3CW2A

Crystal structure of the intact archaeal translation initiation factor 2 from sulfolobus solfataricus .
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
414
structure length
414
Chain Sequence
AWPKVQPEVNIGVVGHVDHGKTTLVQAITGIWTSKHSEELKRGMTIKLGYAETNIGVCESCKKPEAYVTEPSCKSCGSDDEPKFLRRISFIDAPGHEVLMATMLSGAALMDGAILVVAANEPFPQPQTREHFVALGIIGVKNLIIVQNKVDVVSKEEALSQYRQIKQFTKGTWAENVPIIPVSALHKINIDSLIEGIEEYIKTPYRDLSQKPVMLVIRSFDVNKPGTQFNELKGGVIGGSIIQGLFKVDQEIKVLPGLRVEKQGKVSYEPIFTKISSIRFGDEEFKEAKPGGLVAIGTYLDPSLTKADNLLGSIITLADAEVPVLWNIRIKYNLLERVVGAKEMLKVDPIRAKETLMLSVGSSTTLGIVTSVKKDEIEVELRRPVAVWSNNIRTVISRQIAGRWRMIGWGLVEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Translation initiation factor 2 subunit gamma
publication title Crystal structure of the intact archaeal translation initiation factor 2 demonstrates very high conformational flexibility in the alpha- and beta-subunits.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Translation
total genus 64
structure length 414
sequence length 414
chains with identical sequence B, E, F
ec nomenclature
pdb deposition date 2008-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
A PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 3cw2A02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 3cw2A03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3cw2A01
1IY0A 1CIPA 3B1VA 4KU4A 1F48A 3LNCA 3R8FA 3QFRA 4C0KA 3PUZA 3KB1A 4LHXA 3BERA 2J0QA 4G0NA 1DARA 1U90A 4FCTA 3UANA 2OAQ1 4BWYA 2XTZA 4G5RA 1E79A 1IM2A 4ZKDA 4RKEA 1FRQA 3B1ZA 4KJZA 3LVRE 2O8FA 2WJVA 3PUXA 1S1MA 3KKQA 1YR6A 1ZRHA 4WXRA 1NIPA 3DDCA 3OHMA 2OV2A 4LX0A 2JA1A 4QJ4A 5FPKA 5F9HA 4AI6A 3LFUA 3NBZC 1HYQA 1W0JA 2AKYA 1KO8A 1S1CA 1YU9A 2OBMA 2YHSA 1UDWA 3CNOA 4GOKA 5KOYA 1K6MA 4K8OA 3TUIC 1TF7A 2FSFA 1XE1A 1SHZA 3TAHA 5L3RA 2F3TA 4OJKA 5G3YA 3UPUA 2DHRA 4NCIA 3BH7A 1T6NA 3KZ1E 4NYIR 4B43A 3U2QA 2VHTA 3AKCA 4FXPA 4ZCMA 1Z0FA 3R20A 5F3WB 3RLFA 1CR4A 1OSNA 3QFCA 1QHHB 1T0JB 3DPUA 2WPDA 1BQEA 3P4YA 2ZRKA 3AF3A 1VIYA 3LAWA 3I32A 1G17A 1AM4D 1XB2A 1BO6A 2IXEA 4DIDA 3HU1A 4QGFA 3CRQA 1H8HD 3GEHA 3LWNA 4UNSA 1NN1A 3BB3A 4BRWA 1YZKA 1OXTA 4TSFA 1M74A 3AKYA 5HXBA 3L2OB 1E9DA 2D62A 3OIUA 1M34E 4HAYA 4WVFA 3TSZA 4C0HA 1CKEA 3KXLA 1U8YA 1N25A 1XD8A 3EG5A 3AUYA 4DSOA 1NF3A 1Z5ZA 2D4HA 1DBSA 4P3YA 2XSZA 3UMSA 5EP3A 3GLIB 5HE9A 2B8WA 3MJRA 4OBEA 1SXJE 1XP8A 2NQ2C 1FOEB 3EIQA 4L15A 3GJXC 4LHVA 5AUNB 4Q47A 4B71A 3DM9B 3DMDA 5JS8A 2E1RA 1COWA 3IKJA 4US0R 3AVTA 4M22A 1P5ZB 4BASA 2DCUA 3NDPA 1NBMA 5KDDA 2ZRHA 3UXMA 2WSMA 1VKJA 1VECA 2W0SA 4RZ3A 1XMIA 1VQNB 3O47A 1YHNA 2Z4SA 5FTJA 2OK8A 2GCNA 2ZR7A 1E94E 2CE2X 3ZVLA 4DQLA 2IK8A 2V1XA 1W36D 2P6UA 5G53C 3PUYA 4JVMA 4EPTA 3TK1A 2BBTA 4PAQA 5D3MA 2DB3A 4WOPA 3OE7D 2XZPA 5EE5B 3BGWA 3SJAA 4PXAA 4A82A 521PA 4JVNA 3I61A 2QSZA 2R6DA 3ZIAD 4I1OA 4EKDA 4EPXA 1J7KA 1Z06A 2KB0A 1T5IA 3G0HA 2J1LA 1TNDA 1HA3A 4XWOA 4UJ5A 1AIPA 1DE0A 2C95A 3R9WA 4DRZA 2GVDC 5EP1A 1JJVA 3K70B 4LV6A 2ONJA 2XEXA 5EE3A 5DHAA 4EFLA 2W2VA 1CJVC 2KE5A 1XPRA 1GP2A 3BRWD 4BUJA 1HE1C 3LLUA 1V43A 3AP2A 4EPWA 3RC3A 2ZM5A 1DAHA 2IUTA 2ANCA 1KI6A 4RCYA 5JI3E 4NYMR 3I4LA 2BSAA 2ZPTX 3QKSB 2OHFA 4FMCB 2XB4A 2J0UB 1KI2A 3QE2A 1XRJA 1XJCA 4GT1A 4URUR 1VQLB 1KDRA 3K0SA 1FNCA 3K0CA 3JQPA 1AMOA 1W4AA 3K0AB 2ODBA 2HT1A 1KI7A 1EP3B 3NBYC 4DC9A 3MUFA 1U8ZA 2Z5FA 4WBSA 5CLLA 3A1WA 3E70C 5JEDA 3RS2A 3A37A 2ZI6A 3MD0A 4Q9LA 3PR1A 3EAQA 1FX0B 1YJWB 4R98A 1KI9A 5JWOA 3D7MA 2CNDA 3CWZA 2QUZA 4IXNA 4Q21A 2HT6A 2C99A 4II7A 1DAEA 1ETUA 5HCIA 1S9HA 4FW9A 1E2NA 2Q3HA 2V7QD 4JLNA 1S3GA 4BPBA 2A78A 1OV4A 3BXZA 4Q18A 1R6BX 2QAGC 1XTRA 4U5XA 4Y7CA 3NKVA 2GCPA 4IDHA 3LBNA 4M9SA 1KI3A 2VP2A 1E1RD 1QHSA 1SM4A 2F6RA 1H8HA 3AKEA 4I99A 3LA6A 5JMTA 3OW2B 2WIBA 4P4TA 3CPEA 2C04A 4JL8A 2IS1A 1JBKA 4ZDIA 2IA5A 2JDID 5E3HA 1Q0UA 4DDWA 3CRVA 1G291 4D4JA 4TMKA 1G7TA 2IYSA 3MRSA 1A4RA 3W8NA 2EWWA 1CLUA 4HDCA 4B4DA 1NY6A 4LBVA 2P67A 5DSZA 3TUJC 1GL9B 3N70A 2JAQA 1T9HA 2WMOB 3DKVA 5FUWA 3VX4A 3U3KA 3ZZTA 1CR0A 2VEDA 4RVCA 4ZIRA 1R2QA 1NVUQ 1Q57A 4Z8YA 5BN4A 3PG5A 3QF4A 3IUYA 3QXSA 5GJVC 1SVWA 2ZS8A 2R8RA 3W3AA 3O8DA 1FNMA 1Q12A 5KPJA 1S96A 1E96A 2PJZA 4RSGA 2C9YA 4W9MC 2W2TA 1UKVY 3W9YA 3DZDA 3OE7A 3AGPA 3TNFA 4C0JA 3GLIE 2GXAA 4PPQA 1RPZA 2OCAA 2QP9X 5HE8A 1NVVQ 1T3HA 3F8TA 1NLFA 2IBMA 2FOLA 5LB2A 2D7DA 2N46A 1G3IA 1XCGB 1KK3A 4XVUA 5H8WA 3QQ5A 4OK5A 1WF3A 4NYJR 4ESHA 1SVLA 4KCGA 4LBYA 2XTMA 4IFBA 2R2AA 3MGCA 1QFJA 3CCSB 1E0SA 3K70C 1E2IA 3I62A 4UAJA 5J4LA 2JGNA 4PPGA 4NL4H 1FP7A 4UJ3A 1QGZA 1W34A 1VQ7B 2KBFA 3AF2A 4TT3D 1NSTA 1UPTA 3WNDA 3ZBUA 4GBMA 3SC3A 3HWSA 5FTKA 1TLLA 1MO6A 4Q4LA 1QG0A 1LF0A 1KNQA 4ZDKA 2XXAB 1JR6A 4CVNA 5EXTA 1N5LA 1NN3A 2YOHA 4DXAA 1IN6A 3PXGA 1N3BA 2P65A 1KZ7B 1NJFA 4YAFA 1NBME 1G21E 4W5WA 1Z08A 1M7GA 3CR8A 1GL7A 2WAXA 4M1KA 4YXWD 1GNQA 4IOJA 5H1YA 4QGHA 2QTVB 4ZDWA 5F9FA 1RJ9B 3BFXA 2DEUA 4PZYA 4AC9A 1ZMXA 3BH6A 3CCVB 4NCJA 4OL0A 1QBKC 4M21A 2OTLB 3C4JA 1Z6AA 2RHMA 1SVSA 4LYJA 4M1YA 3THWA 1QHNA 4M4SA 4N0EA 4PC3A 2QG6A 2GEVA 1NMYA 3B7GA 3TIFA 3UG7A 1QVRA 3EPKA 1NMZA 2ZRFA 4B73A 1QVFB 3B1YA 3TBKA 2V7QA 1EWQA 4I1UA 1N6HA 1XTJA 2CE7A 4DSTA 4JLOA 5KDOA 1NLYA 3EC1A 4M1SA 2ZR9A 1GM5A 1VYUA 1JR3D 4UNRA 3QJYA 1C4OA 3ZS8A 5FL7A 2OSBA 1F2TA 1SHKA 1NSFA 3CX8A 3B13B 1WBDA 2XTNA 1GDDA 2JDIA 3OAAD 3MAAC 4E22A 5K8TA 3KQLA 1YI2B 2GWHA 2ZRAA 3C41J 4Q1DA 4QBGB 4H9GA 4UQOA 3T1OA 2G88A 3TKLA 1UF9A 4A4DA 4JJKA 1HE8B 1A5TA 4L8GA 4LC0A 5E4FA 5EE1A 5DNYB 4PC2A 4CGZA 1RRGA 3K1JA 1A7JA 2IEYA 1AJEA 3U44A 1KQSB 1NKTA 1JA1A 3AQ4A 3GFPA 2XAUA 4L4UA 3SFZA 5FPSA 2O8CB 1E99A 4TMWA 2HEIA 3AVOA 4AURA 2GA8A 4UNPA 4P4UA 2GILA 4KI0A 3R8CA 4C0SA 5KSZA 4NH0A 4AF7A 3TE6A 3GLGB 1YE8A 1GG2A 3KKOA 1X8KA 3L0SA 3E2IA 3CZQA 1E2KA 1SQ5A 1CJMA 4DUGD 2WIAA 5DYGA 1GITA 3W2FA 1FMJA 1MOZA 5FOTA 3SS8A 3ADBA 1VG9B 1Q1BA 2GZDA 3HDTA 4QM7A 3WHKA 1J70A 4G5OA 4LI0A 2RGBA 1KSFX 2VSFA 1E9SA 4TZ0A 1XXHB 2EFHB 3MLEA 3IPYA 4JL5A 4KV9A 4M1WA 2BVNA 2C8VA 1KJZA 1HV8A 1G3RA 2SHKA 2I1VB 3FB4A 4Q4AB 1E98A 2Y8EA 5FUYA 2OLJA 1EP2B 1QH0A 4I1SA 2ECKA 3QENA 1NI3A 2REBA 1KAOA 3M1IA 3W3ZB 4TT3A 4UXJA 2R44A 2YOFA 2AK2A 3GFOA 1DOAA 1M1KD 3ZZ0A 2WSSA 5JWHA 3CNNA 4LJ7A 2BGIA 2B7CA 3AVWA 1SKYE 1W0KD 4TL6A 4LWZA 3NEJA 1G8YA 1IJEA 1X3SA 2CJWA 2VSXA 4E5UA 1Z2AA 2C5LA 4Q01A 3PFIA 4A2PA 1DAFA 6Q21A 1KJWA 3CPHA 3NHBA 1QVAA 1KNXA 1P3JA 2CLCX 3REGA 1R4AA 1J8YF 4CZ2A 3JQRA 3WBJA 3EA5A 4IDQA 4YXWA 3NXSA 2QDXA 2Q9CA 4A8JB 4Q7KA 1M1YE 1Z0IA 2ZJBA 1OFTA 2JLVA 3ZVNA 3ONWA 4YMWA 2XZLA 2QRZA 2FE4A 2G1KA 5FH9A 1P73A 1SVIA 2QP4A 4O2LA 2PZFA 2QM8A 3W2EA 1A2KC 1ZUNB 1GOTA 2P5SA 4XVRA 2C03A 1KO4A 2ZSEA 3VKGA 2GAOA 4MQBA 2ZE6A 5IK2D 2W58A 1GAJA 2A5GA 1MT0A 3UWKA 1US8A 5JJIA 3WP0A 2FFBA 3LDAA 2YC2C 4I1VA 4JYBA 3QXXA 4BEJA 3KJGA 4DDUA 1TVCA 4FI3C 2D3WA 4LDJA 2VPPA 3KX2A 1CJTC 1JR3A 3R9IA 2A5JA 1UDXA 2EWVA 3GLFB 4D80A 3KKPA 3OAAA 3WMFA 4EUNA 4RCZA 5SZIA 3FKQA 1IONA 4B44A 5JHHB 3HPRA 1MR3F 1K73D 2AWOA 5FBQB 5KSPA 4B32A 4P32A 2QENA 2W6JD 2W6ID 3K09C 1MABB 3C14C 1QFYA 3CXCB 2J45A 4NYMQ 1IY1A 3LO8A 3AUXA 4G3XA 3QEJA 2XOKA 3SQWA 3CCMB 1LFDB 1AKEA 3AVXA 3B9QA 2ZVPX 3A1TA 4MA4A 3BORA 4BFWA 4OYHA 1JB9A 1OH8A 2IYUA 1D1NA 3X1YA 3VX3A 2CHGA 4HZUB 4P4SB 3U7GA 1Z83A 1CTQA 4DUGA 4HLQB 3OJWA 1OHHA 3B82A 2OZEA 5CJPA 4GZMA 2GQFA 1ZD9A 1HURA 2JJ2D 4LOAA 1NVXQ 5AJXA 1E0AA 2ZYWX 2IWRA 1TU3A 3KQKA 2A2ZA 2IT1A 4BFVA 1ZINA 4QHYA 3PUVA 1N6IA 3OZXA 2AXNA 3PEVA 3QKTA 3CCEB 1SZPA 2YINC 3JVVA 1GIAA 2IXFA 2RGXA 3M4YA 1PJRA 1BYUA 8OHMA 2QNRA 4Q02A 3CMEB 1Z22A 1Q1QA 3LX8A 2O8BB 2ZRMA 4LJ9A 3EZFA 4MKIA 1G7RA 1FNNA 5DYIA 2YOGA 2ZI7A 1E4YA 2OUKA 4OQLA 3D8BA 4DLVA 4MKGA 4G1UC 4UNQA 4TN1A 1GKUB 1ZIPA 2Z0MA 4OI4A 1RFLA 1UJ2A 4TL7A 2BF4A 4AY2A 5GJBA 1W0KA 1N0VC 2WM9B 1KDTA 1LY1A 3DHWC 1AS0A 1E2PA 1WCV1 2VLIA 4N0DA 2QMOA 4EPRA 2IS4A 2C2HA 1RYFA 4KSCA 5L3QB 4A8JC 1W4RA 2BM1A 3EX7C 1E32A 1SXJB 3IO3A 3B1WA 2J46A 5FBLB 5FPYA 1XEFA 2BBWA 2DWQA 1FRNA 1RRFA 2VHCA 2WJJA 2ZUCA 4MUBA 1IBRA 2EFEB 3CPJB 3GJ5A 4X8HA 4KO8A 2QEXB 2GAAA 3ICQB 4HAUA 2ZJAA 2ZRIA 4AKIA 3Q9LA 1X86B 2ZITA 1FL9A 1CJKC 1U0HC 3C16C 3CPWB 2UZIR 3QKRB 5IK2A 3SQXA 4MRRA 3VHLB 2OFXA 2Z4RA 1LV7A 1EWRA 2HXYA 2ODEA 2OG2A 1ZJ6A 4UXIA 3X1WA 1XEXA 3WP1B 4CT4B 2ZE7A 1XPOA 5FI0B 4EJSA 3GD7A 1QUFA 3AV0B 2BJWA 2F1RA 2R6CA 3NH9A 2ZR0A 3QPWA 5FR2A 1QVGB 3U4QB 4C4PA 1BYIA 3RS7A 3SEAA 1UKYA 3W90A 2ZJ8A 3QNUA 1NN5A 2RC5A 4Q00A 1TADA 3FMPB 3WNBA 4BFUA 4CEHB 1XTKA 1U2RA 4MGKR 2VIIA 2BCGY 5AJYA 1SKQA 2F7SA 2RC6A 2ODNA 3TQFA 3ZYCA 2WKRA 1FMLA 1P6XA 1LNZA 3VFDA 1QHXA 3UIEA 4AYXA 4PZZA 1UBFA 2W6JA 4QGAA 4PR0A 4OQMA 3RABA 2ANBA 5DI3B 1K8AD 3OIVA 4AKHA 2FZLA 3HPQA 5DO9A 3C5CA 2D2EA 5CIQA 3ADCA 2VHQA 4TMTA 4V0OA 4B6EA 3PEUA 4GL2A 3EPLA 3THYA 3TVTA 4LJAA 4US2R 1T8UA 4BFTA 3GLFE 1JAIA 1I4LD 1YHQB 3HR8A 2OO7A 2B8TA 3PEWA 3VU9A 1UEIA 2MSCB 2ZJZA 3UK6A 5C4MA 1Y3AA 5B30A 2BN4A 1FUKA 1K5GA 5EP4A 4Q4HB 1HQCA 3BK7A 2WJGA 4EH1A 3BBPA 4HATA 2JJ2A 4HDQB 5FUVA 4C0QC 2IW3A 1JA0A 3E1SA 3V00A 3EPJA 3FMIA 3K53A 2AKAB 3AF4A 2RGGA 2W00A 3DZ8A 3EIEA 2PMKA 2WWHA 1D5CA 3GMTA 4HLDA 4EAQA 4JLPA 1FW6A 1WE2A 2J9RA 3HR7A 1OH6A 5H5JA 1N0UA 1E1QA 1P60A 2AR7A 4BE7B 3K9GA 5J4KA 2B92A 1JAHA 3O8RA 5AUQA 2A9KA 3Q5DA 1R10A 3MWLA 4BLPA 3BIFA 1N6PA 3GEIA 4JLJA 3WYFA 4Q66C 4NCNA 3U6BA 4C0BA 2HLDD 1G8PA 1LB1B 1CRQA 1KTVA 2ODWA 3DKPA 4HAWA 2FV8A 3SJCA 1AK2A 4V0MA 1VIAA 3AKDA 3CCLB 3SDZA 5L3VA 3ND9A 3SNHA 3EW9A 4EDHA 5F98A 1F3OA 5DI9A 1XX6A 5EZ6B 3FHCB 1G4AE 4A6XA 1ZYUA 2JLQA 2ZJ5A 1SXJC 4GOXA 3ZVRA 2O8FB 4D4KA 4AK9A 3LQRA 3QKUA 3U3MA 3W6PA 5CB8A 2OT3B 4NZYA 3B60A 3AVVA 5FOWA 3W34A 2QAGB 1XMJA 1TF5A 2G6BA 4LZZA 1N6RA 2QAJA 1P2TA 2FGKA 1XBTA 1OT3A 2IX3A 4DEYA 1TQ2A 2GJKA 4RZUA 4DCNA 2CRVA 1YZQA 3CF0A 1Q81D 4ZGNB 1DAMA 2ZYUX 3QUSA 5BQ5A 3WRXC 5J4HA 1TX4B 2C9CA 5B57C 1LTQA 2ZXUA 1N8RD 2WOOA 4FMDF 2WWYA 3A6PC 1X8LA 4OI2A 1ELOA 4KITB 1ZC3A 2GVZC 2PH1A 5A4JA 1K8RA 3CCUB 4HSEA 4B74A 3QBTA 2IS6A 5FPTA 3TGPA 3GJ4A 2P6RA 4QFMA 2ZTSA 2BMFA 5DE3A 3L8YA 5EP2A 4YAUA 4RD2A 3KQHA 4XOIA 4M0LA 2DBYA 1NP6A 2GJ8A 4IDPA 3EZ2A 4B2LA 3IEUA 2WZQA 4EPYA 2JJ1A 3L8ZA 4Q9HA 4WA7A 4D25A 2F3RA 2P5TB 1YR8A 3EXAA 4IEEA 4JKIA 1DAIA 5KSWB 3IHLA 2OEPA 3W8RA 3SJBA 1UFQA 1OW3B 2J59A 2V6JA 2D06A 1P9RA 1KKLA 5DHFA 3NBFA 2NMVA 1CNFA 4RD4A 1P75A 2DETA 4PHHA 2BMWA 4M8NE 2H17A 4NE2A 4U9UA 2VZLA 4NONA 1Q3TA 1FNBA 4A9AA 4MGZR 1OLOA 1E9FA 2PLRA 3ECCA 3FHOA 2RGAA 4JSYA 1TQDA 3AF1A 3AGQA 2OM2A 3OF5A 3QI2A 3DMNA 1PVOA 4IKEA 1TU4A 1QF9A 4DLZA 2VYFA 4HEJA 1D2EA 1G6HA 2RMKA 4AG6A 4DT1B 4Y9RA 1E2GA 1N5IA 2OAP1 1M7BA 2OCPA 2ASEA 3CO5A 4BLTA 2J3EA 1II0A 1FFHA 1XJ0A 3FE2A 3VR6A 1XTIA 4RD1A 1TQ4A 1JQLB 1YQTA 2EIXA 3WYAA 3LW8A 3SE0A 3JVUA 4A2QA 3NTUA 3WY9A 1M90D 2FPKA 3QKSA 5IDVA 2FG5A 3G6EB 3PV0A 2IHYA 1IXSB 1QUEA 1KC8D 4FMCF 4LJ4A 5FFMA 1XEWX 3H0KA 1GWNA 3K0AA 2AXPA 4B3GA 4Q19A 1KK0A 1NDHA 4GPTA 1WDTA 2KSQA 3IGFA 4D4LA 1IN7A 1EX6A 1JQJC 3EPHA 1GNPA 5HTKA 4FN5A 2NO7A 2PCLA 1I2DA 1HQYE 1YRBA 3J81k 4C2TA 1XD9A 2FZ4A 3EA0A 5G40A 3VO1A 1U98A 1ZD1A 821PA 2CVHA 2HLDA 1OB5A 1DS6A 3H4MA 3GEEA 2CXXA 4MITA 2VP0A 1NKSA 1KI6B 5KO2A 1GRNA 2R62A 3KFXA 3PIRA 4JJZA 3CB4A 4QBIA 1WRBA 4G5GA 1ZIOA 3PJRA 1R8SA 4IOMA 4LCBA 3VNVA 2FA9A 2AD5A 1VQ9B 3PVSA 2QTLA 3CCJB 1VQPB 2WMNB 4JLKA 3UG6A 5J4VA 5IF9A 3KKMA 4PC1A 2YKGA 2QQEA 4AD8A 4FMBB 4XWKA 4IDNA 4U00A 1J90A 1YITB 1N6OA 3LBHA 4LBZA 1ZNZA 1T5LA 1DVRA 3IBGA 4B2IA 2IYWA 1YKSA 1U9IC 4IEIA 2P0EA 1WBBA 3C8UA 2GBLA 4G5SA 4JL6A 3X1XA 5KNBA 3TMKA 1OIXA 3BS4A 4O3MA 2WWIA 4E07A 3QFTA 2QROA 1LVGA 4CDGA 2ERYA 2EVWX 2QE7D 1GTVA 2QMUA 1H85A 1GRQA 2PX3A 1OXVA 3G5UA 3NVAA 3KTAA 3VR4A 2QBYA 2IF2A 3IBYA 4DB2A 3W5HA 3UATA 2XJ4A 4K81B 3I8SA 1VPLA 5JI2E 4P0TA 2BGJA 2IEZA 2YNMA 4Q4JA 4YONB 3SHWA 1G7SA 1JXMA 3KUCA 4AIIA 3QF7A 2FFQA 1YRAA 5JJLA 2YWHA 5EUQB 4RZ2A 1P62B 3CCQB 3VR3A 5FTMA 2VF7A 1G1MA 1P4SA 1XZQA 3BFKA 2H16A 3IHWA 3SYKA 1W4CA 2B6HA 3VO2A 2ZRLA 2O8DB 5C46F 4TTPA 3BOSA 3CC4B 2RGDA 5JSZA 2OXRA 3T15A 4MUAA 4K1XA 1DTSA 1E9BA 1JECA 2WJIA 4LSGA 2G3YA 4TWZA 4WAUA 4OHZA 2N42A 3OFND 2GF0A 2HCBA 1IN4A 4ZV4A 4CEJA 2AFIE 5EZ5A 4B33A 2GCOA 3ZIAA 4RD0A 2QQ0A 2V8OA 3EZ9A 3MJHA 1SKYB 2OILA 5EXSA 4TMZA 4NBSA 3KJHA 2PX0A 3P27A 2YWGA 1E9CA 3RS3A 3T1TA 3AH8A 3CC2B 4IW3B 4JS0A 5TMPA 3QF4B 3QG5A 2OE2A 4ACAA 1T91A 3QG1A 1BX0A 1KZGB 1H65A 2ZU0C 3FYHA 1ANKA 2EFCB 2NZ8A 2WOJA 4H1VA 4URZR 3SYLA 1W36B 4GDFA 1NL3A 2IUSA 1LS1A 2BCJQ 5KUTA 2CHVA 4TLAA 4A0RA 2RHDA 2ZUDA 4D0GA 2HYIC 1ZCAA 3KQNA 1Z07A 2O8EA 2O0HA 2C78A 4Q1CA 4L9WA 1UM8A 2ZJOA 3C7KA 4M1OA 1Z0KA 3PITA 5FI1B 3OZVA 2C9OA 1E2EA 2VTKA 4XTRA 3C15C 5DIFA 2F43B 3IIMA 4JLBA 4JT4A 5FTNA 1P61B 2ZU6A 3N2EA 1XJQA 1XF9A 2CDNA 2IXGA 2QGNA 2ZVQX 2ZRNA 1RJ9A 3NIBA 1FPMA 2CLDX 1E2JA 5FOSA 3LW7A 1NNEA 1JEDA 5J4YA 3K0FA 3G4SB 1JXOA 1Q20A 1VMAA 3LD9A 3EARA 1Z28A 4NDZA 4LJ5A 2D74A 1E0JA 3TW8B 4ZDJA 2ORVA 2RCNA 5JLJA 3A4MA 2BIFA 4F4IA 2ZI5A 2OK7A 2I3BA 2MSEB 2ZI4A 1PLJA 4E09A 3K0CC 2BKUA 1UMKA 4KLZA 1NY5A 3F3YA 1VDZA 4YC7A 1NLZA 1E2LA 4ZPXA 3O8CA 3IQXA 4NCHA 2NO9A 4ASUD 1G18A 1E1RA 3QEOA 2V6IA 1OXSC 4D82A 2QEQA 2FFHA 2ZROA 3SFVA 1OIVA 2LKCA 3A36A 2QZ4A 5KHOC 2E9SA 1VG0B 3THWB 4PC7A 5K8UA 4MYTA 1VCOA 4B3DA 4A15A 1CNEA 2QORA 1AN0A 3ES9A 1G19A 1FNDA 2REXB 1F2UA 4YMTA 3CZPA 4Q1EA 1AGRA 2BDTA 4Q48A 4C43A 2V55B 3W2GA 1X1RA 2D7CA 3CRRA 4CYMA 2NO1A 3CF2A 1BH2A 2GJ9A 4C7OA 2XNSA 5KSYA 4QJ5A 5GJWC 3GLGA 3BB1A 3GP8A 1F2TB 5CITA 1G5TA 1UBEA 2GHIA 3E1YE 2L0XA 2VP5A 2AK3A 3HU3A 4EQ6A 5C18A 3A4LA 1CBUA 3BB4A 3CM0A 4HLUA 2KI5A 4OQNA 4Q7LA 2EW1A 3EZ7A 1OPXA 5H59A 4NHOA 2ZUBA 3SYNA 3FTQA 4OK6A 1XD2B 3OFNA 2F55A 2VP4A 3RS0A 1UBGA 1XXHA 3ETLA 4L9SA 3HJNA 3CC7B 4LYFA 3RANA 4F92B 2WTUA 3U44B 2QT1A 2H57A 4C9BA 1X6VA 1HY3A 3X1ZA 2DFLA 2Z83A 4IVQA 4Q4AA 3OEED 5AK0A 2CL7X 2ATXA 4YLGA 4KHZA 4US1R 1VQ4B 2DWPA 4TLEA 4F93B 1KHTA 4MYUA 4S35A 1ZD8A 3I55B 4FWTA 1K5DA 1N6NA 2RGNA 4WXPA 1W36C 4LYAA 3QPUA 4F4JA 2J5XA 4A0GA 4Q03A 2C96A 4TMVA 3CRZA 2GKSA 3K9NA 4UNNA 1J8MF 3DM5A 4ILEA 4O0MA 5LBIA 4TLBA 3REFA 1JNYA 5FBVB 2PIAA 3B85A 4DDTA 5DN6D 4IVRA 4PFSA 3Q7QA 4RD3A 1KDOA 1G5PA 2VYQA 2QN6A 1Q1EA 3T5DA 3U7FB 3IDQA 5B64A 2UVQA 1VG1A 3T1QA 1EGAA 2JASA 2HMAA 1Q7YD 3OJXA 3ZH9B 1SXJD 2GTPA 1TAGA 3L0OA 1R7RA 2ZJ2A 4JSTA 5E7MA 4BZPA 4QKQA 3R9XA 3MMPA 1SULA 4M2LA 1GKYA 4B76A 4BFSA 1R5OA 1KIMA 1EXMA 3PENA 1IHUA 5BYJA 1WMSA 3KJIA 1RC8A 3K8YA 1ZP6A 3DVLA 1W5SA 4D81A 1IXRC 4Z1MD 1L4YA 1QHIA 3VTKA 1ZW6A 1XFAA 4PAMA 3U60B 1II8A 2Z43A 3B9PA 4D6PA 3IIKA 2R6AA 2QPAA 4R2IA 2V1UA 2CJWB 1VQOB 3FKSD 5TB5A 4R71A 1KJYA 1KRHA 1OYWA 2GK6A 2ZJYA 3DOFA 2YVUA 3GLHA 4WW0A 2JLYA 1Z0JA 3W5VA 4LHWA 2DY1A 5EMNA 2QU8A 4LC1A 2QGZA 2E87A 1J2JA 4URYR 1FTNA 4DCUA 3T5GA 5FBRB 1YZLA 3NG1A 2WJYA 4IJMA 3LH5A 4PO8A 5EXPA 4F7WA 3EWSA 3QXCA 4MH0R 3SI7A 1D2MA 3SZRA 1F60A 1VQ6B 2O0JA 5HPYB 2IC5A 2J0SA 4GZLA 1DAGA 4LV5B 4NMMA 5FL3A 2TMKA 2BMJA 1G8FA 1VG8A 4BLRA 3RAPR 5ELXA 3RRNA 3C5HA 2IF0A 4Z8XA 3TAUA 3LXRA 4PSVA 5F2EA 1TUEA 3F5FA 1Z63A 3LBIA 2R9VA 2QI9C 3EC2A 2GRJA 2KBEA 1S8FA 5CYOA 5JWRA 2JLZA 4YALA 1G8GA 4Z54A 1U94A 1GRRA 4HE5A 3WBKA 1US8B 2BMDA 2AFHE 3CIOA 1XZPA 1I4TD 1TL7C 4FWIB 1VHTA 3I8XA 5UKDA 5E7JA 4F4CA 2O0KA 4OQFA 3QOFA 2GEDA 4OI1A 3OZWA 4P6VF 1Z47A 1T3SA 2VNIA 5AJZA 3UKDA 2ZYVX 3IPXA 1AZSC 4QL3A 1KO5A 5B2ZA 1I4DD 2OFWA 3I56B 1E3MA 2IWHA 1E9RA 3TQCA 1ZM3A 2PEZA 2DFKB 2V54A 3ASYA 4B3FX 2ORIA 1AGPA 2BEKA 1B0UA 2YV5A 1GR1A 3GFTA 5SZHB 2OLKA 1QHGA 3V9PA 5JEEA 1XMSA 2PMDA 2DWOA 1XNJA 5BN3A 3VQTA 1U81A 1MO5A 1OF1A 4B6FA 221PA 2J7KA 3CCRB 3OEEA 1E63A 1ZUHA 3KJEA 5CM8B 1JPJA 2O8BA 1O3YA 1CULC 2EFDB 1UBCA 3TRFA 4KODA 3IILA 4B35A 1L8QA 1VQ8B 1ESNA 2GK7A 1VHLA 2G77B 3JZAA 3UWOA 1XMVA 3M0EA 3THXB 4ARZA 2OCYC 5JECA 1Q44A 1XCPA 4XSGA 1DAKA 4CEIA 5CB6A 3V76A 3K0EA 1YJ5A 2FH5B 1SVOA 3OIWA 3VKHA 4PQRA 5DN6A 5L8VA 1RRPA 1A8PA 5BWMA 2GDJA 2ZRBA 4A2WA 4DSNA 5G41A 1GAWA 1E79D 3L0PA 3G82C 1E2MA 2GNOA 5KNCA 1QGYA 4P31A 3CONA 1W2HA 4NPHA 1G4UR 1E69A 4MGIR 4BZXA 1EP1B 1G64A 1GVHA 4M53A 1UADA 1UEJA 2Q9AA 2GF9A 3CH5A 4IVPA 2IYLD 2P3SA 4JLVA 3N5CA 3RSLA 1ZM2A 2BEJA 2VA8A 3CX6A 4JLAA 3ZLJA 3T12A 2BBSA 1UAAA 1UKEA 4GMXA 2GEUA 3FOZA 3QVVA 3CMAB 1VQ5B 2BKEA 3LXXA 2X1VA 4Z1MA 4EIWA 1T3LA 1TPZA 2YZ2A 4QC2A 1VCNA 3AP3A 5HZHA 1KY2A 1JJ2B 2LKDA 2V9PA 1KMHA 2A5YB 3QVUA 3FKSA 1CRPA 1S2MA 1PLKA 2Q6TA 1T8TA 3ASZA 4LYHA 1EK0A 1A1VA 2A30A 1OGJA 1EFHA 621PA 2ZANA 3A58B 1X8JA 5DISB 2EFGA 3U4QA 4DCVA 4YQFA 1HT1E 2GESA 2X2EA 1KKMA 4DLSA 2K5UA 4BECA 4U02A 4TSFD 1HT2E 1XDBA 2BOVA 2ZSFA 4CEHA 1AZTA 3EWAA 1S72B 4IFEA 4RFSA 1OIWA 2NO6A 1J9ZA 2ERXA 4LUCA 3R7WA 2QY9A 5BXQC 5L3SB 3GJ3A 4PO1A 3S1AA 3QBVA 2XSZD 3BAFA 3QSYA 4GMDA 2NGRA 1GFIA 1OFUX 3KKNA 4O25A 4S2EA 1W5TA 3ZC3A 1XEXB 2W6IA 4QG7A 3CH4B 3A1VA 2G9NA 1VYTA 3WYGA 4QBFA 2IUUA 4BLQA 4EJSB 1Z6YA 4JYCA 1NBMD 1G6OA 1L4UA 2VNHA 2X2FA 3I73A 3LO5A 1EESA 1J99A 4A0HA 5SZKB 3TR5A 2VRWA 3LX5A 2FWRA 121PA 1CJUC 1PUIA 1W87A 3K70D 1NJID 1QZXA 4V02A 4Q1AA 5AJWA 3CD6B 2IYVA 2IS2A 3FJOA 4IRUB 4DLRA 4Q4HA 1BMFD 1U99A 4HUQB 4OHVA 4DBLC 3I1FA 5BYKA 1AA9A 4C0AC 5CIWA 2JLWA 1P2UA 4NCKA 2J7PD 3HP1A 5HKKD 3CUEF 5A5GA 1VQMB 4TMXA 2CCKA 5AN9A 1JR3E 1OKKD 2NTYC 3QXHA 3ZD7A 5JFGA 2FDCA 3CF6R 3V4FA 5FR1A 4DLWA 3TW4A 2ZRDA 3AVYA 3VU9B 4D0NA 1KI1A 1SVMA 3VR1A 5FOVA 1R5NA 3TVDA 3ZQ6A 1NIJA 2V4ZA 1G7CA 4DDVA 5C1BA 1DDGA 3U61B 4KFRA 3OEHD 5AUOB 2JLXA 3BFVA 2CNWD 2BBOA 3WMGA 4V0NA 2F1HA 4XSHA 3FMOB 3GLGE 2WAYA 2B21A 5HCNA 1MH1A 4XIGS 2VP6A 2CK3D 2LWIA 5EJEA 1ZNYA 2I4IA 4PHTA 1NN0A 1R0ZA 3RVBA 3RC8A 1QHHA 1WA5A 3CX7A 5KU1A 1AKYA 4PAOA 1G3MA 4Y0VA 1OH7A 2CLSA 2X3UA 2HF9A 2ZSBA 5B58C 1C9KA 1YJ9B 1F6BA 4QNRA 4AYTA 2VP9A 5EE0A 2QAGA 1KK1A 4C2UA 4YAOA 1N2CE 1Y63A 3RYTC 3VR2A 1SGWA 1FZQA 2IYQA 3O8BA 4GOJA 5J5CA 3TSOA 2VO1A 1ZUIA 1U9IA 2GXUA 1Z6XA 1Z8FA 1OJLA 2QRNA 1IB0A 2R65A 3A1SA 3FFAA 5JBQA 2ONKA 4IXMA 1FTSA 3SBDA 1NG9A 1ZU5A 4ZCLA 1C1YA 2W2XA 1JJ7A 3GLIA 5LB4A 2D2FA 3ZD6A 4ERNA 1IAQA 1M6NA 3Q7PA 2DPXA 3AB3A 2JLRA 4JBWA 3ADDA 5TVKA 4QM6A 1R5BA 4DEXA 2A5FA 2PZEA 4M9QA 2ZRPA 4KFUA 4BRUA 1E2FA 4Q9JA 1M7HA 3CRW1 4MRPA 4TQUS 4HDOB 4AF6A 2LCFA 2ZRCA 3W2HA 4KBFA 1S3SA 2F9LA 2WWWA 2HXSA 4FMDB 4A1FA 4BPRA 1M2OB 1GVNB 1P9WA 1JPNA 1L7VC 4Q9KA 4QGGA 5KSOA 1LW7A 2GPJA 2FX3A 2QTZA 1ZCBA 1BS1A 1GKIA 1QRAA 2DR3A 2MMCA 2X19A 4LRWA 5FPHA 2CVFA 1Q3HA 2FNAA 4Y9UA 4PQFA 2ZS9A 4OHWA 4EJSC 2ZSAA 2JEOA 1ZM7A 3I72A 4WZAE 4GP6A 2AWNA 4HZIA 4JLDA 4A6PA 1H8ED 4G1VA 4V0LA 1EFUA 3ZBTA 2FPLA 4B34A 3IIJA 1ZM9A 4TTQA 4PGOA 4FCWA 2ZQ5A 1VQKB 2QPOA 4DLUA 4L5BA 3SU8A 4DT1A 4ESVA 4QRHA 2IYTA 4LHZA 3WHLA 1MRNA 4G5QA 3W5JA 4MDFA 1F20A 3T1VA 2QMEA 1KD1D 2B7BA 5D3QA 4XD7D 3PCRB 1BMFA 1HUQA 4B3CA 3KB2A 3GCGA 3PQCA 5D3MB 1XTSA 4HE6A 2H8KA 4TL8A 2ZEJA 4N1AA 1EFCA 4TYWA 1Z3IX 1DEKA 4B2PA 4C0LA 4KSBA 2J7PA 4YMVA 2PCJA 4IDOA 5HKKA 2J0UA 1JI0A 3P4XA 4DLTA 3KUDA 1G5RA 1GL6A 2XGJA 1OKKA 1ZAKA 3D31A 3D3QA 1IXZA 4W7SA 2VF8A 3FWYA 4WIAA 5FBWB 2XNCA 4UXHA 4DCTA 1CF4A 2GZAA 3EIHA 5C4GB 5SZJA 5KNDA 1KMQA 2NO0A 2WICA 1E2HA 2PJRA 2VNJA 1VTKA 2YWFA 1Z6GA 3DO6A 1QX4A 3L82B 3L43A 3W5IA 1ODFA 3OEHA 2P2LA 2CNWA 1XWIA 1Z2CA 4F38A 3RS5A 2OCBA 4ZCIA 1FX0A 2GJSA 4EPVA 2BM0A 4M9XA 5CJ2A 2ZI3A 2CK3A 2GXSA 4KBGA 1MKYA 3THOA 1WB9A 2DFTA 1HTWA 3LLMA 3OESA 1GSIA 4MKHA 3KDSE 1CR1A 2BPOA 1W48A 1YIJB 2CCGA 2ZE5A 4YMUA 4R7ZA 3EASA 1IN5A 2WWXA 5BN5A 4BQSA 4LV8B 1QDEA 2FEMA 4HAZA 2Q3FA 3SOPA 3GJ0A 2O52A 1D9ZA 2JIZD 1N0WA 1II9A 4GSYA 1W2BB 2G0TA 3B2EA 4MGYR 4NTZA 4CT5A 4DCSA 4D0LB 4JZKA 2QTHA 2NPFA 1S4QA 3KXIA 4TLCA 5DLQC 3RRYA 3TLXA 4F91B 1T0HB 1WP9A 1QHYA 2HUPA 4KFSA 2V3CC 5E7IA 1G41A 2CCJA 1OH5A 3AM1A 4PO9A 3LVBA 2ZRJA 4PANA 5CK4A 3CNLA 3SR0A 4ITRC 1U0JA 1Z0AA 4DB4A 1BKDR 3BD9A 2FF7A 1E9EA 4GI7A 2HJGA 5FL7D 3AVPA 2F1JA 4XVQA 1ZNXA 4HB4A 1KO7A 4PSKA 3MWKA 4EFMA 2O8DA 5EQTA 3W6OA 4JIMA 2G0NA 4QHSA 4V0ME 2WWFA 3BE4A 2FGJA 4XWAA 3TH5A 1OFIA 1P2SA 3JQQA 1BJKA 3B78A 1GZSA 1W49A 4F7DA 3IQWA 3L0IB 1E62A 4X8LA 2NPIA 4PX9A 2R6GA 2AN9A 5CDFA 3KTAB 2QBYB 2IYRA 4HB0A 3U3OA 1TUIA 1RIFA 5LDDC 1H8EA 4LJ6A 1ZNWA 2G1JA 3NBXX 4TTRA 4W5JA 3HU2A 2PLFA 3MWJA 4PZLA 3VAAA 4ZIRB 4Q4JB 3KQUA 1XPUA 1EFTA 3NC0C 3Q5EA 4LBWA 4MRNA 1O87A 5HR5A 1RRCA 5TV2A 4B3XA 4JVLA 2ZE8A 3MG9A 3T06B 1D8TA 3B6EA 1E2QA 3I3SR 4QBHA 4XD7A 5ANRB 5JSZB 4MYHA 2P6NA 2OTJB 2A5DA 2QA5A 2RAPA 5J40A 4URVR 1YZUA 2REOA 3E5HA 3SN6A 2JJ8A 3WRYC 2XXAA 1SVKA 1VCIA 3CLVA 4JLMA 4LJYA 3UMFA 4CEJB 3P26A 2CL0X 2GCOB 4X8MA 4AKGA 4ZKEA 1KSHA 2F43A 2WVJA 4E03A 1LS6A 4Q7MB 5FUXA 2ZSDA 4Y0AA 3VKWA 1V5WA 3NDBB 1CR2A 3FVQA 4KVGA 4DSUA 1I7PA 5GV8A 1IQPA 4DJTA 1XEWY 5H68A 1GJRA 3MCAA 3H1TA 1KSGA 3CW2A 4PC6A 1P7CA 2GETA 4PPNA 4ZO4A 2F1IA 2WWGA 4OKSA 1QGAA 2YWEA 4HLCA 3KXKA 4XH9B 2WSSD 3SBEA 4W5HA 3QY0A 4D2IA 1OB2A 2FSGA 4M9ZA 2O8EB 2XX3A 4JT2A 2ZAOA 4PTLA 4B75A 5TY0A 4OI0A 3W2IA 1KAGA 4PSAA 1CU1A 1ZM4A 4LJ8A 2WBLC 2FN4A 2XITA 4A0FA 4H1UA 3V4RA 2WKQA 4RJLA 5GV7A 2BJVA 2OXCA 2XJ9A 1W47A 3N2IA 5H70A 1B23P 3RWOA 4BZQA 3P20A 2NG1A 2UKDA 2PZGA 4FD2A 3A1UA 4RFVA 4RD6A 4FCVA 1YZNA 4WZBE 4AG5A 1KDPA 1GO2A 1QG4A 1A2BA 4POAA 4DZZA 1TEVA 3Q85A 2ZRGA 4O2RA 4Q5IA 3ND8A 4N3GA 4J0QA 2FJUA 1Z29A 4LPKA 3B1XA 1P72A 1AQYA 5JZVA 1MRSA 3K0FB 3NH6A 4BFXA 4YHBA 2JIZA 5HZKA 1KI8A 1KY3A 5EE9A 3RRMA 3W6NA 4BEBA 3AVUA 5JRJA 5JJKA 1CEEA 4MDEA 4YDSA 5AR1A 1Q21A 3AF0A 5FOUA 2X8AA 1NVWQ 4GFDA 4OK3A 1NJGA 1E4VA 2ZYTX 1PLLA 4K46A 4KAXA 5K8LA 1T4GA 2QE7A 1W35A 4DLYA 5K8IA 3FFBA 3K09A 3TJZA 4CF7A 4GNKA 3BH0A 4DWJA 4JBXA 4TL9A 2O8CA 1H42A 2Q21A 2RH5A 4GRAA 2RKOA 1R0WA 3I5YA 4CRWB 4OJQA 1FP6A 3LY5A 5IT5A 1N6KA 2CEAA 5FTLA 3A4NA 1CS4C 3OIYA 1X1SA 1CXZA 5P21A 5LD2B 3CRMA 1QG2A 2GBLC 3ZQJA 1KSJA 4TZ6A 4BLSA 1NRJB 3I5XA 5BW8A 4URXR 3D6TB 4LHYA 4Q9IA 4X8OA 5DH9A 3ZVMA 1CQXA 5J47A 5IHPA 1OGIA 3VMFA 1XD2A 1S0UA 2NIPA 3GQBA 1N6LA 4Q7JB 2IHBA 4KLNA 1GAQA 1F2UB 2XOKD 1Z6TA 4MYCA 4WQMA 1QFZA 1LF5A 1ESMA 2JATA 1EG7A 1MO4A 2OBNA 2HF8A 2RB4A 4C7OB 2FSIA 2WKPA 2H1LA 4OQXA 2DYKA 2H92A 1TQ6A 1IJFA 2OESA 4EQ6B 2DFNA 3CWQA 2AHOA 3HYTA 4IOKA 3RDPA 1MO3A 3OZUA 1OHHD 4ZI3A 2B5OA 1TF2A 4URWR 4NP6A 1I2MA 4NYIQ 1W2GA 1DO2A 2J0VA 2Q3MA 4OHYA 4PPFA 3RRZA 4DHEA 3QE0A 4EFNA 5JRZA 3B8HA 3H2YA 1JB1A 3ADKA 2RGEA 1IN8A 2XZOA 3RSOA 3MSXA 3FPAA 3EZ6A 3BWDD 2PL3A 1W1WA 4QXAA 4BLOA 1FQJA 4A8JA 2Q0HA 1EWYA 1M8PA 1PUJA 2AL7A 3G71B 3U3JA 1NG1A 4B3BA 1HH4A 3X1DA 2HDNB 4QJ3A 3WNCA 1R0XA 1VYVA 1PV4A 4HYYA 2O5VA 2ZIAA 3K9HA 4ABYA 5CDFE 1TTTA 1W4BA 2ATVA 5E95A 1G8HA 3A8TA 1U8AA 3ZS9A 2A3RA 1RZ3A 4CW7A 1GUAA 3JZMA 1AS3A 3K9LA 4YAWA 1DO0A 3VHXA 721PA 3T35A 1W7AA 4BGDA 3Q3JB 4IOLA 5TDHA 1KGDA 2AX4A 5JCZA 2WHXA 2BWJA 3RNLA 2XNJA 4KYIB 4TYPA 2FFAA 3LRPA 2F9MA 3ZZUA 1D9XA 1E6CA 2W0MA 3BJIC 2QP3A 4C30A 4NU0A 3ZGXA 4ASUA 1Q1ZA 5JHGB 1XTQA 4CIDA 4C3ZA 3GLFA 1EFRD 4JKYA 3E20A 3NHAA 3FPKA 3KFVA 5GVRA 4ZGQB 2XB2A 1II8B 4M1TA 5KPDA 4YMSA 5KYKA 1RVDA 4WZ6A 1RE0A 2JLSA 1U0LA 2W83A 4JVSB 1DDIA 4XTCS 2HV8A 2VSOA 2IYZA 1S9DA 1YJNB 2HYDA 3GLHB 3BC1A 3MWYW 5GVSA 1MABA 3CBQA 4ON9A 4QNMA 1WQ1R 4I4LA 2IYYA 1RW4A 3F0TA 4BFYA 3FGNA 2ZREA 1NMXA 2XNDD 3QFSA 1IOZA 3IO5A 1N5KA 2KJQA 2PT7A 5TR9A 3ICEA 2FPMA 4LK2A 1AQUA 3GJ7A 2JLUA 3WXMA 2BC9A 5LD2C 4L16A 3VR5A 4TLDA 5EUMA 4YDHB 4TYNA 1YVDA 4ZI2A 1F5NA 2VHJA 4MRSA 1G16A 4HZUA 4HI0E 4P4SA 3DOEA 5GJCA 2CHQA 4AYWA 3TUZC 4N3NA 2GXQA 3U5ZB 3U7HB 2EU8A 4Q1FA 1AS2A 5CLQA 4UKDA 1DPFA 3GPLA 1JALA 2Z6VA 1GNRA 3KL4A 2JCSA 3T61A 4TQ9A 2DERA 1FDRA 2VBCA 3NEYA 2CL6X 1K9MD 4R2HA 5M04A 5IRCD 3TSWA 3U7EB 2MMGA 1WXQA 3H84A 3U3RA 3AEZA 1RYHA 2MSDB 3MHPA 2VH5R 4AWXA 3W5UA 1P9NA 4V0KA 3M6AA 4TYYA 3AP1A 4HLUC 2IYXA 3THXA 4HB2A 4XJXA 2IL1A 2QT0A 2BV3A 2EYQA 4HB3A 4RY2A 1ZU4A 2C77A 3LV8A 5FOXA 3ZDQA 5JCPA 3GJ8A 2EYUA 1DG3A 1BOFA 1P2VA 2CMKA 1YZTA 2H5EA 3NC1C 5LPNA 3FHTA 4PHFA 4LY6A 1VCMA 1MV5A 3PUWA 1G20E 2GZHA 1YZGA 3TR0A 2ZAMA 4A36A 2PEYA 2J41A 1D6JA 1G3UA 2FMXA 2NZJA 1YR7A 1B2RA 2KWIA 2VHUA 4I81A 1E1QD 4V03A 5AWFC 5AUPB 3LQQA 4BFZA 5L3QA 4OHXA 2RGNC 1Q86D 3FDIA 3T34A 2PBRA 1SXJA 4RZXA 5TARA 4D4MA 4FK8A 4RKFA 1Q82D 4FINA 4DKXA 1GILA 1W0JD 2I1QA 2ORWA 1L2TA 3DEFA 4KYUA 4ARZB 4JBYA 421PA 1XU4A 3WMEA 3CR7A 5CYPA 4NKRA 5FA6A 4CEIB 4ACBA 4DVGA 2A7QA 5GADl 1NVVR 1XXHE 4GP7A 5CK5A 1E9AA 1ONBA 1UKZA 2QA4B 3QKRA 1D2NA 2ZS7A 4HAXA 3Q8XB 4LGMA 1E2DA 4JMPA 3X2SA 1W44A 3FMFA 4KVAA 2VL7A 2WPDD 1G9XA 4PQYA 2RGCA 3SJZA 1KYIA 1OXXK 1R0YA 1Z0DA 4DQKA 4Z51A 4Q1BA 1ZBDA 3B5JA 1KO1A 2EQBA 3NWJA 3UMRA 1EX7A 2H7VA 1BIFA 1R8QA 1JEEA 1OE0A 4B47A 2OBLA 1EFRA 2QSYA 3VNUA 2YJTD 3U6KA 2WV9A 5AJVB 5KDLA 2QMHA 2FSHA 3RWMB 1KOFA 5L3SA 2ZI9A 3RHFA 1KMHB 3QIAA 4R9UC 1A82A 4P33A 1Q22A 1KK2A 1IY2A 1YR9A 2BMEA 2N1BA 2YC4C 2G83A 1KI4A 2HJVA 4MKFA 2GJAA 3LVQE 5DI3A 2FU5C 2R6HA 4AKEA 4HAVA 5CM9C 2XNDA 4FIDA 3H86A 4NYJQ 3ZJYA 1E0KA 4KXFB 2YYZA 1COWD 4QHTA 4LPSA 3P32A 1W46A 1OFHA 2JJ1D 2QL6A 1DELA 2HCJB 1ZC4A 1E64A 4M1MA 2BHRA 3AVQA 5KTYA 2Q9BA 3HYRA 4G1BA 2QPTA 2AD1A 3DL0A 4U7DA 1G3QA 2UZ3A 4RFSB 1ZVQA 3R7WB 4PHGA 2C98A 4HUQA 5A0FA 1PZNA 2PT5A 3GJ6A 4G01B 2J87A 2NOAA 1CP2A 3MFYA 3GLHE 2QTFA 1BX1A 3CKLA 3S1AB 3P1JA 2VNKA 5DGXA 2X77A 1HEIA 3QXJA 2ZETA 4MRVA 4QOSA 1TMKA 4DLXA 1XCMA 4IHQA 5THXA 4DIEA 2WJHA 2CBZA 5JS7A 1DG1G 1OYYA 3SHFA 1DADA 3Q72A 2OFOA 5TXGA 3PEYA 1FUUA 4HUTA 4A92A 4TQAA 3THYB 3RS4A 4D26A 4KFTA 4B48A 1N5JA 2FEOA 2R6FA 2VQSA 1RKBA 5G3ZA 5EXXA 3I92A 2H18A 3QPVA 5C2JB 2QM7A 1FQKA 3IEVA 1TEXA 4TYQA 1OXUA
chains in the Genus database with same CATH superfamily
1M0TA 1NVDA 1E1MA 3LRTA 2R00A 4ZAGA 4TX1A 5KU7A 2Q1WA 3TLGB 2VZ9A 4G1EB 3LNCA 3R8FA 2Q2NA 4QVGA 4QQRA 1MJGM 4GD3Q 4JEMA 4N3AA 1JTFA 3WGOA 5C80A 5JALA 3ZW9A 1YT5A 4WLUA 5CDSA 4FCTA 1JEYA 1MGPA 2GN6A 4G5RA 1POWA 4XDGA 2JARA 1E79A 4AS2A 1RWNA 2ZBGA 4ZKDA 2X58A 1O0CA 2CMHA 5TRTA 3GJRA 4AZWA 9MHTA 1YR6A 4WXRA 1CDDA 1CDOA 1NIPA 1U2QA 3BMOB 1BE6A 2IYFA 3WQRA 3SBXA 2RSLA 4DCGA 3NHKA 2AKYA 1KO8A 1S1CA 5LP6B 1UDWA 4YP0A 1PWZA 5F5XA 2EAUA 1K6MA 1MHPA 1FFGA 4U7FA 5L3RA 4BGEA 3UPUA 4K6GA 1CR6A 4NYIR 5ALMA 3FVRA 4B43A 3U2QA 2VHTA 4FXPA 4XSVA 4ZCMA 3R20A 2O0LA 2EKLA 3G6WA 5LYJB 3A4IA 3BXGA 3DOIA 1E3JA 5F3WB 2Z2XA 3P45A 3L01A 4ZAZA 1QHHB 1FXWA 1JZQA 4AP5A 3NATA 1YX2A 3JSXA 1BQEA 3GAZA 1H4QA 1PG2A 4PQEA 4YCLA 1KMNA 2JIDA 1FXWF 3LAWA 3I32A 1PKEA 1G17A 4RVOA 3VSDA 1XB2A 1U4SA 5HBRA 5HJ7A 2IH4A 3BTSA 4QGFA 3Q7EA 1SELA 2CV2A 1H8HD 3FCAA 3GEHA 1NN1A 5DS0A 1F38A 1LU9A 1YZKA 2AX3A 2P78A 4XFJA 4V0RA 2JFWA 1TIBA 3T51B 1LSUA 4ZOLA 1PT7A 1XWWA 1Z7EA 3WGYA 1E9DA 1NI4B 2D62A 3OIUA 4D3DA 5KNBD 1ISHA 2PKRA 1CKEA 3CX3A 3KXLA 4D9KA 1DBIA 1N25A 1PV2A 4YLEA 1OY1A 4ZOLF 1XN4A 4JJ7A 3RU7A 3PCTA 4YMGA 4X07A 4L0MA 2YVLA 4P2BA 4P3YA 1JF8A 1N9GB 1QYDA 4W4TA 3UMSA 2RHTA 3JAKB 3K4QA 3V3KA 1XDGA 5FWXB 4OBEA 1RYBA 5HS4A 4L15A 1FOEB 1Y7TA 4PS0A 2TMYA 1LZKA 3G68A 4LHVA 4Q47A 3RG8A 4MW4A 2IVZA 3WAGA 1IRXA 1COWA 2E1RA 1RQGA 1T4BA 2AJ8A 2H5IA 1P5ZB 3EIWA 4FGKA 4PLGA 1YVEI 1XOIA 4WFIA 3WSWA 2ZRHA 5AJUA 2CNOA 5B4TA 5LQJA 3A4YA 4HPJB 1VKJA 4WNIA 2O2XA 3OJLA 5KJEA 1FU7A 2R7MA 2ZP1A 4MJ7A 1VQNB 1UK8A 3BRQA 1J21A 1KA9H 3TRIA 4CFYA 3OQNA 3T3NA 3W3AD 1V26A 2N0SA 5TPZD 4DLBA 4DQLA 2KYRA 1W36D 5G53C 3PUYA 2RD2A 2V9CA 3F1LA 4O4HA 2C5BA 4OXNA 5FO1A 3GPCA 1V4NA 4G0ZA 5ELLA 4O4HF 3KWLA 1KQFA 4OBBA 3LT1A 1L6IA 4PXAA 3S5UA 2R79A 3I61A 4Z0NA 3TD2A 2IEAA 4EPXA 1AGNA 1Z06A 5K3DA 1GQYA 3GXOA 1XZDA 3G1UA 4W8OA 3EZYA 1Q1GA 1T5IA 5K05A 1XN1A 3F4LA 1U63A 2RBEA 4WLFA 5JW6A 3NVKI 2LR0A 1DE0A 2FPOA 2SKCA 3OOHA 4H31A 4J91A 3FWHA 4IO1A 4YRZA 1BDJA 4Q3NA 3DEAA 3R5SA 2PD4A 2ONJA 5CA0B 1VJDA 2EZUA 2I8LA 3FTDA 2BGWA 2AA3A 3BXPA 3MGGA 3PXAA 2W2VA 3G0CA 2QV7A 2V4DA 3C6YA 4RJIA 1XPRA 1GTRA 3NEPX 2APJA 1EVEA 1X14A 4A8HA 2OV3A 4TVOA 4G81A 3AP2A 3TQIA 2ZL5A 1SXPA 5HDBB 1K7FB 1PGPA 2IUTA 1ZOOA 3BHJA 4YK7A 4BO3A 2BSAA 4FFRA 2UYOA 5E6SB 4R8KA 1P8JA 2XB4A 3U4AA 1NNLA 4URUR 3RVPA 3K0SA 1UT5A 2X8KA 4LZNA 4YAIA 1LDMA 3QFFA 2ODBA 3AR3A 3E9ZA 5CFMA 5ETJA 3N8NA 4DC9A 1JFFB 2IOFK 1NBIA 5EKDA 4ML3A 3R9KA 3ST7A 2RG1A 1YJBA 4I9GA 5ILGA 3A37A 2ZI6A 4KMOA 3RS2A 5JEDA 4G0YA 3PR1A 4CMJA 5K45A 2Q8NA 1ZX1A 3EAQA 3PL1A 4GUDA 1RKVA 2E18A 1J22A 1GCIA 1QPBA 4BVAA 3HEBA 3GNTA 2VDOB 4QOHA 2IYOA 3B5EA 4WZZA 5IJ9B 5JWOA 3PXCX 1W0CA 4YBRA 4RDXA 1J1UA 4H77A 3PHBE 2C99A 2YVQA 4J0GA 2V3WA 4Q21A 1JBQA 3F3SA 1ETUA 3PC8A 3VPAA 3KZCA 2VKQA 4FP9A 2A78A 3JWIA 3ELBA 3THSA 4RC9A 1KRWA 3ZLBA 4Y7CA 1CHDA 2OV4A 4ZT2A 4QVKA 4DM3A 1YVPA 5FB3A 2AMYA 2BGGA 5JBIA 1HKHA 5KWIA 1MAHA 5JMTA 3OW2B 4H0FA 3ROFA 3I2GA 4Y6PA 5EERA 1Z8HA 2C04A 2FMIA 4JL8A 5EKXA 2JBAA 3PRYA 5C5EA 1I33A 3KHUA 5LU9A 4WNYA 2JDID 2NUPA 5E3HA 5KYXB 3IJ5A 1Q0UA 4DDWA 2P4HX 3CRVA 1OA0A 4BO2A 4TMKA 2XRFA 3WB2A 3UC5A 2AG1A 1FVHA 1G7TA 2IYSA 3MRSA 1A4RA 3AFOA 2EWWA 2F3QA 3P97A 1NY6A 4REQA 3HYLA 2WLSA 1DHTA 4PU0A 3U56A 4W8HA 4WCFA 2OBTA 1QMGA 1L3CA 2Q6IA 5ES3A 3ZZTA 1FJ2A 3NP7A 4FKZA 2GD1O 4IICA 1WP6A 2PL1A 2RONA 5DCUA 1HNXB 3OP1A 1PL8A 3PG5A 1VLMA 5CEEA 2O2CA 2ZS8A 1PCXA 4WACA 2OCDA 1R12A 2YJNA 4IRXA 3O8DA 3U1BA 4Z53A 1VE5A 4MKZA 4DY6A 2FQYA 1JT9A 4UREA 5KVSA 3GGOA 2VHZA 1J5XA 3OC0A 4RSGA 5CXQA 2W2TA 1YAHA 3BGSA 3Q6NA 3LHFA 5FAKA 3GLIE 4Y30A 2VRCD 4DIFA 1BOOA 1I6LA 1Y6ZA 1S6YA 1T3HA 3JQBC 3TWOA 1OH8A 1NLFA 2IBMA 4LRQA 2D7DA 5HK8A 2O7QA 1Z7BA 3OQ1A 1PE0A 4HDRA 4WUTA 4AJOA 1C9EA 1JLLA 1SVLA 4KCGA 1IEWA 1PFVA 2C3PA 1JQBA 5A4KA 4WN9B 2XTMA 4IFBA 2R2AA 4BC1A 1FS4A 3CCSB 5ICEA 1CF9A 1E2IA 1A9OA 1L0BA 3K70C 1TPYA 4XONA 2ISCA 2K2WA 4UAJA 3LP5A 2ZT5A 5J4LA 2JGNA 4PPGA 2PNJA 5FX2A 1Y0BA 4N48A 2EKQA 3PXBA 4HQ0A 4UJ3A 5CLGA 3S44A 4B2YA 4CMCA 1LJ8A 1T2VA 3DTNA 3LSTA 3R2JA 4BO0A 1Z0SA 2KBFA 3KKEA 5BMVA 3LKZA 1NSTA 4RS4A 5CT8A 2CSXA 3LY8A 3LKDA 5A02A 3ZBUA 1DV2A 4PVCA 3WX0A 5BMVF 4TUYB 4WEOA 3HWSA 4KLCA 1MO6A 1TKBA 1QG0A 1U2GA 1GGEA 2C1ZA 3LL7A 4OATA 4ZO6A 2EGHA 4ZDKA 5JFTA 4L4ZA 5NLLA 2J3IA 1D1TA 3UMGA 3UW3A 5BT8A 3E3AA 2BY4A 3MMXA 4YAFA 4LZOA 5D84A 1G21E 3HYSA 4XD2A 2J07A 2FZCA 3OPYA 1SEPA 3CR8A 1YSCA 3GGDA 4JI8B 4AJJA 4AZ3A 1T2AA 2XYVA 1N06A 4KKXB 4TWJA 4QGHA 1M5RA 2Y99A 1EGQA 1ZDMA 2AXEA 1JHRA 2QIPA 2CFRA 2VYVA 1CJBA 4KACA 3RO7A 3OA0A 2IZ6A 4JIGA 4HGOA 4JOBA 1KMMA 1R1DA 5FA8A 3CWCA 1V9CA 1BH6A 2Y71A 1G1AA 5DYNA 3WIUA 1DRVA 3CCVB 1VBKA 5KBYA 4G4SP 5G4LA 1N8NA 3QK7A 1SHJA 4EEKA 2C9MA 4LYJA 4MS4A 3RR2A 1SU4A 4KAFA 5JQWA 2QG6A 4IFIA 5T67A 4NS1A 3ZXUB 3EPKA 1M3SA 1A7UA 2CYBA 1P4GA 3AIOA 4RF4A 4Y6OA 1QVFB 5BUZA 3TBKA 2V7QA 4PM4A 3TLBA 1Y5IA 2SCUB 4ZXFA 4CTKA 2DMRA 1N6HA 2ACWA 2CE7A 3KK0A 3RYIA 1XUOA 4MR9A 5HWSA 5CVTA 5KDOA 1NLYA 1SBHA 3HP4A 2X0KA 1ZRMA 3W5SA 5C35A 3SQMA 1VYUA 4XR6A 3KYCB 3PGVA 4UNRA 2CMDA 3ZS8A 2H1HA 1GEGA 4R8RA 2OSBA 4B5LA 1UUFA 1SHKA 4KO2S 3CX8A 1WBDA 2ZB3A 1PAUA 3KQMA 1D3AA 1EFPB 3MAAC 4E22A 2IS2A 1FA9A 5DKFA 3KQLA 2ZB4A 2SKDA 1SCUB 3PKJA 1XRRA 5C3MA 3HKBA 2OYCA 4J0CA 3D3NA 1G8JA 1Z88A 2GFQA 2HHJA 4TQGA 1HE8B 1SCBA 2H59A 2ZWVA 3OM9A 4MWEA 2CJXA 3OUUA 4YT2A 5EE1A 4RTQA 2HDHA 2QN2A 2ON6A 3UJBA 7ADHA 4D44A 1UBOS 2LXNA 3U44A 1KQSB 1NKTA 1JA1A 3O3MB 4GX1A 4ZYUA 2XUQA 4L4UA 5J35A 2C0PA 3AVOA 4B0PA 1TGVA 1QGDA 1U28C 2AJDA 2HLNA 1NW9B 2JZCA 4UNPA 4CQNA 1F5SA 3MQFA 4EHBA 4JAVC 1SG0A 3PS9A 2FMHA 2Q8QA 1JWLA 4HD8A 1HYHA 4ZU3A 3KSDO 3RUIA 4ZOAA 3L0SA 3M8KA 5DX0A 3E2IA 4F8YA 1E2KA 4GKVA 5A0TA 2CKDA 2BFAA 4O08A 4Q12A 5DYGA 3W2FA 3M1YA 1SCAA 5T3UA 3T7JA 4I8XA 3NKLA 3VO8A 3CTAA 1ULTA 1QH9A 3MCTA 1Q1BA 3H75A 4ZQBA 4ZYYA 7MHTA 1GLVA 3KHSA 5ALUA 3U26A 3TEFA 1J70A 4G5OA 3HUTA 4L50A 3WICA 5MN6A 2G70A 1KSFX 1Q0SA 2PGJA 5HK9A 1UXJA 1AKQA 3IPYA 5KTSA 4KV9A 4WZTA 2RK4A 3OLYA 2QQ5A 5T8KC 2C8VA 1KJZA 1HV8A 1PJQA 2O8NA 3M4JA 3KSZO 2SHKA 2I1VB 4Q4AB 4GE3A 4MCJA 4RTPA 3HWRA 1NFFA 3ORFA 4S1PA 5A4AA 3R6KA 3C39A 3QENA 4MO9A 4J03A 4F06A 1FZTA 1K8XB 4UEJA 1NI3A 2REBA 5U1PA 3PDUA 3RKUA 3PQ5A 1WMAA 4UXJA 1VHJA 2AK2A 5TS3A 3NBAA 1ESDA 3NUZA 1RCUA 1DCFA 1EDOA 3ZZ0A 2NM0A 1KZLA 1EFAA 1L7MA 4LJ7A 2BGIA 1PFQA 1VFNA 5ARBA 4LC9A 4TL6A 3JARB 3X1KA 1G8YA 3BYZA 4M55A 1A8IA 2FDXA 1WTHD 3MRTA 2DVMA 2NP6A 2BF7A 2WSIA 4DN6A 2VJIA 5LFAA 1KJWA 3NHBA 1EUQA 1QVAA 1KNXA 2HZ7A 4FB5A 3O73A 4U2CA 1R4AA 3UT6A 1BQ3A 3OO0A 4YMTA 5ED4A 3F9IA 4C88A 3CU5A 3MTEA 4QODA 2Z2IA 1QONA 4P3NA 3ROMA 2DHDA 2P6OA 3CYFA 3FMGA 3HR4A 2QR3A 3A3BA 2JLVA 2Z2YA 3ZVNA 4YMWA 2H54A 3B89A 4RZIA 2QUIA 2XZLA 3O1LA 1VHDA 2E4YA 2FE4A 1P73A 1IPEA 1SVIA 1Y5LA 4J49A 4MQFA 3AK4A 5KNBH 2TYSB 3R7DA 3NIDB 3O4HA 3Q4GA 3EBLA 2KM1A 2RIPA 4X7BA 2YRWA 2C03A 3MJ4A 4EK9A 1WV0A 2QY6A 3OHSX 5C1OA 5IF3A 1F51E 4ECEA 1O4WA 1P1CA 3JPWA 3O4RA 4DK0A 3LHKA 5F2OA 2PZ8A 1JKJB 2PFSA 5DTJA 1MD9A 4E21A 2V96A 5JO9A 5ARCA 2GJPA 2JL1A 1DC4A 3A3NA 2A5GA 3L0DA 3MT7A 1MT0A 1YI1A 2NN3C 3J80A 4EB8A 1VJSA 5K4AA 2R8EA 1CQWA 4RPIA 4RE6A 2JGKA 1KZ6A 1P9OA 2EARA 1WOPA 4S3MA 1EM8A 1O03A 3ANLA 3AOGA 4NMHA 3KJGA 3OPQA 4IJ5A 1FLAA 2D3WA 5ERGB 1A1SA 1NI5A 4LXYA 3I6QA 2A5JA 1ILEA 1N1GA 2UYCA 1D07A 3GLFB 2B69A 3CE9A 3UUFA 4D80A 5IC5A 3WMFA 3DFFA 1K3FA 1THGA 1AUXA 3KUXA 4QSHA 2FRDC 5DXAA 3KL9A 1L5RA 4PYIA 3FKQA 1WOOA 1PR2A 3FETA 2QLJA 4C05A 4DMCA 2NP7A 4I1RA 1MR3F 3BL5A 3QU9A 4AQDA 4OYYA 2HFJA 1TJYA 3VUFA 1WLYA 1MABB 3O8NA 4RBNA 1QFYA 3CXCB 4NOMA 2IHJA 2XAAA 3QLJA 2HWYA 3LO8A 4NYMQ 3WIOA 2WFAA 2KVOA 2VZEA 2YY5A 5G4KA 4G3XA 1KOJA 3SEZA 1L4LA 5CH8A 3TSYA 3WG9A 3Q6QA 1QRDA 3A1TA 1NU8A 2VK4A 3NXKA 2Q4OA 4IJUA 2QLTA 3IAM1 1P1FA 3H9EO 3NHPA 1TA0A 4PCVA 3A25A 3LWBA 3X1YA 4IY1A 3ZE9A 1W85B 4RSRA 2AZ4A 1Q15A 2BI7A 3MCWA 3TZEA 3HXTA 2W9XA 4HLQB 3GOQA 4QOGA 3ETNA 2FMFA 4H4DA 2BH9A 1HURA 2R8PA 2JJ2D 1PL6A 2N9UA 4I55B 4LOAA 3U9SA 5JZOA 2BKXA 3TZQA 1RWMA 4HLNA 1WKVA 2CNNA 1KJ8A 2A2ZA 2IT1A 4G0OA 1DBPA 1ZINA 3T9FA 1UD3A 3KQKA 1H9AA 2YW2A 4RHYA 4TOIA 2P11A 2QJFA 1VC2A 1N6IA 1F2DA 3GGJA 5FWYA 3CCEB 1SZPA 4KC0A 2PY6A 1RU3A 4I3FA 3O82A 4A26A 2PE5A 1DIAA 3HB7A 2QNRA 2O8BB 3RROA 2NXWA 2GEBA 2GEFA 3CEJA 2SNIE 2QNIA 1Q17A 2ZYAA 4S2EA 3FWPA 5DYIA 1NBEA 1E4YA 1RXUA 4IIFA 2AG8A 1WMFA 4I50A 1U6IA 2NU6A 3D8BA 4OQLA 5GZ1A 4P86A 2VDNB 3E22A 4G1UC 4I50F 3ZZ1A 1GKUB 1YUMA 1F4LA 3ENQA 4UZSA 3ZV3A 3DAFA 4NRDA 4E5MA 1RFLA 4JOSA 3AI7A 4FZ3A 4K3VA 3Q38A 4EA8A 4OHFA 1ISGA 3O26A 2R5FA 4QEZA 4G0UA 2HMSA 3PNVA 2DJIA 4DNFA 5LKAA 1SUSA 2W4QA 3HI4A 2ECQA 4MWCA 3T7TA 4ZVTA 1SBTA 1WCV1 1XZBA 3HDHA 2VLIA 2NV2B 3NHFA 1X38A 3KPJA 2X0RA 5CFRA 3S8YA 2IS4A 2C2HA 4V38A 3PP8A 2XTAA 1V6CA 2BM1A 2ACEA 4A8JC 2HTEA 2PKQP 1JA9A 2Q28A 3IO3A 5FFNA 3SDBA 2QMYA 3H5AA 4TXNA 2J46A 4WZAA 4B6SA 3HB9A 3G8YA 2FN3A 1YLOA 3DBRA 1FRNA 1RRFA 3KKLA 1AUOA 2P3QA 3LNNA 2EKZA 4YT8A 2OYNA 4QG3A 2J5KA 3ZE1B 1SCJA 1A9SA 1EK2A 3GDGA 3ZH2A 4U7HA 4AKIA 1HNWB 1X86B 4KKTA 3KJXA 3KLBA 3ZXYA 1T9GR 3TB6A 1TZMA 2Q4RA 5IK2A 1HDGO 4M88A 4DMRA 3U17A 4MRRA 1UQRA 4LA4A 4IR7A 3O9ZA 1LV7A 4X6LA 4I4IA 4UXIA 1ZJ6A 3Q7RA 2CGEA 3HI6A 4R81A 1NLUA 5HZAA 5FI0B 1X8XA 5AKYA 2IX9A 1QUFA 2CLFB 2DUUA 2FPPB 2OZLB 3AV0B 1OGYA 4OUKX 4YJGA 3VISA 3WWOA 1PD1A 1QVGB 2AUNA 2VNAA 5FR2A 3ZTWA 4YT4A 1MHTA 1Y1KE 3N3AC 5K3FB 4DV1B 4AT1A 2D8MA 3LA8A 4N49A 3RS7A 1UKYA 1C2TA 2ZJ8A 3NFRA 2JGRA 4AO8A 1MC4A 2Z8ZA 3FGOA 1RYZA 4KDRA 4XJTA 5DX1A 5BRNA 5LNK6 4XCVA 5LJIA 1MVLA 1TADA 1T9GS 3JD3A 4O4JA 4BFUA 4PAWA 3WMWA 3EULA 3L41A 2RC6A 4O4JF 5FNZA 2WKRA 5E1OA 2J33A 1VYHA 1F9EA 5EJ9A 1KEKA 1LPNA 1VZ3A 3IHKA 5TF0A 3E23A 2VPXA 1I3OA 1QHXA 3VFDA 1UBFA 2W6JA 4PINA 4EGFA 1NW8A 5F12A 2YV1A 3O1HB 2OTCA 5BSGA 2Z5GA 5DI3B 3TTXA 5E6RB 3OIVA 5DO9A 1KS9A 4I8DA 1L1RA 4IIDA 5CIQA 1SU6A 2VHQA 1ZGHA 3T1HB 1L1EA 5LQNA 4P83A 1O4VA 5AW2A 2Q5OA 3O1IC 5LM3A 2QTBA 1T8UA 2NVUB 4UVEA 1I4LD 3EY4A 4Y2HA 2OO7A 3EBPA 1H5UA 1F7UA 4R2XA 3TZKA 1UEIA 2D5LA 3E81A 1MXHA 4JI4B 2OVBA 5K0BA 3TOSA 3UK6A 5C4MA 3BSFA 3AHHA 5IDYA 5J63A 3N2GB 1FUKA 4IYJA 4EGAA 5EP4A 5AHWA 2Y0CA 4BUZA 1QF7A 4PG7A 2XNHA 2IW3A 4AY4A 2XB9A 2LUOA 3A7DA 2A58A 1Z5WA 2ZBEA 1J2YA 3AF4A 3ILSA 3MXOA 4OFZA 3B8EA 4X20A 1HEUA 5EIHA 3VKFA 4N5MA 2H9AA 1S7CA 3DT8A 4QOFA 2C5AA 3GMTA 5EJGA 1ENZA 4HLDA 2D13A 4JLPA 3HY3A 1I7NA 2X0DA 3X1JA 3DJYA 5FV4A 4O33A 1N0UA 3JRXA 3RYIB 1HFWA 3FY4A 1ZN8A 3ASVA 3K9GA 4X91A 5J4KA 2B92A 2VC2B 1LLFA 3KKZA 3O8RA 2A9KA 2WE8A 1GZ7A 3N2YA 2V7WA 4BVKA 5DRYA 5B7NA 4YUWA 2DFVA 4HSGA 3UTCA 4BLPA 1N6PA 5FYQA 4XVCA 3L8DA 3UAXA 3WYFA 4Q66C 3H0CA 5IFLA 4C0BA 3QTLA 2HLDD 2HV9A 3CKKA 3EGOA 4D6YA 3CJQA 1CRQA 3FTEA 2AI2A 2LE0A 1AK2A 1IEVA 1VIAA 2A0XA 3CCLB 5TQ2B 3NOQA 2W22A 1DG9A 4EDHA 2PRIA 5DI9A 2NO4A 1GUBA 1EZZA 2FCRA 4LRUA 4A73A 1G4AE 1ISJA 3RSQA 1ZYUA 4A6XA 4NARA 1AZLA 3WLFA 1UM9B 3EDYA 4B80A 2O8FB 3GY0A 3BKXA 2ATEA 2PFGA 3U3MA 5IT9A 4N7BA 5DM60 4NZYA 3AVVA 2DX7A 2JAXA 2ID7A 2J85A 1YJAA 1FE8A 5J3OA 1GCOA 2P9JA 5LBUA 3I2YX 1R5JA 5FULA 1L5NA 3SHOA 1I7QB 4FFPA 3WKDA 2FGKA 4DEYA 2GJKA 1JVBA 2QLNA 3OLWA 1VHEA 4RZUA 3RFUA 2PU7A 2Q8PA 4DCNA 4HFMA 4DILA 2ZUFA 1VOTA 4ZGNB 5BQ5A 3TE7A 3STUA 3ESRA 1X80B 4TSRA 4D4GA 1N2JA 4WBNA 2AC2A 3ZDZB 3KEGA 5L4NA 4OI2A 1ELOA 3K9FC 5AM5A 3A6PC 4PFQA 4BRSA 3CCUB 4HSEA 1J56A 1JHPA 3QBTA 5TJ9A 2A9VA 4ER6A 4WBNF 1Z18A 4Y2RA 4C5BA 4MUEA 4JI2B 2ZTSA 5K3FA 2GPAA 4M0LA 1A98A 3OM0A 1GGKA 3L05A 2AFIB 3HNRA 4RJ2A 4RZQA 5JPCA 2DBYA 1NP6A 2GJ8A 2MSWA 1PVDA 1LPMA 2CZGA 4IF4A 3EZ2A 3JASB 3IEUA 3I5UA 4GI3A 5HF5A 5LOVA 1TGYA 3EG9A 3A6HA 1U4OA 2Q27A 2P5TB 1B1CA 1WAMA 3EXHB 3EXG1 4FCCA 4UTXA 4RTOA 1DAIA 2AE2A 3IHLA 1HK7A 2B83A 3VR3D 1UFQA 4RLSA 2WRZA 2KW5A 3G05A 1KZYC 2QX8A 3D1JA 4RHFA 4HQFA 5ITWA 4JOQA 3L0YA 3S2GA 4PSUA 5IN4A 1CNFA 4RD4A 1ILWA 1HTBA 1OTYA 1P75A 1ZBQA 3ILHA 1EAYA 3AL2A 3G6KA 2NZ2A 4NONA 4XJVA 3F49S 5EMKA 1KAHA 3QFHA 3MLBA 3WRYA 3F7NA 2O57A 2PLRA 2RGAA 1TVKB 3MOSA 5EJ2A 4WY2A 3UXYA 3ZQUA 4DV5B 3ADPA 2B4QA 4YCJA 3WI7A 1K3TA 1G21B 2ZOSA 4P7KA 1L8LA 3NDRA 4K9PA 1TU4A 2VYFA 4YHHB 5FUBA 4DT1B 1TRKA 3VNQA 4Y9RA 2OAP1 1R4MA 1D8AA 1M7BA 3PL5A 4ZOQI 3CO5A 3HDQA 3QLEA 5LQSA 3UUEA 4BLTA 1ZXXA 1UK6A 4X7RA 2B2NA 3SG0A 4EW2A 3BMNB 3E48A 3B2QA 3P0FA 3TFQA 1ZJWA 3WYAA 2XYRA 4XLLA 3QV2A 2IP2A 1YAJA 1LBSA 4LNUA 2FJPA 3IOYA 4DIUA 1EWVA 3T7EA 1M90D 2FPKA 2I0FA 2LVBA 3QKSA 6YASA 2FG5A 3G6EB 3VYWA 5A05A 2WM3A 2IHYA 3X3HA 1C7ZA 3HBLA 5FFMA 4PSCA 3HXPA 1XEWX 4RVFA 3T7IA 1GWNA 2MYPA 4X90A 3T3IA 4S1OA 4EKIA 2NZVG 3QYJA 1Q0TA 3HCRA 2KSQA 2Z95A 4ND5A 3KU1A 4R0MA 4YJHA 1NUQA 1P2GA 1HQYE 5CVCA 1FPQA 2ZCVA 3C1AA 3J81k 2SKEA 2ATIA 2YX1A 3VO1A 1U98A 4YP7A 1XZ8A 2F90A 5A5DA 3WNZA 4EVQA 3VZQA 2EDAA 3GEEA 1GPBA 2D1FA 2QZJA 3A9TA 2W7TA 3O93A 4KE8A 4EHKA 1NKSA 3LP8A 1VHQA 1Q1AA 2IKSA 1RXSA 1VL0A 3CB4A 2XYHA 5HYVA 1WRBA 3IE0A 1JIVA 2IOFA 3BGIA 4E5DA 4LCBA 3VNVA 2AD5A 1H4TA 1YDGA 1JG6A 3CCJB 4GSKA 4FGJA 3FNIA 4ZOBA 4IXDA 3UG6A 4BB6A 3OM1A 4PC1A 4ZAVA 4Z4TA 5A6SB 2QQEA 1YB7A 3DBOB 3X0DA 3PJGA 3PBKA 1J90A 3F7MA 4XWWA 3DAYA 2X86A 1SCNE 4WWVA 1NZFA 3ESBA 2F1LA 1P5RA 1ZNZA 2DLDA 1V5EA 2TRSB 4KMMA 3WGQA 2PKCA 2JCVA 1XK6A 5TGTA 3QXGA 4EUSA 5JAZA 1WBBA 4G5SA 4XYEA 4A6EA 3DXZA 5KNBA 1TCVA 1TMGE 1ZISA 1DRWA 3ENVA 3KEMA 3R0QA 4DQVA 4O3MA 1DFGA 3CUTA 3TPZA 4E07A 1YC2A 1RYYA 2AN5A 2ERYA 4CIAA 2RE8A 2NUBA 3SC2A 1OXVA 3G5UA 3KTAA 4J0HA 4F85A 2I2WA 2JEZA 5ENVA 2PX8A 3UATA 3VBCA 4K81B 2UUBB 1VPLA 1A96A 1WW2A 4O1HA 3OECA 1BS2A 3IURA 3JATB 3DPIA 1U1DA 2A4KA 3N39C 4JC5A 1RAGA 3QEMA 4FFVA 4Q4JA 5JSQA 4F6LA 4E33A 3KUCA 3ZHTA 2WFMA 3QF7A 3S7ZA 3Q3GE 3A0RB 4YUZA 1UXHA 1SG9A 4ND8B 4Z9FA 5TPZA 2O8DB 3SYKA 4C6HA 3UMYA 1H2AS 2ZRLA 5C46F 1ETHA 1QANA 2RGDA 3ERCA 4X3CA 4G07A 1E9BA 1JECA 2G3YA 4BQFA 3EEBA 1BGXT 1PYGA 2HCBA 3PFNA 4DLKA 1GU1A 1NXPA 1GSOA 5TQJA 4RD0A 2QQ0A 2V8OA 3EZ9A 3MJHA 4AZSA 1DT3A 2O5RA 3IVRA 1L7OA 1CUYA 2XKKA 2YWGA 3G59A 1EIWA 5TT0A 1HBJA 3CC2B 4IW3B 4JS0A 4BAGA 4JT9A 4UTOA 3LC0A 3SZMA 5TMPA 1R15A 5JASA 1GGVA 1XHLA 4LHEA 2QTNA 1KZGB 2EFYA 2ZU0C 3FYHA 3UOWA 4GDFA 1MIOA 3ZNNA 1W36B 1VSTA 3FYUC 2IUSA 1LS1A 5BSTA 5KUTA 4A0RA 3ZDFA 4E2WA 2OL4A 4F4UA 3GLQA 2RHDA 4NG4A 3L4JA 1JSRA 4F21A 1O89A 4CCYB 2V7TA 2O0HA 3GMDA 3RTDA 4L9WA 1UM8A 4BVGA 1T8YA 1C9MA 3C7KA 1H6CA 5HQTA 1RVV1 1CUBA 1QZ3A 3Q98A 1PG0A 3SQNA 4YJ2B 3RREA 1YTLA 5DYTA 5FTNA 5BQXA 2JAHA 2LNDA 1XF9A 2IXGA 3VMMA 4CE6A 4RM0A 5B7GA 4LAFA 2O1WA 3AUTA 2ZRNA 2JIOA 3NIBA 4FMPA 4HDSA 1DIHA 2CLDX 4B3SB 2Y1LA 5E2AA 1VE6A 2NU9B 1O5TA 2J6IA 5MFPA 3N2ZB 5CAEB 5BVHA 3HVJA 1DINA 2D2IA 4R2LA 2D3NA 1Z28A 4GI1A 2I78A 4ZDJA 1HZJA 1YZFA 2ORVA 4QPPA 3RFTA 4F2WA 5E1BA 5JLJA 2FW0A 1LSOA 4BNNA 5KWVA 2CMFA 1PLJA 3D4PA 3L1HA 2XLCA 4NU5A 2X9GA 3V8RA 3QUCA 4ZARA 2JB9A 1KJIA 4FXOA 1QRSA 4NCAA 1ZL2A 1R64A 5JDCC 3F3YA 4YC7A 1NLZA 1SQ6A 1VKHA 4JELA 5DT2A 3UH0A 3O8CA 2RHGB 2BFNA 4FOPA 3QTTA 2CLMB 3H97A 4OOFA 2DXIA 3U13A 1FMCA 1YWGO 2FWAA 3PQ7A 3F98A 1IE3A 3QEOA 3ASTA 4FWBA 2V6IA 4HX2A 5CD1A 1QYVA 3BD6A 1OXSC 2CFSA 3LYHA 3GCXA 3F47A 4X1IA 4D82A 4DPLA 4HNVA 3COWA 1K7EB 1XNGA 2FFHA 2CYCA 2ZROA 2PO5A 2V74B 4S1NA 2LKCA 1ADJA 2FRDA 1YI0A 4IL5A 1LDNA 4RPKA 4ZT7A 1ZH8A 3ZCVA 5EIEA 1THZA 2RDMA 3O4JA 2P9CA 3Q15C 1X7YA 2V31A 1HYGA 3ES9A 3BAZA 3CLTC 3H2KA 3SF8B 2AZMA 2C92A 2Y92A 1FNDA 4ID3A 4Y6LA 1M1NA 4GPIB 4LCEA 3CZPA 4YVFA 4MLDA 2XCRB 2DUMA 3KCQA 2Q4DA 2PS1A 2B35A 4L2IB 5AJTA 3WYNA 3CS3A 1UP4A 2WVAA 1VJ0A 2XQIA 3A3PA 4HNUA 2GJ9A 3JQAD 3QGMA 4CLRB 1B8OA 4R9VA 1GV0A 3GP8A 1F2TB 1ZL0A 3AG6A 4RX1A 2GHIA 1UBEA 3B70A 1BGVA 3HU3A 4H18A 1H3FA 5INTA 1JAZA 3HN2A 3BB4A 1CBUA 1FSGA 3OZEA 4PWYA 4KRGA 2EW1A 3ORYA 2ZK7A 5AKIA 3S28A 2VUSA 1I36A 3GFGA 3SYNA 1NXTA 3BWMA 4IJ6A 1BXKA 1M10A 2VN8A 3PHLA 3PA2A 1GXSA 2G76A 2VP4A 3MGKA 4JQZA 3ETLA 1E5VA 1H2BA 2P7IA 4LYFA 5H3CA 3RANA 4F92B 3HZZA 1EE9A 1WEKA 1RWOA 2P9EA 2H57A 3HB5X 3I1IA 2IE0A 2FQXA 2OO3A 1F4VA 1HY3A 1BHSA 2QX6A 2WD9A 4UUAA 4IVQA 4YECA 5DP1A 1EE1A 4B83A 2QGFA 3OEED 5ICFA 2ATXA 1TQHA 3BWBA 3EQ7A 4QU0A 5U4QA 3JRNA 4TLEA 4F93B 3BE5A 2COKA 4KUEA 1O6BA 4ZEVA 2ZXIA 2RK6A 3I55B 1N6NA 1KXJA 3ENZA 4KXXA 3EK2A 5F23A 3IQIX 3LOQA 1Q16A 3VPXA 1B6SA 4AP6A 5T57A 4F4JA 1M8GA 1VL6A 5CDYA 1IULA