT8A 5HUQA 4WHMA 1MJGA 2PH3A 4UM7A 5CD1A 4AJOA 1EFRA 1GT6A 2QAJA 3N75A 4U9HS 2FWPA 4DA7A 2NSDA 2ZZFA 3QVSA 2GO1A 2VZ9A 3E9RA 5FTNA 1NX9A 4PLTA 3ZJYA 3WIEA 3WIOA 1Z63A 4QREA 2J3HA 1ETUA 2VJMB 3TLGB 3FX2A 4BFSA 5FUXA 5GONB 3OZCA 1KPIA 1WXIA 4M98A 3PA1A 5H70A 1XZIA 1YONA 4N12A 5T57A 3I6YA 2BBWA 3EIWA 3LFUA 3TBKA 2Z6UA 1CY6A 1HDYA 3TKAA 5KZMB 2H31A 5CXXA 4BKUA 2FZVA 2GJAA 4ONEA 3O6VA 3P4YA 2WIJA 3PGA1 4EYEA 3ZD7A 5EIAA 1WY7A 1UJCA 4QYIB 4LNHA 3SSMA 4CIYA 1M0WA 1K9MD 2ZWPA 2GUWA 1GGHA 2XA2A 3FPEA 4KOAA 5EQDA 1DDGA 1FBNA 3OESA 1U1CA 1VQ9B 1UKAA 4MLPA 5DV9A 2F00A 5IXYA 3P0EA 4XOTA 1U0JA 1Z6TA 4RMHA 1KKLA 4CT5A 4RTQA 3KQMA 1HEIA 3EYAA 2CC2A 3LQQA 4BUJA 1CEEA 3FIJA 5B1IA 3SSNA 1W8DA 2WKPA 4OB7A 2PUWA 3C5CA 5BMOA 2Q5QA 4G5OA 3SBDA 2CUKA 3KHKA 2J0QA 5G41A 2E21A 2PBLA 1XNHA 3WYDA 1P1HA 3ZD8A 1TO2E 4BFWA 3NYRA 4DTIA 4WI1A 4NSNA 5KX5A 1LUAA 2W0SA 4R0NA 3OZFA 5HIIA 2VPYA 4KMMA 3DHWC 3G9TA 3KJHA 2FFAA 4KITB 1ZN9A 3Q7RA 3UAZA 2HQ1A 4YJGB 4IOJA 4NJOA 1U1DA 1UBRS 4WOJA 4Q3EA 5B6IA 4YUWA 2XF2A 1TT5B 3AI7A 3DMPA 3RI3A 1EJBA 1KBOA 2IUFA 2QE7A 4WXHA 1XTIA 1E62A 1O5IA 2BHLA 1EFVA 3RYHB 4O4IB 2M6KA 1JFFA 1PR9A 1B8VA 3KQTA 2QLFA 3UB4A 4RMJA 5LP1A 4OBBA 3I05A 4PZPA 1S8OA 1XXHB 2ZETA 3IBYA 2OGTA 3VZCA 4AZSA 1WORA 3DZBA 2Y9PB 3FN4A 4QSMA 3NBAA 2ODBA 1XELA 2I4OA 1MABB 1HFEL 1ESNA 3E22B 1KU6A 3DDCA 4IWNA 1XTKA 5DM1A 5DMXA 4PE5B 5DGDA 5G3ZA 1TL7C 3B89A 2PQ6A 3F7NA 3HB5X 3ILYA 3R0IA 3GJ3A 4F3NA 4UNNA 2PEYA 1PSZA 2BI4A 3ETDA 4PLWA 4QUZA 5AR1A 3WHPA 1NP7A 5KCMA 4N47A 1UK7A 2YZ2A 3AVOA 3TTXA 2VT2A 1ZJ6A 4X20A 4K5QA 4Z0HO 1OT5A 3UH1A 1GL9B 5PNTA 4EYSA 4IXTA 1NVTA 4HDSB 1AZSC 1APBA 1XZLA 1QCZA 1T3LA 7MHTA 2PVPA 4RPDA 2EF1A 4YQZA 1UKVY 3EG9B 1PKVA 2DH5A 3PQ6A 2WWRA 4YAGA 1P7YA 2PM8A 2XZTA 1TKRA 3I6IA 2XNHA 4MH0R 5DWVA 3WLMA 5GM1A 4Y1RB 1GQQA 4DAOA 1L1FA 1PJAA 1XCGB 3LDUA 1F5SA 5CHEA 4B3IA 1UJ5A 2P79A 2FETA 1Z0KA 3THOA 5C7IO 5H16A 4RF4A 1OLSA 3UXEA 2NACA 1RAFA 2YJZA 4MW6A 4B79A 4IIJA 1L5KA 3P9ZA 3T3MB 1SC6A 5LLTA 1X38A 3KB8A 4ENRA 4BQNA 2HRCA 2X6RA 5A3SA 5FJJA 1XU9A 4A03A 3G2JA 3PQDA 4CF3A 5FUBA 2MMCA 1OU0A 3NRBA 3T3IA 1QGYA 1B26A 5JTTA 3GXBA 4WKGA 1NC3A 4ARBA 1DAHA 3ECAA 3C7CB 3HKCB 1XD8A 3R8XA 3PHLA 3W2FA 2ZB3A 1YR3A 1UBSB 4ZAXA 3Q7IA 1UADA 2A7XA 3OLZA 4A26A 2F6RA 2G9NA 4C0HA 4CTJA 4P3XA 1JB9A 3BGOS 1Z68A 3NNDA 4M22A 2OV8A 3SGLA 3HSKA 5LU8A 3NHBA 1X86B 3V7UA 4TVSA 4UEKA 2V7BA 5YASA 1WHTB 1F48A 1O2DA 3ITEA 4N3NA 4W5RA 1DKNA 4GRIA 5FKJA 5FLKA 3R1IA 1Y4SA 4GI1A 5KTMA 3ZHXA 1XFDA 1NQAO 2A9QA 1T36A 3GFQA 2J7PA 2JCXA 3O8LA 4LRWA 4Q39A 3ZHZA 1YF3A 1K7CA 2AX3A 3MS2A 4OSPA 3DEIA 4E1BA 2C4TA 5DCLA 4BO0A 3P97A 1C7FA 1P9NA 3OUUA 1G63A 1TMOA 5BSHA 3ADDA 3PNQA 2IK8A 4EKDA 3U0BA 4OI2A 5CFQA 5ICCA 1NBIA 1Y6RA 3HNRA 5EVCA 1MNAA 1WV0A 2RHWA 3H3XA 5AKJA 2DQKA 2FEPA 4FTWA 1R7RA 4JMPA 1Z0JA 2C07A 5CX1A 3E1GA 1O96B 2E49A 4NPHA 4Y1EA 4BXOA 1N2BA 3HXLA 4TTJA 1QAOA 1SMKA 4GBMA 4U2KA 4NNPA 3BJZA 2G5TA 3ADPA 3O8OB 1N0WA 2WJGA 4Z51A 1M10A 1N33B 2VBTA 5SYAA 5DH9A 1ZBDA 2ENUA 2PX6A 4PBTA 5E7MA 2XUIA 3UH0A 3K0BA 2ZZGA 4WWVA 4X0CA 1NJ6A 2CKDA 3H8SA 5DBHX 3O4FA 2BFAA 2QD1A 3KJQA 4D9CA 1QZUA 3GY0A 4TRJA 4LPSA 4UNSA 3BXFA 3SZ3A 4EZBA 3R0VA 4BMDA 1IC6A 1WG8A 3DW3X 3H0KA 3RAGA 3GJZA 1CUGA 3V3KA 3OIVA 4R2IA 3HCAA 2H7CA 5FUQA 4F38A 4PFQA 4M60A 1EG7A 1UD5A 1RZUA 4QTXA 1LQ2A 2WU0A 1OBHA 1MAAA 4TV9B 3ZJTA 3IOEA 4UDOA 4R2HA 5IBPA 2HA6A 4EL0A 2A78A 2MU1A 4MYDA 1U2QA 4OYHA 3DLAA 2VATA 4P9NA 4AZWA 4P35A 1MC4A 1ZLYA 3L8EA 4DEYA 3FCUB 5C1IA 1W34A 1KFKB 5P8WA 3TUIC 4BPRA 4M1YA 3VDNB 2D7JA 4Q9IA 4CMKA 5BNWA 3R6KA 1AKQA 4UHEA 4B0OA 4D3XA 2X22A 1GIAA 1O8BA 2CY0A 5SYMA 7YASA 3I9LA 3TW0A 1F2UB 2YJ4A 3DA8A 4OTZA 5KWJA 2QTFA 4YCAA 1DC3A 1HRKA 5JXWA 4ZVLA 3H2SA 3OTOB 2L2QA 1L7PA 2G4LA 2GM5A 3BFPA 3Q88A 2V7PA 4MWOA 1QGOA 2Q8QA 2YN0A 3G0BA 2GD0A 2B6HA 3ER9A 2XHZA 4Z49A 1HDGO 2ZUSA 4KLNA 3S27A 4ACBA 2YX1A 2KI5A 2ZJ7A 4LRSB 3MA0A 5IWAB 4YJ3F 2JLXA 1LZKA 2NU8B 5I9TA 4LFCB 2XBUA 1NVVR 1ZO8A 2AZTA 3PX3A 1DRJA 4BQRA 2JI4A 3GD5A 1JAIA 1Z4OA 4RF5A 4RV5A 2WF7A 1V0EA 1M6VB 1I5OA 1N4DA 1ILWA 2FQQA 2VDPB 2YH2A 1NQVA 3L1UA 4HNAA 1Q19A 4IVNA 4TXMA 1PBTA 1D0SA 1WDLA 1RXIA 1BTOA 1N7IA 1V9SA 2BZGA 4DQ0A 5L9AA 4U2FA 1SXJD 2Z6QA 3OF5A 4JAVC 2EG9A 3KL2A 1QTNA 2QRLA 4MUFA 3WADA 1DKOA 3Q2KA 1NW6A 2CJPA 5TNXA 1WKBA 2C5BA 1J90A 1U3FA 2QHXA 5G0UA 3ON5A 2NX2A 3LPAA 2PKCA 4OEHA 4BX0A 1DGQA 4QUKA 4IIUA 4XJVA 1QORA 3C3DA 1FTGA 1HQCA 3KUXA 2ISCA 1AE1A 1NXQA 2R3SA 1Y0RA 3DMGA 3GA0A 4H6WA 4PGMA 3AVTA 1B1CA 2R8ZA 2GZMA 1KYWA 1V5EA 1WPGA 1CE8A 2RIRA 3C6XA 4JYBA 4MDHA 4MSUA 1U3GA 4B6JA 4EG5A 1Y8AA 3Q9LA 5EJAA 4FSDA 3LHDA 4J6FA 4YWJA 3R8FA 2BMWA 2EFCB 1AHHA 2O2HA 4W9RA 2FWRA 1R0YA 3JVVA 2O3UA 5CDFE 3H9GA 2C42A 3GLHB 5IM5A 3JASB 4Z4WA 2QT1A 4N40A 4XUDA 2WG0A 4LHWA 3EXG2 5BNTA 2DJ5A 4N7RA 2FWMX 2W8BB 4ZCIA 2EW1A 3CGWA 3GJTA 3HFGA 5FR2A 4YRPA 1R18A 4GE0A 4LQLA 1Z4IA 3IL2A 2JLSA 2HRRA 2IYWA 1T13A 1T2AA 2G5PA 4BO2A 3RC9A 1GUBA 4S1PA 4KFUA 3TVDA 2BHRA 1UF9A 2H2DA 4G6IA 1R6AA 3AV0B 1QFYA 1A7UA 1P1KA 4I4TB 1P9RA 5FWAA 2BFNA 1MO2A 4XLAA 3QOYA 2BFFB 1IE3A 3AGPA 3WL8A 1LDMA 2B1GA 2D9RA 3OU6A 3RIMA 5JAOA 2BOVA 4QZVA 2COEA 3PITA 1L7VC 3PQ5A 4PLFA 2D5AA 2AMYA 3AWDA 3RUEA 3TPZA 4C0SA 4CKEA 4Q82A 3V32A 5LNK1 1FX0B 2NVUB 3ZV5A 1NQXA 3OOJA 4UM9B 2C2GA 2R7MA 2XBMA 3KQKA 3WNCA 3CY6A 3OEHA 4Z4UA 1N5OX 2E82A 4TUYF 2Q5JA 1FFDA 3FWKA 2C9OA 3O2JA 3N2KB 2C77A 1M6NA 1PQYA 1X1QA 2QP3A 3BGDA 3PFHA 5ULLA 4D82A 5AHOA 4MS1B 1JKIA 4UBJA 4R1SA 3U9TA 1YDEA 1YZHA 2I6XA 1B8OA 1ORWA 1M2OA 1TVEA 2QVCA 3I4CA 4P98A 5C32A 3HN6A 3DZ8A 2HHHB 3OQIA 4IFIA 5EJ8A 2J9FB 1CY1A 4ZD6A 1P5ZB 2A9JA 1QP4A 4KP7A 1CJTC 2PTGA 2PH7A 3RRNA 4JI6B 4K9LA 1QHIA 3PF9A 1H5NA 4HJRA 4HLDA 4Y9DA 4CLEA 2E18A 3CKMA 5AD1A 1WEHA 4F3TA 2BMAA 4JELA 2XYGA 3M6LA 1MT0A 3CNHA 1EM6A 4ABYA 2CF5A 1D6JA 3RJZA 3F2VA 3VR6D 2VDJA 3N2NA 4JQOA 4ZOBA 4RC9A 4Q7MB 4CEIA 1E9CA 4ZZ2A 4MR7A 5DYGA 5CA1F 2HCBA 1I1QB 2ZWMA 3BE4A 3GJ7A 3ZI0A 1NW4A 4RPCA 4YAEA 3UAXA 4IDFA 5KNCH 1X7XB 3JVUA 2ZRGA 3SJCA 4OQFA 1Y7IA 5EMNA 3QU9A 4C0AC 2JZCA 5L3SB 5CDFA 1BEZA 3PKJA 2IS4A 2ZJ2A 2HADA 1A9YA 5ISMA 3NHRA 3R40A 1ISJA 1J49A 4RZSA 2BP7B 3K73O 4MDFA 3TLAA 1N3LA 3E9CA 4O2AF 1K0UA 1T5IA 1QGDA 3AU8A 2BONA 4ZJPA 4BKRA 5CEJA 3V9PA 4C6SA 3N6RA 4W63A 3ZVNA 4KXQA 3Q41A 1ZD3A 1BYUA 1MIHA 2O8EB 1ENZA 1DAIA 3PWZA 4JUFA 1GPMA 1TZBA 2QB5A 3KOZA 5CG2A 2Z30A 1Z7GA 1KEEA 1O94C 1JKJB 2YY7A 5AVRA 5K01A 5FNVA 3HVUA 1PJ6A 4NG4A 5HBGA 2J5RA 3LCJA 3SOPA 4IKOA 1QS0B 3KD3A 3ZWPA 3SR3A 2PE3A 1E61A 1X15A 3WHIA 3M9XA 3V4SA 1G0NA 4DR2B 4DPMA 2E1PA 4OJQA 3HKBB 3KWJA 4O2BA 4RGVA 1DUVG 2QMEA 5ARCA 3WJ2A 5I7FA 4G8CA 3G17A 5IS2A 4MIYA 3Q6IA 1LI5A 4GMKA 4GKVA 4R7ZA 2D74A 4C5AA 4MI1A 3B6KA 3PHIA 4HNSA 4IGAA 4QEDA 1TZJA 1KYXA 1TCAA 3G5UA 3KM0A 3PHBE 5CPBA 1LLQA 5JMTA 4PWYA 4U7PB 2XUJA 5DHRA 1ULBA 2ODQA 4AJ4A 3RANA 4D46A 1P2UA 5D7NA 4QV2A 4RL6A 5BV1A 3IDZA 5IKXA 5DGCA 1OI4A 2GZ1A 2HIAA 2CSUA 3PDIB 2IPNA 4XARA 2VTVA 1SHJA 2IYAA 5E4FA 3VZQA 5DX8A 3LY9A 2WR8A 4UEOA 4NAUA 3TX2A 4KWIA 3DEZA 1DBSA 2YIJA 3QJYA 2R6AA 4MRMA 3CCFA 5IW8A 5E9JA 3B52X 1T8PA 1V47A 3PPIA 4GLOA 3NC1C 3SJ7A 2HI0A 3TEFA 4KFSA 5G0TA 5BWBA 1DWQA 3L92A 1P1FA 4Y3UA 3T35A 3ETEA 4DNOA 3ZE1B 4DYDA 3NDBB 4EM6A 1SB8A 3OPQA 3STWA 5KOJA 1ZD5A 3ZY5A 5ES3A 1K7FB 4X66B 2C2XA 2GSWA 4JSTA 3A1TA 3A58B 4PXAA 2I6QA 4N54A 1JKFA 4OREX 3ZU3A 3ZCUA 2AOWA 4EZEA 5BQXA 1XJ5A 2CHVA 2I1QA 3OMXA 1R8SA 1VE1A 3UXYA 5AVXA 3ZVMA 3MJRA 1XKXA 4MUBA 2Q0XA 4LECA 4PPNA 4R2WA 3R75A 3I55B 1TFUA 2W4IA 4RVHA 1SQGA 5K0LA 1YVRA 3UOGA 5IZ4A 3LFTA 2Q62A 3DXYA 4FOLA 2CGEA 3RROA 4N6GA 2P2LA 3P2OA 3W9YA 1XFAA 4Y0AA 2RGYA 4JLOA 1O5OA 1A2BA 1PTKA 3JD0A 3TJZA 3HUDA 5IYZF 2HWXA 4R8LA 5KJ6A 4X60A 5DO9A 5A9RA 3L7NA 4C3VA 1E6EA 4IP0A 4EHBA 2C4KA 5HW0A 3PB3A 3G0GA 3BSSA 1E1LA 3DPSA 1HV8A 3LUDA 2G1PA 3FB4A 6LDHA 1S1CA 3G7SA 4B45A 5K8VA 2WIGA 4K6GA 3P26A 1RVV1 3Q6RA 1TYAE 4L4SA 1N4AA 1KFJB 4AG3A 1NC1A 1WCWA 3G2OA 4URFA 4MO2A 3E05A 4IIGA 3DOUA 2XE4A 5EXPA 3SOZA 2CHFA 1XMSA 5BT9A 3K72B 1E3TA 2EJUA 3DEKA 2HLPA 4MYHA 4KLRA 4XLEA 1M72A 2A1TS 1OMOA 3IUQA 3MWFA 1XQWA 1B6GA 4MR8B 1M1NA 2AG0A 3KPYA 1P0IA 3NRCA 2A1TR 2PKYX 3RS9A 3ZGVA 5HQ3B 4J9VA 2PMDA 2ZI3A 3WK6A 1E2HA 4RVCA 4L95C 4OKSA 2XXAA 1C8KA 3WL3A 2N1MA 1SOAA 3DKRA 3LL7A 4DCGA 4CR7A 4R01A 4OY3A 3RS7A 1OB0A 4MVJM 3B1YA 4ZU1X 1XTUA 1GTMA 4LY9A 3UAWA 2EU8A 3UAGA 1TMGE 1ZBQA 1GRRA 3HN7A 1J9GA 1M0EA 4P3IA 1Q0QA 1NTOA 3CVVA 1XEXA 3GVXA 1KQGA 1VL1A 1KMIY 1T35A 3L0CA 4WBXC 2R65A 3WNZA 1VFPA 1GPUA 2FKNA 2BT4A 1RP7A 2NU7B 4TQUS 2P2ZA 4XKVA 2RJOA 4MXDA 2J31A 2C9ZA 1U90A 1PF7E 4Z54A 4JSYA 1XMPA 4OL9A 5HHTA 2FPPA 3MWEA 1JP7A 2YQZA 4IBOA 1HRDA 1ZINA 2XXJA 3DE5X 4GE3A 4LJ8A 4MP6A 1MJNA 3ESBA 4OXQA 4DM7A 1T6YA 4D42A 4F2WA 2UXBB 2QYSA 4WXYB 2GREA 4F3CA 3FZGA 3C45A 3ODGA 5K3CA 2NW6A 1LB1B 3ND9A 4WESA 1VM6A 2Y1FA 1D2HA 1QFZA 4U6NA 3RKRA 4UHHA 2XWQA 5H81A 1E3LA 2XE7A 2PIDA 4Q9LA 1VTKA 3DLTA 3ORFA 1ECGA 2ET6A 1VZ2A 3MGAA 5K3FB 5JFOA 3U37A 1AQLA 2GEKA 3N07A 5K6TA 1WSVA 3P45A 4AS2A 1GG2A 1KIAA 2FSPA 1HETA 3A27A 4MVJP 5JASA 3HS3A 3OQNA 3OEEA 1ODKA 1XAHA 1I14A 2O07A 2X41A 3OU2A 4L5BA 1L4FA 3C24A 1NGSA 1T6ZA 2M6RA 3EHDA 1S3FA 5E6TA 2H4XA 4BBJA 3JY6A 4D4GA 4L76A 4E07A 4QG3A 1DVRA 3SBXA 3VPHA 3F78A 5HVNA 3FOBA 4RU1A 4ZOQI 1IJKA 4QNRA 2Y1DA 4MULA 4M9ZA 3LCUA 5C81A 3NASA 4OKNA 2J3LA 3USZA 1PU2A 5DYIA 3ZD6A 1AUQA 4C4AA 3PGMA 4UPEA 2J4DA 1W7AA 2BR4A 3CCLB 3WYEA 1X8KA 3AUYA 5BWCA 3GZ4A 3MD9A 3PDHA 2DUJA 2J5BA 1K75A 1KIMA 1WOMA 2XWPA 3HY3A 3PJGA 4X93A 1ZGJA 2G8LA 3OM1A 3TZQA 3H17A 1AKMA 2ERXA 3ZHYA 1HT2E 2BSXA 4AZ3A 4Z4FA 2IS1A 1XE1A 2WJJA 3VU8A 1YITB 1PJ5A 1OFHA 3FNFA 4EK9A 5EKSA 3U49A 4F71A 3CSDA 4KXXA 5B3LA 4YUYA 2B5VA 1XZPA 5KJFA 4ZVQA 5F2NA 1C2YA 3WAGA 5DHSA 4D9IA 2QI9F 4YJHA 2LUOA 3PZRA 5B1YA 2Z2JA 4GRDA 4RLSA 3VDXA 2EFJA 2GCIA 1KY5A 3SSAA 3QF4A 4LGYA 2PMEA 1GCUA 4V2IA 4JHXA 4D9MA 3DM5A 3AF3A 4D8XA 3A25A 1H2ZA 2H16A 4YMUA 3C3XA 2GM3A 3EVDA 3AIKA 2GT1A 3R0ZA 4NCJA 4TRNA 4D80A 2AUTA 3RFFA 3NNSA 5B3JA 4C88A 1JEEA 1H8HA 4FYXA 3WGHA 4G07A 1E1RA 4I9HA 2D0DA 5EHGA 1EJ6A 2DQSA 4IOMA 3E1KA 4QD3A 4I1UA 4MWBA 3CP8A 1C9MA 2OSBA 1NONA 4PGHA 5AUPB 1WL8A 2VF8A 3F8WA 2LKCA 3H16A 1UPXA 4IMPA 4WWHA 2Q2OA 2HMWA 3DCYA 2Q6TA 3ASVA 1NJ8A 3CNEA 4OI1A 1RJWA 4LDJA 3GMIA 1ZYUA 4HX5A 1V8BA 4Q66C 4QDTA 2PLRA 3E7WA 4NWIA 3GZTB 4JOSA 1X77A 1OZFA 1GVNB 4MQEB 3B38A 1KK0A 1KO4A 1T4GA 3INNA 1JU4A 2FEOA 3M81A 4NYJQ 1N77A 2OOKA 4PVCA 3A3OA 4TWAA 1SCIA 3F4KA 2O2XA 2ECOA 2ZFUA 3C3KA 3K0HA 3ZGXA 1UM8A 5J2TB 3R3VA 4RKYA 3ZC3A 3T5CA 3T5TA 2LGJA 4HN4B 5TT0A 2FVGA 4KBFA 4MW7A 1Z13A 1G5IA 5K0ZA 4HLUA 1N9GB 3HZRA 3K30A 4Z7JA 5B3JC 1KI3A 4F5YA 5LZ8A 3GI1A 4JD5A 3E5MA 4B81A 4PZUA 2WLTA 1BE1A 1FZQA 4QTUB 3D1LA 3ANTA 4PZLA 2Y0CA 3HWRA 1E3MA 1N8SA 1VBFA 4NOKA 5TV2A 4P22A 3DPUA 1GSHA 4EDFA 2AYZA 4HPJB 3K1TA 3NE5B 1UEIA 5JS7A 4BNLA 2HMTA 1QFJA 3MMZA 5HMLA 2C4VA 2HA2A 3ENWA 4C4PA 5BP7A 4UARA 1EESA 1Z5VA 3LBYA 4M9UA 4EJMA 5L45A 2Z5GA 5JMOA 2VDVE 3GV0A 2DUNA 4ZRDA 4ZOAA 3AM3A 3UHJA 1WJGA 5BRJA 5KTOA 1JW9B 4HQKA 1FVFA 3ZDEA 4D8UA 1CUAA 3DBLA 3HI4A 4IIJB 2C4NA 3T34A 3OW7A 5BR8B 5CA0A 4MO9A 4EOGA 2ZUTA 4EVIA 5B12A 2EP8A 3N86A 3DVAB 2FZGA 4ND4A 1PD0A 4J0KA 4HNRA 2V6MA 4B7UA 4JB0A 1II9A 4YALA 1JIUA 1NWCA 2PMWB 5H02A 1EFRD 1AS3A 4CUKA 1TLLA 1MB3A 4R6WA 1QF7A 4Q15A 1BMDA 5LB4A 4K87A 4CZ2A 1V6AA 2FFQA 3U4HA 4HLUC 1PG0A 2JIDA 1DMRA 4E08A 3RK1A 4ROTA 3P5SA 1I33A 3UK1A 4HEQA 1WOPA 2AG1A 2DJIA 1UDXA 2BSQA 4LJ5A 1UODA 1EVZA 2RGCA 3TIGA 4B0PA 1Q0HA 4F3KA 5F9FA 4EUFA 4B4UA 3GLVA 4CLHA 4P3NA 4MLDA 2VZ8A 3IQDB 4NYIR 1G9TA 3HXKA 3DO5A 4YMIA 4JI5B 1UMCA 3EYWA 5JI3E 1G3RA 1DBQA 3GU3A 1M90D 1FW6A 1JFLA 2WE8A 4R4JA 3FETA 1D0IA 1T36B 2HF8A 4KOEC 2IYYA 2P1RA 2DWQA 5AI9A 2WM9B 2DR2A 4DCTA 3DH0A 4WOKA 3AEUA 5SV2A 4YO7A 2ZIAA 3KZMA 2IZ7A 2J9GA 3I9V6 1KJNA 4UEQA 2FN4A 3QBVA 3RABA 1E77A 3OKCA 3QSYA 2VBFA 3AX6A 1FDIA 2X7XA 4TKMA 1VJDA 3VKHA 4X7DA 1GADO 2RJNA 1ZLXA 3ELWA 4HNGA 4PQGA 3ZI4A 4DWWA 2F48A 4Q4AA 1N2GA 4DCOA 3RGGA 4EEXA 1UEJA 4JJKA 4XCXA 4AKTA 2M2IA 4DLZA 5B6JA 4X1IA 4N7BA 3OKPA 4FSHA 3A2MA 5FI0B 3VKUA 1N05A 3PXGA 1IIBA 4BXOB 4TYWA 1BD4A 4GZMA 4UUNA 2H92A 4RDJA 1IQUA 2KBFA 3EMDA 3GGSA 3KQOA 1TD9A 4I19A 4Z0NA 5GM2A 4X9XA 3OCVA 5I7VA 3G8BA 3PENA 4DCCA 2ZRCA 1S89A 2GBFA 2RHLA 4CMBA 2VLBA 2WHXA 3HGQA 3EA4A 1ADGA 2WJWA 2VUHB 1VKOA 1A5BB 4CFSA 2VTBA 1P80A 1JDNA 2JFBA 4Q4DA 1HKHA 3GXOA 2QN9A 5L3ZA 2ONKA 1J0AA 3KKLA 4K6CA 4WFKA 2W70A 3M6WA 4Z4HA 4LGCA 1XZGA 4JQSA 1PJ4A 2DC1A 4UVEA 3RJ9A 1W85B 4EB6B 3IV7A 1RZRD 1H0KA 5IFLA 2CHGA 2GJ4A 4CLOB 1EZZA 2HCJB 3W7BA 5M29A 3MK31 3ZDAA 1YDWA 4HQNA 2FG5A 3FB1A 5ERYA 5K4AA 2F55A 1I9CA 1MEJA 1VJ1A 1NAIA 1W4ZA 2APJA 2B82A 4BEJA 4TMTA 2DSNA 3MCAA 2KYRA 4IFBA 5JW6A 2VF7A 3AHEA 3LI2A 3LWNA 4P4TA 5K45A 1MD9A 3UWPA 1VLVA 3NWBA 4NDAA 5ILOA 3OZSA 4UAVA 1OE0A 4AF8A 2CFIA 4DY4A 3T1TA 3WGJA 3R9WA 1BGVA 4PHCA 4RQTA 3FOZA 1OU4A 1LWOA 3AZPA 5FH9A 4NMLA 1JJ7A 1BW9A 5KYWB 4DSOA 4M53A 1JU3A 2JK0A 4XW2A 5H3HA 3L1IA 4C2AA 1PWHA 3HFJA 3OY2A 2JJQA 5DRYA 4DILA 4PC6A 1MJGM 5EHQA 5HS4A 4ZJYA 4TV8F 3C4VA 2PN1A 1I4EB 2WJ3A 2WU4A 2X9NA 1LD3A 2YC4C 3PR1A 4G0NA 2PX2A 1JMVA 4MJ7A 4Q03A 1ND6A 3VPAA 2I3GA 3N2LA 4BAUA 3HTXA 1JLSA 2RI6A 3TQQA 4CLRA 2WPDA 4PRLA 1HC7A 3E5RA 3L77A 1JJIA 4AY5A 2HXGA 4PXSA 1X3LA 1FS4A 1QAMA 3CJRA 4QYWA 2PO7A 1FJHA 5JD4A 4RHYA 1AD2A 5A5DA 1G4UR 2C9BA 2W58A 5F77A 2BGMA 5LLSA 3RUIA 3LQFA 2J33A 1VMEA 1BXZA 3JATA 4HNAB 2KM1A 2FE4A 3H1FA 4NOJA 5K8CA 3GLIE 3OJCA 4KUHA 2OHIA 3IHLA 4CCSA 1EP9A 4GQBA 3K9FC 3T06B 4LJLA 1XLWA 1ZRMA 3LV8A 4EMUA 4K46A 3WX0A 4XB6B 4YT4A 3F6SA 4TKVA 2ZL7A 4BLVA 1F7VA 4OXXA 4YREA 4G0UA 3HUTA 2AXEA 1A5AB 4OXKA 1GCIA 1PEYA 1SUSA 2RCYA 3BWXA 4ZK6A 1GGEA 3AEZA 3H19A 4RWZA 5EZYF 1AV6A 3VNUA 3E2IA 2WHYA 4BWGA 5JZSA 2BGWA 3RRFA 2QLTA 1N2XA 3HBLA 1CE8B 3DZCA 1FLNA 3EZ9A 2BDUA 2YQ4A 4YRQA 3BA1A 1VA5A 1GZHB 5C1DA 1QRAA 1NVFA 2NXNA 4PYIA 1JDZA 1YO6A 1P3Y1 3P9NA 3PU6A 4EQ6A 4UU8A 2NTVA 2ZR7A 1KGSA 3LQRA 4CLDA 1BROA 3GRRA