2JN9A

Nmr solution structure of ykvr protein from bacillus subtilis: nesg target sr358
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
105
structure length
105
Chain Sequence
MVKTLRLNNVTLEMAAYQEESEPKRKIAFTLNVTSETYHDIAVLLYEKTFNVEVPERDLAFRGEMTNYSTSLTNLYEPGAVSEFYIEITEIDKNADSLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords YkvR protein
publication title NMR solution structure of YkvR protein from Bacillus subtilis: NESG target SR358
rcsb
source organism Bacillus subtilis
molecule tags Structural genomics, unknown function
total genus 14
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2006-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11514 DUF3219 Protein of unknown function (DUF3219)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.80 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 YkvR-like 2jn9A01
2JN9A
chains in the Genus database with same CATH superfamily
3P26A 5B6IA 3SLNA 3OAAA 3OKXA 4XLFA 2WR8A 2FVGA 2W6IA 2Q6KA 2GK7A 4X7DA 4DNRB 2DCUA 1BX1A 1XB2A 3BNWA 3AVTA 1AIPA 1FNBA 1KK3A 1E79A 3WYAA 2F4NA 3U6KA 3V76A 4DNTB 2FX3A 2RC5A 3KEWA 2V7QA 1R5OA 4HE5A 1DARA 1COWA 4QV2A 3BCDA 4ACAA 1H8HA 3VO2A 2BPOA 4II2A 5L46A 3T53B 3DDYA 2VNJA 1JA0A 1N06A 4OPSA 3PA1A 1W35A 5DN6A 4RM0A 4B3FX 1KZLA 1W9XA 1EXMA 2BSAA 3OW7A 4WWVA 3AVYA 5JBQA 1QH0A 2M5SA 2ZXIA 3H94A 5F4OA 3ISXA 5KW9A 2X3UA 3W2HA 1T5EA 1QFYA 2BV3A 4P1VA 4WQMA 1N05A 3CCLB 2ZZGA 3GVLA 2ZZQA 1E64A 2Q6OA 2XZPA 4KKUA 1PJ6A 1ZM2A 4Z4WA 3LQ6A 4NCNA 1JA1A 1Q9SA 4OOVA 4KKTA 1Q81D 2X0KA 3CD6B 2WPDA 2W6JA 2YWEA 3GSIA 2XZOA 1E43A 1JB9A 3ASRA 2ZZFA 4OOSA 4M1KA 1Q86D 4L8JA 4YAFA 3VO1A 4Z4VA 1EP2B 4X8IA 3JQQA 2CC2A 4K1XA 2E1RA 4PC6A 3GVJA 1E1QA 3CCSB 3CC2B 2HMAA 2YWHA 1TUIA 1VQPB 5F4JA 1WTHD 2DIEA 3CTAA 1VQLB 1CQXA 4RCZA 4XOTA 1IB0A 2B7BA 4RJLA 2GREA 3Q6RA 2JIZA 3H9NA 4X07A 2VJIA 4XLHA 1BJKA 4RCYA 3SEJA 4AVZA 2XEXA 3OJXA 3CMEB 1NB0A 1GO2A 1EWYA 4X0CA 2QMUA 3J81k 4TMVA 3JQPA 3QFSA 1K8AD 1HVXA 1V5VA 4DQKA 4ZGNB 1N0UA 3OZVA 1SKYB 3W2EA 3VMFA 3ZUGA 5AN9A 3CP2A 4PC2A 1D1NA 3ZPNA 1IJEA 1FX0A 3OEHA 1NB9A 2QA4B 1VQ8B 3CPXA 5HZAA 4Y9RA 3LNNA 4II3A 4P9SA 5TY0A 3GIRA 3CMAB 1YX2A 1BPLA 5BSYA 4B43A 4QHYA 2DYIA 3V7AA 4XL9A 4YALA 2XNJA 1G7TA 5IYNA 2DOGA 3CCEB 4IW3B 1KK2A 4P2NA 4XKWA 1OB0A 3WY9A 2JJ1A 3ZBTA 5BSXA 1PKVA 1W0KA 1E63A 1NBMA 2X6YA 2V4DA 2XNDA 1FDRA 3PENA 3T51B 3I55B 2BMWA 2WJYA 4XLCA 1FNDA 3OZUA 4C0SA 3G71B 2OTLB 2I1LA 1J9ZA 3A8KA 3LVBA 1VQ7B 2R6HA 3R6JA 4MYTA 3BY1A 2AHOA 2V7XA 4RD2A 3ZZ0A 5LMZA 4AC9A 3CC7B 1EFUA 3R6KA 1F60A 3LO8A 2D9RA 2CW5A 4XR6A 3QE2A 2XZLA 1N07A 5EMNA 5J35A 3ZZTA 4TSFA 4TMWA 3PA2A 3CMMA 1S0UA 4M53A 2X85A 5A88A 3AVWA 3ES9A 3CP8A 4TMTA 1E3ZA 5E6TA 4WZKA 2VJJA 3WNDA 4EH1A 3KL9A 3ONUA 4XLEA 5IYWA 1GVHA 2EIXA 3B8HA 4PC7A 1JJ2B 4XKVA 2ZITA 5H5JA 4P3YA 3T56B 3GQBA 4Z4RA 1NDHA 4N3GA 4RD3A 1DDGA 3FKSA 3OW2B 3B78A 1WU8A 4G7XA 5FNZA 1KC8D 1U2RA 2WZNA 1K73D 1A8PA 1BX0A 4XD7A 3A3GA 2JJ2A 2C2WA 4P25A 4PABA 4XOPA 3I56B 2DY1A 2D74A 2GK6A 4XM3A 2OK8A 2ZZEA 4XONA 2V31A 1H42A 2BVNA 1CNFA 4OOXA 4TMXA 1QG0A 1OGJA 5TR9A 1I8DA 2OBRA 3W5UA 1QUFA 4Z4TA 4E0FA 2EFGA 4PAAA 4XMYA 2ZTNA 4XQFA 1S4MA 4YAWA 5FIUA 5DS0A 4WZLA 1RQPA 4RD4A 2CF4A 2QE7A 5DSZA 1PJ7A 1H85A 3Q39A 2QTLA 3CRZA 2X6XA 3ZIAA 1T6XA 4B48A 1QGAA 1OB2A 3E20A 2V7WA 3I1FA 4X05A 1GAWA 2HDNB 2ZTGA 5IYRA 2ZXHA 1EP1B 2XNCA 3FPPA 2GJRA 4WZEA 4N3NA 2E1BA 2KVOA 3BQJA 4YELA 1TTTA 5FO0A 3SJPA 3ASPA 3OZWA 4U9UA 1BMFA 5GV8A 2V7TA 2OTJB 1Y0YA 2F43A 1QUEA 2F1MA 3GVKA 2ZL7A 1NRKA 2CRVA 4YHBA 4H9GA 3CCJB 4Z4ZA 5F4MA 1D8TA 2OBTA 4P6VF 4RPBA 3G4SB 2D3LA 4LC0A 1YITB 2OBSA 1VHOA 1N08A 1Y0RA 2V7VA 2X6WA 3ASTA 3SJZA 4Y9UA 4Z1MA 3OFNA 1VHEA 1QGZA 4B3GA 2JN9A 3ZC3A 4CQJA 1E3XA 3A35A 4P3IA 3A1PA 3W2GA 4B44A 2LZJA 1CNEA 4C43A 4P12A 2C4UA 2F1LA 2GJPA 4Q7JB 3AVXA 2WJVA 1RQRA 1WOSA 4YAUA 2C4TA 2CK3A 3QFCA 1KD1D 4Z4UA 3QFRA 1W0JA 4RDLA 4P22A 2B7CA 4ASUA 4M2LA 2WYRA 5FO1A 4Z4YA 4ZCMA 5A8AA 1WORA 2VNHA 4NBSA 1OGIA 1AMOA 1VLOA 1BLIA 1G7RA 1UD8A 3OOCA 3W2FA 4G6IA 3FJOA 2OK7A 1GR1A 1KK1A 2X8KA 3A8JA 1DG1G 3OEEA 4R71A 4FWTA 4ZGQB 1GAQA 1FNCA 3D26A 3RY8A 4HIZA 2D3NA 4OPVA 2ZBVA 2P3MA 5J3OA 2QEXB 3WBJA 4TMZA 5HKKA 1B2RA 5TRDA 1ZM4A 2CBXA 1IJFA 3QSYA 1VJSA 4KKSA 3CCVB 3PUMA 1OB5A 1QVFB 4QVAA 4M4SA 4RD1A 3SLDA 1EFTA 1ZM9A 2BM1A 3Q38A 1DDIA 2VBVA 4XLAA 1T6ZA 1YJ9B 2ZL6A 3E1YE 1ZUNB 1UMKA 2OYNA 2NPFA 3LQEA 5FL7A 4X7FA 2BM0A 4LBYA 3FPKA 4PC3A 2DETA 4ZV4A 4GQNA 4Z4SA 2VBSA 2VBTA 1PJ5A 2Z6BD 4DQLA 3W5VA 2C5BA 3WXMA 1M1KD 3U2QA 1R5NA 1UD5A 2XOKA 3VR6A 4LBVA 1IHMA 1QFJA 4YXWA 4LBZA 3BH4A 1YI2B 2GQFA 3PVDA 1V0FA 1V0EA 1H8EA 1K9MD 4F7DA 2DEUA 4RDKA 5IK2A 1UD3A 3A3BA 4UZEA 3AGQA 4Y7CA 1SKQA 1VQNB 1FRNA 2CNDA 3Q3AA 3AGPA 4XN3A 3SKBA 4ZCIA 2HLDA 1WPCA 4X7CA 1YJWB 2VYQA 2WSSA 1BQEA 4G1VA 1N8RD 5IYQA 1WSRA 3A8IA 3VNVA 4WZTA 1QX4A 1WDTA 4DK0A 4ZCLA 4XN0A 3ASQA 2PE3A 4HE6A 1B23P 1VLYA 1VQMB 2GJKA 2DERA 2B5OA 1HA3A 3ASSA 3CW2A 1I7PA 3BC9A 2Q6IA 1VQ9B 4UAJA 4DK1A 2BF4A 1QVGB 3B82A 4FXUA 2HCJB 4P26A 1VQ5B 1WOPA 3WNCA 2J7KA 2QTZA 2VZLA 4UZUA 4NNJA 1ELOA 1WOOA 3JQRA 2JDIA 3OPOA 3WBKA 2X53S 2XGJA 3U6BA 1XFOA 2BGJA 1YLOA 3CESA 1I18A 4B4DA 1M90D 3WNBA 3CC4B 4J0QA 5FA6A 1E1RA 1GJRA 2NV4A 2C77A 1KJZA 4P6YA 4YAOA 1VQOB 1JNYA 4PC1A 1W34A 4G7WA 4ACBA 3CXCB 4JMQA 1SM4A 3CCUB 4YEJA 4B47A 3G05A 2PLFA 4PGOA 3OE7A 2RC6A 3AVUA 3Q6QA 3QFTA 1ZM3A 1KRHA 1YIJB 3P27A 4XORA 4G5GA 1UD4A 3AVVA 1UD2A 2VNKA 3PUNA 3CB4A 1WSVA 4X06A 1VQKB 2YWGA 1VQ6B 3CCMB 4X7EA 5KNLA 1Q82D 4AF7A 1KQSB 1FNMA 4FK8A 4B3XA 4RDJA 3CPWB 2PMDA 3W5HA 1YJNB 1N0VC 1QFZA 4LBWA 3WQZA 1VF7A 4BPRA 4TT3A 4OPOA 4M0LA 5CDFA 2QGGA 3NE5B 1MRZA 4OP7A 5GV7A 1NJID 1T6YA 4RLZA 1D2EA 1KTVA 2YWFA 2BGIA 1XE1A 1HZEA 1F20A 1XQBA 4QUZA 2C5HA 1EFRA 3CCQB 5HZBA 1E62A 3OJWA 4RD0A 5TV2A 3VNUA 1OHHA 4FN5A 1KK0A 1KMHA 1MABA 2ZL5A 1Q7YD 2C78A 4MYUA 1P4MA 2PIAA 4RPDA 5THXA 4UZFA 1G7SA 1WP6A 2QDXA 1VQ4B 2GPJA 3G6EB 2ZBUA 2Q6LA 3OP1A 4G1BA 2BN4A 1R5BA 3BY2A 1EP3B 3BCFA 5A89A 3HAGA 5HXBA 1K28D 4XNFA 3ONYA 5KSWB 5IYPA 1G7CA 4QVJA 1S72B 1W2BB 4QFMA 3ZBUA 4TKOB 3ZZUA 5H59A 1QGYA 4RD6A 3MMPA 4ROXA 4TN1A 3MCAA 2VBUA 1EFCA 1W87A 1YHQB 2VNIA 3JU4A 3W2IA 1TVCA 2QN6A 1TLLA 1UD6A 3CCRB 2R9VA 3MHPA 4AF6A 2WZPP 1FRQA 2V7UA
chains in the Genus database with same CATH topology
2JN9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JN9 A; 
#chains in the Genus database with same CATH topology
 3P26 A;  5B6I A;  3SLN A;  3OAA A;  3OKX A;  4XLF A;  2WR8 A;  2FVG A;  2W6I A;  2Q6K A;  2GK7 A;  4X7D A;  4DNR B;  2DCU A;  1BX1 A;  1XB2 A;  3BNW A;  3AVT A;  1AIP A;  1FNB A;  1KK3 A;  1E79 A;  3WYA A;  2F4N A;  3U6K A;  3V76 A;  4DNT B;  2FX3 A;  2RC5 A;  3KEW A;  2V7Q A;  1R5O A;  4HE5 A;  1DAR A;  1COW A;  4QV2 A;  3BCD A;  4ACA A;  1H8H A;  3VO2 A;  2BPO A;  4II2 A;  5L46 A;  3T53 B;  3DDY A;  2VNJ A;  1JA0 A;  1N06 A;  4OPS A;  3PA1 A;  1W35 A;  5DN6 A;  4RM0 A;  4B3F X;  1KZL A;  1W9X A;  1EXM A;  2BSA A;  3OW7 A;  4WWV A;  3AVY A;  5JBQ A;  1QH0 A;  2M5S A;  2ZXI A;  3H94 A;  5F4O A;  3ISX A;  5KW9 A;  2X3U A;  3W2H A;  1T5E A;  1QFY A;  2BV3 A;  4P1V A;  4WQM A;  1N05 A;  3CCL B;  2ZZG A;  3GVL A;  2ZZQ A;  1E64 A;  2Q6O A;  2XZP A;  4KKU A;  1PJ6 A;  1ZM2 A;  4Z4W A;  3LQ6 A;  4NCN A;  1JA1 A;  1Q9S A;  4OOV A;  4KKT A;  1Q81 D;  2X0K A;  3CD6 B;  2WPD A;  2W6J A;  2YWE A;  3GSI A;  2XZO A;  1E43 A;  1JB9 A;  3ASR A;  2ZZF A;  4OOS A;  4M1K A;  1Q86 D;  4L8J A;  4YAF A;  3VO1 A;  4Z4V A;  1EP2 B;  4X8I A;  3JQQ A;  2CC2 A;  4K1X A;  2E1R A;  4PC6 A;  3GVJ A;  1E1Q A;  3CCS B;  3CC2 B;  2HMA A;  2YWH A;  1TUI A;  1VQP B;  5F4J A;  1WTH D;  2DIE A;  3CTA A;  1VQL B;  1CQX A;  4RCZ A;  4XOT A;  1IB0 A;  2B7B A;  4RJL A;  2GRE A;  3Q6R A;  2JIZ A;  3H9N A;  4X07 A;  2VJI A;  4XLH A;  1BJK A;  4RCY A;  3SEJ A;  4AVZ A;  2XEX A;  3OJX A;  3CME B;  1NB0 A;  1GO2 A;  1EWY A;  4X0C A;  2QMU A;  3J81 k;  4TMV A;  3JQP A;  3QFS A;  1K8A D;  1HVX A;  1V5V A;  4DQK A;  4ZGN B;  1N0U A;  3OZV A;  1SKY B;  3W2E A;  3VMF A;  3ZUG A;  5AN9 A;  3CP2 A;  4PC2 A;  1D1N A;  3ZPN A;  1IJE A;  1FX0 A;  3OEH A;  1NB9 A;  2QA4 B;  1VQ8 B;  3CPX A;  5HZA A;  4Y9R A;  3LNN A;  4II3 A;  4P9S A;  5TY0 A;  3GIR A;  3CMA B;  1YX2 A;  1BPL A;  5BSY A;  4B43 A;  4QHY A;  2DYI A;  3V7A A;  4XL9 A;  4YAL A;  2XNJ A;  1G7T A;  5IYN A;  2DOG A;  3CCE B;  4IW3 B;  1KK2 A;  4P2N A;  4XKW A;  1OB0 A;  3WY9 A;  2JJ1 A;  3ZBT A;  5BSX A;  1PKV A;  1W0K A;  1E63 A;  1NBM A;  2X6Y A;  2V4D A;  2XND A;  1FDR A;  3PEN A;  3T51 B;  3I55 B;  2BMW A;  2WJY A;  4XLC A;  1FND A;  3OZU A;  4C0S A;  3G71 B;  2OTL B;  2I1L A;  1J9Z A;  3A8K A;  3LVB A;  1VQ7 B;  2R6H A;  3R6J A;  4MYT A;  3BY1 A;  2AHO A;  2V7X A;  4RD2 A;  3ZZ0 A;  5LMZ A;  4AC9 A;  3CC7 B;  1EFU A;  3R6K A;  1F60 A;  3LO8 A;  2D9R A;  2CW5 A;  4XR6 A;  3QE2 A;  2XZL A;  1N07 A;  5EMN A;  5J35 A;  3ZZT A;  4TSF A;  4TMW A;  3PA2 A;  3CMM A;  1S0U A;  4M53 A;  2X85 A;  5A88 A;  3AVW A;  3ES9 A;  3CP8 A;  4TMT A;  1E3Z A;  5E6T A;  4WZK A;  2VJJ A;  3WND A;  4EH1 A;  3KL9 A;  3ONU A;  4XLE A;  5IYW A;  1GVH A;  2EIX A;  3B8H A;  4PC7 A;  1JJ2 B;  4XKV A;  2ZIT A;  5H5J A;  4P3Y A;  3T56 B;  3GQB A;  4Z4R A;  1NDH A;  4N3G A;  4RD3 A;  1DDG A;  3FKS A;  3OW2 B;  3B78 A;  1WU8 A;  4G7X A;  5FNZ A;  1KC8 D;  1U2R A;  2WZN A;  1K73 D;  1A8P A;  1BX0 A;  4XD7 A;  3A3G A;  2JJ2 A;  2C2W A;  4P25 A;  4PAB A;  4XOP A;  3I56 B;  2DY1 A;  2D74 A;  2GK6 A;  4XM3 A;  2OK8 A;  2ZZE A;  4XON A;  2V31 A;  1H42 A;  2BVN A;  1CNF A;  4OOX A;  4TMX A;  1QG0 A;  1OGJ A;  5TR9 A;  1I8D A;  2OBR A;  3W5U A;  1QUF A;  4Z4T A;  4E0F A;  2EFG A;  4PAA A;  4XMY A;  2ZTN A;  4XQF A;  1S4M A;  4YAW A;  5FIU A;  5DS0 A;  4WZL A;  1RQP A;  4RD4 A;  2CF4 A;  2QE7 A;  5DSZ A;  1PJ7 A;  1H85 A;  3Q39 A;  2QTL A;  3CRZ A;  2X6X A;  3ZIA A;  1T6X A;  4B48 A;  1QGA A;  1OB2 A;  3E20 A;  2V7W A;  3I1F A;  4X05 A;  1GAW A;  2HDN B;  2ZTG A;  5IYR A;  2ZXH A;  1EP1 B;  2XNC A;  3FPP A;  2GJR A;  4WZE A;  4N3N A;  2E1B A;  2KVO A;  3BQJ A;  4YEL A;  1TTT A;  5FO0 A;  3SJP A;  3ASP A;  3OZW A;  4U9U A;  1BMF A;  5GV8 A;  2V7T A;  2OTJ B;  1Y0Y A;  2F43 A;  1QUE A;  2F1M A;  3GVK A;  2ZL7 A;  1NRK A;  2CRV A;  4YHB A;  4H9G A;  3CCJ B;  4Z4Z A;  5F4M A;  1D8T A;  2OBT A;  4P6V F;  4RPB A;  3G4S B;  2D3L A;  4LC0 A;  1YIT B;  2OBS A;  1VHO A;  1N08 A;  1Y0R A;  2V7V A;  2X6W A;  3AST A;  3SJZ A;  4Y9U A;  4Z1M A;  3OFN A;  1VHE A;  1QGZ A;  4B3G A;  2JN9 A;  3ZC3 A;  4CQJ A;  1E3X A;  3A35 A;  4P3I A;  3A1P A;  3W2G A;  4B44 A;  2LZJ A;  1CNE A;  4C43 A;  4P12 A;  2C4U A;  2F1L A;  2GJP A;  4Q7J B;  3AVX A;  2WJV A;  1RQR A;  1WOS A;  4YAU A;  2C4T A;  2CK3 A;  3QFC A;  1KD1 D;  4Z4U A;  3QFR A;  1W0J A;  4RDL A;  4P22 A;  2B7C A;  4ASU A;  4M2L A;  2WYR A;  5FO1 A;  4Z4Y A;  4ZCM A;  5A8A A;  1WOR A;  2VNH A;  4NBS A;  1OGI A;  1AMO A;  1VLO A;  1BLI A;  1G7R A;  1UD8 A;  3OOC A;  3W2F A;  4G6I A;  3FJO A;  2OK7 A;  1GR1 A;  1KK1 A;  2X8K A;  3A8J A;  1DG1 G;  3OEE A;  4R71 A;  4FWT A;  4ZGQ B;  1GAQ A;  1FNC A;  3D26 A;  3RY8 A;  4HIZ A;  2D3N A;  4OPV A;  2ZBV A;  2P3M A;  5J3O A;  2QEX B;  3WBJ A;  4TMZ A;  5HKK A;  1B2R A;  5TRD A;  1ZM4 A;  2CBX A;  1IJF A;  3QSY A;  1VJS A;  4KKS A;  3CCV B;  3PUM A;  1OB5 A;  1QVF B;  4QVA A;  4M4S A;  4RD1 A;  3SLD A;  1EFT A;  1ZM9 A;  2BM1 A;  3Q38 A;  1DDI A;  2VBV A;  4XLA A;  1T6Z A;  1YJ9 B;  2ZL6 A;  3E1Y E;  1ZUN B;  1UMK A;  2OYN A;  2NPF A;  3LQE A;  5FL7 A;  4X7F A;  2BM0 A;  4LBY A;  3FPK A;  4PC3 A;  2DET A;  4ZV4 A;  4GQN A;  4Z4S A;  2VBS A;  2VBT A;  1PJ5 A;  2Z6B D;  4DQL A;  3W5V A;  2C5B A;  3WXM A;  1M1K D;  3U2Q A;  1R5N A;  1UD5 A;  2XOK A;  3VR6 A;  4LBV A;  1IHM A;  1QFJ A;  4YXW A;  4LBZ A;  3BH4 A;  1YI2 B;  2GQF A;  3PVD A;  1V0F A;  1V0E A;  1H8E A;  1K9M D;  4F7D A;  2DEU A;  4RDK A;  5IK2 A;  1UD3 A;  3A3B A;  4UZE A;  3AGQ A;  4Y7C A;  1SKQ A;  1VQN B;  1FRN A;  2CND A;  3Q3A A;  3AGP A;  4XN3 A;  3SKB A;  4ZCI A;  2HLD A;  1WPC A;  4X7C A;  1YJW B;  2VYQ A;  2WSS A;  1BQE A;  4G1V A;  1N8R D;  5IYQ A;  1WSR A;  3A8I A;  3VNV A;  4WZT A;  1QX4 A;  1WDT A;  4DK0 A;  4ZCL A;  4XN0 A;  3ASQ A;  2PE3 A;  4HE6 A;  1B23 P;  1VLY A;  1VQM B;  2GJK A;  2DER A;  2B5O A;  1HA3 A;  3ASS A;  3CW2 A;  1I7P A;  3BC9 A;  2Q6I A;  1VQ9 B;  4UAJ A;  4DK1 A;  2BF4 A;  1QVG B;  3B82 A;  4FXU A;  2HCJ B;  4P26 A;  1VQ5 B;  1WOP A;  3WNC A;  2J7K A;  2QTZ A;  2VZL A;  4UZU A;  4NNJ A;  1ELO A;  1WOO A;  3JQR A;  2JDI A;  3OPO A;  3WBK A;  2X53 S;  2XGJ A;  3U6B A;  1XFO A;  2BGJ A;  1YLO A;  3CES A;  1I18 A;  4B4D A;  1M90 D;  3WNB A;  3CC4 B;  4J0Q A;  5FA6 A;  1E1R A;  1GJR A;  2NV4 A;  2C77 A;  1KJZ A;  4P6Y A;  4YAO A;  1VQO B;  1JNY A;  4PC1 A;  1W34 A;  4G7W A;  4ACB A;  3CXC B;  4JMQ A;  1SM4 A;  3CCU B;  4YEJ A;  4B47 A;  3G05 A;  2PLF A;  4PGO A;  3OE7 A;  2RC6 A;  3AVU A;  3Q6Q A;  3QFT A;  1ZM3 A;  1KRH A;  1YIJ B;  3P27 A;  4XOR A;  4G5G A;  1UD4 A;  3AVV A;  1UD2 A;  2VNK A;  3PUN A;  3CB4 A;  1WSV A;  4X06 A;  1VQK B;  2YWG A;  1VQ6 B;  3CCM B;  4X7E A;  5KNL A;  1Q82 D;  4AF7 A;  1KQS B;  1FNM A;  4FK8 A;  4B3X A;  4RDJ A;  3CPW B;  2PMD A;  3W5H A;  1YJN B;  1N0V C;  1QFZ A;  4LBW A;  3WQZ A;  1VF7 A;  4BPR A;  4TT3 A;  4OPO A;  4M0L A;  5CDF A;  2QGG A;  3NE5 B;  1MRZ A;  4OP7 A;  5GV7 A;  1NJI D;  1T6Y A;  4RLZ A;  1D2E A;  1KTV A;  2YWF A;  2BGI A;  1XE1 A;  1HZE A;  1F20 A;  1XQB A;  4QUZ A;  2C5H A;  1EFR A;  3CCQ B;  5HZB A;  1E62 A;  3OJW A;  4RD0 A;  5TV2 A;  3VNU A;  1OHH A;  4FN5 A;  1KK0 A;  1KMH A;  1MAB A;  2ZL5 A;  1Q7Y D;  2C78 A;  4MYU A;  1P4M A;  2PIA A;  4RPD A;  5THX A;  4UZF A;  1G7S A;  1WP6 A;  2QDX A;  1VQ4 B;  2GPJ A;  3G6E B;  2ZBU A;  2Q6L A;  3OP1 A;  4G1B A;  2BN4 A;  1R5B A;  3BY2 A;  1EP3 B;  3BCF A;  5A89 A;  3HAG A;  5HXB A;  1K28 D;  4XNF A;  3ONY A;  5KSW B;  5IYP A;  1G7C A;  4QVJ A;  1S72 B;  1W2B B;  4QFM A;  3ZBU A;  4TKO B;  3ZZU A;  5H59 A;  1QGY A;  4RD6 A;  3MMP A;  4ROX A;  4TN1 A;  3MCA A;  2VBU A;  1EFC A;  1W87 A;  1YHQ B;  2VNI A;  3JU4 A;  3W2I A;  1TVC A;  2QN6 A;  1TLL A;  1UD6 A;  3CCR B;  2R9V A;  3MHP A;  4AF6 A;  2WZP P;  1FRQ A;  2V7U A; 
#chains in the Genus database with same CATH homology
 2JN9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...