3CW2A

Crystal structure of the intact archaeal translation initiation factor 2 from sulfolobus solfataricus .
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
414
structure length
414
Chain Sequence
b'AWPKVQPEVNIGVVGHVDHGKTTLVQAITGIWTSKHSEELKRGMTIKLGYAETNIGVCESCKKPEAYVTEPSCKSCGSDDEPKFLRRISFIDAPGHEVLMATMLSGAALMDGAILVVAANEPFPQPQTREHFVALGIIGVKNLIIVQNKVDVVSKEEALSQYRQIKQFTKGTWAENVPIIPVSALHKINIDSLIEGIEEYIKTPYRDLSQKPVMLVIRSFDVNKPGTQFNELKGGVIGGSIIQGLFKVDQEIKVLPGLRVEKQGKVSYEPIFTKISSIRFGDEEFKEAKPGGLVAIGTYLDPSLTKADNLLGSIITLADAEVPVLWNIRIKYNLLERVVGAKEMLKVDPIRAKETLMLSVGSSTTLGIVTSVKKDEIEVELRRPVAVWSNNIRTVISRQIAGRWRMIGWGLVEI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Translation initiation factor 2 subunit gamma
publication title Crystal structure of the intact archaeal translation initiation factor 2 demonstrates very high conformational flexibility in the alpha- and beta-subunits.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Translation
total genus 64
structure length 414
sequence length 414
chains with identical sequence B, E, F
ec nomenclature
pdb deposition date 2008-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
A PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 3cw2A02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 3cw2A03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3cw2A01
1GAQA 2IYSA 1J2JA 3CNOA 4HLCA 1JNYA 2OCYC 2IL1A 1MT0A 2G1KA 5FI1B 4PR0A 1V43A 1XTQA 4PHHA 3RRNA 2JLRA 3P26A 2G0TA 2ZRAA 2ZYTX 4LJ5A 3RC8A 2CHGA 4XD7D 1KI6A 2OLKA 4MQBA 1KKMA 5FUVA 3RRYA 3MHPA 4NONA 2GF9A 3LBIA 4Q18A 3AF3A 3UMRA 1QG2A 4U00A 1UMKA 1OF1A 3U7GA 4LJ6A 4Q9HA 3FOZA 1XMJA 4ZDWA 1CR1A 4ESHA 4MITA 2FU5C 2ZE8A 5K8UA 3E2IA 4M1KA 1UDWA 1G5RA 2KJQA 4PPGA 3UANA 4F7WA 4YMVA 3GEIA 4I1SA 1DAIA 1UEJA 2HYDA 4G5QA 4JVMA 1Z0JA 1GUAA 3VR5A 3OEHA 5H59A 2ZYVX 1XD9A 2AX4A 1KO7A 4IDPA 4DUGA 1OSNA 4JYCA 3DZ8A 4AKHA 2G83A 3K0FB 1TF7A 1E9EA 4DLWA 2CEAA 3U6BA 4LHVA 1XTSA 1QF9A 4BFTA 2AKAB 2VSFA 1K6MA 3AUYA 3NHBA 2ZJOA 1AM4D 1JPNA 4V02A 1W2HA 2F55A 2W00A 2JLQA 2R44A 1NKTA 1XD2A 3CNNA 1DVRA 4BFYA 1TQ2A 1KI6B 2WVJA 3HU2A 4D81A 1KK2A 5E7IA 2ZROA 2O0KA 5H1YA 5HKKD 3K9GA 3ADDA 1YHNA 2GESA 4B44A 1PLKA 1CJTC 3T1QA 1XP8A 4Y7CA 1QUFA 2W0SA 1K8AD 3PEVA 1Q22A 3QVUA 4MA4A 4S35A 1ZINA 3EG5A 4PO1A 4BRWA 1AQUA 4JZKA 2JEOA 2FZ4A 1M7GA 4HSEA 3K09A 4M1TA 1ZUIA 2DBYA 3B9QA 4QBHA 3OW2B 1GO2A 2FSHA 4DUGD 1Z0FA 1HH4A 2QENA 2QAGB 3NC1C 2YWHA 4B47A 1P60A 3QFRA 1N6NA 2BGJA 1L7VC 2FE4A 2FFBA 3QY0A 1E6CA 4URYR 4IFBA 2C9CA 2IW3A 1J90A 3K09C 5EE0A 1LS1A 1Q44A 4H1VA 2Q6TA 1XTJA 2QORA 2WWWA 3IDQA 2A2ZA 2EFCB 4NYIR 1YI2B 4IOKA 3W8RA 3VR3A 3KQLA 5THXA 1F2TA 1S9HA 3LW8A 3ZQJA 1XMVA 3KUDA 5HXBA 2QPTA 1Y63A 5CYOA 4EJSA 1E9SA 1E3MA 1XD2B 1NVWQ 4TLDA 4WXRA 1VPLA 4P31A 1M1KD 2NO1A 1C9KA 1ZM7A 5JCZA 3W2FA 3V9PA 3CONA 2PJZA 4JKYA 2NGRA 4RCYA 4ZDJA 1VMAA 3AVVA 1E0SA 4EJSC 4B48A 1CR4A 3ONWA 4GZMA 4FW9A 3PVSA 4NH0A 1TTTA 1E64A 3EC1A 1KI9A 3DO6A 621PA 4Z8XA 3HR7A 5FTMA 1JB9A 5AUQA 5BN5A 3P4YA 3KJGA 4LRWA 2GCOA 4Q1FA 3SQWA 4NTZA 3GFPA 2IF0A 3NBFA 1XJCA 2QBYA 4CGZA 3R8CA 2I1QA 2VF8A 2F6RA 1OT3A 1W46A 1DO0A 1HEIA 1AKYA 2R6FA 5HZHA 4QM7A 5AN9A 5C2JB 1F2TB 1ZAKA 3FWYA 2D74A 4YAWA 4GMXA 1COWD 3PUVA 2OZEA 2IYLD 2ZI3A 1CS4C 4JL8A 5F3WB 2H7VA 4HE5A 4Q1EA 3ZD7A 3SYLA 3NTUA 2H5EA 2LCFA 4IHQA 1YJ9B 1XJ0A 4UNPA 2O5VA 2QP9X 2QPAA 3ZZTA 5FPKA 1KK1A 4AG5A 2CLCX 2W2VA 4FMCB 4JJZA 5JI3E 4UQOA 4OHVA 4YMTA 5CLLA 3IHWA 1CEEA 1BYUA 1KDPA 5J4HA 4DRZA 2GCOB 3ZYCA 4QKQA 2VHJA 3THYA 2NZJA 2WHXA 1P2TA 2QMEA 1VQ6B 5KDOA 3M0EA 3DM5A 1Z6XA 1R7RA 2QBYB 2QNRA 2CVFA 1G7SA 4F38A 1OXSC 1G7CA 2FSFA 1E79A 5ELXA 1LFDB 4RD1A 3JQRA 5LDDC 4PFSA 1GM5A 2ZAMA 3ZZ0A 4BZQA 1YITB 1NJGA 4NE2A 2EW1A 4V0NA 4C0LA 1U0JA 2LKCA 2B6HA 4PPFA 3NEYA 3BH6A 4KAXA 2GKSA 3AP2A 3IQXA 3RRMA 3X1XA 3K0CA 4LUCA 3P1JA 2BF4A 1ESNA 2JJ1D 4Z8YA 4EPVA 4Q7LA 2H16A 3BAFA 2XZOA 4NYMQ 5F9HA 4KODA 4HB2A 5AUNB 3CRZA 1OIVA 2FFAA 3REGA 1IB0A 1G3UA 3PEUA 1JECA 4Q9JA 2C8VA 4ZV4A 1G8PA 2I4IA 2Z5FA 1D2EA 2JJ8A 4KVGA 2REOA 2QPOA 1T3HA 1NN5A 3K0CC 1VHLA 1KTVA 2HYIC 1AA9A 3CPJB 4W7SA 4LX0A 2ZJBA 2ZS9A 2ZQ5A 4YMUA 2PJRA 2IXFA 1IQPA 2H57A 2IHBA 1A5TA 1GL9B 1RKBA 3GJ5A 3THYB 2DFNA 3IIMA 2VTKA 3ICEA 1Q81D 2F1JA 1KI3A 1L8QA 4JBXA 4KSCA 1JJ7A 1SVKA 3AKYA 3OIWA 4LV6A 3BORA 3OZVA 5DYGA 2CXXA 2IYXA 4MRVA 1Z0DA 4A1FA 5JZVA 1T5LA 4MKFA 4R2IA 1G18A 1NP6A 2VF7A 4OK6A 3TAHA 3W3ZB 1DS6A 1Z6TA 4Q7KA 1Z83A 3MWKA 1UPTA 4RSGA 1FX0A 1IXSB 4HAUA 1FTSA 2BMDA 2Z4SA 3BIFA 1NJID 2QEXB 1OXXK 4PPNA 3VMFA 5GV8A 1XXHB 4MRSA 3B9PA 2CL7X 3UMSA 3UG6A 4X8MA 4A0GA 2WJVA 1XXHE 1MO3A 1NVUQ 3QNUA 1TUIA 3SYNA 4MYHA 4BASA 4BLRA 2W6JA 3EPKA 1KMQA 4OHYA 3B82A 3L8ZA 5CLQA 2IYTA 4TYPA 4LHZA 3AVOA 1PUIA 2O0HA 4JLBA 4FMDB 4FIDA 3QFTA 1VIAA 2Q21A 3CCSB 1OXUA 3FPAA 3W6OA 2GNOA 2VHTA 3LVBA 2OEPA 2BMFA 3LAWA 4TZ0A 1VECA 2GJAA 1U94A 1T8TA 1YRAA 1EP2B 4ZCIA 1GRRA 1Q57A 3W3AA 3TSZA 1R8SA 2B8WA 3MWLA 4TMZA 4PO9A 1G20E 1QZXA 1GAWA 1YRBA 2ZRBA 3C5HA 4Q47A 2LWIA 3TK1A 1Z08A 2OM2A 2OAP1 3LLUA 1TEXA 2P5TB 3OHMA 5AUPB 1W0KD 2RHDA 5H70A 2ERXA 1N5LA 5JRZA 3U61B 1FX0B 4ZDIA 3U6KA 4G5OA 1N5IA 3I55B 3VKWA 1LF5A 4HDOB 4PX9A 1QHIA 1NNEA 3TE6A 4EPTA 1KKLA 3U60B 3K0EA 2EFHB 4P33A 3CC4B 3KFVA 1DAEA 3QQ5A 3IPXA 4ZDKA 4OI0A 2W6JD 4R2HA 2ZRGA 1FRNA 1BX0A 4M21A 4B76A 1KI8A 1FZQA 5EP3A 4FCTA 4M9SA 3T34A 2H17A 1AN0A 4PHFA 4M1MA 1TVCA 4II7A 2VNKA 2P3SA 5SZHB 1Z5ZA 2X19A 1KI4A 1JQJC 3OZWA 2ZTSA 3Q5EA 4A6PA 2E1RA 4M2LA 2ZYUX 3FGNA 3NWJA 2XAUA 4K46A 3QEJA 5GVRA 3C15C 1Q20A 5HPYB 3K70D 3C4JA 3SHFA 4NDZA 4DEYA 3CX6A 4AKEA 4E09A 3K70B 4OQMA 2C78A 3CWQA 4JT2A 3LX8A 3CWZA 3LVRE 4A2PA 4WZAE 4Q9IA 4US2R 1NVVQ 1P9NA 1VHTA 4NU0A 2ANBA 1PVOA 1TL7C 4Q4LA 4A8JA 3RWMB 3L2OB 4JLJA 4EPWA 2XX3A 1LVGA 5EE5B 2XEXA 2FH5B 2J7KA 4M1WA 5DI3B 1GL7A 3KX2A 3LO5A 3QPUA 1X86B 3AQ4A 1VQNB 1W36C 1XE1A 1FMLA 3CCRB 2QT0A 2CL6X 3CMEB 1KI7A 3G6EB 3IO5A 4LYFA 5CK5A 2GF0A 4V0KA 1N6OA 1YZNA 4Q9LA 3CPHA 2MSEB 2FJUA 3IIKA 4YMWA 4TYWA 4DKXA 3UIEA 4B3DA 4LJ7A 3ZIAA 5JBQA 2GPJA 4C0AC 1FDRA 2ZS8A 4O2RA 5SZKB 1Q86D 1LV7A 1P2VA 4PC7A 5KNCA 4LSGA 4OI4A 1GTVA 2F1HA 2P67A 3FYHA 3O8CA 1HY3A 2NIPA 1W1WA 1Q3HA 2CHQA 1OFIA 3D6TB 3PR1A 721PA 5KUTA 2D7DA 2VBCA 3E70C 4QGGA 1XCMA 1CP2A 3OFND 5HE8A 3UK6A 5BWMA 2JJ2A 4Z51A 3QE0A 4HE6A 2WIAA 1NKSA 2RGDA 4LV8B 4C0HA 2NO6A 1NIPA 4A8JB 4W9MC 5L3QA 1WF3A 4RKFA 3CLVA 4PQYA 2FWRA 4BPBA 5HCNA 3NDBB 3WY9A 3BB3A 1MH1A 2O52A 4US1R 4MRPA 1M1YE 3QUSA 4XTCS 3G0HA 3FHTA 3FHOA 2XB4A 1JXMA 4M8NE 3M6AA 5KSYA 3C8UA 5CJPA 4DSTA 4XWOA 4B32A 3CC2B 1VDZA 3LQRA 2NMVA 2XJ9A 3FTQA 5FL7A 1GVHA 4ZGNB 4TYQA 1G291 2FG5A 2PLRA 1HUQA 3SNHA 3W2EA 4K8OA 1GAJA 1KI2A 1IN6A 3LVQE 2RH5A 2WAYA 1UBEA 3TUZC 1E9DA 5FPYA 4A15A 1S9DA 3WBJA 1KHTA 4MRRA 2R6CA 3IUYA 4G5SA 1Z22A 2PBRA 2MSCB 3H2YA 2O8DA 1Q3TA 1FFHA 3H1TA 4MRNA 3SU8A 1HA3A 1HE1C 1SKQA 2N46A 4D0LB 2KBFA 1GNRA 3RS0A 1QHHA 3FMOB 3P4XA 2CCGA 1IY0A 3X1ZA 2DWPA 2J3EA 1TLLA 4GMDA 5J47A 5L3QB 3B60A 3TVDA 4D25A 2WMNB 1QVRA 4UNNA 1E2GA 5FTKA 5GJVC 3VHXA 1U99A 1VQ7B 1ODFA 3B1YA 3W5HA 3V76A 4TN1A 4TL8A 2B7CA 3JQQA 5HCIA 2OBMA 2CBZA 2C98A 3VAAA 4HDCA 5FL7D 1EK0A 1IY1A 1GFIA 2A5DA 5E7MA 3EA5A 2PEZA 3IKJA 1QRAA 3ECCA 4IKEA 3TAUA 1LF0A 1FQJA 2BOVA 1X8LA 5FUXA 5KHOC 4PAMA 3MFYA 1KSFX 4LV5B 5KYKA 1JR6A 2VQSA 4EDHA 4TMWA 1M90D 4B6FA 2VRWA 4UNSA 1KZ7B 2IYQA 3K53A 5GVSA 1F2UA 4FWIB 5EP2A 3F3YA 1IN4A 2O8DB 4P4SA 3IQWA 1KRHA 2AK2A 4U9UA 2WPDA 1DAHA 5F9FA 5FA6A 4IDOA 4QBFA 1SXJC 2DFKB 3OIYA 1QHHB 1EWYA 3AVQA 4DEXA 3OIVA 4MKIA 2KE5A 4PXAA 4BEBA 5EZ5A 3A1WA 3CUEF 4DT1A 3T5DA 4PHGA 3D8BA 4QC2A 1KDRA 4KXFB 2C2HA 4KFUA 3PCRB 1S0UA 4TQUS 3L43A 5C4MA 4OHWA 2PCLA 2YC2C 2ZRNA 3Q5DA 3R9IA 1BO6A 1G8YA 1YE8A 2QQEA 4IRUB 4UAJA 2XJ4A 3FB4A 4DLZA 5M04A 3FMFA 2W0MA 4HI0E 3REFA 1TAGA 4JT4A 3ADBA 1IXZA 1CLUA 3I8SA 2GJKA 2R9VA 3NIBA 3B1VA 3BXZA 3OE7A 1I4LD 2GBLA 1ONBA 3TKLA 1KDTA 2EYUA 4C0KA 3CBQA 3ZVNA 2QUZA 4Q1AA 3QFCA 4GOKA 1IXRC 2QU8A 2ZR9A 4OK3A 3GJ3A 4D0GA 3CH5A 4HAZA 4HAVA 1VIYA 2F3RA 2XOKA 4QL3A 3GPLA 1F2UB 4C3ZA 2RGAA 2QY9A 2D06A 2BSAA 2AD1A 2ODBA 2WPDD 1G8FA 3T06B 1P73A 4I4LA 3ZD6A 1OKKA 2J7PA 4EFNA 1JA0A 1QH0A 2GVZC 3Q7PA 4W5WA 3SHWA 1GRNA 4AI6A 2AWOA 2HDNB 4QFMA 6Q21A 1Y3AA 4EAQA 3V4FA 4ABYA 3RDPA 1I4DD 4OKSA 2P0EA 4DT1B 3QXXA 2RHMA 3FVQA 1PV4A 3PENA 1XF9A 1WB9A 1G6OA 3GMTA 4AYTA 5A5GA 1X3SA 5IT5A 1T91A 2A5GA 4AC9A 4GNKA 1CBUA 2OFOA 1KGDA 1XPRA 1YZUA 1XDBA 4UXJA 1HV8A 3QEOA 4RCZA 4TWZA 4QBGB 3OE7D 1XZPA 1XU4A 4YQFA 3ES9A 1NMYA 2IBMA 1CJMA 2ODWA 3CMAB 4BLPA 3ICQB 2B8TA 2V7QA 2FMXA 4M53A 2ZVQX 5DISB 3TVTA 4DDWA 821PA 1K73D 2QTLA 1G1MA 5DO9A 3KQUA 4IXMA 3VHLB 4DSNA 3BE4A 3LBNA 4QJ5A 1U0HC 3AKEA 1CF4A 2W6ID 3QJYA 2QE7A 1P9RA 1QFYA 2IS4A 1XX6A 1JJVA 1AGRA 1X8JA 1W2GA 4UKDA 3SJBA 3UKDA 4AKIA 5LB4A 3T35A 3S1AA 5BN4A 2JLWA 3PITA 2JCSA 1FL9A 4P0TA 4YLGA 3TRFA 2GJSA 4CT4B 2BBTA 3QENA 1MOZA 3MJRA 2BMJA 4YALA 1W5TA 2PL3A 3R8FA 3SBDA 5LD2B 5CM9C 4DHEA 3V00A 1G3QA 1XEWY 4F4JA 1VQLB 3UPUA 2BV3A 2REXB 2Y8EA 1OB2A 2ANCA 4OJKA 3ZQ6A 4QG7A 1I4TD 3CPWB 4QBIA 4TQ9A 4QJ4A 3EARA 5DIFA 3EA0A 3I72A 2B21A 3CC7B 1T9HA 4IOMA 3GJ7A 3RS2A 5C1BA 4GOXA 4CEIA 2DHRA 1B23P 1MO6A 4V0ME 4US0R 4P32A 3GD7A 1QVFB 4UJ3A 3BFKA 4CEHB 4GT1A 3TJZA 1UF9A 2A3RA 1CRQA 3CH4B 2OK7A 5F98A 3QPWA 2A5JA 2J0UA 2QE7D 2YVUA 4YDHB 3WRXC 3CRMA 4Q9KA 5KNBA 3CF2A 4TLCA 4B71A 2HCBA 2F43A 4TMXA 3TW8B 3T5GA 4ZI3A 1D8TA 3X1YA 3S1AB 3TH5A 1N8RD 2ZUDA 3WHLA 3WRYC 1VG1A 4S2EA 1NLYA 1E0AA 5CB6A 5FFMA 2DWOA 3LNCA 1ZCBA 2D4HA 1VCIA 2V9PA 3F0TA 4KITB 1G4AE 2ZEJA 4URWR 3NHAA 4KV9A 1OB5A 4PC1A 2EWVA 1AJEA 3DM9B 4CT5A 4XH9B 3TUIC 4RD2A 4GP7A 2Q9AA 5IK2D 2OTJB 3LRPA 4XWAA 1IJFA 3IEVA 2FNAA 4IOLA 1M7HA 4Q66C 3I62A 2YOFA 3QXHA 4JVNA 1D9ZA 3GJ6A 4LDJA 2OG2A 4Q4JA 4X8OA 1DAFA 1AKEA 2C99A 3QF4A 2IF2A 1M8PA 4CEIB 2OFWA 1II0A 2MSDB 4MH0R 3MCAA 1N0UA 1NLZA 1Z0IA 2ZSAA 2VNHA 4DSUA 4D2IA 1WBBA 1NN3A 2J0UB 2HXSA 2N42A 3CPEA 3SC3A 1E2FA 1UBCA 2ZUCA 2OXRA 2R6HA 3IEUA 2WJGA 1FRQA 1NI3A 2RC6A 3R9WA 2NO7A 3E1YE 1R4AA 1YZGA 1E99A 5EXXA 1Q82D 2RGNA 2IYYA 3CZQA 3CCQB 2WWHA 4Z54A 5BYJA 2JASA 5TDHA 3UWKA 1XMSA 1EG7A 5LB2A 1P7CA 2YV5A 1GZSA 3IPYA 1VCOA 2QM7A 2OAQ1 3MJHA 4HZUA 1PLLA 1EP1B 2RGNC 5TY0A 1RJ9A 4PQFA 3DOFA 1HT2E 1KJZA 5B2ZA 4LOAA 3W34A 1DARA 1KJWA 3B7GA 3OEHD 4Q4JB 4WIAA 4LYAA 2RGEA 5JS7A 1P62B 3QF4B 1UDXA 4E07A 3OZUA 1DO2A 4RD0A 2GEUA 1A8PA 2CCJA 3X1WA 3FPKA 1F48A 1D5CA 2JA1A 4BEJA 4TT3A 1C1YA 4G01B 3EC2A 2G9NA 3GP8A 3PQCA 3JVVA 1UKVY 3ZJYA 1TQ4A 1CU1A 1P5ZB 3BFVA 4XWKA 1EP3B 1VTKA 1UKEA 4BECA 1IJEA 3DEFA 3A8TA 3ND8A 3VKGA 3CRRA 2RGBA 5DE3A 1N6RA 3WP0A 3LY5A 3TSWA 4QOSA 1X6VA 1ZNWA 2JIZA 4F93B 1PUJA 4RD6A 4DLRA 3KZ1E 2BMWA 3ASYA 1OE0A 4JLAA 3CCJB 4MUAA 3K1JA 4B6EA 4HZUB 2ZJAA 2VP4A 4A2WA 3QFSA 1YR6A 2FOLA 3H84A 3RS4A 3TUJC 3BOSA 1ELOA 2ZJZA 1QBKC 3EAQA 4A0HA 4BFVA 1RJ9B 3W9YA 1FMJA 4MDFA 4M9ZA 2CK3A 4WAUA 5JLJA 2CDNA 2KB0A 4EPYA 2ZITA 1KO1A 4IFEA 2HJVA 1S2MA 1AS0A 2ECKA 5JHGB 4O25A 1MO5A 4L15A 4JKIA 1YR7A 3A37A 4Q7JB 3TMKA 3SJZA 1US8A 3BBPA 3PV0A 4M22A 3DL0A 1R5OA 2PH1A 2PMKA 1OLOA 1L2TA 4EFMA 3THWA 2DB3A 3ADKA 1UKZA 2W58A 4EJSB 3EWAA 2WZQA 3AGPA 4HB3A 4M1YA 4MYUA 4DDVA 3CB4A 4EQ6A 1S4QA 2JIZD 4D4LA 1HURA 2OO7A 1UADA 4P4TA 4N0DA 4ON9A 4URUR 5EXPA 2P6UA 4LBYA 2RGGA 2XNCA 3CCEB 1Z28A 4LPKA 2IWRA 3TR0A 5TR9A 1MRNA 2CK3D 4RZUA 4PTLA 4EIWA 4TMVA 1W0JA 4HUQA 5D3MA 3W8NA 1SM4A 2FX3A 3QXSA 4KYIB 5JS8A 4EPRA 2V6IA 3I4LA 4M4SA 2ATXA 4TSFA 2ZYWX 4HDQB 4HB0A 3EXAA 3P32A 3HYTA 1GL6A 5J40A 2JLUA 3CIOA 1EWQA 1IBRA 3ZS9A 1RE0A 1CRPA 3SOPA 1G3IA 4ILEA 1G3RA 4Q7MB 3IIJA 3SQXA 1GNPA 1OJLA 1KO4A 1W48A 1H8EA 4C43A 1US8B 2H1LA 2ZSDA 4LJ4A 2TMKA 2IYWA 1H8HA 2JLVA 3L0IB 2J5XA 3K9LA 1JAHA 3THWB 2VNIA 1YZQA 4BLSA 5JSZA 1RFLA 2V55B 1A1VA 2I1VB 2YHSA 3Q9LA 5IRCD 2IS1A 3BFXA 3D7MA 1G6HA 3MRSA 4EQ6B 1PJRA 1SVLA 4AF6A 1E9RA 2BBOA 2J41A 1T3SA 3U7HB 2FPMA 4RZ2A 2C5LA 2G77B 4QNRA 3T1VA 1HTWA 1QUEA 2FFQA 5BN3A 1OH8A 4I1OA 2MMGA 4QJ3A 1XBTA 1KIMA 3NVAA 3LA6A 5KPJA 1OHHA 4KVAA 2ZETA 3DVLA 3KJEA 2A9KA 4EKDA 4DLXA 2FPKA 3AF4A 2J0SA 4HUQB 2DPXA 5D3MB 1UJ2A 2XTMA 2R65A 4I99A 5G53C 4Q1BA 1NY5A 1A82A 4BFSA 4ZI2A 5BQ5A 3B5JA 5GV7A 2PCJA 4F4IA 1E9BA 4LHYA 1E79D 5AJXA 2GCPA 2C9YA 4BLTA 2ZRMA 3EWSA 3RAPR 3VO1A 1H8ED 1Z29A 3BGWA 2ZE5A 1ZIOA 1XCGB 3M4YA 2IEZA 3B2EA 3M1IA 4ZIRA 1GRQA 4RD3A 1FTNA 1OH5A 3SE0A 5B58C 2GILA 2ZU0C 4LJYA 4TQAA 1Q1QA 1ZW6A 4XSHA 5JSZB 3HU1A 2BCJQ 4N3NA 2A7QA 5D3QA 1ZU5A 4BGDA 2NPFA 2ZI7A 3TSOA 4DLSA 1SVSA 2OBLA 3WMFA 5DLQC 2GAAA 2BEKA 2A5YB 4Q01A 4POAA 5J4KA 1J99A 2D2EA 1E1RA 2BBWA 3KL4A 4Y0VA 5EUQB 3PEWA 5LPNA 1XCPA 3FDIA 5CM8B 3RSLA 5E95A 5JJKA 2GAOA 1OV4A 3QKUA 1AZTA 2EWWA 1VQMB 5FH9A 4EFLA 1Q12A 1OPXA 2NG1A 5HTKA 4KHZA 3GFTA 3CRW1 1TF2A 1JR3A 1AK2A 1IONA 2VP6A 1I7PA 4HAXA 3ZVRA 2OE2A 1JALA 4C0QC 4IXNA 2QP3A 4FWTA 4ZIRB 2FN4A 4Z1MA 1S8FA 4OQLA 3SI7A 1M74A 2FV8A 5FTLA 1G4UR 5KSPA 2WWGA 2OSBA 5J4VA 1E63A 3HU3A 2ZSFA 1D1NA 2IYUA 3MAAC 1J8YF 4Y9UA 1ZIPA 3BB1A 4PSKA 3IBYA 3PUZA 1JJ2B 3L0OA 4LC0A 1ZNZA 2ZI6A 3GLIA 2O8CA 2G88A 4JLMA 1E1RD 2YNMA 3ZS8A 1E2DA 3VR6A 4Q1CA 3KDSE 3QXJA 1BX1A 2DCUA 2HCJB 1R10A 4C7OA 1KNXA 4AD8A 3HJNA 3A58B 1G5TA 2VA8A 4JMPA 2WOOA 3CF0A 2G1JA 2JGNA 1YR8A 1JR3D 1T8UA 2HV8A 2IHYA 3CX7A 3F5FA 2UZ3A 5BW8A 2GXAA 5JWHA 2XNDA 4UNQA 4QHSA 1W2BB 4MGYR 3CO5A 1JR3E 4C4PA 1DAGA 1G8GA 2R6DA 2WWFA 4D80A 1V5WA 4CZ2A 2K5UA 4G0NA 1E69A 2GEDA 3O47A 2ZVPX 3QKSA 2OCBA 1P3JA 2B7BA 1G9XA 1OFUX 3WYGA 2YYZA 3A1UA 4GZLA 1WE2A 3HR8A 3FKQA 1N6HA 1DEKA 4I1UA 1MRSA 1XTKA 3U7FB 4RD4A 1EX7A 2BIFA 3U4QA 4P4UA 1WRBA 2OCAA 2YC4C 3GLIB 2O8CB 1TPZA 1CTQA 1WMSA 2ORWA 4JJKA 5CB8A 4KJZA 1FUKA 2O8FA 4MGIR 1K9MD 4XVQA 4IVQA 3RVBA 4ZCLA 3AKCA 3EPHA 1N3BA 1FUUA 5HR5A 1DDIA 2ZSBA 2WIBA 4B3CA 4DSOA 1S3SA 4C7OB 3LX5A 3PUWA 1RYHA 5ANRB 3CXCB 3PJRA 1T0JB 3PIRA 1U9IC 4A6XA 2BGIA 1T6NA 3NKVA 4G3XA 3K9NA 3AP1A 3IO3A 1KQSB 1QHXA 4LJ9A 2XNSA 4IW3B 2IA5A 2PX0A 3GLHA 4DB4A 2O8BA 2GQFA 1ZD9A 1R0YA 2XNDD 2WSMA 1T0HB 3BB4A 4IDQA 1YKSA 4HLUC 4A0RA 1A2BA 5FTNA 5BXQC 2IYVA 1W36D 3W6NA 3JVUA 3AVXA 4AG6A 4B43A 1W36B 3OF5A 5KU1A 1IOZA 1U8YA 1W87A 3AVYA 3QKSB 4JSTA 1VQ8B 2IX3A 1GKUB 4JS0A 2YWFA 5H8WA 1OIXA 4GI7A 4LYHA 5B64A 1YJ5A 4OHXA 2WKQA 4LI0A 4FCWA 1NF3A 4PAOA 3RANA 2GDJA 1E9AA 2IS6A 3Q85A 4F91B 2FGJA 3GLGA 5DI9A 3K9HA 4JLOA 2GTPA 4B3GA 1W49A 3QVVA 4OK5A 1RC8A 2O8FB 4WW0A 2VHUA 3P27A 4C0SA 2J1LA 1WA5A 3FKSA 3DKPA 3ZIAD 2ZS7A 3E1SA 2CL0X 4E22A 2QI9C 3WMEA 2C03A 2ZRLA 1E1QA 1TMKA 1GIAA 1ZP6A 1ZU4A 3RS5A 3CR7A 1TQDA 3EIQA 2RGXA 2O8BB 2EFGA 3GLHB 4JSYA 5F2EA 3KQNA 4LBWA 3TQCA 5KTYA 3MD0A 3B85A 4E5UA 4FINA 1TUEA 4BQSA 3Q8XB 3AF1A 1KY2A 2JJ2D 1LTQA 1IN8A 3F8TA 4KCGA 5GJWC 1UEIA 3WXMA 3GLFA 1P2SA 3ZVMA 2BM0A 4AIIA 1NBMA 1P72A 2GVDC 2QMHA 2EYQA 4KLNA 1OGIA 5JCPA 2CHVA 4PAQA 4NZYA 5TV2A 2XGJA 2V1XA 2CLDX 5AJZA 3GLGB 1E2NA 2GCNA 3Q72A 1OIWA 2OV2A 2VPPA 2WWIA 4LHWA 3SN6A 2WWYA 1T5IA 3ZBUA 2JDIA 3SEAA 3GLGE 2WJYA 4BPRA 5K8IA 4NP6A 2IXGA 2VEDA 2GK6A 4NCNA 3KKNA 2PZFA 5EP1A 4D26A 3R7WA 1K8RA 2ZPTX 4ZPXA 3CD6B 1YVDA 1N6LA 1SVWA 3MWJA 2D2FA 1QG0A 3CR8A 2NOAA 1SXJA 2YZ2A 1QVAA 1FP7A 4LC1A 1TADA 1NMXA 2XTNA 3AF0A 3NH9A 4MKHA 4V0OA 3SYKA 2QZ4A 3ZLJA 3MWYW 4TTQA 2BMEA 4QGAA 1JB1A 4E03A 1N0VC 3W2GA 2FGKA 4TL9A 5FBRB 1G41A 3GLFB 1EFHA 2IUSA 2WMOB 3BK7A 1S1CA 2F1IA 5J5CA 4YAUA 1VQ4B 3A1SA 2E9SA 3R20A 4JYBA 5JI2E 1E2PA 3GLFE 1R0XA 5HE9A 1W4RA 2BCGY 3HDTA 2GK7A 5J4YA 4OI1A 5E7JA 3EIHA 1RVDA 1ZM4A 1YHQB 1C4OA 4RFVA 2C95A 3N70A 3C41J 4FD2A 4B73A 1SKYB 4TYYA 2JDID 1KMHA 2IEYA 2Z83A 3CCLB 4R71A 1NLFA 3DKVA 5G3ZA 3GJXC 1G19A 1H65A 1QG4A 4DDTA 2XTZA 1S72B 2YJTD 4WQMA 4WA7A 3MMPA 2B92A 2ZIAA 4DZZA 1EESA 2PT7A 2PZEA 1KC8D 1EX6A 2NO0A 1ZRHA 3IBGA 4LYJA 2WSSA 2EU8A 1JXOA 4NYJQ 2V3CC 2WBLC 3R7WB 2GXSA 5FTJA 1ZM9A 5EJEA 3VX4A 3C14C 4Q1DA 1Z6YA 1VYUA 1ZBDA 2PMDA 2N1BA 3VQTA 2VHQA 3FHCB 4MKGA 4YDSA 2J45A 3QF7A 2QN6A 2VP9A 4EH1A 3BD9A 4NCKA 5G40A 1KNQA 2W2XA 4P4SB 3W5IA 1E2IA 2P6NA 3UG7A 4B35A 4AYXA 2F7SA 1GKYA 5DSZA 1YIJB 1FQKA 1KAGA 1NMZA 2QG6A 2VP5A 2X8AA 2ZRCA 3A4MA 4NMMA 4B74A 1YJNB 2X2EA 3NH6A 2GRJA 3C5CA 1F20A 1BIFA 4HEJA 3I56B 1G5PA 1OXTA 5AWFC 2DR3A 3WMGA 4FK8A 5FOWA 1MKYA 2BKUA 4M9XA 3O8RA 2ZJYA 1X1SA 3WNDA 3VFDA 4DCNA 8OHMA 3VU9A 1E0JA 2GXQA 1KMHB 5KSWB 2ODNA 1U8AA 1II8A 3EPJA 1N6PA 4NL4H 2OXCA 4ZCMA 4Q5IA 2IWHA 2WJIA 2FZLA 3IHLA 3B8HA 1KY3A 3UXMA 5CDFA 5JEDA 2XXAA 2EQBA 1A4RA 2QQ0A 1AS2A 4I81A 1ZC3A 3ZH9B 1QVGB 3AKDA 2P65A 2AFIE 5JECA 1TU4A 1L4YA 2VSXA 2XOKD 4PSAA 1KK0A 3RNLA 1JQLB 4ZKDA 5DNYB 5KPDA 2FSGA 4Q02A 5GJCA 3OEEA 5B57C 1QFJA 4M9QA 4F4CA 5K8LA 3FJOA 2HLDA 1BMFA 1OKKD 2J7PD 5A4JA 4JLKA 1KDOA 3GJ4A 3I8XA 3G82C 5L3VA 3KJHA 1FPMA 1A7JA 2Z43A 4F7DA 3KQHA 1I2DA 3QG1A 4JLDA 1W4CA 1CNFA 1YR9A 4CEJA 5K8TA 3VNUA 2GZAA 3JZMA 2KWIA 2WKPA 4CDGA 1II9A 3SFZA 3B13B 3TBKA 2XITA 3I3SR 3KB2A 2BEJA 4B75A 1DPFA 2BVNA 1G16A 3O8BA 4N1AA 1GP2A 3BRWD 4ASUA 1LY1A 2DY1A 1II8B 3BJIC 4LK2A 4HLQB 1OXVA 3FMIA 4C2TA 1RRFA 3ZGXA 1BH2A 1E0KA 3A36A 2HMAA 4C0JA 2BWJA 2ZANA 3LQQA 4IEEA 4RKEA 3PXGA 4BWYA 3E20A 2ZSEA 4L4UA 4MUBA 1KI1A 4XD7A 4BE7B 4DLTA 3ADCA 3B78A 2BM1A 2V7QD 2QEQA 2Q3HA 3A1TA 3T61A 1P4SA 3R9XA 3OJXA 1NJFA 1IAQA 1FNCA 3ZC3A 1QGYA 1XEXA 2WWXA 1G21E 3QXCA 1JEEA 4IVRA 1AS3A 1BMFD 2OT3B 3LV8A 4C9BA 4RJLA 1TQ6A 2CRVA 4KI0A 5JRJA 4BRUA 1GJRA 1CJKC 4NPHA 4OL0A 4Q03A 1DADA 3Q3JB 2QA5A 3QIAA 3SS8A 1L4UA 2GZHA 2ZRPA 5IHPA 2ORVA 1CR2A 5FUYA 1X8KA 5TARA 4CEJB 1RIFA 4FCVA 2BN4A 5C46F 5FBQB 1NL3A 5FUWA 4DCTA 4XVUA 4BFUA 3AP3A 1B0UA 4NYJR 3K0FA 3K0SA 3LFUA 4K1XA 4JL6A 2JLSA 4L16A 4ASUD 4QRHA 5FL3A 4XOIA 4U7DA 1XJQA 1S3GA 2KSQA 5JWOA 1KZGB 3CZPA 2WTUA 3W5UA 2Q9BA 2F1RA 3D31A 1U81A 1S96A 2FEOA 4QXAA 5CITA 3AGQA 1AQYA 3LW7A 2ZU6A 3QSYA 3X2SA 1NSFA 2VHCA 4GSYA 5DYIA 3I1FA 2ZUBA 2E87A 521PA 4OI2A 1CIPA 4B33A 4B3FX 1P75A 4CRWB 3W5VA 4DLUA 4L9WA 5IF9A 3U44A 4FXPA 5HKKA 1UM8A 1XEXB 1R5BA 4P3YA 1F5NA 3T15A 5EE1A 1ZJ6A 2IUTA 4C30A 1BKDR 1G3MA 2QRNA 2J0QA 1OFHA 4KLZA 1VQKB 3AVWA 3L8YA 5E4FA 4DCSA 1D9XA 3GEEA 4BFZA 4TZ6A 3CCVB 4LBZA 2F43B 1Z07A 1VQ9B 2JAQA 2QGNA 1BJKA 4PANA 4BUJA 3THXA 3LXRA 4QNMA 2NZ8A 1MR3F 4HLDA 3BWDD 4TL6A 3MGCA 4OHZA 3PEYA 3ZBTA 5TVKA 3DOEA 2QAGA 5FOXA 2AN9A 2Z0MA 3KKPA 2AK3A 4A4DA 1PZNA 1RRGA 1E98A 2QTHA 5EE3A 1KO8A 2Q9CA 5FBLB 2OK8A 4A2QA 4XJXA 1Z6GA 2WICA 1OFTA 2ATVA 2QAGC 2R6AA 4HUTA 2KBEA 1EFRA 1FOEB 2HEIA 4JIMA 3WHKA 1NDHA 4JVSB 4URZR 1E62A 3QG5A 3QKRA 2ONKA 4IVPA 3U3RA 4D4MA 4URXR 1N2CE 2ZRJA 3U44B 5CK4A 4DXAA 2CMKA 2P5SA 3I92A 1Z06A 4XTRA 4UXIA 4WBSA 5H68A 4DQLA 4KFSA 3ETLA 2VZLA 3EASA 1N5JA 4H9GA 5KDDA 1MV5A 4MGKR 1KSHA 4JLNA 4WOPA 2DEUA 1GILA 1Z0AA 1WP9A 3THXB 2AL7A 5JMTA 3WNCA 1Z63A 1IM2A 2ZRKA 3LDAA 3OIUA 3CM0A 2GHIA 2YKGA 3TNFA 3E5HA 4MYTA 1DG1G 1KJYA 1Z47A 3VR1A 2ZRHA 1W35A 3W2IA 4YXWA 3RRZA 3UMFA 2JLZA 3LLMA 5FBVB 2V8OA 1LNZA 1GITA 4FI3C 3VO2A 1VG8A 1DAKA 1Z2AA 2YINC 2OILA 3KUCA 3RHFA 1CQXA 2V4ZA 1EFRD 3WNBA 1DDGA 1XB2A 1E2HA 1MO4A 1QHYA 3KJIA 4Y9RA 1CULC 2GA8A 2Z4RA 2CNWA 3KXIA 4URVR 5KSZA 1HQYE 1S1MA 1COWA 1VCMA 2WJJA 3I32A 1E2MA 3KTAA 4QHTA 1T3LA 3QKRB 5EZ6B 1HQCA 4TT3D 3VX3A 5KO2A 3PG5A 4B3BA 2QMUA 4ACBA 2EFDB 2CJWA 2GEVA 2ZREA 3MG9A 4OYHA 3VR2A 4K81B 1NVXQ 1XMIA 4Q00A 3GFOA 1QX4A 1G7TA 3CRVA 3T12A 4LGMA 5A0FA 2RB4A 4G5GA 5TXGA 2FSIA 1HYQA 3H0KA 4D82A 2HF8A 2Z6VA 5DN6A 3UATA 2O8EA 1E94E 2HF9A 2ZXUA 3AVPA 4N0EA 2FA9A 3RC3A 5AJYA 5DH9A 2J0VA 4YXWD 5EE9A 2ZRIA 3I73A 3EZ6A 2WM9B 4HZIA 2KI5A 4I1VA 3TIFA 5AJWA 1BS1A 4KBGA 2B5OA 4CYMA 2ZI9A 1LW7A 2VL7A 4WXPA 4HAYA 3AB3A 1VQPB 3HPRA 1M7BA 4YHBA 1N0WA 2CNWD 4EPXA 2Q3FA 3W5JA 3U2QA 5DGXA 2FDCA 1KAOA 5L3SA 1RW4A 4PZZA 2R8RA 1K5DA 3KTAB 1F6BA 5CIWA 5EP4A 2OTLB 2JJ1A 5AK0A 4GL2A 4QGFA 2CJWB 2ZRDA 3ZZUA 3AVUA 1SULA 2AWNA 4JLPA 4DC9A 1TNDA 4MGZR 3CRQA 3OAAA 3BERA 1SZPA 3A4NA 1Q1EA 1H42A 1W44A 5JWRA 1ZCAA 5CYPA 5DN6D 4JBWA 2GXUA 1KSJA 4PZLA 1AMOA 1W34A 3RWOA 2OLJA 3FMPB 2O8EB 1ZM3A 2XB2A 3EX7C 3A4LA 2GETA 2QTZA 3GEHA 3N2IA 4UXHA 2PZGA 2UVQA 3RABA 3NXSA 4JL5A 4DIDA 1NY6A 1ESMA 1Q1BA 2C04A 2PT5A 5G3YA 2OBNA 2ZJ8A 1FW6A 4KSBA 1P9WA 1M6NA 1Z6AA 2ZE7A 2ZR0A 3BC1A 3LD9A 4W5HA 4A9AA 3T1TA 4AY2A 1W0JD 2R62A 4B34A 2AKYA 1B2RA 2AHOA 4CIDA 4D6PA 2LKDA 1LS6A 3GJ8A 1KOFA 4IEIA 1AZSC 4JLVA 3J81k 4A92A 1E9CA 4TSFD 2RAPA 2W83A 5L3SB 2BKEA 3N5CA 4LZZA 4BFXA 2QA4B 2ZR7A 2W2TA 3V4RA 3QBTA 1NSTA 1EFTA 3GCGA 1XXHA 3EZ2A 3FFBA 2CNDA 3EZ7A 5BYKA 4BLQA 1D2MA 3EIEA 1VG9B 3P20A 1N25A 2A30A 2QTVB 2R6GA 1CJVC 3OAAD 1O3YA 2G6BA 3ZDQA 1H8HD 1W4BA 5JJLA 3K0AA 4LHXA 3RSOA 3KXLA 1VYTA 2PX3A 5KNDA 4ARZA 1NRJB 4GBMA 2OUKA 1VG0B 2J87A 3U3KA 1D6JA 2VIIA 1JAIA 1GKIA 5EXSA 5FBWB 3LBHA 1YZTA 3W2HA 4G1VA 1OYYA 1XD8A 1Z0KA 3FE2A 1R0WA 2VSOA 4R98A 1OHHD 2CE7A 1G17A 4YC7A 3LXXA 421PA 5C18A 121PA 3BS4A 1E2EA 2IUUA 3U7EB 3IGFA 4ESVA 3T1OA 4B2PA 3VKHA 4G1BA 2ZJ5A 4GOJA 4KO8A 4MYCA 4ZO4A 4M1SA 1JI0A 4DJTA 2BC9A 2J46A 3PUXA 5FPTA 1W0KA 4DCUA 5TMPA 4G1UC 3KQKA 2BBSA 4CVNA 4GPTA 4XSGA 1IN7A 4Q21A 2J59A 1WDTA 4YAFA 2X3UA 1E32A 1NN1A 5KSOA 1YQTA 2QSZA 3SFVA 3UWOA 3K0AB 2A78A 3DZDA 4C0BA 2WV9A 4P6VF 4ARZB 4DVGA 1HE8B 1ETUA 1RPZA 4KBFA 2MMCA 4YONB 2QP4A 4QGHA 4UNRA 2EVWX 5DHAA 1ZMXA 2G0NA 1Z2CA 2V1UA 3VTKA 4WZBE 4DCVA 1FNDA 4M0LA 1U98A 2ASEA 3QPVA 2IYZA 2PIAA 1E4VA 3A6PC 3MLEA 3G71B 1J7KA 2DYKA 1NIJA 1E9FA 1Q1ZA 4RZ3A 3QI2A 3TW4A 1Z8FA 1RRCA 2D3WA 2F9MA 3B1ZA 4O2LA 1W4AA 3K70C 5DI3A 1DOAA 1GSIA 4PC6A 1SGWA 1TEVA 2DWQA 1TU3A 3AF2A 3W90A 5FOTA 4Z1MD 2ZE6A 2GJ8A 1AGPA 2VH5R 4GFDA 2X77A 2CE2X 1H85A 2C9OA 3NG1A 3NBZC 4LPSA 3RS3A 1JA1A 1VQ5B 2QSYA 2I3BA 2WKRA 2JLYA 2HUPA 1MABA 1CKEA 2OFXA 3C16C 2GJ9A 2ZRFA 3AV0B 4KU4A 4OBEA 4ITRC 2QTFA 5CIQA 2X2FA 3TGPA 4NCHA 2YOHA 3IILA 2RGCA 3WYFA 1XEFA 2VNJA 1J70A 1SVIA 4XIGS 4HYYA 1U9IA 2ZI5A 4H1UA 2ODEA 3VR4A 2QM8A 3NEJA 3SDZA 4PO8A 2GZDA 2BJVA 3GLIE 4NYMR 1XWIA 2RMKA 3OFNA 4HLUA 4RZXA 3CNLA 3ZVLA 1R6BX 2REBA 1EXMA 2P2LA 1T4GA 3JZAA 4LJAA 2NTYC 1ZVQA 2C96A 4TTRA 1EGAA 3AUXA 1DELA 2QRZA 3AH8A 4PSVA 3SR0A 1QGAA 3I61A 1VKJA 1ZNYA 2XNJA 4Q48A 2WOJA 3EW9A 2CLSA 4NCJA 4DWJA 1OYWA 4PZYA 1FP6A 1U0LA 5FI0B 4A8JC 3EPLA 1JPJA 2IS2A 3G4SB 2Q0HA 2EIXA 1F3OA 4OQFA 2RC5A 1IHUA 4NCIA 2IXEA 3A1VA 1FNBA 4PHTA 1MABB 1XTIA 2Q3MA 3L82B 1SQ5A 4FN5A 2FF7A 2ERYA 1DTSA 3SBEA 1WQ1R 5EUMA 4KFRA 2BPOA 1ZM2A 5DHFA 4J0QA 3U4QB 4GDFA 3EZ9A 2DETA 1N6IA 5EQTA 4ZGQB 3BH7A 1LB1B 3NBXX 5IDVA 5UKDA 1UAAA 2VLIA 2QL6A 2YOGA 4DB2A 1I2MA 2PEYA 4IOJA 1KYIA 5EXTA 2UKDA 4XVRA 1IN5A 4LBVA 4FMCF 3W6PA 4B2LA 4HAWA 1NG1A 4G5RA 4AF7A 4L8GA 5JFGA 4PQRA 5CJ2A 2QT1A 5AUOB 5JEEA 1SVOA 1ZD1A 3MUFA 2FEMA 3B1WA 1Z3IX 1P2UA 2A5FA 3GLHE 4KYUA 3WBKA 2CVHA 1VQOB 1QHGA 5FPHA 1XEWX 3PUYA 4Q4HA 1F60A 1UFQA 2X1VA 2NPIA 4HATA 4A82A 4X8LA 2ONJA 1OH7A 3U3JA 5LBIA 1XFAA 5B30A 1ZUNB 3KFXA 5HZKA 1J8MF 4FMBB 2FFHA 1KO5A 3KXKA 2HXYA 4Q4AA 3CW2A 1DBSA 3TR5A 2G3YA 5GADl 1K5GA 1ZYUA 1CR0A 4A0FA 4BZPA 4D4KA 3WP1B 2NQ2C 3U3OA 1XPOA 3U3MA 4BLOA 1EFUA 4DDUA 1YU9A 1DAMA 3DPUA 1Q7YD 1WXQA 3FKSD 2P6RA 1CXZA 2SHKA 2BJWA 4MDEA 5FR1A 2XSZA 4Y0AA 3CX8A 1UBGA 3U5ZB 1E1QD 4A36A 2IK8A 1E2KA 1FNNA 2YWGA 2RCNA 5J4LA 2L0XA 3HWSA 3CCUB 2ZAOA 4O3MA 4IDNA 4D0NA 1R5NA 5JHHB 1ZC4A 3HYRA 1A2KC 4BFWA 4LJ8A 1D2NA 1ZUHA 3OJWA 3O8DA 3Q7QA 4GP6A 1NN0A 4L9SA 2WAXA 4U02A 1RRPA 1WCV1 1OGJA 2HJGA 1Q21A 1NBMD 4Q4HB 1YJWB 2QGZA 2IT1A 4Q19A 1G64A 4ERNA 1GDDA 3KKQA 4DLYA 2R2AA 1Q0UA 3AEZA 2F3TA 1NBME 2BHRA 4TMTA 4M1OA 4Q4AB 3DMNA 1OW3B 1SVMA 1TX4B 1E96A 4RFSA 2AXPA 3TLXA 1NVVR 4KFTA 4N3GA 3BH0A 5FPSA 1U8ZA 1O87A 4BZXA 2UZIR 3GQBA 1XTRA 4IDHA 3NDPA 4X8HA 2RKOA 2XSZD 3SJAA 1SKYE 2DERA 1E2JA 1G8HA 1E2LA 1E4YA 2D7CA 2F9LA 4OQNA 5FR2A 1VYVA 4LWZA 4R7ZA 4V0LA 4PC3A 2FPLA 3QE2A 4V03A 3CCMB 3DMDA 1M2OB 4JBYA 4LCBA 1SXJD 4W5JA 1VCNA 4NBSA 4TMKA 1SXJB 2CCKA 4NHOA 4AWXA 4TTPA 3RYTC 2V54A 1J9ZA 1CNEA 1GOTA 2YWEA 3B6EA 2OESA 3L0PA 3PFIA 4FMDF 4AK9A 1KD1D 4CF7A 1M34E 1X1RA 4EUNA 4F92B 3QOFA 1SXJE 3LO8A 3KKMA 2EFEB 2ZJ2A 2GWHA 3K8YA 2O0JA 3AM1A 4ZKEA 2QMOA 1DG3A 5P21A 3OESA 1QHNA 1FNMA 1N6KA 5TB5A 4IJMA 2DFLA 3NBYC 3ND9A 4HB4A 4AYWA 5E3HA 1YZKA 3KB1A 2ZI4A 1P61B 4TLEA 2ORIA 1GNQA 3FFAA 3RS7A 4GRAA 4C2UA 2WJHA 3VNVA 1BQEA 3H4MA 3LH5A 3G5UA 4RFSB 1W47A 4U5XA 2NO9A 5L3RA 5G41A 3WYAA 4PGOA 1GG2A 1QDEA 3SJCA 2D62A 4LY6A 1IY2A 4D4JA 1E2QA 2C77A 2QAJA 4QM6A 3D3QA 2GBLC 4YAOA 2WSSD 5SZJA 2W6IA 3RLFA 1U90A 1XNJA 2VYQA 5H5JA 1U2RA 1GR1A 2BDTA 3QBVA 3LWNA 1BYIA 3MSXA 4WVFA 2AFHE 2AR7A 1UKYA 3SZRA 1KSGA 5EMNA 1EFCA 1KK3A 3KKOA 2OHFA 4ACAA 1YZLA 2VYFA 1JBKA 2IYRA 4PPQA 2DFTA 2AD5A 1QGZA 4TL7A 4OQXA 1TF5A 1EWRA 5AJVB 5LD2C 1G7RA 2VP2A 4B3XA 2QROA 4V0MA 4DQKA 3QKTA 4AURA 3B1XA 2HT1A 5JJIA 1NG9A 1ZNXA 2J9RA 4DIEA 4TYNA 4JVLA 4OJQA 1HT1E 2JATA 2JLXA 1XPUA 3EZFA 5FOVA 4CEHA 2H92A 5FOSA 3VU9B 2VP0A 3HPQA 3L0SA 5SZIA 2QDXA 3HP1A 1JEDA 1R0ZA 1UBFA 3N2EA 1WBDA 1ZD8A 1BOFA 1XZQA 1CJUC 2VO1A 221PA 4YMSA 2PLFA 1R2QA 2V6JA 2XXAB 2H8KA 4UJ5A 4CW7A 1P6XA 4AKGA 4O0MA 1W7AA 1GVNB 1OH6A 1ANKA 1DE0A 2H18A 2AXNA 5CDFE 3CF6R 5FOUA 3THOA 3X1DA 4NYIQ 4L5BA 4B2IA 4R9UC 3NC0C 1AIPA 1SHKA 3CKLA 2HT6A 3OEED 5C4GB 5KOYA 3GJ0A 4DLVA 3DHWC 1N5KA 2HLDD 3I5YA 5GJBA 3AVTA 1RYFA 2ZM5A 1PLJA 5IK2A 4WZ6A 1R8QA 2IC5A 4TLAA 4RY2A 2XZLA 4PC2A 4B4DA 4QHYA 1SHZA 4TLBA 1W5SA 4RVCA 1QFZA 4DBLC 3OZXA 5AR1A 3TQFA 3I5XA 1XRJA 3C7KA 4NKRA 1QHSA 3H86A 3DDCA 5L8VA 3ASZA 1GWNA 5KDLA 2XZPA 1RZ3A 3JQPA 2OCPA
chains in the Genus database with same CATH superfamily
2IU3A 3A0UA 2IYSA 5DF1A 2O1SA 1QV9A 1A50B 4DR1B 3ZDCA 3RUDA 3V32A 1MT0A 3K94A 3ORRA 4FONA 3ZE6A 3E48A 2R25B 4ZQBA 4ZEVA 2C92A 3IIEA 3T1HB 3GN2A 3RRNA 3PDWA 2JLRA 2G0TA 4AS3A 3RUPA 3G2LA 2CHGA 3FTDA 4N3AA 2AC2A 3N3BC 1KI6A 2A67A 1D7AA 1LC0A 3L6UA 1PJ3A 4LXTA 1KKMA 2EX1A 3FYDA 4V1CB 4NONA 1JPVA 1DT3A 1BVUA 3BXPA 3LBIA 1DCMA 3DTTA 1QIFA 1QG2A 4Q18A 4U00A 1UMKA 1UD2A 1YMQA 5CX1A 4N5HX 3EB9A 5TGZA 4D8VA 3PF8A 2Q6LA 1XMJA 1YJCA 4BL5A 2BDUA 1PBTA 2CNNA 4KBYA 2DC1A 2CHUA 4CMIB 2CDRA 3E2IA 4M1KA 2FEAA 4HH0A 4PPGA 1O2DA 4RWEA 3UANA 4F7WA 1UPXA 2HMYB 3KZOA 3ZQUA 1ONOA 4PYQA 3R7NA 4YMVA 4Q05A 5B58T 1DAIA 3AFOA 4AAYA 3G5TA 3R6GA 3VR5A 3IH5A 1UPUA 3H1EA 2WJ3A 3OEHA 3HP7A 2BFOA 4C0XA 4NQRA 4OAOA 4XX1A 2FR8A 5HRCA 3PQEA 1XMXA 2WUVA 4RIEA 1NM5A 3DZ8A 5FI3A 1CUXA 1OLXA 5FX2A 3N1UA 3TCKA 2CEAA 2ZUUA 3P19A 5K4GA 2PXAA 2QLNA 1GN9A 1L5HB 4DIOA 1BCSA 4ZREA 2AKAB 4J6EA 1UP6A 1DFGA 3AUYA 3LGSA 2ZJOA 5G0TA 5AVQA 1WPCA 2F55A 5IAJA 3AM3A 3AERA 2JLQA 5AP9A 2R44A 1NKTA 3CNNA 3VDNB 5L3ZA 4UBIA 2VPWA 4OQZA 1EU1A 2WVJA 5IZCC 2RFLA 2JZNA 1F6WA 1P4GA 1XO1A 1WZ2A 3C8ZA 2PBFA 2ZGVA 1RPJA 4TKZA 3ADDA 1KORA 2ESRA 4RPDA 5B37A 1AXEA 1XVAA 2PWAA 4HV4A 2IHKA 3SQLA 4KR0A 1C2TA 1Q22A 2Q45A 4NECA 2J09A 3TTUA 3DWFA 4DR4B 1ZINA 2XUAA 3EG5A 1XHLA 3EMDA 4EQZA 2FQQA 1V7QA 3TFQA 5LP6F 1G8MA 2JEOA 4KRXA 2QUKA 4HSEA 3CPSA 3DQZA 2H4WA 3TLKA 2DBYA 3VKFA 3R0JA 1GO2A 1Z0FA 4ERXA 4OX9Y 2BMVA 1QP0A 2YWHA 5G4KA 3LZCA 5HRUA 1P60A 4OM8A 2ZLBA 3TAXA 2FFBA 2QXYA 1LZKA 3GWGA 3PYLA 3Q7SA 4YS6A 3K09C 3B7PA 1LS1A 1QO9A 1T3TA 3CZMA 1NBEA 2QORA 5DTEA 2J4CA 1EWVA 5EZSA 3DMRA 2EFCB 5I4CA 4NYIR 1AE1A 3JQ9C 3LL4A 2Y9PB 3M34A 2GPYA 4NJMB 4CCSA 2AFRA 1XMVA 3KUDA 3C3KA 1E3MA 1Y63A 4GKVA 2HRRA 3IYLW 3AR6A 5CB0A 2XXJA 5EIAA 4WXRA 1VPLA 4ZVNA 2NO1A 3O91A 2BGTA 1ZM7A 5CA0F 4MAAA 2Z56A 4ZVTA 2ZL7A 3SZGA 1UBKS 2WIGA 3DOJA 4JUBA 4TKVB 4ZDJA 2F8TA 4WPGA 1VMAA 1UZAA 1IEQA 2J48A 3OZFA 4KQGA 1NLUA 2PUWA 4YIKA 1Q3KA 3GNQA 3ONWA 4HDSB 2DSNA 1D3AA 1HT0A 3KVRA 1E20A 3SK0A 6REQB 2OL4A 3LK6A 2B0CA 2I2DA 4NH0A 4R1UA 3VAYA 3WLFA 3EC1A 3SVZA 4Y7DA 5D1HA 1CV2A 1QCZA 3DFIA 4NG4A 5BN5A 3P4YA 1YR2A 1MOSA 1GZ7A 1YS9A 1NJ8A 4AIRA 4Q1FA 5FWNA 5LZ5A 2H6EA 3SQWA 3UHPA 4NTZA 3E81A 3EYAA 3GFPA 1NVBA 2DUNA 4L8FA 3AV3A 4AJHA 1XJCA 4YAKA 3O8NA 4MQLA 3HJGA 1MOQA 2I1QA 3BSFA 1B00A 2VF8A 4UARA 3KTDA 1LTKA 1TK3A 2O3UA 3DEZA 1PZFA 2HKIA 3F6EX 4FILA 4PYNA 5EMMA 5HIJA 1I2CA 1DO0A 3KYBA 1M2NA 2QM0A 3N05A 2PANA 2R6FA 3O73A 5E0KB 5HZHA 4S05A 2Z6UA 1F2TB 4ILKA 2QJFA 4WBNA 3BHJA 2I1WA 3BQNB 5ALJA 3WC4A 3W04A 6ADHA 4IS3A 1E5QA 1UFKA 3Q2OA 3K1TA 4IKOA 2IYLD 1SIBE 2VZEA 3DPIA 4UATA 5EKSA 1W4ZA 1H6CA 2H7VA 2C2OA 2O0LA 3SYLA 3R0XA 3NTUA 2W2PA 3ZXUB 3RV3A 1YJ9B 3M3PA 5B4TA 4OGKA 3P9SA 5FPKA 3E15A 5FIUA 4IDCA 1OX4A 4QJIA 1E77A 1LXCA 4JJZA 4KN9S 5M2QA 1U2QA 1JMVA 2XTAA 4ADSG 1AK1A 3Q1KA 3RVJA 2UXDB 1SU7A 1VP9A 5KJEA 1BYUA 1KDYA 2YXDA 5J4HA 1GGKA 5BMVA 4QYWA 1U5CA 3WVNA 4DRZA 4J4BA 1K27A 5EHNA 5DGDA 3ZYCA 3WWDA 2FWBA 2I1LA 2YHIA 5I7WA 3F7TA 4FFVA 3AW9A 4IIDA 2WHXA 3BC9A 3WG9A 3HL4A 3P4UA 5IW8A 1Z6XA 3JW8A 2QT9A 3ENWA 3FRIA 3W5DA 1NR5A 4YV0A 3ZNOA 2FSFA 5ELXA 1YQEA 1MX3A 4K9PA 4J0GA 4N03A 3LPCA 4FZRA 2M6RA 2NU9B 1K98A 4EKIA 3TGLA 2ZAMA 1YITB 1NJGA 1XALA 3ZCXA 4B8WA 1XK7A 1U0JA 1NXVA 2QUJA 1F51E 2B6HA 2CVZA 4JBGA 4O02B 4M1EA 4PPFA 5AKHA 5E9QA 3BH6A 5EHXA 1T43A 2UUAB 3AP2A 3OP4A 1SQFA 2Q2NA 2C4NA 4LUCA 4RK4A 1YKGA 4EPVA 2GJRA 5LQSA 4Q7LA 4QU8A 1HBJA 5ALGA 4YIHA 2K4MA 5CNKA 1QB8A 2W2KA 2A0YA 3HY3A 5I9BA 5AUNB 4DNOA 3OQ1A 4WFQA 1OZFA 3K5PA 4YRLA 1GPH1 1EDBA 2HPVA 3F3KA 3RTCA 1JECA 3ZE2B 4CM1A 4Q9JA 4U3JB 4CCAA 2JJ8A 3JYHA 4Q3KA 3H4VA 4KGXA 3LP5A 3KQVA 2OZLB 1NN5A 3K0CC 5DCWA 1PJQA 2HYIC 1AA9A 1M6HA 2DQYA 1VIDA 4LX0A 4P83A 1RLJA 3DOHA 4W7SA 2IY9A 1V16A 1FUEA 3M6FA 4F06A 2NZXA 1VMIA 4J75A 5C80A 3FHJA 5DOZA 3WE7A 1JEJA 1R50A 4W1RA 3B2QA 4YMUA 3PTLA 2FW9A 4NF2A 2BEVB 2IHBA 1A5TA 1GL9B 2C3YA 3KZNA 4ZXFA 2DFNA 3IIMA 1QDUA 2VTKA 2F1JA 1E9VA 1Q95A 1H2ZA 3KV1A 4PLFA 4ZOCA 2JFYA 4EW3A 16PKA 1JDZA 4KSCA 2I2AA 3SEJA 1NQ5A 2R8EA 3I58A 4D9EA 2B99A 3EGCA 5HJ7A 2Z57A 1W59A 1XNHA 1Z0DA 1NQUA 2FPPA 1YJXA 2X5KO 4FHDA 4MS4B 4R2IA 5LM3A 4MPPA 1O95C 4ZQIA 2BHLA 4GM4A 4OK6A 3TAHA 5DNAA 4CJXA 4RVOA 1EKXA 2WW8A 4Q7KA 2C7PA 2W2LD 1M66A 2J3MA 5JLAA 4D4JA 2BMDA 1ZJZA 2H4YA 3TTVA 1N9GA 4XGQA 3S0JA 1JRLA 3BJEA 1XSEA 4MRSA 4OBBA 2CL7X 3GFFA 3ZGOA 1YCHA 8GPBA 1K3FA 1JG1A 1QC5B 3O7MA 2FZCA 1C0IA 5ALZA 5TQ2A 2WJVA 4RM3A 1XXHE 1MO3A 1BW9A 4YWJA 1R4MA 5KNDD 1B0PA 1E3XA 3M6LA 4BLRA 1KMQA 2IY7A 5CLQA 1AKWA 4W63A 4BNXA 1ECBA 2WTNA 4ND5A 3GA5A 1BFDA 1NT4A 2V74B 1NT2A 3A6KA 5A62A 4FMDB 4YTEA 1B8NA 4KXQA 1H4TA 1HNWB 2GNOA 3LVBA 1N0IA 2BMFA 2OEPA 3VZQA 4TZ0A 1VECA 4D74A 1T8TA 1EP2B 4R41A 5IAKA 1CVRA 5AK3A 3UC9A 3UQYS 4CI9A 2VTBA 3UAOA 4WXEA 4HHEA 1ZKMA 4IUDS 1VMEA 4PBRA 4TMZA 5B7QA 1OGYA 2XMSA 3H0CA 4ZYWA 3UCEA 3H8SA 3FOEC 2RGUA 3QBJA 3Q9UA 4AJIA 3F71A 1Z08A 2OAP1 2NO4A 3AR8A 1LEHA 1TEXA 1VPDA 5BV1A 3FUUA 3F98A 1XDDA 1VL0A 1M1NB 4ER3A 3KIPA 3U61B 5JNVA 3INYA 5B3AA 4MP3A 4GR4A 4OH1A 3VKWA 4JNCA 1D2HA 2VZ8A 3DW3X 1LF5A 3WKDA 3R76A 3O9ZA 4HGQA 2XDQA 4PX9A 5IJ0B 3PLAE 1E92A 3TE6A 4EPTA 3U60B 3IMFA 4EK9A 4EY7A 2A92A 4X5OA 2G82A 4M8IA 1PVDA 4NS1A 3HYNA 3Q41A 1FRNA 4M21A 3JATB 3K6RA 1QTRA 1T13A 2O2ZA 4O4IF 5EP3A 4MUXA 3RYHB 3WJAA 3UFXA 2O14A 2AZDA 3LMKA 2G7ZA 2MR6A 3NIDB 3T34A 1AN0A 1JR4A 4PHFA 5TT0A 4M1MA 1RLUA 1GXSA 1X1EA 1VLOA 3GROA 1LC3A 2F3UA 3NEAA 2VNKA 2H1SA 1Z5ZA 2XMBA 3KRTA 2WTMA 1VBNA 2ZTSA 1Y9AA 4FZ5A 4IIFA 2J67A 4M2LA 1RHKA 2PAFA 1XNQB 1TJNA 4JB3A 2V0GA 4O1MA 2VHWA 1L5YA 2C3PA 4AJOA 3K70D 1U2GC 1PFYA 2JGDA 1SJ9A 2DT8A 4JT2A 4KE8A 5GINE 2HA6A 3S68A 1ZMTA 1JHUA 1O08A 4H3KB 4Y2VA 3RFCA 3T5CA 4A2PA 4AMUA 1I7LA 1NVVQ 1P9NA 1P9LA 4MVJE 5C52B 4Q4LA 1PEYA 3Q9NA 3RWMB 3L2OB 5F7ZA 3WZMA 4WADA 4H7EA 1X92A 3WR5A 1WOPA 1U9CA 3L7NA 4HK4A 2AJ8A 1GL7A 3I9NA 1DKMA 3E8XA 1DQNA 1OTHA 5EJ6A 3KU4A 1QDLB 1EGHA 4C3OB 4BDSA 3BA1A 3OMLA 1KI7A 3TZCA 5FBKA 2PT9A 4V0KA 2ETXA 3KVYA 3GVHA 4MI9A 3VNRA 3TJRA 4A91A 2X13A 3CPHA 4ROTA 4ZOLB 1NZFA 4QDXA 3HMQA 3IIKA 4BTEA 5A9SB 4P3XA 1GD1O 3NTOA 4LJ7A 5AHRA 3E2PA 3GGOA 2ZS8A 2HFKA 5IXJA 1LV7A 4F5WA 4PC7A 4JT8A 4CF3A 4L5CA 4ZARA 1SPBS 1A2QA 2V3WA 4FB5A 1M6EX 5IDWA 1GTVA 1O54A 2F1HA 3IS3A 1ECPA 4MVJP 2DHCA 3RS9A 4JC0A 2R7AA 1K06A 1Q3HA 1ZESA 2CHQA 2NV0A 2VDWA 1F7VA 2IUFA 3HCPA 3OZ7A 2CEKA 4IIHA 2O2YA 2D7DA 1PJTA 2EZ9A 1WSBA 1BXGA 1XCMA 1CP2A 3O4JA 3OFND 5AOBA 4P9SA 2XT0A 1C29B 1E3WA 2C54A 3N2YA 2QRJA 5HE8A 5BWMA 3QE0A 4HE6A 2RGDA 1A0OA 2FY8A 3AJEA 4C0HA 1DJPA 1NIPA 1PAUA 4G9EA 4YK7A 4IBOA 4A8JB 5L3QA 1IN1A 1WF3A 4Z4RA 4RKFA 1IHPA 5IVPA 2JAUA 3CLVA 2GPTA 2FWRA 1RI2A 5HCNA 3W05A 4Z6KA 3ZV3A 1PJSA 3LG2A 1CNMA 2FMHA 3SMVA 5L6MB 4DFDA 1PFUA 1T15A 1WIWA 3LUKA 4WKBA 3FHTA 4U1RA 1K6EA 4KZKA 5F5NA 3A4VA 2NXEA 3IERA 4DANA 1T4DA 3UAXA 4HPXB 4NFYA 4DJJA 4HFMA 4URHA 2OECA 3FTQA 1Q84A 1Y9DA 4IJQA 5JO9A 1Z35A 2FHPA 5IHXA 2PLRA 3HK2A 4EUFA 3C3XA 1GDHA 4JYMA 1GAJA 1P5HA 2J30A 4XVCA 1KI2A 1L5FA 3DBOB 2WAYA 3Q7TA 1UBEA 4A15A 5GONA 5E6RA 1H05A 1WUKS 3AOGA 4ZGBA 1EM8B 3H2YA 3NTQA 1Q3TA 1FFHA 1WU8A 1Q2UA 2G1UA 3H1TA 2XCQA 4U2FA 1CUZA 2Y27A 1HA3A 5DBIA 3SU8A 3WHIA 3R7LA 5E1OA 1DOHA 1DPGA 1V3UA 1GNRA 4ZI5A 3EFEA 2HDOA 3VPXA 5AVSA 4TVSA 4YT2A 5BR7A 3EDCA 2JH9A 2QXTA 4D45A 5C8ZA 1TLLA 5J47A 5KMGA 5BPFA 2J3IA 1WD5A 2F48A 4BVFA 5HYVA 3B60A 4BXOA 2WMNB 1A9ZA 3NNDA 5IMBA 5GJVC 1ES9A 1PN3A 1U99A 1VQ7B 3P0JA 4JOBA 3MUNA 1XG5A 2GD6A 2RK3A 3V76A 1LK0A 3O3OB 3QPCA 3GRYA 1FPQA 2B7CA 1AU9A 3JQQA 1X1AA 2OBMA 2TRSB 2FMFA 4IX9A 2IZ5A 4A3SA 4QUAA 3VNSA 3AUAA 3LUJA 4HPWA 3DG9A 1U6KA 3OM9A 1V9LA 1CE8B 1Y8CA 2VBVA 1K7YA 2D3TA 2PEZA 3IKJA 1EZZA 3B7WA 1P3DA 2BOVA 3E1GA 5D8DA 2VJIA 2QYOA 2VHXA 1S2LA 4PAMA 1ISGA 3Q11A 4LV5B 4MV1A 5KYKA 2VQSA 1I4EB 3QX7A 4JENA 3REQB 2P5UA 2CZGA 1P0IA 1YRHA 4ZQCB 3CH6A 5GVSA 1KZ7B 2IYQA 5L7YA 3EGXA 2WRZA 3NPAA 3IVGA 4NV0A 4PR3A 5EP2A 1U7TA 2RHLA 2EIHA 3IQWA 3AR2A 2QIOA 3PX2A 4C7VA 3NM5A 4KNYA 4CMEC 4ROSA 4D9JA 3EHEA 4DIUA 3G2MA 3OIYA 2I80A 5AI8A 3OETA 4X90A 1JDBB 4EWLA 3SYRA 4OLBA 1WOOA 1J2YA 3EEBA 4YP5A 3A2NA 3FPJA 1NOIA 1DEOA 3MXTA 3MHTA 5EZ5A 1KZ1A 1F0PA 3CLTD 3G68A 1QORA 4EGFA 3T5DA 3D8BA 3KOZA 1OU4A 2WAMA 2C2HA 2QHXA 3GA7A 3R4VA 3PICA 3U4IA 4EGSA 1UBNA 3WWZA 4XCXA 5JSQA 1VL5A 5K3CA 4OHWA 2YC2C 3T7DA 4J0JA 3Q5DA 3O1LA 3NALA 3S2EA 3TZBA 2H4FA 2Q5EA 2P4SA 2QQEA 3DZHA 5DDIP 3FOBA 2XJ4A 4DLZA 2W0MA 2W6NA 5CHYA 1GLNA 1OA1A 2EDAA 5THKA 4BB0A 2YZMA 3HVHA 3MB5A 1P45A 1IXZA 3DC7A 3I8SA 1SIWA 2DKNA 4LQLA 5BYAA 1I94B 4YEDA 3JPYA 3NIBA 3FXAA 2VBIA 4FYVA 2EYUA 2KX7A 3AIOA 2PX4A 1FNSA 1LTHR 3C3JA 1IXRC 4GOKA 4D8YA 4E5SA 1JGTA 3BXFA 2ZAGA 4HAVA 3OQIA 1VIYA 3ETEA 4HAZA 1K63A 4CV3A 2ID9A 2RGAA 4RM0A 1WUHS 2X2PA 1W88A 4I14A 4Z4QA 4XA8A 2D06A 4GOND 3OOSA 2ODBA 5EZQA 4XIJA 3VSBA 2FZ5A 4MSUA 3T06B 4I4LA 3HLTA 1ORRA 3ZD6A 1OKKA 5ICSA 4EFNA 5JCXA 1JA0A 3NBMA 3Q7PA 2AQIA 1YBAA 1N5OX 1GRNA 2JFOA 3OTIA 2HSGA 3FHLA 3WJ7A 1HR0B 6Q21A 4GI1A 1MRZA 1Y3AA 2ATEA 5I7VA 3V3TA 1L5KA 1XN1A 3ST7A 3RDPA 4OKSA 3DDHA 4DT1B 5ARDA 2OGSA 3SQDA 5MGBA 3I2GA 1XF9A 3GMTA 3PXXA 5A5GA 2JHFA 1RM4A 3KLBA 4ISCA 4WNCA 1SXPA 2F3PA 2IZ6A 5IYQA 3BRWA 3T9BA 4Q6WA 4GNKA 4RLZA 4B6RA 1CBUA 2OFOA 2QRLA 3TLEA 3HRKA 3QNMA 3VZCA 1HV8A 3BCRA 2FPIB 3QEOA 4OHMA 3W78A 3UW3A 1PTJA 1S01A 2ZIUB 1LU9A 1XZPA 2VT2A 1XU4A 3PWZA 5THQA 1F0YA 2IBMA 4V39A 3G8AA 1JWAB 1ODCA 2MDTA 2IV7A 1YRQA 2GK4A 4YJFA 1CJMA 1OLUB 2CLMB 3H9GA 2UUBB 3OTHA 3I9KA 2FMXA 4M53A 4XGIA 5DISB 3TVTA 2H63A 4CDMA 1K73D 2QTLA 1T1SA 4ZT7A 1MGOA 5GOTA 2IEBA 4IXMA 1P77A 3S81A 4INPA 4A8HA 4DSNA 2EATA 1DBPA 5H8WA 3BE4A 4FFLA 3AKEA 5J3OA 2VUHB 1ADJA 3GI1A 1NXXA 3JRNA 3QJYA 4LGYA 4Z9BA 1XX6A 1ZGAA 2O4CA 1FIUA 3EZYA 3WFIA 2GZSA 2W2MA 1IZ8A 2DFVA 4OQYA 2NQ8A 4FEEA 1J22A 3PITA 4P0TA 2JLWA 1Z37A 4CDNA 3TRFA 2I99A 4CT4B 1EDOA 5BV0A 2FVXA 2C07A 1BA2A 4B6QA 1MZPA 1MOZA 1WB5A 3MJRA 4Z4HA 3LE8A 1UD3A 2PGIA 1JKMA 1TTQB 2HPAA 2O5RA 3V00A 1XEWY 4AKHA 1VQLB 3HQ4O 3KBOA 3LOPA 3T56B 4DNRB 4RF5A 3WK8A 3SVTA 5SY9A 2FOIA 1ZIXA 5F23A 2B82A 3BYZA 4QG7A 1I4TD 3ONEA 2NXWA 3ZV5A 5CNMA 3HKCA 1HLDA 2EGUA 4ZOAA 3R24A 3EARA 4FDAA 2JCBA 4LE1A 5DIFA 4D3SA 1ENPA 4MP6A 4ZI7F 1WKBA 1NGSA 4WCFB 4HWKA 4DL9A 4IOMA 2JLCA 5C1BA 4XKVA 4LXUA 4CEIA 1UKBA 3PBKA 3ZWBA 3ISTA 5ALOA 3RVDA 4QLBA 1UK9A 4UJ3A 1UJMA 2HLNA 3NWOA 4GZ3A 3TJZA 2M98A 4O33A 1UF9A 5IT4A 5KVSA 1HDZA 3WLLA 3LLVA 4B6GA 5F98A 4YVFA 3N07A 2A5JA 2JJQA 2R00A 3D2BA 2YZNA 3FNRA 1W5FA 2EFJA 1SELA 3CRMA 5CYGA 5KNBA 3NV7A 1BNCA 4D7AA 2HCBA 1KEZA 2PVPA 3RFTA 4W99A 2NV6A 2SKCA 4ZI3A 3DL2A 1YXMA 3DT9A 3X1YA 1T2NA 2WDPA 2ZUDA 3RNOA 2PQ6A 1E0AA 1NWCA 5ERYA 3M4JA 3LNCA 1ZCBA 2V9PA 4OEHA 4KAFA 1G4AE 4KPYA 4V38A 1DHTA 3NHAA 3LLCA 4KV9A 4BHTA 4CT5A 1VGQA 3R5SA 1YQWA 4IEFB 2Q9AA 3OQHA 2NVUB 3UYKA 4M76B 4MNTA 2QQ5A 1XLUA 3FLMA 2NSDA 4XWAA 4DA7A 1EINA 1PGJA 3SLNA 2FUCA 3L0YA 4CFSA 1RRKA 2H07A 2Y1DA 3GJ6A 2IE8A 5FLYA 1BRMA 1C0PA 3QF4A 2G4CA 2ZWPA 3X1KA 2O2JA 4LYDA 4TRNA 4JDUA 1P39A 5KX5F 1WZEA 4HQ0A 2JIRA 4B7ZA 1BHJA 1NW3A 2EBFX 1JAZA 2QVCA 3MCTA 2PU7A 3A9UA 4XM2A 5FJIA 4PBTA 2E4ZA 3T7AA 3OD1A 2VNHA 1UOEA 1A77A 3OLVA 3RLIA 3V8QA 2GPBA 5KIAA 2EAUA 1WBBA 3V1TC 2J0UB 4FGWA 5KNBD 3CPEA 2D5AA 1NFFA 1R0KA 3IEUA 3LK7A 3B3JA 2RHGB 1TAUA 2DPMA 2JGRA 3RJTA 3VZDA 1ULTA 4U8GA 5H81A 2PUDA 3JQAD 2WHEA 1YZGA 5HXAA 5KWIA 2I78A 5EXXA 5IVKA 4COKA 1YQQA 1KZYC 3CZQA 3O5AA 4GWGA 4QPDA 1EBUA 5D7NA 5EY5B 4ZZ2A 2NXNA 2H9AA 5AW7A 2MYUA 2ZTNA 4IFIA 3EY4A 1WEHA 5BYBA 2YWRA 4YDQA 1X42A 1GZSA 5BSMA 1L4HA 1A5SB 2G8LA 2NU6B 4P54A 1YS2X 3MJHA 4ER5A 4HZUA 3I2KA 3A3BA 5EN4A 1EP1B 4CM8B 3JVDA 4DN6A 2GPSA 5DNUA 5HFNA 2OHVA 2RGNC 1RXCA 4Q3OA 4E1BA 3BQJA 1QP7A 3R5KA 2DRIA 3AEUB 2XF8A 4I55F 5A4KA 2BFCB 5B2ZA 4LOAA 1SHLA 1PFWA 3NHPA 4WIAA 1M76A 1P62B 1PQWA 2ZPUA 3C3AA 3K20A 5DM1A 4DV4B 3TOVA 4YJ3F 4DY6A 1IJBA 1P4AA 1YJBA 2JK1A 1EUDB 2CCJA 3KWMA 4RA6A 1JU9A 5JMPA 4XDYA 1F48A 5HOQA 4GIBA 5DHQA 5IXYA 1XWFA 3FGZA 1P8AA 1HTBA 1GGVA 3H1FA 1WW3A 4G0OA 5T57A 3DLAA 3GDGA 4XUEA 5ELLA 3TXXA 4RHUA 2R8BA 2NTJA 1KFEB 1OH6A 3VC7A 5F4ZA 3KDPA 3ZJYA 3F74A 1TQ4A 2W11A 1E1CB 1AX9A 3FY4A 2PS9A 1UKEA 4OD0A 1IJEA 1TEHA 2H31A 3DEFA 3UMJA 5JTTA 2B4AA 1GCGA 2IOFK 3VKGA 3AR7A 5I4IA 3O4RA 3NAZA 4XYLA 3UMMA 1SCQA 1ZNWA 1RYZA 3GZNB 4YRPA 1GPKA 4DLRA 1R4NB 1UANA 4ZJZA 1P2GA 2W70A 5J63A 3OZEA 1HE3A 5I01A 1M1XB 1E3TA 3IAS6 4JB0A 1NBOA 5LYYA 2VP4A 3WAKA 1NX9A 1XKXA 4BX2A 3BOSA 1QBKC 3EAQA 4BFVA 4MQFB 1RJ9B 1LI7A 1QGED 1TRKA 3FSRA 1LSOA 3W9YA 2OFFA 3NPMA 3UXEA 3V9AA 3B53X 1KO1A 2H59A 1SD2A 4IFEA 3HEAA 4RJIA 3IUNA 3UXYA 4K7JA 3P2MA 4E2ZA 3B52X 3HB4X 1ODKA 1FTQA 1I5RA 3GY0A 4J0KA 1XQ9A 4P7GA 4P5EA 1CS0B 2NADA 1CUUA 3SHVA 5HIKA 3BBPA 4M22A 4RZIA 3SIWA 2FEWB 4L0CA 1XNGA 3F46A 4P3NA 3M2TA 4F8JA 4ZAGA 3SZMA 3M6MD 2NSLA 5U4QA 2DB3A 2AOTA 1I9CA 3ADKA 1DC8A 1UKZA 2V0NA 3DDSA 4WKCA 3EWAA 2RD2A 4MYUA 3U9LA 4EQ6A 5FADA 4Q3CA 4YCMA 1A95A 1EDEA 5JZBA 2OO7A 1TW2A 2BFNA 3I04M 2BFWA 3HNRA 4P25A 4N0DA 3W7AA 4BV9A 2X3FA 1NHWA 1Z28A 1DTWB 5ADVA 3TR0A 5FWYB 2JLAA 2HI0A 4UUBA 1FYVA 4RZUA 4IHAA 1EQUA 4TX1A 3M3DA 3MJ4A 1MG5A 1OBCA 4MVJG 1SM4A 1MAWA 4KYIB 2EQAA 3HN2A 4NHEA 3KEGA 4DCJA 4EPRA 5DN9A 3ZHTA 5IKPA 5EIXA 2FLWA 4CF6A 1Q2XA 2J3DA 4HB0A 2YRXA 4YJGA 5HQ3B 1EGQA 4IYJA 5J58A 2VHVA 2Y71A 2ZUVA 3G1TA 2E85A 3PC6A 1CF9A 1Y7PA 5A3SA 3MJSA 4R0MA 3OI7A 2FPWA 5AIAA 2ODTX 5JSUA 2V45A 2WTEA 1E7YA 1H2BA 2VDLB 1DKQA 1XEAA 2YFKA 1GNPA 1US8B 1W48A 3VJRA 5A3QA 3ILXA 3VU0A 1H8HA 3A9WA 3AR3A 3L0IB 1CRZA 3TTXA 4A8TA 1BVRA 3VXKA 3THWB 1YZQA 1F1JA 4R8MA 1JH8A 3AZOA 1WY5A 1A1VA 1HFKA 5IRCD 2IS1A 2HK6A 5C8YA 1G6HA 3MRSA 3G9UA 1PJRA 5TQ0B 2R68A 5H9WA 2J41A 2D0PB 4XN3A 1D2GA 3ZVKA 2G08A 2AG0A 2FPMA 3ROTA 3EXIB 2J5BA 2G77B 1HTWA 1QUEA 2OQ2A 3OMWA 4RMGA 3RFVA 2FG6C 5DM2A 4QJ3A 1RS0A 1DWUA 1XBTA 2PE3A 2ZETA 3GJQA 3KJEA 1CC1S 1XRQA 1PWYE 1RD4A 2AQ8A 3BIXA 3HVIA 3P0FA 4L02A 4LCEA 3QWBA 4QFDA 2G6TA 4DILA 5LQUA 1NJSA 5U9CA 1RKUA 3SWWA 4I99A 1GCUA 4LA4A 3QITA 3NDRA 5ALUA 3FBTA 4RF3A 1JDTA 2DVMA 5GGXA 4DNXA 4J0FA 2YXNA 4PZPA 4ZI2A 4IJUA 4CXMA 3HWX1 3SJ7A 4DYHA 1D4FA 5GV7A 2WHPB 4WY2A 2VHZA 1CZHA 4F4IA 3H7IA 4LHYA 5EZYF 5FJJA 5AYVA 2GCPA 5LU9A 5U4XA 1QQ5A 3EEYA 1K6XA 4Y6RA 3VO1A 3QKIA 4KH0A 4KQ1A 3O21A 4LVOA 2X5JO 1ZIOA 3M4YA 4O4HA 1KEVA 3B2EA 4ZT6A 4ZIRA 1KEKA 1QGUA 5F4BA 1OH5A 3SE0A 4YT5A 1VJDA 2HRQA 4LJYA 4O1HA 4YO7A 1YWGO 3O3CA 1FP4B 1ZW6A 2RHCA 3GZJA 1DCKA 3PD7A 2VYNA 4XMYA 3HU1A 4PX2A 3STWA 5EYPB 3RBZA 1PWXA 1ZU5A 3EXHC 3CLKA 1JHYA 3R3XA 4AZ0A 1JWLA 3LSYA 3EVCA 1J5EB 1TQHA 2P4HX 1KJIA 2XUQA 1T1EA 2ZIVB 3NRBA 5HTOA 1U1IA 3QE4A 4GL4A 5EHIA 2VHEA 4H7KA 2CMDA 4K6MA 1BGWA 4IRMA 1J99A 1KQGA 3AL3A 1A69A 2UUPA 4TWAA 5EUQB 4R4JA 3WAJA 1GN8A 3RSLA 5E95A 1U4OA 3QKUA 4BC1A 4DA6A 3ONDA 1M2JA 2ZBGA 4H1WA 3GDFA 4RAQA 2LVBA 2GZRA 4A0QA 2IRWA 3G2QA 2QF7A 4KRGA 4YRAA 4LRUA 3D7SA 4FYWA 2IELA 1JG6A 1OPXA 2FDRA 2YXEA 4RA9A 1DP4A 1P0MA 3S2GA 3GDHA 1JR3A 2V8BA 5CVTA 1I7PA 2VDQB 1RYDA 3W2TA 4K88A 4LOKA 4EY5A 3SC2B 1J56A 2NYUA 2P91A 4LOHA 4IXNA 4C0QC 2NPOA 4FSDA 3RPEA 5FLXA 3H2IA 3ICCA 2FN4A 1QG6A 4JLUA 4UREA 3UKJA 2WYIA 4RDLA 2IQIA 4UD2A 3NTVA 2VYND 5DTRA 3TLGB 3IULA 3WGVA 4EFKA 4IQ0A 4JH0A 1K4KA 5SYNA 2FXIA 1QYDA 5CXQA 4GX1A 2IDJA 3MAAC 1J8YF 3JU3A 1YI8A 3F1LA 3CRNA 5DGCA 5FNVF 4XR4A 3BB1A 3IKMB 4PSKA 3T1YB 3WGOA 1JJ2B 3BE8A 3L0OA 4JFRA 2R7KA 4LC0A 2NVBA 2ZI6A 1GZ5A 2UZ1B 4KXWA 2JI6A 3VH1A 2O8CA 4HO1X 2YNMA 3G3EA 4EO7A 1E2DA 2XY4A 1TCUA 2ODAA 4OSOA 4Q1CA 3SZUA 1ODTC 1XTZA 4G37A 4I1YA 2IIPA 3TPCA 5K4HA 3AYXB 2DCUA 1Y4ZA 2AMYA 1XROA 2QLBA 1UEXC 2HSJA 2ISQA 2NUTA 1HI9A 3B5IA 3HJNA 5LKAA 4RTOA 4NOLA 2BH2A 4K86A 1KP9A 3CF0A 5J5VA 2JJYA 2NZVG 5E6SB 5EHQA 5DW3A 5A05A 2JGNA 1LRLA 1JR3D 3GD5A 1YDGA 2HK7A 1U80A 1P8JA 2RAUA 4R16A 4UAGA 1ODSA 3OD5A 1D2RA 4ANFA 4N5MA 4RJKA 3AU9A 3FCUB 1WTCA 1W8IA 1KOJA 4MQ5A 4N8EA 2GAIA 1G8GA 3WI7A 4CU2A 5B1DA 4PYOA 1NXOA 2ZVPX 4BWVA 2OCBA 1VRVA 4QFCA 1NYRA 3ZDZB 1WCIA 2HIHA 4GZLA 3MF4A 5JT1A 3LCMA 2OBYA 4UBOA 4RD4A 2ZDGA 1XK6A 4HDRA 1YQXA 2YNMD 4YUVA 4JQSA 4P22A 4GO1A 2WQ7A 2O8FA 4AJNA 1HDIA 1XKTA 3AKCA 3BWEA 3O8QB 1N3BA 4GI2A 3ICPA 3I1JA 4W8GA 1DDIA 1O6GA 2WIBA 2ZSBA 3NBQA 5IARA 3LXUX 1HYHA 3PUWA 1F14A 2NWQA