3W2FA

Crystal structure of oxidation intermediate (10 min) of nadh-cytochrome b5 reductase from pig liver
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
271
structure length
271
Chain Sequence
TPAITLENPDIKYPLRLIDKEVVNHDTRRFRFALPSPEHILGLPVGQHIYLSARIDGNLVIRPYTPVSSDDDKGFVDLVIKVYFKDTHPKFPAGGKMSQYLESMKIGDTIEFRGPNGLLVYQGKGKFAIRPDKKSSPVIKTVKSVGMIAGGTGITPMLQVIRAIMKDPDDHTVCHLLFANQTEKDILLRPELEELRNEHSARFKLWYTVDRAPEAWDYSQGFVNEEMIRDHLPPPEEEPLVLMCGPPPMIQYACLPNLERVGHPKERCFAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Elucidations of the catalytic cycle of NADH-cytochrome b5 reductase by X-ray crystallography: new insights into regulation of efficient electron transfer
pubmed doi rcsb
source organism Sus scrofa
molecule tags Oxidoreductase
molecule keywords NADH-cytochrome b5 reductase 3
total genus 76
structure length 271
sequence length 271
ec nomenclature ec 1.6.2.2: Cytochrome-b5 reductase.
pdb deposition date 2012-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
A PF00970 FAD_binding_6 Oxidoreductase FAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 3w2fA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 3w2fA02
3OW2B 2FX3A 1DG1G 1QUFA 1TLLA 2HCJB 1BJKA 1KTVA 1UMKA 4TMVA 1CNFA 1JJ2B 3CCMB 1OB5A 3CW2A 1JA0A 1VQPB 4BPRA 3B82A 2YWGA 4C0SA 1IJEA 1YJWB 2BVNA 5FA6A 4ACBA 1ZM9A 4R71A 1VQKB 1N8RD 1EP1B 2VNHA 1Q7YD 5JBQA 4YHBA 3B78A 4TMXA 3AVUA 1TVCA 3CC2B 2HMAA 2QDXA 2QTZA 1YJ9B 1VQ7B 1N0VC 1VQ4B 3W2GA 4Y9RA 1JNYA 2BGJA 4PC7A 4ZGQB 3CCUB 1QFJA 1IJFA 4DQKA 4DQLA 2DEUA 1KK0A 4RCZA 4UAJA 3OJWA 4G1VA 4ACAA 2BPOA 1H85A 1R5OA 4NCNA 1F20A 3CC7B 3VNUA 4TMTA 1D1NA 3W2HA 4FN5A 4YAWA 4ZV4A 3ZZUA 4AF7A 1ZM3A 3JQQA 1BX1A 3VO1A 4AC9A 3QSYA 4RD4A 1EFTA 4PC3A 1E64A 3QFSA 4LC0A 4M0LA 2BF4A 1GJRA 2VZLA 3P26A 2YWHA 5TY0A 1D8TA 2NPFA 1YI2B 2OTLB 4WQMA 4LBWA 4QFMA 4ZCIA 1HA3A 5DSZA 5GV7A 2DERA 4AF6A 3AGPA 4TMWA 3QFCA 4RD0A 4IW3B 1YHQB 4B44A 4P3YA 1KD1D 2DY1A 3AGQA 5THXA 5H5JA 3CXCB 3CMAB 4P6VF 1B23P 2CNDA 1FNCA 4MYUA 1EFCA 1OGIA 1S72B 3OZWA 4ZCMA 2VNJA 3U6BA 4K1XA 4FWTA 3WNDA 1Q86D 1K8AD 3OJXA 5H59A 4RJLA 4EH1A 1EXMA 1FNMA 3U2QA 1K73D 1WDTA 1G7TA 3CB4A 1S0UA 2E1RA 2C78A 1ELOA 3WNBA 4Y7CA 1QGZA 4QHYA 1NJID 1R5BA 3MHPA 3VNVA 4B43A 2OTJB 3WXMA 1YJNB 1BX0A 3ZBUA 4HE6A 4TN1A 2RC5A 4NBSA 5EMNA 4RD2A 2XNCA 1VQ5B 1QX4A 3ZBTA 2YWFA 4N3GA 2QEXB 1DDGA 1IB0A 3CCLB 4F7DA 1EFUA 1W34A 3W5HA 1TUIA 1QFZA 1QH0A 3LO8A 3W2FA 1AMOA 3ZZ0A 2RC6A 3JQRA 2PMDA 1KRHA 3FJOA 4LBYA 1FRNA 1G7SA 1M1KD 3G71B 1GAQA 3SJZA 3J81k 1N0UA 3WYAA 3WY9A 3OZUA 1OB2A 4Y9UA 4TMZA 1H42A 4G5GA 2QN6A 1KJZA 1ZM4A 1W2BB 4PC1A 3CCQB 1FNDA 2DCUA 3ES9A 2BSAA 1VQMB 4YAFA 1M90D 3P27A 1GR1A 1DDIA 1A8PA 2BM0A 1J9ZA 2OK7A 1AIPA 2B7CA 3LYUA 5GV8A 4M1KA 3CCVB 3VO2A 1TTTA 1Q82D 2X3UA 3QFTA 1B2RA 1KC8D 1XB2A 4M4SA 3CMEB 1SKQA 1CNEA 1DARA 3VMFA 5KSWB 4G1BA 4N3NA 4B47A 1G7CA 1VQ8B 1GO2A 2BMWA 5TV2A 3OZVA 3E20A 3CCRB 3U6KA 1K9MD 2BV3A 4RD3A 1VQOB 4LBZA 2DETA 3WNCA 2CRVA 1QVGB 4RD1A 3CC4B 1FRQA 2B7BA 3FPKA 3CD6B 2C77A 1EP2B 2YWEA 2EIXA 1VQ9B 1SM4A 3AVYA 4M53A 1JA1A 1I7PA 5HXBA 2EFGA 3ZC3A 2BM1A 1W35A 1QFYA 4H9GA 3W2EA 2VNKA 4ZGNB 4B3XA 3AVXA 5TR9A 2QMUA 4Q7JB 2OK8A 4B4DA 2R6HA 3WBJA 3B8HA 2GPJA 1YIJB 3AVWA 1JB9A 2QTLA 1G7RA 3JQPA 2AHOA 1NDHA 3I1FA 4YAOA 3W5VA 4MYTA 1FNBA 2XEXA 1YITB 1VQNB 3A1FA 1E62A 3CRZA 1D2EA 1E63A 1GVHA 2VNIA 2PLFA 1ZM2A 2ZITA 3CPWB 3I56B 3E1YE 3CCEB 4YAUA 1KK1A 3I55B 2BN4A 1QVFB 1R5NA 3MCAA 2QA4B 2HDNB 4U9UA 3MMPA 1QG0A 1KK3A 4FK8A 4HE5A 1U2RA 2XNJA 1EP3B 4PGOA 2PIAA 3G6EB 1ZUNB 1Q81D 4J0QA 1OGJA 1GAWA 4YALA 2D74A 3CCSB 1W87A 3QFRA 2J7KA 2VYQA 3V76A 4C43A 4B48A 1KQSB 4RD6A 3ZZTA 1CQXA 4M2LA 3W5UA 1QUEA 1VQ6B 1QGAA 2BGIA 5AN9A 2B5OA 3G4SB 1FDRA 3AVTA 4PC2A 3QE2A 3CCJB 1XE1A 4PC6A 3AVVA 1EWYA 1F60A 3WBKA 4RCYA 4LBVA 3LRXA 2GQFA 1KK2A 4ZCLA 1VQLB 3LVBA 1BQEA 3PENA 3W2IA 1QGYA
chains in the Genus database with same CATH superfamily
1VECA 2WSIA 5DLPA 5E6RA 4EFDA 1NWHA 4ARBA 1JEQB 4Z0PA 3U7JA 1MIOB 1ST2A 4D0SA 1Z47A 4IIXA 1ORVA 1Q1AA 1QF7A 3K9GA 2O1WA 2QMEA 3R3ZA 1I2BA 4HAZA 5DH9A 5JCJD 2RHOA 4WUVA 1CP3A 3BT7A 4EYEA 4G09A 2YY5A 4QBKA 4M3NA 1GPKA 3N3BC 4BU1A 3D31A 3T4XA 4LF4B 2VBGA 3GEIA 4JC5A 4ND8A 4GX1A 1A7AA 3HMKA 3Q15C 4NEGA 2K4MA 1UBEA 3KUDA 3MTBA 4K2AA 2P5TB 4RF3A 1USVA 2ZIGA 5ALDA 3FROA 4MRAA 4QM7A 2CCGA 4TMVA 4LYGA 2ORED 2QY6A 4Z54A 4RU1A 1Z2PX 3DDYA 3A11A 4BKOA 2N1BA 4BL5A 5JXJA 1E4EB 2PNFA 3L0YA 3ZDBA 4DLZA 1CVRA 1JDSA 3FGNA 2PN1A 2VXCA 2QD1A 1L4LA 4ME6A 5KNCH 3HVIA 2PZ8A 5AQ1A 3QX3A 1VQKB 2CZCA 1EP1B 2IYTA 5JWOA 4LJKA 1DAEA 1I14A 1KEWA 1M34E 1OE0A 1PNOA 1YS9A 2VF7A 3BORA 3CEMA 2ERYA 3Q72A 4R05A 4MUFA 5CR9A 5FPTA 4C04A 2AV6A 3B78A 4M22A 2W8BA 3NHYA 2CHEA 5MN5A 2DHDA 5LXTA 3D4IA 2A5DA 2G8NA 3D6TB 3IUNA 5SY4A 4D2IA 5F9FA 4UMVA 2HD4A 4D9NA 4AI6A 4UHDA 4LYAA 4KFTA 3JQGB 5A62A 1AKUA 1T0HB 1QYDA 2EEZA 3PFCA 4I4NA 4DEYA 5TIIA 4IVQA 1FBNA 3RVOA 5JJIA 2OAGA 1V5EA 2IEBA 3K8YA 3B7PA 1E2KA 4KE8A 2IHJA 3MXTA 1T2VA 4ACAA 4CHTA 2B5WA 4EUNA 2UZ4A 3T3MB 1SO8A 4NEQA 1NIPA 3KXPA 3WTBA 2GBGA 1M1ZA 3EGWA 2TYSB 2FSGA 4G86A 4EYKA 2COEA 3HCRA 5KYTA 1UD8A 2Z57A 3RC9A 5FPSA 4ZV4A 1CUAA 4XOTA 5FBKA 1ZEJA 2YYZA 4IZHA 1ZM3A 3ND9A 3VYRB 3CTMA 1VRCA 3FN4A 2WWTA 2BZ0A 2JNWA 4B31A 3QZUA 1JQKA 1UZUA 1VLOA 3ICOA 5KNBD 5A0VA 4IL5A 3SX2A 2BONA 4NYIQ 4DNOA 1U2GA 4ZKEA 5LU8A 3AJEA 4L4XA 3KSAC 1TZJA 2VDWA 4KCGA 3RSFA 3VBEA 1PRYA 2NZUG 4HUTA 1GRRA 5IF3A 1CJMA 4G5HA 4OL9A 2BFPA 1Y4ZA 3DQQA 5K5EA 1MB2A 4GQIA 3EFEA 4ZAFA 3ZS9A 2QVCA 1OXMA 1XAHA 2JLBA 4ZC8A 3RVMA 4BNJA 1MPTA 4BNVA 2RH9B 3E4DA 3N2GB 4WACA 3I0NA 1G6Q1 3AXTA 1UK9A 3GW8A 4EB3A 1ECCA 4YR9A 3DMRA 5JVDB 2IHUA 5LA6A 5CDFE 2OPBA 3PQDA 4OYLA 2R79A 1QJCA 3C97A 3EZ9A 3E8MA 5FA5A 4QUEA 3W0LB 4LJAA 3K16A 1ZM7A 4WT7A 1XAGA 3EGIA 5CDHA 4LY6A 4MKFA 1LCIA 3DO6A 2ZU0C 4P7GA 4NFYA 1N4DA 5GP1A 3OOYA 5A3QA 1OH6A 1YB5A 4O2BF 1RU3A 2CLDX 2WIAA 4HLQB 4M89A 1E2UA 4JOCA 1N92A 4S35A 1B76A 4HN9A 4ZPXA 4HGQA 3V97A 1W9HA 4BLUA 3O47A 5EJ9A 1JWLA 1OU4A 1O0SA 3I8SA 3WZLA 2VTBA 1S2MA 2O4UX 1DS6A 2QSUA 4FQ7A 4U2FA 1L5OA 1Y1QA 4PF1A 4QICA 4RKFA 2QNBA 1FQKA 3KK0A 2Z8YA 4R3UC 4BGUA 5CFRA 4URXR 2AQKA 5LMNB 4RIGA 3MIZA 5JHHB 3LZDA 3VHXB 3PIRA 4U7PB 4B32A 1JFVA 4CM4A 2IYYA 1V9LA 3P32A 3GCWA 4B46A 3CZRA 5DGXA 4E4YA 1TRHA 4HB2A 4KJZA 3KRTA 4KXQA 2ZT8A 4QNRA 4RK5A 3E22A 3C16C 3VH2A 5ITWA 1KI3A 3K9CA 1WDTA 1J2TA 1NUQA 4KXXA 4N8EA 4IIDA 2LKCA 3ET5A 1E0AA 2GD0A 4WWVA 3CB4A 4RKRA 1ZX1A 4IVPA 5DX1A 3S5UA 1RLTA 2UDPA 5JZMA 3GLGA 1T9CA 1ORDA 2ZRQA 1KKUA 3I9V1 4TKVA 4XPIB 4EFKA 4JXZA 1BRTA 4Z4UA 2F67A 3ITKA 4I55A 2PUDA 2IDJA 5DLYA 5EA2A 2ZJZA 3NH9A 4HYEA 3DT8A 4JBGA 2DUNA 1KH3A 3BHNA 1IZZA 4FHCA 3VNVA 1GP2A 2OPHA 4F91B 4B43A 1BCSA 2VP4A 4B73A 5BURA 1RI2A 2X6XA 3S2IA 2FEPA 4GDMA 3RPEA 4EG8A 5ESXA 2O1XA 4OIFA 5DGIA 2B8TA 2HA3A 5JPIA 4YRZA 2WZDA 1Q12A 5CXXA 5BV2P 3R9WA 1LSSA 1TJPB 2HK8A 4KOAA 4R41A 1UH5A 3QV2A 4F5ZA 3ZIDA 3GI1A 1XJ5A 2DFNA 2X9VA 1QYCA 3IAUA 2C7OA 4N3GA 2ETVA 3CRVA 1WY5A 3ZX5A 3I4FA 4LHSA 3SEZA 4QLBA 4COKA 3WGUA 3KZ1E 1G20E 1ND5A 4F4HA 4JI2B 2D00A 1C2YA 3FMFA 5GJCA 4B6PA 1UF9A 2LP4Y 2Q5LA 2FN8A 3CZQA 3KL4A 1TLFA 3NKFA 1NT4A 1JHZA 2Z2ZA 4HJRA 4OXNA 4BX2A 5IANA 2VCEA 4RORA 3UXEA 1SUSA 5EE5B 1UFVA 2B3TA 3T9AA 3ABRB 4DIMA 4ENSA 3OIVA 4P4SA 3B3JA 5EJIA 2DYIA 3B85A 3STVA 5AVTA 2MMCA 5LYJB 2HNAA 3TQHA 2PX8A 2MSLA 2CLMB 3G0CA 4EF6A 4DWOA 4PRLA 1ITZA 1N36B 1O9GA 1P31A 5EGNA 5JDIC 2IF2A 3LT5A 4UAUA 3SLDA 1JR2A 1P44A 3HI4A 4H6XA 1ZQ1A 1QRTA 1AHIA 2P9FA 2XTNA 2FQYA 4ERXA 2PUJA 3DBLB 2VBUA 3FAZA 3ZCQA 1P1FA 1YNOA 5LQNA 3WA7A 2F1HA 4UZSA 5K3SA 3WS7A 1Q20A 3B6JA 1FB5A 3ENVA 3PLAE 2OGWA 2OYCA 4EDFA 2H85A 4CCYA 2GO1A 4YRRA 2WTNA 2HQ1A 4UUMA 2VFAA 2BZGA 3O9MA 3DTVB 3GGCA 1NRIA 5FTLA 4RAQA 1F4VA 2GCNA 1P5JA 1ABFA 3CPSA 3SBXA 5CB8A 2BFOA 4RVGA 5BO5A 3MILA 1BYIA 1YKGA 1NB0A 4EY6A 2GS9A 4X44A 4BVAA 1JYFA 3SYNA 3T54A 1ENOA 4LDAA 3FG9A 3FSGD 2JF0A 2ZSFA 3D64A 2QGNA 1QFSA 2GAIA 1IG0A 1F48A 1B6SA 5BY2A 1O6GA 1EM8B 4UNQA 4UBMA 1IVSA 4F8JA 3P27A 4FUTA 3UGKA 4IICA 3K71B 1HDZA 2EJVA 3PGLA 4TVBA 2H3HA 2Z8XA 3FOBA 5AJTA 3S29A 5AQEA 1G63A 3E7PA 1A7UA 4ZZ0A 4CMKA 2CNLA 1L4MA 3GMIA 2OCDA 4AJLA 1F5SA 4M8NE 4OREX 1PJAA 3O21A 4PANA 1I7NA 1G2OA 2WMYA 4X92A 5CTJA 5HIKA 1W0JA 4HDNA 4G2TA 3FNHA 3GPDG 3RYHB 1GZ5A 5BQFA 4MZXA 4JC4A 1FP4B 1G8FA 2IXEA 3E2IA 4UQPA 2UXBB 1A8IA 2GCGA 4JI3B 1SHTX 1E3XA 2X3UA 1HYQA 1UBFA 2WINI 3KV1A 4REMA 5H3LA 3U5TA 5HIMA 3A26A 3D0KA 1KC8D 4H3SA 5LD2C 1P4GA 3OMWA 2C2MA 4ROTA 1ORHA 3AB7A 3GGDA 3DDCA 4Y2PA 3V8PA 3PUMA 2X1LA 4ZYYA 4O4JB 1YZLA 2GN1A 3GJ0A 3AF3A 3FYHA 3GZNA 4ZDWA 3CX6A 3IT3A 1CWUA 2NO4A 1OXKB 2ZDQA 3UMYA 5HQ3A 1PR0A 3GJ5A 3X1JA 3WMFA 4PQYA 1WPGA 4OP2A 3OZVA 4J3JA 2VP0A 5A7GA 1K06A 4B3GA 2BWJA 1K5HA 1Z5NA 3GVHA 2FG5A 5AHRA 4U6NA 1SD2A 1Z25A 2VSOA 4LF8B 3EXFB 3HJHA 3USES 2I9KA 1IAVA 3IPLA 5DEOA 3W06A 2H5LA 2DETA 3KSRA 1GDHA 1S8FA 1GM5A 3RSGA 2WUGA 1MABA 1JHUA 3DM5A 2R3SA 2BKXA 3DP9A 5KSYA 4TQUS 3Q5EA 5HJ7A 4DUYB 1QVGB 3HJTA 2EFJA 1R3UA 3H2KA 3SICE 3LHFA 1KZLA 4OAOA 2O3SA 4CODB 1MF7A 3RC1A 3UKDA 2GWRA 2R7MA 3SU8A 4EG5A 1L3IA 4KGDA 1RBQA 2DWQA 2X3FA 1P0CA 1Q7TA 2QZ4A 3PEFA 2J6BA 1AKMA 3D5TA 3SXPA 4C22A 1AGRA 3I5YA 3GP3A 3KCQA 4M1MA 5AIBA 4JU8A 4XYLA 1UWLA 3A4TA 2FPWA 4AO7A 5HBRA 5AM4A 5TEVA 4NBRA 3C7CB 4BV3A 4M53A 4MQ5A 3UJ3X 3KQMA 8GPBA 2A94A 1C1XA 1ZOLA 2RMKA 4IO1A 1KEZA 2JFXA 2C2XA 1IHMA 2BM1A 1QO9A 2RH4A 3GPLA 4YYZA 2C99A 2HIAA 3W2EA 3IUMA 3WQHA 4C0KA 5LMUB 1U7XA 4E2ZA 4LI3X 2NV0A 1CRZA 2VNKA 1AQLA 2WUDA 1M0EA 3AVXA 3R5JA 1ECLA 1TW3A 1YDEA 2ASVA 4XW2A 3G9ZA 4EUKA 4Q7JB 3D81A 1CIVA 4IDNA 1MB4A 4JHLA 1MCZA 3B2QA 5HMLA 4LV6A 4ESOA 5KINB 2WICA 1RQPA 3C3EA 3ZBPA 4EB6B 4LZLA 4TTSA 1QHGA 3UCFA 2A5LA 3DGFC 3E3NA 1PSWA 3ND6A 3TTYA 5I8WA 1NDHA 2Z9BA 1JXAA 4TL9A 4BTVA 1V41E 4LX8A 2A4MA 5ES4B 3ZN2A 1H8HA 2ADMA 4ZQHA 4RS3A 4DTIA 4KQHA 3AIMA 4F4FA 2IOQA 4GIBA 2RHWA 3V4SA 5E3HA 4C0LA 4XR4A 4HDRB 3AYZB 1Y1RA 4JBIA 1EFVA 5NULA 2WVHA 3V4OA 2FJUA 2ZL6A 2RE8A 3B3FA 4C2BA 5JNVA 1A9PA 4X07A 1J2JA 3GV0A 4I4TB 3DYVA 2YWXA 3CPWB 3W3AD 3HTXA 1HT2E 5CHYA 4C2UA 1N2SA 2UUAB 4ZGWA 1E94E 1VI6A 1XEAA 4OFXA 4ZREA 3KB6A 5LB4A 3H04A 1KDYA 3VU0A 4MTLA 5CTAA 3RAEC 3MWDA 4H7IA 4C05A 2B8JA 3Q8MA 1TJ3A 5J5VA 1R0CA 3MQ2A 3LUJA 5DGHA 1ZXBA 5BVGA 4KPFC 3CTAA 2RHLA 3A6GA 3QKSB 5KJCA 4KAAA 1YDGA 2E18A 3HN6A 3QTLA 4TXHA 5F2NA 2WBLC 1S1MA 4PHTA 3LSTA 3V8VA 1LBHA 4C5AA 3KG2A 2XBLA 3KFLA 3G5TA 3SDZA 2R6GA 2GEFA 3STWA 1B26A 2DR0A 2ZB7A 3UXMA 2MJLA 2X8AA 4D6PA 4D9IA 1KK3A 3LBNA 1E1CA 4R1NA 3JWGA 1CB0A 2PIDA 5MFPA 3Q6QA 3T52A 2QAJA 2EX1A 3PC8C 4QREA 3LFTA 3FCAA 4K9PA 1O77A 4KZKA 3S70A 5CA0B 1WKBA 4QAJA 2IP1A 1LSOA 2XUQA 2PQ2A 1IM8A 4F6LA 4NS1A 2HBYA 3TW0A 4IXTA 3E6AA 4WK6A 1SOVA 1U90A 5ITVA 3FHTA 3PUKA 4MGIR 2Z5LA 1C8LA 5KYWB 4BNMA 4ZANA 1Y4SA 4ZDJA 2WILA 5EPUA 3WLFA 3ZU4A 4YALA 2RHGB 3BXXA 4DY6A 5EHGA 1BXKA 2IUTA 5B36A 2C0PA 4A9AA 4XB6B 4L5CA 2IS2A 2VVTA 1RWQA 3JD4A 5GONF 5TB5A 3FTFA 4H4EA 5G4KA 2NZWA 1M9NA 3H4TA 3QNUA 1T26A 1OT5A 3I0ZA 1IHPA 2QVBA 4GKBA 1IN7A 1JHAA 2B8NA 2JGIA 3IDQA 2DP4E 3KUUA 1PS8A 3TD6A 5C8XA 2O8CA 2AOTB 1NMSA 2GFIA 2ODNA 2Q3JA 2FSHA 2PZAA 1NURA 1XTSA 3ONDA 4FYYA 4P25A 2JBAB 5GJWC 4BO0A 3W5UA 3KYIB 2PQ0A 3LW7A 3CVOA 4WOKA 4QTZA 5AVWA 4AG6A 1VQ6B 4CKZA 1GN8A 2XA2A 3SMQA 4BWVA 4MQ4A 3DWGA 5DV9A 1EAYA 4FJ1A 4MYDA 3H2SA 4F3CA 1CZNA 1JEJA 4RLZA 1EVLA 1H23A 1RTTA 1U2TA 2BTOA 5IAAA 1JKXA 2IYZA 3FWZA 2X8JA 4F9TA 3D5EA 1XAIA 4YJFA 1NXSA 1OXSC 4UHCA 3PKIA 1SBYA 5CW1A 1JRLA 3LUAA 1JKFA 2DWPA 5H02A 5CCDA 3QE2A 1P91A 4U7GA 2GM3A 4DLKA 4XWWA 2BFEA 1P18A 2PANA 2V54A 1BG6A 4ZOLA 3V7NA 1MOPA 4TMFA 4YUXA 1MB3A 4GYYA 3SLGA 1PGNA 4YMUA 3OESA 1YI8A 4K05A 4ZCLA 4UATA 4IQ0A 3UHOA 3OTOB 3EGOA 1X7GA 2MSWA 3ESBA 2Z1MA 1KJYA 3HXLA 1XAJA 4JJZA 4EQZA 5HXAA 3OTQA 3EXEB 3QE0A 3ZY2A 2DPGA 3QXGA 5GPBA 5FBVB 2VHUA 1TYCA 3GRKA 2IYRA 2Q3CA 5DKFA 1VE9A 4O6VA 2C4KA 2CBGA 3S1AA 4NNPA 1IM5A 1E5TA 1DG1G 4KRGA 4MO2A 4N5IX 2YJ6A 1E4OA 3PXGA 4FC7A 7REQA 4QVIA 1W2WB 1ZWKA 3O2SB 3RUHA 1NVEA 4A6DA 4BNIA 1PBTA 5C37A 5L3SA 1YSCA 3COVA 4LE1A 4MROA 2K7FA 4FDAA 1Q15A 4PPNA 1JR3E 1DT3A 1MAWA 2D3LA 5B4TA 5KNCA 3EGEA 3NHMA 1QS0B 4OPMA 1A96A 3V1LA 2GILA 3TRIA 3DPSA 1OB5A 4BNYA 5M3BA 3HO6A 4OTZA 4JCOA 2ZRLA 4A8JB 3KTAB 4DSOA 5KYNA 1R15A 3SBEA 4BZPA 1Y3DE 3N2KB 1G3RA 4NARA 3EDYA 4UVHA 3T7IA 5FTWA 3K05A 1R9GA 3NTVA 3WDKA 1HEIA 3DBLA 2PAFA 5ALEA 2ZPUA 1E6LA 4YLEA 5H80A 1G5RA 2V55B 3LWZA 2QTFA 5HZMA 4N01A 1XU7A 4YMTA 1TVCA 2JAOA 1FP4A 2DPYA 2F1IA 3GNQA 5CVCA 4D3DA 4DDVA 1L6IA 1H2ZA 1L7RA 4H7DA 3RRMA 4X1YB 2CWWA 4XPZA 3ZDYB 1VQ4B 4HH1A 4AZ3A 5JV5A 3CLRC 1IRIA 1A7JA 4RPCA 5J3JA 2Q6KA 3FPGA 5B1HA 1I10A 1E1RA 1SBTA 3QKRA 5IKEA 1XMJA 2YDYA 1A5BB 3OU6A 3FUUA 1JG6A 2OXRA 1GZUA 3EGXB 4MCJA 1L9XA 3SC2A 3BDIA 1NBMA 3K0CA 3V32A 4AJ4A 4MOWA 3QW4B 3BXHA 4V0NA 4WA7A 4C3VA 4CIDA 3DDOA 4JR0A 1J7JA 2GZSA 3PF8A 1BMQA 3LKBA 1CSEE 4F12A 3UK1A 1NQVA 2V7GA 3E7DA 4JUBA 4JI6B 1C9EA 1HL3A 2REBA 4L51A 1PHPA 4AJEA 3NT2A 4DCVA 3WTCA 1AZWA 3DZFA 1Y6GA 2X40A 3II6X 4O02B 3HLYA 5LOVB 4AF7A 1T6XA 2GN4A 4MKGA 2AOVA 1AC5A 1FVXA 1U4NA 2C8LA 4FI3C 3Q3AA 1RQGA 4G97A 4LAFA 2YV1A 2P68A 4HNGA 2F1JA 3L0CA 5HKOA 5ED4A 3ZWBA 5JNSA 1OLXB 1YQDA 1K7CA 2B4AA 2PHZA 2LCQA 4ZQCB 2TRSB 1Z13A 4TTQA 3B6MA 3AR8A 3F5QA 3OC6A 3ADCA 1UMCA 2V6FA 1DX4A 1EHCA 3MCVA 5ELLA 4A73A 4LC0A 4Q3LA 2AXEA 4OUDB 4DTCA 4Z3OA 1QVAA 4QNMA 2Q41A 4A8HA 2YWHA 3TINA 3K5WA 4PCUA 1SCKA 3DAHA 2H31A 4RXTA 3CRNA 2ZSJA 4HEJA 3TLYA 4D97A 3HGTA 5JASA 1YIDA 3BSWA 5K6AC 4PWYA 4TKMA 5C8YB 2I3BA 1P1HA 1E6CA 2R1TA 1OZGA 1KDRA 3OJ0A 4U3JA 3EEYA 4UPVA 4G8BA 5CB4A 2Z3WA 1P33A 2C03A 1MXHA 4K0RA 2O8FA 5UKDA 3GARA 3KJGA 3IUJA 2FEAA 3L1UA 4CVNA 4BAZA 4UTOA 1M8FA 2JGNA 4ZP1A 2ZZEA 4IW3B 3DV0A 2OXTA 3THYB 5FI1B 1Z18A 4RZHA 1IBLB 1E5QA 2DY1A 1L4HA 4W4TA 1H5UA 4OOFA 2V7QA 4OLAA 1SU7A 1AQ6A 1KQ3A 4LY9A 4CMCA 1YBMA 2XRYA 1GG2A 4QUIA 1P2TA 1Z6YA 3CM0A 5DU2A 2A8YA 4RADA 5LR6A 2COKA 3QXJA 3FDZB 1HV8A 3K5HA 5FBQB 1SPXA 1ZYUA 2NPIA 3C3DA 3UZUA 1BO6A 1H1DA 3PDCA 4ZCMA 1NJ8A 2ICAA 4L02A 3WQBA 3QU4A 3V8BA 3CWQA 1QYIA 4TX1A 3ZHSA 5A9SA 4BUJA 1IZYA 2CF5A 2GDZA 2CJFA 3A1CA 3DWEX 1Q6YA 3FE2A 4FD3A 4IYRA 4F3NA 2CNNA 5JCZA 2QY9A 2NO0A 4PFQA 5AVUA 2JEYA 4HPXB 3VZRA 4V38A 1U3CA 4KPUB 3VR3D 3A14A 1ZCAA 3I5XA 2QTBA 3QMPA 1N1MA 4R8RA 1UD3A 3ZHVA 2GNOA 4CKYA 1KYYA 2PZFA 4MJXA 5KOIA 3W1WA 5LQAA 3ICQB 4ARZA 2QS9A 3V1TC 2NTJA 1NUUA 4EFMA 5EZYF 3HR7A 1PHRA 1OAOA 1X2EA 1ZWLA 2RHMA 4P7BA 4PYQA 3WK7A 4EPRA 5IFKA 3DCIA 1N08A 5IKMA 2IFTA 4J9VA 3HMQA 3RV4A 1QK5A 4YJ3A 3TWOA 1OI3A 4GVXA 4FFLA 5HKLA 3EUAA 1GU1A 4QIHA 1GU0A 2P6OA 4HI0E 3PHCA 4JDPA 4GBJA 4XUGB 4AAYA 5KIAA 1M2HA 1WCWA 3AIIA 4XUCA 1CUXA 1DQYA 1WW3A 2I6XA 3FZGA 4YS6A 2BI4A 2FPUA 5EJ7A 1FFYA 1ZNYA 3H1TA 1YJ8A 2B0JA 1J5XA 1IB0A 4C01A 1JAXA 1RLOA 1IPEA 3R6WA 3IEUA 4IGFA 3HH8A 1K7SN 1P5HA 1T3LA 1UZLA 3SSOA 4LOHA 4XX0A 1MGPA 2YS6A 4I1SA 2HJGA 4MQLA 2HFKA 4A2CA 3R9IA 1NLYA 2I2AA 4N7BA 4OJNA 4RHUA 4X7BA 1LQ2A 1QH0A 1W581 1C9KA 5JHGB 4YJ2F 2DC1A 3QUAA 1PJBA 2AR7A 1KZ6A 1WP9A 2FW0A 4JQOA 2I4RA 4FZJA 5BP7A 2R6ZA 1QRUA 5A89A 1ZS9A 2JIZA 5DM0A 1N07A 4GR5A 3DTNA 3JU4A 4K3VA 4JGBA 3CBGA 1OFHA 1SUCA 4ER7A 5T8KC 3GCGA 5JNUA 1CR2A 2PCJA 1KJNA 4CMGA 3DKPA 4KLZA 2W8BB 2DSTA 3G71B 3LUPA 3O8QB 2M6KA 3DXFA 4RS4A 4EHFA 4EAQA 4X71A 1XFOA 4P3IA 2NADA 3WRYA 3KEGA 3G2QA 3H5IA 1GL9B 1OR8A 4TL7A 1NDQA 4IHJF 2VYFA 1PLJA 3H3XA 3HDJA 3RJ9A 5EHNA 4DBZA 1C9YA 1O9HA 1XQ9A 2DMRA 5IC4A 3SQNA 4WBNF 3A06A 1XUOA 2C2HA 4M37A 3ETGA 2NZ8A 3TL6A 1T2UA 3G6KA 2FHSA 3DE7X 1KJZA 3RFUA 2W43A 1T6ZA 4AO6A 1IOZA 2JANA 1B0PA 2YNMD 3ROTA 2ENWA 2BEVB 3CPHA 3A58B 3U3JA 3WSWA 5AW9A 3VHQA 3HU1A 5FR2A 4CKWA 2YRWA 1E2DA 4R9UC 4R9VA 4C0AC 2FF7A 2JFVA 1KXJA 1EVKA 1N9ZA 3KKZA 4MV0A 4YJDA 2AZ4A 1NC3A 3J81A 3NORA 5E8JA 3TIFA 4X7EA 4JD5A 1H2AS 1BXGB 2V8OA 3OP1A 1W1WA 4WLUA 3U3MA 3WV5A 2QL7A 1KETA 1M0WA 1XG5A 1ZP6A 3BE6A 3LF1A 2A14A 4ILEA 3RWBA 1O7JA 1O97C 1LX6A 2SBTA 4PU0A 4YRKA 3CRRA 4IJ6A 1M6VB 3AFGA 1UEJA 2E1BA 1TJ5A 2XGJA 1SIBE 1UPCA 3HFJA 1VLVA 3VR4A 4DJDC 3VAAA 1BS9A 1II0A 3L8YA 1JZTA 4BJ5A 3LTEA 2QX7A 4WOBA 2JIRA 4M60A 1EBUA 2LZ0A 2BHTA 5DSXA 3FZEA 1N6OA 1LV8A 4HB3A 3CP2A 3PXBA 4LKRA 1B2RA 2FMKA 5C31A 3AEUB 5SY9A 3UMSA 1YL7A 5KYXA 1UPTA 2LIVA 2BHRA 5GIPE 1YD7A 4OXKA 4TWAA 3SS9X 2F43A 2OOSA 3GFPA 2F2TA 3ND7A 2G4LA 4LVCA 3OCUA 4GKVA 4KKXB 3K9LA 1SH7A 2PWAA 3AU8A 3PFHA 4MUKA 4QT4A 4FCWA 5ICGA 2VA8A 5BN5B 4MSUA 3OUUA 5JJKA 2ZJ8A 4KXUA 4NDAA 2Q3MA 3GR6A 5DGTA 2GEJA 3INYA 1GZVA 1FX0A 3C2QA 3TKAA 3VR5D 3ADDA 2VJYA 4EKYA 4ZOAA 3RTDA 1O97D 4CJXA 3GVLA 5AXAA 4NE9A 3M6LA 3ZWMA 4JI1B 1H3FA 5EWMA 3HE3A 2YH2A 3WJAA 4G0PA 3WNCA 1GD1O 3L82B 4WVLA 2FUEA 1VC2A 3FRHA 4OGKA 3EDRA 4XSGA 1II9A 5TMBA 2ZU6A 2V0GA 2C29D 4KL8S 5IK2A 3CRQA 2WZBA 1IMOA 4WEOA 3HB7A 1RZ3A 3TMKA 3UMBA 3KEWA 5AWFC 3CC4B 3COWA 3NC4A 3QOXA 3HKCA 2ZZMA 2FP3A 1N2CE 3STHA 1XX6A 4OAPA 1R50A 2YXBA 2YFYA 5LKRA 5T67A 2MIIA 1Y7IA 5GADl 4MDFA 4UFOA 1GKYA 1PT9A 4DM7A 3BMQA 3N2KA 2HUPA 1FDTA 5IDYA 2C82A 4WZAA 3TSOA 3VSEA 5L4NA 1XPRA 3N3AC 1U0OC 3NHZA 4M0UA 4RDHA 5B1YA 3AINA 1WF6A 1EUYA 4Z51A 5JTUA 3KSBC 1C7QA 4FT2A 1SM4A 1H65A 2LPMA 4UBIA 4K03A 3ANMA 1ISPA 3IAM6 2ORVA 1TVKA 3AVPA 3ZWAA 2GXAA 4OIMA 1I33A 2FOIA 3DXYA 5HS4A 3NASA 4C29A 1HTBA 3G3EA 4OLHA 1XRJA 2Q0SA 3A32A 1XDSA 2SKCA 1U9ZA 3HCCA 4MV6A 5CVVA 5CVTA 1HLGA 3B1WA 4Y2QA 3QWAA 1NQUA 1XTUA 1ZJJA 4W1QA 2AW5A 1NW6A 2A33A 4QO8A 1GT91 2RIPA 1NV9A 4HUQB 5AJYA 2NT4A 5D86A 3BGIA 3ZGVA 3RROA 2VPXA 5C7OO 1JFFB 1LZKA 3MBIA 1QK3A 3BM5A 3M83A 4XLAA 1ZK3A 3N59A 1NGSA 2BMJA 2EZ9A 2O05A 4J76A 2Y3IA 3IP3A 2OA0A 3REOA 4LOJA 1ZVVA 2PXCA 5FOUA 1C4XA 2KQUA 4OEHA 4Q4AA 3R7DA 2PKEA 3WISA 4TWIA 3OSUA 3CUUA 1F8XA 2GEBA 3BKWA 1R4MA 1T6NA 4DA0A 2GAFA 4NWIA 2NP7A 1NBME 5K45A 5LLSA 1GDTA 1GGKA 5IU6A 1N2CB 2CYAA 3FFWA 4KXMA 4R0VA 1JH8A 1YAJA 1T5TA 4J0JA 2CKDA 1D2EA 2FUCA 1WAMA 4QG3A 4PABA 1LPPA 2W22A 3EZGA 3PDWA 4P4SB 4DMKA 5K6AA 2H6EA 1WXHA 5LOVA 4P7KA 4QYXA 4JGIA 1MFPA 1S96A 1Z6XA 1KR5A 2Q49A 2WT9A 4BNHA 3M2TA 1MO2A 3GJ4A 4AKSA 5B3KA 2QRLA 4HQLA 4HSEA 2JGFA 4ZOEA 1L4BA 1VLJA 4HAXA 4Z7QB 2RHHA 4IDGA 3R23A 3A1TA 3ILSA 4JJ6A 2D8MA 1E6WA 4J0CA 5E2BA 1VKRA 3L7DA 1EGQA 2NACA 5U9CA 1PK7A 3O2NA 3UHFA 1N5KA 4FDTA 3CC8A 4LZZA 3BG5A 2HYDA 2L69A 5ALLA 1DADA 4N76A 4GNRA 2ZFUA 1K7YA 3GNLA 3O4IA 4B09A 5BSFA 5IN4A 3AUKA 2DB3A 4LJ4A 3TL3A 4C4SA 5F3RA 4I08A 2C4MA 5G3ZA 3QPUA 1KFBB 4X6YA 2BOVA 5F5XA 3RE1A 4JL8A 1JKMA 2IUYA 3NS7A 4B74A 4CM1A 4CTNA 2ODEA 2XNJA 1HO3A 1I9GA 4IS2A 1PFKA 1Q0TA 1NVGA 1AA9A 1HETA 1SOMA 3GEMA 3IDZA 4HFMA 2Z6QA 2F9FA 2X8KA 3V80A 4QDTA 2ST1A 1I30A 2XQKA 2QT1A 1TQ2A 2HIGA 1F2TA 4K9DA 3I34X 1MAAA 3OZFA 5CU7A 1PLLA 1U0LA 2WJZB 4LGYA 2NNLD 5DBEX 3O73A 4FE7A 1OLUB 3JYOA 3AFOA 5HKKD 3RRYA 3NBUA 4J0GA 2B1JA 2XB6A 4LRQA 4M6WA 1POWA 1ZR4A 4CV0A 3QXSA 1PZFA 4HG2A 2NVUB 4XL9A 1VJRA 4OM8A 3W8EA 4EGAA 3OZBA 5BW4A 1KQSB 1PNTA 1KVQA 1UPUA 2HOQA 1KO8A 1XFDA 5K3AA 3VPCA 2IPOA 5CXSA 2HT1A 3FWHA 3ASQA 3DFKA 3QXHA 3C74A 4BKRA 3ZCRA 3FUTA 5DW3A 1ABEA 1D04A 1MR3F 1OREA 1BH6A 3LSYA 2XMSA 2A0XA 3DHWC 1OTHA 3PXEA 3ZLBA 2EGUA 1WE2A 3VR4D 3O8LA 3WMEA 1Y7TA 2P2DA 3AMVA 4G25A 4HK4A 4XGIA 3EEBA 10MHA 4RQBA 4YN3A 5KJ1A 5LYJF 3EFBA 3UA3A 4GKJB 2I6FA 4CDRA 5DX8A 5FWYA 1CLEA 2CDNA 3WNVA 3IKTA 3NZEA 4AJJA 1F0YA 1B0AA 6Q21A 1CPYA 221PA 4RJIA 3QYPA 2W98A 3AUYA 4KGVA 4MKHA 4H7FA 2Z6UA 2GQFA 1NHGA 1R64A 1F3LA 1OAOC 1VPVA 4AZ3B 5E7QA 4ZK6A 1WBDA 1VQLB 3WQZA 3PCTA 1E3DA 3SM9A 3LVBA 3KETA 4QXOA 4O0LA 2A9OA 5CIQA 3LY9A 2VHEA 1IEQA 3U44B 2XADA 1X7XA 2WIKA 4I9UA 3LHIA 2OFXA 4AX4A 1WBJB 6LDHA 2P5YA 1QGYA 2ODQA 5BSRA 1E2BA 3VAZA 5F64A 5H70A 4WH0A 4DDTA 2G6TA 1DAFA 2HR1A 2C8KA 2IQIA 2HHJA 1P17A 2VXOA 1J5PA 2GETA 2D1YA 3GFTA 3IXLA 1TUBA 2P3OA 4YQEA 4D9JA 3V8RA 1J20A 2WQ7A 4WJKB 2AG5A 1NMEA 3M5CA 3QA3E 4DCPA 3FWNA 3AHGA 3FIJA 3SIXA 1JYSA 1U0RA 1UDBA 3TLEA 1DU4A 3OZDA 4YT8A 4O3FA 3VSCA 3S2SA 3CCMB 4EPVA 4MDEA 3WGLA 4ZU6X 3EW7A 1UIMA 3OIWA 3JU3A 1TCVA 4M99A 3PX2A 1Q1ZA 3I0MA 1OBFO 1CP2A 2WWWA 4GUAA 5CLJA 1TAUA 1CR1A 5LU9A 1EKXA 2JI4A 1DJMA 4KUGA 4E6EA 2X6QA 4IM7A 3GUHA 3HQ4O 4FNMA 4WXMA 1F2VA 4RTPA 1WKCA 4EHDA 2TMYA 2EF1A 1HG0A 5AXCA 4DUPA 1YB6A 3GC6A 4C6TB 4EMBA 4JLOA 1JDZA 2MT9A 3LECA 4L95C 4Q21A 1EWQA 1I2DA 5IT4A 4RESA 1IIRA 2CBXA 2XNDD 4FOLA 1S2NA 2YIMA 3N0RA 3F78A 3CLKA 2QLMA 2ZE6A 1MKYA 1JLLB 1JNYA 1QFJA 1RBZA 1E1KA 2OBFA 3KXLA 4IZOA 5JSUA 5KTMA 3RUEA 2Z1NA 4HDRA 2HMUA 3ZE2B 1KHHA 5CFOA 4RCZA 3AWDA 4D9MA 3KOMA 4IG9A 1JPNA 2ZIUB 4KKUA 4UTRA 3WYEA 3LOPA 1QNFA 1YQUA 4YUVA 1BS2A 3TTTA 1Z63A 2UXCB 2GTHA 4DGQA 1DO8A 3H13A 3FB4A 1UOPA 4IOJA 5AKJA 5ITZB 4MK4A 2QR5A 3T7CA 2FSFA 1LDYA 4DLWA 4FN4A 5KDOA 3A4VA 4NLLA 1J2YA 3H19A 2M6SA 1P0MA 1RD4A 4Y7DA 2X4LA 4QM6A 1FUUA 3LT0A 1II8B 1D7AA 3JVUA 2GRJA 4JN6B 2VSQA 2QTCA 2Q50A 2W2KA 4QGAA 2Q21A 4OY3A 4AY2A 1H2BA 2BAGA 3TZBA 4HATA 1BWSA 4N6GA 1ISJA 1ESCA 5DIZA 5L3RA 3KFVA 4PC3A 1RAAA 2ON6A 4DMLA 1B73A 3C8HA 1E1QA 3IIIA 2BGTA 1UBLS 1JN0A 4PFJA 4WJZA 3VR5H 1UBUS 1J24A 3BXOA 2GBPA 4EG0A 1JLRA 3BL8A 2QG6A 2BW0A 2O3QA 4Y9DA 5E4TA 2BEJA 3WL3A 4RTNA 5ER6A 1RACA 1RJ9B 3SYLA 2G09A 2Q5JA 1ZC4A 5TQ2A 3UMGA 3NATA 3W6ZA 4FMBB 3LUGA 3TNDA 3WQRA 3IA7A 4DLXA 5HQ3B 1YMUA 5GV7A 2P0EA 3VPAA 1JSXA 4ETWA 2SHKA 3NT4A 1X8KA 1FVOA 1RYDA 2BZSA 3K35A 4W7IA 2HTEA 1GPH1 1O89A 4N8DA 1UEXC 2P2SA 1IAQA 2OSVA 2EBUA 3L1HA 4H27A 1A8QA 1NXWA 1VXOA 1XN1A 3B6ZA 3FNFA 3K6JA 5DYIA 4BO4A 2C7BA 3EVCA 4JT4A 1X38A 5B6IA 4OB6A 2ZETA 3UXHA 4JIMA 3HKCB 4OLFA 2XT6A 5I8PA 3D8RA 3ZKAA 5K7SA 3BXFA 2QL9A 1U7ZA 2K5UA 3D6JA 4P31A 5BWMA 3HV0A 4K86A 3RC3A 4UM9D 4Z9AA 5ITZA 4MYUA 4X84A 2H4WA 2BKVA 4W5NA 4ND4A 3BCDA 1E3SA 1XU4A 2HMSA 3IJPA 5SZKB 3BE5A 2FF5A 3QW2A 4NYJR 2YXPX 3O8OA 1VBKA 5F1PA 4LNHA 2BCEA 3MYYA 4ASUD 1P80A 4BO6A 2VHXA 5HHTA 4J6FA 5EKSA 3UV3A 4B2LA 2RIRA 3LOQA 4BNZA 5IZCA 3L6BA 3SX0A 2MSCB 2VEOA 3DV2A 3C3KA 4I1IA 3VISA 4BFVA 5AHWA 2WOOA 4F2PA 1OLSB 2Z4TA 1R2QA 3QLJA 4JLJA 3ESYA 2BBWA 2AYYA 2IV2X 3SKXA 5BUCA 4ZEWA 1RAIA 3U7GA 1ELOA 2A5GA 1WIWA 3FUXA 4IPTA 4Y9TA 2CN1A 2HXGA 4XRGA 1X7YA 4QG7A 2J4CA 3OFSA 3S27A 4KDEA 5EINA 5KNDH 1S2GA 1RIFA 3PQ7A 1WW2A 2M6LA 1EZ4A 3ELBA 4AB1A 5BNZA 3ROEA 3WXMA 1DTWB 1OV4A 2ZAYA 3HA2A 3VPBA 1N4AA 3O1LA 1QORA 3B70A 3BF7A 3T56B 2J3IA 3VDQA 2D7DA 3EC2A 1RC8A 3L02A 3F6BX 1L7PA 2QGFA 2VUIB 3COPA 3V6LA 4KXWA 2SICE 4K3UA 4I81A 4X8OA 4QOSA 2QEXB 1E6MA 1BCSB 2FFAA 1A1VA 3OM1A 4DY4A 1AE1A 1FDVA 3OLCX 2I66A 5C8YF 4AMYA 2PKWA 4ETIA 1I7DA 4GX5A 1OTYA 1AXRA 1XTJA 3AX6A 5FH9A 2LR0A 4FDVA 3BTUA 3NP9A 3OQJA 4YROA 4ER5A 3M9LA 3PS9A 4CQJA 5JAUA 5CVJA 4F9GA 1C30B 4N6OA 1ZH4A 3H11B 1TKRA 4M0KA 3KOXA 4IUYA 1T8SA 2VUUA 1SCBA 4JXKA 1X7HA 5JJBA 3HA5A 2UVDA 3DOHA 1TEHA 1W4RA 5F21A 4G07A 1D4ZA 1BDJA 1H9BA 5E1DA 2RGDA 3VJMA 1JMKC 1E66A 3BQMB 2ZTLA 3WGIA 4DLNA 5DM70 2E3JA 3NPMA 1PL6A 1MZVA 2JGEA 3H3JA 1MVLA 2Q4BA 1N0UA 5FOSA 1KEUA 3QELA 2WU0A 4WKGA 2C5AA 3AI2A 721PA 3FETA 3WY9A 1OB2A 1ZKMA 3DFFA 3F5SA 2CB9A 3LL7A 4FTWA 3RK1A 5B2FA 3ER8A 1T9ZA 3G9QA 4GYJA 3LQQA 2WIBA 2JFWA 3U4CA 3NBMA 2GHIA 5C3MA 2ZM6B 1L7XA 5J2UA 1E6EA 3GHHA 4NCJA 2XUJA 4LZNA 1YZ3A 3JXEA 1SR8A 3BEDA 2P6UA 3N2ZB 1DMRA 5EPEA 4PC1A 1T9KA 3SSNA 1Y6FA 2VQDA 1FNDA 5GJVC 3RYCB 1EI9A 3PC2A 4Z49A 3ACDA 4N0DA 3M4NA 3EULA 4I8DA 2ZCVA 1BH2A 3AM3A 3FWKA 4I6EA 3T7EA 4OFZA 3ZW9A 2C57A 2K6GA 3KPUA 3OURA 5FTKA 5LQJA 3BE8A 4ZI3A 1IY2A 1UBCA 4M1OA 5PGMA 5T4FA 5K8UA 1YQGA 4EDHA 1QKJA 4CMIA 5EMLA 4FE3A 3HUTA 4MRRA 1BJRE 5FFMA 4CG3A 3HJUA 3Q1KA 2CKMA 1L4EA 3OLVA 1PTJA 2DIEA 1KYQA 5GV8A 1ZH8A 2Q5CA 1D6NA 3EWAA 3TEFA 1OH5A 1ESDA 2C59A 1J0AA 2LXNA 3FPHA 4M38A 2D0DA 3CUWA 2XXAA 1ISIA 1NN1A 1KIMA 1P8JA 1YZYA 3DF9A 3PFBA 2I6UA 4TT3D 5BN3B 2QLBA 1P4RA 2RARA 1I24A 3WL6A 4X1IA 2DKOA 2I65A 1K4MA 3SIRA 1WDWB 3U48A 2AJTA 4PZUA 1QR2A 2Q3DA 2QI9F 4BKUA 4DIBA 4BY9E 4LY3A 4I1PA 1HKUA 2FR0A 3OUTA 5I7UA 3DW1X 3L7BA 5LYYA 1C8BA 1NMZA 1R4NA 2WG1A 3C3AA 4HQKA 2R96A 3BCFA 2LW7A 4U7JA 5JSHA 4JXXA 5FJIA 4LG1A 4PTLA 3T5DA 3BFXA 3A70A 5AJHA 1G8KA 2P1DA 4ZAGA 3ILVA 3USZA 4MR8B 1ZI9A 1B41A 3RQIA 3D4BA 2OCIA 1ZIYA 1JQLB 5IAJA 4MVWA 2O2EA 3NHKA 4EO9A 3UUEA 1AKRA 2GLTA 1BHJA 2XMCA 3CVUA 2Y0DA 3LPMA 4HYTA 4GBMA 1G3IA 4NPAA 3H9UA 3QU9A 1T5SA 1TVEA 3OKPA 4GRIA 1NJ6A 4X00A 3A31A 3AUUA 3D26A 1NQWA 1P9NA 3FDZA 4FEAA 4TVOA 4CM7A 1UFRA 3U7HB 2AKAB 2I0FA 1IN4A 4BZXA 1B6TA 2GJ9A 3IR7A 4JQYA 1E7QA 3LG2A 4NE2A 3K70C 4CLRA 3L06A 3CONA 1TZKA 2BHLA 1GNPA 2HLDD 2Q3BA 5A88A 2R60A 1LBTA 4X8IA 1Y42X 2FXVA 3NGLA 4I9NA 4Q05A 3P9CA 4G01B 1WEHA 3TNYA 1MJ5A 1TZMA 1FEZA 2P91A 2WWHA 3AWIA 2OG2A 3O4HA 3TG8A 4MB0A 3PHJA 1D09A 3E7FA 2PL3A 2FG6C 3RNLA 2PE5A 3G7UA 1HZZA 3EFOA 3JALA 2PAAA 3GQVA 4MWOA 5IAEA 4JENA 4B7AA 3WB2A 4NCKA 4I5FA 3L5OA 1JLMA 2PD3A 3DLTA 2QTVA 3V8QA 3KPWA 1A69A 1CRQA 1KVRA 4BCBA 2OBLA 2P0AA 3RBXA 1S5PA 2OQ2A 1RXSA 2XUFA 1TIKA 3BJIC 4K6MA 2WPDA 3QMMA 4I14A 2IOYA 1CF9A 5EI5A 4NV1A 2W2QA 5DTIA 1SN7A 5D84A 5G0WA 5G4LA 1WCV1 1WSBA 2Z83A 5IH3A 1Z68A 3CG0A 2HBZA 4OQQA 1IBSA 4TTIA 4OI0A 2GESA 2TMKA 3GVCA 2BISA 2IYVA 3IAM1 2VHVA 5AHKA 2O3UA 2H9YA 3NONA 1UQRA 3W4IA 4MICA 2IU6A 2JAWA 1X92A 2WAYA 3M9XA 4RHYA 1KU6A 1N7HA 2W2VA 3JAMA 4JA0A 3TCXB 4NAUA 3GLHA 2QD4A 5AVSA 3UWPA 2QL5A 3HCEA 3THWA 5IP5A 2GVDC 4B6QA 1BD3A 4TV8B 5JZOA 2X9GA 4XDZA 2CXNA 3CMMA 3K9FC 5EIEA 3C14C 4YACA 3A27A 1JWBB 2B61A 1IN8A 2ZSKA 3CFYA 2PLFA 1WZEA 5BV8A 5C1PA 4O4LB 3O38A 4ER3A 2AOWA 2G80A 1ZDMA 2N0SA 1NZDA 3I56B 1N6HA 3PI6A 1D1SA 2JLRA 3JWPA 3GDOA 1GKUB 2X8LA 3HAGA 4MDYA 3NLLA 1MVOA 2GX6A 3KJZA 4OHXA 1LDGA 1P77A 4MRNA 3KQKA 1EVYA 1Q7CA 4XD2A 2CFRA 1K68A 4MRMA 3U4IA 2OVFA 4DWVA 5ALVA 4R2KA 1YFZA 4DABA 2QIOA 1GTRA 4FYXA 2GXSA 2VJKA 3HXMA 3D54D 1NSYA 4BCCA 2WPNA 1EUQA 4XGNA 4EEZA 4V0OA 2H65A 1JT9A 2HHLA 3I2HA 4L27A 4MTCA 2AE2A 2IEYA 1G3QA 1X77A 1WDKA 2DQZA 4DB2A 2XYQA 2DHQA 3B1XA 3RK0A 4XIJA 4PEVA 2G5TA 5CT9A 2CD9A 4LK3A 2WQ6A 3AOEA 4RX1A 2DQYA 2FMIA 2OQIA 3NPAA 4GPZA 5KAMA 1C1YA 1RM3A 5LIRA 4J0FA 3B7GA 1CK4A 4N5DA 2JGLA 4KMOA 1HLFA 1FJXA 4XLCA 3KJNA 4QHTA 5LP6A 4W5RA 1EEXB 1JFRA 3QLUA 1NU6A 5KOJA 1YA8A 4UMDA 2J3JA 2VK8A 3N5KA 4E22A 2B6NA 1ADGA 3SZLA 1NXOA 5E7JA 4RSGA 4C4RA 5BR7A 4YO8A 4HAIA 2WA1A 1ISMA 3BMCA 3IOBA 3MWLA 5FOVA 5JYCA 4AECA 1U1IA 3OI7A 3OZRA 3RUPA 3CNQS 2IODA 1T0BA 5CGQB 2FK7A 4BFWA 3DMTA 2IK8A 2I2BA 4EEXA 1L4KA 3E1GA 2P79A 1A4IA 4XD7A 1TUBB 1Y4UA 2IE8A 4I50A 3KVOA 4ZAWA 3WGJA 4Q3EA 1TO1E 3P19A 3PSAA 4E07A 4M2LA 4TQAA 1TD9A 3PR2B 4JVOA 4QOFA 3TQFA 1MHTA 1YGYA 3AUTA 3DUFA 3Q12A 2IYUA 4H6WA 4JJEA 4GF5A 2EKPA 4US1R 1EZ1A 1IOLA 1AOXA 1WNFA 4DXAA 2FZVA 1XK6A 3DBIA 2AMYA 3N8IA 3QFFA 4R2IA 4U00A 2XB8A 5CK5A 5KW9A 2BGRA 4Y67A 4MRMB 3ZDQA 2AF4C 1QWSA 1HR0B 3JARB 1FYWA 4CF6A 4LV5B 1ETHA 2B69A 1C3XA 3CLSC 3QVVA 2PEZA 4IGEA 3ULKA 2YVKA 3WYCA 1EFAA 2WF8A 4R2WA 3CB2A 3OCYA 5A5VA 2FPGA 4NJMA 4MUEA 5AM2A 4OQPA 3FPLA 5LD2B 3RJZA 3AI7A 1F9EA 3MUEA 3PNVA 4YLGA 3WR5A 3NDBB 1RWPA 4MRSA 4ZDKA 2QTAA 3O7MA 2FPSA 1TT7A 4KTTE 1AF4A 1V26A 4JROA 4PIVA 3ZE0B 1DJPA 1R00A 1EFRD 1XI2A 2Z5GA 2XUOA 5K4HA 1Q0ZA 3GRPA 4IKOA 4R2LA 1ZI8A 1TM7E 2X9NA 3OQIA 4L5IA 4RW0A 2RB5A 2F8SA 2FSPA 4DHEA 2ZRFA 4GAEA 4A8JC 3ELDA 1GA4A 1NF3A 2WM2A 4MJ3A 4WESB 5TJ9A 2HMVA 4PLZA 3INTA 1YQXA 4P0PB 2VXYA 1C4KA 1HE5A 3CUSA 1A2QA 3R6KA 3PNQA 4EY5A 2WB2A 4RJJA 2O8CB 1VG0B 3WLSA 4BMZA 4DDWA 4IMPA 3WB1A 2EBHX 2CJWB 2Z6VA 4HWKA 3T5AA 3D6HA 3QYJA 4KRYA 3W6PA 5KTTA 4E4TA 1ANKA 4KLRA 5FWDA 4QVKA 3ASUA 4DNRB 2PGIA 4H1TA 1CVIA 5DLQC 1DIAA 3G59A 2UUBB 3HUDA 5TVKA 1EAMA 1GQSA 2P78A 5H3HA 4Z4GA 1DQRA 1CUBA 4L8JA 3GFSA 2QNIA 3B1JA 4NH0A 3ZQUA 2E85A 4D9GA 2PQMA 4ID9A 3EFHA 1L8XA 4RPIA 3KQLA 3I92A 4FMDB 2PUBA 1XZQA 4JJ4A 3M6FA 2WIJA 1Y1SA 2HM7A 3CW2A 1VQPB 2QYSA 1WLYA 3GGPA 1CE8B 1OVGA 1WHSA 4C1NA 3C3WA 1YX2A 2BVNA 3KWMA 1Y3BE 4PSVA 2QVYX 1Z7EA 2W4IA 1Y3CE 1WPRA 2GN6A 4K81B 4KWCA 4E51A 2RJ3A 2FVGA 4WECA 2IW1A 4G65A 4RHCA 5A1TA 4ABYA 4JC0A 2IS4A 4JBHA 4MS4A 3WO0A 4AJPA 3KR2A 2QQ0A 4O5OA 2WP8J 3KEMA 1YZKA 2AG1A 1HEUA 2HMAA 3GSIA 1RWVA 1WMDA 2ZRAA 3IV7A 3LUDA 3T4EA 1TE2A 2C0QA 2P6PA 2VN8A 4TLBA 3TFOA 2GO7A 1EGMB 1E79A 3GPCA 5H7XA 3ZGYA 4JP5A 3JYQA 2V7EA 2JA1A 2IH4A 1T24A 3F9CA 2BGJA 5K3BA 3OQIB 1TAGA 1XIVA 3QOYA 1K6MA 3ZLJA 4LFCB 2MCFA 4TV8F 3ZVMA 1XVAA 1WXQA 3JTMA 3BILA 3O0TA 3X1KA 3OOSA 2GASA 5EP4A 4DV1B 5DHRA 1H85A 1Z4JA 2ZWIA 3MT9A 5G40A 4EGCB 4HT3B 4IFEA 1FL9A 1OF1A 5ELXA 1Q74A 1E5XA 2Q5QA 3PFFA 4UTZA 3VJKA 3W2HA 2IEGA 4RPBA 3IP7A 5TVGA 5JCXA 1VJTA 5ILGA 2WJHA 3ZZUA 4L7VA 4N48A 1DCFA 2FXIA 2Y0BA 5A3JA 4UU8A 3SI7A 3AQ4A 3JQQA 2CK3D 2XVMA 2PGLA 1LRJA 4D1YA 4PG5A 4AC9A 4Q15A 3QY9A 3EBOA 1X70A 4G5XA 2GK7A 1MAVA 4PLVA 3OUZA 3V7WA 4B3CA 4DC9A 1LXCA 1JPUA 3UB4A 4J49A 3QF4A 3K0BA 1GL6A 1LF5A 3G5MA 3FOZA 2JJ2A 1E99A 1QVZA 3GRRA 5LPNA 4UVGA 1SKYB 3CX8A 3PPIA 5JXGA 2XTMA 2O8FB 2M1XA 2J08A 2CCKA 3CCFA 8MHTA 2WFLB 2Q8PA 4CNBA 4IDEA 2IH2A 5DCLA 3QX7A 4J9UE 5FV4A 2OUIA 1Y8AA 2WG2A 3JASB 2HSDA 4J0HA 4DIDA 2F43B 1QHEA 2AEFA 1NNSA 2CDAA 3EGDA 3LP8A 4HDSB 5L7YA 3CBQA 1YI2B 1BMDA 2FY8A 2JCYA 5BN4B 4UDYX 3FD8A 3ZCPA 2JHPA 2XCIA 3RANA 3QJYA 1I80A 5BNWA 3R4VA 2OZLA 4C0XA 1ZJZA 2VDVE 4S1TA 4CXMA 1DTEA 4CLOA 2PDAA 4ZWNA 3BAZA 1NFRA 1PZHA 1Z34A 2PYIA 3L93A 3DUWA 3WXBA 4QASA 4B44A 3DE3X 3HFSA 4FCCA 3U3ZA 5THXA 2OMEA 2Y1XA 3CX7A 4AMBA 5IH7A 4PQEA 4A4DA 2ZQ5A 3AI1A 3OICA 4G26A 2A3RA 3I2GA 4TUYB 2O5VA 1YVUA 1M2OA 1OAKA 1QPBA 1Z4QA 4H4CA 4JMPA 1JJIA 4RSHA 3NP7A 2VPPA 4MB2A 5C80A 5IBCA 2I29A 3ZX4A 5F5LA 1XRNA 5P8WA 3DKKA 1JG4A 4JEMA 1B74A 3PTZA 3T8YA 1CW2B 3PDHA 3CN7A 3QYAA 4JVLA 5TE9A 4XA8A 1IVNA 4QEKA 2PBRA 4N40A 2REOA 3BXEA 4I9GA 4CG2A 4IKPA 3LUBA 4K1XA 3CKMA 1CDDA 2FUG1 2DG2A 1QFMA 1Q86D 1UJMA 5EJAA 3QBEA 1EK5A 3NHJA 3HDVA 4E1AA 4G5SA 4EPWA 4OATA 1MC8A 1ZICA 4YA6A 3ZVNA 2VZEA 1CB7A 4LMPA 3RARA 2ZAIA 2O2YA 3M89A 1V1RB 3H3FA 4UDNA 5IC6A 3VU3A 4AYWA 4J43A 4B3IA 4D74A 1A76A 1R27A 4HS9A 2VATA 4O4JF 5TPWB 1X39A 3K1TA 1YE8A 3EXHA 1YVPA 4LXIA 2R65A 4X63A 3HS3A 1OIWA 3KPJA 5KC9A 2ZTNA 1T13A 2X23A 3PVCA 1X7XB 2G4CA 4UTNA 3K30A 1KXZA 1TADA 1YR9A 4LPKA 3COZA 4EELA 3JZDA 2QT0A 1V1MA 2NTYC 3NAZA 3SCZA 1CUVA 3RS8A 3UY4A 1NLZA 3RVLA 1JFLA 4IDOA 4Q1EA 2CJYA 4AUMA 1MDFA 4ZVPA 2J6CA 2LCFA 5IXYA 1N9KA 1H9CA 2C2BA 3QVSA 3SEQA 4CT0A 3FKJA 3M0EA 2WKSA 3QLTA 5DYWA 5SZIA 3RS0A 4DA6A 4G0MA 4DMFA 4XORA 4L1KA 3VOAA 4P1VA 4ILKA 3UK0A 3W5HA 2V58A 5LDHA 3UUGA 1S9DA 4XIFA 5FLKA 4ZQEA 1YK0A 1Q95A 3T15A 1XZDA 5FIUA 4D0RA 1BE8A 1TZCA 2B4KA 5LZ9A 4QOEA 5EN4A 2CUTA 4IIEA 4PS1A 4W9MC 1Z73A 4H16A 3ZZ0A 1R12A 4ZVMA 2EJWA 3PNLA 2VBSA 4ZVNA 3K1ZA 1IC6A 2JFUA 3OBBA 2EWVA 3RSQA 1C80A 4Q03A 3RYFB 4GL4A 4EG3A 3SSMA 4MEBA 2VS1A 4L6IA 1W46A 5IYZF 2WWYA 2EATA 2MYPA 1U5CA 2C5FA 1YBFA 3AV0B 1I7SB 3K2QA 2PKCA 3ZHUA 1FDWA 4UUBA 3Q6NA 2B20A 3I3OA 4R1LA 2ZYGA 3HPRA 1F7UA 1QHHA 1XKLA 3PC8A 3VR0A 1F2DA 1N1DA 1SBNE 2E49A 5COQA 2GRAA 3KZKA 5JCJA 3T35A 3E7XA 5DE3A 1Z22A 3VTFA 4D3YA 4G5GA 3QQPA 1DVRA 3TMYA 9ATCA 1XHLA 1A95A 2ZI9A 1KRWA 1TNDA 1TD1A 1SPBS 2OBYA 1NRWA 1CZUA 1E9VA 1FXWF 2J30A 1LTQA 1EMDA 1XTPA 3HABA 3AIOA 3VJRA 1K8XB 1FA9A 2OB2A 2PXXA 4XJXA 2VHQA 3ILXA 2AEEA 2FWBA 5AMXA 5EUBA 5LVAA 1IFXA 3JQCA 2ZJ3A 3HWWA 3OAAD 4ADSG 4I1VA 1D1QA 3AU9A 2DF8A 5AM1A 3I9NA 3ZDFA 3KC2A 4EPTA 3K0KA 4NZYA 3DE2X 4GBED 4IMRA 5JSYA 2A0WA 2L17A 3ZCTA 1Z5PA 4E3WA 3NC0C 3ZLUA 1U6IA 1ZNXA 2XGSA 2LVBA 1N6IA 1NFQA 1NVVQ 2PO5A 1L7DA 1RAEA 3LV8A 4CDNA 3TQRA 3QE9Y 3F6EX 3PHIA 3SC6A 2BE9A 3SF8B 3PDJA 4W8GA 5I9MA 2ZBUA 3VNSA 1SURA 3GMDA 5AHOA 3WB9A 5CT6A 4M8LA 1ML4A 1UDRA 2GAOA 2XHZA 3AFNA 4KGXA 3VUEA 3RHFA 2ONKA 3V33A 3ZR4B 2BSXA 1VI2A 4IMJB 1Z2AA 4MVJF 1QQ7A 1G18A 4WZLA 1X14A 2GD6A 2KHZA 3VR6A 3D3NA 1V7QA 2VAPA 3D7LA 3VSAA 1YS2X 3OPYA 1CJTC 3L8DA 5B7GA 3DXXA 2KJQA 4B47A 4LPSA 5FPKA 5FOWA 5M5BA 4YDQA 4K9OA 2VYND 3A7EA 2BRUC 4LDRA 1XLWA 3VSBA 2VBIA 3EIOA 1KC3A 1HEYA 1AD2A 4KU4A 1V8BA 2OC4A 3FVWA 2NUAB 1ZOIA 2XWQA 3Q7EA 4WMLA 2CVZA 1WQ1R 3UG7A 3LUCA 3WZ2A 1QAMA 3H5WA 1Z35A 2G0AA 1HE8B 4I36A 3X3HA 2BV3A 1C0EA 5JAIA 1HX7A 1G8MA 1K3TA 5KNBA 4O8ZA 3DMPA 5F9MA 1IH8A 2DQSA 3SS7X 3ASPA 3LM8A 5I7OA 4DV0B 4FD2A 2CLIB 3NV9A 2FETA 2ZRBA 2RHRA 2I8CA 2CF4A 1VKOA 4K5QA 5EZ6B 2A92A 4RF4A 4LF9B 2ZS8A 4KXYA 3NJRA 3T1YB 4OQNA 5LNK1 3H0KA 1HFJA 2DHEA 3I9KA 3Q98A 4HAWA 4U8GA 1D0SA 1Y37A 3S2EA 3X43A 2A4KA 4BRWA 3OW7A 3U4HA 4ZJZA 1L5MA 4BMSA 1M5RA 1HXHA 1K4YA 3HNRA 1UINA 3BD9A 3H42B 5EMKA 5BW5A 1QIHA 2VJJA 1OYVA 4IYJA 3AKZA 4B40A 2KS6A 2ZSIA 3IAS6 1DO0A 6ABPA 4II2A 4W5JA 2BKUA 1SCQA 2WJWA 3GP5A 3KB8A 4Z4CA 1QG4A 3WIUA 1BOOA 3L4JA 3C6YA 4TMYA 4TKLA 3BY1A 2GEDA 1I7PA 2XCLA 4RLSA 4D5EA 3VVBA 4NFHA 4NIMA 4NBKA 4ZT6A 1W35A 1RKQA 2HRBA 5ES3A 1XNRB 1SIOA 4NU8X 4N7JA 2E9SA 2C98A 2O9JA 3BEOA 1OYYA 2AYZA 4MVJD 1QC5B 5ALRA 3V46A 1UJNA 2H59A 3SDBA 3RWMB 4E5YA 1FSPA 4ALIA 1DBPA 3LGAA 3BK7A 1TVKB 5KZMB 1X3LA 4KQWA 1EX7A 4I46A 5ITSA 5GGXA 3B8HA 1R0SA 3G2NA 1NZJA 3HKBB 3AFHA 1H1LA 2WWIA 2X4DA 2ZUTA 4DEXA 3VH1A 4UTPA 4YXFA 5BMOA 3SYRA 4ZU3A 1O54A 3JQPA 1QH9A 3L7MA 1JQ5A 1SHLA 2IQ5A 1O9BA 5HDQA 2GVNA 4KQ2A 4HZUB 5IUNC 1ESZA 5JH7F 1KI6A 3TE7A 1T2NA 3THYA 3I42A 4HVAA 1GPUA 1QLJA 4RMIA 1FJHA 4YQFA 5HP4A 4LISA 1S89A 1VPTA 1CR6A 3AM1A 1UBJS 1GQYA 1ZGHA 3KEQA 4QLOA 4WKPA 3TI9A 1Q1BA 1GVHA 1PQ4A 1FDIA 3M6WA 4B84A 3T5PA 4MW4A 5HRAA 5JCPA 1WHTB 4V3BA 1QHFA 1TQ6A 4EATA 1OIXA 3K20A 1GUZA 5C1IA 4G7XA 5BT8A 1NASA 3TAXA 2GCPA 4D57A 2D06A 1M2GA 2FWRA 2PT5A 1T6YA 4F86A 3CCEB 2P40A 2FZWA 3G8DA 2XA9A 3GHYA 1Z6TA 2W71A 1BDMA 1EE9A 1TGVA 1R5JA 2C2ZA 4BU0A 4YMSA 3A10A 1VJ1A 2Q0HA 1M8KA 2FOXA 2G0TA 2XB4A 2EFHB 3T51B 1UC4B 4WHMA 1L9KA 4YONB 4G0QA 1PGPA 2YHSA 1QCDA 5ALYA 4GI2A 1IU9A 1P7YA 4HPWA 1J1UA 1ZD5A 4HUQA 1JECA 3DP7A 4NCAA 3A6HA 1G8HA 3ECCA 1U3UA 4QOJA 1D7OA 1X6VA 1NZFA 2XVYA 4HE5A 2YCLA 2WE8A 3NEAA 4LSGA 5BN4A 1WL8A 3AF6A 1PJ7A 1SXQA 2F8TA 3ZVLA 1H2WA 3O4VA 4Q7QA 1TQ8A 2HK7A 4ZPJA 3PQ5A 4BQRA 5CDTA 1NXTA 4EQ6A 5C8DA 1DE0A 1RC0A 1SCUA 4NBVA 1W0JD 5K03A 1R0XA 4P4UA 3C8MA 1BHO1 4PRZA 1J49A 4IGIA 4S1VA 3RODA 2IBTA 5CA0F 4QXRA 1H2YA 1PJ4A 2V03A 3LY5A 2YMQA 3FCCA 4HXGA 1OGJA 2DSNA 2AJDA 2GZ3A 2YY7A 3HEMA 4L4YA 1C0LA 1HRKA 3CYFA 2IYSA 3VHRA 1W36D 2P9QA 1OWMA 5SICE 1PKEA 5EXXA 5HE8A 1OZHA 1IZ7A 1MU0A 2P7IA 2ZKLA 5EESA 5HK8A 2GZAA 3A3GA 2P77A 3LE8A 1QIGA 1I4LD 4IIVA 1UMDB 1UAAA 3R8XA 3WHLA 1E3EA 4HDAA 4WGGA 4XOIA 4WZEA 4YXWD 1A7KA 4DUGD 5EXDA 3UGTA 1VXRA 1PV1A 3N1UA 1ZHFA 5JECA 2EV9A 2RBEA 3PUZA 1IHOA 5GINE 4R9RA 1Z0SA 4R6WA 4D8XA 1A2BA 2IEZA 1GRVA 1KMHA 2RGAA 1QNLA 3WIOA 4PO8A 4CMAA 4YPOA 3VPGA 1TF2A 3L7YA 3NOQA 4ER6A 4K2HA 3SJAA 3HVRA 2X1VA 4MWGA 1X1AA 4G4GA 4WN9B 4QVJA 4Q9JA 2PUWA 5CH3A 1M1XB 5AI6A 1J0DA 2B82A 2HBQA 2PVSA 2VPWA 4AXXA 2JLUA 1U28C 1BFUA 1RW4A 1K6IA 4MR8A 3OZCA 4R84A 3T99A 3VC3A 1JPJA 4TYYA 2KM1A 3IPXA 4RKEA 4V0LA 4N5MA 2R1UA 5DBFA 3MXOA 4A91A 1BDIA 1RIIA 2K87A 4L8VA 3WDLA 1NF2A 3E3MA 2P6RA 4WWHA 3LQ6A 1DGQA 4JJIA 4J16C 1L7EA 2ERCA 2B25A 3R40A 4CIBA 5IXSA 1HK7A 1KK2A 1P73A 2DQKA 3L8FA 2YICA 2H1HA 1DDOA 2NO7A 3PQ8A 2BDTA 2EWWA 2ZE5A 2ZREA 3TUIC 1H0HA 1JEEA 3R0XA 3BVPA 5DFAA 4ZA2A 1R7RA 3E5MA 2FW1A 3KQPA 3KQUA 3T1QA 4MQUA 2RJOA 2G7ZA 2ZJ5A 3FHOA 1W0CA 2HNBA 3A3PA 4TL6A 5C9ZA 1V2HE 3IQXA 3LLMA 3P0EA 3I6BA 3ETHA 1IE3A 2VDPB 2HCJB 1TMGE 2WUFA 1H4SA 1CTQA 1G5HA 3BIOA 4XDHA 5FO0A 4L2IA 2HCTA 1OLOA 4BTLA 3OPYI 2HJWA 4TS1A 4Y2JA 4JV5B 4DLUA 4YBRA 1DWOA 4OHYA 1E9AA 4LEIA 3ZEIA 4RVHA 1J8YF 2ZS9A 1TU0A 1ZBQA 3OTWA 1L1RA 4KRFA 3ZNNA 1T29A 2G77B 3CZ5A 2OO5C 4UE6A 3IMFA 1GITA 4K6OA 4MW5A 1HQYE 5FBRB 3SIPA 3MSXA 2BSQA 3DYIA 3R75A 1ZM9A 4R71A 2QENA 3VR4H 4DVJA 1CQZA 2XMRA 3G85A 3Q87B 1RPNA 1HUQA 4HZIA 2GLXA 2OO3A 3ZQKA 4UARA 2QU8A 2ZWOA 3I83A 4FU0A 5CJPA 4BZZA 4G9EA 4HQ6A 1QH1A 1Q14A 2J9ZB 3AP1A 3H05A 2DPLA 3CF0A 3WWCA 1JHRA 1BWQA 1OROA 2YYSA 1N0VC 4JWTA 1E58A 1J07A 5K01A 4RVFA 5DWQA 2ZZGA 1VMDA 1C9JA 4Y9RA 1YI0A 4RA9A 1QGOA 1AV7A 4Y2YA 1Z5UA 1IJFA 3ZQJA 4INZA 2GJ8A 3IXMA 4J8PA 5LXTF 3K1JA 2CJXA 3U81A 4A2WA 2QJTA 2HO5A 3WK9A 3HP4A 3NIGB 2AFVA 1AM4D 2GUGA 4GMHA 4K9SA 4M9XA 2F1RA 4MLPA 3T1TA 3Q3JB 3U4AA 4QEDA 1OHHA 5JR3A 1LA2A 3Q41A 4V39A 1KMQA 1JLLA 3CC7B 1UP7A 1OBVA 2FMHA 2NOAA 3A2MA 1WV1A 3A6ZA 3Q7RA 3TW4A 1SKYE 1JR3D 1SOUA 1Z0AA 4EGJA 1NI4B 1W52X 2NAFA 1ECGA 1VPEA 2CLSA 4AVYA 3OM8A 3TEMA 3C3BA 3F9RA 4GBGA 4GSYA 1KZHA 3FWPA 1FFGA 1MB9A 4UHKA 4YI5A 1EBFA 3DC2A 2ZWAA 2I1QA 2RGEA 1VI5A 3QA9A 4G89A 5FUYA 1UC9A 3C3XA 2IKQA 2EQBA 1UBSB 3L01A 1GOTA 2JB9A 5FHQA 1PR5A 2E21A 3IAAA 4ZVUA 3D3QA 3R77A 4L8FA 2H2HA 4MQEA 3ZI7A 1P2GA 2WMDA 1QHSA 5AVKA 1KO7A 2ACVA 2HA2A 1XTQA 1DKOA 3MTAA 1N32B 2GM5A 3ZVKA 5COBA 4PSCA 2XMGA 4RDLA 3EQ2A 3MGGA 1H4VB 3NWJA 1NXXA 4OHRA 4G4SO 2PX6A 4ER0A 2EZ4A 2CNBA 2O8BB 5AOVA 2NQ8A 4IZ6A 6REQA 1N57A 3GDWA 4HQNA 2NPFA 2RGGA 1F8YA 1UJCA 1L7AA 2R6CA 1E59A 2A0FA 4WBNB 4WQMA 3RF7A 4F6RA 2D2VA 4V2UA 3IR5A 4MS3A 1SOAA 2IYEA 3U40A 3OEEA 3WOHA 5FOXA 1DP4A 3UBMA 5K9ZA 1Y63A 3NNNA 1A50B 3QUBA 5JSQA 4KXVA 4I4LA 3ZXYA 4ZT5A 5KTKA 2IPLA 3PUWA 4RULA 3FGZA 1O58A 3HACA 2PBZA 5J47A 4RTSA 2D3NA 1SXJB 1XRMA 2IU4A 2PK3A 5I48A 4KFRA 4P26A 4WCVA 2I4LA 5GIOE 3GPBA 1K86A 4H1WA 2VTBB 3NE5B 4MVCA 2G88A 5BMVF 1H1LB 2Z4SA 2VTDA 4OG2A 1FNCA 4O2BA 1K3FA 3HVJA 5H81A 1LLFA 4QUDA 5KCZA 4J4TA 5CH8A 4KSBA 3FYUA 1CDZA 4RYDA 4UJ5A 2CHGA 4FR2A 1CULC 3LKZA 4Z86A 4CGYA 1I1OA 3U6BA 2QW8A 3L8EA 1COZA 3CCCA 4X7CA 3CMCO 3FGOA 1ETUA 2C04A 4PTZA 4E70A 1TGYA 4ZHQF 5ESDA 4NDZA 3MYRA 4HV4A 2ARKA 1WOSA 3ZJTA 1NVXQ 3GLFA 1NJ2A 1PYDA 1WXFA 2Q29A 5IZCC 2B9EA 5ICMA 2HLNA 4UEQA 1K3UB 3EUEA 2VJCA 2PSJA 4YNBA 2VK4A 4NY1A 2JLXA 1L5VA 4Z4SA 3DJFA 3LHDA 4YK7A 2PSEA 2ZIXA 3PXUA 4CMJA 4DDUA 1WQ3A 2XE6A 1UKYA 3ZXUB 3UPTA 4D5GA 1Y8ZA 5F76A 4OMCA 4OJMX 1QDEA 4FYKA 1VJCA 3L6UA 3FMVA 1CY6A 4DIFA 5ICCA 2QAIA 1Y8RA 2IZZA 2O06A 4FLMA 5BRNA 1HQDA 5I7WA 3ENNA 5KYXB 2DUMA 3LX6A 4BAUA 4RMGA 5KREA 4I99A 3UB3A 4M87A 2A30A 3MUOA 4B3HA 1IXRC 1G60A 4JUFA 1I0IA 1NYRA 1G9TA 8AT1A 1XL0A 2MWMA 4MW1A 4HFJA 3TZEA 4BXOA 3SLNA 4Z4WA 1C3JA 2CUNA 4PHCA 3QPCA 5JROA 1Z7BA 1BOFA 2P9YA 1XQBA 5ALNA 3H6KA 4N5NA 1MNQA 1YZVA 1DUIA 2BFDA 3FCSB 3OIYA 4RMHA 1L3CA 2Z09A 2AXPA 4BRUA 5JBNA 2GBFA 2YR0A 1JE0A 2YYYA 2Z2IA 3O84A 1HQCA 1V47A 4K9MA 2HKIA 2D2EA 2RONA 3CZ9A 1UDWA 2UV8A 3E53A 3FOWA 2PKRA 4BFZA 3PT5A 1JIXA 1HDXA 4MINA 1Y8CA 3G2LA 3S2UA 1FP7A 2O7QA 4MGYR 4AP9A 1IQUA 1SUIA 3E5HA 4XJVA 5FFFA 1BMFA 1NBOA 2JAQA 3HA3A 3A4YA 3NI2A 4LMBA 1HNXB 5MGBA 1YE3A 5CPFA 1KDZA 3R8CA 3SNKA 4R2JA 3FJOA 1OMOA 1AX9A 3Q7IA 5SYMA 2Q4RA 5B37A 4QUKA 4WINA 1GAQA 3U3OA 3VZBA 1ZRHA 3VKUA 2Y67A 1LEHA 4BO9A 4DAEA 5K20A 2J0QA 4L5BA 4PGFA 2WU1A 2ATCA 1B42A 2QN3A 2INGX 3I01M 2Q6TA 4OHUA 5BUSA 5DK4A 4K6KA 4BLOA 3EZ6A 3ICVA 1I2ZA 1KO4A 3CKKA 3B89A 1X1TA 4JEUA 1NYTA 2LCIA 2ROQA 2FEKA 2YBEA 2W9XA 2J59A 1RM5A 3FA2A 3OCXA 5JDCC 4L7QA 4UPDA 4DWJA 3FHLA 5IMSA 1KYTA 1NW7A 4GXRA 4TRMA 3A8KA 4JY7A 4XLZA 4B76A 2WG0A 1HURA 4BQNA 3KZVA 2HPHA 4GWLA 5AI9A 5FB3A 4NMWA 3D8SA 1UJ4A 1M6WA 2O1SA 2DLDA 1VQMB 1U7UA 5JO0A 5C4GB 8ATCA 4LSMA 1B7GO 2C3OA 1VP3A 2GN0A 4OGGA 3VDNB 3L5KA 2DUWA 1Y1TA 1MAHA 2WF6A 5HPYB 4LF6B 1TECE 2WV7A 3CLVA 3NETA 5KDLA 4A16A 4ITRC 1J06A 2N9UA 4IOMA 4M0EA 3UAZA 4RA6B 2GAAA 4TVSA 1LW7A 3S8MA 4C78A 2XNSA 1F5NA 3RAJA 3KSMA 4RGBA 4B8ZA 5BSEA 2WMNB 1M2OB 5TXGA 5C5EA 5MFZA 5FDFA 4X24A 1OYWA 1NMQA 3KM0A 1YL6A 2VJMA 1DEXA 3OZ7A 4JKYA 4NI5A 2WYUA 4OQDA 4Y3UA 5FUBA 2VQFB 4AZWA 3QKIA 3GJZA 5FQNA 4P12A 1T8RA 3E82A 3MINA 3CMEB 2JZOA 3Q9LA 4DW8A 2WABA 5EE0A 2XMPA 2OHFA 1BYUA 2CMGA 3AG5A 4UNNA 5GY7A 3AR3A 1HDGO 2GAJA 3QI2A 4KODA 1YJXA 3MNFA 2IITA 2PV0A 4JZYA 1JLSA 1NE7A 1GGVA 1PR4A 1W1UA 1YQQA 5B3AA 1K0FA 1N33B 1P61B 4X06A 2H16A 2ISQA 2QVLA 4Z3DA 5TV2A 2DFTA 2I1VB 1V1RA 1B93A 4GSLA 3RF6A 2GPWA 1J23A 1ZK1A 1GN9A 1K6XA 3IKJA 4QJIA 5T6MA 3C3YA 1IHDA 3DBVO 3WLEA 5AUPB 1AMUA 1IRXA 2KI5A 2AK3A 3K4HA 4RHFA 2YUTA 3EVFA 4FGLA 4UM7A 1CR0A 5KWIA 2JFNA 1NF9A 4HZUA 4OYYA 5EIWA 1ZGBA 4WZZA 2D3TA 4Q7MB 1B8OA 3KT0A 5I6DA 2WAXA 2QRQA 1JP7A 2A9PA 4LTNA 3VNQA 3ETEA 1XO1A 2UU9B 5J58A 4A82A 3ZTYA 3G23A 3G89A 4RY9A 1ZD9A 3RT7A 4PO9A 2VRCA 5ERGB 1RXYA 4MPTA 3S8EA 2ZTGA 2EX0A 1P81A 4D4HA 1G5QA 1G55A 4M0MA 1EP2B 1CVLA 4WDQA 3K32A 1RXUA 2IPMA 4DR1B 3F49S 1NLUA 1FMFA 1L5NA 5MN6A 1KEVA 4NK5A 3H8WA 1C1XB 2LTAA 3ZOZA 5KEIA 4DG8A 1E79D 2ZCJA 1IZ0A 5ALGA 2R8ZA 2GEUA 4GMDA 5BSKA 2XWBF 3B2EA 3IQGX 3PE4A 3BFKA 4U2GA 3THRA 5REQB 1PQPA 1KHTA 5EP2A 2WTUA 1QLHA 4KFUA 5DM60 4R5MA 3C3CA 4FILA 4KOEC 5KQSA 1YBAA 5K8VA 1GTSA 1T8PA 1O4VA 2KPOA 1Y0YA 4L5JA 3S6JA 5LWQA 1LDEA 3OFVA 5E8RA 4REQA 3RYFA 4CQLB 4TYQA 5JS1A 1X7DA 1GVNB 3DE1X 5BPHA 1BE0A 3EAGA 2ZS7A 1NN5A 1OI2A 1WKVA 5B7NA 1WZ2A 2HWYA 1GAEO 2DVMA 1O94A 3PJFA 1D0IA 5M29A 1M7BA 1GQRA 3HY4A 2AB0A 1RNLA 3SS8A 4CTKA 5JATA 5DP2A 2QXYA 1G7RA 1N05A 4YAOA 2V6JA 4JP3A 4WLEA 5TARA 3TX6A 1E2EA 3ZUPA 4CT5A 2G1KA 1O6CA 1D1PA 2IU3A 3RAGA 1PS0A 1OT3A 2JG3A 2MHCA 5TT1A 1EFVB 2PR7A 1UFOA 2ODAA 4Z4FA 4UW9A 2VUHB 5G2OA 3UYKA 4PO3X 1KY5A 5B5SA 3OKAA 1A4RA 1DRVA 1I1NA 3FVTA 1X9GA 7ADHA 4L0CA 2H1OA 3WLIA 1INLA 4RNCA 2ZZNA 2C7QA 3KD3A 2C88A 4LGMA 4QBGB 4BMYA 1XPOA 3ABIA 4H17A 4PNHA 2PUEA 2WF5A 4RVNA 2AMFA 1FXUA 1Q91A 3FPCA 3G82C 3W3ZB 1SCDA 3O90A 4Z8YA 2B1GA 5L7WA 3PKJA 3IKMB 5A7HA 4QEZA 4Q19A 2P1ZA 5DWVA 1GRQA 2NUBA 3PGA1 4GPIB 3EQ6A 3H8JA 4J03A 2H0AA 2PUFA 2WZNA 1MRZA 3NVMB 3TTXA 3WSTA 1JG7A 4H6VA 4V1CI 4EM6A 5AR1A 2PT9A 4HVLA 1D2NA 3EIHA 5EKXA 1KI1A 3ENWA 4WBXC 2OFOA 3AR6A 4Y2XA 5SV2A 3ITNA 4MUAA 4CIYA 5HSGA 5HUHA 1Z4OA 2PU5A 3ZHRA 3LXRA 2IV3A 5EQTA 3QUQA 4KNVA 1H5NA 2II6A 3HN2A 2V6MA 3O75A 2CE7A 2XW6A 3TD9A 1G59A 4AS1A 3BIFA 4JLUA