2JN9A

Nmr solution structure of ykvr protein from bacillus subtilis: nesg target sr358
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
105
structure length
105
Chain Sequence
MVKTLRLNNVTLEMAAYQEESEPKRKIAFTLNVTSETYHDIAVLLYEKTFNVEVPERDLAFRGEMTNYSTSLTNLYEPGAVSEFYIEITEIDKNADSLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords YkvR protein
publication title NMR solution structure of YkvR protein from Bacillus subtilis: NESG target SR358
rcsb
source organism Bacillus subtilis
total genus 14
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2006-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11514 DUF3219 Protein of unknown function (DUF3219)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.80 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 YkvR-like 2jn9A01
2JN9A
chains in the Genus database with same CATH superfamily
3R6JA 3OZUA 1T6YA 2VNHA 2XNDA 5DSZA 3ZBUA 2DIEA 3VMFA 2ZL7A 3WNCA 3CCLB 3HAGA 4XOTA 3CCQB 2V7WA 1QGAA 4JMQA 2PLFA 3AVYA 3U2QA 1WOPA 1VQPB 2WSSA 2GQFA 1E1QA 3ASPA 1WP6A 4ZGNB 1W9XA 5KNLA 3RY8A 1F60A 5A8AA 2CNDA 5TY0A 2ZBUA 3LNNA 5TRDA 4II3A 4C0SA 1YJ9B 1B23P 1BMFA 3VO1A 1Q7YD 2XZPA 2ZBVA 4XORA 1N07A 1E62A 1TLLA 1UMKA 4RCYA 1EFUA 3FJOA 1FDRA 1W87A 1WSVA 2WR8A 4K1XA 2WJVA 5F4JA 1SKYB 3A3BA 4MYUA 1Q86D 2CBXA 1ZUNB 1YLOA 4IW3B 1JB9A 4FXUA 4LBYA 2QDXA 4P22A 2QTZA 3OW2B 1J9ZA 2JN9A 1VLYA 1BPLA 2C2WA 5E6TA 1EXMA 3OP1A 4P12A 2CW5A 4AVZA 2GJPA 4Z4YA 2QN6A 1VJSA 3G71B 4P9SA 3WYAA 2DETA 1VQ9B 3T53B 2VNIA 4P26A 3ZZ0A 4U9UA 1UD3A 4ZV4A 5HZBA 2BVNA 4II2A 1S0UA 4RPDA 1SM4A 3SKBA 2HLDA 4M2LA 4Z4WA 3BH4A 3AVXA 2PMDA 3LQ6A 1T5EA 3ASRA 1BLIA 5HKKA 4P3IA 5THXA 1W2BB 3A8IA 1E43A 3CCVB 3CB4A 4QFMA 1PJ5A 4HE6A 1QFJA 3KL9A 4PC6A 2DEUA 4H9GA 2X53S 4G1BA 4PC7A 1EP3B 2F4NA 3W2HA 4UZEA 4XLEA 1E1RA 4X7EA 5HZAA 2ZZFA 5IYPA 2X8KA 4G7XA 1BQEA 4WZEA 3GSIA 1DG1G 4RD0A 5H59A 1QVFB 4XD7A 1QX4A 4P25A 1VQ5B 1QH0A 1W35A 3G4SB 1VQLB 4P2NA 3WXMA 2XNCA 2VJIA 4G1VA 1VHEA 5J35A 3FKSA 1FRQA 1PKVA 1OB2A 1K73D 2D3NA 3H9NA 2P3MA 2OK8A 3ZC3A 1TTTA 3QFRA 2XZLA 4YXWA 4XQFA 1T6XA 2QEXB 1N08A 1ZM3A 1A8PA 3BY2A 4AF7A 3Q38A 4TMVA 2ZTGA 3BC9A 2B7CA 3Q39A 1YX2A 5GV7A 4DQLA 4AF6A 1VQMB 4KKSA 1E3ZA 2W6IA 4X06A 5EMNA 4ZGQB 5CDFA 1V0EA 1N05A 1CQXA 2XOKA 1R5BA 3A1PA 4ZCIA 4GQNA 3W2FA 1VHOA 3ZUGA 4CQJA 3CCSB 1VLOA 2X6YA 5KSWB 1DDGA 2VBSA 4YAUA 1XQBA 3CC2B 1NJID 3OFNA 4TSFA 3QFTA 1G7CA 4ACBA 4RCZA 1NB0A 4X05A 4X0CA 3I55B 2ZITA 4X7FA 4LC0A 1E79A 2W6JA 1D2EA 3OPOA 3ZPNA 5A88A 2C5BA 3BCDA 3U6BA 4QUZA 1WTHD 1FX0A 2X85A 3CMEB 4DQKA 2BF4A 2YWHA 3SJPA 4KKTA 2ZXHA 2ZZQA 4NCNA 3SJZA 1HZEA 2GK6A 5GV8A 1WOOA 4YALA 3WNDA 2XZOA 4TMWA 4XLFA 3Q3AA 3CCJB 2OTLB 4WQMA 1I7PA 1N0UA 2WZPP 1GAWA 3D26A 2V7XA 3QE2A 1ZM2A 4X7CA 3GVKA 4P3YA 3A3GA 2JJ1A 4N3NA 2I1LA 4LBWA 1BX0A 2PIAA 1FRNA 1G7TA 1Y0YA 4B4DA 1YIJB 2DERA 4G5GA 1QG0A 3PA2A 3Q6QA 5A89A 1YJNB 3OJWA 3WNBA 3CD6B 1E3XA 1KQSB 2F43A 2GREA 1EFTA 1MABA 3J81k 1M90D 2WZNA 1QGZA 2WJYA 3CP8A 1KK0A 2R6HA 4WZTA 3LO8A 1WU8A 1OGIA 3CESA 5IYWA 3PUNA 4HIZA 1NRKA 3CTAA 4PABA 1QGYA 3QFSA 2HDNB 3CCMB 1V5VA 4DNTB 1KRHA 2BM0A 4TN1A 1GR1A 1JA0A 4Z4UA 2VYQA 2CK3A 2DCUA 2F1MA 4RPBA 4Z4VA 1KZLA 3CRZA 3GIRA 4B44A 2C5HA 3BY1A 5IK2A 1G7SA 2V7UA 2ZTNA 2JJ2A 1GAQA 4XMYA 4YAFA 2B7BA 4XNFA 2XGJA 1IJEA 2V31A 4OPSA 1KD1D 1FNCA 3LQEA 1UD2A 3OOCA 2V7VA 4DK1A 1YHQB 3VNVA 2YWGA 3FPKA 3OEEA 3CP2A 4RLZA 4C43A 3QSYA 1OB0A 1QFZA 1PJ7A 4WWVA 3P27A 3T56B 2QMUA 1ZM9A 1MRZA 1N06A 2RC6A 1QFYA 1UD6A 2GJKA 3W2EA 4WZLA 3OJXA 1HA3A 3W2GA 1COWA 1D1NA 4UAJA 4OP7A 2CC2A 1T6ZA 2PE3A 2YWFA 3VNUA 1I8DA 3ZZTA 4OPVA 4XLHA 1IB0A 2DYIA 2X3UA 1GO2A 3MMPA 4KKUA 3CC4B 1VQNB 4FN5A 1JNYA 1KJZA 3LVBA 2WPDA 5TR9A 1F20A 1WPCA 2EIXA 4G6IA 3GVJA 3ZZUA 2C78A 1BJKA 1OHHA 4Z4SA 3CC7B 5DS0A 1AIPA 5FO0A 4P1VA 3B82A 2D3LA 1DDIA 2Q6OA 2V7TA 3ZIAA 1G7RA 2BM1A 4F7DA 1TUIA 1KK1A 1WSRA 3JQRA 4XLCA 4TMZA 1P4MA 4X07A 1EP2B 1B2RA 3NE5B 2XEXA 4XM3A 4MYTA 2HMAA 3BQJA 4X7DA 3A8JA 3SLDA 4QVJA 5BSXA 3A8KA 1WORA 4OOSA 3VR6A 1S72B 2D74A 3DDYA 1D8TA 3SLNA 3MCAA 4B3XA 1FNMA 1S4MA 3H94A 4L8JA 4YELA 1WOSA 4YAWA 3CCEB 2BV3A 3AVTA 4P6VF 3AVUA 1I18A 4XOPA 1XB2A 5IYRA 2R9VA 4WZKA 2E1RA 1FNDA 3OZWA 4RDJA 2BPOA 4PC1A 2CF4A 4XONA 1VQOB 1YJWB 5L46A 2C4TA 2V4DA 4ASUA 2DY1A 4XR6A 3T51B 3WBJA 3U6KA 1NBMA 1U2RA 3Q6RA 1Q82D 4UZFA 3WQZA 1YITB 1KTVA 2YWEA 4NNJA 4AC9A 1K8AD 3WY9A 3PA1A 2JIZA 4YAOA 4DNRB 4TMXA 5FA6A 1H8HA 3B8HA 2D9RA 3JU4A 4B47A 3A35A 3CW2A 4XLAA 2J7KA 3CMMA 4P6YA 3SEJA 2Q6KA 3V7AA 3AVVA 2FX3A 4FWTA 1OB5A 2OTJB 3GVLA 1IHMA 3KEWA 3QFCA 4YEJA 3ONUA 4RD2A 2KVOA 5JBQA 1K9MD 2M5SA 3W5HA 4XKVA 1NDHA 2AHOA 2VBTA 4B43A 3OKXA 4LBZA 4HE5A 1BX1A 3CMAB 2DOGA 3JQPA 4OOVA 2HCJB 3OE7A 2C77A 1H8EA 2C4UA 1DARA 2QGGA 4XKWA 5F4MA 2Q6IA 1QVGB 1W0KA 1QUEA 4Q7JB 3PVDA 4UZUA 2BN4A 2VZLA 4ROXA 5IYQA 3OZVA 2CRVA 4QVAA 4G7WA 1TVCA 3E20A 4XN0A 1UD4A 1XE1A 2VNJA 2BSAA 1W0JA 2VBUA 4LBVA 4RD1A 2FVGA 3OEHA 2OBSA 1VF7A 5H5JA 2X6WA 1W34A 3OAAA 2F1LA 2V7QA 2OK7A 1N8RD 5DN6A 1Q9SA 1ZM4A 1EFRA 4XN3A 3G6EB 3G05A 5IYNA 1RQRA 3ASTA 1PJ6A 4RD6A 1XFOA 5LMZA 1VQ4B 1HVXA 1JJ2B 1EFCA 5AN9A 2VJJA 5J3OA 4OPOA 1Y0RA 3E1YE 4FK8A 3ZBTA 3R6KA 4YHBA 3VO2A 2BGIA 4B48A 1AMOA 5FL7A 2GPJA 3ISXA 4TMTA 2ZL5A 3W5VA 5KW9A 4RD4A 4PC2A 3W5UA 1EWYA 5FIUA 4M1KA 4Y9UA 2OBRA 3BCFA 5B6IA 1UD5A 1VQ8B 3CCRB 4RD3A 4M53A 1V0FA 4ACAA 1E63A 4M0LA 4Z1MA 3B78A 4TKOB 1IJFA 4OOXA 1H85A 4BPRA 4EH1A 4ZCMA 3P26A 3PENA 2ZL6A 4Z4RA 4M4SA 4NBSA 4RM0A 1UD8A 2QE7A 1SKQA 4E0FA 2BMWA 1GJRA 1VQ6B 3AGQA 2OYNA 3W2IA 5TV2A 1VQKB 4QHYA 1FNBA 4PAAA 2XNJA 4RDKA 1E64A 1JA1A 1R5OA 3MHPA 5BSYA 1R5NA 2GK7A 4N3GA 3CPWB 2EFGA 2ZZGA 1QUFA 3FPPA 2VBVA 2Q6LA 2OBTA 4Z4TA 3ES9A 2BGJA 1OGJA 3V76A 1YI2B 4DK0A 3CCUB 2VNKA 3OW7A 4PGOA 4B3FX 3I1FA 4Y9RA 4TT3A 1CNFA 1RQPA 5F4OA 1NB9A 4J0QA 3BNWA 4R71A 4Z4ZA 2ZXIA 1ELOA 1KK3A 2X6XA 3JQQA 3ASQA 1H42A 2JDIA 4RJLA 2X0KA 1KC8D 2ZZEA 1VQ7B 4Y7CA 2QA4B 4RDLA 4B3GA 3ASSA 4PC3A 5FO1A 2RC5A 4QV2A 3CXCB 2NV4A 3GQBA 3WBKA 1K28D 1KK2A 1N0VC 3PUMA 1Q81D 1GVHA 2E1BA 2Z6BD 4ZCLA 2GJRA 3CPXA 2NPFA 2LZJA 4X8IA 2WYRA 3ONYA 1M1KD 5HXBA 1WDTA 2QTLA 1CNEA 2B5OA 3AVWA 4XL9A 1EP1B 1KMHA 3AGPA 3I56B 5FNZA
chains in the Genus database with same CATH topology
2JN9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JN9 A; 
#chains in the Genus database with same CATH topology
 3R6J A;  3OZU A;  1T6Y A;  2VNH A;  2XND A;  5DSZ A;  3ZBU A;  2DIE A;  3VMF A;  2ZL7 A;  3WNC A;  3CCL B;  3HAG A;  4XOT A;  3CCQ B;  2V7W A;  1QGA A;  4JMQ A;  2PLF A;  3AVY A;  3U2Q A;  1WOP A;  1VQP B;  2WSS A;  2GQF A;  1E1Q A;  3ASP A;  1WP6 A;  4ZGN B;  1W9X A;  5KNL A;  3RY8 A;  1F60 A;  5A8A A;  2CND A;  5TY0 A;  2ZBU A;  3LNN A;  5TRD A;  4II3 A;  4C0S A;  1YJ9 B;  1B23 P;  1BMF A;  3VO1 A;  1Q7Y D;  2XZP A;  2ZBV A;  4XOR A;  1N07 A;  1E62 A;  1TLL A;  1UMK A;  4RCY A;  1EFU A;  3FJO A;  1FDR A;  1W87 A;  1WSV A;  2WR8 A;  4K1X A;  2WJV A;  5F4J A;  1SKY B;  3A3B A;  4MYU A;  1Q86 D;  2CBX A;  1ZUN B;  1YLO A;  4IW3 B;  1JB9 A;  4FXU A;  4LBY A;  2QDX A;  4P22 A;  2QTZ A;  3OW2 B;  1J9Z A;  2JN9 A;  1VLY A;  1BPL A;  2C2W A;  5E6T A;  1EXM A;  3OP1 A;  4P12 A;  2CW5 A;  4AVZ A;  2GJP A;  4Z4Y A;  2QN6 A;  1VJS A;  3G71 B;  4P9S A;  3WYA A;  2DET A;  1VQ9 B;  3T53 B;  2VNI A;  4P26 A;  3ZZ0 A;  4U9U A;  1UD3 A;  4ZV4 A;  5HZB A;  2BVN A;  4II2 A;  1S0U A;  4RPD A;  1SM4 A;  3SKB A;  2HLD A;  4M2L A;  4Z4W A;  3BH4 A;  3AVX A;  2PMD A;  3LQ6 A;  1T5E A;  3ASR A;  1BLI A;  5HKK A;  4P3I A;  5THX A;  1W2B B;  3A8I A;  1E43 A;  3CCV B;  3CB4 A;  4QFM A;  1PJ5 A;  4HE6 A;  1QFJ A;  3KL9 A;  4PC6 A;  2DEU A;  4H9G A;  2X53 S;  4G1B A;  4PC7 A;  1EP3 B;  2F4N A;  3W2H A;  4UZE A;  4XLE A;  1E1R A;  4X7E A;  5HZA A;  2ZZF A;  5IYP A;  2X8K A;  4G7X A;  1BQE A;  4WZE A;  3GSI A;  1DG1 G;  4RD0 A;  5H59 A;  1QVF B;  4XD7 A;  1QX4 A;  4P25 A;  1VQ5 B;  1QH0 A;  1W35 A;  3G4S B;  1VQL B;  4P2N A;  3WXM A;  2XNC A;  2VJI A;  4G1V A;  1VHE A;  5J35 A;  3FKS A;  1FRQ A;  1PKV A;  1OB2 A;  1K73 D;  2D3N A;  3H9N A;  2P3M A;  2OK8 A;  3ZC3 A;  1TTT A;  3QFR A;  2XZL A;  4YXW A;  4XQF A;  1T6X A;  2QEX B;  1N08 A;  1ZM3 A;  1A8P A;  3BY2 A;  4AF7 A;  3Q38 A;  4TMV A;  2ZTG A;  3BC9 A;  2B7C A;  3Q39 A;  1YX2 A;  5GV7 A;  4DQL A;  4AF6 A;  1VQM B;  4KKS A;  1E3Z A;  2W6I A;  4X06 A;  5EMN A;  4ZGQ B;  5CDF A;  1V0E A;  1N05 A;  1CQX A;  2XOK A;  1R5B A;  3A1P A;  4ZCI A;  4GQN A;  3W2F A;  1VHO A;  3ZUG A;  4CQJ A;  3CCS B;  1VLO A;  2X6Y A;  5KSW B;  1DDG A;  2VBS A;  4YAU A;  1XQB A;  3CC2 B;  1NJI D;  3OFN A;  4TSF A;  3QFT A;  1G7C A;  4ACB A;  4RCZ A;  1NB0 A;  4X05 A;  4X0C A;  3I55 B;  2ZIT A;  4X7F A;  4LC0 A;  1E79 A;  2W6J A;  1D2E A;  3OPO A;  3ZPN A;  5A88 A;  2C5B A;  3BCD A;  3U6B A;  4QUZ A;  1WTH D;  1FX0 A;  2X85 A;  3CME B;  4DQK A;  2BF4 A;  2YWH A;  3SJP A;  4KKT A;  2ZXH A;  2ZZQ A;  4NCN A;  3SJZ A;  1HZE A;  2GK6 A;  5GV8 A;  1WOO A;  4YAL A;  3WND A;  2XZO A;  4TMW A;  4XLF A;  3Q3A A;  3CCJ B;  2OTL B;  4WQM A;  1I7P A;  1N0U A;  2WZP P;  1GAW A;  3D26 A;  2V7X A;  3QE2 A;  1ZM2 A;  4X7C A;  3GVK A;  4P3Y A;  3A3G A;  2JJ1 A;  4N3N A;  2I1L A;  4LBW A;  1BX0 A;  2PIA A;  1FRN A;  1G7T A;  1Y0Y A;  4B4D A;  1YIJ B;  2DER A;  4G5G A;  1QG0 A;  3PA2 A;  3Q6Q A;  5A89 A;  1YJN B;  3OJW A;  3WNB A;  3CD6 B;  1E3X A;  1KQS B;  2F43 A;  2GRE A;  1EFT A;  1MAB A;  3J81 k;  1M90 D;  2WZN A;  1QGZ A;  2WJY A;  3CP8 A;  1KK0 A;  2R6H A;  4WZT A;  3LO8 A;  1WU8 A;  1OGI A;  3CES A;  5IYW A;  3PUN A;  4HIZ A;  1NRK A;  3CTA A;  4PAB A;  1QGY A;  3QFS A;  2HDN B;  3CCM B;  1V5V A;  4DNT B;  1KRH A;  2BM0 A;  4TN1 A;  1GR1 A;  1JA0 A;  4Z4U A;  2VYQ A;  2CK3 A;  2DCU A;  2F1M A;  4RPB A;  4Z4V A;  1KZL A;  3CRZ A;  3GIR A;  4B44 A;  2C5H A;  3BY1 A;  5IK2 A;  1G7S A;  2V7U A;  2ZTN A;  2JJ2 A;  1GAQ A;  4XMY A;  4YAF A;  2B7B A;  4XNF A;  2XGJ A;  1IJE A;  2V31 A;  4OPS A;  1KD1 D;  1FNC A;  3LQE A;  1UD2 A;  3OOC A;  2V7V A;  4DK1 A;  1YHQ B;  3VNV A;  2YWG A;  3FPK A;  3OEE A;  3CP2 A;  4RLZ A;  4C43 A;  3QSY A;  1OB0 A;  1QFZ A;  1PJ7 A;  4WWV A;  3P27 A;  3T56 B;  2QMU A;  1ZM9 A;  1MRZ A;  1N06 A;  2RC6 A;  1QFY A;  1UD6 A;  2GJK A;  3W2E A;  4WZL A;  3OJX A;  1HA3 A;  3W2G A;  1COW A;  1D1N A;  4UAJ A;  4OP7 A;  2CC2 A;  1T6Z A;  2PE3 A;  2YWF A;  3VNU A;  1I8D A;  3ZZT A;  4OPV A;  4XLH A;  1IB0 A;  2DYI A;  2X3U A;  1GO2 A;  3MMP A;  4KKU A;  3CC4 B;  1VQN B;  4FN5 A;  1JNY A;  1KJZ A;  3LVB A;  2WPD A;  5TR9 A;  1F20 A;  1WPC A;  2EIX A;  4G6I A;  3GVJ A;  3ZZU A;  2C78 A;  1BJK A;  1OHH A;  4Z4S A;  3CC7 B;  5DS0 A;  1AIP A;  5FO0 A;  4P1V A;  3B82 A;  2D3L A;  1DDI A;  2Q6O A;  2V7T A;  3ZIA A;  1G7R A;  2BM1 A;  4F7D A;  1TUI A;  1KK1 A;  1WSR A;  3JQR A;  4XLC A;  4TMZ A;  1P4M A;  4X07 A;  1EP2 B;  1B2R A;  3NE5 B;  2XEX A;  4XM3 A;  4MYT A;  2HMA A;  3BQJ A;  4X7D A;  3A8J A;  3SLD A;  4QVJ A;  5BSX A;  3A8K A;  1WOR A;  4OOS A;  3VR6 A;  1S72 B;  2D74 A;  3DDY A;  1D8T A;  3SLN A;  3MCA A;  4B3X A;  1FNM A;  1S4M A;  3H94 A;  4L8J A;  4YEL A;  1WOS A;  4YAW A;  3CCE B;  2BV3 A;  3AVT A;  4P6V F;  3AVU A;  1I18 A;  4XOP A;  1XB2 A;  5IYR A;  2R9V A;  4WZK A;  2E1R A;  1FND A;  3OZW A;  4RDJ A;  2BPO A;  4PC1 A;  2CF4 A;  4XON A;  1VQO B;  1YJW B;  5L46 A;  2C4T A;  2V4D A;  4ASU A;  2DY1 A;  4XR6 A;  3T51 B;  3WBJ A;  3U6K A;  1NBM A;  1U2R A;  3Q6R A;  1Q82 D;  4UZF A;  3WQZ A;  1YIT B;  1KTV A;  2YWE A;  4NNJ A;  4AC9 A;  1K8A D;  3WY9 A;  3PA1 A;  2JIZ A;  4YAO A;  4DNR B;  4TMX A;  5FA6 A;  1H8H A;  3B8H A;  2D9R A;  3JU4 A;  4B47 A;  3A35 A;  3CW2 A;  4XLA A;  2J7K A;  3CMM A;  4P6Y A;  3SEJ A;  2Q6K A;  3V7A A;  3AVV A;  2FX3 A;  4FWT A;  1OB5 A;  2OTJ B;  3GVL A;  1IHM A;  3KEW A;  3QFC A;  4YEJ A;  3ONU A;  4RD2 A;  2KVO A;  5JBQ A;  1K9M D;  2M5S A;  3W5H A;  4XKV A;  1NDH A;  2AHO A;  2VBT A;  4B43 A;  3OKX A;  4LBZ A;  4HE5 A;  1BX1 A;  3CMA B;  2DOG A;  3JQP A;  4OOV A;  2HCJ B;  3OE7 A;  2C77 A;  1H8E A;  2C4U A;  1DAR A;  2QGG A;  4XKW A;  5F4M A;  2Q6I A;  1QVG B;  1W0K A;  1QUE A;  4Q7J B;  3PVD A;  4UZU A;  2BN4 A;  2VZL A;  4ROX A;  5IYQ A;  3OZV A;  2CRV A;  4QVA A;  4G7W A;  1TVC A;  3E20 A;  4XN0 A;  1UD4 A;  1XE1 A;  2VNJ A;  2BSA A;  1W0J A;  2VBU A;  4LBV A;  4RD1 A;  2FVG A;  3OEH A;  2OBS A;  1VF7 A;  5H5J A;  2X6W A;  1W34 A;  3OAA A;  2F1L A;  2V7Q A;  2OK7 A;  1N8R D;  5DN6 A;  1Q9S A;  1ZM4 A;  1EFR A;  4XN3 A;  3G6E B;  3G05 A;  5IYN A;  1RQR A;  3AST A;  1PJ6 A;  4RD6 A;  1XFO A;  5LMZ A;  1VQ4 B;  1HVX A;  1JJ2 B;  1EFC A;  5AN9 A;  2VJJ A;  5J3O A;  4OPO A;  1Y0R A;  3E1Y E;  4FK8 A;  3ZBT A;  3R6K A;  4YHB A;  3VO2 A;  2BGI A;  4B48 A;  1AMO A;  5FL7 A;  2GPJ A;  3ISX A;  4TMT A;  2ZL5 A;  3W5V A;  5KW9 A;  4RD4 A;  4PC2 A;  3W5U A;  1EWY A;  5FIU A;  4M1K A;  4Y9U A;  2OBR A;  3BCF A;  5B6I A;  1UD5 A;  1VQ8 B;  3CCR B;  4RD3 A;  4M53 A;  1V0F A;  4ACA A;  1E63 A;  4M0L A;  4Z1M A;  3B78 A;  4TKO B;  1IJF A;  4OOX A;  1H85 A;  4BPR A;  4EH1 A;  4ZCM A;  3P26 A;  3PEN A;  2ZL6 A;  4Z4R A;  4M4S A;  4NBS A;  4RM0 A;  1UD8 A;  2QE7 A;  1SKQ A;  4E0F A;  2BMW A;  1GJR A;  1VQ6 B;  3AGQ A;  2OYN A;  3W2I A;  5TV2 A;  1VQK B;  4QHY A;  1FNB A;  4PAA A;  2XNJ A;  4RDK A;  1E64 A;  1JA1 A;  1R5O A;  3MHP A;  5BSY A;  1R5N A;  2GK7 A;  4N3G A;  3CPW B;  2EFG A;  2ZZG A;  1QUF A;  3FPP A;  2VBV A;  2Q6L A;  2OBT A;  4Z4T A;  3ES9 A;  2BGJ A;  1OGJ A;  3V76 A;  1YI2 B;  4DK0 A;  3CCU B;  2VNK A;  3OW7 A;  4PGO A;  4B3F X;  3I1F A;  4Y9R A;  4TT3 A;  1CNF A;  1RQP A;  5F4O A;  1NB9 A;  4J0Q A;  3BNW A;  4R71 A;  4Z4Z A;  2ZXI A;  1ELO A;  1KK3 A;  2X6X A;  3JQQ A;  3ASQ A;  1H42 A;  2JDI A;  4RJL A;  2X0K A;  1KC8 D;  2ZZE A;  1VQ7 B;  4Y7C A;  2QA4 B;  4RDL A;  4B3G A;  3ASS A;  4PC3 A;  5FO1 A;  2RC5 A;  4QV2 A;  3CXC B;  2NV4 A;  3GQB A;  3WBK A;  1K28 D;  1KK2 A;  1N0V C;  3PUM A;  1Q81 D;  1GVH A;  2E1B A;  2Z6B D;  4ZCL A;  2GJR A;  3CPX A;  2NPF A;  2LZJ A;  4X8I A;  2WYR A;  3ONY A;  1M1K D;  5HXB A;  1WDT A;  2QTL A;  1CNE A;  2B5O A;  3AVW A;  4XL9 A;  1EP1 B;  1KMH A;  3AGP A;  3I56 B;  5FNZ A; 
#chains in the Genus database with same CATH homology
 2JN9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...