3W2FA

Crystal structure of oxidation intermediate (10 min) of nadh-cytochrome b5 reductase from pig liver
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
271
structure length
271
Chain Sequence
TPAITLENPDIKYPLRLIDKEVVNHDTRRFRFALPSPEHILGLPVGQHIYLSARIDGNLVIRPYTPVSSDDDKGFVDLVIKVYFKDTHPKFPAGGKMSQYLESMKIGDTIEFRGPNGLLVYQGKGKFAIRPDKKSSPVIKTVKSVGMIAGGTGITPMLQVIRAIMKDPDDHTVCHLLFANQTEKDILLRPELEELRNEHSARFKLWYTVDRAPEAWDYSQGFVNEEMIRDHLPPPEEEPLVLMCGPPPMIQYACLPNLERVGHPKERCFAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NADH-cytochrome b5 reductase 3
publication title Elucidations of the catalytic cycle of NADH-cytochrome b5 reductase by X-ray crystallography: new insights into regulation of efficient electron transfer
pubmed doi rcsb
source organism Sus scrofa
molecule tags Oxidoreductase
total genus 76
structure length 271
sequence length 271
ec nomenclature ec 1.6.2.2: Cytochrome-b5 reductase.
pdb deposition date 2012-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
A PF00970 FAD_binding_6 Oxidoreductase FAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 3w2fA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 3w2fA02
1CNEA 4YALA 4FWTA 2CRVA 4M2LA 1VQOB 4M1KA 1AMOA 4WQMA 2DY1A 4FN5A 1R5NA 1VQKB 1E62A 3CC7B 2EIXA 1ZM4A 3B8HA 1TTTA 1NDHA 1YITB 3OZWA 1D1NA 2YWEA 1KK1A 1F20A 1Q7YD 2YWGA 2QN6A 1EFCA 1N0VC 2E1RA 3QFTA 3MCAA 3CCMB 4NBSA 5HXBA 1Q82D 3OW2B 3AVTA 3QFCA 1R5OA 1A8PA 1EP1B 4K1XA 1Q81D 3G6EB 4QFMA 3WNDA 1QGZA 2HMAA 1JNYA 4LBYA 3W2HA 3B78A 1CNFA 1EXMA 3W2EA 3ZZUA 2VZLA 5EMNA 5TY0A 3WYAA 3J81k 2QEXB 3VO1A 2YWHA 2RC6A 4HE6A 2DERA 4B3XA 1QVGB 4B48A 3VNVA 3G71B 4N3GA 1QUFA 1BX1A 5GV7A 3AVWA 4BPRA 3U6BA 1KC8D 3P26A 1GJRA 4YHBA 3QSYA 1QG0A 3AVYA 3AVVA 3JQPA 1KRHA 3W5HA 2OTJB 1VQNB 1GAQA 3CCUB 1AIPA 1QH0A 1FNDA 3E1YE 3A1FA 4G1VA 3CXCB 2XNCA 1DARA 4EH1A 1OB5A 2J7KA 4RD1A 1ZM9A 1N8RD 2GPJA 3CCJB 2C77A 3CCLB 2DCUA 1VQ8B 1FDRA 1WDTA 1FNMA 3CD6B 2B7CA 1ZM2A 5AN9A 4G5GA 4YAUA 1B2RA 1G7RA 1J9ZA 3MHPA 4M53A 1DG1G 2VYQA 4Y9UA 4FK8A 2AHOA 2ZITA 1EWYA 1KK2A 3I56B 3G4SB 4M0LA 3I1FA 1YJNB 3CCVB 4LC0A 4ZGNB 4AC9A 1FRNA 3JQRA 1ZUNB 4LBVA 1BJKA 3VMFA 3WBJA 3AGPA 4TMTA 1M1KD 4C0SA 1QFJA 3ZZTA 1KQSB 1HA3A 2DEUA 2PLFA 3ZC3A 3OZUA 1GVHA 5GV8A 4RD0A 3CMEB 1TLLA 1XE1A 1YHQB 2HCJB 3CPWB 1YIJB 1IB0A 1I7PA 1SKQA 1E63A 3P27A 1YJ9B 1OB2A 1GO2A 1EP2B 4PC2A 1VQ5B 2OK8A 2R6HA 3JQQA 4RCZA 4R71A 1EP3B 3CRZA 4MYUA 3QFSA 1QFYA 2VNHA 1FNBA 2BPOA 5TR9A 1JJ2B 3OJWA 1H85A 1K9MD 4H9GA 3CCSB 4ZCMA 5DSZA 2QMUA 1D8TA 1JA1A 2BVNA 1N0UA 2GQFA 1F60A 1ZM3A 3ZBTA 4LBWA 2C78A 2QDXA 2BSAA 2B7BA 4PC3A 3W2FA 3ES9A 4M4SA 4C43A 3VO2A 2BMWA 1QX4A 1DDIA 3AVUA 3V76A 1OGJA 1YI2B 4DQKA 1VQ4B 1DDGA 1KD1D 1NJID 4TMWA 3WBKA 3CCQB 4P6VF 4Y9RA 4YAFA 1Q86D 1U2RA 2BF4A 2BM0A 4YAOA 1M90D 1XB2A 2BGJA 3CC4B 3CCEB 1K73D 1KJZA 4J0QA 2EFGA 1TVCA 1GAWA 2QTZA 4UAJA 2HDNB 3W2GA 4B44A 1VQMB 3CCRB 1R5BA 2VNJA 3AGQA 3WXMA 4Y7CA 3B82A 4RJLA 3PENA 1EFUA 3WNCA 2RC5A 3FJOA 1VQPB 3LRXA 5THXA 4AF7A 1JB9A 2D74A 4B47A 2BN4A 4N3NA 4RD3A 4ACBA 1QFZA 1W87A 4P3YA 2NPFA 1UMKA 1D2EA 2XNJA 2BV3A 4QHYA 2PIAA 4B43A 2FX3A 1QUEA 3FPKA 2BGIA 4TMZA 4DQLA 2X3UA 2CNDA 2QTLA 1W2BB 3VNUA 4TN1A 1G7SA 2XEXA 1H42A 4HE5A 4Q7JB 3CB4A 3CMAB 5JBQA 3U6KA 4ZGQB 3LVBA 1BX0A 4PC7A 5FA6A 1IJEA 2DETA 1W35A 4RD6A 3MMPA 3LO8A 1KTVA 3E20A 1VQLB 1QGAA 3QE2A 3SJZA 4G1BA 3W2IA 4ZCLA 3W5VA 2VNKA 4RCYA 5H59A 2PMDA 1QVFB 4TMVA 5H5JA 4IW3B 4F7DA 1TUIA 1B23P 4U9UA 1KK0A 1VQ9B 4MYTA 3AVXA 4PGOA 1IJFA 1G7CA 1QGYA 1SM4A 1S0UA 2YWFA 3CC2B 2BM1A 1FRQA 4RD2A 1FNCA 3U2QA 4TMXA 4RD4A 3WY9A 4PC6A 1BQEA 4ZV4A 5KSWB 4B4DA 3OZVA 1ELOA 3W5UA 4ZCIA 1JA0A 3ZBUA 3ZZ0A 4YAWA 4ACAA 3I55B 3WNBA 1E64A 1G7TA 1VQ6B 4AF6A 1W34A 4LBZA 1YJWB 3QFRA 1GR1A 4PC1A 3LYUA 3CW2A 1S72B 4NCNA 1KK3A 5TV2A 1OGIA 1VQ7B 2B5OA 2QA4B 2OTLB 1EFTA 2OK7A 1CQXA 2VNIA 1K8AD 3OJXA
chains in the Genus database with same CATH superfamily
1OLUA 1TMOA 3C6KA 4X44A 2OXIA 3RHFA 3SC4A 3Q0TA 4XGIA 2H11A 5AK4A 1QS0A 2WWRA 4Z1MA 1HBJA 1Z45A 2DHDA 3DEKA 3NYQA 3MT9A 4PIVA 3BH0A 1UEJA 1Z2PX 3DP7A 3W1WA 2R8YA 3FDXA 1Z8NA 4UXHA 3S5JA 5C3UA 4D42A 4EHFA 4IIJF 1XK7A 4HQRA 3WLNA 2P8SA 1W29A 3R0IA 3Q1LA 1XLWA 1TTTA 1PL7A 2GA9A 4MAFA 4N6GA 4O08A 5K3DA 1PHPA 3KQPA 3DOCA 4L50A 2H4JA 3MTAA 3ZVMA 3FF4A 3S1AA 3VR3A 1MQAA 2H1LA 2YWEA 2BCGY 2VDNB 4XJXA 4HMQA 3PUHA 4WEOA 5CVTA 3NI2A 3P0JA 5KYUA 3GF4A 2ONJA 3DVSX 1OYWA 3QVVA 3JRXA 3P9XA 3EIUA 4RTPA 3PXUA 3G0IA 4KNVA 4NP6A 3FI9A 4YRFA 4P25A 2GF2A 1XD9A 1FFBA 3CT4A 4P86A 3ZU6A 4J1QA 1Q82D 1P7CA 3F6CA 3QLEA 4OFZA 4BDTA 1V7PC 5KJFA 4NAHA 5F21A 4TLAA 4GKVA 1W4ZA 4FE3A 5DFAA 3CNQS 3ENNA 1EK1A 1QDUA 2WF5A 3HKCB 1QV7A 1DKLA 4FR5A 4GQAA 5EE0A 1N6LA 3TLYA 3BE8A 4CG3A 1T5EA 4DYVA 1HZZC 1MRNA 2QXTA 3BRCA 2OKGA 3F46A 3HVHA 3KE8A 3ZGVA 4Q4CA 4UEOA 2QPLA 4B5LA 4Q3DA 4Z8YA 2FW1A 4EARA 3ZIAA 4Z4QA 1VIMA 1RJEA 4F2DA 3PDIB 1FEZA 1AG9A 1GKYA 1RRMA 3ERCA 4DILA 1DX4A 2B61A 1A77A 2H4ZA 2Q3LA 2WQZA 4I08A 4FNAA 4DV7B 3RUFA 1JQAA 2GZSA 3LC0A 4ROXA 1OYOA 2YYZA 4N12A 4JVLA 4JVOA 4ZAYA 5TGTA 3L6OO 4OQDA 1L4EA 3K1ZA 5LFAA 3LL7A 3JX9A 3A6PC 4H7KA 3NWEA 5MN5A 3QUBA 1P80A 1Q1EA 4DCVA 2DERA 1L7NA 3X1DA 3VPBA 2NP7A 2EP8A 4UNPA 4WXPA 4HAWA 3HG7A 5C5IA 1NFQA 5JFTA 4LV6A 4W9NC 1KS9A 1WU7A 4ARVA 5FBKA 4F9TA 4UBLA 4AXXA 1SBHA 4OP1A 2JLUA 4RFLA 3EC2A 1Z13A 5JNSA 3VNVA 1U2ZA 3DE3X 2KHZA 1J5PA 3C48A 4G5SA 4ZDJA 4LZAA 2OHXA 4H15A 1TCAA 4EY6A 2X4IA 3CLUD 3EPJA 5I3CA 2HLHA 2V7GA 3D7RA 5JAQA 4C0AC 1R2QA 4FD2A 5DWVA 1YZKA 1L7PA 4G4IA 4JJGA 2BRUA 3L0OA 1NY6A 2BEJA 4ZYTA 2WAYA 3R6WA 1N2CE 4GP6A 4BNYA 1C7RA 3D4NA 3MTBA 1MQSA 2ZE6A 1OUMA 2D5CA 3GHYA 1N7HA 3K1AA 4M1WA 3ZG6A 1Z4OA 1VQNB 4UXJA 1NDQA 1U02A 3T7EA 2FU5C 3BGWA 1VBNA 1YS1X 3C87A 1B8UA 3FOWA 3I01M 1EDOA 2IYQA 3C3MA 2SKEA 3GJ6A 1L4NA 4AZ0B 4I50F 4NYIR 4C0BA 3QTBA 4GYYA 3A2LA 4KTTE 5C0OE 1MRZA 4B7CA 3GN2A 5DNWA 1U9CA 4RM2A 3U0BA 2GPTA 3ZK9A 5FUQA 3LKVA 1DARA 2W42A 3K94A 5EJ7A 5K0CA 3IP3A 3C4QA 2FPPA 3QUSA 2H31A 2QDKA 2QGFA 3NDJA 2AC4A 4ON9A 3V32A 1Y1SA 3GUCA 1PR1A 4MDYA 2AFRA 1NBHA 3I1JA 3O84A 1XFAA 1M1XB 1NR1A 2Q6VA 2ZGVA 3P1JA 4TWZA 4B4KA 1ZQ1A 4D80A 1BFUA 5KVVA 1YMVA 1G8MA 2GZMA 5C46F 1BGWA 1VOTA 2WG0A 3JQ7B 3G9UA 1XAJA 4HLNA 4ZAZA 3VRHA 1LF0A 4UNQA 1I94B 3S2IA 1P4HA 2Q5QA 1DKQA 2XH8A 4DARA 1BW9B 2H9AA 3OF2A 4XN0A 2WHPB 2BFOA 3F5MA 2DSTA 2VUUA 4G5GA 3AG5A 1QYIA 3ZBQA 5BSEA 5KWSA 2QVZX 5I8ZA 3EQ9A 3AESA 2OP1A 3LA6A 5REQB 5EMHA 4GMGA 1SHTX 1I3OA 1B2LA 1UBGA 2C20A 2RSLA 2WWHA 2O52A 4XFDA 5EPOA 3RO7A 5H9WA 4F4DA 1HE8B 5M2QA 3CF6R 2WPDD 1UAAA 3ZX4A 1Q7CA 3Q38A 1FTQA 4I2VA 4EKEA 2OBXA 1WLSA 3OE4A 4TL7A 2ZZMA 1GILA 3HY3A 1YB6A 1JSRA 2V7PA 4F06A 4HNAA 4DG9A 1BVHA 3EF1A 4K6OA 2YN2A 4OQLA 4V0KA 2CVHA 1BFKA 2CWDA 2Y9MB 3Q98A 4UDXX 2P4HX 1A4IA 1FVXA 4BIMA 1W19A 4EMBA 2B9EA 1FF9A 2C2KA 1DMRA 2XECA 4M7OA 4C03A 1WVGA 3AGPA 10MHA 2XTZA 2Q3JA 3H1TA 3G2PA 1CUVA 1M7BA 3ZIDA 3FFXA 4N9QA 2H0RA 1U7HA 1FFHA 3H5VA 4OLJA 4TUYB 2O14A 2WYWA 3DR3A 3K6KA 5ECWA 4E5PA 3T7RA 2ROQA 4JOSA 1DCKA 3UHFA 1SWVA 1ESDA 2AH5A 4UCXA 5KAPA 3LS2A 4HNUA 5A2QA 4B2PA 5JCOC 3OE7A 5D51S 4RSHA 1U0HC 1FLNA 1UP6A 2PSSA 3F3MA 3B5IA 1XQYA 3TJMA 3B6KA 1YZFA 5KMGB 2BFEB 3COSA 5I5EA 2XOKD 3IQXA 2IODA 3KFXA 4FOTA 5JUWA 1USWA 4UQOA 1FU8A 1ID8A 1AH2A 1HGXA 1M8JA 1XN1A 2B8EA 2HA3A 1KI2A 3WMGA 5ECGC 1LA2A 1SUSA 4J0EA 2ZJZA 3DV0A 3EIEA 3A6ZA 4L3WA 1HYGA 4PHGA 1Z2OX 1S9DA 2J46A 4WY2A 4ZANA 1IOLA 1WCXA 4M0DA 5DX0A 4B31A 4L8WB 5DLEA 2VDRB 2H7CA 4IIHA 3NMUF 4V1CA 4XQFA 1UJNA 2R6JA 1MO5A 4RMGA 4E22A 4KO2S 3WWYA 1UPXA 2QLTA 2VHUA 3GT7A 4BNDA 1SUCA 1EFRA 3CRZA 2BTQB 4L4YA 3VM6A 1ZLXA 1VJGA 2ZKLA 3H2IA 4MR8A 2OQIA 4XM1A 1UBKS 3OIDA 1FYXA 4ISCA 5DTRA 2JPDA 3TUJC 5EP2A 3I42A 3VV3A 2WIJA 1M6YA 1PX2A 3DPUA 2IHNA 1XZLA 3O3NB 4BJ5A 2IS4A 1X7ZB 2FN4A 1L7AA 1ZZGA 3GDHA 2R85A 3GAMA 3K0AA 4J7AA 4OHOA 4Y6RA 1TF2A 1KI7A 3THSA 5A9TA 4UBJA 2Y1GA 2C7GA 5DTQA 5EA2A 1R27A 4GBGA 5K3FA 2DHEA 4A8PA 2ESRA 5B2EA 1JHAA 1CG6A 5K0ZA 3WA6A 2AB0A 3U26A 3MBKA 1D8TA 1PCXA 4H1TA 2BBTA 4YPVA 3HWSA 4B45A 4PLHA 1DO2A 5FI1B 1OR8A 1V39A 3EGVA 5H7XA 5K51A 1X80A 3QWFA 4PPGA 3DZDA 1D1QA 4HZIA 2WE8A 2C4NA 3DS8A 1KYWA 1A7UA 3GGCA 2UZ1A 3OPYA 4EHDA 2VF5X 3B1JA 3SQDA 3LQ6A 4MNTA 1ACLA 3LX4A 4BNVA 2OENG 4CIAA 2C83A 2IDKA 4ZD6A 2IW1A 4RVGA 5I6DA 3PQCA 1MFPA 3GLUA 2AFVA 4JAVC 5K3SA 4BNXA 1KC1A 3OHMA 1DS6A 1KJQA 4FOLA 3WLMA 5HYVA 1CEEA 4Y0AA 4ZZ1A 1PG2A 4Z4EA 5FPPA 3E8MA 5THQA 1QG2A 3PX7A 3IQGX 4D9BA 1A9QA 3G9ZA 1K8ZB 2GA8A 2QR2A 3EZXA 3IIJA 1E6CA 2FSGA 2M6SA 3FHOA 2QBYB 1IN8A 1RWXA 5B30A 1K4MA 4Y6OA 5BR1A 4NV3A 5FL7A 2GUGA 621PA 3KKZA 5DF1A 5T57A 3RARA 1L0BA 1Q3KA 2INGX 2W0MA 4C5BA 4YXFA 1WZ2A 4GLBA 3I2IA 3SVZA 1GAXA 2BF4A 4HWSA 4PG5A 4LW8A 4TS1A 4D8XA 4MULA 4XLEA 1ENPA 4PLZA 4AULA 2Z6QA 4BNTA 4WZ6A 4D96A 2PZMA 1RLJA 4PSVA 3P4YA 4LRQA 1FDVA 1JAIA 4OUKX 4TT8A 4PAAA 3R2JA 4UUAA 4JLSA 4XGQA 1PGJA 3T3DA 4AD8A 4N0QA 1H5QA 3MUNA 4L8LA 4QOEA 4CM4B 1QNLA 4K05A 4DCTA 4RANA 4CHTA 3ZD9A 1HFKA 1D2RA 5HJ2A 1AHHA 3VKHA 1PJRA 2WINI 4JODA 3A6KA 2W4QA 3R7AA 5BQOA 3ZV5A 1WETA 2VNJA 4NK5A 5LMCA 2QI9C 1BROA 1H4SA 4TWBA 5F5NA 2CMFA 5JCXA 1ZVKA 2V96A 3ND8A 2QAJA 3B20A 4RVSA 3O93A 5CD1A 5I7UA 1GQ2A 1YDFA 2DFPA 4U7TB 5EMJA 5FL3A 3C0KA 2VHXA 4G0UA 1TT5B 2VEDA 2XE8A 1E4EB 1BFDA 4IUYA 2J1LA 1ZD2P 4MUBA 2CXTA 3MXOA 4O1IA 1RQRA 4GMKA 3UMRA 3TFOA 2UZ4A 4PYQA 3IMKA 4DBZA 1B8NA 5BR4A 3GVXA 3KUXA 2LWIA 4DSNA 4MKIA 4DLAA 2AG0A 4MI6A 3AB8A 3OC6A 2H63A 4OREX 1CK4A 2JFZA 1GL7A 2TMYA 1AGRA 2JD0A 3HO6A 4FVTA 5AI9A 5EUCA 4ZN6A 4PLCA 4RJKA 3EEYA 3IV9A 1N57A 2XQIA 2YZGA 4R5MA 2PUHA 3BC9A 3U4CA 3WLTA 1QFZA 4ME6A 2Q8QA 3KNZA 1T5IA 3M9LA 2PZJA 2J0VA 1T6NA 2R6R1 2KQUA 3ON5A 5LD2B 4IG4A 4MQBA 2GHTA 3CURA 1WRBA 3B1YA 4GI7A 1WOYA 4QQFA 1MX3A 1NXTA 1RIFA 1UK9A 5AI6A 3WRVA 3SQMA 5J2UF 3ZUPA 2WEKA 2ZSIA 1QUEA 4MGKR 4HCJA 3A25A 1OWLA 5ALFA 3H4IA 3PWTA 3HS3A 4EUEA 4HDNA 1QIMA 4TMZA 1B6SA 2QI9F 3L0ZA 3B3QA 4OYHA 1ZW1A 4IXMA 1P2GA 1W2BB 2O0MA 4IFIA 4WNYA 4UDYX 4RHXA 2GETA 3RFXA 5AVJA 2ZTMA 4MW1A 3RFFA 5JZSA 3CN9A 3HP7A 2G28A 3IO5A 2XEXA 2Y93A 2Z8YM 5E4FA 4NBNA 2VK1A 3B2QA 2B1IA 3ITNA 5AM0A 5GGYA 3V00A 4BNUA 2BHNA 2JGAA 3L18A 1NQAO 4NK4A 5EQJB 5FXMA 4P3IA 3UVEA 3ZE8A 4WFQA 5CD9A 3V8PA 1A4UA 1ZM7A 4WLVA 4BQSA 4PC7A 3W3AD 5FA6A 4I4LA 3PSAA 3BIFA 5G41A 3FAKA 2P3LA 1Q1QA 5HW0A 3MJRA 1D4AA 4YRNA 2WDPA 2FR8C 1EWRA 4HVLA 1KOFA 1OXXK 2A30A 2PUJA 3ESAA 4ZCLA 1GGVA 2FSIA 4IJUA 4BAUA 3KR0A 1P33A 3DOJA 4BASA 1QBGA 2YH2A 3K9GA 3R9IA 3FI0A 3HYCA 4EELA 1PT9A 4BFTA 1C4KA 4DSTA 3GFGA 1Y37A 4HDKA 4OBBA 3BXGA 3PKJA 4K9QA 5DX1A 3UENA 2CLKB 3JARA 4DSAA 4TMVA 3VHXA 3EG9A 2J30A 3EC7A 3OOSA 5EIAA 2DPXA 1WUIS 2JJYA 4U8HA 3EEBA 1Z6ZA 4TV8A 4AAYA 3AVQA 4ER6A 4CIYA 4NNOA 3ZJVA 4WZZA 3STHA 4HVTA 5J47A 2QTHA 3ISVA 3P20A 4OHXA 1MJGM 1ZXLA 4NCKA 4JT8A 4X64B 4XDYA 2BEVA 3ANNA 5J5VA 3LF2A 1N77A 2G5TA 3IUPA 5DYNA 3V8VA 4IIXA 2WLSA 4CDGA 3NOOA 1PJTA 3M3HA 1KO8A 1VC2A 1N2SA 3DZBA 3F2IA 1U0GA 4HGQA 2C0PA 3U2QA 5EL0A 2FQQA 3AEKB 3BKXA 1GRVA 3AIOA 3H1EA 4EG3A 1PQWA 2ZVDA 5KSWB 4AURA 1X39A 3PFNA 1CQZA 1JF8A 3PPYA 4BE7B 3TPCA 4G4SO 1P73A 3BT7A 1T1IA 4WK2B 2MMCA 3P0HA 4IPTA 4NG5A 1YB2A 3RIYA 3FNQA 1OYVA 3PWZA 1GGKA 3SZUA 5EIFA 1NASA 1FFSA 1XR3A 1ONSA 2RHGB 1RACA 3IDSA 3NBXX 4EZIA 3AU8A 1X9IA 1S02A 4G5OA 4JUIA 4RTKA 1XNGA 1V96A 2AVDA 2FFAA 5KQGA 3GWZA 4RPJA 3QW2A 2QZZA 4G63A 3W8FA 4JXZA 1Q16A 5L7WA 4O4IA 2NZVG 3WO1A 1PD0A 2D06A 4LBZA 3H8JA 3NT4A 4C7JA 1DCFA 2BFMA 3KKOA 3QMPA 4X1IA 4ZODA 3VAZA 3HP4A 4F4JA 3IOYA 1AHPA 1YCGA 3BIXA 5F23A 1UDAA 3FPJA 3H1BA 5ERXA 1WL8A 3EZNA 4YA6A 3ZE7A 4M9RA 2UYYA 3V4FA 3ZHZA 3DJFA 1KK3A 3LG2A 5TV2A 1V16B 2WA1A 1XRLA 1E8MA 3AY3A 3UGJA 1OX6A 2XUDA 2WB2A 3QELA 3D8NA 1KYZA 3CYFA 4BWFB 2XGJA 1OAAA 1RCTE 4KE6A 4D6YA 2FEOA 1U7XA 2GXSA 3AUYA 4FOSA 1ZK4A 3ZGZA 3NNDA 2O8BA 5HZHA 1DWUA 1XZEA 4R9VA 3A70A 5AHRA 1K2WA 3TVDA 1PKVA 2ZIZA 3ORRA 3FWNA 5IHPA 3OJLA 3T7AA 4HVCA 1KQOA 4CLRA 3F71A 3QG5A 1Z0ZA 4G8CA 3C6ZA 4MWOA 1XCLA 2HV8A 2FUNB 2EEPA 3ZDCA 1RU3A 2UVPA 5TMPA 1D0SA 1ZD4A 3IAUA 3ZHCA 4AKGA 2IEIA 2XJ9A 1FDIA 2BUCA 3UATA 2FG6C 1UKAA 2AF3C 3C5EA 3W6UA 1L4GA 2QN6A 1DBPA 1VZ3A 2O0LA 3DL4A 1ADJA 1BCSA 4P3KA 1Y1QA 2ID4A 5H4HA 3GEBA 1N0VC 4YQZA 3T54A 1FYFA 5K6AA 5AKXA 4UOZA 3H99A 1DXYA 5JVDB 4B71A 4RJIA 3VYRB 1HVXA 1EX7A 4LXUA 4DDMA 4QGGA 2XUGA 3TYXA 4DWJA 1N08A 1CUGA 5C4GB 1GNSA 3KSZO 1YQDA 4D43A 4KBYA 3ROMA 3KQHA 2X6XA 4LRYA 4IMPA 3RQSA 4CMIA 5B37A 1AKVA 4J0FA 3BIJA 3X3HA 3HR4A 5JAUA 4YWHA 2UUOA 1IBSA 4NU6A 4UUNA 3NDBB 1PGNA 4E5KA 1LFAA 1WSWA 2H92A 4JLMA 5DNEA 2A3NA 4B2YA 5COAA 1EZZA 1D5WA 3JV7A 1RW4A 3KUUA 2IDJA 2CXOA 3G6WA 3H8WA 3L7BA 2YWRA 2VXOA 2ZBFA 5IKMA 1AKWA 1MJHA 3TZKA 2DHQA 3THYB 1UC5B 3KDPA 3A8KA 4D0LB 1NUAA 4FWBA 3IERA 1NATA 1X92A 3DZIA 4R8MA 5JNRA 3CLKA 3TLJA 1QVZA 3VPDA 2H1CA 2N1MA 3SY8A 1JH9A 1WHTB 5SYMA 3DCJA 3CWQA 4BLRA 1XTTA 9MHTA 2E7ZA 5D86A 5LQSA 3R24A 1AU9A 4B7AA 1BU5A 1GSOA 2A78A 3CCFA 3QBJA 4KR9A 1YUBA 3KXPA 3WC4A 4XVCA 4LF6B 3FLMA 3NWOA 5J43A 2JGIA 3V8RA 3OVMA 5IN5A 3SIWA 1NB9A 2LE0A 5TQ2B 3U44B 4UQLA 4LX0A 4KQCA 2JAOA 4EKYA 1PUIA 5ANRB 4AJLA 4OHCA 4E51A 4L5BA 5L3SB 4L16A 5FA8A 3HLKA 3B7GA 1LV8A 5GINE 2I6GA 1H1LB 3TE6A 2FUCA 3S2ZA 4CEJB 3X2SA 2FGKA 5BYAA 8LDHA 2C2MA 2XZPA 3W5HA 1TO2E 2WJIA 1R0XA 2XNDD 3BSFA 3QVMA 1LS1A 4LTNA 1J0BA 1DZ3A 1NVMB 2QMOA 4BC1A 3IJEB 3E15A 3L7CA 3PDUA 1F2DA 1KBQA 2WWXA 5CA1A 1CJUC 1KO5A 3HR8A 2EVWX 5A8AA 2PT9A 4FFVA 4OPSA 1T1SA 4FX2A 4MW4A 2YVUA 4ND4A 1NNUA 4RXTA 4F5WA 1OLOA 4E15A 2Q9AA 3KJZA 3O8LA 3GD7A 1HDZA 4LG1A 1PU2A 1X1BA 2ATCA 2OFXA 2AV6A 3B9BA 4US1R 5JMPA 3WRYA 5ICGA 3UMYA 1FC0A 1OFUX 2D54A 1P60A 4TQAA 3E82A 5DYIA 3I2JA 3RK1A 3CSDA 4QOSA 5KQMA 1GRQA 1TCBA 4G84A 4KXVA 4KXMA 1U90A 3CVVA 1JJVA 4I19A 1JKFA 2X5OA 1VQ8B 3T6KA 2VPTA 3WVNA 1Z18A 3T34A 1KVQA 3PZBA 1KH1A 1XRRA 5AKHA 2IS2A 2W7TA 2JIZA 1U2PA 3CD6B 1JT9A 1Z7GA 2YNMD 3I9KA 1JIXA 4DG5A 1SC6A 3DR5A 1GZDA 3EDYA 2ZRAA 3FNRA 4OXRA 5DSXA 4XGKA 2HHJA 1KKUA 2VK2A 3BXPA 5FWYB 4C0QC 5IVIA 5E0KB 4M53A 2C9OA 3GVPA 3MUEA 4LY6A 4RA9A 5SY4A 1YZHA 3VPAA 3BCUA 1UFQA 5JS6A 1AE1A 1CVIA 4O33A 1JSXA 4WNAB 4XX1A 5F78A 3TRFA 3I8XA 3RJ9A 4HBZA 4EPRA 4BPBA 4XYEA 3LT0A 4RE5A 5CB4F 4GZ6A 3D1LA 2F1LA 4MITA 2WJ6A 3IGFA 3RS8A 8ABPA 3E9ZA 4CKEB 5C52B 3DHYA 3ZHBA 3I64A 1XELA 1NNSA 3TLMA 4CM9A 4LRUA 3VNRA 1H8EA 1FLAA 5F33A 1A69A 3PNPA 4ZCSA 3AZPA 4KX3A 3MM4A 4MX8A 5CRIA 4IFBA 4ZHQF 2D2FA 1H6DA 3U4IA 5IJXA 3ZW7A 3OLQA 2HEGA 3NZEA 4MS1A 4WN9A 3OF5A 1VJ5A 1BJKA 3D0QA 1PQYA 3H2SA 4DLZA 3WQRA 3Q5EA 2GCOA 2ZJ8A 3VKVA 1UJ4A 5TPWB 3FDFA 2WYRA 4HNRA 4P26A 4C0SA 1AXEA 1QGUB 3L2OB 3U39A 1HA3A 2YN4A 4IP0A 3JYPA 5I7HA 2H8KA 2BT4A 2OSBA 1J0AA 1JDNA 1GPDG 3BNWA 4WKNA 3WSWA 4AZ3B 7REQA 3ZGOA 3GJ4A 3DVQX 1E2DA 4OYRA 2AK2A 3SM3A 1TEZA 1TYEB 3R0XA 3RF6A 4BTVA 2WTEA 1RXWA 1RWMA 3CPWB 4J2HA 3KWFA 2E3JA 1KJWA 5ALEA 1KMCA 1W7AA 1YCFA 4KI0A 2UXDB 5KSOA 1G8HA 3G2MA 1B41A 3C3EA 5G4LA 3OZIA 5GMOA 5I9MA 4AJJA 3R8FA 5FHRA 1V35A 2QX9A 5A5GA 1XMVA 4XOPA 4HTFB 1YJ9B 3D54D 4PSCA 4WNIA 5J4KA 2G9UA 1CERA 4LPSA 5JD3A 4BN5A 1B6TA 2XLBA 2YXBA 3FR8A 4XX0B 3TL3A 1COWA 2O59A 2PU7A 2BEKA 5EZYF 5J1TB 5BN5B 3WMRA 4CEHA 1HE4A 5ADWA 3H5TA 1IG0A 1Y4ZA 2PXHA 3W0LB 1JEOA 3GNTA 4ZCRA 3TBFA 1ZKMA 4X8OA 2QOEA 5DGHA 4UOEA 2EZ4A 5B1EA 1ZP6A 2W6PA 4DG8A 3O31A 1GLNA 4ZO4A 4QULA 5AQ1A 1Z6AA 2QTTA 1DP4A 1RWWA 3OZGA 4PX3A 4NZYA 4B87A 3FHCB 1MO2A 3LHSA 3EWIA 3NONA 5HJ7A 3PYMA 2VC2B 4WINA 3TSAA 2IE8A 4XQ9A 3UMSA 5IYZB 4NOJA 3RSOA 2ODNA 4QHSA 2Y6UA 3UC9A 5EXEA 2PUBA 4P3PA 2OGUA 4RESA 3K5IA 4ZDWA 1DSSG 4LHEA 4FP9A 4IIGA 1GWNA 3E6AA 1OX4B 3AL3A 4UMFA 3LUAA 3NTOA 2C0QA 2OZLA 1OREA 2VPXA 3FOCA 3HUUA 1T8UA 3E23A 2P1DA 4AYWA 2VBGA 1E3QA 1Y4AE 2ZI4A 5E95A 2IK8A 2F3TA 4FYHA 5HZGA 4ZT6A 2HMYB 5EKXA 1LSUA 4P31A 2PWZA 2ZPAA 3TRHA 4LV5B 3WJ2A 4Z2AA 2WYIA 3EFHA 5KOJA 2J59A 2VVTA 1E3ZA 1OFGA 2VBTA 1NMEA 2I76A 3LKZA 4JFRA 1NKVA 4LMBA 4OQ4A 5HIAA 4O0LA 2G70A 2G04A 2R62A 2QN9A 2E5WA 3SR3A 1XBTA 5HVNA 1XG5A 3FBTA 5CM2Z 3QLVA 2N0SA 4KBGA 2KMLA 2QX6A 2W2MA 3BILA 3PJDA 3FA2A 4NBRA 4DOMA 5KTMA 2R48A 1O95C 3L8MA 4OAPA 3VGPA 1T9GS 2ZYHA 4M9ZA 4LKOA 2F9FA 4MARA 5U4XA 1E0KA 2BHSA 3KQOA 4KPYA 1E18A 1AUQA 1ZD5A 1X8JA 2ZWOA 4ZI7B 1VHLA 2NUAB 1UXKA 2YZ2A 4F96A 5FQOA 1QP8A 2CV1A 3CCQB 3K8OE 2V6GA 3RIMA 3MWGA 4F8EA 2XQJA 2Q1UA 1X86B 4BCBA 4Y9RA 2GEUA 1YRLA 3TSCA 3GLRA 1T3GA 2ZRGA 3ANYB 4D8TA 1GY8A 2XAAA 3J81A 1TECE 3HM2A 4MUFA 2NZXA 3ONYA 3OMWA 4O4JB 2YR0A 3NHMA 1DDOA 1VZ2A 1IE3A 1MFZA 2IY8A 3L06A 3NC4A 5E6SA 5C8DA 3D7KA 1JE1A 2Q0XA 3VI3B 3E3NA 4FLFA 4AJPA 2QR5A 2XUOA 1ND6A 2XVZA 2R97A 2PYIA 1N06A 1K7XB 2JGDA 2ODBA 3LUGA 5ALZA 2ZQYA 2FNAA 2X5NA 1SFRA 3FWZA 4WKPA 2CV0A 1NE2A 1XYVA 4N5LA 1QR2A 1RDFA 1VG9B 3W4KA 4QT0A 3L46A 5HJEA 3H4MA 1VPWA 1QAOA 4Y2HA 2CLSA 2R8EA 3CG4A 4GX5A 1SZDA 4MRNA 4Y7CA 1VRCA 4HDMB 4HUQB 2XGOA 3BCFA 1YDMA 3LT4A 3AERB 4FT4A 4YJHB 3O8CA 1I5OA 5GQSA 1VHTA 1OWOA 2EHJA 3DJYA 1Y9AA 4I1RA 5T4FA 3USZA 3CMMA 1QH8B 1XJWA 2PGOA 3P2JA 1NIJA 1U1DA 3LXUX 1BHSA 4MPDA 4D9IA 5I51A 2ZXIA 1DTWA 5ELMA 2HA7A 4LJ9A 5BURA 3K1YA 3TAUA 4HMPA 4RY2A 4KX5A 4P6YA 4CKEA 4FD3A 3GFRA 3P5BA 2XWSA 4K1LA 4Y9SA 5C5CA 1A50B 3I5YA 4HAZA 4A36A 4I2NA 2HOQA 5DM60 3HMKA 1SVWA 1C7IA 4AU1A 4RF4A 2D62A 1N75A 3C6XA 4UMDA 1Q9SA 4LZLA 3V7YA 3NLLA 5BSHA 2DBRA 1WDMA 1CY0A 1WF3A 2Q1YA 2RI0A 1GTL1 3DLTA 1JEYA 3KSMA 1WVIA 4HQ6A 4RIIA 2DPGA 1A9RA 3L0DA 3K1JA 3GJSA 1ZC3A 2O4CA 4JXKA 5DXFA 2CLEB 4JJAA 5FIUA 3M5PA 5AH0A 4EW6A 5B12A 3E7FA 2D2EA 2ZPTX 3LQRA 2X6TA 3KJHA 2DPLA 1TUBB 3LQ4A 1FZQA 2NV0A 2JDIA 4WOCA 4CCYB 2WVJA 4R1NA 2XLCA 3UAWA 4K7JA 1B14A 1CIVA 3IEKA 4ZAVA 1R6XA 4TKVA 3GFBA 1DJNA 4OAOA 1Y3IA 2HSDA 2FLVA 3MRSA 3ZQJA 3LC7O 2IPOA 2JGNA 3JVUA 4XYLA 1NFRA 3U7QA 3K9LA 2P9QA 4EZEA 3ZPXA 5HR5A 4MIKA 3IHKA 3CB4A 2XVXA 6ADHA 1Y5IA 4ND6A 2P77A 3F74A 5JBQA 3WV5A 4XR9A 2ANBA 1JAHA 3GR6A 3PE6A 3CZ9A 3M5CA 2EBHX 3LH5A 4LJ6A 4FKZA 4QYSA 3U62A 2GN9A 1RZRA 1WKVA 2WM9B 3P45A 5LLTA 1YRQA 3CLUC 3JQCA 2P68A 5FCDA 3ROXA 1ZS9A 2F9MA 4F38A 2BMAA 4OATA 4LYDA 3VZDA 1N2IA 3RUAA 4XVUA 3H11A 5LOVA 2CSUA 1AQUA 2WPDA 2XZLA 3RSGA 4IKEA 3WQZA 3W5VA 3DL2A 3FYHA 4CE6A 1CLUA 1N2JA 3DDUA 4DAEA 2UDPA 1YBMA 5F51A 2GNPA 1SVKA 1I7NA 4RDHA 1LW6E 1V8OA 3F5QA 5EJ2A 4RVDA 7MDHA 3ZDXB 3IBCA 2QAGA 3ECAA 3TRJA 4EI9A 4P9SA 3KS9A 1WXEA 4RAQA 3SICE 1UL1X 4KRGA 5FNVB 4FCWA 4B76A 3SLNA 4DN6A 4QE3A 2WU8A 2OM2A 3BJRA 2DC1A 4D3SA 4HNVA 1PUXA 3C1OA 3G6KA 2DKOA 1R18A 3QPCA 3VVCA 1HZJA 1ZUWA 2AWNA 2C8JA 2W2KA 1FNCA 1S2IA 4MZDA 3OC0A 3WY9A 4ML3A 3MC1A 1OFHA 5KOHB 4OP3A 1UDWA 2V0GA 3LRTA 4DQXA 2WZQA 3NEJA 4HG2A 1B3RA 3DBHB 2XOKA 4D8UA 1P81A 2LP4Y 4EHBA 5FHQA 3OKPA 3BWXA 4MPJA 1U3VA 4NYIQ 4I4NA 4AX8A 1EWVA 4ALIA 4OQXA 1WD5A 2VO1A 1ZYUA 5BSMA 1VRVA 3RLIA 3R3ZA 1PLLA 3FUXA 4IFTA 4NS1A 2QMQA 4YMGA 3PJFA 1EJBA 3FKJA 3KYBA 1D2HA 2RGUA 3K72B 3M6FA 4Q4JB 1JDVA 3A1VA 3FSJX 5BW8A 1O8BA 1TJ5A 5JE8A 1WDKA 2IDZA 4OH7A 3UQYS 2QB5A 2XTNA 1E9BA 4DIKA 1BTOA 2Q2VA 1IVYA 2VJQA 2VT2A 2EXXA 3CNLA 1V5WA 3RKSA 2C8LA 2Q0HA 2OBBA 5ES3A 4PZCA 3FZQA 2FDCA 3F4KA 4NCNA 1CF2O 3LPAA 2HYDA 4C22A 2EX0A 3MN1A 3N7TA 2RH8A 1E79D 1N9GB 1XQWA 4M0EA 3GY0A 3MJEA 1KI6A 1AURA 3I6YA 3QPBA 4FOOA 4P2GA 4V02A 4NH4A 1K8AD 1NF2A 1B76A 4IQFA 4PNHA 4HRYA 1T0UA 3EVAA 3KHUA 1OKKD 3QOYA 4E2YA 5CG2A 4RTNA 5JALA 1XZ8A 2O9JA 5C9ZA 3AFOA 3FMFA 1YZYA 3E3MA 1HWYA 4LXHA 3STVA 1DELA 2C2OA 3AKEA 3RNOA 2NNLD 5EZ6B 3T0IA 1C2TA 4X1YA 5D01A 2XDQA 3AFIA 4PM4A 5HF5A 2QYTA 1QYXA 1IY8A 3OQIB 3PVZA 5FKJA 1I33A 1IPEA 1RHQA 4ZV7A 1MVNA 3KTFA 5JISA 4RX1A 3IC5A 4OFXA 4DVJA 5BORA 3DUFA 5IX8A 2GKSA 3RVPA 1TPYA 2ORYA 2WT8A 4KGDA 1Q44A 1T8SA 1NVKA 2I8CA 3N5CA 4FYJA 1E2LA 4JEIA 5DM2A 4TQUS 4URXR 4FNGA 3FYCA 1KK1A 2OBTA 4JUCA 5JD6A 1O4WA 2OXCA 3DTYA 4DGQA 2MOKA 1AKTA 1H66A 2NO1A 1A8HA 1CUBA 1J5XA 2XKAA 3E3LA 4XIIA 5TE9A 2O7SA 1UXJA 1Z39A 2X7HA 4CBVA 4KUHA 4PRZA 5JNVA 2ES4A 1M1ZA 2ZM5A 3EULA 4URVR 2Q1XA 2P6RA 1UPUA 3LNNA 5HXBA 2XF2A 3KKMA 4KHZA 5P21A 2WSBA 3ML1A 4YP5A 3AR3A 2H9IA 4UDOA 3QFCA 3T41A 3N2EA 5L6LB 1A8PA 2IEZA 2LUOA 4JJFA 4HNSA 1GNPA 1QVAA 3GMSA 4LJAA 1CUJA 3G5AA 3EZ2A 1Y8CA 3UH1A 2FLKA 3MMNA 3T3MB 1WSVA 1J09A 4L2IA 4HNQA 4HX2A 3DDOA 2YFYA 3K71B 5KHOC 3V34A 4W9MC 2PV7A 2OCLA 4EYQA 2PZLA 2YVLA 4H7IA 3D4LA 1W30A 1Z12A 5IWAB 2E0IA 2HMVA 2RBEA 4AJIA 5JO0A 5L7TA 2A9RA 2BZ0A 3UW1A 3WK9A 1I3LA 5KI6A 3UWDA 2FW6A 1EFVA 1E59A 3TW0A 2K6GA 3T5DA 4Z0TA 4YLYA 1KQ3A 1HFEL 1SQFA 2OBRA 4FUTA 5A4DA 7AT1A 5LM3A 1RC1A 3ZWAA 4JKYA 1U0SY 4F04A 4GX1A 4U7GA 1RVV1 3TM4A 1EDDA 3S1LA 1K7FB 1XTKA 3FDIA 1S8FA 3IHLA 4H7EA 5D5PA 1SVLA 5UKDA 4EW1A 4YMSA 1E9AA 2ZAIA 3KYDA 4D4GA 2O6LA 4JOCA 3GCDA 3KWLA 4RMIA 2CFRA 2YHBA 3OJCA 2F17A 3MWJA 3K92A 3OBBA 3QVOA 1CS0A 4XR4A 1WPCA 3HR7A 3B9QA 4ZGGA 1UINA 1WMEA 4N3GA 1QIJA 2H4YA 4BGIA 2GEJA 3OPMA 3KFVA 4PFQA 3QHAA 5KDLA 3IDZA 1WCV1 5JHHB 2CDRA 4DQVA 3KALA 1TZKA 4MRSA 4X3OA 5EE3A 5I7OA 3C7AA 1A72A 1P2SA 5EMMA 3WIDA 3L0IB 3ZCSA 3SEQA 5B7GA 2CHUA 4YHBA 1NAIA 3WFJA 4LNAA 2IITA 4H59A 3MUOA 1IM5A 1XEFA 1FJ2A 3TWOA 3K70B 3HU3A 3G8DA 4DLRA 1VSVA 1D2CA 4CM8A 2PJRA 4WASA 4YDHB 5EJ6A 2WKRA 5HQ3B 1DJQA 1QXSA 4OYYA 4WVFA 1BDJA 3KB6A 4XZ3A 1IUKA 3IXLA 4MW6A 4C0LA 5FX2A 1N2EA 2XNCA 1YVEI 4PYLA 2GZ3A 4NY1A 4Q02A 5CU7A 1E60A 1GT91 2Q3FA 4GI2A 3K09A 4ECEA 4EO7A 5HZMA 3GNSA 5IUJC 4OA8A 1H5UA 2F48A 4IOLA 2OGTA 2FVYA 5LWQA 3B6EA 3IELA 2HSEA 5DBOA 1GV0A 1WOPA 3IVCA 1W6UA 1U8TA 4OY3A 3TQIA 1ZLYA 5IEJA 4L6AA 2BDUA 2QJWA 2XUKA 2ZRBA 3B5EA 4WAUA 1USVA 1H05A 2WMNB 5ALWA 2GBIA 3SYMA 1VLZA 1FDRA 1IDOA 1T8YA 4OL0A 4KH1A 4AL4A 3W3AA 5B4VA 1QHSA 2CVFA 4OAQA 4BE9A 1EVIA 3D7NA 1YI8A 4MO9A 5LA6B 2QMEA 4CM5A 1CJVC 1GPJA 1JFVA 1OFUA 1RAGA 2BH9A 3GT0A 3QA3E 2YJZA 1NP7A 2IXEA 1W88B 2ZZQA 1R4ZA 5P8WA 3U7RA 3TQHA 2IKSA 4PGMA 1YZ3A 5LU9A 1EFLA 1ULUA 4OOSA 1A98A 1Q7EA 4PRLA 2IZ1A 2XDAA 1EMDA 1FRFS 1GDHA 1L8OA 2PYDA 4OIMA 4P32A 5FAKA 4Q0MA 5FI3A 4BWVA 4DCGA 2ZSAA 5F76A 4LA4A 2H17A 5KBYA 5GOZA 4M1QA 4JZYA 5FPKA 1NBIA 5TC4A 4J1TC 5ALUA 1K06A 3CZCA 3LKDA 3ME5A 3H16A 4L08A 4UQPA 2OILA 3N59A 3B89A 4LBVA 4DIFA 1ZCBA 3ZXXA 2O5CA 2PH7A 5IDVA 3PD7A 4H4EA 1NBWB 1T3SA 4AUNA 1T4CA 1VM6A 2YASA 1TCUA 4R1OA 4PZZA 4QAJA 4F11A 5DGTA 3OP1A 4QXQA 1EQUA 1QF9A 4XDGA 1X77A 1C9EA 3G9TA 5F64A 4RTRA 3QBTA 5ALMA 4FTWA 2DEUA 3DXFA 1Y9DA 1T2FA 2IH4A 1N0HA 2NPIA 3OEYA 3WLAA 4MSUA 4QVGA 1NBOA 4MVCA 2AG6A 5K0EA 5HIKA 4ESOA 4DR1B 4REQB 3HUDA 5B53A 1GIAA 2NNWB 4Q01A 5E7MA 4QTUB 1TO6A 4EAAA 1F0NA 1P6XA 1R0BA 2QUIA 2PKQP 3O9MA 4L5CA 4UNNA 1AMUA 2D4AA 1G2OA 1ZK3A 4IG9A 2C1XA 4KV9A 1NXWA 2GILA 2VPWA 5F1PA 2J7PD 1PKEA 5ALKA 5K01A 1TZBA 3HU2A 3K3PA 4KUGA 3IUQA 1KDRA 2WQ7A 4IDGA 4RVCA 3T5PA 3RT1A 1G5TA 2XB2A 4N0DA 1A8QA 2AOXA 4S12A 3CX7A 2Y66A 5LLDA 3RR2A 4P38A 3OT4A 2H2DA 3NIGB 3V80A 2QD2A 5EWLA 3VR2D 1LTQA 1TF7A 4RPLA 3KRTA 4W7IA 1QFYA 3O8QB 4UTRA 5IVPA 3NKFA 3B36A 2J32A 2A9FA 4Y6GB 1LK0A 4M55A 4MB6A 5GOTA 2G25A 3HVIA 4FJ1A 2ZR7A 1Y1TA 5M7EA 5KKNB 4DMFA 3QX9A 3CW9A 4QARA 4YUVA 2YV5A 1U2GC 5K0LA 3RIXA 4YV7A 4I1YA 1TIBA 1I01A 3IP7A 4Z9YA 4CYMA 4ZI2A 4YUZA 4KDEA 5EY5B 1GAEO 3CLTD 3ESXA 1UBSB 2DOGA 1JA1A 2A88A 4N01A 4RSMA 3UXMA 3W90A 1YE3A 4E5UA 3THWA 5KTSA 5K6TA 4RBNA 2O5EA 5JNTA 4NBWA 4PQGA 1E7YA 3LP8A 3LPNA 3V1YA 4GBED 3CRW1 3H1GA 1CVRA 1N6PA 1RJWA 1P9NA 2FGJA 1QHNA 2WAAA 3AUAA 1J22A 3FJ1A 3QE3A 2M6LA 4CGZA 4ZQEA 4GSYA 2IBTA 4X65B 4UVEA 4C43A 3PNLA 4CVNA 1MDBA 2CFIA 4MKZA 5FP0A 4O8CA 2V4UA 1B0PA 5EZSA 3CESA 1DDIA 4GUAA 1PZGA 3LV8A 3KQNA 3AKDA 2F2TA 2OCDA 4CF5A 4B4WA 3T4XA 3X1XA 5KX5F 4FEYA 4W5JA 2QG4A 3WMEA 2HUNA 1DDGA 3JW8A 4HGRA 5JSYA 2OCYC 4YMTA 1UFRA 4RFVA 3T53B 3R7WB 2PH1A 4LGMA 1AOXA 2BKUA 3KZXA 4AUMA 1DIOB 2XF8A 2Y1XA 4O4LA 3ZTYA 4CKYA 4PFKA 4QOGA 4CUKA 4E21A 4OI0A 1G0OA 4TXLA 1MCZA 1PT6A 2IDMA 3MILA 3M4XA 3Q85A 721PA 1VLVA 3JWIA 2WQ6A 4RQTA 1TVCA 5A05A 2AL7A 3BERA 4D3DA 1EGAA 2DBYA 5EJ4A 1BEEA 1PFWA 2P4UA 4PF1A 3TB4A 3TCXB 3NRCA 4XWTA 1MT0A 1EFKA 4M8LA 4QQ8A 3THXB 1X1SA 2BIFA 3FUVA 3TMYA 5FI5A 4HXFB 1XU9A 5PNTA 3UOWA 3EOZA 3TTUA 1KZ9A 3ZJYA 4CQNA 1V5IA 2P90A 2JEZA 1MABA 3K0FA 5HK8A 2VI5A 2CLFB 1NW5A 3LYAA 5EFOA 5F5XA 5AW5A 4EQZA 2VHJA 3KEFA 5J3OA 3GFQA 1SRRA 1UFOA 5BV1A 2C7VA 1VSTA 3ZVRA 2Q99A 3AUXA 4BVFA 1Q19A 2AOTB 2OAGA 4I55F 3OLYA 1U7DA 1C0PA 2ZWIA 4X3PA 4JSYA 3TL6A 4CM6A 2GKGA 3COVA 3PGJA 1VE3A 4ALJA 3HAGA 1LNZA 1UANA 1F14A 3HGTA 5K0SA 4MHSA 4K81B 4DJFC 3WL5A 3CY6A 5CJ2A 2VDJA 3IVXA 4FDUA 1M2GA 1C1XB 2GDZA 1MG5A 4JASB 3PNVA 4OOFA 5EKDA 5BSRA 3RRZA 5LYJF 1K1EA 1NDUA 2X77A 4HPJB 2WHXA 5JD5A 2AQ8A 3OZSA 5A6SA 2ORVA 3PGKA 2VQDA 4HFNA 4PCAA 1XJQA 1XZNA 2GUWA 2PAFA 1WZUA 2XNDA 4KN5A 4Q3EA 1UZMA 1E1MA 5CLIA 3F5SA 4WESB 2NPFA 2IU0A 2XNJA 1VI2A 2QXUA 1TK3A 2VCYA 4JX9A 4R1PA 3LDAA 1I9CA 1ML4A 2JGJA 5I9BA 2IWRA 1X1RA 2QQ0A 1AUPA 2FX3A 3E48A 1EI9A 3RRYA 4PZ9A 2QLNA 4H0CA 4LXQA 2FUKA 3EBOA 4H4DA 4R2LA 1GRCA 1TKBA 1ZH2A 3DDCA 3OEHD 2PD3A 4RV4A 3ZCUA 3GJYA 4BX9A 3EPLA 3TLAA 3I9FA 2B36A 2HQRA 3TK1A 1X7YB 4G5HA 4WBNB 3A6GA 4XYBA 2RBGA 2I1LA 5ALSA 3R3UA 4W6ZA 5FB3A 2ZYDA 3HKBA 4BEJA 4EF5A 4YR9A 2H1HA 3D8UA 3GUZA 4TN1A 5IDWA 5BN3B 1QPBA 1SQGA 2HPHA 2F90A 4OH1A 4WMLA 1I13A 1K92A 1LBIA 3PPIA 2AC2A 2GJKA 2YNMA 4MRRA 2NO5A 1V7ZA 5HE9A 3DMGA 4RYDA 3A35A 3BCHA 4LWQA 2FPGB 5TLSA 1AX9A 3QKWA 4KIGA 1P19A 4MP6A 4NNPA 3W6NA 2E85A 3DCNA 4ITRC 2OKCA 4II3A 3K5PA 4KN9S 4XUGB 2MIIA 1TK2A 3DKIA 4ERXA 3KB1A 1KL7A 3ZHRA 3CVUA 1BPLA 1QU2A 1ZIXA 2VUSA 4L74A 3JCZA 4PSUA 1EFHA 2PRKA 2C04A 4G67A 4G1BA 1OU0A 4N49A 2XWBF 3FHJA 4QNMA 3EFOB 4LCEA 5I7EA 3QVXA 2I6SA 4O4LF 3OD1A 4JKOA 1E4OA 1YDWA 4LZWA 4EI2A 2WUWE 3BFPA 3MRXA 3UMBA 3FDJA 2FOXA 1PTJA 1X7WA 3WA7A 1XGKA 3RI3A 3WQBA 4EZBA 5HKOA 4MINA 5JS8A 4IGAA 1JZQA 1C8VB 3CMCO 5H5JA 2OY0A 3F9RA 3NV7A 4S24A 4EVSA 2VDLB 1PNTA 1ZDMA 5K8LA 1YF3A 1RHJA 4D44A 5AK5A 2MSKA 1KAOA 3CR7A 4OGGA 3SFZA 3D6VA 2P2LA 4U2BA 1E0SA 5PGMA 5KTTA 1PT8A 1UM9A 5AVRA 3CUWA 3TLGA 4HAVA 2XUHA 3KQMA 1W85A 5KU7A 3WZLA 3TGPA 4BXOB 4US2R 4O2BB 1XRPA 2ZYTX 1O6FA 2VP3A 4TV9A 1QGYA 1EUDA 1OLUB 4H6PA 4CTJA 2X9GA 4U5XA 2EARA 1GPLA 1SOMA 1QTNA 2FMIA 2J0UB 3J7TA 5KNCD 5L53A 4G0PA 3FGZA 4RD4A 1E0DA 1XVTA 4PC6A 1JJ7A 1CJCA 2CDBA 2QSJA 5JANA 1AF4A 1D6JA 2YINC 4XSGA 4PYIA 4EMUA 3ETJA 1HLDA 3PP8A 1J6UA 4F1WA 2GAJA 4M3NA 4OXNA 3RWOA 4QO7A 2FSPA 3GW8A 4M0PA 4ZMBA 3A8IA 1JQEA 1WWKA 4EUSA 4UUOA 1LLQA 2COUA 3TEJA 2FWPA 2P6PA 1D4FA 2ZAOA 3S1AB 2CJFA 1EVEA 5HGJA 4TKUA 2H7VA 1WMBA 2IUEA 1DV2A 5EP3A 2PSEA 4HEHA 5KYUB 2G5GX 1X1AA 1L7XA 3JASA 5DOZA 3HDVA 1CIJA 4Q7LA 1A8SA 2IYSA 3K9WA 5CVUA 3W3AH 1YFKA 4ENRA 1IU9A 1VJ0A 3TVYA 2ZTGA 3FVWA 4HLCA 2OOKA 2OAP1 2IYVA 2AC7A 5KQLA 1GR1A 1Q91A 3GX1A 4J1SA 4LDNA 4LGYA 3TRDA 3D7MA 4GXNA 3ET5A 5TIIA 2DRIA 3TD9A 1NAHA 5SV2A 5IM4F 1MX9A 1S3FA 4Q1EA 4OHYA 1FPQA 3D3KA 3SE7A 2VN8A 4J91A 4M9XA 3F4LA 4LFBB 3C45A 2HTFA 1L5VA 3WGNA 1BSVA 2ATEA 3R6KA 4ONEA 2Y1WA 3F0TA 5GZ6A 4B81A 1ODCA 1RXIA 3E9MA 2FN7A 4ETMA 1I1NA 1GA4A 4BX8A 4MGZR 5DMXA 4BV8A 4QBFA 3NX4A 3F8SA 2VR1A 1SKYB 4YALA 4FWTA 1N1GA 4B5KA 2BFDA 4XQGA 4DXAA 1KWGA 2HT1A 1KIAA 5JZVA 1KZGB 5HDQA 2D0DA 1SBNE 1R4NB 3E2IA 3R5SA 2EWMA 1YVDA 3O38A 4GL4A 3R8CA 1NI4A 1IMOA 4P53A 4JY7A 2J9YB 3H5AA 2QP4A 3D2LA 2IBMA 2YDXA 2Z43A 3I9NA 4IUBS 4KEAA 3T8YA 3DYBA 3ZWYA 3A2MA 2XRZA 2FR1A 2JCVA 5ECYA 3AFHA 1SHZA 3L8EA 2DFDA 2GF0A 4DL9A 1DIBA 2TMDA 2F8TA 1ZZEA 3L8HA 5HJ5A 1ICEA 1XZFA 3DAHA 4NVRA 4PIPA 2XCSB 1U0TA 5DI3B 5HF8A 4BGDA 1L5WA 5I9IA 3KQVA 5DN9A 2R47A 4BQEA 2G9QA 3RHTA 2H1RA 4I6EA 3HJCA 1Z0FA 3W8RA 1L5HB 3QFTA 1RM4A 3ILVA 1PEKE 3K5HA 2A1TR 4M7PA 5B1HA 4XKWA 1DAMA 2A2ZA 3EC1A 4IEEA 4D97A 1GPMA 1IAVA 3AW8A 3AR7A 3PPVA 2DU8A 1MJ5A 3DBRA 4Q3KA 4TWAA 2M6KA 3RFCA 4EUNA 3CVWA 5EXTA 5LXTA 1ODSA 1JR4A 2HDHA 2J4CA 2QZSA 2CNNA 3KJFA 4Z4VA 1ZIYA 4BVHA 1GU7A 1N2GA 1ESNA 4YEJA 3I0ZA 5FJIA 5T6MA 2DYIA 1ZIOA 3KOOA 2VT7A 2P1ZA 4TV9F 5KQSA 1KZHA 4AP6A 2VDOB 4M7RA 4C4RA 1Z68A 4ERNA 5KQPA 3I37X 1PD1A 3TJRA 2GI4A 3UUGA 1XP8A 2Z57A 1G1MA 4L3VA 1ZGBA 2AXNA 2AYXA 2E4ZA 4OL9A 3RREA 1EVYA 4FMBB 5CFOA 3LWDA 3PNOA 4KODA 1U0FA 2XUJA 4R3NA 4ZO6A 3BGDA 2RC6A 1BMFD 5BVGA 1ZCZA 2ZBVA 1UBLS 5CDYA 1EIWA 1O6GA 3H5RA 2XZOA 2HBYA 1YL6A 3F1KA 3L7YA 3NVDA 1ISPA 3OZDA 4FFBA 2PHZA 3TNFA 2WHYA 4B48A 2QN2A 1KI9A 2NUBA 3NV9A 3ZXUB 4D98A 1O4VA 3NWJA 5KYVA 3NASA 3VU1A 5BOVA 3G68A 3R3SA 1LDBA 3HCPA 3R9XB 1AZTA 3SSNA 1JI3A 2YWDA 3FUTA 4P3XA 1TJPB 2GBCA 5I8WA 1KGSA 4NJEA 4B3SB 4IHJA 3MQ4A 3EXHA 1NXPA 4BMXA 3AESB 2IZ0A 1T34A 2PJZA 1U3TA 3GMTA 1H4QA 4C0HA 4JZKA 3BGSA 4FX5A 4BFZA 3R7DA 5IDXA 3QVGB 2E4XA 4YCSA 3O8DA 2C3UA 2G1JA 1AXRA 3H2GA 5K0NA 3JALB 5JHGB 4NCXA 2H16A 1G5QA 2JS7A 2II6A 1JA9A 2IYZA 5BR8B 2C7PA 1LDMA 3ZEAA 5AW0A 5KSZA 2DFKB 1L7EA 4QPDA 5IM5A 3WYGA 1KRHA 2PK3A 4EYEA 2Z2IA 1SZCA 2DULA 5K8UA 2C2YA 4GYKA 2O48X 3KBOA 3PR1A 3DWIA 3GU3A 3PKIA 4MAAA 4FZRA 3TB6A 5JNUA 5C8ZA 1N4DA 2AI2A 4QO8A 5CTAA 1IG3A 1QKIA 2K2QB 3PHBE 4ZAXA 3URKA 1PGQA 4XWYA 3F73A 4AF8A 2JAHA 1N8RD 1E2PA 4HPWA 4LF5B 5EZQA 1D2NA 1G18A 3FFWA 4O2AB 2FPRA 1Z4JA 1I4LD 3DXYA 3HDQA 2LCQA 1V0JA 3A3KA 5C5EA 1Q0HA 1SCUA 2AJCA 2DG2A 2QT0A 3AXTA 4LHVA 1YV9A 3CN7A 4QDKA 4TN5A 3BE4A 1KQGA 1G1AA 1T5BA 2RH4A 4X7DA 3C3PA 2FUEA 3ABRB 4DY4A 2G0TA 3BWMA 4BFLA 1G38A 2Q2QA 3AEYA 3AIIA 1P0PA 1HMYA 1ZUD1 5E1BA 1W5TA 3DV0B 1OBCA 4WOKA 3CO0S 4MKGA 1EM6A 3UPTA 3W9SA 1R0SA 2AFIB 2I4TA 4M76B 4RY0A 3QH4A 3VSAA 3HLTA 3E03A 2PLAA 4Q37A 1EZ4A 1OXTA 1N0WA 3HSSA 5LXTF 4D5GA 1OIXA 3WS7A 4PSDA 5BOSA 1SH7A 1W46A 2PEZA 3UOAB 4BVEA 5HKKD 4RGVA 1R6UA 3HO8A 2JGFA 2H48A 4EF4A 1ZGCA 3T15A 3OCJA 3RWBA 3D6FA 3HZRA 1T2NA 4MR8B 2EP5A 5IVDA 3L8YA 3Q88A 4H1HA 2AVNA 2L82A 4IVPA 4LC0A 5AJZA 4RK6A 1BXKA 1O6ZA 4L0CA 3SKVA 3PA6A 5BWLA 2JFPA 4UZSA 4OBWA 1RQ7A 1A9XA 1DI0A 2Z6BD 4KTVE 3E58A 2HO5A 3BJZA 4C1NA 1T2EA 3OZAA 2DWOA 1VYHA 1Z25A 3CLRC 4UE6A 5BNTA 3HB4X 2ZAGA 5K3FB 3DXXA 2V31A 1ZI8A 4HHEA 4O3MA 4O1HA 3QF7A 3OTGA 3B3AA 1NTOA 1T5OA 4ARIA 4PZPA 1QG4A 2PGAA 4JB8A 5TT1A 3UAVA 2ZT8A 3H0KA 5D1HA 4OG2A 5HNKA 4UHDA 4WY5A 4DV5B 3T56B 1FJXA 1TO1E 3EHDA 3EVTA 4U9IS 3SJ7A 2MINA 1MZVA 2A59A 4Z4ZA 4C3ZA 3PA2A 2YC4C 9ATCA 4N9WA 3U4MA 2ONKA 4I5EA 2OUKA 1K7CA 3IBTA 1IB0A 4RF5A 2JIPA 1YFZA 4WH0A 4WOJA 3M4NA 5F7JA 2YOGA 3IEUA 2HQSA 1ZHHA 3EVEA 1ESCA 4LJYA 1GO2A 2G0NA 2QYHA 4XA8A 5DNAA 1ZA1A 4B9EA 4GXQA 4JGGA 5I3ZA 4C30A 2BSQA 2J07A 3WICA 1NYRA 4O4HF 3HSYA 4P2BA 3V3KA 2R11A 3B52X 1CR2A 4B6OA 3IKTA 2RGWA 3ZV3A 2WUVA 2HLNA 2NVUB 3OOYA 2Z6UA 3PLAE 3CV3A 1ONPA 1EP3B 3OM9A 1BMQA 5EQFA 4DFDA 4BFSA 4F0JA 1JHMA 3W9YA 1HV8A 1ZFNA 1DRVA 2P2ZA 3S81A 1ZVJA 1I30A 1TZCA 4J0JA 5E1DA 2H5IA 4X0EA 2V4MA 4ZKEA 1WBDA 1M2FA 4U2CA 1FNBA 5KCMA 1E79A 4X8LA 4HDRA 5FOXA 3UW3A 4KKTA 2OORA 3LD9A 4PO9A 2VPYA 3SSOA 3D2CA 4WCFB 1BDIA 4D46A 2AI3A 3JQAB 4BNHA 3IIMA 1OKKA 4NMLA 1W581 4G7WA 1VMDA 2J5RA 1QQ7A 1XKTA 3D5EA 1DC3A 1VLYA 2FW8A 5DSZA 1LFDB 3C7TA 2CZQA 3MTIA 4YLGA 4MDEA 1E4YA 4FMCF 4AJEA 2DKNA 1ENYA 4C0XA 1KC3A 3H1PA 1W47A 2UXCB 2BBOA 3Q6RA 1B7GO 2RGGA 2VSYA 2LRHA 3P2IA 5U4QA 4S0XA 2AR7A 3TFQA 1TEVA 2J67A 1KXJA 4X5OA 5ADVA 2DLDA 1HMPA 2Q8NA 3GFSA 2NM0A 3C3KA 4IS3A 2QDXA 1RMTA 5ULLA 2JLSA 2BSAA 1CPYA 1ZNYA 1ZXXA 4WUVA 4Y2JA 4CLDA 2ZI7A 2F55A 2QK4A 1UOQA 3AFGA 2GVZC 5IARA 5JXGA 1MC4A 4K9PA 5SZHB 4DMLA 2YOFA 2QT9A 2E89A 3WTBA 1ZOOA 2PO5A 5FULA 3N74A 1LY1A 5TX7A 7YASA 2UZAA 1LQUA 1RMQA 1M2NA 2O3TA 5LQUA 4XTRA 4W99A 3UK1A 1ATZA 3I09A 5AXAA 3EZLA 4NH0A 3NJRA 4B7XA 2NT3A 2V0NA 1Z9BA 4CETA 1SVNA 2H06A 4FB5A 3VNSA 1SUEA 4LJ5A 5BP7A 4P12A 1R3UA 4FU0A 3H87A 1N5OX 2JFUA 3O4IA 4DJAA 5JD4A 4JQSA 1NR5A 2Z3VA 2D8MA 4HZUA 1JVSA 2BGJA 1VMEA 5KPDA 5BNZA 2YWXA 3W6ZA 1V8FA 3SLDA 1TM2A 3OY7A 1O3YA 4TLEA 1W59A 1ZH8A 2H2AA 3PE4A 4UVHA 3V4RA 1TQ2A 2OORC 1ZY2A 3A10A 4NYMR 4PNZA 1ONOA 4HDNB 3FKQA 1SUBA 2CUZA 2PANA 3PQEA 1NX9A 4KMRA 4ATNA 3G0OA 4UAUA 4YAIA 3WBFA 2FSUA 1C50A 2WJ4A 5JSZA 1FX0A 2RGAA 3AJ9A 2ZR8A 2PMEA 3UJ3X 1JQDA 2OTCA 4W9RA 4M8SA 4Y1RA 3S6JA 3VNBA 4B82A 2Y77A 1R8SA 1QGDA 1H2ZA 3EASA 2HWUA 3JQDA 4BWGA 2PKCA 2OCGA 1D03A 3LOPA 3OFND 3JU4A 1H3FA 5E9QA 3VA7A 1ZJWA 1IY1A 1AZSC 1YS7A 1KEUA 1KEZA 3EIWA 4R2XA 1MW9X 2GR9A 1NN5A 1T0HB 1PR6A 3DB1A 4P9NA 1KS2A 4B40A 5THXA 4JLDA 1D0VA 1M0TA 2PT7A 4FKMA 3RIHA 4I5IA 4AF7A 4G0MA 3NGXA 4A8HA 3OJOA 2X8BA 1GZUA 4KXXA 4S35A 3STTA 1KMHA 1ORDA 4JI6B 3TTSA 1VECA 4Q1CA 2DY0A 1ZJ5A 4N5MA 4N3NA 3O82A 4X91A 1HE2A 2ISQA 3FDZA 4TVKA 5AUQA 3NTQA 4EENA 3PQ8A 4BZQA 2W2XA 4BB5A 1XQ6A 3KYCB 4D6XA 3WLHA 1NXVA 3DOHA 4R54A 2BV3A 4MLPA 1C0IA 1E2FA 4ZEWA 3EG9B 4TSRA 3VHXB 1N92A 2H00A 2RGNA 4PICA 3OOEA 5H3LA 4PLYA 1A2QA 3DB2A 3GUHA 3EVFA 1JEQB 2O07A 4EBBA 3ASUA 1EAMA 4HT3B 4YRGA 2JI7A 2G7MC 1L4YA 3KD3A 3BMOB 2YJNA 3JXEA 5A4KA 2QPAA 1ZI9A 3ZWPA 2M1XA 4LJ8A 2Z8ZA 2OGZA 5EKSA 4BEBA 3W79A 4EW3A 1NRKA 2GD0A 4F93B 3OT5A 2XXAB 2X7XA 5I45A 3JYQA 2B83A 2JD2A 3FCXA 4JP3A 5FOTA 5LB2A 2DWQA 1F8XA 1P45A 4M83A 5CW1A 4IGKA 1EGHA 1JQJC 3I6IA 1ZR2A 3M6MD 4EECA 1P0MA 3ODGA 1IXRC 2BWJA 2P6NA 5EUQB 4EHLA 4I5FA 3HL0A 4GR9A 4QDJA 4MGHA 5C1PA 4U63A 4DR2B 1UKCA 1Y5MA 4PSAA 5CM9C 3C16C 4C3UA 2ZRKA 5D3ZA 1F3LA 5FO0A 4OHFA 4YHHB 1O58A 1L8QA 4PLWA 3WL3A 4EYOA 4ZGQB 1DJPA 4IH4A 5BMVF 3LQKA 3BMCB 1KHTA 3TNDA 2C98A 1UT8A 5F35A 3AHGA 1E4VA 3RUEA 3SOZA 2UUAB 2MYUA 2ZYIA 1WHSA 3KVYA 3MMPA 4J0CA 3E7WA 1WVMA 1ZN9A 4JB0A 3ZY5A 1HEUA 2IV2X 3H3FA 4G0VA 4P4LA 2FPOA 3WXBA 2XR1A 4K6FA 1GYRA 4BJ1A 2X8WA 3IEIA 4O4IB 3EARA 1RFGE 3K0EA 1RCUA 1J00A 4PGGA 5K05A 4HIZA 1WUJS 4QM7A 3UHJA 4Y2GA 2IUTA 1T0JB 4NFLA 4F3YA 3RAGA 1NLFA 1WMFA 2YZNA 1T4MA 3R0JA 3DT9A 1H8HD 4RVOA 1IWPB 3UAXA 2EKDA 5AKGA 1XEWX 4ZYUA 1GUDA 4M8IA 6AT1A 3LPLA 4QDUA 1PJCA 4NULA 1MVOA 3ISTA 4GPZA 5JDCA 4MIYA 2ZTSA 2QUAA 3MJFA 3QV2A 5LKRA 1FLDA 3SR4A 3FPSA 2RB5A 1KK0A 3JS5A 4MYTA 1DOZA 2K5UA 4DM3A 3K9FC 4R0NA 3QUQA 3DFUA 3RY8A 4Z0PA 2V3WA 3QELB 3ZXSA 3M1IA 3GAZA 1SM4A 1O08A 2BISA 2F1KA 2W8ZA 3CNEA 3WJAA 3CC2B 3AM4A 2BM1A 1TYCA 2IYEA 3R76A 2O8BB 3PXGA 1NRXA 4LX8A 1P1FA 4KVFA 4CLRB 4WXYB 2I3ZA 5CBPA 4ARSA 1ELOA 1PW7A 2FFQA 2R25B 3ABOB 3R1IA 3EAFA 4ZCIA 1HFJA 1NU8A 2J7PA 2XMZA 4ZA2A 3ZDBA 3RSZA 1U1GA 3PDIA 5D2CA 2NV6A 3A11A 2XD9A 4ENQA 2H1IA 2ZB8A 4ACAA 2WOJA 3OM1A 2FZ4A 1K4KA 5J59A 1XXHB 5LQMA 2FSVA 2R2AA 1L1EA 4P80A 1G7TA 2C58A 1BCSB 2NP6A 2OLKA 4FXPA 2QP9X 4MKRA 1MH9A 3LY5A 2FDRA 3VR2A 4QRIA 1FA9A 1B1CA 2DBQA 3JVEA 3BHMA 3LFHA 5DRTA 3THOA 1A9PA 3ADPA 4A5OA 3AH8A 1FTYA 1QDEA 4PFSA 1U8YA 3UC5A 5M34A 2VRWA 4RL6A 2O2SA 4ZZ2A 3GFPA 4EEKA 4ZFNA 4DR6B 4YT5A 4M22A 1SZJG 1WPGA 3PUKA 3RVBA 5E1MA 9LDBA 2YUTA 3M4YA 4KGVA 4CIXA 5L3ZA 2B3DA 3B6MA 5CXXA 4CMIB 1AF7A 3RSFA 3WHKA 2A9KA 2IGBA 1YIOA 2I4NA 3I6BA 2DWUA 4C7MA 3VX3A 4G1MB 2NO4A 2YVAA 1JHZA 4HGOA 1KARA 1C3JA 1NHGA 3EDCA 3L1KA 4GSKA 2ZLBA 1JIUA 4MW0A 1AKQA 2Q6KA 4YDRA 1Q0LA 3D9QX 5JS1A 1MRSA 1XTBA 1FRZA 2XITA 1ZX1A 4G86A 4TQGA 4DLKA 1FSFA 4L4UA 2H1VA 3FYSA 2QGNA 4GOOD 3IUJA 4HD8A 1P0IA 2RAUA 5IJAA 5KAMA 3ZW8A 2NLOA 1ZD8A 2R65A 5TQ0A 3IAFA 3UY4A 3FUCA 4XIFA 3T1NA 1UBNA 4AZ0A 1L7RA 1GQYA 1X6VA 3OZWA 3B2EA 2Y1DA 3W2TA 5JDIC 1AJEA 1G3RA 1E3MA 2HJSA 5CM8B 1NUTA 3O1HB 2Z09A 2WV9A 4KR6A 3PRHA 3EWAA 5JYDA 2C82A 5GADl 1JBQA 1P5RA 3D8SA 2YXDA 3KOZA 1ZUIA 1BQ3A 1E32A 1K86A 3G49A 4KC0A 2HBQA 4V3BA 4GP7A 3ROKA 1NG9A 1XCPA 2D4HA 2VCHA 4U7WA 2ZFUA 4RPKA 2PNJA 2N3ZA 3ABQB 5JSFA 2EYQA 4WT7A 3SE0A 4JX8A 4R2WA 1ZH4A 2G76A 5BN1A 2JLAA 3JQ7A 1GT6A 1EP1B 4DB2A 1T91A 3G7SA 3O2SB 1DUIA 1BW9A 4EB3A 5AK6A 3HEMA 4QKQA 4L07A 1NA5A 1YB7A 2E82A 3C43A 3ONWA 3G6EB 4LECA 4XE5A 5CA1B 5CA0B 3IRUA 4QPNA 5A7FA 2C94A 2QL5A 4LBYA 1OWNA 5REQA 3PE3A 3IH5A 1IL0A 1CNFA 5K8IA 4ALLA 3KKLA 4UPEA 5ILQA 1Q1AA 1RZUA 2FMKA 3TQFA 3R75A 1NXXA 1JQKA 1NNI1 2NSHA 3CLTC 1FTWA 1JKMA 3L92A 5F4JA 1KDZA 6YASA 2I7CA 4HE6A 4R7GA 3BB1A 3WYDA 4HY3A 3C5CA 1BD4A 3BFVA 2YBEA 5KVAA 4GOND 1ZCAA 1J21A 3DEIA 1O97D 3FRIA 4Z2YA 2VH2A 1FMJA 3KZ1E 4KFSA 4ZYWA 1WZNA 1Z33A 3WQHA 1A96A 4RY8A 3ANMA 3ICOA 2PMBA 1JQ5A 3LL4A 4F6RA 3OY2A 4F97A 4F2WA 1ZOPA 1M73E 3K16A 1C3LA 2V58A 3CNNA 1Z7BA 3DPIA 3NTRA 2L18A 5BQ3A 2FH5B 2PR2A 1CZUA 1NRIA 4RA9B 4TUYA 3RVSA 2AEMA 1ZU5A 3FPHA 3ACCA 4GEKA 3ZGNA 1RVDA 2O8VA 5EGNA 2V97A 5ARCA 1DEOA 3IOCA 4BFWA 3PLRA 4CEIB 3QI7A 4DIBA 1YE8A 2HPVA 3DTVB 2CXNA 3LGSA 5JJLA 5K5EA 4COOA 5LYYA 3ZLUA 4PY2A 1PNOA 1T9GR 3VZSA 3AVYA 5AVUA 1C3EA 1KOLA 3FZNA 4U7PB 3LLCA 1IRXA 2V03A 3I39X 3AF1A 3P0EA 5E2BA 2JGEA 1EDZA 3GFTA 2HLPA 2Q6LA 4TMKA 3SZRA 2CE2X 4YAKA 2QD1A 3E1YE 4KIUA 2Q0SA 3FZYA 1OFVA 2GZDA 3B85A 3IP5A 4X90A 1PWZA 4OBEA 3CM0A 1UOOA 4XNFA 3RIEA 5BUCA 4X71A 4X1KB 3P2OA 1DAKA 2NO6A 5CPFA 1NVXQ 4CFYA 5B6PA 3PEEA 4PTYA 4E32A 1NI3A 1ZM9A 2VQSA 2J3MA 1VIDA 3D6NB 3MGKA 4GYWA 4KZKA 4ZYYA 7REQB 4WLOA 1VHJA 4WKOA 2Q5HA 2C77A 1CIPA 4TTSA 3AR8A 3G23A 1CUEA 3DUWA 1BZYA 1YR2A 2GPWA 5AJVB 1XMOB 4XLCA 1IDN1 4YTEA 1CLEA 1NBAA 1UC9A 3BORA 3M9WA 4MYSA 3DFZA 5ER6A 3D3WB 4NYJR 4B79A 2W83A 2IPMA 3GRYA 4JJZA 3KAKA 1IHMA 2VTBA 1CZKA 1NNEA 3PPWA 5AN9A 4F4UA 1PJZA 1JU4A 4C7VA 4J75A 4W1QA 3OU2A 4B4VA 5IXSA 4XPIB 1UZLA 4D3FA 4DV1B 2DYKA 3HBMA 1ADYA 4UATA 2GH1A 3L8GA 4ALMA 3NT2A 4RABA 3J80A 4B3RB 16PKA 2ZL6A 4X8MA 5E0OA 5F5LA 3QE9Y 5A04A 2Z2ZA 4DV2B 1YVRA 5FI0B 3PEVA 3VR4A 4QL3A 3W9BA 3I56B 3JAWA 4M0LA 3I1FA 4Q9JA 4D0SA 1QDLB 1YJNB 3VUEA 1E9VA 3ZD8A 4BO7A 4F5YA 1SKMA 4OQZA 1OHHD 3FGOA 2V7WA 2J8ZA 4QVIA 1RWNA 1CETA 2I5PO 4C2AA 3F6YA 1TMGE 5CJPA 1VXOA 1XTRA 2PA3A 5DTMA 3NTUA 3SEJA 4HEJA 1JTVA 5KNCA 2GDJA 1HLFA 3AHDA 1KH2A 1A95A 2YIVX 1G3MA 2D5AA 1P4MA 2P41A 3AI7A 3EXAA 3ZZTA 3KTAB 2NQTA 2YV3A 2AWOA 2OUIA 5BW6B 3P9PA 2QBYA 2GD2A 4YYEA 2O7QA 4C3VA 5BWCA 2A0UA 1GVHA 3U7EB 2WF6A 4KVZA 3T7SA 1IJBA 1IZZA 1M0SA 2HIAA 2P3QA 1V5GA 3IEPA 3PNBA 4KLRA 1ZGGA 4YJ2B 5B1SA 4Z5XA 5JT1A 1DCTA 1AKEA 4WFJA 2HSWA 3PICA 2O2GA 5KOJB 1P18A 2IC5A 2V9ZA 2WJAA 4YP6A 3SZOA 2OCAA 4A2PA 5C7YA 1ZRHA 4IYJA 3WIOA 4A2CA 5LQJA 4K9SA 1NPYA 2GPAA 1D4OA 3GP3A 3WYFA 5CITA 3R3HA 2C96A 4TUYF 2ASEA 4OI1A 2JGRA 2HDWA 2QJRA 2PL3A 3K05A 4Y6QA 3T35A 4RTQA 3UUFA 4FPXA 4NFHA 1OB2A 3FCSB 1KFJB 2JLBA 5L7YA 4HXGA 3ZV6A 1R37A 4Q3NA 2VDUE 3TPZA 3G2QA 4CM4A 3IQIX 4EGAA 2H2WA 3DNPA 4IHAA 2OK8A 2QN8A 4GQBA 4PGHA 4I1UA 1C7EA 5CFZA 1ZVVA 1DGQA 1DOHA 1V26A 3D2BA 1F1BA 1J8MF 2W6ZA 1J39A 3ZN2A 1DT3A 3H8VA 3ZHUA 3NHZA 2WIFA 2Q0QA 2UYOA 5DH9A 5CIYA 2CKMA 2IYRA 1RKBA 1J0DA 2JL1A 4JUDX 3NBYC 4A6PA 1XKQA 4A0RA 2QTNA 3HEBA 5AESA 3QQ5A 4RLSA 4B2LA 3QHQA 3G5TA 1LSOA 4RKFA 4JXXA 4X92A 1PI3A 5CX1A 1BVUA 2GRJA 1E4EA 1M6VB 5FOSA 1L1FA 3DOOA 5HGXA 1D7OA 1YKFA 3MJHA 4H77A 4UW9A 5E6SB 2X2OA 4YRQA 1BE0A 1GZ5A 1L8XA 1T10A 3KTOA 1S7GA 1IBMB 4HQLA 3CJRA 3QFFA 2FWJA 1LRJA 2I2BA 2JGDB 3DDHA 3M6VA 5FLEX 1RKUA 5AQEA 2ZI3A 4LK3A 1U4OA 4YELA 2O2HA 4E5YA 5GTDA 5GIPE 4II2A 1FFWA 3EQ6A 3HJUA 4G25A 4MVYA 2B82A 1KMMA 3CE9A 1A8UA 3AXSA 2GESA 2ZJBA 5E4YA 4Q7EA 1E2GA 2QYOA 2C78A 1AM4D 2H5EA 3DQZA 2XB6A 3JQBA 1E6EA 3Q12A 3QOXA 4BV3A 1IRIA 1DEHA 1F2UB 2G77B 2YQ4A 1ZMTA 4IVQA 4J3NA 3RS9A 3K70D 3ES9A 4ZXPA 1WCYA 4NABA 5CT9A 1IUPA 1FVFA 2RHWA 3TRIA 4YONB 1N3LA 3RB8A 4E09A 3IMEA 4QYWA 1DOAA 5KNDA 2Z3WA 3ZYCA 3IEVA 2B6NA 2HM7A 4TTAA 5DJ5A 3L07A 2G82A 4PLGA 1QVVA 4RENA 3ZDYB 3T5AA 3CT6A 3QI2A 2PRYA 3ETEA 3G2KA 1SQ5A 5AOCA 1JW9B 3DFIA 1WY7A 2HU5A 4PG4A 2VJKA 3DVAB 4KQ6A 4S1VA 1G2IA 1U8CB 5CEFA 2HAEA 4W5NA 3EVBA 4KWEA 2CMKA 1SELA 1J8VA 1MJNA 3PU6A 2JEOA 4LSWA 4TYNA 3SYRA 4ZICA 1OZGA 1XVVA 3KXDA 4FIDA 5A03A 5BUZA 1EK6A 3A2KA 2BJHA 1KJZA 2BP7B 1QFSA 3UB4A 4OP7A 3ZE9A 2XUPA 1V2GA 3MCUA 1DINA 2OWEA 1O5IA 2PUWA 1KVRA 1Y4SA 3BTOA 3R4CA 4IZ6A 1OLSB 1T4BA 5B1DA 3WWZA 2AG1A 1MTOA 3HP1A 4A91A 1E9RA 1BEUB 1DBIA 4ILKA 3H8SA 4MUNA 3DXZA 2QR3A 3OKCA 1BMFA 4TKVB 2G8NA 5HMLA 3WMWA 4HRXA 3DSRA 1ZAKA 3MUFA 2CD7A 3GQBB 4Q15A 4QUKA 3AGQA 1PF7E 2I4RA 2X3YA 3A4NA 3QG1A 2UUCB 3BH4A 1VMIA 3C1TA 2ACEA 1GFZA 2CDAA 5I7VA 3TOXA 4MYHA 5LN1A 4EB6B 3Q1KA 4B73A 3ICEA 2WTUA 2WIBA 5C8VA 2O2EA 4G0XA 4HGPA 121PA 2UZ0A 1GRNA 1LRLA 1NFFA 2XXBA 2H7YA 3JQBC 3PF8A 3CIFA 2ZYRA 4RK5A 1YQUA 1JEAA 4FCTA 3ZCPA 1ANKA 2Q5EA 5DYTA 3ZCRA 4AZTA 1PR0A 1B26A 1UWCA 3GXOA 1NVBA 4DCSA 5KSPA 5IJ9B 4AN4A 4AVYA 3FWYA 3QKIA 2ZRNA 4Q48A 3N8HA 1QIDA 2DQYA 1XROA 2OV4A 1ZH0A 4QJ4A 5CR9A 2I2AA 4LQDA 1SUFA 1W52X 2HF9A 3FNIA 1CWUA 4R0VA 4S1WA 4ZVVA 3GL9A 1XQXA 5IH7A 4P1VA 1GHTA 2XMCA 3QNMA 5FWAA 2QT1A 1QMGA 4RHUA 5EESA 2Z08A 3ZY3A 3R0ZA 3H19A 1K5DA 2QGGA 3NW9A 1P1BA 2WU0A 3RF7A 3UTCA 4PYJA 3TLBA 4X63A 2R2GA 1J7KA 2R7NA 5KYNA 3TQOA 1E5LA 2J6IA 2F1IA 2WWWA 5AKIA 4EUKA 2ETVA 4U2KA 4XB2A 3S3TA 4Z4TA 4OI4A 1DWQA 3LGAA 4QYMA 2JCGA 4P5PA 3PCXA 2PR7A 5A2GA 3RJ5A 2GJPA 1OZHA 4RJTA 3KT3A 1E6LA 1C7JA 5AI4A 3HBNA 2G63A 3H1AA 1TIKA 2CF6A 1F48A 3W3ZB 5BNIA 4C2UA 4DCCA 2ZE7A 1KIFA 2A4KA 3BAFA 4OI2A 2QSZA 2IKQA 1Z2CA 1XEAA 2GSWA 3UMMA 3KZOA 2W4IA 1V2HE 2OL4A 2ORIA 3B6ZA 1PL6A 4R68A 1E9SA 2Q50A 1WKCA 5DSTA 4CKZA 3B12A 2WF9A 3TZEA 4KITB 2NYAA 1WAMA 3MLEA 5K8VA 4G8JA 4F2HA 2EZTA 2WU1A 3HCRA 3HACA 3FNHA 5CW2A 4KFTA 4UPVA 1UWVA 1YAHA 2RD2A 4QYTA 1LI5A 1XEXA 1DVRA 2X6QA 4KFRA 4M0FA 1QJCA 4UHFA 5E8RA 2AFHA 2RAFA 3EEOA 2IYOA 3ZD6A 3BPSA 4F3TA 2FP4A 4JUAA 2RGXA 4EJSA 5HKKA 1R50A 2QTCA 1FYDA 3EZYA 4DNRB 3G8AA 1YBAA 5E9JA 2C9CA 4OX9B 3HPQA 2QRUA 5FFNA 3T0GA 1U4SA 2CLMB 3L02A 2OAEA 3M6LA 2D5BA 4RHTA 3UUEA 2R8OA 4RCYA 3AY0A 5KWVA 3KE9A 2H2FA 3M7IA 1Z7YA 2SECE 1EFAA 1J25A 3M3DA 4I4TA 5BQXA 1IXKA 2CVOA 1G64A 1XDDA 2ZXUA 3LHFA 1ZK2A 2BLNA 4QUJA 4DA6A 3WI7A 2NSJA 4NPAA 4JBXA 2ZBRA 5DO9A 4AROA 4P81A 2VDWB 3SGLA 1OH6A 5JAZA 5JAIA 3OOWA 3RG8A 3S2YA 3I73A 2KB0A 2JGMA 3SI7A 2VOEA 2ZANA 1NW9B 5I4BA 4BY9E 1FRQA 5JVDA 3BDIA 3OCYA 5EHIA 2HB6A 4LXYA 3SU8A 1XQBA 4ZV4A 1RAAA 2IOQA 2QLMA 1S2NA 3I9V6 5DM4A 3S0JA