3CW2A

Crystal structure of the intact archaeal translation initiation factor 2 from sulfolobus solfataricus .
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
414
structure length
414
Chain Sequence
b'AWPKVQPEVNIGVVGHVDHGKTTLVQAITGIWTSKHSEELKRGMTIKLGYAETNIGVCESCKKPEAYVTEPSCKSCGSDDEPKFLRRISFIDAPGHEVLMATMLSGAALMDGAILVVAANEPFPQPQTREHFVALGIIGVKNLIIVQNKVDVVSKEEALSQYRQIKQFTKGTWAENVPIIPVSALHKINIDSLIEGIEEYIKTPYRDLSQKPVMLVIRSFDVNKPGTQFNELKGGVIGGSIIQGLFKVDQEIKVLPGLRVEKQGKVSYEPIFTKISSIRFGDEEFKEAKPGGLVAIGTYLDPSLTKADNLLGSIITLADAEVPVLWNIRIKYNLLERVVGAKEMLKVDPIRAKETLMLSVGSSTTLGIVTSVKKDEIEVELRRPVAVWSNNIRTVISRQIAGRWRMIGWGLVEI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Translation initiation factor 2 subunit gamma
molecule tags Translation
source organism Sulfolobus solfataricus
publication title Crystal structure of the intact archaeal translation initiation factor 2 demonstrates very high conformational flexibility in the alpha- and beta-subunits.
pubmed doi rcsb
total genus 64
structure length 414
sequence length 414
chains with identical sequence B, E, F
ec nomenclature
pdb deposition date 2008-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
A PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 3cw2A02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 3cw2A03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3cw2A01
3Q7PA 2GETA 5FL3A 4XOIA 5L3QA 2UZ3A 4TN1A 1HYQA 1CJUC 1K73D 3T1OA 4A0RA 1E2FA 2I1VB 2EIXA 3TVDA 3R9WA 2F43A 1PZNA 2R6FA 4WOPA 3H86A 1JNYA 4XH9B 1VG0B 1QH0A 2Q9AA 5J4VA 5JSZA 1I2MA 4C30A 5L3VA 4TMTA 4RZ3A 3TUZC 1MOZA 2IYLD 1XTSA 2OZEA 2MSEB 2A2ZA 3HU1A 4OQNA 3TVTA 3GJ4A 5BYJA 4YAWA 5EXXA 4Q03A 1S72B 5B64A 1I4LD 1GNPA 4POAA 1QFJA 1NY6A 4GI7A 4M8NE 2H17A 2F1JA 1G16A 4UNPA 1PVOA 2X8AA 2CL6X 3GJ8A 3K0CA 3K0EA 2ANBA 3ICEA 4AC9A 5J5CA 2UKDA 2FF7A 2XB4A 3MJRA 1II8B 2NG1A 3AVTA 1G5TA 2W0SA 3MMPA 1K9MD 3RWMB 4V0OA 4YXWD 3QKRA 4US1R 3B1WA 4U02A 4V02A 5L3QB 5TB5A 4A8JC 4QBFA 1GJRA 1ZRHA 4DLVA 1F20A 1G7SA 5KHOC 4W7SA 4RD2A 4EPRA 2FSFA 4DWJA 2AD5A 2QRNA 4D6PA 3IQWA 3TSWA 1QG0A 2NOAA 5FBLB 1DO0A 1HUQA 2FV8A 2HF9A 4L16A 3JVVA 2V1XA 4WQMA 4C0KA 3GFTA 1L8QA 5LB4A 1ZUHA 3EX7C 3VO2A 4OJQA 1N5KA 2C9CA 5SZIA 4NYMR 5TXGA 1E69A 2CXXA 3TQFA 1TUIA 1FNBA 3CCSB 4F4JA 2GJKA 2CLSA 4M0LA 1SXJE 4PGOA 1KSFX 1N6NA 3WHLA 4JJKA 3BFKA 5EE0A 1OKKA 4Q19A 1ZM7A 5H5JA 3CWQA 3ZD6A 2GBLA 3P20A 4MA4A 1BO6A 2QMEA 4M1OA 2GAOA 1FOEB 3N2IA 5KNCA 3MCAA 3DHWC 3LO5A 4AKHA 3FB4A 1PUJA 2BHRA 5JWHA 1G21E 1DAEA 2ZRMA 3OZUA 2YZ2A 4OQXA 4HUQB 1J90A 2JLRA 2ZJ2A 4FIDA 1YZGA 1H42A 1XTRA 5G53C 4D2IA 4E5UA 3ECCA 2E9SA 1G20E 1LB1B 1MO4A 1GFIA 3I32A 2GF0A 4GT1A 221PA 2JJ1D 2VSXA 1Z2CA 1E2KA 1OYYA 2CMKA 3BXZA 5DI3B 4A8JB 2WWWA 4EFMA 1JA0A 3THWA 2JLVA 3QI2A 2XB2A 1RRGA 3FHCB 4UNNA 2HF8A 1ZUIA 4HDQB 2V54A 1W35A 1SKYB 2WICA 3KQHA 3LX5A 4NCHA 2NIPA 2BPOA 4JLJA 2I4IA 1GZSA 4NYMQ 4JYCA 2G1KA 2QPAA 3QF7A 1GP2A 1NG1A 1W48A 3ADDA 1N2CE 3U60B 3IKJA 2CK3D 4MGYR 3CC7B 1L4YA 4DZZA 3CMEB 2GK6A 4R98A 4F7WA 4F7DA 1NMXA 4QRHA 2P6RA 3GJ3A 4MQBA 2JLZA 4O0MA 3CCUB 1Z6GA 2QQ0A 4Z1MD 5JI3E 2NO6A 2D3WA 2P2LA 4QL3A 3QBTA 4GL2A 3GLFB 4C2UA 1E6CA 3CCVB 2ZYVX 1Q1QA 5HTKA 1CR0A 3OAAA 4FCWA 4Z8YA 1YZLA 2CRVA 2F3TA 3EARA 3H2YA 4HLCA 1UPTA 4US0R 5JCPA 4PXAA 2HCJB 1FMLA 3ZJYA 1YRAA 3U7HB 4XJXA 2A5GA 1R8SA 3FGNA 1ZNZA 1Q22A 1U98A 3KXIA 3N70A 2FG5A 2QTFA 3QXXA 3U3JA 2IS1A 4TLEA 1OXVA 2WKRA 4R2HA 4UXIA 3SHWA 4KFRA 4P3YA 4BLOA 4DJTA 2DBYA 3A8TA 4ZKDA 1IY2A 2Q0HA 3FFBA 2QPTA 5L8VA 4YAOA 1AJEA 1U8ZA 2VLIA 1NVXQ 1E63A 2JLXA 4KI0A 3SJCA 3KXKA 5AUQA 2QU8A 3LFUA 4QOSA 2BMEA 3CCQB 4G5RA 3SBDA 3U7FB 4HLUC 2ZJOA 3GLIA 2QMOA 1A2BA 2H92A 3TSOA 1ZNWA 5KPDA 2X3UA 2JJ2A 3CCMB 2REXB 4P4UA 1XNJA 3RRMA 2EVWX 3EZ6A 4DSUA 2OLJA 3MAAC 1E32A 4LJ5A 4QXAA 3NBXX 1Z22A 2AKAB 3OE7D 4QKQA 3HYRA 4A1FA 4OI1A 5DHFA 4YMWA 1DAMA 1EXMA 5HKKA 3K0AB 1AM4D 1JR3E 3QG1A 3GLGE 1AS0A 2JLSA 3QKTA 5KUTA 1FL9A 1RC8A 4N0EA 2XITA 2AK3A 3IHWA 1QHSA 4O2RA 3RS7A 4P33A 5A5GA 2R65A 1RJ9B 5LDDC 2AXPA 3NG1A 2FEOA 2XZLA 1SKYE 1B23P 1M1KD 4Y7CA 1RRCA 1QUEA 1MT0A 1EFRA 5HCNA 4URZR 3Q72A 1W34A 1AKYA 3I1FA 1E4VA 2J0SA 4TTQA 1NN1A 4CW7A 3U44A 3BC1A 2Z83A 2FX3A 3AP1A 5C4GB 3GJXC 2BSAA 3AM1A 2VHTA 5FTJA 1T5IA 5DO9A 1IBRA 2BJVA 2GJ8A 3AVXA 5FOWA 3UXMA 1O87A 4ZDKA 2O0JA 3ND9A 1P60A 2WV9A 3NC0C 1FRNA 1J2JA 2GNOA 4LZZA 4NCKA 1YR6A 4QHSA 5FUYA 1G3IA 2OAP1 3UMSA 2FEMA 1OGJA 5DLQC 5JWRA 2IUTA 2QQEA 4M22A 4R7ZA 2P3SA 2XX3A 1D8TA 3CF0A 1COWA 1N6OA 4B44A 4N1AA 3QFTA 4UNQA 2ZEJA 3GLIE 2WWIA 4PAOA 2VP2A 4B48A 2E1RA 4DBLC 5GJWC 1OW3B 4B76A 4M1SA 3KQKA 1R0YA 3IO3A 2BMJA 1GVHA 4FWIB 5JZVA 4ARZB 4DCNA 1KI9A 2MMCA 3B2EA 5EXTA 4DDWA 4MDEA 4CEJB 2ZRHA 1FNCA 1WRBA 3N2EA 4YONB 2CJWB 4JLKA 1N25A 1J8MF 3KJIA 4HUTA 2MSDB 5GJCA 2QT1A 2J0QA 4CEJA 4NYJR 3EPLA 3NIBA 4RCZA 4XTRA 4CVNA 4C7OB 3W5HA 4TLAA 2WIBA 1Z83A 1AN0A 3E70C 5FPYA 5HKKD 3PEWA 3X1XA 3QPWA 4ZIRA 4Q1DA 5C18A 1A2KC 2C77A 3OE7A 5FOVA 3VNVA 2G0TA 2D4HA 3DOFA 2NMVA 2X2EA 3GFPA 2JJ2D 4Q9IA 5D3MB 5JWOA 4RFVA 1TF5A 3C4JA 1M6NA 3V9PA 1TQDA 1P72A 1NDHA 1U8AA 1N6HA 3PITA 4YDSA 4ZCMA 4Y9RA 2PLRA 4GOXA 3ZVMA 2AD1A 4PC6A 3AF0A 1VCOA 4MGZR 1LNZA 3UANA 2NPIA 2X2FA 3WMEA 3AKDA 4FMCF 4MKFA 3GLHB 2DWQA 1GAWA 1W0KA 4Q7MB 4Z54A 1R10A 3QVUA 4MKGA 1G7CA 1GKYA 2Q3FA 3SS8A 1F2TB 1XX6A 2A30A 3OIVA 4E09A 1IONA 5K8UA 2AFHE 4LJ4A 1CJTC 2VH5R 2WJIA 2H16A 2QBYA 3D31A 3EASA 1XJQA 3W6PA 4G5GA 1AGRA 5HPYB 3K0FA 3QJYA 1F3OA 5AUPB 2ZETA 4KVGA 1G6OA 3NH6A 3O8CA 4HDOB 3AB3A 2CK3A 3ZZ0A 1E0JA 1GNRA 3LXRA 1G8YA 2CL7X 2OXRA 4PZZA 4Q4JB 3D6TB 1DVRA 1ZINA 4IDHA 2XZOA 1MRNA 2OV2A 2YJTD 4F4IA 1GL7A 1W44A 1VCIA 2XOKA 4Q7KA 2OILA 4WVFA 2O5VA 5BN4A 2BGJA 3CX7A 2V55B 3I61A 3CC4B 1XXHA 2GVDC 1OXXK 3PG5A 1ZW6A 3ES9A 4WXPA 4L15A 3CR7A 2FOLA 4AG5A 2IYTA 4GNKA 3GEIA 2VEDA 5THXA 4PSKA 4HE6A 2WKQA 5H59A 1JAIA 4HATA 4Q4HB 1FUKA 2HCBA 2VP4A 1R0WA 1SM4A 1WXQA 3KTAA 3T35A 5BXQC 4ASUA 3S1AB 1DELA 2O8EB 1KK1A 1SVSA 4G1UC 4DB2A 3ZBUA 1NN0A 4OI0A 1S9DA 1E62A 4LWZA 4Q1EA 4Q4HA 4UNSA 4FCTA 1A4RA 5IK2D 5G41A 2ZM5A 1SXJD 1PJRA 4BPBA 3AVOA 4PZLA 3T5DA 1OKKD 1Q1ZA 5EZ5A 2AL7A 1XD2B 4HYYA 1X6VA 4M1TA 2YOFA 4TT3D 1ZD8A 4NZYA 1U9IA 3V76A 2PIAA 1G4AE 3AP3A 4ZGNB 1KMHB 1EGAA 1QVAA 2ZE6A 3RS2A 4F92B 1TAGA 3FYHA 3A4NA 4A15A 3WRXC 3FKSA 5CK5A 4ZIRB 2QE7A 4YMTA 2V6JA 2WJYA 3G5UA 1E2NA 2C9YA 3T5GA 4XTCS 5DSZA 5HR5A 1XTIA 2W58A 1E4YA 3LLUA 5E4FA 4C43A 1XTKA 2FDCA 2J87A 3T15A 3EA5A 4BUJA 3QEJA 2V8OA 1SQ5A 2RCNA 4IDPA 3A6PC 3U6BA 2DFLA 2VTKA 4HAUA 2ZYWX 5KDLA 1ONBA 4MGIR 4II7A 3VU9A 2IL1A 3ZQ6A 1VQOB 121PA 3U3RA 2CLCX 3CRVA 4I4LA 4FI3C 3A36A 4DVGA 1OSNA 4M53A 5F98A 4M9XA 1E9BA 3I55B 3RS0A 5JEEA 2QTVB 2QGZA 3ZBTA 2A9KA 3NBFA 4KCGA 1G7TA 1E2LA 2BBSA 3WRYC 2BGIA 2QE7D 4KLZA 4JLVA 3W9YA 4KO8A 1GG2A 3K9HA 1KD1D 5JRJA 2WJHA 4G5OA 3ADCA 2RGEA 1NJFA 2RH5A 3SHFA 3ADBA 5FTLA 4EJSB 3FFAA 4ZDWA 3EXAA 2ZI9A 4L9WA 4D0LB 1MRSA 2PL3A 3RC8A 1YJ9B 1GVNB 4M1MA 2B8TA 3M0EA 3DPUA 1BH2A 1XTQA 1G291 2NO1A 1G5RA 3THWB 1Z0KA 3PEYA 1NP6A 2C78A 1P9RA 2FSIA 4EH1A 4BASA 4HSEA 2VHUA 2QA5A 3A4LA 5J4KA 1UBFA 4CEIA 2JAQA 4IVQA 3CCEB 1JEDA 3Q5EA 4G01B 4C9BA 3SJBA 5KSZA 1FTNA 1Z29A 3RWOA 2Z4RA 5EZ6B 3OJWA 2OBLA 4KVAA 2F55A 1FPMA 1MH1A 4B75A 4BLTA 5JCZA 2F9MA 1EWYA 4KODA 3AP2A 4US2R 1KMQA 2ZSBA 3GJ7A 4G3XA 1CU1A 5KNDA 2EU8A 4QFMA 3G4SB 2IYQA 2Z4SA 3MJHA 621PA 2FFAA 2GESA 3VKWA 1OFHA 4D4MA 1F6BA 1P2VA 2O8CB 1W7AA 3IDQA 4L4UA 4OK6A 2QORA 5FOXA 2J9RA 2VBCA 1QVGB 3DDCA 1NIPA 1NJID 2OBMA 4YMVA 2BEKA 1U81A 4BLQA 1G8PA 5F9FA 3H84A 4DLTA 4NMMA 4YDHB 2VHQA 4JMPA 1E1QD 2IT1A 2ZE5A 1UBEA 4D82A 1Y3AA 3SFZA 3I5YA 3RRYA 2QN6A 2PEYA 1QGYA 2BEJA 3IBYA 1DAHA 3B13B 3QXSA 3ZGXA 3FJOA 4ZGQB 1IN7A 3EIHA 2J7KA 2FPMA 2IUSA 1HQYE 3SYNA 2F9LA 4LBYA 3NWJA 1D9ZA 3TW8B 5JJKA 1XD9A 4L5BA 3CD6B 1JQJC 2ZE8A 3PFIA 4OYHA 1KO7A 2QEXB 3K70C 2V7QA 2F1RA 3VU9B 2OFOA 2C96A 1VQ7B 2BOVA 3PR1A 2IS6A 1HTWA 2HEIA 2D74A 4JLMA 2L0XA 4C3ZA 3QFCA 3K9GA 3VQTA 1G5PA 1BX0A 1B0UA 3IGFA 3R9XA 4I81A 4FK8A 1ZM4A 1AS2A 3CCJB 2QMHA 3NHBA 1R0XA 1DDGA 1R5BA 3HPRA 5CYPA 1WBBA 2GJ9A 2F6RA 3E2IA 3RRNA 3TLXA 5E3HA 4LOAA 4A8JA 421PA 1SHKA 2QT0A 3UKDA 5SZHB 1CRPA 3E1YE 1U0HC 3DZ8A 1ZM3A 5AK0A 4KJZA 4Q01A 2IHBA 4DSNA 2IS2A 1DBSA 1E2DA 3UPUA 3ZS8A 1VHTA 1KO4A 3EPJA 1E9EA 1CJKC 3ETLA 1J8YF 4MGKR 2IK8A 1GSIA 5LB2A 3VFDA 2EWVA 5GADl 3IHLA 2CJWA 4C4PA 1YZNA 1ZM2A 1A82A 3BH7A 3MRSA 1M2OB 3C16C 2WWFA 1KI7A 2W6JA 1KNQA 2VO1A 5CJ2A 3LVQE 2DWPA 3Q5DA 1CR4A 4M9ZA 4TL7A 2OG2A 5DYGA 2I1QA 1ZD1A 1KDOA 3SDZA 1KZ7B 1DARA 4M1KA 1R5OA 4QBGB 4Q02A 5CB6A 3H0KA 5IT5A 4BWYA 5F9HA 1DAGA 1EFCA 3DZDA 4TLBA 4Q9HA 4CEHA 2ZJZA 2ZITA 1DAKA 1N0WA 2IEYA 5A0FA 2ZREA 1LV7A 1UKZA 2H5EA 4DT1B 1GDDA 3KKOA 2ONKA 3CUEF 3LH5A 2IEZA 5FPTA 5L3RA 2GCPA 4G1VA 2ZU0C 3B9QA 4BFXA 1SVWA 3X1DA 1HT2E 3ZC3A 1AMOA 2GEUA 1OE0A 1YITB 5FL7D 3PQCA 2ZQ5A 3HDTA 3LLMA 1IJFA 2AX4A 1RVDA 2OCPA 3CMAB 4H1UA 4KBGA 3QE0A 1ZUNB 3NBZC 4JYBA 4TSFD 1E2PA 1GWNA 4JVSB 3GLFE 3VR4A 1RFLA 4K46A 1G9XA 3ZVLA 1KI1A 3L82B 3EZ2A 5EUQB 4X8OA 2ODNA 3DVLA 4LBWA 1NL3A 4OKSA 2FFBA 2GVZC 3B60A 1W46A 2IYXA 1Q1BA 4LHZA 4PQYA 3W5JA 5DN6A 1CTQA 3G82C 3VNUA 2ZU6A 3QXHA 1GITA 1D2MA 3PUWA 2ZIAA 4B32A 4JT2A 2NO7A 1W2BB 4X8LA 4PFSA 1VYUA 4QM6A 1O3YA 1JPJA 4HB4A 2J0VA 3K0SA 4GRAA 3JQQA 1T91A 1E9DA 2AXNA 2E87A 5KDOA 4RSGA 1ZM9A 1XEXA 4U7DA 1EP3B 4IFBA 4Q7JB 3U6KA 1TUEA 5UKDA 3B6EA 4RFSA 2ODWA 3R8FA 1RIFA 1ZAKA 3AKCA 4URXR 1S1MA 3HU3A 4JVNA 5E95A 2QBYB 1OXSC 1YR9A 3QVVA 2RKOA 3B7GA 4ZCLA 1RKBA 3IBGA 1TTTA 3A1WA 4Y9UA 4KV9A 4D0GA 4QHYA 1DO2A 4HAXA 2EFEB 4OHZA 1QHYA 3W6NA 5K8TA 2FA9A 2YYZA 4PC2A 3ZIAA 3DM9B 4BLSA 2PBRA 4PX9A 5J4YA 3U5ZB 1OLOA 1QHHA 2CBZA 4M1WA 1YZTA 3AVYA 1AQUA 4MITA 5CB8A 2IWRA 2BBWA 2W6ID 3OAAD 2Q9CA 1QX4A 4MH0R 5A4JA 2ZYTX 3UMRA 1E94E 1NVVR 2JLQA 4LDJA 4KFSA 2J46A 1KNXA 5CK4A 4EFLA 2ZRIA 3N5CA 3P32A 4Z1MA 4Q1CA 4WBSA 1W36C 1N8RD 4ERNA 3BB1A 1GOTA 2R44A 3SYKA 5JBQA 1L7VC 2FE4A 3TUIC 1NJGA 2VP5A 3W5IA 3HU2A 1SVIA 4MRRA 1I2DA 3CH5A 4EFNA 4HEJA 1CR2A 3BBPA 4BRWA 3J81k 1E2HA 4QBIA 4C0QC 4MYTA 1N5JA 1G19A 2EFHB 2R2AA 1ZU5A 2RMKA 4AK9A 2KSQA 2IYRA 1VQ4B 4ILEA 4ZDJA 3TGPA 2Q6TA 2YVUA 3DEFA 1U99A 4TMZA 4NE2A 4OBEA 3S1AA 2WPDA 4M4SA 2N42A 5L3SB 3GMTA 1Z63A 3UWKA 1K5GA 1JXMA 2NGRA 2JJ1A 2KE5A 3PUXA 1LVGA 2YHSA 1E2IA 2QP9X 3CRRA 1YVDA 4B33A 4C0AC 4BFWA 2ZVPX 1ODFA 2ATXA 4DLUA 2WSSD 1VIAA 2GEDA 5CLQA 4AD8A 4C0HA 2OTJB 3GLHA 1AIPA 2FZ4A 5FOTA 4K8OA 1WCV1 3X1ZA 4ZI2A 3EA0A 4NYIR 4B71A 2R8RA 2WJGA 3KKNA 4A36A 2GCOA 4JSTA 3I56B 1OB5A 3AF3A 2A5JA 4LRWA 5FPHA 5BYKA 1DAIA 5K8IA 3RSOA 4CEHB 1XWIA 1Q3HA 2GKSA 4DCVA 4Q66C 4I1VA 4XWOA 3CRZA 4LJ9A 1MO6A 5EJEA 2ZRKA 4N3NA 2VYQA 4QGGA 4MKIA 1Q0UA 2A3RA 4MRSA 1VCNA 4GOJA 3CWZA 2D7CA 2B7BA 3AKEA 3VAAA 2PZGA 3HR7A 4HB0A 4EQ6A 1NBME 1JAHA 2A5DA 2J1LA 2X19A 4IDQA 3RAPR 4O25A 4K1XA 3BGWA 4X8MA 2BN4A 3C14C 2GILA 4CDGA 3SI7A 1H85A 3CBQA 5EXSA 2HMAA 4F93B 3SOPA 1RYHA 1T8TA 3QPUA 3H4MA 4IDNA 2ZANA 3UMFA 4B35A 2G3YA 4DLYA 1V5WA 4DC9A 3IEVA 2CL0X 3R7WB 3AKYA 4YXWA 1Z0DA 1W4BA 1W49A 2YWGA 2P5TB 4AY2A 2CDNA 4G1BA 3LDAA 3ASYA 4JZKA 2BCGY 4B3BA 4NPHA 1Z6TA 3KKMA 4DQKA 4BGDA 1X86B 4RZUA 1RRPA 2OCYC 4MYHA 3W5VA 1XEXB 1N0VC 2C03A 1TU4A 4TQAA 3U7EB 1XMJA 3I8XA 1WP9A 4TYWA 1E9FA 1A8PA 1AKEA 4Q4LA 2GDJA 3A4MA 3LX8A 5EE3A 2CNWD 5FUVA 4UQOA 4KITB 5KDDA 1S8FA 1YU9A 3KXLA 1GR1A 1XD8A 2YC2C 2YWHA 2SHKA 1GTVA 1HV8A 3ND8A 4CT4B 5HCIA 3T1VA 4B4DA 1UEIA 2QP4A 1Q21A 4Q4JA 1YIJB 3L8ZA 1HE1C 2GBLC 1Z0FA 4DSTA 2VHCA 1NMZA 2RGDA 1XZPA 3B9PA 1JJVA 4L9SA 5JEDA 3AGPA 1M74A 3CIOA 1W0JD 4HDCA 1AA9A 1YI2B 1VQ6B 3JQRA 4KYUA 3U2QA 3L0PA 1E2MA 2PZEA 4NTZA 1EESA 3OEHA 4D25A 1N0UA 2OTLB 1NLZA 3NXSA 2OCBA 1XJ0A 1ESNA 2CE7A 3EC2A 3IPYA 4NBSA 3I8SA 3OIYA 3L0OA 4AURA 4FMBB 2XTZA 5GVRA 1KY3A 3TE6A 2QMUA 1XJCA 2BIFA 1NLYA 3JVUA 1JJ7A 3P4XA 4A92A 2ZUCA 3BFVA 4QG7A 5JECA 2D7DA 4I99A 2H18A 1LF0A 1WF3A 1GO2A 3QIAA 1IN5A 3E5HA 1SVOA 4LK2A 3RANA 1P2TA 1UAAA 2BVNA 4TWZA 4AWXA 1LY1A 4EJSA 1LS1A 3KX2A 4D80A 1CS4C 3V4FA 3IPXA 5SZJA 1SKQA 2VNIA 3OEEA 3QY0A 2IC5A 1BMFD 1DTSA 3I72A 1QFZA 4IFEA 1XD2A 3LD9A 2EYQA 2FGKA 2Q3HA 3WNBA 1XXHE 3SN6A 4HAVA 4JBXA 3LW7A 1EWRA 2VZLA 1HT1E 2AWOA 2VF8A 3GJ0A 2VNHA 5TDHA 3RS5A 4IEIA 1JALA 2ZSFA 3CPHA 2JGNA 5DI3A 1XMVA 2JIZD 2XXAB 3TK1A 4DDUA 4QGHA 2IYWA 3NC1C 3TRFA 2NO9A 3QOFA 4IVRA 5E7JA 3P27A 4NYJQ 1JQLB 4TYNA 1OIVA 4FN5A 3SBEA 5FBVB 5FFMA 3VR6A 4AF7A 4BFSA 1OH5A 4O3MA 1FZQA 3FWYA 3REGA 4W5JA 1CF4A 1NSTA 3E20A 1KI3A 4PAMA 4B3XA 5TR9A 5H68A 2GXQA 2WSMA 1ETUA 1UFQA 3CRMA 3L43A 3GEEA 3NDPA 2PCJA 3OIUA 3FHTA 3GQBA 3MG9A 4HAYA 3V4RA 3CNOA 4ACAA 3NBYC 4KSCA 4KYIB 4B2IA 3QF4B 5ELXA 4HZUA 1GAQA 3WNDA 1IXZA 4WZBE 2RC5A 1QBKC 3L0IB 2LCFA 4ACBA 4NYIQ 5SZKB 3VHXA 1XPOA 3LO8A 1XP8A 2DR3A 1OT3A 2XEXA 3MWKA 4LHVA 3R9IA 3EPKA 2DEUA 2HLDA 5H8WA 3OZVA 2ZRCA 4I1SA 2FNAA 3JZAA 3VR2A 4F4CA 2O8DA 2IYSA 3VO1A 2VA8A 4HLQB 2AFIE 2XNSA 4FCVA 4OL0A 4OK3A 4PC1A 1ZIOA 1ZU4A 3R7WA 1G4UR 3T12A 4DUGA 3W2GA 2ZRJA 3O8BA 1W4AA 5AJXA 3SYLA 1KI8A 1E9RA 3HP1A 3HR8A 4U00A 4BLRA 3PUZA 1GIAA 2Q9BA 4YAUA 2VSOA 3LW8A 2D2EA 2WOJA 1YJ5A 4V0ME 2XGJA 1BIFA 5K8LA 1JB9A 3I3SR 4RKFA 3TKLA 2FJUA 3WBKA 4LGMA 3LXXA 1IY0A 3TSZA 4AYXA 4DLZA 3GPLA 2ZI4A 1T9HA 4LYHA 1Z07A 2ZJ8A 5B58C 4KU4A 4JLDA 3TR5A 2XTNA 1T3LA 1ZCBA 2QENA 5DYIA 3MLEA 2DETA 2R6GA 3AVPA 3NHAA 3GCGA 1W87A 2ZRFA 3MFYA 3MWJA 1XMSA 3WYAA 3KKQA 1TEXA 3AUYA 5G3YA 4DT1A 1KGDA 4XVRA 1KKLA 5HZKA 2JDID 3MWLA 2OUKA 4EIWA 4QNMA 1FDRA 1OF1A 4E22A 2O8BA 4XSGA 5FBRB 1T0HB 2ATVA 2ZSAA 4RD3A 3KJHA 2ZS9A 2EW1A 3AGQA 1G64A 1GILA 2YWEA 1D2EA 4DLXA 4IHQA 1OXTA 1GRNA 3QPVA 2KBFA 1KMHA 3I62A 1PLLA 4DDTA 2ZAOA 4P6VF 4OK5A 2N46A 2YNMA 2WHXA 3X1WA 2WTUA 3QKUA 3CPEA 1C9KA 4CT5A 1SXJB 4ABYA 3AF2A 2OO7A 4LPKA 3K70D 2YOGA 3JZMA 4B2PA 4IOMA 1IOZA 4LHYA 4QJ3A 1W0JA 3ZQJA 1IXSB 3BH0A 3F5FA 3I4LA 1N6PA 3RC3A 4B3DA 3U3MA 4TL8A 1OFTA 1P61B 3KTAB 1J9ZA 1IJEA 1FP7A 2FWRA 3FMPB 4MRPA 5TVKA 1CNEA 1OPXA 4IKEA 4UKDA 4TYPA 1SHZA 3VR5A 1AQYA 3OHMA 1R2QA 5KO2A 4EDHA 1ZVQA 1VG9B 1XCGB 4C7OA 3NEYA 4Q9LA 3A37A 2CNWA 4M1YA 4TLCA 3W2EA 3B5JA 2XNJA 2YWFA 4GDFA 3W2IA 2J59A 4B3GA 2C95A 5EP1A 3CF2A 3QXJA 3QG5A 4B6EA 2QY9A 1ANKA 1IAQA 2VP9A 2WWXA 2ZUDA 3FMIA 3KFVA 5CDFA 1EP2B 3TIFA 3SQWA 1TQ6A 4PO9A 2DHRA 1ZNYA 5EE5B 4JSYA 1IN6A 4Q4AB 5JHGB 4YC7A 1WQ1R 1RZ3A 4BLPA 3O8RA 3MSXA 4B34A 1XCPA 2TMKA 3WMFA 4GZLA 1QDEA 4JL5A 4RKEA 4FWTA 2GXUA 2OXCA 4TL6A 1A5TA 3DKVA 2FSGA 1X1RA 1S1CA 1NVVQ 1MABB 1OHHD 1Q81D 3IQXA 2OSBA 3RLFA 1X8KA 3DMNA 3OFNA 4P32A 4G5QA 4X8HA 2JEOA 5LBIA 4S2EA 4Y0AA 1QG2A 3K9LA 1KK0A 1UJ2A 2RC6A 3CKLA 3HPQA 4NKRA 3D7MA 5F2EA 4ON9A 2P67A 5AR1A 1OFIA 4WAUA 1Q57A 3SU8A 1T5LA 3EZ7A 1UDXA 3AVQA 4U5XA 4XD7D 2WWYA 5KSWB 1WE2A 1EFHA 4J0QA 3D8BA 1TNDA 4NCJA 1N5LA 5EP4A 1E9AA 2GXSA 1XZQA 1NVUQ 5KSYA 2ORVA 3GJ5A 1XFAA 4TMXA 4URUR 3NVAA 3AQ4A 1XB2A 3HWSA 2QNRA 5FOUA 2QUZA 2WSSA 1SVKA 2WAYA 2ZRNA 3TR0A 1G6HA 1F48A 1VDZA 3LBNA 4P4SB 2O8DB 4M2LA 3CXCB 4HB2A 4DEYA 4TL9A 4LCBA 3P1JA 1GL9B 4WW0A 2BWJA 1T0JB 5FBQB 4TLDA 1G8HA 3NTUA 2HJVA 1ZD9A 2WPDD 1KK3A 1MO5A 1Z06A 4MRNA 1JXOA 2CCGA 3L2OB 3QKRB 2V6IA 3A1VA 1SVLA 5BN5A 1E79D 2ZPTX 1KQSB 4EPVA 2REBA 2WOOA 4URYR 4C0BA 4V0LA 2ANCA 2DFKB 1UKEA 1U2RA 1E1RD 1KI6A 5H70A 3ZS9A 4PC3A 2H1LA 4ZI3A 2GXAA 1PUIA 1JPNA 1M34E 4BRUA 2CCKA 1VG1A 3MHPA 2GZDA 3SE0A 2FSHA 4CZ2A 1QF9A 2CCJA 2NO0A 1G3MA 5EUMA 4D26A 3PUVA 5JI2E 1CXZA 4QNRA 1IM2A 3OZWA 3QNUA 1YR7A 2ZRDA 1GNQA 4OHVA 4PR0A 3AH8A 2OEPA 3KKPA 4BZPA 3LRPA 4YLGA 1XPRA 4AYTA 4C0JA 4XVQA 1IHUA 2PJZA 4TQ9A 1PV4A 1BYUA 3ZIAD 1QG4A 2ERXA 4A2WA 2XNDA 3B85A 3SJZA 5DNYB 1S3SA 3GEHA 3O8DA 4PSVA 2ZVQX 3RYTC 1GAJA 2Z5FA 2WWHA 4ARZA 1KZGB 3LY5A 5DH9A 3BIFA 3LVRE 4LHXA 4EPXA 3QF4A 4IXMA 4PPQA 1NBMA 5EP2A 4NHOA 2A78A 1XE1A 3SZRA 2FGJA 1KAGA 5G3ZA 5CLLA 1NVWQ 8OHMA 2QM8A 2Z43A 3CX6A 2Q21A 4DKXA 1XMIA 2PLFA 5FBWB 2XAUA 2GCNA 4A9AA 2WKPA 5JMTA 3CM0A 2OLKA 1CRQA 4B47A 2OESA 2XSZD 4A6XA 1YJNB 2IYZA 2NTYC 2ZI7A 1S3GA 1P2SA 5P21A 2F43B 1S0UA 3CPJB 5GV7A 3NDBB 2PEZA 3EWAA 1Q7YD 4CEIB 2LKCA 1Q20A 3FPKA 1PLKA 2CEAA 1RW4A 4KLNA 3PENA 4NDZA 1ZJ6A 1NIJA 1UBCA 2W0MA 2XTMA 2ZS7A 2C04A 4GMXA 2H8KA 1KO5A 2G9NA 3WYGA 2OK8A 1KJZA 1UKVY 1U9IC 2QAGA 1XEWY 3W2HA 1KSHA 4CIDA 1W36B 3K1JA 1W2GA 4A2QA 3Q7QA 1YRBA 5KNBA 2GK7A 2ZAMA 1OIWA 2CE2X 4HZUB 1CNFA 1VQ5B 4PO1A 2YV5A 4UAJA 5FL7A 4C0LA 3R8CA 4B3CA 1KK2A 3SJAA 4PZYA 4RY2A 3GFOA 1JR3A 4LHWA 5IDVA 3GLGA 1FTSA 1D2NA 1FW6A 1JR3D 1M8PA 2HYDA 2PX3A 4IOJA 2QTLA 2J45A 1NRJB 5F3WB 5FH9A 2QG6A 2QROA 5TY0A 3HJNA 3CH4B 3VKGA 3QENA 4FINA 2PZFA 3IIMA 4QGFA 3KQUA 1J70A 2J7PA 4IOLA 4PPGA 4UXJA 1P7CA 2D06A 1CLUA 4HAWA 4IW3B 1E96A 5AUNB 2FN4A 4JVLA 2QSYA 3W3ZB 1FNNA 3CONA 4PC7A 4GMDA 2WIAA 1LTQA 3BB4A 3A1UA 1OH8A 3C5HA 3B82A 2ZI3A 2ZSDA 4GSYA 1BYIA 1K8AD 1G3RA 4DLSA 5KU1A 4KSBA 4C2TA 4UJ3A 1W1WA 1TQ2A 1II9A 3LA6A 4R9UC 3UG6A 4Z8XA 5B57C 3ADKA 4TTPA 2ZRLA 4DDVA 1YZUA 5EP3A 3FKQA 1UBGA 1KKMA 3BD9A 3K9NA 2GHIA 2F1HA 1NF3A 2QGNA 1NBMD 5C2JB 2YKGA 4RD0A 5JHHB 2F1IA 1KI6B 2HLDD 5DIFA 3RDPA 3I73A 4IXNA 3PEVA 4JIMA 3RS4A 1BX1A 3AV0B 3BH6A 4EPTA 4QC2A 4PO8A 2XJ9A 2RHMA 3V00A 4DEXA 4DRZA 4Q21A 3O47A 2B5OA 2XNDD 5JRZA 1G3UA 4TTRA 3G0HA 1ZIPA 1Z6XA 1OXUA 2ZR7A 2ZJBA 4JLNA 2CVFA 1P75A 3PVSA 4Q1AA 1FNMA 2RB4A 1DOAA 1DDIA 1OV4A 4Q48A 2V1UA 3L0SA 3OJXA 3U7GA 2BDTA 2B21A 3T61A 1KSJA 1ELOA 1W4RA 2OBNA 4PTLA 2C5LA 1OGIA 2ODEA 1UADA 3DOEA 4TQUS 3UWOA 5BN3A 4BPRA 2HXYA 2Q3MA 3FPAA 521PA 3TH5A 4RFSB 1I4TD 1KSGA 1W5SA 3FDIA 1Q3TA 2BKUA 4MKHA 1T3SA 4RZXA 1X3SA 1G8GA 5FI0B 1KIMA 4HB3A 4A6PA 1P9WA 1A1VA 1R8QA 1AK2A 2EFCB 2WZQA 4A0HA 2JIZA 4TZ6A 1NKTA 3LNCA 4JBWA 2VL7A 2ZSEA 3IO5A 1FNDA 1GKUB 1QVFB 2FZLA 3QFSA 3WMGA 1P5ZB 1KC8D 2QSZA 4TMKA 5HE9A 5H1YA 1HE8B 1P73A 1R7RA 1ZC3A 4A0FA 5J4LA 4PQFA 4HLDA 5FR1A 4DB4A 2ZRGA 2B6HA 1W4CA 4Q4AA 2EQBA 1KO8A 2PMDA 2ZROA 4HI0E 3QBVA 3GLIB 3CB4A 3VTKA 2G83A 1Z3IX 1VQ9B 2WBLC 2VRWA 3IILA 3Q9LA 5FI1B 2VP0A 2B92A 2HXSA 3EZFA 4IVPA 1GRQA 3AVWA 2W2TA 1FX0B 2WMOB 4P31A 1BKDR 1G17A 2X1VA 1K6MA 5GVSA 4Q9JA 4JLPA 4I1UA 1FQKA 1JB1A 1F2UB 2WJVA 2VQSA 1YE8A 2QL6A 3KUDA 4B43A 3ZZUA 3RS3A 2GAAA 2JLYA 3F3YA 2OAQ1 1X8JA 3FHOA 1OHHA 3FOZA 3RHFA 5CIWA 2V4ZA 1VHLA 1OFUX 2JA1A 1OJLA 5FOSA 2ODBA 3VX3A 1QRAA 1C4OA 1YZKA 1Z0IA 2H7VA 1B2RA 2GJSA 2W83A 4OI4A 2A5YB 2CHGA 1R4AA 4ZPXA 4LJAA 4PPFA 5FPKA 5AN9A 1KJWA 4YAFA 4IOKA 2P65A 1D5CA 3VR3A 4XWKA 3W5UA 5DI9A 5AJZA 2I3BA 1BQEA 1CULC 4BEBA 4TMVA 1L2TA 1JEEA 4BFYA 4LJ7A 4ZDIA 6Q21A 4LV6A 4OHWA 1VPLA 4AKGA 1VQKB 2JJ8A 4EJSC 1HEIA 3ICQB 2W00A 1YKSA 2QDXA 3PCRB 5KTYA 4Z51A 4HLUA 2OM2A 3B1XA 1VQ8B 1A7JA 1TEVA 2OT3B 4DCUA 4CF7A 3OESA 3ZH9B 2W2VA 1KI2A 1DG3A 4GP6A 4L8GA 4LBZA 2IX3A 3NEJA 5TARA 1XXHB 1M90D 4JLBA 1PLJA 1MO3A 1N6RA 1U0JA 1XCMA 1U0LA 3W34A 3M6AA 2DCUA 3WYFA 1MKYA 1OIXA 3DO6A 3M1IA 3PV0A 1CP2A 1E0SA 1Z5ZA 4H1VA 1YJWB 3ONWA 2G0NA 3OZXA 3FKSD 3FVQA 4QGAA 4W5HA 1RPZA 3G71B 2PH1A 3WP1B 1K8RA 1Z08A 3AEZA 1T3HA 1XF9A 3MGCA 1NNEA 2DY1A 1Z6YA 1JR6A 1NG9A 4PSAA 2FFHA 4TT3A 4CGZA 4V0MA 2QAGC 4HE5A 5J4HA 4GFDA 2OFXA 3KQLA 1SXJA 5LD2C 2GQFA 1NY5A 1E2EA 2FPLA 5IK2A 4AI6A 4TMWA 2BM0A 1X1SA 4F91B 1S96A 1TQ4A 2GF9A 3QKSA 4ASUD 4IRUB 1N6KA 1VTKA 4D0NA 2OCAA 2O0HA 4LV5B 4W9MC 4LYJA 4XIGS 2JDIA 4W5WA 3QFRA 3LAWA 5JS8A 4IJMA 3WP0A 3K53A 2H57A 1HURA 1EWQA 3KB1A 1FQJA 4AYWA 4LBVA 2IWHA 2O0KA 4LJYA 1E3MA 1VKJA 4JL6A 4YMSA 1AS3A 5CJPA 1DS6A 2QTHA 2R6HA 3TMKA 2YOHA 2R6AA 4EPYA 1HA3A 2XOKD 4MYCA 4KXFB 2QRZA 4DCTA 4N3GA 3VHLB 3H1TA 3W6OA 1N6LA 4E07A 1VQNB 1IXRC 2Z6VA 3EIQA 5KYKA 4RZ2A 3GLGB 1IN4A 2J0UB 2D2FA 2ZRPA 1MABA 4RD6A 2XJ4A 1G1MA 3LQRA 5EQTA 1E9CA 4BZQA 5KPJA 3PJRA 1G7RA 1P2UA 1SXJC 2DPXA 2FU5C 2NZJA 4NCNA 1TX4B 5BWMA 4LPSA 1ESMA 1FX0A 3BE4A 1C1YA 4F38A 2ASEA 5JSZB 2QAGB 3KDSE 1TMKA 5E7MA 2JCSA 5IHPA 3PUYA 2ECKA 4FW9A 3RABA 5GJBA 1VG8A 4RJLA 4QJ5A 3SNHA 1TLLA 4BFVA 1DE0A 2RHDA 1EK0A 2P5SA 2QP3A 2V9PA 1OYWA 3BWDD 3BFXA 2ZS8A 4B73A 4V03A 1W0KD 4LJ6A 3WY9A 1U90A 1FRQA 3C7KA 2ERYA 1IY1A 3PIRA 2ONJA 4WZ6A 2P6UA 1G3QA 1D1NA 1QHIA 2KB0A 5CITA 1I4DD 5E7IA 1P6XA 3QXCA 1M7HA 3IUYA 3CC2B 1EFUA 1E2GA 1QHGA 3W90A 2IS4A 2QPOA 4MRVA 5IF9A 2JASA 4Q9KA 4RCYA 1KY2A 5FPSA 3BJIC 4Q7LA 2WVJA 4UJ5A 2ORWA 2B7CA 3B1YA 3K70B 4LY6A 2HDNB 3CZQA 1EG7A 2EFDB 3HYTA 5ANRB 2IHYA 1Y63A 2GEVA 5CM8B 1Z8FA 5CYOA 3WHKA 1RE0A 4FD2A 4BE7B 3NKVA 1DG1G 4H9GA 4PANA 1OB2A 4B6FA 1QGAA 3OIWA 4OQLA 5B30A 2O8BB 4R2IA 3UK6A 5TMPA 5D3QA 2YC4C 1BMFA 2ZJAA 3RRZA 3OEED 1WDTA 2J7PD 4TSFA 5EE9A 1CJMA 1DAFA 3Q3JB 1GUAA 1US8B 1T4GA 2Y8EA 3QEOA 1EX6A 1GL6A 4JS0A 3AVUA 3EW9A 4GOKA 2BBOA 1TVCA 3AF1A 4FXPA 4LV8B 4NONA 4Q47A 1CQXA 1KRHA 1QGZA 4AF6A 2AKYA 3A1TA 2W2XA 2C99A 1COWD 2ZJ5A 4GPTA 4OJKA 4K81B 4E03A 5LPNA 4A82A 2RGNC 1SVMA 3AUXA 3LV8A 4Q1FA 2WAXA 5HZHA 2GPJA 4TYQA 5FUXA 2VNJA 3U3OA 3LWNA 1OH6A 1XU4A 1Z0AA 3K09C 1MR3F 2DFTA 3WXMA 3VX4A 4MUAA 3CZPA 1V43A 2DB3A 3OW2B 2IA5A 4HUQA 2W6JD 2ZRBA 4EKDA 1TADA 1WA5A 4WA7A 4XWAA 2RGAA 3CRQA 2C2HA 4XSHA 3LBHA 3DMDA 2IBMA 1KO1A 1EP1B 2BM1A 1EFRD 3W3AA 2AWNA 1XEWX 3AF4A 4PHHA 4PHTA 1CIPA 2XSZA 5AUOB 1FP6A 5M04A 1N5IA 1AGPA 1W5TA 1VQMB 2REOA 3UATA 2BMWA 3Q8XB 1QVRA 4QM7A 3ZD7A 1XDBA 1P9NA 4WZAE 1ZMXA 3B1ZA 3CF6R 4D4JA 1NSFA 2G77B 2G88A 2R6CA 4A2PA 5L3SA 3BOSA 3CNLA 1L4UA 2IXFA 4YALA 2J5XA 1K5DA 3KL4A 3CRW1 1Z0JA 2EWWA 3TUJC 2VYFA 1F2UA 4BFUA 1UF9A 4KAXA 2GCOB 3ZYCA 2HT6A 1R5NA 3MD0A 1HQCA 3D3QA 2RGNA 2PMKA 3EWSA 1J7KA 4LSGA 1Q12A 2MMGA 4RD1A 2BBTA 3LQQA 4CRWB 4PPNA 2V7QD 2ZE7A 1KYIA 1R0ZA 4WXRA 1IN8A 5J47A 2F3RA 3GP8A 2RGGA 1TU3A 5FUWA 1LF5A 2QZ4A 3IEUA 3X2SA 1H65A 1S2MA 1U8YA 3P4YA 4DXAA 4NU0A 3R20A 2WWGA 4M9SA 2ZR9A 3QQ5A 4PAQA 2NQ2C 1LFDB 1U94A 1ZNXA 2GA8A 2GWHA 2IF2A 2O52A 3BERA 1VYTA 2AN9A 3E1SA 4DIDA 1W47A 2F7SA 1CKEA 2KI5A 1E1RA 4LI0A 3JQPA 5HXBA 2WMNB 1DADA 2HJGA 4LYFA 3RSLA 2WM9B 1CR1A 2FPKA 3ASZA 1CEEA 1TL7C 5AJVB 4D4KA 3KQNA 1II8A 5FA6A 3FMFA 3GLHE 1NN3A 3A58B 3THYA 1E79A 1E1QA 1QHXA 3ZZTA 3SQXA 3CR8A 2FMXA 3OF5A 4EUNA 4URWR 4S35A 4B74A 4JLOA 3BB3A 4XVUA 2P6NA 2ZI6A 2Z0MA 3LBIA 4NP6A 1KI4A 3K0FB 4JL8A 4NL4H 4ITRC 3L8YA 2VPPA 3VR1A 1VYVA 1XPUA 1D6JA 3C8UA 2OFWA 5JJIA 4M21A 2NPFA 2BMDA 2VNKA 1G41A 3T1TA 2IF0A 4P4SA 4KFUA 4GP7A 4A0GA 3U4QB 5EXPA 3ZLJA 4N0DA 4QBHA 5FR2A 3TQCA 1YHQB 1F5NA 5B2ZA 1KDPA 2VF7A 3KUCA 2R6DA 4FMDF 5J40A 3EC1A 3GJ6A 2AHOA 2OK7A 4JLAA 2BCJQ 3GD7A 1NMYA 2HYIC 1NN5A 4LJ8A 3BAFA 2P0EA 4EQ6B 4UNRA 4OHYA 4XD7A 1KOFA 2BMFA 4OHXA 3BRWD 2RGXA 3EAQA 4G0NA 1KHTA 5DE3A 1WBDA 2ZTSA 1NI3A 1YQTA 2HT1A 3IIKA 5EMNA 4LYAA 1M1YE 2ZR0A 1RYFA 3OFND 3WNCA 2V3CC 1VMAA 3Q85A 3W8NA 1F60A 2RGCA 2W6IA 3KJEA 1W36D 721PA 2AK2A 4IDOA 4BZXA 2BJWA 3SEAA 2ZXUA 3QE2A 3T06B 3U3KA 1KDTA 4M9QA 1J99A 2UZIR 1QFYA 3CCRB 4URVR 1E0KA 3UG7A 4TYYA 1LW7A 2ZI5A 4AKIA 2PT5A 3DKPA 1XTJA 4C0SA 3EIEA 2BV3A 1DEKA 2PJRA 2X77A 1UM8A 5HE8A 2CNDA 2CHVA 3EZ9A 1CJVC 1D9XA 4MDFA 4TZ0A 3F8TA 3SFVA 2A7QA 2KBEA 2CVHA 1QZXA 4JJZA 3ZVRA 4Q18A 5JS7A 4DHEA 2IYUA 2O8FB 5AWFC 4PHFA 3DL0A 3T34A 1E2QA 3CCLB 1Z47A 2BC9A 4LX0A 3ZDQA 5JFGA 4RVCA 1UDWA 4PHGA 1KAOA 5CIQA 3VKHA 2A5FA 3CLVA 4ZO4A 2ZUBA 4MYUA 1W2HA 3WBJA 1JJ2B 2IYYA 2KWIA 3B78A 4HZIA 4P0TA 1EX7A 5G40A 3BK7A 3CNNA 1JA1A 3CX8A 5TV2A 3MWYW 2ZYUX 3T1QA 1G8FA 4QHTA 2DERA 5GV8A 1E9SA 3X1YA 4A4DA 1E0AA 3FE2A 5DN6D 1P62B 5GJVC 2CLDX 2XNCA 1Z2AA 2GZHA 3AVVA 1X8LA 4YQFA 3GLFA 1Z28A 1Q44A 4QJ4A 4NH0A 1QUFA 1T6NA 2XXAA 4RD4A 4I1OA 2QTZA 4NCIA 5JLJA 1ZYUA 1UEJA 4CYMA 2CHQA 3C15C 3QUSA 4FMCB 1YHNA 2GRJA 2EYUA 3FTQA 4ZKEA 4MUBA 2LKDA 3REFA 2JLUA 3THXA 2BKEA 1RJ9A 3I92A 1H8HA 4AIIA 1Q82D 4JT4A 5IRCD 1ZCAA 2RGBA 2QM7A 2XZPA 2QAJA 1JBKA 2EFGA 1MV5A 1XEFA 3VMFA 1H8EA 2AR7A 5DGXA 3RNLA 4DCSA 5C4MA 1ZP6A 1FMJA 4KFTA 1HH4A 3U4QA 4YMUA 5LD2B 1WB9A 3BS4A 4O2LA 1TF7A 4BECA 4Y0VA 1S9HA 1XRJA 2G1JA 4DLRA 5KSPA 4B2LA 2QI9C 4DLWA 1FFHA 1P3JA 4P4TA 1VQPB 1TPZA 1IB0A 3CO5A 2VP6A 1FUUA 5EE1A 2IW3A 4U9UA 1QHHB 3THYB 4ZV4A 3BORA 5FTNA 2IXEA 4AG6A 3W8RA 3B1VA 2HUPA 3SC3A 2IYVA 1I7PA 5BW8A 1TF2A 2K5UA 4YHBA 3TNFA 3F0TA 4KBFA 2B8WA 1AZTA 4V0KA 2C98A 1BJKA 4DUGD 5C46F 4OI2A 4ESVA 2O8CA 4G5SA 4V0NA 2ZRAA 1XBTA 4DQLA 2MSCB 2R62A 2DYKA 3A1SA 3M4YA 1R6BX 3K0CC 1QHNA 1WMSA 4ZCIA 2OE2A 5FTMA 2ORIA 1UKYA 1JI0A 3KB2A 5FTKA 2J3EA 3U44B 2QA4B 3ZVNA 4UXHA 2IUUA 4DSOA 3K0AA 3NH9A 1KJYA 2NZ8A 4GBMA 5CDFE 2RAPA 2VHJA 1NKSA 3KJGA 2PT7A 3C41J 2OHFA 4JBYA 1ZBDA 4OQFA 4ESHA 1SZPA 2JATA 1S4QA 5CM9C 4JVMA 5KOYA 2VIIA 1GM5A 1DPFA 3EPHA 1E99A 1SGWA 1LS6A 1US8A 4FMDB 5AJWA 3C5CA 2O8EA 4R71A 1JECA 1M7GA 1N3BA 4Q5IA 1II0A 1BS1A 4LC1A 1Z6AA 2C8VA 3KFXA 4JKIA 1GRRA 3PXGA 5AJYA 1N6IA 4Q1BA 2G6BA 4WIAA 1G18A 2BF4A 2QEQA 1OH7A 2DWOA 2C9OA 1GKIA 1T8UA 4B3FX 3KZ1E 1VQLB 3QKSB 5DHAA 3I5XA 3G6EB 3B8HA 3TBKA 3K8YA 4Q00A 2ZJYA 3P26A 1HY3A 1F2TA 3CW2A 4LUCA 5C1BA 1P4SA 4EPWA 4OQMA 2FFQA 4HAZA 4PQRA 2J0UA 5DISB 1YR8A 3FMOB 3DM5A 3PEUA 4BEJA 1E64A 3U61B 3RVBA 2IXGA 1EFTA 2R9VA 2J41A 2WJJA 2D62A 4IEEA 2VSFA 1BOFA 3EG5A 4GZMA 4DIEA 5BQ5A 3IIJA 4D81A 1YZQA 2FH5B 1VIYA 3TAUA 1E98A 1NLFA 2JLWA 1RRFA 4AKEA 2KJQA 3TAHA 3TJZA 4LC0A 5KSOA 2N1BA 1UMKA 5D3MA 1KDRA 821PA 1VCMA 3CPWB 1AZSC 4KHZA 3SR0A 4EAQA 1IQPA 3K09A 2PCLA 2GJAA 2LWIA 4D4LA 2HV8A 4BFTA 3W2FA 2DFNA 2UVQA 4BQSA 3TW4A 1ZC4A 2YINC 1KTVA 3OEHD 3UIEA 2GTPA 3MUFA 2O8FA 1SULA 3THXB 2PX0A 5JJLA 1M7BA 1Q1EA 1H8ED 1VECA 3QSYA 1Q86D 4JKYA 4BFZA 3THOA 1CBUA 1E2JA 2GZAA 1H8HD 3LVBA
chains in the Genus database with same CATH superfamily
5FL3A 2GETA 5TQ0B 3T3GA 1AA6A 1UK8A 1CJUC 2AFIA 4E15A 2I1VB 3BICA 5I7SA 5DP1A 4ZQFA 4C4SA 1G8MA 2I2XB 4FOTA 2WUVA 2VAXA 1E3XA 1X1DA 1VG0B 1QH0A 1CSEE 2ACEA 2HNAA 4XH9B 5JSZA 1BHO1 4TUYA 3H9CA 5JZOA 3CV3A 1ID1A 1MFZA 2WA2A 3I2FA 4RZ3A 1DTWA 1Z8DA 4ML3A 4WZKA 2QDKA 3HXLA 1FFCA 3AHGA 1V8OA 5BYJA 1UMDA 2GPBA 4Q03A 4FEYA 1OWLA 2CLIB 4POAA 4GI7A 1BG6A 1WUTA 2AYYA 2EFYA 5SYNA 1CZUA 1SCUB 4GPIB 4UNPA 2CL6X 3QLTA 3K0EA 2ANBA 3ICEA 5J5CA 4RVOA 4KW7A 5I9LA 1RAAA 2UKDA 2XB4A 4PICA 3BCDA 1J9GA 2O3UA 3CZ5A 2VF2A 4R8SA 5DBOA 2R47A 3RYHB 4RPLA 3MMPA 1LW6E 2IZOA 1BXRA 5LOVF 3GR6A 4XB2A 4US1R 5DYTA 5FX2A 3P9NA 4HDKA 3PPVA 2P77A 3V2UA 5L3QB 2I34A 1XMOB 1ZRHA 4J94A 4WN9A 1F20A 4ARSA 1KP2A 4CQJA 1A9PA 2FZEA 3TOCA 2RJNA 4RD2A 3PA2A 5L6LB 3Q3IA 1V5FA 3A35A 2QRNA 2CXPA 2X1MA 1OLUA 4LY9A 1KPGA 3FOFC 1ZK3A 2NOAA 5FBLB 2WUGA 4HF7A 1DC3A 3KEQA 2ZUEA 2OYNA 4AZ3B 1PZHA 4FNMA 1FFEA 3BRQA 4FT4A 2C2ZA 5YASA 4C0KA 4XFJA 5CNKA 4XGKA 1MXFA 2HMTA 1Y0YA 3AUSA 1OAAA 4BJ1A 1N2EA 2C1EA 6ADHA 1HG1A 2W6PA 4DUYB 2C9CA 1KKUA 1J33A 4NYMR 4WESB 5SZIA 1BVUA 5EEHA 5ETJA 1TUIA 1JKJA 2X4IA 3H1PA 2C5EA 5IT0A 3H1GA 2ETVA 2AKEA 2H1HA 4L0QA 1C8VB 1X1TA 4E2XA 5AFSA 2BFOA 2FR8A 3KT8A 4MCJA 4I5GA 5EKUA 3BFKA 1GAXA 1QZ3A 5AW6A 5ALLA 3HMQA 5LLSA 4E5KA 2NV0A 1SXIA 3CLHA 2B20A 2QYSA 4DDWA 5KC8A 3CWQA 3C6YA 3IT1A 2QMEA 2C9DA 1ZOOA 3G9ZA 5AT1A 1NF9A 3BEDA 3N2IA 1NXOA 5KNCA 3MCAA 2G80A 2GZMA 3C5EA 3DHWC 3LO5A 3NUQA 2ZJ6A 3CISA 3DOHA 3FB4A 2BHRA 4AKHA 4EAAA 2ZRMA 2WZDA 2YZ2A 1KH2A 3PRYA 4OQXA 2HHLA 3T9FA 1J90A 1V25A 1QQAA 3TFWA 3TDMA 1B6GA 3K2BA 4FIDA 1PFKA 3G9XA 3HZHA 5JNTA 3R23A 1VLJA 5G53C 2OM6A 2Z5VA 1DUVG 2CWDA 2PGJA 3A11A 1G20E 1LB1B 1WX1A 1GFIA 2P2NA 2VJPA 1WUKS 2A1TS 1OC2A 2XUDA 1L4LA 2IYOA 4B3JA 1E2KA 1OYYA 3PL5A 2DFVA 3N07A 4A8JB 1P91A 3FFXA 3H6GA 2AMYA 3QI2A 4LMRA 4EKGA 1B41A 1A4XA 1CUFA 1Q84A 2M32A 4UNNA 1P7YA 4PAGA 2C2MA 1W35A 1SKYB 3MC1A 4KQIA 5LQAA 1BXGB 3LX5A 2FLVA 1YTLA 1ECBA 3IC5A 5C5CA 3UB3A 4CQLA 5DVZA 1QTRA 1GP2A 1NG1A 2DQKA 2IE8A 2P62A 4WHMA 4BMCA 3BHMA 4KXQA 3ADDA 3U81A 4DZZA 1UCFA 1EUQA 4II3A 1I8DA 3UHOA 4F7DA 3A8KA 4PQEA 1ZRSA 3OQJA 4NU8X 3E0XA 1NXTA 5B6IA 2A0FA 1OI3A 4MQBA 5EAIA 4E11A 5A4DA 5BUZA 2VRNA 4CKCB 4Z1MD 3MGAA 5ITSA 1RAGA 2QNBA 5HS4A 1KYYA 3B51X 1JVNA 2ZYVX 3TW0A 1W85B 4ND4A 2J31A 1YZLA 4RPHA 1W4LA 1U28A 3H2YA 3IKMB 4HLCA 2C4NA 4WWVA 4PXSA 1YQGA 1FEZA 1FMLA 4RVNA 3SKYA 3EJWA 1UK7A 1N05A 2DSNA 7ABPA 1RLTA 4XJXA 5KVVA 2XRZA 1NNSA 2EP7A 4I6JA 3UWDA 2X86A 4ND6A 3MUNA 3N70A 2AGVA 2QTFA 4K2AA 5DNWA 1LLUA 3PHCA 1OXVA 2WKRA 4R2HA 4TLEA 5CEEA 3JAKA 1TCVA 2C9BA 1RWBA 2DBYA 1ORTA 4ZKDA 5LP6A 1ZK1A 3QEKA 3QYPA 2FKAA 2QPTA 2VATA 3I83A 5L8VA 1HMYA 2EW2A 1JG1A 3HY3A 1J1UA 3OECA 1YS1X 3SJCA 3N3BC 4F3KA 4PN7A 2QU8A 4JCCA 9MHTA 1MP0A 1WHTB 2NO5A 3CCQB 4EBBA 3AOEC 4P98A 5J1TB 5J35A 1WNTA 3PGXA 4BJ3A 4HLUC 4NS4A 4YEDA 5KCMA 1ZNWA 1N36B 3G2NA 1XNJA 4DSUA 2OLJA 5CVTA 3L01A 3OE7D 4CU5A 1EHYA 3HYRA 1ACMA 2Q2NA 3IUSA 2F00A 4HVLA 5JTTA 2Y1GA 1TYBE 3ZN2A 3E9DA 3JVIA 4DMFA 5HKKA 2FB9A 5AQEA 1TKBA 4X07A 1RLMA 1I32A 1ZDMA 1Q7GA 3QKTA 5HZBA 4IHJF 4J43A 4PX3A 3I1IA 3OZFA 4MRMA 3MWDB 4O2RA 2ZL6A 1WS6A 3RS7A 2XCUA 2R65A 3W8DA 1GPMA 2AXPA 2MSNA 2HBQA 4R54A 4M54A 1B23P 3ROMA 3MA0A 1A95A 1MT0A 1VSQA 3I9JA 1EFRA 3W3AD 2X85A 4BAZA 4URZR 3UTCA 3I1FA 3UJHA 3NFRA 3N87A 1NN1A 4IIYA 4TTQA 3NYWA 4LDNA 1KIFA 1SXHA 1JH8A 3KQOA 2H3HA 2Q4DA 3AP1A 3GJZA 1RQXA 1RYZA 1WCIA 4PZCA 4XQCA 1XMQB 3ZGOA 3GJXC 2WQ7A 2BSAA 2JC3A 4RSRA 3AM1A 2VHTA 1H2AS 4ZVMA 1IBRA 1ZSNA 3AOEA 3DW3X 4NEHB 3HHPA 1B3BA 5DM1A 4ZDKA 4YAJA 5B1HA 4RTQA 1P31A 3NC0C 4JXJA 4WK6A 4BBJA 1B76A 4ZFNA 1FRNA 1KZ1A 1DFHA 1ZISA 2HMWA 2PXXA 3LPAA 4LZZA 4UUNA 1YR6A 4X94A 4DJDC 2WUEA 3UMSA 2BFBB 2RHRA 3H0CA 5CR9A 1JWAB 5DLQC 4G4SP 3ZW8A 3ZJTA 5COBA 2W2NA 4R7ZA 5C7IO 4QE3A 2XX3A 4BNUA 2V6BA 3NNSA 1EXNA 1HMPA 1TE2A 2YVAA 3O83A 4Q16A 2E1RA 3OE1A 1U3DA 3WQRA 4DBLC 1XELA 4B76A 4M1SA 2RCYA 2V4UA 3BMXA 5JZVA 1GVHA 3EJ6A 4FWIB 3RUPA 1NE2A 3VR5H 3B2EA 4QX6A 3TLGA 1EWVA 1PT9A 3QLUC 5JG7A 3N2EA 4YONB 2PZ8A 4FZJA 4JLKA 1J8MF 4YRSA 5EQJB 9ABPA 2A9OA 2VDMB 2VOJA 3LF1A 2J0QA 3L84A 3CNBA 1YBVA 3PDHA 3EPLA 5KWIA 4CVNA 4C7OB 2VKTA 3W5HA 4CR6A 4R2LA 2NTEA 5JAZA 3I01A 1Z83A 2HRRA 4X65B 3E70C 2NZVG 5FPYA 4ENVA 5HKKD 2PGNA 1RZVA 4B1FA 2J07A 4M6WA 5FOVA 3H99A 2YXLA 2D4HA 3I6YA 2DHCA 5D3MB 4RLSA 4JI6B 4RFVA 5KYNA 3D3KA 1TT5B 1CDDA 1M6NA 4IBOA 1U0EA 1ZXLA 1MEOA 2FR8C 1NDHA 2F3UA 3N6RA 5CU7A 3S8YA 4KWTA 4IMJB 1U2DA 3L7AA 1VJRA 3FB1A 4GOXA 4PC6A 2A92A 3S44A 1SBZA 1VIVA 1CRLA 2QYHA 4BX8A 2BFCA 1AUVA 1NT4A 3KP1A 4LYDA 5E1BA 5FORA 1OCEA 1WD7A 3A3KA 3NBMA 4MKFA 5K51A 3GLHB 3V8NA 5IC4A 2MYPA 2DWQA 5JQGB 2Z8YA 2YXPX 4Z54A 5E6SB 5CBPA 3USCS 1C30A 1HYGA 4BWGA 2FUNB 3OX1A 3Q41A 4RMNA 5HFNA 1Z3CA 5EJ4A 3HA5A 2BHLA 3MN1A 3OIVA 2J3MA 4JV5B 1HDXA 1JFVA 5AVZA 1K97A 1R1DA 3GMDA 4PLPA 4NG5A 5K3BA 3WGHA 2JAOA 4R2WA 4WRRA 4F2WA 2JFGA 4E2WA 4M88A 4YFVA 1ZR4A 1CZOA 4G5GA 3FR8A 2BLNA 5COAA 3ZV4A 4H7KA 2G28A 1HBJA 1WUYA 1PTJA 1VLOA 1A9XB 1L4GA 2YXBA 3ACCA 3IKLA 3OICA 2JL1A 3A3NA 1E4EA 3F3MA 3KRTA 5I6DA 1MEEA 2Y1FA 3UAGA 2GT1A 4D44A 1R88A 1M6VB 5LIRA 3QJYA 1NRKA 2DXIA 2X1HA 1FLDA 1VBFA 4KVGA 5BT8A 2EKLA 2Q4RA 5PGMA 1PFQA 3VR0A 3HGTA 1R8YA 1JJBA 1IPEA 1GNRA 2XWQA 1FSGA 3AB3A 4UBKA 2CL7X 3ZXUB 3X1JA 4Y6GB 1DVRA 4IDHA 4AIRA 5LQSA 1QXSA 3IOYA 3QFHA 4C05A 3H1FA 2YJTD 3IQFA 1Y8ZA 1GL7A 3FDFA 5C32A 1VCIA 5C0OE 5CW1A 4Q7KA 5TEWA 5LZ2A 3ODPA 2BGJA 3CX7A 3T5MA 2X6QA 4RZSA 3PG5A 3TQTA 2CBGA 4WV3A 3R0QA 4FGLA 2P41A 4Q34A 4WXPA 4YMIA 4AG5A 3RASA 3UFXB 5KNDH 3PBKA 1WDLA 3FNQA 4YRLA 5THXA 1DKPA 2WKQA 1U3FA 1EAYA 5H59A 1JAIA 1L1QA 4HATA 1FUKA 4OHUA 5AKZA 4DBVO 2VP4A 1R0WA 1WXQA 3KTAA 5EJ6A 4QWMA 1BKYA 2C2OA 3LYLA 1DELA 4RTJA 3CSUA 4X85A 4ZOEA 2O8EB 4D57A 1Q0ZA 3R7LA 2HXGA 1WBJB 1RM5A 3D7KA 2ZXFA 4JJ6A 1S9DA 4ZQHA 4OI0A 3MCVA 4JBHA 4Q1EA 5A7FA 3TQRA 2X9LA 5IK2D 2QRVA 2ZM5A 2O3JA 4BWFB 4OQEA 1C4KA 4EZBA 4KXMA 2AEMA 3OQOA 3P0HA 5CNIA 5AVOA 1GRCA 1X6VA 2Y0BA 2YOFA 1ZEMA 5EVCA 1BU8A 1J7JA 5TMEA 4HHEA 2BM9A 1U9IA 3V76A 1G4AE 4FFBA 4BHTA 3KETA 1EGAA 3RS2A 1PE0A 3SQOA 4UTVA 3FYHA 1X1QA 2C42A 2N75A 3EF1A 3M6FA 4HQOA 4K26A 3SQNA 4A15A 3E3OA 4JUDX 3L9WA 5CK5A 4C3UA 4X84A 4ZIRB 5B53A 7MHTA 1M76A 2CXUA 5EJ2A 2ID7A 3UTDA 3T5GA 4XTCS 1RM3A 2C8LA 2Q3JA 3C7TA 4ZYWA 5FLXA 1FVXA 3T56B 1YIOA 2W58A 3QA3E 1MAVA 4C6SA 1EIWA 1G63A 2YIVX 3C6BA 2XT9A 5I47A 2CXSA 5KIAA 1NQOA 4BNTA 4GBED 2ZB8A 4Q37A 5B1EA 3QELA 1CUDA 2V8OA 1OXMA 2RCNA 5GPBA 1DWQA 3LWZA 3PHLA 4GPAA 4IDPA 4HAUA 2A9QA 2ZYWX 5KDLA 3T7RA 2BEVA 2R8YA 3IQEA 4MGIR 4UMDA 4OFZA 3PC7A 2NAFA 1XAIA 4LXIA 3U3RA 3EEOA 2I78A 3EVAA 2J5RA 3WLQA 2FSSA 1NRIA 4RMJA 4DVGA 4KIWA 5GZ6A 4BMPB 1HZJA 3N28A 4QYTA 4XD2A 3RS0A 5JEEA 4J2HA 3I6IA 1JKMA 3MJ4A 5LQKA 3ETJA 1GYPA 2CMDA 4OMFG 3RUEA 3NBFA 4KCGA 3IIEA 3HO6A 2SECE 4C2AA 2BBSA 2H4HA 3V8VA 3M7IA 1P2DA 4KLZA 1IZ7A 1IK4A 4KO8A 4HH3C 1KD1D 5BOVA 3UT5A 3DKKA 1P0FA 3EGOA 1NJFA 1U0OC 4Z99A 5IYPA 4UD2A 1KARA 1DB3A 2YN0A 4I4TA 3ANTA 5EWJB 5FTLA 1G5HA 1UC8A 4MV0A 3D7LA 3FFAA 1J0DA 3EXAA 1NT2A 1G2OA 4IJWA 4L9WA 4J3NA 3TD6A 1FUYB 1DKQA 3BXOA 1YRWA 1H2YA 5AJUA 5CH5A 3A7DA 3PDIA 5EJIA 3UM9A 2GN8A 4EJ0A 5ITVA 3DPUA 5JADA 1FSZA 4J1TA 4HWRA 2NO1A 5CCDA 3UJCA 2FW9A 4F06A 1PYOA 3THWB 2R86A 5GOZA 1P9RA 2PRJA 3IAS1 4HSEA 5DWQA 2QHXA 1GRVA 1OLUB 1HLDA 1XRRA 1XQWA 3CCFA 3CHYA 3NKLA 4G41A 3A26A 3LLCA 5HBGA 4CEIA 3SJBA 1FTNA 1Z29A 4PNEA 1WY7A 3A1FA 3UV6A 1SU6A 2GDZA 3OJWA 4KVAA 4DSAA 1V0JA 3C7AA 3N76A 1NPTO 3EVFA 3GUZA 3LOQA 4B75A 4US2R 4RTNA 2PS3A 5BOSA 2W22A 3PC3A 4FXOA 3OT4A 1ONPA 1M2KA 3GVPA 621PA 5BWNA 2FFAA 2JGMA 5K6AC 3RSGA 5I48A 1VJCA 2QVLA 5CB0A 2QN9A 2A1UB 2PBFA 2V9ZA 3C8HA 3H6HA 1LJLA 3EZGA 4PFJA 2WVGA 3L0ZA 1K7XB 5E4JA 4I9HA 1PT6A 4I36A 4NBWA 5E3IA 4MJ3A 2J48A 2Y0EA 3Q88A 1NGSA 1D03A 4UU8A 4K5QA 1WEHA 3FOBA 1ZS9A 4KR2A 2ZJFA 1I6KA 2FWPA 2P8SA 1QVGB 2R1UA 2VBCA 3DDCA 1NIPA 3AU8A 2WAAA 1NJID 3OX2A 4PNPA 5FQNA 1KJ8A 1X1AA 3INTA 3W1EA 2PV0A 3SD7A 1U81A 1VMDA 3JWPA 1Z26A 4BLQA 1YBFA 4P22A 1E5VA 3H84A 4B31A 3H2GA 1J0XO 2PUJA 3IOEA 3QOYA 3OO1A 2C4UA 1AG9A 1NW4A 1UWVA 4JMPA 2IT1A 1ULAA 2XUQA 2R66A 1P17A 2ONCA 3LBAA 1PSZA 2NW6A 2X4DA 3PE3A 4MV5A 3TRJA 1PQUA 4IUDS 4DREA 1AD2A 2C8JA 2WINI 3G6WA 4WNIA 2GZSA 1GZVA 1T2FA 2D1RA 2E85A 3JQGB 4XXHA 1XYGA 3VDNB 3VZQA 1WPCA 2O59A 1QGYA 2BEJA 1EXVA 3HVHA 3ZE6A 3FJOA 1QJ4A 1P1JA 1U3CA 3GRAA 3T51B 3O93A 3TX2A 6REQB 3NIWA 2IUSA 3MRTA 4IDDA 1XQXA 3LPNA 4WBNB 3NWJA 1D9ZA 2VQ6A 1XD9A 4L5BA 1N77A 1UBNA 3D6NB 1L9KA 4FC6A 4OYHA 4X66B 3EGDB 1O94A 3JARB 4EYKA 2BEUB 2QI9F 5E7QA 1HOTA 3VU9B 3DAYA 4BNKA 3T1NA 1GHTA 3GWZA 1VQ7B 2OD9A 2BOVA 2OVBA 3PR1A 2CFSA 2V7EA 2V7PA 3K72B 3QITA 3W77A 4EB0A 3IULA 2L0XA 2XGSA 3ZE1B 3JWIA 4XUCA 1Y5IA 1BX0A 3IGFA 4WSOA 4DM4A 3ICOA 5BO5A 2O2ZA 4DJEC 4LTMA 3ZIDA 2QMHA 4M98A 3J7AC 1DDGA 2VDWB 4UM7A 4DMMA 1V7ZA 2IRWA 4BKRA 4QXOA 2IYPA 1XLTA 3HK2A 5JIBA 1ICEA 2TSYB 5HQ3B 2Z2ZA 3JQCA 4CIVA 3FSRA 5CURA 2XUJA 1Z9BA 2P8JA 3EAGA 3TEFA 5ARBA 1LLQA 3UKDA 1ZIXA 2QD5A 2XQIA 4GPZA 4RHTA 5A5FA 1ZM3A 1L5VA 1AGXA 4G37A 1OT5A 2GJPA 2OPBA 4TGLA 2HLNA 2VNAA 3RROA 4U63A 4GDMA 3EPJA 2PXAA 3EN0A 1E9EA 2PWYA 1R4ZA 3A2LA 3W04A 4AXXA 1NV9A 4LJLA 1K88A 1BXGA 1GSIA 4QLBA 4HV4A 3VFDA 5CDGA 1FFSA 3VR4H 4AMGA 5GADl 1Y1KE 5ALMA 1GLNA 3GRRA 4C4PA 1MD9A 1ZM2A 3I5AA 4OA8A 1QHEA 4PRKA 2VHVA 4QU9A 1YIAA 5ALPA 1TVKB 5I7RA 2WWFA 3AUTA 3BY2A 2R00C 5DMXA 2DWPA 3IVMA 2ACVA 4TL7A 1Y7LA 1RWOA 2I1QA 3H5LA 4O2AB 5IZ4A 4FI3F 4H4CA 4OB8A 2GA9A 2LIVA 3UYLA 4QBGB 3HXOA 2AMVA 5G02A 2JHAA 4HDMB 3H0KA 4QQFA 2FW1A 1XROA 4TLBA 2JAPA 1HK7A 3HA2A 5AK4A 1N0WA 1JQAA 4TRNA 1P7WA 3UUGA 1QGOA 1VQ1A 4YFYA 1ZD3A 4L8LA 4L5YA 4MQFA 3KKOA 2ONKA 3CUEF 3WLJA 1EH5A 4G1VA 2ZU0C 3AF5A 1UC5B 4YRCA 5FI5A 3B6KA 3DLPX 1HT2E 3L5OA 1ILWA 3IP7A 1U2GA 3W7VA 1AMOA 1K6IA 1Z62A 1T8PA 3LLMA 3LS2A 1IJFA 5K4GA 3L3BA 1H2WA 4I14A 4EY3A 4OGGA 3ZY4A 4ALJA 4AJKA 5K3EA 4AAYA 3RTEA 3JXEA 2FF5A 3DD5A 2R4TA 1P5RA 5KQSA 1OILA 2ENUA 1G9XA 3ZVLA 3IP6A 4GE0A 1FJXA 3R5FA 5EUQB 1G8SA 1YZYA 3C6KA 4X8OA 3WL8A 1BQ4A 3ZGNA 1NL3A 1GEEA 3ISVA 8ADHA 2IYXA 3KOUA 1W8IA 4LHZA 3B52X 2P9JA 4Y67A 3JQGA 2HU5A 4KDRA 4JIGA 3PUWA 4OQQA 4P7KA 5KJEA 1YIDA 2PJDA 4I4TB 2QRUA 1X39A 1HDIA 1Q0SA 1TYEB 2ZIAA 1V3TA 3EVBA 2REQA 1JP7A 4LHEA 4YJGB 5E6RB 4MGHA 3NOOA 2NO7A 3WXBA 2BFEB 5GTDA 4QM6A 1SUPA 1XWFA 5IULC 1G0NA 1JFFA 4X97A 3R74A 3AY3A 3K0SA 1T91A 5KDOA 3H1AA 4Z86A 4LVOA 4A6EA 8ATCA 4UOEA 4P38A 3UGTA 3NDJA 4R4JA 5C8ZA 1Y81A 1P39A 2JIBA 5F76A 4RFSA 2ODWA 3GIWA 2XRFA 2QBYB 4Z2AA 1YR9A 4WOBA 3FGPA 2RHLA 3DXZA 1RKBA 3IBGA 3NO4A 1N2XA 3A1WA 4Y9UA 1W30A 2JIDA 2G25A 4MW0A 4R0NA 5BSKA 2I2AA 1QFSA 1B8PA 1PX0A 2JGLA 4HAXA 2YZKA 3W6NA 1NJ5A 2YL2A 4R7GA 3SIWA 5K8TA 3EFOA 4DA0A 3FBGA 5JSFA 3ZIAA 1EVQA 4ISCA 5J4YA 2HNKA 1BDIA 4CQNA 3IT2A 3ITKA 4J16A 3DH0A 1S2OA 3H8VA 3OTIA 3WGMA 4EG1A 2HJWA 4UARA 3L4JA 2UXCB 4QU0A 4KQFA 5DS0A 1D09A 4JU8A 3EMKA 4RXTA 1BJRE 1WXFA 3OAAD 4E7PA 2WU1A 1XZNA 4XEHA 1SHUX 3RU9A 3WGLA 4LF6B 2DFPA 1E5TA 2BW0A 4LDJA 4KFSA 5U4QA 5CK4A 3ASUA 1WETA 4BV8A 4ERNA 1YK1A 1DKOA 3BM5A 2QX4A 3PK0A 4XIJA 4P92A 5HQ3A 1NJGA 1XKLA 5AM4A 5AW9A 4MRRA 1I2DA 2OZLB 2OV8A 1CR2A 1RWMA 3DMTC 1KAQA 3L1IA 2GR9A 1T9CA 4EVIA 1QRSA 2NU7A 3D3WB 3PC8C 1N5JA 5EFZA 4CI9A 1TW3A 3UT0A 3DUFB 2KSQA 3UKJA 2ZPAA 2H63A 4CKBB 3KQMA 3TGPA 2GN4A 4IINA 1GDTA 2Q6TA 1SBNE 1O6FA 2YWCA 1ACJA 3ESYA 3S1AA 4M4SA 1R9NA 4FZRA 1JDNA 4DBLE 2ZQZA 3RC2A 3GMTA 3Q40A 4UPVA 3EFBA 4LY0A 3SR3A 4CFSA 1LI4A 1JXMA 2QTVA 3GQVA 1L5HA 4AZWA 2JJ1A 1MH9A 3IAAA 1MX3A 1IVNA 4HFMA 3PUXA 5TQVA 3TPFA 3WS7A 2NUPB 4XLLA 2COUA 2I6TA 1V8BA 4BYMA 4D92A 1AUXA 1EGHA 3GEDA 4QUAA 4C87A 1KJIA 3NRCA 4CM9A 4HMOA 4C0AC 1USUA 2B37A 1ODFA 1W1IA 2H2HA 7REQA 4G9BA 3QVKA 3GLHA 1AIPA 5A4KA 1E66A 4MA5A 3CEMA 4RNCA 4K8OA 1Y8QA 1WCV1 3X1ZA 4BN4A 5H16A 1U1GA 4FFLA 4B71A 3OTHA 1WEKA 1WTCA 1EE2A 1PQYA 4KWCA 1B0ZA 1U02A 3AF3A 4ISBA 5BYKA 2WHYA 1DAIA 3A4TA 1SUDA 5LM3A 2GKSA 4EK9A 1JHYA 1ZLYA 3PJFA 4HYEA 3CRZA 1MO6A 3O3MB 2C8KA 2GZ3A 2VYQA 3P71T 1X15A 4QGGA 4CDMA 4L02A 3INGA 4HDRA 4L85A 3PQEA 2A3RA 4DEVA 1QVVA 1WM1A 4E4YA 1CUVA 3JASB 3N3AC 5C8VA 4E5SA 5FCDA 3MT9A 2B7BA 1HT0A 4G4GA 1L5GB 3WQSB 3U80A 4IV8A 2Y1EA 2A57A 1JAHA 2J1LA 4TS3A 1Q1GA 4HP8A 3Q10A 2G4LA 4XLZA 2ZYHA 3AW9A 1MCZA 1TGYA 4B6SA 4ZJPA 2HF7A 3EW7A 5EXSA 4DJAA 4DA9A 4F93B 5K6RA 3Q87B 4B35A 2ZANA 1J9EA 3WX0A 1EWTA 1G55A 4CDRA 3WOVA 3HO8A 5K09A 4QG3A 1V5WA 1M67A 1UFOA 3IEVA 3HLYA 4UM9B 1TM1E 2IHJA 3MINB 4IUYA 1YWGO 3AKYA 3QMVA 4QXRA 5TGDA 3R7WB 2XY4A 1GLVA 1V3QE 4RXMA 2BCGY 3AR7A 4GI5A 5I4IA 5GZ3A 4GM0A 3S8MA 5KTOA 5BNTA 4HH4A 4BO1A 1Z5UA 2BFNA 4MYHA 4NBNA 3PQ2A 4V24A 4BGUA 4P12A 2H4YA 1XMJA 3I8XA 4TYWA 1KZ4A 1DZIA 1I0IA 3ICWA 2A0KA 4JWTA 3KDPA 3A4MA 2X3YA 5F52A 1C5KA 3DXXA 3KXLA 1PO7A 2EKZA 3EMDA 2V0CA 1ESEA 1YJXA 2VF4X 3L7CA 3R44A 3VR5D 2YWHA 2SHKA 5JMOA 1GTVA 2AXEA 5HDQA 4B9EA 4BAUA 4K28A 4CT4B 3X2EA 2YZMA 4EEZA 2YICA 2BZSA 1Q21A 3KBOA 1Y3CE 4EHDA 1Z0FA 4YGYA 5F64A 4XLEA 4DSTA 3JAMA 3B9PA 1BHJA 3IYLW 1JSXA 1W52X 3N2NA 2H06A 1P1KA 1M74A 3CIOA 3GZJA 1M1ZA 4H31A 3QUQA 4HDCA 4ZTBA 5BMVB 5IP5A 2D1YA 1CVLA 1ECCA 2JHFA 4B6PA 3U2QA 4NTZA 3ZTWA 3LUBA 3EEIA 4D25A 1N0UA 5CAEB 1Z7GA 2W93A 4C4YA 3NHYA 4MUFA 3SYMA 4B33A 3MLAA 3OIYA 4NJEB 4AURA 2IZ1A 4QDKA 5HK9A 2BIFA 1XJCA 5BQXA 1NLYA 3OZTA 3HKCB 1JJ7A 3UFXA 2GRAA 5A4IS 1Q2XA 1RMYA 4GYWA 5L53A 3WKCA 4I99A 3UAZA 3L7NA 1WKBA 2Z8XA 3D64A 3IMCA 1KMIY 1GO2A 1HRKA 1T8RA 4XASA 4UZEA 1IN5A 5ICEA 4XFDA 3UAOA 1KJQA 2XCLA 2UZ1A 3RANA 4WBNF 4IILA 3RUAA 5LZ8A 4BVGA 1WZEA 4TWZA 5EHNA 5CVUA 1UJ4A 4XWGA 2FPSA 1LS1A 3KX2A 1CS4C 3HR4A 3LUCA 5SZJA 5K4HA 3C97A 5AI4A 2WE8A 2K7ZA 3OEEA 5DHPA 3RBVA 4JKOA 4BV2A 4CKWB 1BMFD 3I72A 3KE9A 1QFZA 1T13A 3ME5A 3IQDB 4KX5A 5EWLB 2LR0A 2EYQA 2DPHA 2I4MA 3T0FA 3UUWA 4HAVA 3EQZA 3K9CA 1EWRA 1HT1E 3DAGA 2AWOA 3GJ0A 3RG8A 2R85A 4L7QA 5C5DA 1JALA 3AYXB 2WFMA 4G8CA 4BB6A 1BX3A 1B15A 3ITDA 3ASPA 1LZLA 1P3Y1 4DDUA 3ZE0B 1HETA 2VK1A 2NO9A 3AEXA 3E9ZA 4M0EA 4N5MA 1NI4A 2XXBA 1ONOA 3MAGA 4F1JA 3IMEA 4C4XA 3SBEA 5FBVB 3H5VA 3KT3A 2XI4A 1B8NA 3AHDA 2BUAA 1ITZA 4LSWA 5LJIA 4UPDA 1FZQA 3PYXA 5FLEX 1NYRA 4W5JA 2W2PA 1NSTA 2YFKA 3NGXA 1CF4A 2CXNA 2D13A 1X9GA 4B3XA 3CVVA 1AKMA 3E9RA 3HH8A 5KBYA 1ZJZA 2WG0A 4H35A 3BMQB 2FVYA 2OC4A 3EDYA 4XAQA 5CEFA 4B2YA 3ZIUA 2P7IA 3Q7EA 1QIFA 3MXTA 5IXJA 2E5LB 1YS4A 2PCJA 3FHTA 3ZQUA 1WQ4A 4BUCA 1YRYE 1ZJ5A 3MG9A 1JPUA 1X7YA 4ACAA 3CNOA 2HRQA 4KYIB 4KSCA 2G9RA 4B2IA 1X7ZA 5KC9A 1A8QA 1UZMA 4WZBE 4NCAA 5IT9A 1QBKC 3V2HA 2LCFA 1MT3A 2O48X 4XOPA 5SZKB 4B4WA 3DLIA 1LJUA 4CTOA 3OU7A 1XPOA 3LO8A 1M8FA 5K05A 1JIIA 2I03A 2P2YA 3OLYA 2J3DA 2DEUA 1YDWA 4Y6LA 1O89A 3TX6A 3ZCUA 4G81A 3JZAA 4F4CA 3JAKB 3BWEA 1CUBA 4HLQB 3IHKA 2WP0A 4OL0A 4OA5A 3R7WA 4M0FA 3EFHA 3T12A 1XU7A 1ZK2A 4L07A 1XI2A 1W4AA 3L7JA 2I7VA 4YTEA 3U9LA 4YPVA 3HP1A 3HR8A 1I6WA 1QMGA 3E7DA 1GIAA 3L9XA 3SPXA 3KEWA 4ARAA 2GZ2A 1YOBA 2QRGA 1TYAE 1UBLS 1YJ5A 3TWOA 3TQOA 3R9XA 4KQWA 5LZ5A 3TKLA 4LGMA 2BONA 4DLZA 1YB1A 2XYGA 2FRDA 2FSUA 3ZY5A 4PV7A 4KU4A 5KKNB 1MQ8B 1YE5A 3K7EA 2QENA 4HLNA 5JNWA 4F96A 3MLEA 2DETA 3GCGA 1W87A 1U6JA 1UD5A 3MFYA 1O1YA 1XMSA 1EDZA 3BGSA 2C94A 3KKQA 4WZAB 4F4FA 1TEXA 3AUYA 1D4ZA 4H15A 5G3YA 1KGDA 5HZKA 1IIRA 3OE5A 1ZVMA 3SK0A 4XQ0A 1ID8A 4EIWA 2POQX 1FDRA 3BWCA 5C1IA 1U4OA 3BMOA 1JHUA 3ESQA 4DILA 3AZQA 4XMYA 1H2ZA 3RAJA 1UOOA 4CTNA 1KDVA 3FTEA 2W7TA 1T0HB 2ATVA 2ZSAA 3GDGA 3HY6A 3D4IA 2ZS9A 3IHTA 2I55A 3KJHA 4FOLA 4OH1A 1G64A 4TKZA 4UM8B 5A62A 1U7TA 5ICGA 1D2EA 1WU8A 3PNLA 1QMPA 4DLBA 3T5PA 4P86A 5F33A 1F4LA 1PLLA 3WIUA 1BW9B 4Z9XA 1GY8A 4JB0A 1HE5A 3X1WA 4LMBA 2WUFA 1PGOA 2BAGA 2JCGA 1C9KA 3GW8A 1Y4AE 4ZHQB 3HBMA 1L3BA 1X92A 3GOQA 5DB4A 4QYIA 4BFLA 3BE8A 1OD6A 2GAIA 4QEZA 5DHTA 3JZMA 5ALYA 4B2PA 3NHWA 4HJXA 4IOMA 4BNMA 4BVEA 2VC2B 3H5IA 4DWWA 1IXSB 3QLJA 2B82A 3RC3A 1N6PA 2QM3A 2I8CA 3O1IC 3PRJA 3U3MA 3NHPA 1IJEA 1J9ZA 3ZEAA 2AA3A 1QH8B 2XBLA 3OCCA 2QZJA 5I8PA 4IKEA 1B16A 1JDTA 4IYJA 5K3AA 2W2LA 2QV0A 1ZOPA 2FWBA 3PJEA 5EI5A 3VR5A 2FW8A 1E6KA 5JFTA 4PZUA 4KR9A 4FMPA 5AW1A 1VG9B 3RYCA 1NVKA 4Q9LA 1MBZA 2CNWA 3ZDRA 3W2EA 4H77A 1RXWA 2V6GA 1O2DA 4EHNA 1HL3A 2YWFA 3MB8A 2ZYIA 1XVTA 1X1EA 3FPPA 1QGUB 2AFIB