3CW2A

Crystal structure of the intact archaeal translation initiation factor 2 from sulfolobus solfataricus .
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
414
structure length
414
Chain Sequence
AWPKVQPEVNIGVVGHVDHGKTTLVQAITGIWTSKHSEELKRGMTIKLGYAETNIGVCESCKKPEAYVTEPSCKSCGSDDEPKFLRRISFIDAPGHEVLMATMLSGAALMDGAILVVAANEPFPQPQTREHFVALGIIGVKNLIIVQNKVDVVSKEEALSQYRQIKQFTKGTWAENVPIIPVSALHKINIDSLIEGIEEYIKTPYRDLSQKPVMLVIRSFDVNKPGTQFNELKGGVIGGSIIQGLFKVDQEIKVLPGLRVEKQGKVSYEPIFTKISSIRFGDEEFKEAKPGGLVAIGTYLDPSLTKADNLLGSIITLADAEVPVLWNIRIKYNLLERVVGAKEMLKVDPIRAKETLMLSVGSSTTLGIVTSVKKDEIEVELRRPVAVWSNNIRTVISRQIAGRWRMIGWGLVEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Translation
molecule keywords Translation initiation factor 2 subunit gamma
publication title Crystal structure of the intact archaeal translation initiation factor 2 demonstrates very high conformational flexibility in the alpha- and beta-subunits.
pubmed doi rcsb
source organism Sulfolobus solfataricus
total genus 64
structure length 414
sequence length 414
chains with identical sequence B, E, F
ec nomenclature
pdb deposition date 2008-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
A PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 3cw2A02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 3cw2A03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3cw2A01
1P5ZB 3RRZA 4DUGA 5TDHA 5E7JA 2IYYA 1RJ9B 4FI3C 5B64A 1GKIA 3AVXA 2CK3D 1F20A 1JR3D 1JJVA 2IX3A 4IVPA 2GJKA 4DDVA 4XTRA 3RC8A 4BFTA 3BOSA 3M6AA 2CVHA 4TQUS 3LV8A 1OSNA 1VCOA 2C95A 2CJWA 2QQ0A 2PBRA 3LVQE 2YC2C 4R98A 4II7A 4TYWA 5EP2A 2Q21A 2OESA 5BN3A 1EFRA 2PLRA 3A37A 1M8PA 4EAQA 2PX0A 3KQUA 1JPJA 3LBNA 3E70C 3QBVA 1VQ5B 1MV5A 2ZI7A 3RLFA 3UG6A 5B58C 4URXR 2GCOB 3ICEA 2ZJAA 1H8HD 4O25A 1RC8A 2IT1A 1HV8A 5CB6A 3PR1A 1XPUA 4TT3D 1E63A 2GJ9A 2B7BA 4OQNA 4TYPA 4OHYA 2B8TA 2ZJ8A 2A5YB 1G8PA 2ZROA 3CF0A 3X1ZA 2PJZA 4EJSA 2VLIA 5L3RA 4TLCA 5AJZA 3KQKA 2Q9CA 5BW8A 2GF0A 4IFEA 5GV8A 5A4JA 2XB2A 3QFRA 3AVVA 2BJVA 3OE7A 4QGAA 3THYB 1EX7A 5K8LA 2C03A 2QT0A 2BBOA 1F48A 1Q1BA 1E32A 3RABA 2OBMA 2AWNA 4POAA 1P61B 4IOKA 4JBYA 4LI0A 1S9HA 4MA4A 2HYDA 1PVOA 5ANRB 4HAXA 3K0CA 3IEVA 3B9PA 4FCWA 3GLGA 2NO1A 5JI3E 4LBVA 1BYUA 1LB1B 3K9HA 4HZUA 3X2SA 2ORIA 1YJ5A 2VSFA 3QVUA 4RZUA 4JJKA 4KITB 4GDFA 3THXA 2YHSA 3SJCA 4D4KA 1YRAA 4WZAE 1Q82D 2F3TA 3NHBA 4D25A 5J40A 1MO4A 4MRPA 1E4VA 5DGXA 2OV2A 5EE1A 1M90D 1Z63A 2QORA 1JI0A 2FN4A 4FMDB 3CMEB 1XJQA 4B3DA 4EPRA 1TQDA 2VP9A 1YZQA 2RMKA 1XEFA 3CRQA 2BEKA 3IQXA 1Z28A 2J5XA 1QFZA 5BYKA 4JMPA 1P62B 1AK2A 1U0LA 3BE4A 3IBYA 3LD9A 3O8DA 4PAQA 4B33A 5F9FA 4JT4A 4C0HA 3CONA 1FP7A 2XTZA 2QENA 3DO6A 4P4UA 4YC7A 1JB9A 3ZVNA 2QMEA 3PIRA 4RFVA 5LB4A 2ZJYA 3VR6A 3FHCB 2LKCA 3L0OA 1G3MA 4NYMR 1XD9A 1P4SA 4M21A 1DAGA 5AK0A 3UMRA 1PUJA 1N6OA 3W34A 1M7BA 4YMUA 1RYHA 3GLHA 4OK3A 4FWTA 3FHOA 2R6FA 4B3CA 3NWJA 2HJVA 2WSSA 4GP6A 1Q21A 3A1UA 3NXSA 3U3RA 2EFGA 1EP1B 1XB2A 2BBWA 2P6UA 4RZ2A 3EZFA 3KB1A 1DAFA 1DO0A 4G5GA 4M8NE 3FB4A 3W5IA 4Q4JB 4LC1A 3TIFA 4HB3A 5E4FA 1Q22A 1P9WA 2O8EB 1KO8A 1E9SA 1CTQA 3A36A 1I4LD 5SZKB 4PX9A 1JQLB 1XMVA 4HB4A 1T0JB 2R65A 4QKQA 2D7DA 4AG6A 3UK6A 3CCQB 1AKEA 2JJ8A 1T9HA 4HYYA 2B5OA 4C0AC 2KSQA 2IYQA 3B1VA 2QDXA 4Q21A 3CXCB 2WWXA 1XE1A 1G20E 2WVJA 3NH6A 3OFND 3B1YA 2O0HA 1NNEA 2A5DA 2IS4A 4LGMA 4TT3A 5FA6A 2NIPA 4G5RA 1E2IA 3QNUA 3BRWD 5DLQC 1AN0A 2D74A 2QTHA 1OXXK 1CU1A 5FBWB 1EESA 1I2DA 1FTNA 1ZRHA 2FNAA 3OEHD 5LB2A 3KUDA 5KOYA 1OXUA 3TAHA 3V4FA 2V3CC 4RD6A 4M9ZA 4CEIA 2REXB 2IUTA 3I5YA 3DDCA 2JLQA 4DZZA 1UADA 4AG5A 2OAQ1 3HWSA 1WBBA 1MABB 4BLQA 2O0KA 1OV4A 1KI4A 2IYXA 2ZI4A 3LWNA 4GT1A 4YDSA 4O0MA 2QTLA 3TUIC 1XCPA 2CEAA 4GP7A 4NCIA 4A2QA 5AJWA 1F6BA 1COWA 1Z6GA 4B34A 1SXJE 2FSIA 1DE0A 4GPTA 1F2UB 2P2LA 3K70B 4P3YA 4A8JA 5KSYA 2PX3A 2FDCA 1E0SA 1F2TB 1N6RA 2GXSA 5FPSA 4A2WA 2XX3A 2AK3A 1XXHE 1ZU4A 2FGJA 4TTQA 4HB2A 4GMDA 2C9YA 4JJZA 2DPXA 1CRPA 1CS4C 3VX3A 5EXXA 1SM4A 1BQEA 3ZQ6A 4I1UA 4IOJA 3T1OA 3CCLB 2V9PA 4KYIB 4Q18A 5JHHB 1CJUC 2OILA 2DERA 1EWQA 1QHHB 2YWHA 2DFLA 2IHBA 4AI6A 1A82A 3VFDA 2VHJA 2AFHE 3H84A 2ZRBA 3QPUA 2WZQA 2CHVA 3O47A 3Q5EA 3QVVA 3CCRB 1DPFA 3D8BA 4PAMA 2JIZA 1M1KD 4UNRA 4HDCA 1R5OA 3I8SA 4KJZA 1UKZA 1VQ7B 1XJCA 4W5HA 3P27A 1U81A 4PC6A 2BM1A 3VNUA 3OHMA 1L4YA 2BM0A 4LRWA 4B48A 4M9XA 3TSZA 2DFTA 3B60A 1X3SA 4JLDA 4WOPA 5DE3A 1G3UA 1Z8FA 1X8LA 3K0SA 2ZAOA 4HZIA 2D4HA 4ZCMA 4JBWA 3B78A 4TN1A 4QG7A 4US1R 2B6HA 2WICA 1MT0A 4M22A 2EWVA 4YMTA 4U7DA 1GAWA 1FPMA 3M0EA 3FWYA 3EIQA 3ONWA 4IXNA 3FOZA 3IDQA 4Q4HB 4IHQA 2XOKA 4LDJA 1KO1A 1GJRA 4B43A 5TARA 2R6DA 1BIFA 2H7VA 1KIMA 1VPLA 4TQ9A 5JRJA 1TUIA 1WE2A 4G5SA 3SFVA 3EG5A 2G1JA 3BXZA 2YYZA 4WZBE 2VHTA 4NYIR 1KSHA 1G7RA 1JA1A 2RC6A 4QBIA 1BMFD 1P2VA 2EFDB 4HSEA 3W5VA 1IJEA 2O0JA 2RCNA 3W8NA 4DCVA 1EFCA 4PC1A 1T4GA 3TAUA 3CBQA 1KZGB 3GLIE 3A6PC 4DB2A 3K70D 3QIAA 3P4XA 2VP0A 4EPXA 4J0QA 1M2OB 3Q7QA 2C9OA 2CNWD 4WAUA 3U3KA 1TNDA 4G1VA 3VTKA 2GXUA 2FX3A 4B44A 4NE2A 4RJLA 1DOAA 3CRRA 4Q1FA 1N5KA 1E2QA 3KKNA 1QHSA 3GP8A 4TSFA 3FHTA 3X1XA 5HTKA 3PEWA 1OFHA 4W5WA 2ZJ2A 3EC2A 4DDTA 4DCNA 3C8UA 4GSYA 2FFQA 2Q3HA 2EVWX 4OI4A 3LH5A 1E2FA 1ANKA 1FMJA 2JASA 3QY0A 1J90A 4ZPXA 3U3JA 4PZLA 1OH8A 2E1RA 4HAVA 3W2EA 1RIFA 3CZPA 4D4MA 2RGNA 1P6XA 2W58A 3WHKA 1FQKA 4BLRA 4Z8XA 2IWHA 4FMCF 1E1RA 1ZD8A 3HP1A 2O8CA 1NLFA 4ZKEA 2GEVA 1Q12A 2GJAA 5HZHA 3U3OA 1P60A 5FOVA 3OZUA 1GVHA 4PXAA 2QM8A 1W87A 4TZ6A 4KVGA 4RSGA 3CB4A 2VPPA 3UATA 3PUYA 4QC2A 2FPKA 3RSLA 2C96A 5UKDA 3K9NA 1MR3F 1Q3HA 3EARA 2O8BB 4TLBA 2QSYA 4JIMA 2Q6TA 3PXGA 2AD5A 2LWIA 4MKGA 2HF9A 2G1KA 4MYTA 2VEDA 4DCSA 1TF5A 2OZEA 3JZMA 3LAWA 1W7AA 2OFWA 1XFAA 4OYHA 6Q21A 3VMFA 3CCEB 1D9ZA 3GLHE 3DVLA 5KPDA 2OE2A 3K0FB 2WPDA 3DMNA 2K5UA 3GJ5A 3NKVA 4D2IA 2QQEA 1N5IA 3TJZA 1US8B 1YJ9B 1OYYA 2NTYC 2CE7A 4AK9A 3Q7PA 4G1BA 3SI7A 5JWOA 1OB2A 2SHKA 3A8TA 5TMPA 4P4SA 2IXGA 2OCPA 1GP2A 1D2EA 2DHRA 4WW0A 2ZITA 1E62A 2JGNA 3BIFA 4PPGA 1D9XA 4BFXA 4XWOA 2JJ2D 1KI6A 1N6NA 2VP6A 1YZGA 4YLGA 4DLUA 1TQ4A 4TL7A 4WVFA 3VKWA 4EPVA 2H18A 5SZIA 4DLWA 3KUCA 5IRCD 1GL9B 1EGAA 1S72B 1XZQA 2GZAA 3T06B 1V43A 5JEDA 2BMDA 4YAFA 3BAFA 5DNYB 2YZ2A 1KNQA 4GBMA 3KJHA 1FOEB 3LVBA 1VKJA 2P3SA 4TL9A 4UXIA 3RS4A 4HDQB 1MABA 1PLKA 3RWOA 3LVRE 4JLJA 4Q03A 4BWYA 1YZKA 3ZVRA 3Q3JB 2JLYA 1TU3A 2IK8A 3LQQA 5F9HA 5F2EA 1E9RA 3AM1A 4F4CA 1KMHB 1FTSA 2H17A 2ZM5A 1OPXA 2W6IA 1GTVA 3C4JA 4DEXA 4QM7A 1E9FA 2P6RA 3LRPA 1F2UA 2A30A 2GHIA 121PA 5IK2A 3W90A 4KSCA 3ZQJA 4ZV4A 1YE8A 2FF7A 4IDHA 3IHLA 1A7JA 2OTLB 3UWOA 5KSWB 4LJ5A 4MUAA 1FMLA 1QFYA 3CWZA 2NQ2C 3R9IA 2FFAA 2VP4A 2R6CA 4RFSA 4K8OA 3G5UA 5AUOB 1XD2B 1S1MA 2CXXA 1OHHD 3LO5A 5JMTA 3EZ2A 1E0JA 4TL6A 4QBHA 3DHWC 3I5XA 5DN6D 1Z2AA 2ZAMA 4A1FA 2OEPA 3TE6A 1B0UA 3F8TA 5EXTA 1OXTA 5P21A 3CCSB 1CNEA 3CR8A 3OIYA 3GJXC 1LFDB 2HCBA 1NMZA 2ZSAA 4LHYA 4NHOA 4Z54A 2ZVQX 1HY3A 3B1XA 5FTMA 1SVSA 4EFNA 4CF7A 3KQHA 4QHYA 2NOAA 2WJVA 5K8IA 2VIIA 3QJYA 2BMEA 4Q5IA 1RFLA 1AS2A 1YZNA 3JQPA 1VHTA 3P1JA 1KAOA 1R0ZA 3KXLA 3RS7A 4TMZA 1WQ1R 2YWGA 1NKSA 2H57A 1Z6AA 5TXGA 4N1AA 1QVFB 1W44A 2VO1A 1VYTA 2A5FA 4DKXA 1VIYA 2OCAA 3ZH9B 4GRAA 2IYSA 2ZYTX 3TW4A 4CEHA 1NN5A 1QHGA 1NI3A 3NG1A 2VQSA 2XAUA 4QGHA 2QTVB 3GLFE 1XEWX 2GQFA 4HUQA 2YVUA 4QJ3A 3IKJA 3EXAA 4E5UA 4EUNA 1DTSA 1CEEA 4Q4HA 3MFYA 1M6NA 4C3ZA 3QF4A 1XEXB 4C9BA 4ASUA 1OGJA 2VNHA 4IEEA 4ZGNB 2ORVA 1E99A 3T15A 4DLRA 4LYAA 5JBQA 1E1QA 1GKYA 3EZ6A 4N0DA 5FBQB 2CLCX 1FP6A 1D2NA 2ZJOA 5FL7A 3NBFA 1G21E 1J8YF 3A4LA 3CCUB 2WHXA 1KI7A 4UKDA 4OHZA 3D6TB 2ZSBA 1ZNXA 1NMXA 1QZXA 1W5SA 2XNDA 3IHWA 5HKKA 5JS8A 3U60B 1L8QA 2GNOA 2CCGA 2Z43A 1ONBA 4U02A 5BYJA 3T61A 3PJRA 4W7SA 1QF9A 4L9WA 2AD1A 4TTRA 5A0FA 1SHZA 3HU3A 3OZVA 1NJID 2J7KA 3ZBTA 1BH2A 1WB9A 3Q72A 1AS3A 4E09A 4B6FA 5H5JA 2BDTA 2GAOA 3QXJA 3IIJA 3EA0A 1W0KA 1X1SA 4V02A 3CW2A 4DEYA 1EWYA 4W9MC 1TADA 4ILEA 1N6PA 1YU9A 3LA6A 3TRFA 4AC9A 4P31A 1HQYE 3QKTA 2G6BA 1G4UR 1S96A 2QZ4A 4LOAA 5G3YA 1M74A 2E87A 4F91B 3UKDA 5AUNB 5BWMA 2Z4SA 4BFVA 3RC3A 1HTWA 4L5BA 2Y8EA 2XTMA 2F9LA 3SJZA 1SGWA 1KYIA 1GR1A 1V5WA 1OIWA 1ZP6A 4HLUA 2GDJA 2QUZA 1PLJA 1LTQA 3MGCA 4ZIRB 4A36A 1IQPA 2QTZA 1VQ6B 1VG9B 4Z8YA 3GMTA 4HDOB 3VKHA 1UFQA 3B13B 1TLLA 4B2LA 1YR8A 2D62A 2NZ8A 1YIJB 5H70A 1UM8A 4LJ4A 5CJ2A 2OO7A 4PC3A 1IJFA 4PPNA 5FOXA 4KV9A 4RCZA 2V55B 2ZSEA 2G3YA 5BN5A 5KNCA 2IYTA 2GRJA 4XIGS 1XDBA 2QAGA 5CB8A 3THOA 4CIDA 3FYHA 3NDBB 5CIWA 3WMEA 4TMXA 4HLDA 3TUZC 1NKTA 4MGZR 4DBLC 1HQCA 3ADKA 2Z5FA 5CDFA 1TF2A 4JLBA 1NBMD 2RH5A 1DAHA 1G291 3F5FA 4Y9RA 3CC2B 3VHXA 2KB0A 2FA9A 2YKGA 2JJ1A 4AY2A 5J47A 1AS0A 4WBSA 1CR0A 2BCGY 2V7QA 4JSYA 3MJRA 2JLWA 1KNXA 3RVBA 4BFWA 1U94A 4YQFA 1VQOB 1G7SA 2ZUDA 3NEYA 1HEIA 1RKBA 3WMFA 2A78A 3MWKA 2FZLA 3B5JA 2XJ9A 3WRXC 2WTUA 1G9XA 3MJHA 3WNDA 4BGDA 4TMTA 2XJ4A 3NTUA 1JAIA 1Q20A 1SHKA 1U8ZA 2V1XA 4KFRA 5H59A 1VQ4B 1YI2B 1E2MA 1BOFA 2QROA 5FPHA 1FNCA 1JBKA 1G19A 1YR9A 3AP3A 1KI2A 3HU1A 2PZFA 2V1UA 3O8CA 5DO9A 1K5GA 3K9LA 2H1LA 4EIWA 4DT1B 1KDOA 3KTAA 4WXPA 1Z29A 1T6NA 3LLMA 4B3BA 2FE4A 2WJIA 4Q7JB 4WQMA 4F7DA 1MRSA 3MSXA 1QDEA 4D82A 4DIEA 4US2R 3VR3A 4MGYR 1H8EA 1DARA 4MUBA 3R7WB 4AYTA 2F55A 1UJ2A 3E5HA 3C14C 4BLOA 2ZRGA 4IOLA 4V0KA 2E9SA 3ZIAD 1Z3IX 1QFJA 1U2RA 2ONJA 2FPLA 2O8FB 1OKKA 1R10A 3QKRB 4IRUB 1ZIPA 5GADl 3FMIA 3VO2A 1MO6A 3RNLA 3UANA 1Y3AA 4YAOA 1ZJ6A 1FNBA 1ZC4A 1FW6A 3KL4A 4F38A 1QVRA 3AQ4A 2JDID 3AKCA 3QPWA 3HR8A 3LY5A 4OK6A 2WSMA 2QT1A 3EIHA 1BO6A 5KNDA 2AFIE 4MGIR 2CE2X 1QHYA 2RHDA 4PQRA 2GVDC 1CR4A 4HEJA 4TMWA 4Q9KA 4TZ0A 4YONB 1NVXQ 4Q1CA 1NDHA 4F92B 4L8GA 4NCNA 5FI0B 2G9NA 4I1OA 4TMVA 3AB3A 3E1YE 1OGIA 1VQ9B 3ND9A 3LFUA 1U9IA 4V0ME 1G1MA 2RB4A 5FPYA 1ZM2A 4UQOA 2H92A 5TVKA 1FUKA 4Z1MD 2A5JA 3KFXA 5HE8A 5DSZA 2WJGA 4LJYA 3BWDD 4FMDF 1U8YA 4IVQA 4PTLA 1N6HA 2EFEB 2W0SA 4MGKR 4DLYA 1S3SA 5JI2E 1TVCA 4XOIA 3JQRA 3CCJB 4JLNA 3CH5A 5KYKA 2R6AA 2QP3A 2ZRPA 1QHIA 3UXMA 1Q3TA 1LNZA 1LS1A 5EXPA 4F4JA 1FRQA 2XSZA 3S1AB 3CRW1 4MKIA 4QFMA 1HUQA 4QBGB 3A1WA 1J2JA 3N2EA 1N0VC 2C78A 1RZ3A 1W4CA 2OG2A 1IY2A 3KKPA 5FI1B 1DS6A 1RYFA 4AF7A 3DPUA 5AR1A 4B2IA 3LXXA 3ETLA 1Z6YA 3SHFA 3X1YA 4MRRA 4PC2A 2QMHA 4LYJA 1A1VA 5DH9A 2ZE6A 1KSGA 3DKPA 4C2UA 3L2OB 4RVCA 3VX4A 1E2HA 2WOOA 3OIWA 5KSPA 4BFUA 1ZW6A 3KB2A 4F4IA 1NP6A 4B3FX 3PV0A 1IBRA 2ZRFA 2FMXA 2B7CA 4MYCA 1YRBA 1LW7A 4JLMA 4LPSA 4LHVA 4MKFA 2XB4A 4AKEA 2J0UA 1XRJA 3WBKA 1OXSC 1BKDR 2J9RA 4DLSA 1Q86D 4F7WA 3CZQA 3RS3A 2A7QA 3CM0A 3OW2B 2UKDA 1TPZA 4D0LB 3ZS8A 4MDEA 1Z5ZA 3A1VA 2JEOA 4JL5A 4QNRA 3BC1A 1R6BX 4Q1EA 5BQ5A 3WRYC 4NYIQ 1KHTA 1NVVR 4GZLA 2C99A 3TR0A 1KI3A 1IY1A 2HV8A 4JYBA 4ABYA 4DXAA 1WA5A 3FMOB 1LVGA 3PQCA 1AKYA 3FE2A 3IO5A 3BJIC 4JVLA 3VR5A 3K1JA 3V76A 4U9UA 3AUYA 1OIXA 1EFUA 4A0HA 1IXRC 4A15A 2CVFA 3UMFA 1KOFA 3QQ5A 4QJ5A 5DI3B 3LW8A 2GK6A 1UF9A 1XTSA 4Q1AA 1Z0KA 1P9RA 2PCJA 2X3UA 4AYWA 5IHPA 1DG1G 3VR4A 5G3ZA 2QA5A 4PSKA 1CBUA 1T5IA 1IHUA 4PQFA 4XD7D 4AKHA 1YITB 2RGEA 2WKQA 4EQ6B 1EWRA 2CK3A 1E0KA 1ZM4A 1JR3A 4B32A 2AHOA 1CIPA 2XNJA 2CLSA 3B82A 221PA 2CMKA 2ZU6A 1XWIA 4URUR 4X8MA 1K9MD 2OK7A 4PR0A 3KJEA 3G0HA 4RD1A 1B2RA 1Q81D 3EC1A 4A2PA 1W48A 1AIPA 4R7ZA 8OHMA 1J7KA 5FOWA 2REBA 1GRRA 4BLPA 5FR2A 2N42A 4RZXA 2X77A 1R5NA 2IYVA 3RS2A 1H8HA 4H9GA 3FKSD 1KDTA 4RKEA 2DFKB 4BRWA 4LYHA 1U98A 3H2YA 1GZSA 1LF0A 1UBEA 1Z0DA 5J4HA 2CDNA 2OUKA 4Z51A 2XTNA 4Q4LA 2P5TB 3U44B 5CDFE 4D26A 3L0SA 2XZPA 5HE9A 4PGOA 4HE6A 1M1YE 5L3SB 1G5TA 2QPOA 3QBTA 1Q1EA 3JZAA 1VQNB 2ZRKA 3C16C 1L2TA 4I4LA 2QN6A 2XZOA 5C1BA 2XZLA 1X86B 2CNDA 1NJFA 1Q1ZA 2OBLA 2V54A 4DJTA 1P75A 1NG1A 2NPFA 1CRQA 1D5CA 2IEYA 3QKUA 1W47A 3ND8A 4DT1A 4LBZA 4ACAA 1ZM3A 3AF1A 3B9QA 5D3MB 1DADA 2ONKA 1C9KA 3CCMB 1WDTA 5HXBA 1P2TA 1S9DA 3R7WA 1SXJC 1KZ7B 5IDVA 2IWRA 1TEXA 5EUQB 2D3WA 4HI0E 1B23P 4DQKA 2YNMA 1G8FA 2QRNA 1DAMA 1OFTA 3AKYA 3LNCA 1WF3A 4PANA 5DHAA 4XVUA 2HUPA 2EWWA 3M1IA 4IW3B 2QPAA 4NKRA 4RD2A 2WKPA 2ZIAA 4UNNA 1RJ9A 2CBZA 3SOPA 1VQ8B 1Z0JA 4OKSA 1OF1A 5KTYA 3QKSB 4TTPA 3FDIA 3CRMA 3F0TA 3TBKA 5J4VA 1SKYE 2OLKA 2Q3FA 1EK0A 3BH7A 3CNOA 5KPJA 2QBYB 2B92A 3RYTC 2R8RA 3WXMA 3A4NA 3ZVLA 2JLUA 4MQBA 3IO3A 3T12A 1DAEA 3LQRA 3DL0A 2IYRA 1VQMB 4CEJB 5JSZB 4V0LA 1YVDA 2ODBA 1AMOA 1WXQA 5KU1A 4S2EA 1JJ2B 3KFVA 3ZZUA 5FR1A 5IT5A 5TR9A 2AR7A 2HXYA 4FMBB 4PFSA 4B35A 2W00A 2GCOA 4ACBA 4C0SA 3PITA 2J1LA 4B2PA 2H5EA 4NDZA 2HYIC 4JKIA 5JEEA 1BS1A 4OHWA 4M1KA 2X2FA 4EFLA 4NU0A 4KU4A 2GILA 2R2AA 2GBLA 4FW9A 1FL9A 1SQ5A 2NGRA 3T1TA 3MWYW 1HT2E 1ZNWA 2P65A 3EPKA 4C0KA 3AVTA 1IM2A 3I61A 4KCGA 3U4QB 1FQJA 1NL3A 2QMUA 2ODNA 2F1HA 1VCIA 4OQXA 4Q4AB 1QGZA 5BXQC 2YINC 5FUXA 3QG1A 4G5QA 1DDIA 1QHXA 1TQ2A 3THYA 1E2NA 1HH4A 1W2GA 1YR7A 1FUUA 3ICQB 2XNCA 1KJYA 2ERYA 1NJGA 5F3WB 2ORWA 3OFNA 4DIDA 4WIAA 1K6MA 1FNMA 4JSTA 4EJSC 2PLFA 3QE2A 2RGAA 3OAAD 5DYGA 3I56B 1JECA 3VKGA 2KWIA 3U5ZB 1F3OA 4Q48A 4H1UA 1ELOA 4KVAA 4LY6A 5L8VA 4Q00A 2JAQA 3OEHA 1DDGA 4OQMA 2WWGA 2YOFA 3I92A 1DBSA 1IN7A 1XMJA 4GOJA 4JLKA 2AKYA 3BB3A 1NRJB 2AN9A 3W5HA 2UZ3A 2CL6X 1U8AA 4Q7KA 1ZNZA 3G6EB 1QVGB 1NN0A 4PC7A 5FUYA 4D4LA 4C7OB 1NSTA 3GLGE 1U0HC 4YXWD 2EIXA 3W5UA 2GJSA 3K0CC 5A5GA 4X8HA 1E98A 3FKQA 3I4LA 4TWZA 2W6JD 4MRNA 4YAWA 1CR1A 4PO1A 5FPTA 4HE5A 3KXIA 4PHFA 5GJWC 1ZD9A 3GFOA 3WYAA 4EKDA 2A2ZA 3M4YA 2WMNB 3P20A 1OH5A 1XNJA 1VDZA 2BKEA 3BBPA 2FG5A 3TGPA 2W2TA 3BD9A 3FPAA 1Z08A 3AP2A 4P32A 4CDGA 2ATVA 4K1XA 5DIFA 2ZUCA 5AWFC 1D8TA 2I4IA 2ZR7A 3CPEA 1GRQA 4ZCLA 1OB5A 1QHNA 2BMJA 4LCBA 1MRNA 2GPJA 3T35A 5C18A 2DEUA 2OK8A 3R9WA 1QG4A 3BFXA 3SBDA 4M1TA 4BE7B 1A4RA 5EMNA 3O8RA 2HT6A 2ZSDA 3EPLA 2RGCA 3IBGA 3QXSA 3PUXA 2FEOA 1CNFA 1Q7YD 3B2EA 5CLLA 4A4DA 5JWRA 5D3QA 4XVRA 1G6HA 4Q4JA 1EP2B 4KAXA 4Y7CA 3MHPA 1CJVC 3VNVA 2PH1A 2HJGA 3T34A 2VBCA 4DWJA 1XTRA 2IW3A 3MLEA 4NZYA 3A1SA 1P2SA 3BGWA 2GWHA 1LS6A 4E07A 1G3QA 3ZBUA 3CCVB 4DB4A 2HT1A 1SULA 2FOLA 1O3YA 2ATXA 2BGJA 3FGNA 3AVYA 3W2GA 3WY9A 1GL7A 3I8XA 3K0AB 3CIOA 4RD0A 1E2GA 1VIAA 4EDHA 2ZR9A 4BASA 2ZE5A 1G6OA 1XF9A 4LPKA 4KXFB 2IC5A 4P0TA 5GJCA 3AF3A 3KJGA 4UNSA 2ZEJA 1G5PA 2QGNA 4G1UC 1PZNA 5FUWA 2GKSA 1YKSA 3R8CA 2G0NA 2ZRMA 2HLDD 2ODWA 1VQLB 1BJKA 1ZVQA 2NO6A 2F3RA 2J46A 5FBRB 3SZRA 2MMCA 1SVOA 2VNJA 4JYCA 3WYGA 4Q9IA 2QY9A 4LWZA 2BF4A 3EAQA 4M1YA 2ZR0A 1JJ7A 5HR5A 1EX6A 4AD8A 1BMFA 4PPFA 4YDHB 1S1CA 2C9CA 2AXPA 3OIUA 5CJPA 4A6PA 1SVLA 1R0XA 4C0LA 4FWIB 1SXJB 3PFIA 2BN4A 1H42A 1OE0A 2R9VA 3BFVA 3CR7A 1E3MA 3GJ0A 1F2TA 4IXMA 4KFUA 4DLVA 2CNWA 2ZPTX 3EASA 1XXHB 1R0WA 2C5LA 2EW1A 1G8GA 1HURA 1JPNA 1NN3A 2OFOA 4LBYA 3IPXA 1G3IA 2GXQA 3CNLA 5B57C 2G83A 1VCMA 3DOEA 1WRBA 2LCFA 1XPOA 2Q9AA 4Q19A 2A5GA 4YMWA 3CRVA 4LJ6A 1CJTC 3AP1A 5JHGB 3G4SB 1GWNA 4GNKA 4CW7A 1XP8A 3K53A 3TH5A 1ZD1A 3THWB 3J81k 2C98A 3SFZA 3EA5A 1QHHA 2BVNA 1QH0A 1SVWA 1Q44A 3BFKA 2VRWA 4A8JC 5JLJA 4JLVA 5CK4A 4HUTA 3EWAA 2AK2A 4NCKA 1GRNA 3REGA 3CO5A 3MWJA 2R6GA 1WMSA 3U3MA 1Z07A 1E9BA 3TW8B 3U7HB 4PHGA 4PO9A 2R6HA 3D7MA 2WBLC 1DO2A 1W0JD 4BRUA 1CXZA 4KO8A 2DETA 2IS1A 2D2EA 4ITRC 1YJNB 2DYKA 3I1FA 1E96A 1YZUA 1GDDA 2VHUA 2QL6A 4FD2A 4LJ9A 4ZGQB 4ZCIA 1D6JA 3VAAA 3CC4B 3ZS9A 1P72A 3C5HA 2WWHA 4AYXA 2VHQA 2FFBA 1G8HA 1W2BB 3SQWA 1NVUQ 3UPUA 2J7PD 1U99A 3SYNA 1XD8A 2QEQA 2QNRA 3EPHA 1VTKA 1CP2A 2ZRLA 2IF0A 2F1RA 1TUEA 1KK2A 4PQYA 1JEDA 5EXSA 2HF8A 4FIDA 4JBXA 2VP5A 3TQCA 5K8UA 3MG9A 2QA4B 2PZEA 4D0GA 2W2XA 4ON9A 1FFHA 2O8EA 1XTIA 1GOTA 4R2HA 3OEED 4G5OA 3PENA 3LX5A 4OI1A 1SXJD 3GLIB 5B2ZA 1Z0IA 1QUEA 2RC5A 2O5VA 2P67A 3PVSA 4JVNA 4KBFA 1IN5A 2JJ2A 1CR2A 3KKMA 1R5BA 4GZMA 4D80A 2OXRA 2WMOB 3P26A 3CX8A 1NVWQ 1KI1A 3BK7A 2VTKA 2HEIA 3BB1A 4XSGA 3GFPA 4TL8A 4PHTA 4Q01A 5HCNA 1OH6A 1E9CA 4XTCS 1E69A 1N25A 1TX4B 2C2HA 3WP0A 1T8UA 1IB0A 1R8QA 4DCUA 4DVGA 3U61B 1R8SA 2ZTSA 1WP9A 4YMVA 1II0A 3GLGB 5E3HA 1G7TA 2JLRA 3OF5A 4HATA 1AZTA 2NZJA 1XCGB 3AUXA 4Q47A 4HZUB 4BQSA 1Z2CA 1IN6A 4LV5B 2QP4A 1X1RA 4GOXA 1MO5A 3THXB 3QG5A 2GZHA 2OT3B 3ZJYA 4G01B 4WZ6A 3KJIA 1SVIA 4QRHA 2ZYUX 5FUVA 3AGPA 1XZPA 2JCSA 4DUGD 2F43B 1II8B 3U2QA 1K8AD 2R44A 4NMMA 2ZE7A 4LV6A 3AVPA 1W4BA 2OHFA 2ZVPX 2IXEA 3MUFA 1NVVQ 4IEIA 5AJVB 5EP4A 3GFTA 2QAJA 2VYFA 2V6JA 4L16A 1Q1QA 1XTQA 1OHHA 2FZ4A 3DKVA 3CNNA 1VHLA 3A4MA 2YV5A 5DN6A 3SNHA 2D06A 2EFCB 1EXMA 2RGNC 2WIAA 1KK1A 4KODA 2G0TA 1G3RA 1I4TD 4NYJQ 2O8BA 4M4SA 1EFRD 2ZE8A 3ECCA 4NTZA 2QGZA 2GTPA 2J0QA 1MKYA 1BX1A 2F6RA 1JAHA 2FJUA 3MWLA 2OXCA 3GLHB 4URZR 3AVUA 1DEKA 4EH1A 1E94E 4KSBA 3K0FA 3IQWA 2FPMA 3BORA 4LK2A 1FNNA 1FRNA 2QE7D 2BKUA 4HAUA 2DWOA 3AH8A 3G82C 1US8A 1K73D 4P4TA 3TR5A 1XJ0A 3KZ1E 2KBEA 1OH7A 3RSOA 2FU5C 4IFBA 4L4UA 3HR7A 1KRHA 1EFTA 4N3GA 1KD1D 2YOHA 1E9AA 4N3NA 1W4RA 3L82B 4WXRA 1XMSA 4A9AA 1ZM7A 1N6LA 2QEXB 1AA9A 2OTJB 2DR3A 3OE7D 1NLYA 3B85A 3VQTA 4B73A 3FJOA 1PLLA 3W9YA 3ADBA 4Y9UA 5DI9A 1Z83A 3W6PA 5K8TA 4RKFA 2WWYA 2EYUA 3QFSA 4B4DA 4KLNA 2O52A 1GFIA 3CMAB 4PSVA 3RAPR 1YJWB 4IJMA 1KK0A 1R2QA 4YALA 1A8PA 4LHZA 4ZDIA 4OK5A 1CJMA 3RRNA 3I73A 2IUUA 2ZJZA 3DM5A 1CQXA 2J45A 3OZWA 2QRZA 3OIVA 4B6EA 3U7FB 3C5CA 1EG7A 2PCLA 4HLQB 5DHFA 1P2UA 1N5JA 3H0KA 4G3XA 1KMQA 2GJ8A 4CYMA 1KMHA 3SYLA 2J59A 4LUCA 4BFZA 4TYNA 1OJLA 1U90A 1ZMXA 3GEIA 4NBSA 3B1ZA 1W46A 2ZU0C 1IN4A 2CCJA 1IXZA 1ZC3A 5C46F 3DOFA 4GMXA 1YHNA 3IIKA 2IYZA 1PUIA 4TLAA 3QXXA 4PO8A 3WYFA 1L7VC 2F1IA 2FSFA 2GZDA 4C0JA 5LD2C 1AQUA 1N8RD 3DZ8A 1RE0A 3ZZ0A 1XD2A 4A8JB 3R8FA 2ASEA 3W5JA 4DSTA 1G5RA 5CITA 1W2HA 2OCBA 2HCJB 5CM8B 1MH1A 4O3MA 2DWQA 2CHGA 5JFGA 821PA 4Q02A 5TY0A 1E2JA 1T3LA 4GFDA 3TQFA 3DZDA 2WJJA 1RW4A 4DSNA 2IHYA 4RD4A 2REOA 4DLTA 2KBFA 3HPRA 4HAWA 5H8WA 1Z0AA 4MDFA 1KSJA 2WSSD 1F60A 2VF7A 1H85A 1OYWA 2ZQ5A 1GL6A 1T3HA 1TU4A 3LDAA 4DC9A 1NY6A 5KSOA 1TMKA 4TQAA 4L9SA 2JLXA 5BN4A 3GLFB 1A2KC 4V0OA 5FOUA 4AKIA 4A82A 5FL3A 3I32A 5HZKA 3LBHA 4LV8B 3SHWA 1X8KA 3NBZC 5C4MA 3IGFA 1NIPA 3WHLA 1CLUA 1NBMA 1XEXA 3CX7A 4N0EA 2BHRA 4HLCA 1KSFX 1T3SA 2CCKA 4JLOA 3RANA 4PPQA 2QE7A 1GSIA 4JLPA 4MRVA 4XWAA 1E4YA 2ZJ5A 2QM7A 2YC4C 5FFMA 1E2PA 5F98A 3TKLA 3W2IA 4CRWB 2GEDA 5JCZA 3I62A 3PUVA 5KHOC 1D1NA 2ZI3A 4B75A 2BPOA 1UPTA 3EZ7A 3AKDA 2FFHA 2G88A 4RY2A 4LBWA 3D3QA 2BBSA 3AGQA 1BYIA 2Q9BA 4TYYA 2V6IA 3GLIA 2F7SA 4LJ8A 1GM5A 2BV3A 3RS5A 3SJBA 1W49A 2EFHB 4MH0R 4TMKA 5EUMA 3SR0A 4UJ5A 3T1VA 3W3ZB 3KX2A 4L15A 3N70A 4QHSA 3MCAA 1R7RA 4M9QA 1U0JA 3JVVA 3JQQA 2QI9C 2J0SA 5JECA 1ZNYA 1COWD 3P4YA 1E2EA 4M1SA 5C2JB 4B74A 2GCNA 1K5DA 1BX0A 2BSAA 1CF4A 4M0LA 3EPJA 4I99A 4OHXA 1IONA 3EX7C 3MD0A 4F93B 2YWEA 1MO3A 4NYJR 1A5TA 2W0MA 4JZKA 521PA 1W36C 3WMGA 2VF8A 1C4OA 4FINA 5FTNA 1VYVA 4Y0AA 4NCJA 5EE9A 2IYWA 2X1VA 3ZIAA 3FPKA 2ZRAA 2FGKA 2F43A 1II8A 2ANBA 3N2IA 1VQPB 3PEYA 4ZIRA 3RRMA 2B8WA 3B7GA 4M9SA 1JQJC 1HA3A 1NG9A 1ZUNB 1YZLA 1Y63A 2AL7A 2JDIA 1GO2A 1I7PA 1UKYA 1TTTA 5TV2A 3O8BA 1ZAKA 4LHXA 1ZU5A 2JIZD 1E6CA 4XSHA 1N2CE 2OFXA 2FSGA 4JS0A 4BZXA 4U00A 2O8CB 1KKLA 4JT2A 3SEAA 1KKMA 2NO9A 5J4LA 1S2MA 1CULC 2EU8A 3FVQA 3LW7A 1DAKA 3GJ6A 3VO1A 1UEJA 2KI5A 1KTVA 4HLUC 4QL3A 1AZSC 4ERNA 3GJ7A 2WV9A 2CHQA 2FEMA 5AUQA 2A9KA 4BLTA 4UAJA 1N6IA 3QOFA 1YR6A 5SZHB 3L43A 1ESNA 1RRPA 3QI2A 4Z1MA 3LLUA 2DFNA 2MMGA 4B71A 3GEHA 4ARZB 2ZRCA 1E2DA 2ZSFA 3MRSA 3NBXX 4KYUA 3H1TA 2VNIA 1UDWA 2RAPA 4OJQA 2JATA 3GEEA 4NCHA 1EP3B 2QAGC 3L0IB 5GVRA 5KDLA 1W4AA 2XOKD 2X2EA 1OW3B 1M34E 2BBTA 3NIBA 2ZI5A 5EP1A 2Q3MA 3HYTA 2ZYVX 5FOTA 1KJWA 4MRSA 3K09C 2WAXA 3ASYA 3NC0C 4ZKDA 4DLXA 2Z6VA 4XH9B 5EQTA 4ZO4A 4OHVA 5DISB 5B30A 1NIJA 4ZDKA 3K0EA 4FXPA 4P4SB 2YOGA 4DLZA 4M1OA 1P7CA 4IDPA 1IY0A 1J70A 4NPHA 4O2RA 1IN8A 2CLDX 2WJHA 1W35A 4ZDJA 3NVAA 2QMOA 4D6PA 1FNDA 2HDNB 2FSHA 4W5JA 1A2BA 1KI6B 2ODEA 1AQYA 2ZS8A 1FZQA 1NMYA 3AVQA 3ZC3A 1NSFA 5JWHA 3TK1A 2RGXA 1NN1A 2VP2A 3PCRB 4TLDA 1OFUX 4WA7A 4D4JA 1AM4D 1FX0B 1WBDA 2XXAB 2BMFA 2WIBA 1QX4A 2CRVA 2D2FA 5C4GB 4EPWA 2ZI9A 4BFYA 3CRZA 2GESA 1OIVA 4TSFD 1KC8D 1UKVY 2ZI6A 3H4MA 4MKHA 4ESHA 2H8KA 5LD2B 2O8FA 1R4AA 3EIEA 4M1WA 3QKRA 1UEIA 3WBJA 3R20A 2PL3A 5GVSA 4JL6A 2QU8A 1S8FA 5CYOA 4URVR 2QG6A 1N6KA 2BIFA 4KHZA 5JZVA 2ZYWX 1JXOA 2OM2A 3WP1B 3E20A 3MMPA 4O2LA 1ZM9A 1E1RD 2W2VA 3GPLA 5KDDA 3R9XA 3U6KA 1IXSB 1H65A 1LY1A 3QENA 2I1VB 1GAQA 1KAGA 3REFA 1ESMA 2Z0MA 4RFSB 3IUYA 4HB0A 1OFIA 2X19A 4A92A 2DWPA 2BEJA 3UG7A 1G18A 2PIAA 5JS7A 5KSZA 3AKEA 1CJKC 3VR2A 1E0AA 3QFTA 4I1VA 1HE8B 4XWKA 4M2LA 4XD7A 4UNQA 4QGGA 3V00A 4D0NA 3TSOA 2GCPA 3KXKA 1S3GA 1NF3A 1XTJA 3GCGA 3SS8A 1QBKC 3CUEF 3T5GA 4UJ3A 2YWFA 3CF2A 4E03A 4KFSA 1KGDA 1I2MA 4ZI2A 2WWFA 4PZYA 3CKLA 2VHCA 5HPYB 2C8VA 2WPDD 1U9IC 3AEZA 2KE5A 3BB4A 3S1AA 3W6NA 3GLFA 1SKQA 1MOZA 4HAYA 3B8HA 2GETA 2P5SA 4IDQA 1G17A 1T8TA 4M1MA 5HCIA 4TYQA 3C41J 3UMSA 1IOZA 4TLEA 5JJLA 1E2LA 2BMWA 2PMDA 1M7HA 2G77B 3HYRA 3L8YA 4BLSA 4M53A 4DQLA 3AF4A 4CEHB 1XEWY 2GK7A 4QOSA 1S4QA 3ZD7A 3PEVA 3HPQA 5DYIA 3FKSA 4BZPA 4Q9LA 5L3QB 2OCYC 3I72A 4HUQB 1RPZA 2ANCA 3AF0A 1GAJA 3QF4B 2QTFA 1NBME 4H1VA 2IA5A 3IPYA 2AWOA 1Z47A 5EE3A 1VG0B 3BH0A 1M7GA 2V4ZA 1X6VA 3OESA 2ECKA 1XTKA 2QP9X 1P3JA 5E7IA 1HT1E 2I1QA 5JJIA 2J41A 3KQNA 3B1WA 2ZRNA 2LKDA 3X1DA 2VYQA 3GJ8A 3AVWA 3FMPB 4DSUA 2AKAB 1UBGA 4JVSB 1UBCA 2OLJA 3CPJB 2W83A 2W6ID 3TMKA 4MYUA 3U7EB 5SZJA 5GJBA 4YHBA 5IK2D 2HXSA 4LHWA 3X1WA 1W36B 2P6NA 2XITA 1JR6A 1ZIOA 2RGDA 3NDPA 3GJ3A 4OBEA 3QSYA 1KO5A 2AX4A 2L0XA 1XMIA 2IUSA 4DHEA 5M04A 2DY1A 1P9NA 1X8JA 4AURA 5DI3A 2VA8A 3ZLJA 1OXVA 1Z6XA 1R0YA 2ZS7A 5FOSA 4K46A 1JNYA 3WNBA 1VYUA 2WM9B 1JB1A 1YQTA 1Z06A 1GNQA 3SN6A 1WCV1 3AVOA 4Q1DA 4PAOA 3TVDA 4JVMA 4C30A 4EQ6A 2DBYA 3K9GA 2JA1A 3QXCA 2IL1A 2ZANA 1GUAA 2F9MA 5H68A 2A3RA 2ZRHA 4URYR 5FBLB 4CT5A 2WWIA 3T5DA 4P33A 2BGIA 2D7CA 4UXJA 4KLZA 1TL7C 2P0EA 4ESVA 3L0PA 2Q0HA 2GAAA 3GQBA 1GILA 1N0UA 3KKOA 1KO7A 1KY3A 2IYLD 1UMKA 1JR3E 3H86A 4Q7MB 4YAUA 4KI0A 1W1WA 2IF2A 1L4UA 3VU9B 2QAGB 2R62A 5CK5A 2PT7A 4ARZA 4DDUA 2OAP1 2IBMA 1JALA 1KI8A 5LBIA 2NPIA 5LPNA 2F1JA 5FPKA 4DCTA 4URWR 3U44A 1ZUIA 4UNPA 4ASUD 5JRZA 1XPRA 1J9ZA 3ES9A 5L3SA 5L3VA 3CWQA 1E1QD 5FBVB 1IAQA 3ZD6A 3EWSA 1VG8A 1E79D 3TLXA 1G41A 5FL7D 4CGZA 1YHQB 4C4PA 1PJRA 1KQSB 5GV7A 3QXHA 3RS0A 2ZXUA 3FFBA 1KK3A 3FTQA 4LZZA 5KO2A 2JLSA 5HKKD 2XNDD 4DSOA 5CYPA 4LX0A 2MSEB 1RRFA 3ASZA 4XJXA 5JCPA 3KQLA 2QSZA 3W2FA 3OAAA 1W36D 5D3MA 4FK8A 4OI2A 2XXAA 1FX0A 4FMCB 4A0GA 1GIAA 2PMKA 3A58B 1ZINA 2XEXA 3CPWB 5EZ6B 2FH5B 2GEUA 1G4AE 1ODFA 1W0KD 2YJTD 3GD7A 1Q0UA 5E95A 3KTAB 2BCJQ 2V8OA 2VSOA 4JKYA 3Q85A 2GXAA 4QNMA 3PUZA 1VECA 3SU8A 3LX8A 4GI7A 1RVDA 2WOJA 5EP3A 5EJEA 5KUTA 3EW9A 4OJKA 3P32A 2NO0A 3C7KA 3QUSA 4X8OA 2O8DB 3D31A 4NONA 4E22A 1JA0A 2FV8A 3U7GA 1J99A 3SBEA 5G41A 1XU4A 4KBGA 3ZZTA 4YXWA 2WJYA 3QKSA 2BWJA 5AJXA 4MYHA 1SKYB 1W34A 1G16A 3WNCA 3QF7A 2W6JA 5AUPB 2UVQA 2QBYA 2VSXA 4Q9HA 2VZLA 1VCNA 2IYUA 2DB3A 3RWMB 2KJQA 5KDOA 4IDOA 4V0MA 1S0UA 4RZ3A 2EYQA 4RD3A 5JSZA 4CEJA 4U5XA 2NO7A 3NHAA 4C0QC 4Q9JA 2PZGA 3CC7B 4OQLA 1OT3A 1GKUB 1QRAA 4BUJA 3FMFA 3SC3A 1VG1A 1NLZA 2PJRA 1DELA 2CJWB 1D2MA 1KDRA 2ZRJA 3BH6A 1TQ6A 3NH9A 3UIEA 2J3EA 3DMDA 5GJVC 4BEJA 2NMVA 3SE0A 3TVTA 3V9PA 2ZRDA 3ADDA 1J8MF 1XCMA 3PG5A 3AV0B 3ZVMA 4XVQA 2OBNA 4X8LA 3CH4B 4QHTA 1QGAA 2WWWA 1F5NA 3HU2A 721PA 2JJ1D 3VR1A 3G71B 4AKGA 1LF5A 4HAZA 2JLVA 2TMKA 2V7QD 2VL7A 3BS4A 2C04A 3U4QA 1G7CA 4LC0A 4K81B 1DVRA 1Q57A 2UZIR 3LBIA 4BZQA 4C2TA 3W6OA 4FCVA 4Q4AA 2IXFA 4B47A 3CD6B 2H16A 2RGBA 4EJSB 4ZDWA 4R2IA 4US0R 2ZJBA 1Z22A 3V4RA 1DAIA 3HDTA 5ELXA 4LYFA 2GBLC 3CX6A 3QE0A 5L3QA 1OLOA 1GNRA 1GITA 1HE1C 4P6VF 3QFCA 1G8YA 1CKEA 1JXMA 1T91A 4PSAA 2IS6A 1N0WA 4LJAA 3QEJA 4NH0A 1C1YA 3F3YA 3W3AA 4C43A 2PEZA 3N5CA 3FFAA 1O87A 4V03A 4Q7LA 4LJ7A 4B3XA 3B6EA 1T0HB 421PA 3OJXA 2I3BA 2HLDA 1SZPA 5LDDC 1E79A 1N3BA 3PEUA 4EFMA 1KY2A 4DRZA 3LO8A 1GG2A 2N46A 4JL8A 2ZUBA 2ZETA 1LV7A 5FTKA 3Q9LA 5J5CA 1UDXA 2CL7X 4QM6A 1H8ED 1ZBDA 4C7OA 4PZZA 1ZCBA 1ZCAA 3Q5DA 4OL0A 1TAGA 2HMAA 1VMAA 2J0UB 2MSCB 2Z83A 3NC1C 4B3GA 4QXAA 1QUFA 1QG0A 4NP6A 5TB5A 5IF9A 2C77A 4FN5A 3CF6R 3OZXA 3SYKA 4A6XA 1OKKD 3L8ZA 5FTJA 1Z6TA 4YMSA 4LSGA 4NL4H 3GJ4A 1Z0FA 4IKEA 3NBYC 5E7MA 5EE5B 2BC9A 5J4KA 1KJZA 3ADCA 1ETUA 4S35A 1EFHA 4GOKA 621PA 4R9UC 3SQXA 3W8RA 3I55B 2MSDB 3MAAC 1I4DD 3QEOA 2EQBA 3RHFA 4AIIA 1TF7A 1TEVA 2XGJA 4OQFA 2J87A 5EZ5A 2B21A 1XBTA 3E2IA 2RHMA 3Q8XB 2BJWA 4AF6A 3W2HA 4I81A 3DM9B 2VNKA 1PV4A 4A0FA 2PT5A 1FDRA 2CL0X 5CLQA 3IILA 2ERXA 1SVKA 1QVAA 4OI0A 4EPYA 5CM9C 2GF9A 3K8YA 4CZ2A 4QBFA 1NY5A 2NG1A 1VQKB 4MITA 3ZGXA 3PUWA 5KNBA 1HYQA 1W0JA 2IS2A 2WAYA 2RKOA 4RCYA 4R71A 4PHHA 4I1SA 2AXNA 4BPBA 3QPVA 1K8RA 3AF2A 4Y0VA 5FTLA 3TNFA 2XSZD 3IEUA 1ZUHA 1II9A 3K0AA 3VU9A 1T5LA 1AJEA 5AJYA 4UXHA 4CT4B 2DCUA 3TUJC 3K09A 4AWXA 3CPHA 4NYMQ 1AGPA 1JEEA 3CLVA 3RDPA 4C0BA 1G64A 4QGFA 3OJWA 2GVZC 3RRYA 2J7PA 3IIMA 1KO4A 1UKEA 1E2KA 1QG2A 5G40A 1YZTA 3BERA 4G0NA 1RRGA 1AGRA 4V0NA 5J4YA 3HJNA 3DEFA 5FH9A 4BECA 4QJ4A 5H1YA 5EE0A 2RGGA 1SVMA 2J0VA 2X8AA 3ZYCA 1XX6A 3OEEA 3SDZA 1E9DA 3UWKA 3T1QA 1UAAA 3EZ9A 3SJAA 5THXA 2FWRA 2Z4RA 2ZS9A 4CEIB 1SXJA 4ZI3A 3U6BA 1GNPA 2JLZA 3NEJA 3LXRA 2IEZA 2ZRIA 2WKRA 5CIQA 1GVNB 2PEYA 3TSWA 5AN9A 1E9EA 4IOMA 3JVUA 4Q1BA 4IDNA 4BEBA 1KDPA 1XXHA 5JJKA 3ZDQA 4JLAA 1RRCA 4IVRA 3A1TA 4BFSA 2XNSA 4Q66C 3E1SA 1DG3A 3KDSE 3I3SR 5G53C 1N5LA 4CVNA 4D81A 4A0RA 4BPRA 4B76A 2O8DA 3KKQA 4GL2A 2GA8A 1ZYUA 2BOVA 4FCTA 3THWA 4EPTA 2VH5R 3C15C 3K70C 1E64A 2QPTA 2ZREA 1P73A 4DDWA 4KFTA 1UBFA 1QGYA 1KI9A 1W5TA 2OSBA 3VHLB 2N1BA
chains in the Genus database with same CATH superfamily
1EJ6A 3RRZA 3BTOA 3I6ZA 4KAFA 2IYYA 2OORA 4ZANA 5DNCA 4N65A 5C1DA 1SBZA 2C07A 3CW8X 5B64A 1I4EB 4GGMX 4K9OA 2B35A 4FPXA 4B46A 1JJVA 3EG9B 3IQZA 4GWLA 3BE5A 4DAEA 1AQLA 3EJWA 3L79A 1SG6A 1XI2A 1CY4A 3OUTA 4WWHA 4BFTA 8ADHA 4OL9A 2CJWA 1H05A 2ROQA 3P9CA 1ZJ4A 3DEYX 3JQ8B 3L04A 2YC2C 4IIYA 4J7XA 2XUPA 1YRLA 4P1VA 2PNJA 1L4GA 1XALA 2XGGA 5TE9A 2PLRA 3DXXA 4LC9A 1JIQA 4OGFA 1M8PA 3KQUA 3F96A 3KXDA 5CB0A 3LBNA 4RMNA 3VC7A 1M2WA 3E9RA 1UWLA 1MV5A 2MJLA 3IESA 4JKOA 4MA5A 4OMFG 4WKCA 2GCOB 4URXR 5FWXB 3VYRB 1CUYA 5AOBA 4II3A 5ADWA 1RC8A 4D0RA 4MV3A 1NV9A 2DUJA 1F0YA 1T5HX 3ESCA 3O73A 4OQNA 2B7BA 4H7EA 4TYPA 1PR9A 1F8UA 2B8TA 1NU8A 4G8CA 2A5YB 3B36A 5HKBA 4LCJA 4BNVA 1Z4OA 2M9MA 3FNGA 3M81A 2WZPP 2RKBA 1O6FA 1AQ6A 1Y9AA 4ZYZA 2VUSA 3G0CA 5E4TA 5JQGB 2UZ1B 3V7YA 5AJZA 2BUBA 1UC8A 2Q9CA 2I6SA 3E9NA 4RENA 3ZE1B 1J0BA 2VXCA 3CLHA 5BUCA 5BW8A 3HH8A 1EQUA 5GV8A 4LDZA 1E1NA 4DIBA 4PLHA 3H8SA 1Y80A 4QGAA 4I4IA 3AEUA 4QOSA 5ITZA 3WLSA 2C03A 3M7IA 1U3WA 1CIVA 1F48A 1R9MA 3BL8A 4D9JA 4QPNA 4E5PA 4CM9A 5DM4A 2ZZKA 1NUHA 1A9SA 4POAA 2AW5A 5KNLA 3ZHVA 4JBYA 2D5IA 4IV8A 4GR5A 1S9HA 1ZA1A 3GARA 2GYYA 1Y4DE 3KBBA 2VZ8A 3IEVA 3RY8A 3B9PA 3O9VA 1PFGA 4M38A 1VQ1A 2R66A 3DUFA 4YP7A 3QLUC 2D54A 2NO1A 2CFIA 4J49A 4HNAA 4LBVA 1SBYA 2PRYA 2N75A 4QXOA 2YNMD 3UK0A 2VSFA 4OHKA 5EJ4A 4KGDA 4FR2A 1TJ5A 1JHUA 1WHSB 1UJ5A 3DFMA 4BP8A 3SJCA 1YRAA 1K7CA 1MO4A 4PS1A 4K40A 4PTLA 4JGBA 5DGXA 5EE1A 3RU3A 1M90D 3Q41A 1PZFA 3CVYA 2QUHA 5DASA 3UMJA 2FN4A 3PQ6A 2VAMA 5JYDA 2VS1A 5EZYF 3OF3A 3AY6A 1FBNA 2ZTNA 4B3DA 1TQDA 2CXSA 4MTCA 2VP9A 1YZQA 2D0PB 2HJHA 3ZY2A 2RMKA 2BRUA 3JQAA 3Q3HA 1QV7A 4Q3DA 4Z4SA 4AJ2A 1GTRA 2QW0X 1R6TA 2PUVA 3PT9A 4IZOA 4J7AA 2RARA 1ARZA 3MMXA 4QSHA 5AM0A 3IBYA 3LD9A 4B33A 4PAQA 1IY8A 4FGLA 1YF3A 4N7BA 2E1PA 3DO6A 4P4UA 4M98A 2QMEA 2PYIA 2CBGA 2ZJYA 3U4DA 1VHEA 1GN8A 4W1QA 2EGHA 1XD9A 4M21A 3MUEA 4LFAB 4FFNA 4IP0A 1N6OA 4OX9B 4EGQA 4YMUA 1RYHA 2VPWA 3BJZA 2HJVA 2WSSA 5DNVA 5JYBA 2F1LA 3IV7A 1CYDA 4U4AA 1SBCA 1T5OA 1STOA 3C6QA 5LQJA 5K5EA 2ZTVA 4M8NE 1DKLA 4Q4JB 3ORRA 4HB3A 1SB9A 4P2BA 4M1ZA 4KZKA 4RYDA 2O19A 4F5YA 2BR4A 1E9SA 5ALIA 4AZ0B 5F4OA 1I4LD 1LC0A 2PQ2A 3DUWA 1JQLB 2NUAA 4E7PA 4DR4B 4HB4A 2D7DA 1P45A 1OLUB 4FT2A 2QXUA 3DSRA 3O8OA 3ZHTA 4HYYA 4C0AC 1W5EA 3EEYA 3CG4A 3EMVA 2KSQA 1N2XA 3B1VA 1XKQA 4FUTA 1XE1A 4QPPA 2ST1A 2WVJA 2X5OA 1X7XB 2WAOA 3DA8A 3EZNA 3B1YA 3NH6A 5DVZA 5FEMA 4BDSA 1NNEA 3DZGA 3LKBA 2H1OA 4ZHQF 1IBCA 3QELA 1C4WA 2HHJA 3ID6C 4AS2A 4V1CI 5D7NA 3VTFA 2B7LA 1O8BA 1YBMA 3CUSA 2WVAA 1QDLB 1GNLA 5DLQC 2D74A 2X6QA 3FB1A 1CU1A 5FBWB 1I2DA 1B8VA 1JILA 3OEHD 5LB2A 4KN5A 3ILVA 2VA9A 1JE1A 4PLTA 1Y8ZA 1VSQA 4RD6A 2IHVA 2V3CC 1DCKA 1U1DA 3FSRA 4QTTB 5IUKC 4E0BA 3I5YA 3X2EA 3WGKA 1W96A 2JLQA 3TS1A 3L7BA 3TFQA 4CUKA 2FQWA 2OAQ1 3HWSA 4RH1A 4RVHA 4EA6A 4ENTA 1VHJA 2Y1EA 3M34A 2FQQA 3SBOA 4EHIA 4LIPD 1Y1SA 5B6PA 3ETJA 3UGKA 2XOXA 4D98A 4GT1A 1A5AB 5JADA 2W6OA 3HVUA 3A9VA 1XCPA 2Z5LA 4TOIA 1RBZA 2JAOA 5CA1B 3HMKA 1N77A 3SQDA 3SYMA 3HFJA 1AUPA 1GGJA 2XZTA 3KLNA 1SBNE 4MW4A 1E0SA 1N6RA 2TSYB 3MXOA 3KSBC 1NW6A 3GGOA 3O92A 3SMQA 5FLKA 4A2WA 2AK3A 3TW6A 4A5SA 1Y7TA 4KR2A 2C9YA 2G7MC 4L0CA 1CS4C 3FLMA 3K6KA 1XZ8A 5JAHA 1SM4A 1BQEA 1DZ3A 3NONA 3OP1A 2GPAA 4GEGA 4I1UA 2V31A 3TLMA 4X20A 3WGIA 1IC6A 3BCFA 3CCLB 2Y1GA 4JP8A 1DB3A 1MAUA 4E31A 4EY5A 4J0EA 4ZVMA 3T8YA 3WWDA 4C7JA 3H13A 1PHPA 3L9WA 4LXIA 1QHHB 2YWHA 2W93A 2CXRA 2PRZA 1CUJA 2VHJA 4MQ5A 2P40A 3H84A 4NEHB 2ZRBA 1X7HA 3DGFC 3RVMA 2E4WA 4HXGA 5F4ZA 2YXEA 2JIZA 2BI4A 1DIAA 4AZTA 3L7KA 1R5OA 5GP1A 4DCJA 1EK6A 1XJCA 1VQ7B 3P27A 1K5HA 1PEAA 2IQ5A 3DR3A 4RA6B 3RS9A 3TXAA 5CDYA 1PT8A 2XGMA 4TYNA 2BM0A 3GSIA 4B48A 1NVMB 1KDVA 2XNHA 4M9XA 1B0AA 3K71B 5CYGA 3QM1A 4XJVA 5DE3A 1NTOA 2CGEA 1Z8FA 5T41A 2OGZA 3AFOA 3GV0A 3TD9A 4GM4A 1YA6A 4M6WB 4ZCMA 4A27A 1KEWA 1OLSA 3EVBA 3B78A 3L8HA 4US1R 2B6HA 4H0CA 1ADJA 3WGVA 4BVFA 4YMTA 2CXUA 2GFHA 3WX0A 4BQOA 3JYHA 2Z57A 2I34A 5IBRA 3ZK7A 2VATA 4GKBA 4TKUA 1DTWA 3JQ7A 4Y6PA 3FOZA 4NEQA 2L42A 4YT5A 1JUDA 5SICE 4F11A 3L5OA 4AXBA 2X6WA 2XOKA 2OENG 4IHQA 4N39A 3KK0A 5FUQA 3QTTA 1N0HA 4ZCQA 1A9TA 5TARA 2R6DA 4B6OA 1BIFA 3NYRA 3R9KA 2H7VA 1WCIA 3U7QA 1J49A 1VPLA 1B73A 3CURA 3PX2A 3DBHB 4QRIA 4Y67A 3EG5A 1I0LA 3SFVA 3BXZA 4Q4DA 3A1CA 1J5PA 3DMHA 1SEVA 3F9IA 2VHTA 3KSUA 4RIHA 4ZQFA 2RC6A 4FGSA 1BMFD 2ZJ0A 1HLDA 1YE3A 1WM1A 1BG6A 4NATA 2O0JA 5F21A 5JZSA 3T4PA 4HHEA 1J8DA 4YAEA 4F3RA 4X0CA 1I6WA 2IU0A 5BPFA 4DB2A 4CXMA 2I62A 3A6PC 1FFAA 1OWOA 4I1PA 2NLOA 2YQ4A 3SOZA 5LJLA 3FY4A 2VP0A 2WSBA 4DADA 4EPXA 1SQ6A 3Q7QA 4H60A 1WPGA 4P5EA 2I4LA 1XVIA 2X6TA 3L8GA 4B6QA 1UK7A 2VDUE 1G9SA 2ZXEA 4K9NA 3G8BA 4BVKA 5KWEA 4W8GA 1L7DA 2BZGA 1X2EA 1Z4PX 4UTXA 3HV0A 4F72A 5AW0A 1N5KA 2CJPA 1PVDA 2ZIXB 2C5GA 1J8FA 1QHSA 2XY4A 4GDMA 4DHWA 3GP8A 4TSFA 4GXTA 4U5QA 1JHOA 4ZEMA 3FHTA 1E5TA 4Y7DA 3E3MA 3HCPA 3V3TA 5A9SA 1LDMA 2PH3A 4HOYA 4WKBA 1LSSA 3PKIA 3OPYI 2D3NA 2FFQA 2DPLA 4RORA 2H3HA 3TI9A 1XJWA 2VC2B 3LH5A 5J2UA 3BIOA 4P34A 2OOSA 4PZLA 2HTEA 2BEUA 4IDFA 2YV4A 2RGNA 5K0SA 2IQIA 1HOXA 1N2CB 5CCDA 4BLRA 4P2NA 1OD6A 4Q3LA 1XDZA 1BGWA 3FJ1A 1L8OA 1Q12A 4RF5A 1VDMA 5DYTA 5HZHA 3CRNA 2JAUA 3OZUA 2I3DA 2QM8A 2WLTA 3TZLA 1VSBA 3PDIB 4F9TA 4QUGA 3PHGA 1Y3IA 2RJNA 4KVGA 3J7AC 5IYZF 1OGYA 3KJFA 2FPKA 2WNHA 1YO6A 4E4TA 4HQFA 3K9NA 1ND6A 1QCCA 2C5SA 2ZWVA 1N8TA 3IA2A 1CQPA 2O8BB 4GE3A 4KIUA 5ESDA 4TLBA 2J32A 3AR2A 4X7PA 5K3FB 2QN7A 2W5UA 4JIMA 3P2MA 2AD5A 2NXEA 1T0UA 1PWHA 4FMPA 1IN1A 1M67A 4XLCA 4L78A 4DCSA 2NV4A 1TF5A 4C4SA 1DQNA 2R00C 6Q21A 3VMFA 1D9ZA 1M34B 3N8HA 2BHSA 3NRJA 4M0UA 4JYPA 2OE2A 1BDIA 5TQVA 1GCGA 4LY9A 1MF7A 2QQEA 1N5IA 2AE2A 4AK9A 4PG5A 1MZPA 1EFAA 1KR5A 1CDZA 1QVZA 3OEWA 1FRFS 1OB2A 3V8MA 1QP0A 1TZBA 1IAVA 3RJ5A 4W5QA 1H93A 5KOHA 1D2EA 4HNRA 3LHFA 2O3JA 2J85A 3RROA 4DTIA 1C0LA 3U4MA 5L53A 1KC3A 5EZYA 4E5VA 4EYQA 3EXHA 3OM0A 5BV2P 1Y7IA 1E62A 1WF6A 1NQAO 1Z62A 4PPGA 4UARA 4XWGA 1BD3A 3TLKA 1EIWA 2NZUG 3D3WA 4N3CA 3BILA 5HHTA 1F3LA 2AG0A 2B99A 2FCRA 1JU3A 3EFEA 4OUDA 4Y0NA 3UTCA 5AW4A 1W36B 3A3PA 2CFRA 5JXGA 3VKWA 4DMHA 5BSVA 3ND5A 3PKZA 4HWTA 5SZIA 4LZWA 4G7WA 3T06B 1Z37A 1I0ZA 5JEDA 5DNYB 1V43A 1QIFA 3BAFA 2WD9A 1PSWA 5GONF 1EFLA 3KJHA 4HMOA 3LVBA 1VKJA 4UXIA 4LJKA 4HDQB 2ACEA 1MABA 2BGLA 3EOAI 1XTUA 4M54A 2IIBA 4GM1A 2JI6A 5DHTA 4DZTA 1Z7BA 4WCFB 3Q3JB 5AXCA 1XK7A 1PV1A 2IK8A 2ZYHA 1FSPA 2TECE 3ZE7A 1KMHB 2WFLA 4UMDA 2Y27A 1FTSA 1OPXA 1GTVA 3KD3A 4RCVA 1U6KA 4AX4A 3NIFB 3LRPA 2AFIA 3UFXA 4L8WB 4IDAA 4HN9A 4DFDA 5HQ3B 1SBHA 2NSDA 3TRKA 4QLAA 3KQQA 5BV8A 1YE8A 3T3OA 2C8KA 3IHLA 2EF0A 2OTLB 3O7MA 2Q27A 1Z4IA 5J63A 1S8NA 1FMLA 1QFYA 3R9IA 2IZ7A 2Q5LA 4L4RA 3K0BA 4LF6B 3CLKA 1H9CA 2P5YA 1HYGA 3O4GA 4B6JA 4XQ0A 3I9MA 2VN8A 3HE3A 1R16A 1YRWA 1YIDA 3V48A 3LCVB 2X8JA 2LTAA 5DN6D 3T1HB 5WRFA 2UYOA 4X7MA 5ALKA 3TE6A 1AC5A 5CLGA 2PZMA 1XRPA 1OA0A 3GHHA 3OZ7A 1E5VA 2M6RA 3GJXC 3TQHA 4ZHQA 4KR7A 3L3BA 1G2QA 2GJRA 2AUNA 1V16B 2ZM6B 3HDHA 4NHOA 1DLJA 4Z54A 3B1XA 2DFDA 5ALHA 1SVSA 3ZK8A 2SICE 4D8YA 4QHYA 2IU4A 3L6RA 3RU9A 3QJYA 2LNDA 2RCYA 5JD6A 4PY2A 3O03A 4K0RA 3W8DA 4PSUA 1A69A 1JR2A 1YZNA 1C0KA 2GEFA 3P1JA 2BFFA 4FHCA 4ZGGA 3KXLA 2BLLA 4RESA 4UU1A 4TTAA 5DGTA 3OLQA 4E2WA 1QK3A 3EPPA 1NKSA 2D1FA 1FQWA 4N1AA 2ZZGA 1QVFB 4P5PA 2YZMA 1MFZA 2OCAA 4L0DA 2ZLBA 1X80B 4KXXA 1YIAA 3B6KA 3Q9UA 1N2IA 1QHGA 4IUBS 4WJKB 3NG1A 5BN4B 5K3CA 1I3LA 3QX8A 2AN4A 3QJGA 2AF4C 2FLKA 2GQFA 5IBQA 4HUQA 1QRSA 2YVUA 2A9VA 3AR3A 3IKJA 1CEEA 6PFKA 2PN1A 4Q4HA 4QOJA 5KTKA 3G2KA 3QF4A 4E0FA 4C9BA 4WZLA 4ASUA 3L1KA 4KAAA 3WIVA 1A8IA 5CA0F 4OMUA 4I46A 1E99A 2EGUA 5FF9A 4A2CA 3HDVA 4W5NA 3DDNA 4DIKA 3EZ6A 4N0DA 1VXRA 2CLCX 1FP6A 2GZMA 2W2LA 3PXAA 4AS3A 3FR7A 4FOSA 4KPUB 1J8YF 5B4TA 2WHXA 1YI1A 2EBUA 3PTZA 5AVKA 4HY3A 2ZSBA 2CDAA 2YWDA 3DAPA 5CLHA 1QZXA 5HKKA 2XNDA 1ZH4A 3M5PA 3ZXUB 5I7RA 1MC5A 1T4DA 1U3FA 2GNOA 2Z43A 5JZ9A 2NU7A 4OJMX 3HRHA 3TBHA 5BYJA 2HWYA 4LTMA 3WR5A 3PJRA 4L9WA 5JW6A 1M2OA 1QQTA 2AD1A 4B6RA 4DR6B 2HU5A 1C9MA 3HU3A 1L7AA 3E0XA 2VBIA 3LPCA 4NENA 4OXQA 3ZCPA 4B6FA 4K9KA 1K4MA 2BDTA 2P6MA 3QXJA 3ACBA 3O94A 2PMBA 4LZPA 1XTVA 3H2SA 6ADHA 2EATA 2QJRA 2BL4A 4HC4A 4ILEA 1N6PA 1YU9A 1QR2A 2HA4A 3LA6A 3OLZA 2VZ9A 4AC9A 1U0FA 4P31A 3HACA 1HQYE 2WHPB 1G4UR 1S96A 1Y8RB 2DPHA 2H4XA 5F5NA 3VBEA 3UKDA 3SVLA 3PUJA 4LDQA 4GO1A 4WE3A 1X42A 4GL4A 4JI3B 3RC3A 2JGEA 2VKQA 1HTWA 2H54A 2JFBA 2XTMA 3GPDG 3Q38A 2F9LA 3A4IA 3G6KA 4RNDB 4KKUA 1V5WA 7GPBA 1SRQA 3I1IA 1OIWA 4O3FA 3GK3A 1M6HA 1UUFA 1LSOA 1ZP6A 3E03A 1XZBA 2PKCA 4HLUA 3DDSA 4CHGA 1LTQA 3DLCA 1IQPA 3D2AA 3DKIA 3U7RA 2K7FA 4MJ7A 1L5HA 1KH3A 1J25A 3COWA 1EGMB 3U1BA 4RTOA 2CLHB 2JFXA 3UB3A 2Q1SA 4RLSA 3VKHA 3JWHA 3PE6A 3OQIB 5JSFA 2D62A 1WR8A 4UHFA 5CX4A 4EELA 1TYAE 1YIJB 2CFCA 4JLSA 5H70A 4D5EA 4LJ4A 3LE8A 5B3JC 5CJ2A 2Y2VA 1IJFA 2AJLI 4RCZA 2V55B 1VJGA 2XYGA 4L4SA 2IYTA 4UCFA 3AL0C 2WF8A 2QAGA 4YACA 2M6LA 3TIXB 4RK5A 1VLLA 3IOMA 2QNIA 3NYIA 3WMEA 1E59A 4TMXA 5EERA 4HLDA 2AMYA 1GPWB 4MGZR 4DBLC 5KKCA 4MVJM 1YUMA 1U0SY 4JD5A 1TF2A 4A0QA 4JLBA 2EZ9A 3FVWA 1ZSNA 3PFKA 4DWVA 2KB0A 2E49A 2FA9A 2YKGA 4FM9A 4TRRA 4KC0A 1A3CA 5B3AA 4OAOA 4D9HA 1VPWA 1A4XA 4WLNA 1E6WA 1CR0A 1T0PA 2V7QA 3ROFA 3MJRA 3OOHA 4KV7A 4BFWA 4YQFA 1XT6A 1E92A 3MGGA 1A96A 4YI3A 4CF3A 5DDIP 4XCXA 4MIYA 1HLFA 2CLEB 3B5JA 3QGMA 3WQSB 4B83A 1Q74A 2F1KA 4XRRA 3ZK9A 4DEVA 3KQVA 3TJRA 1M2VB 3MJHA 4F1JA 5LQUA 3R5FA 5GM2A 1VMEA 2FVXA 5ALSA 4J0JA 4TMTA 3O4HA 4KBYA 2HMYB 3UV7A 3VC1A 2FUG1 4LRQA 3USCS 1JAIA 1Q20A 1SHKA 2QUJA 1U8ZA 4OCZA 1UKCA 5DW0A 2QROA 5BSUA 3WJ2A 1FUIA 2FW9A 3ZCVA 4H7IA 5LUAA 3FUUA 3C6MA 3K1YA 2DFVA 2QN1A 2A0XA 5DMHA 5JNTA 2H52A 1ULHA 5E6RB 4BBZA 5DM0A 3LRXA 4EIWA 3U80A 2LZJA 4TVOA 1BMQA 1ZA2A 4WADA 4DT1B 5ITWA 3EY4A 2GI4A 4DTCA 1Q91A 3LLMA 5FWYB 5KTPA 2FE4A 5IYZA 1FTWA 4Q7JB 4WQMA 4LNUB 3T5PA 4BVAA 5ILQA 2FN7A 3VR3A 4L57A 4OKSA 2PS1A 4RF2A 2F55A 2Z6BD 2EP7A 3R7WB 1K06A 4OBWA 3J7TA 2PBFA 1UJ2A 2OQVA 4AYTA 5SYMA 2P62A 4UTPA 4ZEXA 2J3KA 4IOLA 4V0KA 4PYMA 1RAIA 3K1AA 1QFJA 3GBSA 4X3OA 2FPLA 1D6NA 1R10A 3MS2A 1KAEA 1UQUA 5KJEA 3OWOA 4QUIA 3C70A 1MO6A 3UCEA 4PGAA 4MWZA 4ARUA 1FNBA 5H7XA 3KL4A 5IVIA 4F38A 2I4RA 4XVCA 3AKCA 5DGHA 4OK6A 4ETNA 2CWWA 2R751 1BO6A 4P12A 2AFIE 4MGIR 4BGUA 4PNZA 2FMFA 2B1RA 1DXHA 4OVKA 4PFKA 1NVXQ 4YONB 1PX0A 1Z2DA 5IARA 4QQFA 2WG2A 2QZZA 1GYQA 4H59A 4NOKA 3E1YE 3LSYA 3ND9A 2DQYA 3L7IA 2HW8A 4V0ME 1U9IA 5JVDB 1G1MA 3K3PA 1I1HA 3THSA 2I2AA 2ORED 4YV2A 3MCUA 3KB8A 4OM7A 2BTQB 4Z1MD 4FZVA 2WJ6A 2WJGA 2VCEA 3BWDD 4XCVA 1NRWA 2I4NA 5COAA 2Y3IA 3QHPA 2OO5C 4CMIB 4OPMA 4MGKR 3N8KA 1S3SA 3TLAA 4PLPA 1TVCA 2Q49A 3BWXA 1JFFB 4IDCA 3CZRA 1U5CA 5GONA 2AXQA 1AKMA 3PNKA 2QP3A 1QHIA 4PQEA 3K9QO 2OKGA 1H94A 1O9GA 2JEYA 1AUQA 3JWIA 5JXHA 4YO7A 3H9NA 1DXYA 1K4KA 2CXNA 2DH5A 1X7ZA 2J48A 3O90A 2XSZA 3IRVA 4GQIA 5EXPA 4MKIA 4QFMA 1HUQA 2G04A 4YYEA 2NP6A 5DTQA 3IP1A 1YD7A 1N0VC 2C78A 2B20A 3Q11A 5T7BA 2NUBA 1RYFA 1V26A 4KPGA 1NE2A 4B2IA 3PI6A 2OSVA 1OCEA 1Z6YA 3DCJA 3N0TA 4HQ0A 1H4VB 3VC3A 2GYVA 3FNHA 4MRRA 2QMHA 4LYJA 3CJRA 1V4VA 1A1VA 1IHYA 1WTAA 1XQ6A 3UQZA 3NBMA 3C3BA 4C2UA 1A27A 1S89A 1RDFA 2B1JA 4KQGA 1FYWA 2A3NA 1PL6A 2WOOA 2J08A 3OIWA 4GLFA 2NQ8A 3VX4A 2OV1A 1JKXA 1BDMA 1NP6A 1RKQA 3PNVA 3S70A 5I7FA 2FMXA 1LWOA 1QP8A 3AR8A 3PCXA 1FUEA 1YRBA 1LW7A 1Y4SA 2W6QA 4LHVA 2OCGA 4XQCA 2JEZA 2J0UA 3P94A 4D9EA 2GX6A 1X2BA 3O3CA 4DLSA 1TM4E 3FYCA 4KUHA 2JAXA 3CM0A 1J0AA 2P9BA 1T2NA 3R5JA 1Z16A 3F1LA 2XCTB 3I2FA 4MDEA 1J0EA 2JEOA 4XUGB 4YRGA 4LGVA 2P8JA 1R6BX 4QNRA 2QV7A 4HIZA 3NT2A 4UM7A 4RKRA 2PGIA 3RUCA 1JQ3A 1WA5A 3F5MA 3FMOB 1JHVA 1LVGA 4CM1A 4KPYA 4HPWA 4PAGA 1UD5A 4C3UA 4YCCA 3GGPA 5U4XA 3VR5A 1L5WA 1FTYA 1ZH0A 3DXFA 3K1JA 3KQOA 4R69A 3RI3A 1H4QA 1V1MB 4BQNA 4B9EA 4MPJA 1GCUA 3UMFA 1KOFA 4QJ5A 2V7XA 1E2UA 3IOEA 4UUPA 1UFOA 3LW8A 1X13A 2HBZA 1XTSA 3CSDA 3TB6A 3B2NA 1CD5A 4Q1AA 2QZSA 3R7SA 5BMOA 4K6MA 3RSFA 2X3UA 1J0CA 4UEOA 4IHJB 5G0VA 5IHPA 1DG1G 2X2PA 3VR4A 1KS2A 2FZ5A 4U7TB 4NZOA 5J3OA 1CBUA 3HVJA 5JCOC 3DNFA 4L5JA 4COKA 2FPPB 3TLEA 4POOA 3AERB 4FSHA 4IJUA 5CA0A 3RLIA 3TDKA 4B0PA 2NZYA 2NV2B 1E0KA 2Y0PA 3HUUA 5DT2A 3D2LA 1T4BA 1Z8DA 2Z04A 3OCXA 4WT7A 3RVLA 4EENA 1M2EA 4CDMA 3B82A 1YZFA 4LTDA 3L40A 5AW7A 2A92A 4PIVA 5JC8A 1XWIA 1UPCA 1LQ2A 3PJEA 2OK7A 1CUGA 2Y1OA 5BSEA 1GSAA 1DIRA 4PR0A 3KJEA 1J09A 3G0HA 1WL8A 3NOOA 1W48A 3AFMA 4HBGA 4R7ZA 2V58A 3RFFA 4JJ4A 1MPTA 3FNFA 1BQ4A 6REQB 2OPHA 3H2KA 3W3AH 3NV7A 3AEKA 2G1UA 2GPWA 3KSZO 4XYBA 5KAMA 2C5BA 3KYDA 3HY3A 5KU7A 4XM2A 2R7KA 4JAVC 4BNTA 1H8HA 2A1TR 3QLJA 2FTKE 3VZPA 3TF5A 1QQAA 1QRUA 3PRHA 4RKEA 3K5PA 3T99A 1JH8A 1UINA 1GZSA 5IASA 4MS3A 1LF0A 1L5QA 2GN9A 1PEKE 3T7RA 3K7EA 1O57A 3PLNA 1P1KA 4G9EA 5J4HA 1MH9A 2WIFA 3U44B 1NRIA 3G9XA 4HL6A 2ZBEA 4G1EB 5L3SB 5E9QA 4L3VA 2HD4A 3OC0A 4K3UA 1Q1EA 4KQIA 1VQNB 2NZXA 3ABQB 1KJQA 1YASA 2ZRKA 2X58A 5H4HA 4I4LA 2QN6A 2N0SA 4GVLA 5IN5A 3SHQA 3UB2A 3KR1A 4RVFA 1X86B 2G5GX 3LBAA 1H23A 1ZWKA 1A9XA 3PRKE 3OJOA 5FI3A 5TSDA 2IEYA 1X74A 3T5AA 2FMIA 2Z2KA 4ID3A 3KYJB 1QG6A 3SEZA 4C20A 1J39A 3V1LA 4ER5A 1RWQA 1SD5A 1ZMOA 1W85A 2D1YA 3K5WA 2GEJA 2I9PA 4K6OA 3TQIA 4YV0A 3B9QA 1DADA 1H9BA 5EJ6A 3UXEA 3KJQA 3LZDA 1WDTA 1YX2A 4PCLA 4I50F 1Q0HA 4BEVA 1MMFB 1S9DA 4YRSA 1Z6QA 4QWMA 3WLTA 4CWAA 3G9TA 3DO5A 4F3CA 2IWRA 4C3OB 2Q62A 3VTZA 2E2WA 4HI0E 1B23P 4UOQA 3R6LA 3NFYA 3LX4A 4JOQA 1G8FA 1KOJA 3QVGB 3AKYA 3DTNA 3QQPA 3H9BA 1ZLYA 3K6SA 3V1NA 2DOKA 3Q0EA 2DLNA 4Z7NB 5FWNA 5T4BA 5TPWB 3M1IA 1SU4A 4U9IS 2WINI 1X1EA 3CXUA 3RNOA 4IW3B 5LL6P 3H2ZA 2WKPA 4BZZA 2XT6A 4LNHA 7REQB 5A4IS 1V95A 3JQBA 3L05A 4JC8A 3AF6A 5JV5A 5DTEA 4MMYB 4JU9A 5J4VA 2PZLA 4XB1A 2OVFA 5EJMA 2OLKA 1EK0A 1YCGA 1JEOA 3R0QA 3KE9A 5BWNA 1TUBA 5K3SA 3E9DA 2QBYB 2R8RA 3Q6MA 4PGMA 3A4NA 1H1TA 1M0TA 4JMQA 4WZKA 3G7UA 4FC7A 4MHTA 3GYGA 2IYRA 2CF6A 2MHCA 4DA4A 3SXPA 5KU1A 1E3ZA 4LWPA 1Y0YA 2PQMA 4RF3A 4X0EA 4GR9A 2OORC 3KFVA 4PRZA 4E4RA 3TE7A 1JSZA 2AR7A 4H6PA 1TM3E 2Q50A 4WNAB 3KAQA 4B2PA 4B2YA 2H5EA 1R6DA 4WCDA 2ZTMA 4UOEA 3GJRA 4XYLA 5JAZA 4HVTA 4MPPA 3K15A 1IBMB 1Z39A 2GZ3A 2GILA 3FX2A 4KU4A 2JH3A 4CF4A 1KYYA 2WUWE 5BWOA 3M6UA 3GI1A 1QF6A 3H1GA 1YRHA 3JWPA 4Z0PA 3T56B 3OZCA 3FCEA 3BD6A 1DCFA 2EZ8A 1TM1E 2OTCA 1U3VA 3GVXA 1QTNA 4TROA 3CWCA 4WZZA 3ZU6A 4DCPA 1FYEA 4HQLA 2I03A 4Z4QA 5JXWA 3I6BA 1KH1A 3UT5B 4E21A 4G8BA 4UBIA 3JARA 3ISJA 5HCUA 4X7FA 1YBAA 3QG1A 3UAZA 4G5QA 1QHXA 1IJBA 3K5HA 1AF7A 3K0HA 1EDZA 5JH7F 5HK9A 3ICQB 3KSRA 1Z75A 2WE7A 2XNCA 1KJYA 1NJGA 2VJQA 5DK4A 4NI5A 2QG4A 5D87A 4ML3A 3TOZA 2FXIA 2NZ2A 3K16A 1WUIS 1JSLA 3CX4A 1G2IA 4W63A 1M8JA 2V7GA 2F8SA 4C6RA 4BO5A 4RJTA 4HSGA 1VBKA 1Y1PA 5CW1A 4FQ7A 2GPTA 4DLLA 5F7XA 4N9WA 4H1UA 4HDSA 1ELOA 4KVAA 4NAUA 3KZXA 4Y2JA 4E30A 4X90A 2ZAIA 1O7JA 2BFBB 2O48X 1XZMA 3M1AA 4RIFA 2WWGA 5LYYA 3TNJA 4EABA 1XRMA 1L8LA 4WZAB 1IN7A 5BRJA 4JLKA 3PFGA 1NRJB 1TCVA 2E6UX 4BGEA 4C7MA 1KS9A 3DDYA 2JI9A 4RW0A 2UZ3A 1RWMA 3KO8A 4IGFA 4MB0A 5LDGA 3T7EA 1EUYA 1QVGB 4M0MA 4C7OB 2Z3VA 3GLGE 4B79A 1EEHA 3AJRA 5MHTA 1UBUS 4NCAA 3FDFA 2IH2A 3LIPA 1LGYA 3JASA 3I4LA 4TWZA 1CR1A 1HO3A 5FPTA 3H3JA 1I5EA 3NXKA 3INGA 3KPYA 3KXIA 4B7AA 4FWBA 1GZDA 4JP5A 3ER6A 4D42A 4V0NA 3GFOA 3SWWA 1PIWA 1HDIA 2BKAA 4XX0B 1B4DA 4D3FA 3IAS1 3P20A 4XI9A 3OP4A 1VDZA 5DU2A 2JCXA 1ISHA 3TGPA 3BD9A 3S2UA 4P32A 4CDGA 2BP7A 3UAWA 1V8ZA 5AWFC 4B82A 2I4IA 2R48A 2IOFK 1J21A 2ZR7A 3CPEA 3I2GA 4UHBA 5DBIA 5TVGA 3T4XA 3K2IA 1AX9A 1Z4QA 1MRNA 5DNDA 5C18A 1VZ2A 2BRUC 1XEAA 4M1TA 1XUOA 3O8RA 3DBRB 3N2YA 1L5MA 5EIOA 3GIWA 3UK7A 5H3CA 1EXWA 3P0FA 3QXSA 3D4PA 5CFQA 4AB1A 4ETMA 2B8EA 3BXHA 3EUAA 1T2FA 4TWRA 5JWRA 3B2EA 3LK6A 4A4DA 1G6HA 4DV2B 1A5SB 1KAQA 2PGOA 4YMIA 1NJ2A 1CJVC 2PH1A 2O8EA 4BTLA 3OOEA 1L3CA 3A1SA 3BGWA 3LUDA 1K8ZB 1L5ZA 4E07A 1U5BA 3ZDRA 5DGDA 2O3QA 3FRHA 2X0FA 3E9QA 2W2OA 3VVBA 3CF4A 5C8VA 5KPDA 3AVYA 2WTEA 3WTBA 1C7FA 5ILOA 3WY9A 2PT6A 4TS4A 3RVQA 1TAUA 1RLUA 4GVPA 4YJFB 2PKEA 5D5QA 1WB4A 1ZI9A 1VIAA 1LRJA 3DMRA 3IEIA 3EEIA 4I5IA 4P3XA 4QWWA 4RH3A 1BGVA 2A0WA 3ETNA 4LPKA 2P27A 4KXFB 4WPGA 3WHPA 1B16A 2IC5A 5REQA 4O08A 2KVOA 1T13A 3IB6A 2ZIWB 2ZEJA 3QJ5A 5JU6A 3H6KA 2Z9CA 1O58A 1G5PA 1NI4B 1DAOA 5KVQA 1PZNA 4DIMA 2ZXIA 3LUHA 4LK3A 4EUKA 4EEZA 5FUWA 4AN0A 2GKSA