3W2FA

Crystal structure of oxidation intermediate (10 min) of nadh-cytochrome b5 reductase from pig liver
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
271
structure length
271
Chain Sequence
b'TPAITLENPDIKYPLRLIDKEVVNHDTRRFRFALPSPEHILGLPVGQHIYLSARIDGNLVIRPYTPVSSDDDKGFVDLVIKVYFKDTHPKFPAGGKMSQYLESMKIGDTIEFRGPNGLLVYQGKGKFAIRPDKKSSPVIKTVKSVGMIAGGTGITPMLQVIRAIMKDPDDHTVCHLLFANQTEKDILLRPELEELRNEHSARFKLWYTVDRAPEAWDYSQGFVNEEMIRDHLPPPEEEPLVLMCGPPPMIQYACLPNLERVGHPKERCFAF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NADH-cytochrome b5 reductase 3
publication title Elucidations of the catalytic cycle of NADH-cytochrome b5 reductase by X-ray crystallography: new insights into regulation of efficient electron transfer
pubmed doi rcsb
source organism Sus scrofa
molecule tags Oxidoreductase
total genus 76
structure length 271
sequence length 271
ec nomenclature ec 1.6.2.2: Cytochrome-b5 reductase.
pdb deposition date 2012-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
A PF00970 FAD_binding_6 Oxidoreductase FAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 3w2fA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 3w2fA02
1JB9A 1EXMA 3G6EB 1S0UA 4Y9RA 2QTZA 3WBJA 1UMKA 3AGQA 1N8RD 1M90D 5GV8A 3CCRB 1TLLA 2CNDA 2QDXA 4LBWA 3VNUA 1IJFA 3PENA 3ZZTA 1VQMB 3SJZA 2X3UA 1YJ9B 1GAWA 2DEUA 4ZCMA 4M4SA 2BGIA 4U9UA 2RC5A 1YHQB 3VNVA 4B44A 2B5OA 4ACAA 2BGJA 4TMVA 3AVVA 2YWFA 2QMUA 4F7DA 4B47A 1QGZA 1W2BB 3JQRA 4RD1A 4M1KA 2YWHA 4ZCLA 3LVBA 5TY0A 4IW3B 3WYAA 1EFUA 1YIJB 2D74A 4YAUA 3AVXA 1I7PA 1Q82D 3I56B 1S72B 3W2IA 4TMZA 4K1XA 3W2HA 2B7CA 2VNJA 3ZBUA 4M0LA 1QX4A 2BPOA 4TMTA 3FPKA 1QH0A 1GO2A 2VYQA 4MYUA 1D2EA 3LO8A 4YALA 3JQPA 1KK3A 1N0VC 1FNBA 1OGJA 2EFGA 4ZV4A 1GR1A 4RCYA 1KK2A 2E1RA 3P26A 3B82A 3CW2A 1JA0A 2QTLA 4Q7JB 4ZCIA 3CC2B 1NJID 1TUIA 2R6HA 4PGOA 4C0SA 1R5BA 3LYUA 3OZVA 1M1KD 3G71B 1XB2A 3W5VA 3CB4A 4HE5A 4RD2A 4EH1A 3OW2B 4B43A 2BM0A 1G7RA 3WNDA 3I55B 1ZUNB 3B78A 1IJEA 1KK0A 3MCAA 1E64A 2DY1A 3I1FA 2GQFA 3WNCA 4P3YA 3OJWA 1DG1G 1DARA 4RD3A 3VO1A 3JQQA 3A1FA 4N3GA 3AVWA 1DDGA 1DDIA 5H59A 1QG0A 1KQSB 1QGAA 3QE2A 4QFMA 4Y7CA 1TVCA 3VMFA 2J7KA 3WNBA 1ELOA 1BX1A 2RC6A 1D8TA 2EIXA 1E63A 1HA3A 1QGYA 4B3XA 2XNCA 2BN4A 3J81k 2CRVA 1H42A 2VZLA 1XE1A 3QFTA 4P6VF 3AVTA 1CNEA 2GPJA 2OK7A 4AF7A 1YJNB 1Q7YD 4PC6A 2BF4A 2VNIA 1U2RA 1YJWB 3CCMB 2ZITA 4YHBA 4RD6A 4TMXA 4TMWA 1AIPA 2BSAA 3CCSB 4LBZA 1W35A 1FDRA 2YWGA 4R71A 2PMDA 3W2FA 2C77A 3V76A 5GV7A 1G7TA 4PC7A 3WXMA 3P27A 1N0UA 3VO2A 2QEXB 2FX3A 4YAFA 1AMOA 1A8PA 3QFSA 3CMAB 4PC2A 4J0QA 1KC8D 2VNHA 3CMEB 4LBYA 2HDNB 3ZC3A 1WDTA 4PC3A 1B23P 1KD1D 3ES9A 3CCVB 5THXA 5FA6A 4M53A 1Q81D 1OB5A 2NPFA 4FN5A 1VQ5B 4FK8A 4ZGQB 4G1VA 2DERA 1FNCA 4DQLA 3CCEB 1K73D 2OTLB 5HXBA 1BJKA 3CCJB 1VQ9B 4WQMA 3E1YE 1EWYA 1QVFB 1K9MD 2DCUA 1F60A 1CQXA 3FJOA 2BMWA 3LRXA 3QSYA 1KRHA 1KJZA 3CPWB 1FRQA 2B7BA 3AVUA 2DETA 1BX0A 1ZM3A 2QN6A 1EP1B 1D1NA 5H5JA 4AF6A 2PIAA 4B48A 3G4SB 3CC7B 1SM4A 1QUFA 1GAQA 3ZZUA 1VQOB 4DQKA 1KTVA 3CRZA 1VQ7B 3AGPA 4ZGNB 5TV2A 5TR9A 1ZM4A 1EFTA 1VQNB 1H85A 4NBSA 2BM1A 1QUEA 3AVYA 4QHYA 3CXCB 3OZUA 3E20A 2AHOA 3B8HA 1FNMA 2QA4B 3OZWA 4AC9A 1G7CA 3CCQB 1QVGB 1R5OA 4BPRA 2VNKA 1OB2A 1EFCA 1CNFA 1QFYA 1ZM2A 3U2QA 4M2LA 3QFCA 1R5NA 1F20A 1SKQA 2XNJA 3W5HA 2BVNA 2HMAA 3CCUB 3W5UA 3CCLB 4G5GA 3QFRA 5JBQA 1VQLB 4RD0A 1OGIA 4UAJA 1GVHA 1JNYA 4RD4A 4YAWA 1VQ8B 2OTJB 4C43A 3W2GA 4TN1A 1BQEA 3WY9A 2YWEA 4LC0A 5KSWB 1TTTA 1E62A 1GJRA 4RJLA 1VQ4B 1B2RA 4PC1A 2BV3A 1YI2B 1W87A 4YAOA 2C78A 1Q86D 2HCJB 1EP3B 4B4DA 1YITB 3ZZ0A 4NCNA 4HE6A 4MYTA 4FWTA 1VQPB 5AN9A 4LBVA 1ZM9A 3U6BA 4N3NA 1W34A 1QFZA 4H9GA 2PLFA 4ACBA 3WBKA 3CC4B 1IB0A 2OK8A 1K8AD 3MHPA 1VQKB 1J9ZA 3ZBTA 1JA1A 2XEXA 1FNDA 1NDHA 5EMNA 1FRNA 1EP2B 1G7SA 3CD6B 3MMPA 1VQ6B 4G1BA 1QFJA 1KK1A 5DSZA 1JJ2B 4Y9UA 3W2EA 4RCZA 3OJXA 3U6KA
chains in the Genus database with same CATH superfamily
4A10A 1XMXA 2C8JA 4G7WA 3ODPA 2RKOA 1YGPA 2B8NA 4R41A 1WA5A 3PC7A 4K05A 1TGVA 1E6EA 1UUFA 1VE6A 2M6SA 1NNSA 2GM9A 3JD2A 4RYDA 2EKBA 4J1TA 1Z2EA 2ZUVA 5E6RB 1GR0A 3E8XA 4JB3A 1BLIA 1KKUA 4AZ3B 1GDHA 4KYTA 3FUVA 2QY9A 4O59O 4W7IA 3ED5A 2IXTA 2GZDA 2OSVA 3SJZA 4AFNA 2X3UA 1ISSA 1GUYA 2ILVA 2P40A 4HPJB 1KO7A 4JT8A 3UUEA 4B3TB 3I34X 1VLZA 7REQB 3RSGA 1OLXA 2D1TA 2O3UA 1YHQB 4BQFA 5HUHA 4JR1A 1EXVA 1BCRB 3DV0A 3PRJA 4XW2A 4MQEB 2HV9A 2P4UA 1NKTA 2QQ5A 2BGJA 4S35A 4KO2S 1ST3A 1L8AA 2ZIWB 4FGWA 4UVIA 2AJ8A 4LF9B 5ILOA 2QMUA 1KJWA 1XDUA 2GKGA 3FE2A 5C32A 2YWCA 4M8IA 2WZBA 1V16A 1N0HA 1SUWA 2H4JA 1GGEA 3K0CA 3MD9A 3SC2A 1U2EA 3L8HA 4Q9LA 2QD1A 3OHSX 4MWCA 3RSZA 5TY0A 4IW3B 3WL7A 5K2OA 3LXXA 3I2FA 1MEEA 3TTYA 1T4DA 2OAEA 1VCNA 2I33A 1EEHA 2O6LA 3JW8A 2CWWA 3DF7A 3A4IA 4TV8B 4HNAB 5DGIA 5L6LB 2X6TA 4G36A 4MAMA 2VWHA 5ED0A 5EWLB 3WIBA 4QNMA 5BSEA 3DEZA 3CLRC 4FFMA 1Z6ZA 4J7CA 4OQQA 1WVGA 4LJAA 5IFLA 5E6RA 4PS1A 1IHYA 4OQEA 3ZH2A 3KT0A 1FRVA 4LF5B 2R6R1 1DC7A 2FUG1 4PS0A 4L75A 3MN1A 5IEBA 4MHSA 2CDRA 3C3YA 1XDGA 1UDWA 4AZ3A 3PHLA 4HKTA 1UDRA 2AK3A 2B7CA 4E32A 1GGJA 3PXDA 3IODA 1SKBA 4RMGA 1QHHB 2WPDA 3S0JA 1EM8A 1DC6A 4OSOA 4RK6A 3T9DA 2C9BA 1GRQA 3ABQB 3LUAA 5E0OA 2QLNA 3TTSA 4C21A 4X9XA 4BUCA 4BV3A 4DFDA 1U9JA 1N2CB 2JAQA 3VSBA 1BCRA 3MMXA 3NUQA 13PKA 4HDMB 5HK9A 4RHCA 5KSZA 3PSHA 3H86A 2NYRA 3RVLA 4UNQA 3GDOA 2O3QA 4LKOA 1DWOA 1TJ5A 1SBCA 2CJFA 2FUG6 3FW1A 1OIVA 3O47A 3SLNA 3WWDA 5BRJA 2KM1A 4C0JA 2I71A 1AS0A 1B42A 3CKKA 4LXYA 4MQBA 4QU5A 1JSXA 4Z3OA 4OJYA 2QXYA 1GRRA 1YBAA 3ASQA 2XR1A 5KZMB 2F1MA 1MX3A 1D2RA 4J8PA 2GBPA 1JIJA 4O4HF 4OL9A 4HNAA 4TV8A 3VH4A 4PVDA 1G66A 3CZ9A 2FG6C 5AW9A 2I6FA 2QMOA 1ISPA 1AGXA 1BKSB 5EWLA 3EF3A 5FWNA 5FPQA 1IN6A 2OV6A 3HYSA 3ZQUA 1RAHA 4UHEA 3HZRA 4BLOA 2AOTB 2BKAA 5FORA 2M6LA 1XJQA 4JV5B 1EE2A 4JROA 2JGMA 3D4LA 1R00A 4CCYB 3U09A 2GTIA 3WMRA 2Z95A 1YIDA 1ENYA 4QJ3A 3L0IB 4IMPA 5G41A 1QHHA 2EVWX 4HNUA 2NX2A 4HNSA 4H7JA 1II0A 2WJYA 1KZ7B 2P68A 3H2KA 1IM8A 5KYGA 1N2CA 3OG9A 4L0QA 1G5IA 4EGSA 1MP0A 4HDMA 3U60B 1VL8A 3ZW9A 1E2QA 4KLCA 1ND6A 2Q5JA 4JVSB 3FZNA 3AUKA 1C8BA 2IHUA 4MTCA 3WL4A 2IXGA 4LNHA 4BQOA 1BMFA 1AGRA 1OQAA 4U6SA 4E4YA 2VG8A 1LH0A 4RD2A 1VBMA 1YH3A 3CSUA 4K7JA 4RXTA 3B60A 1ZR4A 4I50F 4EHJA 3DZJA 2DFVA 2XRMA 2D2VA 4DVGA 3QQ5A 5MF6A 1SC1A 2IEBA 3BQ9A 4IDQA 4GMXA 4V38A 2ZUTA 1K4KA 4S2EA 4IF6A 1IJEA 5D87A 3MCAA 4RHXA 4CKEA 4DR3B 3VUEA 1Z2AA 1YVEI 3W7BA 4HQRA 1HLPA 1LRJA 3GEGA 1VMEA 4MS4A 4DCGA 5ALVA 4ZO7A 5C7IO 3JV7A 3EGXA 1DG1G 3P0RA 2ECKA 3W5AA 1C2TA 3T3MB 1T1EA 4GSYA 3GI1A 1D1QA 1OAKA 2AOTA 2ATEA 3OTWA 5A4IS 3N0TA 4V0RA 2Q8PA 2EX4A 2I1VB 3TRJA 2VT7A 1PJ5A 4NICA 3VJRA 1M8GA 2GAJA 3V4LA 3WLTA 1MB0A 4YUZA 1YBMA 4FVTA 1R3UA 1ODJA 4D0NA 4QJIA 1G8PA 3WZLA 3DMYA 1SURA 3O6VA 1G8AA 2EKQA 4ND5A 4BNNA 3TIXB 4ZHQB 3K8QA 1BVHA 2XGJA 1I3KA 4L8JA 2CJYA 4GYJA 4AU1A 2GVDC 2ZRAA 2QR2A 2Z9DA 3N2GA 4WKPA 1YASA 3TWOA 2OGUA 2PLNA 4GE0A 1Z35A 3RJZA 3IELA 1PK7A 2X42A 1YA4A 1N1MA 1ADJA 1MABB 2N47A 4R68A 1HO3A 4GSKA 3LYLA 5J58A 2PJUA 4N5LA 2GETA 2H4WA 2NW6A 2OKCA 3IJ5A 2O52A 1JHYA 1SB8A 1ADFA 2AL7A 1D2AA 4PC6A 3HBAA 2QE7D 3U4MA 1NBWB 3G5AA 4PWZA 4E5SA 3ESRA 1JA9A 4ZTBA 1DEXA 4G25A 4CQNA 3H6KA 3K4PA 4KMMA 1LWNA 3MRXA 5M3BA 4RAOA 5AOVA 2WAYA 4BP8A 2O2XA 3QNUA 1FTYA 5AVZA 1V9LA 2R7MA 4G0XA 2Y3IA 4Q47A 4DG8A 1JHMA 1BDHA 4MPTA 2RI6A 3D6UA 4X6LA 4QTXA 3SSNA 1MFPA 3UYKA 2B30A 4D8XA 1ZGCA 4LXHA 1PTJC 2E48A 3RUHA 3PD7A 1FTSA 3KSMA 2I7XA 5C35A 2J0SA 4MV0A 4FYXA 2Z8XA 2QD3A 1LSJA 4X06A 2FX2A 3X2SA 4BJ5A 2CF4A 1XA0A 2FLKA 4AD8A 1U98A 3DL2A 3QVGB 1BS2A 5LZ4A 1CXZA 3FNBA 9MHTA 2PZGA 4AG3A 4ZJPA 4PNEA 4L9WA 5K4AA 2HSWA 3LC7O 4L0CA 1KI2A 3A14A 1DBIA 2FVXA 1G3QA 3OJOA 2JG3A 5TRTA 4IH4A 2FG5A 1PQPA 2QWXA 4K26A 4XFKA 3RUEA 3WG9A 2FLWA 4D9KA 4P4UA 5BQ3A 2YZMA 2YRWA 1T10A 1UM9B 3VR4D 2GEDA 3CZRA 4GU5A 4IIGA 2CLMB 4PC2A 3L0SA 3N74A 4MP8A 2GUWA 1MABA 2QORA 2ZUSA 1J9GA 4MV8A 1JUDA 4EGAA 3G85A 2FN7A 1Z4QA 3QUCA 4YJGA 5AUNB 1XD9A 4GX2A 1RMTA 4ME6A 2QRQA 3S40A 1TKBA 1NJ5A 4HEJA 5L3SB 2PT5A 1EX6A 5JADA 1JEDA 3HCBA 1UXGA 5DBOA 3B51X 5FNVB 1KI9A 4RSGA 1TDJA 2QD4A 3L7AA 4MPRA 4NEHB 1E2JA 4ZQCB 5JAMA 4HYTA 1MJNA 1SPBS 1P5ZB 4LJ9A 1JHPA 5H8WA 2UUCB 1JR3D 2C7VA 4C4OA 1E92A 5FA6A 2OYSA 3N5CA 1A27A 4C05A 1VLMA 4XM1A 2C5AA 1T26A 3WK4A 2J3HA 1WJGA 3B53X 1PP4A 3H5NA 5EGNA 2WM3A 4C7OB 2BE9A 2M98A 2G7MC 1P0MA 2YV4A 3VPFA 3DXFA 2ETXA 4P81A 3NOVA 2JEOA 2AJDA 4TUYB 2ZAOA 2IBSA 3BMXA 3QVGA 2GVNA 3QG1A 1XMPA 4IUCS 10MHA 3KPVA 3GLUA 3CCEB 4HTFB 1BA3A 5K0BA 1SXJA 1P2GA 4J75A 5DNWA 3SEQA 5KQRA 4CLEA 2CBZA 2JBHA 1G6KA 4FCVA 5K8IA 3A6DA 1DFGA 3ZUGA 2PGOA 4IV0A 4MQ5A 3ZHYA 1UM9A 1SUPA 3RVSA 1U1DA 2XHEA 3VJLA 5D2CA 2R1ZA 4G2TA 3B12A 3GLFB 3NTUA 3VH2A 4A8JB 4ENPA 4DRXB 1WPCA 2RIRA 4NMXB 3UJDA 4PN7A 1JAHA 3DBLB 3ZYCA 2B7BA 2XA2A 4NNJA 2RH9B 4ZOLB 2N1MA 3ZJVA 1EVQA 3U4AA 3MNFA 3UHFA 4FHCA 3IUYA 3KEGA 1SKYB 1T4BA 3QGMA 4CQJA 4NZNA 3VI4B 1U5BA 4DJ5X 2AKEA 2F90A 4IIHA 1PVVA 3FGNA 5ES4B 2P0EA 4CEHB 2OD7A 3IAAA 1FXUA 2YVKA 2DGDA 2IFTA 3T06B 3BE5A 1XXHB 2NXEA 4JB2A 4JHLA 4DMLA 4E5UA 4Z4FA 5FOUA 4E70A 3CC7B 3SZMA 4HATA 3DUFB 4Q05A 3WQBA 4OP1A 1QLHA 1Q7BA 2R1TB 4C7OA 5TVKA 5I4IA 4RLQA 2POQX 2J3DA 1GKIA 2EJTA 1U1FA 1PZXA 2QUBA 2W2TA 3EZYA 3GRUA 2V65A 3LXRA 3MK31 1G5QA 2G72A 3OZCA 2X1VA 3KYBA 1L3BA 3RE1A 4ZGNB 4HTFA 1O0SA 3O84A 4Q7QA 1O96B 4FD3A 5KOJB 1GZUA 2WP8J 1YJBA 3K9GA 2NADA 2H57A 4I6GA 2DHRA 1MBZA 1T24A 3K4HA 3TI7A 4X24A 1JR6A 4J9UE 4XDGA 2RHMA 4DDTA 4I5FA 1FZQA 1ZHOA 1BE6A 3VHRA 5AKZA 3BFJA 3OH8A 3UOAB 3GLFA 2J1LA 4CL3A 2IXDA 1OFGA 3JCZA 4A8JA 4JEIA 2JI8A 2R1UA 2UZIR 4P7BA 4YT8A 2FHSA 2CLEB 1DO8A 3KCQA 3N1UA 1RZVA 3T7KA 3DBLA 1E1MA 3ONWA 5DGXA 3DZDA 5EQFA 1KAGA 1CPYA 1EUDB 2JGEA 2VYFA 1AHNA 4N5NA 1BGWA 3QM1A 4FCCA 3WGVA 3CCQB 3RTCA 2WYHA 1IZYA 3N8IA 3TLGA 4TM8A 1N34B 4CEHA 2OBNA 4IO1A 4XYBA 1JR3E 4QQ8A 3OZTA 3VGJA 2DLDA 2HMSA 2KS6A 1KYZA 2XYVA 4NHOA 4RZHA 3NVAA 3VISA 1LY1A 5F2NA 2VHVA 1XA3A 2BD0A 4G9EA 5C31A 4X7DA 1N05A 3FWYA 1CQIB 5KYWA 1V2HE 2I91A 1KXZA 2W98A 2Q2QA 3TTXA 4DUPA 5JR3A 3KUDA 1W36B 2PTHA 2YWRA 4MEJA 3ZNNA 5KVQA 5KOJA 1O96A 2BELA 2DLNA 4GBGA 3KKEA 3VSEA 2NXCA 2I29A 1ZIYA 2Z5LA 3A0UA 2ROQA 4QBTA 1BMDA 4KQXA 5UKDA 1XZAA 2ZZKA 3X44A 4G5GA 3NKFA 3Q8XB 1Z0SA 2P5TB 5EP2A 5B1EA 1BDJA 2E6KA 2BONA 1BS1A 4UULA 4B9EA 2J3KA 1DE0A 4UCQA 4UAJA 4DIBA 1NXSA 1QIEA 2Y0CA 3DKKA 2YQ4A 4P9NA 3UKJA 1GGKA 1JJFA 3PFKA 2VDWB 4TN1A 5ALQA 4Q82A 2Z6AA 1I32A 2DUUA 2HHCA 2A9RA 1UFRA 3M34A 3OZIA 3MIZA 4QD3A 1EUDA 2JHAA 5B1IA 5C4IA 3WMWA 4IGIA 2G09A 1BRTA 3MUOA 3ETHA 4PZEA 3RJMA 3ZOKA 3I5AA 2AFIA 1VYTA 1RKQA 3QEMA 3VTFA 5BOVA 2ZVDA 4RU1A 1XHLA 4C2BA 1CRZA 1RC0A 4YGXB 4NU0A 3JZIA 5CTAA 4HNVA 5A0VA 2B4KA 3MVEA 4NCIA 4KL8S 1ZBQA 3AG6A 3SFTA 4BIMA 3RSHA 4MUJA 4LRQA 1NLYA 3CRQA 4XRRA 1HT3A 2ZE8A 1U90A 1DAGA 1K6MA 1Y1KE 2PKXA 1AD2A 3NIDB 5T6MA 3T9BA 3WC4A 4GRAA 4MPJA 3ZDZB 4XYLA 4LK2A 5HQ3B 4GT1A 1W2WB 2R4UA 3HFRA 4MYHA 4JLPA 2FETA 5BV2P 4TZTA 2HRRA 3ZCVA 3A31A 2X6YA 1W4AA 4JH0A 4Y8VA 5AIBA 4E15A 3C5WP 3DKRA 1JEYB 1DKRA 4YQFA 1LRKA 1NY5A 1W34A 2EC5A 2X6QA 2BY4A 3CKMA 2G0TA 4EY3A 5F5LA 2RBEA 4I3HA 2A9QA 4M88A 1S1MA 2X5KO 2GERA 2M6KA 4QDTA 3G5MA 3N39C 2WR8A 3MHPA 1K8AD 1XZLA 4QTZA 4DY4A 5EHXA 1X8KA 1YL5A 2VDWA 3JRWA 1SEPA 2O07A 1KA9H 3PNPA 1XTBA 2Q2VA 3JTMA 2PWZA 4HJXA 1VRCA 1UBOS 1NY6A 1Y4SA 2WAAA 1HGXA 3KALA 3HH8A 1WKCA 2JIRA 2FFBA 4W9RA 3R7LA 1JVSA 4ZVQA 3LLSA 5LDGA 4BCCA 3ADDA 4PIVA 1UKEA 3HJNA 2QVLA 2WG0A 3JVUA 1ABBA 3LBHA 2UYCA 5BR8B 2FWBA 1GA6A 3SX0A 3V55A 5BVGB 5KDDA 4RCZA 5IJZA 4W4TA 4Y6RA 1WW2A 3U37A 3GIWA 3BGOS 2V58A 3HO8A 4Y9RA 1P7PA 3CMCO 3D5TA 3M89A 3TKYA 1NM5C 1NFQA 1RZ3A 5GPBA 2CFIA 1JRLA 2JFPA 3KVRA 2C88A 1E6LA 4JI3B 1JEYA 3CH6A 4X7FA 1BHQ1 1V8BA 4MYDA 2WU0A 3PNQA 1FMJA 4QDOA 1UBJS 1R8XA 3QFHA 5HGJA 4XWYA 3IBYA 3CUEF 1G5PA 2PKQP 3FZGA 1JBEA 1HLFA 2FVYA 2FPMA 4WERA 5JNVA 1VYHA 1RRPA 2SHKA 3CVJA 3LP6A 1E99A 2ASVA 1VFPA 2CXHA 2D3WA 3VR3D 1VLJA 5CT8A 2RC5A 1LPMA 4KQ6A 5JS7A 3CW9A 2XE6A 3ICVA 4NYIQ 4NE7A 5TLSA 2ZYDA 4CN8A 1LCIA 2WE8A 4MI6A 1JNXX 1DKPA 3H4MA 4L95C 3OC0A 5L3VA 3A3YA 3PDHA 4NJOA 1YQDA 3SBOA 3ZU6A 3RYCA 2YVQA 2VCYA 1Q1AA 4F5ZA 5B4VA 1H3FA 1CETA 2GF2A 3QY0A 5DTQA 4JFRA 1E1DA 5BSRA 3VNRA 3G8BA 3LTNC 3TBFA 5CDGA 5AVXA 1A7JA 1RLMA 2H1IA 5BVGA 4DDUA 4WMLA 3RC3A 2XVYA 3BWCA 2NZUG 1KFBB 4KBYA 3QUSA 5DK6A 1MHPA 4COOA 5KYYA 1Z6XA 3W5DA 2HN9A 1O8BA 5BN3B 5K8TA 1G4HA 1U8FO 4P80A 3ZUPA 4FX2A 5AMXA 4H59A 4MMXB 4PAGA 3UHPA 3L93A 4LV6A 2IZ0A 1E1QA 3UN1A 3Q7SA 3SDZA 1FYWA 2YFHA 3V4ZA 5JAOA 1EDBA 4F86A 1U6JA 5A5EA 1VSBA 1VHLA 1XNJA 1IQUA 3DJYA 1ZGJA 4RZ3A 1BHSA 2NU8A 4NCXA 1P3DA 2GN6A 4E1VA 2OP1A 5JHHB 1HETA 3MEQA 5L7WA 2W42A 2YWJA 2GEUA 2Y1KA 2Y66A 1HRKA 4GMFA 3I8SA 3PGJA 3X1DA 3MJSA 3U80A 1C41A 4F85A 1LPBB 4OH7A 1XKTA 1H3NA 4MGYR 4B2YA 2O2JA 3CEJA 4ZRDA 2EWVA 3RIEA 1QK3A 1T9BA 2GTPA 3KEOA 4HRYA 5T8KC 2G4VA 1RHRA 5JCXA 5HTOA 3RS0A 3WK8A 3M7IA 3AOEA 1WSWA 2QN3A 1KEEB 2GCOB 1D5CA 3L79A 2XVXA 1MOPA 1PKXA 4L28A 1A95A 2AXPA 2WWHA 3OCVA 4XJSA 1RIIA 1K3UB 1E3XA 3KYCB 4I2VA 1OGJA 2CN1A 3TNJA 4ALMA 2Z4RA 4HV4A 4LCBA 4ND1A 2IE8A 2HT1A 3G2QA 1V6AA 3ODGA 4RLSA 2P3OA 1E61A 5JQGF 3D7MA 3ESDA 3MGCA 8MHTA 4RDIA 3SHQA 1J0CA 1QO7A 4OGKA 4BN0A 5B5SA 3GJQA 3QU4A 2VO1A 3GVKA 3DXXA 1IWPB 3CRRA 1L5KA 3B82A 1ESZA 5CDYA 2IS4A 2V7WA 3RODA 3RRZA 2QTLA 1UBUS 2C4UA 1NB0A 1DFHA 4GWLA 4RM2A 5DBIA 5HIKA 5DV9A 3FZYA 5HR5A 1B93A 1Q12A 5JAIA 4N0PA 1TGYA 1Q1NA 2PFGA 5HKBA 1E43A 1Z39A 4RL4A 1AHPA 5K0JA 5AKXA 5L3RA 4E46A 3IUNA 2CLSA 3PCXA 3U3KA 4YRNA 1RZRD 3GBSA 1KI6B 3DMFA 4RMJA 4COKA 3OEED 1IG0A 2XXJA 2EFDB 3U5TA 2GYVA 4Z9YA 1M1KD 5JPIA 2PBLA 4G1FA 1K8XB 1RXSA 2EAUA 3W5VA 1CR4A 1RWOA 3QVTA 4X65B 1QNLA 4TV9A 1LC3A 1WS6A 1YKFA 3EODA 3KKKA 5EZYB 4AWAA 2WF8A 2FSFA 3HY6A 4NU5A 5ICFA 4OYRA 2HK9A 1HQYE 2PRZA 1JQBA 3EULA 3WFZA 1RI5A 2Q07A 4YMIA 3TL6A 3CEPB 3I55B 1V11B 3KTAB 4C0QC 4DQVA 5T3YA 3KYCA 2GI4A 3NZEA 3REOA 2O23A 2K2QB 2QPTA 2Q3CA 4OHRA 1SPXA 4NC9A 3NTOA 4X7CA 3UGKA 1PBNA 5ECWA 4CODB 1BE8A 6LDHA 1Q3TA 1OA1A 1M5TA 2ANBA 3CYFA 3INYA 1L5SA 4R40A 3CVVA 4JJZA 3IAXA 3N2LA 4LJ7A 4N49A 1GSHA 1USKA 4O0MA 4W5RA 5CLJA 3HJFA 3M6VA 3ET5A 5K0TA 4RIEA 1NRIA 2X9QA 3ETLA 1NMEA 3K05A 1W59A 1E96A 4KRGA 2WQ7A 1WIWA 5P8WA 1D7AA 1QP4A 3L1HA 5F1PA 2WEKA 4LZWA 2OCPA 1XZMA 4V3CA 2P6OA 3INTA 2HXSA 2AG0A 1BH6A 3GUYA 4HEQA 1QRSA 1FMFA 4P3XA 3I04M 2HLDA 2CHUA 4QYWA 1VE7A 3A9CA 3NBFA 5K05A 3CJRA 2ZRJA 2QJRA 4YRGA 1X7WB 2C5LA 4HYQA 2ZP1A 1U1GA 4Y7DA 1E63A 3I6MA 3W34A 1HA3A 2F7SA 3IPCA 2ZZQA 4EG7A 1BU5A 5GQSA 3R4VA 1UFQA 3FDFA 3J81k 1EBFA 4DTCA 3QV1A 5EZYA 2R4QA 1OI2A 3GLKA 3F8WA 2PGAA 4UMDA 2VHYA 3GCZA 4EWLA 3D5EA 3MILA 5JJKA 3UJPA 1Z4JA 2I3AA 3GT4A 1J9EA 3KTAA 5HIIA 4YREA 2V59A 3RREA 2HJHA 3KKPA 3FNRA 5HKAA 1T5SA 4US0R 4I5DA 4H6VA 2ZDHA 4LY0A 4HS9A 3WYGA 4L6AA 3QXSA 3H75A 2Q1UA 2E55A 2FMIA 4HXYA 1YJWB 3QEJA 4NARA 3B38A 2JPDA 3BGSA 4N7JA 4XZ3A 5CNIA 4DK0A 5ELLA 2OBTA 3TEMA 3WB9A 4FKBA 4IKEA 4EFMA 5JI3E 4OOSA 2DSTA 1NUHA 4R8SA 4U4AA 3UT6A 3KXDA 2LUOA 3ZIAD 4B82A 3P5BA 4I8XA 4YXFA 4ZT5A 4CR6A 3N28A 1R88A 4KI0A 3CLUD 1T91A 4JP2A 1BYUA 2FG7C 1D1SA 2NPOA 3MCWA 4DMFA 5C46F 1AO3A 1DCMA 3DWEX 1CFZA 4LJLA 2PX8A 1T2FA 5TARA 3E2PA 5FNZA 1WXDA 5IULC 1KDPA 1UODA 3FY4A 4NONA 3TOVA 4F72A 4PQYA 1Z25A 2VHZA 2A2ZA 3Q6IA 1X7WA 3BRWA 2AD5A 2XWPA 3QU7A 4RIIA 3VPCA 2O8CA 3R6DA 3VO2A 1UKZA 2QEXB 2NAPA 3PUNA 2CSUA 4BVKA 1QH8A 4RIHA 4OEHA 3TSWA 1C2YA 4OFXA 3A1PA 2ZZMA 3ZU3A 4Q9IA 4FFBA 3MHTA 4DA6A 1P9WA 1ZJ4A 3AL0C 3EGWA 3IDFA 1TM7E 1V47A 2A33A 1CUIA 1NW5A 2G76A 3I04A 4G0NA 4GNRA 4LISA 5EHGA 2CNNA 4LHEA 4NFYA 1C50A 3FJ1A 2JIZD 1ATZA 2OHFA 3B6KA 2CEKA 4KE9A 4OU4A 1E2LA 3GZNA 3Q98A 4MUYA 3N5KA 3M81A 1LLQA 2VPPA 4H6WA 1JTEA 1KYTA 1S9HA 1JQEA 3Q9NA 4BWFB 1FJGB 4EATA 4LOIA 5CLLA 4RX1A 2F55A 4BQNA 2VATA 1DC5A 3C3XA 1RJ9B 2N75A 4E7OA 1WM1A 5BNZA 2IEZA 3L8DA 1XZDA 3ICPA 4KE7A 1E89A 4G5OA 4I1UA 3DGFC 3IAFA 4PLGA 3CH7A 1ACMA 1N4DA 3UGTA 3BFPA 2WV9A 2BJVA 3RUAA 2H6EA 4F97A 3WNZA 3LIIA 1KZHA 2FMKA 2GZAA 1NJ2A 1Z4NA 2Y05A 4G0YA 3ZHTA 4L16A 4MDFA 2X8JB 1EVEA 5D85A 5CMLA 1IY1A 1NOIA 1NN5A 1T2AA 2Q8NA 1RKXA 2W6QA 3NC0C 1T9AA 3O1JC 4R05A 3I73A 1YZGA 4IHJF 4M98A 4LOAA 3QE9Y 4MUHA 3TSYA 4L50A 4WZTA 3Q88A 4TL9A 1BD4A 5CNMA 5EKSA 4XONA 2QBYB 1H9AA 3ZDXB 4D96A 3SD7A 2LR0A 2YWXA 4FT4A 3GB9A 5TQJA 1OVGA 5BSFA 4NOLA 2GN1A 2F43A 1R3DA 1WPGA 1SCKA 1XZCA 3PF8A 3THXA 2NVUB 3QK7A 2DETA 4DKXA 3WAGA 3VM6A 5IFKA 1QBGA 2OYCA 1P9LA 3UC9A 4DR1B 1L7DA 4IV5A 4BIIA 1ZHHA 3GEMA 3P52A 5FXMA 3NFRA 1P0IA 1Q91A 1RJ9A 2ZB4A 4A0GA 1UK7A 5TE9A 3WMEA 5C5EA 2ZCVA 2QE7A 1CUDA 3E82A 2FMHA 1GAQA 5FLEX 1E1NA 3BM5A 4B4VA 1K6XA 1P0CA 4FQ8A 5EHNA 4OKIA 3KZKA 3D64A 2IU4A 3E23A 2RONA 3FBTA 3P0FA 5AICA 3UVEA 8LDHA 4N0MA 2AXEA 3BG5A 4W5TA 2VP5A 3BEDA 1M1YB 4A4DA 1V26A 2QI9F 1L8OA 4G1MB 2X8JA 3NDPA 4X44A 1YI1A 1XNQB 3ENZA 3IJEB 1W581 4OI4A 5FBRB 4MVJI 1S7GA 3AVYA 1XTIA 3U3MA 3PPWA 3P2KA 3T9EA 4R7TA 2WU8A 1HYBA 1ZGAA 4Z1MD 1ODFA 2C2HA 3I9V6 4PNPA 3ZWXA 2D1RA 3CR8A 4KNVA 4EF4A 3TQHA 1Y3CE 3DE6X 3OFKA 1AO0A 1N6OA 3JX9A 4L4YA 3ENQA 1SR8A 4QE3A 1U1EA 2UZ3A 3P9RA 2HQRA 3V3TA 3IRVA 4Q4HB 5IC6A 2DR0A 2WUEA 4MWGA 1TYBE 1M54A 1YDGA 3CWCA 1XLVA 2IUEA 1BGXT 4MULA 4QYTA 4UVEA 1L5HA 3VR4A 3AR7A 2XGSA 5IVKA 4OJKA 2LCFA 1HE1C 2H1WA 3ASYA 4ZQIA 5HG0A 4CLDA 3UXEA 1C7FA 2GFQA 2GDZA 1QKIA 4ZEXA 2R7LA 2OY0A 5KKCA 1Z08A 2WT4A 4R51A 4F6LA 3VKWA 4MRRA 4P5DA 1NVKA 2H48A 2Y0DA 3W6NA 4BDSA 2Z83A 1CJSA 3B3FA 5HIMA 1JDPA 1R18A 5FUVA 3HPQA 3AHDA 3AUYA 2ANCA 1SKQA 5ED4A 1M1YA 2CDCA 2ATCA 1WOSA 3W5HA 1M6WA 2OC9A 1VKNA 3Q8WA 1CQZA 4QT0A 5FUQA 3MOIA 1Z3CA 1K6JA 3MOSA 5IXSA 2XTNA 3CINA 4KO3S 4BGEA 4XJVA 1F6DA 2PFKA 4BRUA 1PS8A 3JRXA 1BEZA 1SO8A 1YRAA 1QX3A 2A5YB 2RK6A 5D6OA 1L7QA 5F7JA 4O4LF 4IKPA 1AOXA 2GK4A 2GMWA 3I72A 1RRFA 1F0NA 2VHQA 3VH1A 3A6KA 3BCDA 1SVOA 3O8OB 3BBPA 1TTPB 2NV6A 2NYVA 2VP4A 2VXOA 4JBLA 1C7JA 1R9JA 1ZNWA 2VSYA 4HGRA 5CCXA 1GKYA 3Q41A 2A84A 4LC0A 1BJTA 1GOTA 4OPSA 4N82A 2H9YA 4QAQA 4Q4HA 3ILYA 3G2NA 4YRTA 4ALLA 4EA8A 1YTUA 1R4AA 4WW0A 2DH5A 5ICMA 3QEAZ 1BD3A 5E3JA 3DJFA 3T9FA 4LRYA 4PLZA 4OXNA 4AM8A 1V3QE 3F1KA 3TRIA 4GBMA 2PZKA 1YI2B 2NTVA 1W87A 2B83A 4FU0A 4HWSA 4B71A 621PA 1XEFA 2FF7A 2GN9A 3P45A 2A9OA 3UQYS 4RJTA 1V45E 2CXPA 2REXB 4R3UC 1THMA 4Q9JA 3T3PB 3PC8C 2WRZA 4KCGA 4GZ5A 4BB6A 3AZOA 4HZGA 1A96A 2Y6UA 1NB9A 3I0NA 4H1HA 3JASB 1VE1A 4AJJA 1CX9B 4OK5A 1E1RA 5A3QA 1QAOA 4F96A 4XN3A 3GYBA 4BMXA 6CHYA 2VTEA 2WU1A 4Q01A 1IATA 1O95D 3DTVB 3OTQA 4K2AA 4Z0HO 1U2ZA 2LZ0A 3M2TA 4TYPA 2ZSEA 2AFHE 5CLIA 4CHGA 3FFAA 3PNMA 4QFCA 1L6IA 4NSNA 3O8OA 1XMVA 3ESYA 3SZGA 4ITUA 4TLDA 2E5WA 4NPAA 1BC5A 2J5QA 3OQIA 4YRJA 2EZ4A 5JNLA 1E18A 2QXTA 3W8FA 1TIKA 1SXQA 4EDHA 3OP1A 5CEEA 4PAWA 3EEBA 1UM8A 1B0PA 5JW6A 5TX7A 3UV3A 1O0BA 2JI4A 3I2YX 3L7OA 2H54A 3M33A 1NMZA 2ZYGA 5EKUA 1DJMA 2PMFA 2DQ4A 4QPJC 5MGNA 5I5GA 2WG2A 3HL0A 1KK1A 2EWMA 4G5XA 3DZGA 3QYFA 4NV0A 1OXTA 5AKLA 5E8JA 4ZMBA 5FTMA 3SC4A 2P1RA 4BMYA 4N8SA 4Q1VA 5KPDA 3PTLA 4QBGB 3IQFA 3W2EA 4Q34A 3MTEA 1ORDA 3R3XA 4GP7A 5ERYA 2YASA 3IUSA 4KV9A 3CY6A 3TW6A 1VL6A 2OR3A 2CW5A 3BICA 4Y1RB 5JVDB 2HCBA 2PV7A 4IS2A 3G2HA 1K8ZB 3CCRB 3EF1A 5ALKA 4YLGA 2QG6A 3ZE7A 1YB5A 4X6YA 4NOJA 3DTVA 1X1SA 3NV7A 2QZ4A 1SZJG 2FOIA 1TL7C 2WIGA 4FSXA 2RCYA 3BCRA 3I9MA 1KHHA 2GN8A 1K0UA 2IKQA 2VUTA 4E5YA 4IRXA 2I54A 5AW1A 1Q0LA 3LQ2A 5J2TA 4BY9E 4F2HA 4EKDA 2XCUA 2P69A 4WGFA 1V1RA 4XDZA 2PL5A 3V4PB 4PGFA 3KT3A 3PFNA 1FW6A 1NXTA 2P2NA 4WZKA 3L8YA 1JEAA 5TT1A 2XX3A 1W52X 2ZQYA 1PL7A 1CDDA 4OOFA 2XQVA 1VBFA 3WKDA 2IH4A 4ECEA 1WR8A 1YMQA 2ACWA 2BFOA 5DMHA 5EIHA 5FUWA 1Y1SA 5JRDS 3F9IA 4EG4A 2P8JA 1GZHB 2F3SA 5KJFA 1XR3A 4POAA 1CUCA 3PITA 3GT3A 1KEWA 3E18A 1YIJB 4ALNA 1RQPA 2H4FA 4ZO4A 1Q1BA 2VJIA 1PVDA 1UJ5A 2AEJA 2Q9AA 1T1JA 3BORA 3GUVA 5EAIA 3CBGA 2P2SA 5IKOA 5CFNA 3D1JA 1FB5A 1UANA 4MYRA 5JVDA 1Q84A 5K3EA 4AJPA 3KVVA 4NENB 3VDQA 5FD8A 5FOTA 3T51B 4C76A 1HNWB 5FQNA 4EB6B 1FQWA 4CIAA 4UXHA 5B1SA 1KY2A 2ZS9A 4E5MA 4ESOA 2CF5A 2XITA 1EFDN 4R9UC 4WH0A 2GJPA 1LPSA 1QP7A 3CLTD 1TU0A 4X84A 4X93A 2C2YA 3DE1X 2QP3A 4HAZA 3ZJYA 3K31A 4Y2PA 4EG8A 2VWGA 5KX5A 3OX4A 4C07A 2QKYA 1RBMA 4F92B 2MDTA 3HUDA 3WLMA 1S2NA 3OZEA 1AC5A 2PO5A 4NFHA 1CYDA 3K9FC 2WB4A 2E82A 3M4NA 2QZSA 5K4HA 1I2ZA 5SZKB 4BAGA 3PGMA 5A62A 4ZT7A 4OO3A 1A9SA 1QC5A 1YC2A 3E3AA 5LOVF 1K9SA 3H9QA 1PFUA 2ZLBA 4LRUA 4KFCA 4KVZA 4R8VA 4INOA 4FBGA 4TS3A 1YS7A 1YRYE 2BHNA 1IK6A 2OBSA 3VPXA 1I1HA 2FY8A 3NDRA 4DSOA 1UP4A 1X2BA 2EYUA 3AF5A 1AB6A 1HYQA 2DZDA 2GRAA 3UBMA 2NO4A 1JLSA 3NHWA 2I6XA 2JHPA 5COQA 1QBKC 4PG8A 1MZPA 2J45A 3KKNA 3UJHA 4A8HA 2CKMA 1I2CA 1DIGA 1DRKA 1X3LA 4U3JB 3BY2A 1HL3A 1UBEA 3PL1A 4O2AB 5IARA 5C53B 1GNQA 1GNVA 1RZUA 1SMKA 3AF2A 3PFHA 3CW2A 3CF2A 4L3VA 4RAQA 4BU0A 5FUYA 4YUAA 3H5OA 1X74A 5J3OA 2ZBGA 3BL8A 4Q3KA 3GQBB 3NGXA 4WCVA 3IQDB 2QOEA 1FVFA 1CUJA 4K8RB 3GBVA 1H2AS 3C7KA 3P4XA 1GNRA 1PT9A 3IX7A 3QLVA 4NR0A 1KKMA 3H2GA 3GRZA 3TKLA 1Z45A 2FU5C 2XTMA 5B3AA 5GZ1A 1OU4A 5CK5A 4MCIA 5DISB 1U3UA 1Y1QA 2GPAA 3PQ3A 4EUEA 2DR3A 1KHTA 2CLIB 5IYZF 3WL8A 4EH1A 1L7EA 1QCYA 2H59A 3PUXA 4TQGA 1G20E 3ZNQA 3W3AH 5AK5A 3JZAA 5EY5B 3AW8A 1RCFA 5CX1B 4UTRA 3BIWA 4L3WA 4YCNA 4YBZA 1X15A 3SYLA 5A4MS 3SS8A 1IUNA 1KMNA 1PDOA 2GBCA 2YV3A 3H42B 4LDQA 1RJEA 1XOIA 3EWNA 2G5CA 4FMDB 1LB1B 1NAIA 2WBLC 3UAYA 1Q0ZA 2GFIA 2VKQA 4CDGA 1W30A 2QX6A 3GHHA 3NC1C 3JS5A 2AG6A 5F3DA 3NKVA 1I13A 3H94A 4MB2A 4U3JA 3RQSA 3PQ7A 3RNLA 1RABA 4YTEA 3VVMA 4E08A 2PUCA 3AVWA 2PS0A 3UMRA 2ODAA 5KYXB 2JH8A 3OQ6A 1QG0A 3WRWA 4I9FA 2W6JD 3LHFA 3GQBA 4NS1A 3HN7A 1M8FA 3G0IA 4AMBA 4KMSA 2WKSA 1SHJA 2OB2A 5HDQA 3C4QA 3NUZA 5ALEA 1NP3A 3KG2A 3K1JA 1S6YA 1Y7TA 4HQNA 4M1WA 4BXOB 4L0DA 3U56A 4V0SA 2CHFA 2O1SA 5FO0A 4TSKA 4G65A 1M6HA 5DE3A 4LJ5A 1AJEA 3D1VA 3FRHA 2B6HA 3LO5A 4B3XA 2NQTA 1RLTA 1NR5A 5KYNA 4R1NA 1X1BA 3DH0A 5T67A 3OLXA 4X8LA 2C2OA 1T36A 1ZRNA 1Q6ZA 2Q45A 4JWKA 1K5GA 4H17A 4KG7A 4MUIA 4PXAA 4QXMA 3CT6A 5F2OA 5G0SA 5T6BA 3RYTC 1KI8A 3EGVA 1E9BA 1DVRA 3VR6A 4RDJA 4I4TF 4PG6A 5EFOA 1SHKA 2ZIVB 5CX1A 2DQSA 4HFRA 2C57A 2NLOA 2YCLA 4J94A 3WBBA 1Q7YD 4AZVA 2SCUA 3S2SA 3LFTA 2A9PA 3IPXA 4CF4A 3HNRA 5CDFE 1K92A 3C70A 2JVJA 3EXIB 1ZUD1 3RH0A 1VMAA 2W6NA 1N6HA 3D8UA 1V96A 5DM4A 3LRPA 5HMMA 1SH7A 1NIPA 2IYEA 2YV5A 1WHSB 5TGTA 2QYTA 3TSAA 4RSHA 4XQ0A 2E0IA 4ZVTA 1LC0A 1CG6A 2ZI3A 1B00A 1W6UA 1YJ5A 4IIYA 1SVIA 4PHHA 4JP5A 4Q3LA 4D3SA 5KVSA 1K7XB 4M7OA 4RPBA 3CCSB 3C7CB 2O0JA 4LMPA 1AURA 4MS1B 3VNAA 2VQEB 1W35A 1GTRA 4DWOA 2Y1XA 5CVJA 1WXQA 1NMYA 3GC6A 4BXOA 4TTRA 3WXMA 3W2TA 2XB8A 2BEKA 3EZFA 3CEAA 3IULA 3VC2A 5BV8A 1RHQA 1G4AE 1HT0A 3NCHA 3ONFA 4NHEA 4BO5A 1HKHA 3CE6A 1JF8A 1UQUA 3CMAB 3LKBA 4NZMA 4GECA 3WHIA 4RQBA 3CUVA 1S02A 4RIGA 4BKQA 3ZIUA 1RZRA 5EQDA 1F2DA 3R6WA 3F7MA 3ZWVA 3R74A 2FDRA 2IZ6A 2C2KA 1C0EA 4M0MA 4UUQA 4YJDA 3DOUA 1VCHA 3VX4A 3KLOA 1OFUX 1IZ9A 1KMIY 2GM3A 4XTCS 3PBKA 1OZFA 1WOOA 1KR2A 3KVOA 1LVGA 1E7MA 1M0SA 4L8FA 4RCVA 4EG6A 4BVGA 3LSYA 1FFEA 4J1TC 4JVNA 5CT5A 3O75A 4F9FA 2QTFA 3M4YA 4I46A 4DIMA 2ZZEA 4QU0A 2G9RA 4A1OA 5H82A 5K6AA 3FRJA 1CF4A 4OPOA 2XB6A 4IIUA 2DPYA 2OFXA 4DKJA 2J87A 3O4JA 4WFJA 1ZSVA 3KFVA 4LHSA 3VSDA 1CDZA 4UW9A 4C0HA 1AHHA 4F9GA 1LGYA 4DN6A 3TINA 5C8VA 2A4MA 1NF8A 1YCDA 2NXWA 3GNSA 2IOHA 2JJ8A 3JQ7A 4R1UA 3WGNA 1C4WA 2ADFA 1PBTA 4MS1A 2DERA 2O2EA 1TE2A 1WW3A 2JAPA 3K70C 5G53C 1XP5A 1F0PA 3IEPA 4P7GA 3CCJB 1Y7PA 1H8HA 3OQHA 4UNSA 4KXLA 3QKWA 2ZE5A 3CLVA 3CLUC 2FE4A 3EUAA 1J21A 2FQQA 1VQ9B 2AOXA 2HRQA 2FZLA 2L19A 4PFKA 4XX0A 4YRSA 3OTOB 2H1HA 2P75A 1UWVA 4H77A 4P3NA 4KNWA 4LDPA 2ONJA 3MG9A 2FZ4A 3GRAA 1VJTA 2IIVA 4QVKA 4OX9Y 4N5IX 2AOVA 4MDYA 1N3YA 3BBLA 1NXXA 3QSYA 4QDUA 5IX8A 5JCOC 4UDYX 3TXXA 3OLVA 3U1VA 2A1TR 2PAAA 2FW9A 2W6ID 5BSHA 4G0VA 1IBSA 4UUBA 1F8XA 1NQAO 2QW1A 3RFFA 1GZ6A 1S2MA 4R3WA 3T94A 2AQHA 3V7UA 2H7VA 5FI5A 1AUVA 5LMZA 1XQYA 4AF6A 2CZQA 2QMEA 3D6NB 3EIEA 3NH6A 4URFA 2VUIB 1J24A 2MSNA 5JZBA 3GJ0A 3UJ6A 4AKIA 2RMKA 221PA 3LY8A 3VAZA 2YXPX 4YCAA 4UUNA 2ZROA 4AI6A 1QUFA 3DBVO 2VBVA 2C9OA 2X5XA 2FR8A 3D8BA 4IDDA 3MERA 5CPBA 3ILSA 4Q0MA 4O5OA 1E2UA 1VQOB 1UAGA 1VG1A 4IQFA 1HTTA 3KQQA 4LTMA 4RDHA 3VZDA 3K5PA 4KKVA 3DMGA 1FP4A 5FOQA 4E6PA 2G0NA 4UU7A 1UPAA 4I55F 2AK2A 1PEYA 4LMRA 3V8RA 3KHUA 3M6LA 4J6FA 1Z0IA 4Z4QA 1Z4OA 3BDVA 4AJNA 1EFTA 1VQNB 3QOYA 5DHAA 1DLIA 4L74A 2HBRA 5JS1A 1QK4A 1A8UA 1FTQA 2AN4A 1KS2A 2DT8A 4J0JA 4EECA 4WZ6A 4XQGA 1TAQA 1QUEA 2HPZA 4E2FA 4ITRC 1M1UA 2F6RA 4HR7A 3LE8A 1LBSA 4ZEMA 5IC4A 1X38A 1ECGA 3EIFA 3H17A 2R00C 3K4QA 5FAXA 4NBKA 3U26A 1KEKA 2FPWA 1GPYA 1NW4A 3E4DA 2PGDA 2KYRA 2PYDA 1WB9A 1SZPA 3D6JA 1ZNXA 4ZU6X 5JARA 5KMGB 3PD1A 4UTNA 5GONF 3WA6A 3V6LA 1JJ7A 3VGPA 2C5GA 4BBZA 1WMBA 3MCVA 1M2HA 3LOQA 1O8CA 4DCJA 5JC8A 1K3FA 3FDXA 5ALLA 4BV8A 1UJ2A 3KTOA 1NT4A 2VNAA 4H7HA 4JENA 2DKFA 2QTGA 1CF2O 5MGBA 2PZ8A 2JIZA 4KOEC 4B73A 1KBZA 4FOLA 4BE7B 3PL5A 1ZWKA 2P41A 2C92A 2XUKA 3E35A 3IT2A 4MVYA 2I7DA 3RAPR 1A5TA 3IIMA 1EH5A 1QVWA 4JT2A 5FPTA 3LQ1A 1KJJA 2X5OA 5CU7A 2V0CA 3C6XA 3TGWA 1LNZA 5FCDA 4DT1B 1E32A 1VE3A 3GJ5A 3T7RA 3UFXB 2BVNA 3NHYA 3PIDA 5L6MB 2WTNA 5K1ZA 1OBOA 3AJ8A 1XRQA 4J4TA 1XK6A 1IAVA 3FFXA 3O2SB 5CRIA 1C3LA 1KMQA 1XBTA 1Z8DA 4EW3A 2CUTA 2O8EA 2OCBA 2RG1A 4XLCA 3UHOA 1DU4A 1E0JA 1VYUA 4N3CA 2D0PB 3WWCA 4B2IA 2VUSA 4DRYA 5JD6A 2XLBA 3O0TA 1L8LA 2W6MA 4A03A 4C4YA 5KQPA 1ZY2A 721PA 2A88A 2MSEB 4O0LA 1P8JA 3BUSA 4AQYB 4CM4B 1ZP6A 2BGRA 3A1WA 3L0YA 5KMGA 5LMCA 1EVLA 4GIBA 3QP9A 2L82A 3AYXB 3MC1A 3VZSA 4PO8A 1ZBDA 4PEVA 1Q3KA 4PAMA 3A2LA 3H1GA 3RB8A 1NKSA 4IJUA 3G6KA 4CM3A 3LZCA 4JJ4A 4ZVSA 2GESA 5CM8B 4B3HA 4UFNA 5AHOA 5HIJA 4IWYA 2FGJA 5KYKA 2A0XA 1IEWA 2VOJA 3K1AB 3ZVKA 1KEZA 4CWAA 4B4DA 1CY8A 2Q46A 2C1XA 5FV4A 3E5NA 1U8CB 3AY0A 3MSXA 1G21B 3CRW1 2RKBA 2FA9A 3FG9A 4FLFA 3P9KA 3VVBA 2RGEA 3GCGA 1QRUA 3KR9A 5EIXA 4D0SA 1QOZA 1IZ7A 4TM7A 3UFXA 1UPTA 3AEZA 5D6NA 2A0YA 2O1WA 3KJFA 2J0EA 4B8YA 5U4QA 1YRLA 4DYDA 3LF2A 2IBTA 3U7IA 3WBKA 1ORRA 2RGUA 4FP9A 2VP6A 1CW2B 4NPHA 2JHFA 3MS2A 4OMUA 2C2MA 1QCZA 3W04A 3ZOZA 3ZGZA 1RBZA 5K8LA 4HGZA 1GITA 3QWHA 3R0XA 2AMJA 2P2LA 3W9YA 1OXVA 1VQKB 3VPDA 1R8JA 3RVNA 1VI5A 4ZU3A 3L0PA 4HH0A 2H0AA 1GGVA 2WAMA 5A7FA 3WYBA 1UJ6A 2X6RA 3QZUA 3FROA 4EBFA 5JEEA 4Q4DA 2P9QA 4BAZA 3WGKA 4HVAA 3GLGB 2C59A 2NZVG 4JDPA 2NV2B 4C01A 2MTBA 4FB5A 3SC3A 3ITKA 4L4XA 4DAOA 1G7SA 3P0EA 5EESA 4UKDA 2V9ZA 1F9EA 1R27A 3K92A 4Z1MA 3TKAA 4TPKA 4F3RA 4EJ2A 5JQWA 4DR2B 1KSGA 4KIGA 5CB4F 1JJ2B 1SCBA 1GUAA 5LQSA 3FPCA 3RTAA 2CVHA 3MCUA 2FSSA 3K1AA 1RQGA 1ZAKA 3C3MA 2O2HA 5I7AA 2XNHA 3T5BA 3SIPA 4B47A 2JARA 3U6KA 4PBRA 5KKNB 4FD2A 3HJBA 2PV0A 1I18A 3GJ3A 4UTZA 2UUAB 1G21A 4F3NA 3TAHA 3NM5A 3NM6B 1KWKA 3GRPA 1XJ0A 5HYVA 1IPHA 4UM9B 1MG0A 2EHJA 1DC8A 2P9YA 1H0RA 3A9UA 2P4SA 3R2JA 1WMAA 1NRWA 1OXXK 3HJUA 4JJAA 2F8MA 2VXYA 1ZJ6A 3MQ4A 4WNCA 3FTPA 4Z54A 2A9KA 3M9XA 4WA8A 4NPCA 2WMYA 2AOUA 1NTOA 2JBWA 2TYSB 3DKIA 4EHBA 5J1SB 1AS3A 3LT4A 5KNBA 2RGNC 4YJ3F 2C96A 4HB0A 2J31A 4MRMA 1M3SA 2Q5CA 1KH2A 3ERCA 4B7AA 1HEYA 2RHOA 5GADl 5IT5A 1NQVA 2VVTA 1T6YA 2IUFA 5AW4A 1A5AB 4FJ1A 4KSBA 1YQEA 5D1HA 5JASA 1PG0A 4QVAA 2EQAA 2KPOA 2MMCA 1ZESA 1QGOA 3NJ8A 5TB5A 4B87A 1NR1A 2WF7A 1IL0A 4PFSA 5B7GA 1EXWA 1T3LA 2WABA 4YT5A 3DVQX 1T1RA 1C3VA 4E2WA 3SKXA 1D4OA 1E69A 3E6AA 5DPMA 4DY6A 4IEIA 4EJ0A 2H92A 2PRYA 3AJAA 1LS6A 1W2BB 1ECJA 4XTRA 3I09A 3H05A 3HDYA 3PVSA 4GLBA 4YRZA 1QQTA 2P2GA 4MP3A 2YWHA 4OBXA 3KLPX 1H2HA 1DP4A 3QPAA 4B8ZA 2Y27A 2LGJA 5E6SB 5JO0A 4W5NA 2J85A 2H4HA 2J48A 4DIEA 1CSEE 2QVGA 2CUZA 1FP1D 4PQFA 3R6TA 3KOYA 4RS3A 5HILA 4EL5A 3KR1A 2A5DA 2ODBA 4EJSC 3IO3A 1O5TA 3I56B 3G9QA 1AX9A 4UXIA 4C7KA 3HXOA 4L27A 2WU4A 4DA4A 4UNNA 1XEAA 4R2KA 3C16C 2VR1A 2PEYA 3GXBA 7GPBA 3NKLA 3FMVA 4MINA 4P5EA 3WKAA 1W8IA 3QXGA 4DOMA 1C3EA 1SXHA 1KXJA 1NW6A 1H5UA 1WB4A 2CYCA 4JFAA 5K0NA 3ZW7A 5F1KA 2OV8A 5B3KA 5L3QB 4Z4IA 3BRQA 3G8YA 4MTLA 2DXIA 3AV0B 3LCJA 2Z6BD 4NOKA 3ZTWA 2Q28A 5KNDD 5KTSA 2F9MA 1D6SA 1ISIA 4TMTA 4E94A 1O95A 1NVBA 2EJCA 2DQYA 1BVRA 2NZ8A 5EIBD 1F5NA 2PH1A 4HGYA 2ACEA 4KK3A 1ZA2A 5KC8A 3AUTA 4MEBA 5CX4A 4G1EB 5LP6F 3IRUA 5EI5A 2GZ1A 3V3KA 4YP6A 5K8JB 4QFBA 2H17A 4L8GA 2BFNA 5LCXA 3AKZA 4NCBA 1KO1A 2AUNA 5KIAA 2GZSA 3R3UA 3PWTA 5A4FS 4X0CA 3SX4A 1K2WA 1Z17A 2XMDA 3X1KA 3SC6A 1XRPA 1KY4A 3LX5A 4MWDA 1TM5E 2Y99A 2W8ZA 3OPVA 3HA7A 4UAVA 3VR5H 1FW8A 2X2FA 3LL7A 2E1RA 3DE4X 2EKDA 1QGDA 4MUKA 5DM0A 3SXPA 4HRAA 3ZDFA 4QREA 2GCPA 4GYWA 4BZWA 2QEQA 1U9ZA 1W29A 3KQWA 5IKXA 2IU3A 2JASA 2I7TA 3FHLA 4CMBA 3CVUA 1GP2A 4D2IA 1UMDB 3T52A 3D3JA 2Y1CA 2O20A 1GLGA 4RY0A 1T8UA 1UFOA 4KLRA 5BXYA 4UNIA 3PR3A 1MJGM 1TUIA 1NHWA 1GUDA 2BFPA 3K9CA 4RUKA 5DYGA 5L3QA 2F1IA 2IT1A 1R5BA 3LYUA 4YB8A 4ZYYA 3DMNA 3Q7QA 2RH5A 3GARA 2CUKA 1O6FA 3IHLA 1E2PA 3UKDA 1WL8A 3BCHA 1R66A 2Q62A 4AF8A 4DIKA 5FWXB 2P4HX 2EG9A 4WD3A 4JITA 4Y30A 3KHTA 3LBNA 2JVIA 1Z0DA 4E30A 1D4FA 1Z8FA 2XCLA 1FXWF 4BKUA 4JKYA 4LVOA 5L40A 1J0EA 2O0HA 2XDYA 4XVHA 3HKCB 5C1DA 5MDHA 1DBSA 3UK7A 3MTJA 1A82A 1JI0A 2H2GA 2IYUA 3DEHA 1SC9A 2G70A 2PWYA 1FDSA 3E61A 2APJA 5FT9A 1KK0A 3EQ6A 3ESBA 4LGCA 1E64A 1RR6A 4K9OA 3QEKA 5DOZA 2FH5B 1OWOA 3AF3A 3IE1A 3DAYA 1GM5A 3IDSA 2V31A 4JIGA 4LAFA 4UNPA 2OXIA 3OQPA 1Y5IA 4HK4A 4TT3A 3V34A 1N3LA 2QJOA 3L82B 3ZV3A 3TI9A 3EEQA 3A10A 1U4OA 1U04A 4AO6A 4M6WB 1HTBA 1UMDA 2VTVA 1CUEA 5ESDA 1CDOA 5AVYA 2ODWA 3KXIA 4TVSA 1GTMA 2XCQA 5HEKA 3V80A 1MJ5A 2KWIA 3ANLA 4C7BA 2HA2A 3O38A 1QONA 5HMLA 1RW4A 5AJVB 5LYJB 5GP1A 1ELOA 1GT6A 1KPGA 1TA0A 3FNIA 5CH3A 2QLJA 2YBDA 2NUAB 2H5JA 2VTBA 1GQYA 4BB9A 4R8MA 2XKAA 3MBKA 5IBQA 5EMJA 3HCFA 3ULKA 1M2VA 4HVCA 1ZEMA 2AVDA 1I3OA 2CLFB 1PJ7A 1UP7A 5KOHB 3U9LA 1O1YA 1H2BA 3JQGB 1JDBB 2EP7A 3KJZA 1MJGA 3RFUA 1X2EA 1U65A 3L18A 3HACA 3NYIA 3HKCA 1GYRA 1I9CA 1P9OA 2CLHB 4QUZA 1L5ZA 3F9RA 3GCDA 4LNUB 4TWIA 1LX6A 4XVCA 4MV3A 1NU8A 1YJNB 5CB6A 4HLUA 4K46A 1W36C 4JYPA 4FXUA 3MTIA 1UBLS 1Y3FE 4C2AA 1Y9DA 5BRAA 1JDZA 1RHKA 4EGQA 4CDNA 3IALA 4XQ9A 5ELMA 7ADHA 3SF8B 4Q21A 5A5GA 3V2IA 3JU4A 4UAGA 2UZ4A 3T1TA 2O8BB 1E3WA 4M6WA 5CHEA 1J8DA 2O7VA 1B8UA 2XF2A 1ZIDA 5CDFA 5AHWA 2Q9CA 4NATA 3NWPA 1W5TA 3ROXA 4GS5A 1SULA 4TMWA 4IIEA 4D9MA 3D7KA 4EBBA 1MDBA 2WFMA 4AMZA 1LLDA 2WWWA 2ZDGA 2NUAA 2PMDA 2MR6A 2C77A 3VPAA 3G88A 1PYDA 4G5SA 3PGVA 2VIIA 4DNPA 4PZUA 1N0UA 2C3YA 5TGDA 3USZA 4CFZA 2FX3A 2HO4A 3AETA 4J43A 1J2YA 4KJXA 5EHIA 4Z1OA 5BW8A 1RWXA 3IR5A 1MJHA 3F6EX 3G0GA 3O8NA 4LN1A 3QFSA 3GJSA 4Z0PA 1AKRA 1HDXA 5EMLA 5WRFA 4G0WA 3JQGA 4EW6A 2PE5A 2ZTUA 3SMVA 2BBWA 1BH2A 2FFRA 3ZDBA 5IS2A 4LE1A 4RA6B 3L8MA 3X3HA 4BASA 4LNUA 1Z2NX 4CV3A 1J0AA 3BXHA 3WIUA 1CLEA 1BU8A 1N6LA 1U8AA 4F04A 1KMHA 1WDTA 1JZTA 2ARKA 3NU1A 4YRRA 5BQXA 1FDTA 2F2TA 3A1UA 1H1LB 3GJYA 4HO1X 3V1LA 1HSZA 3SVTA 1I2DA 2O06A 1XA4A 1F8YA 1F6WA 2H16A 2VJPA 4OHZA 1PT8A 4HXGA 2WJ6A 4OG2A 4P4LA 3BZWA 3NTVA 4PHCA 3SF8A 5I7RA 4AROA 3D5QA 1N25A 5FOXA 4QYXA 1NWHA 4JEHA 3VZCA 4HGPA 4MZDA 5KSYA 4OX9B 4A82A 5JY6A 3A4MA 1GXSB 4GP6A 3NPMA 1ZK0A 5CXUA 4Y2XA 2IV3A 1VQ5B 3JXEA 3W8DA 1C0LA 3UMBA 4IDBA 5JJLA 3AEYA 3CGWA 1Z33A 5HF6A 1FNCA 2OBXA 2HMUA 2G1PA 1HFKA 4EGJA 3OZRA 2HZ7A 4IDAA 4ZJZA 4MR8B 3UA4A 4ZDIA 4V1CB 4RSMA 3TLYA 3R75A 5BO5A 4J0GA 1NVVR 3OCXA 4NU6A 1Y37A 3H8JA 4NK5A 2W6JA 1Q9SA 1ZUIA 4PQGA 2XD4A 1ILEA 1L4UA 2OXFA 3F6BX 1YJXA 4HAWA 1HDEA 4U9IS 1KTIA 3TLEA 2IPMA 3AWDA 4EYEA 1LPPA 1ESMA 2XAAA 3KSZO 1A4RA 3N76A 2QUIA 1UAYA 2LKCA 2V55B 3AHIA 1X7GA 1F5SA 1RWWA 3PXXA 4RA6A 3W05A 5KJ6A 4M0KA 1W85B 1G3RA 1L7XA 1T4MA 2JIDA 3BJIC 4FZVA 4I6JA 4ZDKA 5FLXA 3K94A 4MI1A 1KJZA 4M83A 3C3PA 2I2FA 1ZJYA 1H1LA 3RTGA 1BX0A 4GKJB 3JWPA 1SVMA 4PLVA 4RA9A 4JC0A 2ACKA 5ADUS 5LJLA 3FCUB 4K03A 3WXBA 2C9YA 1DI0A 1W48A 2YVAA 4MH0R 2VZ0A 2XOXA 1AGNA 5LVAA 3S27A 4WN3A 2JFWA 1T9CA 1RM0A 3PHJA 1ILWA 2GHTA 4RK7A 4B2PA 3JQ9A 5BWMA 3P32A 2C83A 2WWTA 3OQVA 4TN5A 4IFTA 5JS8A 3ZY6A 2ZXEA 1VTKA 3PUVA 1E3JA 2PVSA 3G9XA 2ZRQA 1J42A 2CXQA 1KO4A 1TA4A 2F1JA 2G5GX 2PWBA 1IRIA 3HC7A 4O4HB 1NL3A 1PWYE 1VA5A 1X9IA 1HH4A 3Q2OA 4GLOA 3VBCA 2YMLA 2PQMA 1HV8A 1U9YA 4MR8A 3BZBA 3HUFA 3JAWB 4FIZA 4KTTE 4WZAB 4V1CA 2ZBRA 3P9NA 1C0KA 4HNRA 3AI2A 3A6HA 2XBMA 3Q3CA 3K1ZA 3W90A 4W1SA 2JF0A 3AOEC 3TZCA 1H3EA 3LD9A 2IL1A 2ZYAA 4KO8A 1Z4MA 2ZSHA 5FWDA 5TT0A 2JFGA 5D1NA 3EF0A 1Z6QA 1DPGA 3PFBA 2YRXA 1T9DA 3PHHA 2VTDA 5BSWA 4HNTA 2GSWA 1UD4A 1WU8A 1TZJA 2GBLA 3P2MA 2VP2A 4DE5A 2VJKA 1W85A 2XOEA 4EK9A 2QA4B 3DNMA 1D1PA 2ZIZA 1GGHA 5K0EA 1UXJA 4KU4A 1OX5A 2XZOA 2O0KA 5AK3A 3EJ6A 2QJWA 1GCGA 2PSHA 1RYMA 4DREA 1XIVA 4RE5A 3OFNA 1IRXA 2QTHA 2ZCUA 4S1WA 1H4TA 1HC7A 1SOMA 3P9ZA 5A03A 3PJEA 5FLKA 1EFLA 3OOWA 2CY0A 1CNFA 2B8EA 3NGLA 2WYRA 5F64A 1CCWA 1PNTA 3U7JA 3I5XA 4WTOA 3F47A 1DX9A 1UC9A 2OORA 3QV2A 4I50B 2M9MA 4Y0VA 5EPUA 1DOZA 1N2HA 1YSCA 2BEWB 4KXXA 4XOIA 2NTJA 2BH2A 1X1CA 3O8QB 3LK7A 2CZGA 3UO8B 1OH8A 2OHOA 2H2AA 2H5IA 1AK1A 1KQGA 3KPYA 3AP3A 4O4HA 4RKFA 5IMSA 2WTAA 3HDJA 5DP2A 3RK1A 1Q0QA 3JAWA 3OE1A 3OJEA 2ZRIA 5FULA 2BZSA 1A97A 2V3WA 2IGBA 4P4SB 5H0IA 4BVEA 5CFRA 5K3OA 2UUPA 1N6PA 4K87A 4R01A 1WDLA 2H0QA 4RVUA 1U3GA 2PH5A 2V98A 3DW1X 3Q12A 2DPHA 3T7IA 4RD0A 1YHNA 3WL6A 4CGYA 3IEKA 1PAUA 4I9NA 3IXMA 2QX4A 3H2YA 3KR2A 1M74A 1CEXA 2PBRA 4GI2A 1RRCA 2WG1A 3A1SA 3GFGA 3PLRA 1X1QA 1U6KA 3ZWYA 1LDYA 2ISSD 1DKQA 3OETA 1WU7A 3T1NA 2QW0X 3ORSA 2ZSBA 4GGMX 5DYIA 1ZOOA 4PPGA 4JUIA 2SKDA 3IAHA 3NHBA 4EARA 3J7AC 1ZMOA 1XD8A 4JKIA 1DT3A 1EK6A 4PC1A 2ZZFA 3K0BA 5TMBA 2IGTA 2BV3A 2FXIA 2E9SA 2XNSA 3L84A 5F12A 1C4OA 1CRLA 4ZD6A 4B34A 3CN9A 3A1DA 3ECAA 4I50A 2P2YA 2J3LA 2Y1WA 3G89A 3ZWOA 1ABFA 2W6IA 5T64A 2BEWA 3HZOA 1HRDA 3QHAA 4KN9S 4URUR 4NCNA 1I4EB 2GA9A 1HOXA 4UBLA 3STYA 2EFHB 3ICOA 1DKLA 1OXSC 4OXRA 1O94D 1X92A 1VKRA 3BFKA 4BV2A 5DWDA 5BYAA 1NI5A 1F4VA 2GEBA 4LHVA 4DSAA 3KLMX 3HBLA 4I6EA 1E3ZA 4GM1A 2ZXFA 4LC9A 3AHFA 2CMKA 1CC1S 3LCRA 1WBJB 3K32A 4P4SA 2I22A 4ITVA 2XY4A 3ELDA 4LQLA 3MINB 3UPDA 3KTDA 5TQ2B 3V8VA 4D9JA 4BLPA 1T2DA 1OFUA 2MSDB 3D2LA 4EVQA 3SY8A 1LW6E 2IYOA 2OK8A 4KACA 3GLGA 1USWA 3C7DB 2WM8A 3V4FA 1XEWX 3OHMA 4OI2A 4WCDA 5CVVA 1XF9A 4DUYB 3PUJA 4HS4A 2I3BA 3CONA 4IIJF 4BATA 1VBKA 2OO5A 2PCJA 1BWPA 1T0IA 1EIZA 1B15A 1PSZA 3B5JA 5JCPA 2F8SA 1P73A 1LSUA 1G8HA 1OCEA 3JRNA 4J2TA 3PR1A 1LK7A 4N39A 3PGLA 1EX7A 1QFJA 2FXVA 3OPNA 2WJHA 4HGQA 4KWCA 5CM2Z 4ZN6A 5AHRA 3F5DA 5DSZA 4XCXA 3WWZA 4BNMA 2GTHA 3LBIA 4LUCA 2G07A 3FXAA 1EFVB 3NFYA 2IDZA 4OHMA 2CFTA 2H9AA 3MCZA 1RXYA 3NNNA 1KY5A 2CXRA 2HCFA 2V7QD 2NTYC 3GVHA 5EUCA 5DASA 4E2XA 2VDRB 1PJAA 4AICA 2GBGA 2WUDA 4DLZA 3EMVA 5JSZB 3PEVA 4ZMRA 3JVIA 4B6SA 4JQYA 1TNDA 5IJWA 3VA7A 1ZZEA 5SZJA 4LX0A 4QOGA 3GF4A 1QCDA 2E4YA 2QL5A 1DTWB 3P9QA 4P3PA 3VO8A 2FWPA 3ZQKA 4CV2A 1TPZA 1Y6RA 2XCIA 3KQVA 4I8IA 8GPBA 4V0QA 5G4KB 3MINA 1UPCA 5TQ2A 2QTWB 3WJ7A 4P2NA 3PU6A 3WTCA 3ZS9A 4BTVA 5L9AA 3IKJA 2X8BA 3KXPA 3IOCA 3VNBA 4PYQA 4W7HA 4Z9FA 4UUMA 1NA5A 5A2GA 1Z6AA 2RCNA 4FNOA 5LLTA 1TB4A 3DHEA 3VNVA 4QECA 3G2OA 4M1OA 1PFVA 2HJWA 2QY6A 1E5LA 4EVSA 4JYCA 3UJCA 4ZARA 1FC0A 4PXYA 4PF1A 1PZFA 3HR7A 1SZCA 3KWJA 1Z5OA 4ZI3A 5FHRA 2G67A 5DM60 4C7JA 1VPDA 2BF7A 3W4IA 1C81A 4RETA 4NH0A 4RD1A 4YROA 2FEKA 4QGHA 5A71A 2CNWD 3ELYA 1EFVA 1N5MA 1XCMA 5HCUA 3UHAA 3GEIA 1Y0YA 1YZTA 2E37A 3FMFA 3LTEA 4O5AA 1XTUA 4QULA 1YFJA 2XWSA 2LCIA 4HCJA 4U7TB 3UXMA 3DTYA 5I7EA 1U0LA 4CM1A 3PYLA 3AVXA 1OHHD 2NIPA 5EMKA 2QT9A 3SLDA 4ONEA 4WBXC 1CUVA 3RVQA 1Q82D 2B35A 2Z1DA 4EDFA 3ZG6A 2GASA 2EGHA 3D02A 2YN2A 2JCYA 1U5CA 4G4SP 4MA0A 4MXDA 5BN4B 4B6FA 1RTKA 2P30A 1DTWA 3LX6A 5J9FA 1N2SA 2MWMA 3NIBA 1L5LA 1NUQA 4XLFA 4QTUB 3SZUA 4E2YA 1OWMA 5G4KA 2RGWA 4M1SA 1V0FA 1X7DA 3LYHA 4AWXA 2AR0A 3R5JA 4MW2A 4WOPA 2OFFA 1YFKA 3HJAA 5HS6A 1I5OA 1EBUA 4L9AA 3ZWAA 3DO6A 3EPLA 2CFSA 3WGTA 1GGFA 3LUPA 4PQEA 3AI7A 4OGFA 2BT4A 1VDMA 3EB9A 2CGEA 3U19A 1FVOA 1M67A 5L46A 1XVVA 2ENWA 2FZGA 3RI3A 3FPKA 5M2QA 2PXCA 4QBKA 3CO0S 1UDXA 1Y3AA 2I6QA 2XSZD 3LUJA 2QLLA 3RVJA 1E2EA 1OSNA 1WUYA 3I12A 3M5DA 4QG3A 3IPYA 2ZRBA 2OTCA 3W8NA 4MYUA 5I3CA 1VFNA 3T5MA 4HQKA 4KW7A 1YXMA 4C2UA 1Y8RB 2J4CA 1DELA 2JK1A 1JQ3A 1W0CA 1N0VC 4TLBA 4WEOA 4BEVA 4I0WB 4X41A 3GK3A 1QZZA 3TZEA 3AK4A 4D41A 3UMMA 3P5SA 1YQUA 2GXSA 2AC7A 3OCWA 1V7ZA 1HY3A 4WINA 5JJBA 2EFGA 1Z8HA 5KEIA 3PEYA 1T0HB 4GR9A 1YQXA 4EGFA 1AXEA 1BJRE 1JG2A 1DCFA 1PFGA 1XTTA 2PRSA 4L5IA 2RB4A 5TJHA 2CNKA 3TLZA 3KUKA 2R85A 2P3SA 3VJMA 2HR1A 1YBVA 3KT6A 3L1UA 1U0EA 3CPXA 2GBFA 2Y93A 3ND7A 3OMXA 4GNKA 4LGVA 2BM9A 4RLFA 4UM8B 2HTEA 1TECE 1T3GA 1KJ8A 1O03A 2ZJZA 3U1BA 1OXMA 3GRKA 1P0FA 2OGSA 5BT9A 4G84A 3HRIA 2X8KA 2RJ3A 1NW7A 4X91A 2AEFA 3BXEA 1B3RA 4BQSA 2OM6A 4TROA 3WOHA 2QDKA 3B1KA 2PDAA 2WYUA 5CXSA 4YMSA 821PA 2QROA 4RKWA 4YYEA 1LZKA 4E03A 2E87A 3FA2A 2A35A 1GUFA 4UJ5A 4WUVA 5EXXA 5TS3A 2VRCD 3T3IA 2FSPA 1PJ8A 4L15A 1B76A 3G71B 1J8VA 3D2AA 1USUA 1QV9A 4BMOB 4ZVNA 4HUQB 4OHBA 2GPTA 1IU9A 2EW8A 2GCIA 4M1EA 4ZO9A 3U3ZA 2FW0A 4DM3A 5BOSA 1Y7HA 5A88A 1ZD5A 1Y8RA 1T3TA 2HGZA 4HN2A 4P35A 1JXAA 3HBJA 1YX2A 3ROZA 3NBYC 4LDAA 1ACLA 2FCAA 4B75A 1YC5A 4NBTA 2ZI6A 1I9GA 2JLUA 3P19A 3B89A 3SSAA 2OBFA 4V03A 1JKFA 4MWTA 4EJMA 4Z9AA 3QWIA 3PZBA 3GMIA 1E1LA 2BSXA 4GXTA 1YB6A 4FFVA 2B0JA 4MUNA 1NX9A 2RHGB 3E7WA 4RH3A 2CBXA 1QQ7A 2EKPA 5D86A 1OBHA 5HBGA 4BV9A 4EB0A 1LBQA 2OQIA 3GYGA 3USCS 3ZJTA 1PI3A 5C8XA 2O4UX 4YIHA 5AT1A 5JS6A 3THWA 3M0EA 5JAPA 1DQPA 5JNTA 5K3FB 4CJXA 1OPXA 4LYDA 2HB6A 4Z7NB 1JE0A 2COEA 4DA7A 3WNBA 5AQ1A 4XARA 3QVOA 3IH5A 1MRZA 4R4JA 4YUYA 2P6RA 4MVXA 5AOBA 1QV6A 2EIXA 3O1IC 1M9NA 1BOFA 4LHWA 3U13A 5ALXA 1J90A 2CLDX 2E4UA 2J0VA 1PV4A 1JE1A 3B3GA 3DT6A 1KDRA 3HU5A 1X0VA 3HLYA 5IYRA 1SVUA 1T2NA 1R64A 2WHYA 5DT9A 2R8YA 3BQMB 1YQ9A 1YHYA 2Q3HA 1U80A 3E8MA 1KDTA 1L1EA 4YUXA 1RYHA 4IDPA 2GXUA 2WJGA 3TAUA 2RD2A 4Q1CA 1FTNA 1QYRA 3EGDA 4P7KA 1ZQ9A 4EYOA 5FOWA 3SM9A 5EQJB 4PONA 3UCFA 2VNIA 1IVNA 1XLTC 1XWFA 1U2RA 3FPSA 1VL0A 2JZCA 2YIDA 1C9DB 1XROA 4LZLA 2QGNA 3CCMB 5IZCA 3T4UA 5A5FA 1FSZA 3HZZA 4UMEA 5F73A 1Z34A 1OH7A 1KP9A 1MIOB 2D54A 4FYKA 4HBGA 5CP8A 3H9NA 1G4UR 1M0EA 4UFPA 1JJVA 3EXFA 5KWEA 1T1IA 4RKYA 2OHJA 1WDKA 3FVVA 2NSYA 1B26A 3WLJA 5K3FA 1OWPA 3I1JA 3SKVA 5IN4A 1Y4AE 1ZN9A 4N65A 4OQNA 1KOGA 3LY7A 1EGHA 5TVGA 4A8PA 1M75A 3LKVA 2RK3A 1QRDA 2YBEA 4GGPA 2NNLD 3KP1A 4KXVA 4Q3AA 4N8DA 3R23A 1WCV1 1CUFA 2P6PA 5E7IA 1X7YB 5BV1A 1KQFA 2PWPA 1GTSA 1BWSA 3ZVNA 4M0DA 1CHDA 3IUJA 4S0ZA 2P9TA 1RHUA 3BF7A 3UMCA 4EI8A 3ZNPA 3GN1A 2DFPA 2AQ8A 3TIVA 2F59A 1FP7A 3LP5A 4QUKA 4EYQA 1OV6A 2C1ZA 4GOLD 3VHXA 3RC1A 4GM4A 2WLTA 3CMEB 4R8RA 3GMDA 3R8FA 1I2BA 3A9TA 5JG7A 1UC4B 3FNFA 3O4FA 1OFTA 3O03A 3QLTA 1XRJA 2HMTA 3ND5A 1THTA 4GC9A 4IJVA 2RHDA 4KWHA 4Q12A 4XASA 2IV7A 5F3WB 2E3JA 2OO3A 2ECPA 2YZGA 2AZ4A 2IP2A 3PHIA 5JTTA 4OHVA 5ITZA 1SD2A 4OBBA 1DJPA 5G0TA 2NSJA 2O8VA 1Y4DE 2FDXA 3A3KA 1MIOA 4KPEC 1OB5A 5EERA 1JYFA 3WGLA 1KPHA 5BSGA 5LQNA 5AK0A 2ZYVX 1UKVY 5LQCA 4OPVA 2FWNA 2IODA 4URHA 4CKCB 4BFSA 2ZBQA 4N1AA 3GGCA 4OHKA 4TKOB 3QVSA 5DGHA 3KQTA 4QTTB 1I0IA 4E5DA 2BMJA 1Z7WA 2MR5A 1XEXB 4P2BA 5F35A 4LZNA 4FFDA 1TAGA 4XWKA 2NO0A 4C7MA 2C2WA 5DYWA 2GS9A 4PPYA 1QE0A 2FFQA 2WDPA 2IKSA 4J3JA 2XVZA 4MWBA 3H9JA 5M04A 3IL2A 3R7FA 2CFCA 3D2CA 1O6CA 1V39A 4HMQA 1PK9A 5JMWA 3P97A 4RW0A 4JSTA 3TH5A 4DNFA 1BG6A 1DAIA 2FSGA 5EA2A 5AW5A 5I7OA 1E20A 4N03A 1I3NA 2ID7A 3L43A 4MS3A 2OWDA 3RVRA 1MENA 2CNLA 1PJRA 3UK1A 2VJOA 1DEOA 2B82A 3EXHA 3N9IA 3OKFA 3ZK7A 1ZLXA 2QZJA 2PKYX 3PC4A 4Q9DA 4RC9A 1RYZA 3U5ZB 3CPWB 1HZZC 5AJXA 1H6AA 1MW8X 4ERNA 5DSXA 4QKQA 1FFBA 1AUOA 2ORYA 1EGQA 3GY0A 3K2EA 4NMLA 3ZD8A 2F17A 3LF1A 1PJBA 1YB7A 3GAMA 1NP7A 3PWZA 3ZGOA 2ZB7A 3A8IA 4OFBA 2R7KA 3OA0A 3R3HA 3UTDA 3I39X 1YNSA 2G63A 3AF1A 5TQVA 1ZO8A 1PUXA 2ZIGA 3H4VA 1ID8A 3IVXA 4DSUA 4WXPA 4IFIA 5KREA 2QMHA 3WKCA 3WMXA 2IU6A 4CKCA 2XHZA 5FBLB 1GPWB 2E21A 4NMWA 4DQKA 2H1RA 4C3OB 1FDOA 1U63A 4KEAA 3ZHRA 1XEXA 3BTUA 3WHPA 1WDMA 3A11A 3QG5A 5CW1A 2PD6A 3JQAB 5AVKA 3WHLA 5JQGB 2IYNA 2GEFA 3RUCA 5KDOA 3TQTA 1XELA 5A1JA 3GD5A 4HXEB 3LWBA 3DP9A 3GFTA 1E2NA 1HNNA 4D74A 3AR8A 1QVVA 3AEQB 3AVPA 3KR0A 3M3HA 4HZIA 1ECCA 2YJNA 2GZ3A 3FUUA 4EPXA 2Q3MA 3D7SA 3O94A 1I51A 3RF6A 4A0SA 1HZEA 2YVUA 2XMZA 4DPLA 5D3QA 3COPA 1TFUA 3DYIA 3V8QA 2WJ4A 2NTNA 3RU3A 5EE3A 3DXYA 5DDIP 1EAMA 5C1BA 3QPDA 1FMTA 4AC9A 1ZCAA 1N7HA 3C4VA 3FOAA 3UAGA 1HG1A 4DEVA 1SQ5A 4DGSA 3ZHXA 4RHUA 4CN9A 3IP5A 4MLZA 2PUDA 4R98A 1DPFA 2PGNA 1ZD1A 1GILA 1DX6A 1XZGA 1CULC 3WLRA 1XVIA 5NLLA 5KTYA 4XVQA 3QBTA 1NI4B 3RVPA 3G7SA 4J90A 4LCEA 5DK4A 4BWVA 4OOXA 4OHCA 5I01A 3F9CA 4JQCA 4M86A 1M1NB 1ZH0A 1UF9A 4FTWA 1GAJA 4N41A 3S7ZA 1Q21A 3ZBQA 1D2NA 2XE7A 5I9LA 4Q6BA 1ONPA 2ONZA 1T13A 1CU1A 1Y8ZA 2VJYA 2Z6QA 2R96A 2R8XA 3ZKWB 5IASA 3ZHSA 3BZUA 5CFMA 2QBYA 2C94A 5JQGA 2BFCB 1R8YA 1NBEA 1L7NA 3AR9A 3KQOA 4M9RA 2K2WA 3PQ2A 5DN9A 3B85A 4P93A 3CCLB 1JPNA 2RGDA 3O8DA 4A6DA 4BN5A 4WKGA 3C74A 3MT9A 3AEQA 3NEYA 4FS3A 1SELA 4MGIR 2VZ9A 3H5RA 1M6YA 5AESA 1BW9B 1TJYA 3COSA 2GARA 2ZZGA 2QTAA 3ENKA 4W5JA 1ZOPA 1MB2A 3KSDO 3QNWA 5CYFA 3ZY5A 3TQCA 4BNKA 4DJTA 4C43A 2MOKA 2R4TA 2Z04A 2YZ2A 4Z0TA 4RLHA 3OJLA 1J09A 5K3BA 1PR3A 4Y6OA 2EDAA 4BRSA 4Y6LA 4JI0B 3IVCA 2CFOA 4UHDA 1AQNA 1XV5A 3U81A 3F3MA 1XD2B 3MWFA 4Y2HA 1RQ7A 4F3KA 3LQQA 3N2ZB 4LZPA 5E0KB 3ZX4A 4DQUA 1XQWA 1RE0A 2CYAA 3IILA 3KO8A 1UK8A 4TKUA 1R74A 2VL7A 3WP0A 1WQ1R 1NI4A 2VQSA 1WEHA 3AR3A 3N53A 1NBMD 2ASEA 3CPHA 4FNAA 3KQYA 1RWBA 5CVUA 4YAOA 5E6UB 1WABA 3KAJA 1D07A 2EATA 2TSYB 1QHIA 2AX3A 1YITB 1KAOA 2FJUA 4JNCA 2FW1A 1E0AA 1Q7TA 4MYTA 2PU7A 4FWTA 3LP8A 3ZU2A 4DPKA 1NNUA 2ZRLA 1P2BA 1CB0A 2CJXA 4ZYXA 2YXNA 3PJDA 1Q20A 2BEVB 4NQRA 4PG7A 4KGDA