2CBXA

X-ray crystal structure of 5'-fluorodeoxyadenosine synthase from streptomyces cattleya complexed with beta-d-erythrofuranosyl- adenosine
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
291
structure length
291
Chain Sequence
RPIIAFMSDLGTTDDSVAQCKGLMYSICPDVTVVDVCHSMTPWDVEEGARYIVDLPRFFPEGTVFATTTYPATGTTTRSVAVRIKQAAKGGARGQWAGSGAGFERAEGSYIYIAPNNGLLTTVLEEHGYLEAYEVTSPKVIPEQPEPTFYSREMVAIPSAHLAAGFPLSEVGRPLEDHEIVRFNRPAVEQDGEALVGVVSAIDHPFGNVWTNIHRTDLEKAGIGYGARLRLTLDGVLPFEAPLTPTFADAGEIGNIAIYLNSRGYLSIARNAASLAYPYHLKEGMSARVEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-FLUORO-5'-DEOXYADENOSINE SYNTHASE
publication title Substrate specificity in enzymatic fluorination. The fluorinase from Streptomyces cattleya accepts 2'-deoxyadenosine substrates.
pubmed doi rcsb
source organism Streptomyces cattleya
molecule tags Transferase
total genus 78
structure length 291
sequence length 291
chains with identical sequence B, C
ec nomenclature ec 2.5.1.63: Adenosyl-fluoride synthase.
pdb deposition date 2006-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01887 SAM_adeno_trans S-adenosyl-l-methionine hydroxide adenosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.90 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Bacterial fluorinating enzyme like 2cbxA02
3.40.50.10790 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold S-adenosyl-l-methionine hydroxide adenosyltransferase, N-terminal 2cbxA01
2C4UA 2CW5A 2C5BA 2V7WA 2Q6LA 2V7VA 2CC2A 2Q6OA 2V7XA 1WU8A 1RQRA 2V7TA 2C5HA 2V7UA 2Q6KA 2WR8A 2ZBUA 2F4NA 5LMZA 2C4TA 1RQPA 4CQJA 5B6IA 2CBXA 5FIUA 2Q6IA 2C2WA 2ZBVA
chains in the Genus database with same CATH superfamily
3NASA 2VRWA 4FR5A 1TUBA 3V4ZA 3FLMA 1Y5NA 1CJTC 1G291 1NPTO 4XQGA 4KYTA 3H84A 5LP6C 5TQVA 1DKNA 1T9GS 2ZYSA 5A3RA 1YWGO 5K4AA 2OXFA 5JXJA 3BD9A 4KFSA 1WOOA 4BGUA 4DLKA 2YOFA 1ORDA 2C2XA 2I2AA 4RZ2A 5D51S 1NW7A 4AZ3B 5BURA 3ZVNA 4AKHA 5BN4B 5FTMA 3LIIA 3RF7A 3H1TA 1FYVA 1JFFA 5U1PA 1XPJA 5JYBA 4YC7A 4JSRA 1SC6A 3TG8A 1GUYA 3ZV4A 3N05A 1F12A 5JARA 5GIOE 4KX5A 1LJ8A 1SG6A 5FULA 1F7UA 1UMBA 3S7TA 4YJ2B 4TWBA 4W5HA 4M9XA 3X1JA 3FFTA 2AH5A 1G6HA 3V6MA 4BO8A 4CMJA 1O95A 5L7WA 5K0SA 3NKFA 3RJ9A 1G5FA 2XQKA 1LH0A 3OPXA 4HLQB 1RLJA 4WFKA 1YOVA 2WBLC 2QG4A 3KKPA 5K0GA 2GRJA 3IQZA 1WU8A 2R8BA 3ABSB 4REQA 1QIEA 1E2BA 2W37A 3N5KA 3A6HA 4JP1A 7ABPA 3GFGA 4FEAA 3ABRB 3CINA 4OSEA 1ZH2A 1JUDA 4QO7A 3ROFA 2RGUA 3TK1A 3TL3A 2I33A 5KCZA 1U7XA 2CLMB 2O8DA 1YJ9B 2C99A 1QORA 3L6RA 5EZ6B 4PXYA 4RPIA 2EWWA 4I2VA 3HADA 3DHYA 1VLVA 4FBGA 3DM5A 4DA9A 4TVSA 3Q7EA 1RZUA 4XE5A 3DEJA 4B5LA 5BV1A 4RYDA 4UOEA 5K2MA 5KINB 3DMFA 5FJJA 3ASTA 2PUJA 1U2EA 1P4RA 3ZE9A 4BO4A 2IDJA 2DCMA 2HF2A 3GU3A 2XWPA 3W4IA 2WPDA 2VRNA 5DEOA 4YP5A 1Z3CA 3DEIA 5A7GA 3Q3JB 4Z7OB 3SC3A 3U5ZB 4N5NA 2O8VA 1SC3A 3LVFO 3K6RA 1VB3A 4EJFA 1ZJYA 4KP7A 5T3UA 5CA1A 3RUEA 2DKOA 4X6XA 5LYJF 4KZKA 1OXVA 4Z4RA 1ECGA 2F8LA 2H7VA 2QJFA 3EDMA 2XTZA 3OESA 1T5TA 4A6XA 1HTBA 5ALSA 3GFRA 1JMKC 2XKBA 1PZNA 1DMSA 4NBUA 4QAQA 3L8YA 4OKSA 5KQSA 2PUFA 5REQB 5H3LA 1C0IA 1FPMA 3QHPA 3K73O 3VHXB 2ZZFA 1T5BA 1YK1A 3OUTA 1K4KA 3UJ3X 3ZU5A 1N34B 3UXYA 1UD8A 4P6VF 3O73A 3CUSA 4FDMA 3PC7A 2O06A 5AR1A 3URMA 3IR5A 1EE2A 2ODWA 4B3GA 4KPUA 1DIOB 2QTHA 4ZFNA 4DYHA 5A4DA 1N0UA 2ZKLA 4Z4YA 4MCIA 2YYYA 2D5LA 2WP8J 1N6LA 2IA5A 4JWTA 4R8KA 1QFZA 1ZD3A 4L0DA 3VHQA 1W46A 5BN3A 2JLCA 1GP2A 3JQAD 3O3CA 1FS6A 2CUTA 3EBPA 3U4IA 3WMWA 2BHRA 4HTAA 4JZYA 5EXDA 1RFLA 1YQEA 2CXHA 4R40A 3IIEA 4PSKA 4BTLA 3OTHA 1YI2B 2BMWA 3L8FA 4XYBA 2I5PO 4OVKA 5CHEA 3ZPXA 2WMOB 2Z2IA 3KJNA 4FFNA 4YMUA 5ARBA 4CLDA 1HOXA 2WINI 3R77A 1MC1A 1YZQA 2FX3A 2WNIA 4FDLA 2NUPB 4I50A 3PXXA 4NYJR 2X6QA 4CUKA 3ELWA 1J9ZA 2QA5A 3L18A 3PNPA 4MIYA 2QN6A 2P3MA 4URFA 1LJUA 1K6IA 4F2PA 1PJ8A 3IOEA 4XWTA 5KYWB 2R8XA 1X8KA 4JT4A 3K9WA 3R7LA 3DMHA 1WSRA 4F85A 1YR9A 2ONKA 5HDQA 1HGXA 2ORED 4NKRA 3EGWA 1RQPA 3OPYI 3DNFA 1VQ6B 2MYUA 1FRNA 3WZLA 1JEAA 2Q5EA 3WDSA 2IWHA 4DIUA 3CH5A 1VRWA 4Z8YA 4IY1A 5LA6F 2HIMA 3CW9A 5LWQA 5EJEA 4E94A 3IJ5A 2UV8A 3AUYA 2ZS9A 2O05A 5AOVA 4DA4A 4LQCA 3G79A 4Q3KA 1JYSA 3VNUA 4KMRA 4PC2A 5HXAA 1PN3A 3F2IA 2MCFA 1P3Y1 1JIVA 1QH8B 3BQNB 3WB9A 2GHRA 4ZYLA 3RUPA 2EBHX 3K9GA 4WZEA 2ZUTA 2SKCA 5JOQA 1XUOA 2DC1A 3SZOA 4P5EA 4MLZA 4I8IA 3ADDA 3WLSA 3FKJA 3T0FA 5EJ8A 4GVXA 2CMHA 2XGGA 3SJPA 5KVAA 3WGIA 2GNOA 3OURA 2K2QB 4IQFA 2JBAA 3DC2A 3JQBA 1T9AA 4E88A 2CSXA 5ICFA 3AV0B 2AMYA 3N7UA 3O7WA 3ZWAA 1A5AB 4ZREA 2IQIA 2VSYA 4XN3A 2PSSA 1KXJA 2GH1A 1N8TA 2IYQA 2JGMA 3HU5A 1X39A 4YCAA 1E1YA 1JV2B 5H9WA 1X9IA 3IVMA 1YR1A 3NHWA 4ZYTA 4A4DA 2FLWA 3I01A 5L3SB 3V42A 3BIXA 4CXMA 2XAUA 1YKFA 3FDIA 4HE5A 1Z39A 4RMJA 3KUUA 3LO8A 4TTTS 2NU8B 3H87A 2AG6A 2QRGA 1KPIA 4FR0A 4L4UA 2FCRA 1Y5MA 2C2KA 2JH3A 1YXMA 2BEWA 3IJEB 3VC3A 4AG5A 2IKSA 5KNDD 2JK0A 3B3JA 3VKFA 4JT9A 2MSKA 4Q6WA 1NSFA 3OICA 2DLDA 3NM6B 3WKCA 1QDEA 1QIGA 3D0RA 1F2DA 3DLHA 1MJGA 1DC6A 4LJ4A 1G5HA 2HNBA 5C7LO 3B78A 4OI2A 3O83A 4EFNA 2W8BA 3CEJA 1K6MA 1OX4A 5CX1A 5A5GA 3DMPA 1TEVA 3PC6A 3EISA 5CURA 5KHOC 1II8A 1PD1A 4NPHA 5EMHA 3F49S 1KHTA 1P6QA 3HR4A 4L6CA 5JLJA 3E1GA 1NHWA 3QU9A 5J2TF 3TE6A 3P9PA 2WWYA 2C5LA 3OQBA 4OQEA 4BJ3A 4LI3X 2ZETA 3H9UA 4JC4A 5KOJA 3B70A 4U2GA 5KDLA 1E9RA 4OGLA 2IWRA 2XA1A 1WUTA 2D0DA 1SXJA 4F4HA 1JH9A 3GA5A 4JLBA 1P0FA 2VNSA 3L77A 1PU2A 3I0ZA 3T56B 2JJ2A 1E0JA 1AHPA 2RGEA 4UUBA 2D5AA 4MV8A 1A9ZA 4DGSA 1KQGA 1HKUA 2V6GA 3W8EA 4YEJA 5FLYA 3NTVA 3A4LA 4ZVVA 4LFCB 2M32A 1HORA 2ATVA 3KB6A 1I6KA 3TZQA 2IHUA 1MJFA 4DNPA 3LWBA 1K5HA 3TTWA 2Y1WA 4ARCA 2RGAA 1NT2A 4EPYA 4NZMA 4GVPA 5JZMA 1VYVA 2ZG6A 1WU7A 4TKMA 1E32A 3OQPA 3U9SA 3VSBA 1O0SA 4GYWA 1KETA 1N07A 1D4AA 3QPDA 3LW8A 3C7AA 4YMGA 1FE8A 1C3XA 1XWFA 2M98A 3CO0S 3H2KA 2R47A 3MD0A 3P2OA 2FSVA 3QA9A 3FH0A 4F5DA 4PPQA 3Q1KA 1M2VA 4N54A 2Q9CA 3HBNA 4P0PB 1ECJA 4WE3A 4E31A 1C3OA 2ZBQA 4N0EA 2HWKA 2HA7A 2C58A 3P4YA 2IQ5A 4Z86A 1SVNA 5ALKA 4BHTA 2FDCA 4OAPA 2WTNA 4TWAA 1UDRA 1R74A 2CXXA 4DR5B 4P26A 4XLEA 4ZV7A 1NVDA 1H6BA 2WVAA 4CQMD 4CG1A 4KN8A 4DOMA 2CYBA 3KZKA 1NSTA 2P65A 1CZOA 3M2PA 5FV4A 2V96A 1Q74A 3OA2A 4P3KA 1MZPA 1WXXA 1CB0A 4MA4A 1E5XA 1NI4B 1RWBA 4IKOA 3BHIA 2C2GA 1JHPA 4XJXA 4YRTA 4KQEA 1UAYA 3IDAA 4TLAA 3B8EA 3QENA 2PT5A 2G6BA 3DDNA 3K0AA 4BVHA 1ZGAA 3M6UA 3O82A 5KTYA 4KI0A 3R3JA 4YJHB 4QZVA 4FW9A 4EHJA 3HSKA 3REFA 4QPCA 4QVKA 3QELB 2XUQA 9LDBA 3PXUA 1TF2A 4F5YA 2GYYA 3AG5A 1F2UA 1Z2CA 2AFIE 3ILHA 1WG8A 3MBKA 3KV1A 3MGCA 5JE8A 2F3UA 2XCOA 1FFYA 1W0KD 1N7HA 1U8EA 3E2MA 1Z68A 4O33A 2VTVA 2EZTA 3T9BA 2C84A 4H7IA 3R2JA 1G7RA 4BNXA 4EAAA 2KBFA 2O3QA 5A9TA 4Z53A 1XVUA 2I0FA 1A8SA 1HK7A 1RE1A 2OV4A 4OPMA 1UOQA 2C0PA 2WF5A 5J5CA 2BFCA 2AZDA 1G17A 1P39A 2PXAA 4MQEB 2BE9A 4GC5A 2HH9A 1JQAA 1K75A 2HSGA 3I52A 4D0GA 2B5OA 2CUKA 2JLBA 4Q3OA 5CYPA 1IBCA 4MV0A 5D5QA 4KO1S 3WGNA 1ZRNA 5EEHA 5DXFA 1E9EA 1YR6A 2WZQA 3H2JA 5CLLA 4P33A 2J5KA 3B1JA 3PFKA 1U2GA 5BVHA 2H06A 3H7IA 3PI7A 3A6EA 5KNLA 1ZH8A 3U7EB 2K5UA 6AT1A 1XRJA 1VIDA 4PXAA 5GMOA 2PMEA 3SC6A 1D1PA 1K7EB 1OSNA 1WMFA 1LPBB 2M2IA 3BFJA 3M3HA 4IOLA 4LMBA 2WC1A 1J0AA 1H23A 1VQ8B 1SXIA 2H8KA 4MKFA 5FLEX 3U9TA 3ZGLA 1PV4A 1BSVA 2YJ5A 3D43A 2BFAA 4LZOA 1H9CA 1C1YA 1Z82A 3KKKA 5FX2A 1QP0A 4TN5A 4FVTA 1YZ3A 4B4WA 3MWGA 1R12A 2J5RA 2CGEA 4X71A 4Z4IA 1NOKA 2FR0A 1SXJE 1E60A 2QHXA 3B12A 1JLKA 4UTXA 3RWOA 3T5GA 5HBRA 4PZCA 2FWAA 4HQ0A 3C24A 2WAXA 1F8GA 5KOIA 1DAHA 2HPZA 3BWYA 3UJBA 4G0NA 1WHSB 5KSPA 1EX7A 3UN1A 4CKEA 3NORA 3HY6A 2VOEA 3H13A 5LP1A 4BP1A 4BVAA 2NYAA 3UWOA 1Z0DA 4PPYA 5IH3A 3UWSA 4D46A 1IXYA 1X9HA 2HPVA 4IJQA 4ZVPA 1QG4A 1XD2A 2D74A 1FFEA 3JRWA 1I1NA 3JQAA 4IHKA 1AS0A 1NMEA 2O7NA 5AKGA 5ERXA 2AEJA 2PV0A 1KMHA 2WAAA 4A7PA 3BMOA 4B3IA 3DVLA 1DBQA 1NHGA 2W42A 4UOQA 4UTZA 3DP9A 4N18A 5TEWA 2HV9A 3ECSA 5D1NA 2GCNA 2OCAA 5IU6A 4D41A 4DV4B 1VJCA 4H6XA 4WZBA 1G18A 1C7ZA 1PHPA 2OC9A 2CBXA 1K2WA 1UBCA 1VGVA 2WFLA 2QOEA 1FZQA 3R5XA 4JY7A 3E6AA 4L08A 3V1NA 3KQUA 4LY0A 1ZKMA 3N9IA 3GIWA 5K0CA 1NYLA 2AT1A 3EMBA 4GUAA 4TM7A 5ICSA 1NC1A 2VQ3A 4M8IA 4G25A 4E4TA 2Q4TA 1XZCA 2Q50A 3HU2A 5LB2A 1W49A 4DCOA 3GD5A 4MVJG 4GM1A 5CIYA 1TO6A 1U7OA 3UOAB 1NUPA 3HZRA 1TM5E 2CEAA 1FY2A 2FPPA 2O14A 4JUIA 4PYJA 2BGTA 4DEVA 4D80A 1BOOA 4OB8A 4YPOA 1XLTC 3GYGA 3OOSA 5THKA 3UUEA 2OYRA 2JGLA 1Y63A 2R96A 1S2MA 3FNEA 3OTQA 5JH7A 2VF8A 3L7JA 1DIHA 2CL5A 1EWYA 3E9ZA 1HSZA 1NBAA 4FXPA 4JB0A 4QL3A 4UHKA 1N8RD 4HBGA 2YASA 3EYAA 1UK9A 2ZW9A 1E9BA 4UVEA 2HBZA 4LBZA 1PT8A 5DXAA 1L5VA 1RJWA 4XWGA 4YQZA 1QE0A 3CRZA 2JLZA 3KL9A 1H4QA 1ZZEA 2VDMB 1FLVA 3AI7A 3Q87B 2FFQA 4TKZA 3H8SA 5E4YA 4WY5A 3WGKA 4PC6A 2YINC 3K0KA 1S8NA 4P86A 3MXOA 2NACA 3ML1A 1Z5PA 3HYNA 2WB2A 3FHOA 2P6UA 1P2SA 2Y67A 3FNIA 3VNRA 4YT5A 3ZKWA 1AM4D 3VNQA 2FFRA 1P81A 2WNHA 5I4IA 3EH1A 4H1VA 3TQSA 4ND4A 2GCOA 1T0BA 3OJFA 3V4PB 4RTOA 1E92A 2P9JA 5SY9A 4ILKA 3RVJA 4KXUA 4KC0A 3OMLA 1LPSA 1Z0KA 4CQNA 4JNCA 2VZ0A 1FTSA 3R6WA 5KNDA 1G5QA 3KSRA 3WRXA 1KRWA 4E5VA 1W25A 2M9MA 4X54A 3X1MA 2X1LA 2ZSUA 1U8TA 4LJ9A 1FQWA 4Y0NA 3J81k 2DTEA 2WY2D 2FZVA 4HWPA 1IVNA 4CM4A 3OD5A 4RY9A 1SCAA 5YASA 2RB5A 4HDKA 5U4QA 3CXCB 2EZ4A 4AP6A 3QBJA 5FOWA 3P2EA 2P9ZA 4UDOA 1VI6A 3LC7O 1JLHA 1BCSB 1CT9A 4L8WB 4V2IA 3FVRA 2AC7A 1GZVA 1ZCJA 5FPPA 5TGTA 4US2R 3UFXA 3QLTA 2C2BA 3U2QA 2XGSA 3CEHA 4GR4A 2CN1A 5AW0A 3IH5A 5GVSA 4U5QA 5JNWA 1YRQA 4IM7A 4IQ0A 3JATA 4XVCA 1MO6A 2I2DA 3C3XA 4PGHA 4XRRA 2NW6A 2I4IA 4IX1A 2XNJA 3CCFA 3UENA 2QB5A 3W9BA 1BGXT 2VT7A 5E9AA 1NI5A 1QV9A 1YE5A 3ZHCA 4C0HA 2V6BA 1B3RA 3BSSA 3WL7A 5CA0B 1JFSA 3F67A 1LY1A 3JQ6A 2BMJA 5ILOA 3U80A 4ZHSA 5JAOA 5H81A 1ZVKA 1UOEA 5GINE 1C0PA 4FJ0A 5FDFA 1UXGA 1JA9A 3BDIA 5LPNA 4MV7A 1YMQA 2BT4A 4K26A 1IU9A 4ZO9A 4AKSA 4GQAA 4DIKA 1QTQA 2O5CA 1PR3A 4EVRA 2G40A 2HOQA 2VTBA 4CMAA 1KEVA 1JNXX 1GRNA 3IT2A 2TSYB 4QT4A 2RHJA 2QP3A 2JIQA 3I9OA 2OCYC 3K6SB 4LMRA 3BXOA 4US1R 3DZCA 1E1QD 4JCOA 4G5HA 1S4QA 1V3QE 3R8FA 1UBFA 3DE7X 2FKNA 4O4IF 1AKNA 3KKEA 4MV5A 5E0OA 3U13A 3D6FA 2XDWA 4BY9E 1MIOB 5J2UB 4A5OA 1JXQA 1AKTA 3AB8A 2AL7A 3ESBA 5D00A 1I3CA 1LNQA 2IZOA 1RR6A 4FYMA 4ACBA 1E9SA 3KQYA 4GRIA 4TLLB 3UB4A 3GNSA 2B4TO 3ROMA 4O2AA 5I7VA 4B3TB 2P9QA 5EUMA 2O3JA 1R8YA 3C5WP 2ZL7A 3DDYA 3NHKA 4B09A 4YCSA 1J49A 1KEWA 5AI8A 5J23A 3VKVA 3GT4A 4ZQGA 5AWFC 3BFVA 4BX2A 1VHEA 1THGA 2CF6A 2X19A 3OBIA 2OXTA 4CQMA 1UP4A 1NAHA 4XFJA 2HLDD 3WGYA 3WWDA 3KTAA 2XLBA 4KAXA 1L5YA 2FSHA 1U9IC 4KSYA 3AUUA 5HKLA 2IHTA 3A3NA 3V9PA 1WPGA 2GJ8A 3E9YA 3RS0A 5LBUA 3GC6A 1U9JA 5JS1A 3OKAA 1JEQA 3SYKA 2WAMA 3B89A 4TSFD 4AICA 2EXXA 4AL4A 2GDZA 4DPLA 5C46F 2VC2B 3P0EA 3VZQA 4EO9A 1YQQA 2QV7A 5ADHA 3JVIA 2J5XA 3O7MA 2R86A 4GNRA 1ZYUA 3ZH9B 4HC4A 1QZTA 3AUFA 4BJ6A 4QM7A 1TK9A 1D9ZA 1DQPA 2PKWA 4NAVA 1KH2A 1W0KA 1H8HD 2NZVG 3NLLA 3E3OA 3P9XA 3ILXA 1QAMA 2PWPA 4TSKA 1NW4A 2D13A 4E5SA 4G6IA 2FMIA 1XJCA 1K8AD 1QYRA 3E7FA 2QZJA 4L50A 1PUIA 3O8CA 1YBHA 4Y1GA 2NXNA 4CLRB 1PQUA 3LUFA 1ADJA 3JPYA 1FBNA 4K2AA 4FWIB 5H16A 5IX8A 2XDYA 1SU4A 4TUYA 2HXYA 3VZCA 2G07A 4QICA 3I72A 3EXG1 3FM9A 3QMWA 4EPTA 4WUVA 2E4UA 2AF3C 4ES6A 1MFZA 5G41A 4Q4HB 5C8ZA 2XPCA 4DLTA 5B57C 4JI4B 3IAM1 1E3IA 5DLEA 4DTCA 2Y77A 3AY7A 4NV1A 5L51A 4Q3EA 2QM3A 2BI4A 5F73A 5AKHA 5CPFA 1HEYA 1QYVA 2CNBA 2JZNA 4L07A 4BNVA 4UQLA 5HKAA 1FNBA 2F8TA 5EHQA 4EW2A 2ZRFA 5E6UA 2GZ1A 3CRVA 2NV2B 2PMCA 1ZD4A 4DVJA 3NJ8A 2YCLA 2Z5LA 4RPLA 4RY8A 5KKNB 1DNPA 1UBMS 4DNTB 1TW3A 1P18A 3KELA 4F6RB 4NPAA 1T2UA 4AO6A 5JO0A 5IAGA 5J9FA 4QOFA 2V7EA 4PHCA 2O20A 3UM9A 5AVWA 2R68A 4NBRA 3PHGA 1UMKA 1N7JA 4UEWA 3DZJA 1H2YA 4H1UA 3HUEA 3U40A 3PX7A 2I1QA 1AKRA 1Q21A 1YHZA 1FMJA 2EAUA 3KYDA 1FLNA 4IXMA 3SQMA 5AN9A 3RU7A 1G3RA 3UH1A 1LNSA 4M1EA 3W4JA 3VR3D 2FJUA 2QUAA 2QNBA 3CXUA 4ROXA 3GRUA 1MENA 4EL5A 4DV6B 3JARB 3UK6A 1G0NA 1R6VA 5KQPA 2R5FA 3NNNA 2NTEA 1XNQB 1ZIYA 5IYWA 1I7PA 3DMYA 3LQ1A 3CX7A 5DI3A 4UMEA 2VQDA 4Y67A 3TUZC 2D6FA 4D3YA 2IUFA 3WIVA 5EG5A 1T26A 3L7BA 3F8WA 3Q1LA 1KJZA 1LPMA 4BX8A 3GPBA 2ZSEA 3E15A 4G9GA 4ZAXA 1Z37A 4KO2S 4Q4CA 2CFTA 4MMXB 3W5DA 1ZPDA 5F4MA 2C8LA 1J2RA 1JKFA 4HDRB 3CTMA 4RY0A 5AICA 5ALDA 3VV3A 4K9SA 4X20B 4F4UA 4KHPB 1ZO8A 1VRVA 3RNOA 3QVJA 2ZJ5A 4HVCA 1VL0A 5JSYA 3BCUA 4HXYA 4CN9A 1ZGBA 3R5FA 4KE6A 1XEXB 1SK9A 3I0NA 1DAMA 3O8BA 1E0AA 1XDDA 4QGAA 4GOMD 4OBBA 1LW6E 1E62A 1VPWA 3PXAA 2ZYTX 2YDXA 4IEEA 4LOKA 4ETWA 4QU0A 2F43B 3NH6A 1T5SA 2YWXA 1BWQA 3JRNA 1AUXA 4L1KA 4WWHA 1LC3A 1V1RB 2VHQA 2IE8A 5EFZA 4CMKA 4HWOA 4CM9D 4EUKA 3WDMA 2Q3MA 2X8JA 2RK3A 3A1VA 1UPUA 3O91A 3KNZA 3CF2A 1BKYA 3ZI4A 4AYXA 1TEZA 1EUCA 1HLPA 2V6JA 3I5UA 4AY3A 2ZB3A 3SVZA 2RHDA 3C3JA 2JANA 1XXHE 4YUZA 2BFWA 4BGEA 4YFYA 1R16A 1M76A 5EIXA 3GXOA 1PWXA 2G1KA 4C07A 2PL9A 5BNTA 4V0RA 1JBEA 1NULA 5EERA 1JHVA 1FJHA 2CXQA 2V4ZA 3SSMA 1DHRA 3GLHB 2ZXIA 3HCBA 4JR2A 3ZKAA 1GU0A 1ZEMA 4P7BA 4C3VA 4NCBA 2P67A 3K32A 4I4CA 4FS3A 4WNAA 5JDCA 1KU6A 2W6ZA 3EX7C 1ABFA 2JPDA 2UUCB 3CW2A 4XTCS 4BNTA 3R3VA 4RQUA 5J5AA 1P4MA 2W6OA 2FPUA 1L7RA 1WKBA 1ZONA 3AJAA 1BW9A 3OIUA 3AFOA 4MB2A 4JD5A 2JVIA 4CMBA 5G1PA 3DB1A 3EMVA 3OX4A 1NU6A 1ISPA 1FP7A 1KO1A 4Z7NB 2KSQA 4HL6A 3INGA 3NHUA 1ZU4A 4UDYX 4LQ4A 1WZCA 4XM2A 4JT2A 3D64A 1YIJB 2DHCA 3IUSA 1VJ0A 1E3WB 1LZKA 1YH3A 5B36A 3GWZA 5E1DA 3TIGA 1O95C 1KO7A 2BUBA 2JLYA 1Y9AA 3JQFA 2WIBA 4PFSA 5KNCH 2JGKA 1QE5A 2QA4B 1A7JA 3EK2A 4RM2A 2GVNA 2Q21A 4IHJB 4RQAA 3U3JA 4OHBA 2FGKA 4K05A 3HYTA 1ZNXA 1M2EA 3S5JA 3BH4A 2DTDA 1IOVA 1BS9A 1MB0A 4M9ZA 3U7GA 2YV2A 2ZGVA 3G0BA 4MZXA 1SBTA 5EA2A 2ZE6A 4HZUA 2I4RA 1NGSA 3GK3A 1IEVA 3IIKA 4HX5A 3CUWA 4MO2A 4TQGA 2B4QA 1PLLA 3MS4A 3VJLA 1WKCA 3N2YA 4P8RA 3QH4A 1SH7A 1MQAA 1QRAA 3B13B 4NFSA 4X85A 4ZT5A 4RD2A 3TZEA 4AWBA 1M33A 1V5EA 1MJHA 4PX9A 1L1EA 5FNVF 4MWBA 1K6JA 4KEAA 2QLJA 1VDZA 1E3JA 2Z58A 1IUKA 4M1ZA 4KFCA 1Z88A 4CEJB 2R4UA 4IGIA 5E6TA 3AH8A 4Z8XA 3WGJA 3U31A 3HVKA 2QTCA 2C9OA 5CFQA 4A82A 3NTRA 4LYAA 4E12A 1E1QA 1YB2A 2H1FA 1BWPA 4IDQA 4O4JB 4ZOEA 1C4OA 4LG1A 1KVRA 2VDUE 4I8XA 2QYOA 3KT0A 3QRWA 3EGDA 4I6EA 4QREA 5DIZA 3C6ZA 3L4KA 4X05A 3DDCA 4QFMA 1P5ZB 2BFDB 3MBOA 4KSCA 3LBHA 4FLEA 4BMZA 2XMQA 2QUIA 3JZFA 2REOA 5GZ6A 3TZKA 5BUSA 4O4LF 2I67A 1GQ2A 3FZGA 3SHWA 3TVDA 1LBEA 2GWHA 4XOIA 2GEDA 1M0WA 3MCTA 2Q1TA 3TRIA 2O23A 3U4HA 4C76A 2G83A 4RY2A 3CISA 5I51A 2MT9A 4GSKA 4QX6A 3L7YA 1SVLA 1SCKA 1DOHA 4JLAA 4DVGA 5ERYA 4GZMA 3LUCA 1IJFA 1C2YA 1CS0A 4OH1A 1SKMA 1UXJA 2HLDA 4K9MA 2Q5LA 1EK1A 2CWWA 1XL1A 4D9IA 4Z4TA 2GCPA 2O8NA 2VP4A 4G4GA 1HYQA 4DAOA 2IYRA 4L2IB 4UVDA 2WD7B 3N07A 2A5GA 3QU7A 2VHEA 3ADKA 9LDTA 1P1BA 1XU7A 4D9GA 1RRPA 4Q9JA 1Q0PA 1NSYA 2QG9A 4TSFA 3UAWA 5TF0A 5DTIA 3VTAA 5AVZA 1WUJS 3D26A 1YUMA 2AQ8A 821PA 4XN0A 1CIJA 3HO6A 1FNDA 4LOAA 5FOSA 2VBIA 4UMDA 3MPOA 3I4CA 3S2ZA 3V7AA 1V25A 1VYTA 4AZ0B 2GLUA 3W90A 4GH5A 1VZ2A 4MVJE 1OILA 5AD1A 2BBOA 3AESA 4TQ9A 1JSCA 4NBNA 4P9SA 2BZSA 2BJWA 4ZOLB 4BQEA 1I7DA 3IXQA 1H8HA 4UBLA 1PZMA 2HRBA 2Y0CA 4Q16A 4EI2A 4HLUA 2GSWA 2HO5A 4CM6A 4YRZA 3CZ5A 5CB4A 5K9ZA 2HR1A 4Q18A 2AN3A 2RGXA 1A4UA 1EZZA 2IEZA 3IUNA 3AFNA 3PNYA 4TTIA 4WCFA 5IDWA 1JQ5A 1ONSA 1V8ZA 1W29A 4YV0A 3EDQA 4B32A 1F3LA 3LX4A 1D8AA 2VYND 2JCGA 1IPEA 3CZPA 5LQDA 2FN3A 1T9HA 1RMTA 4IIFA 2GVDC 4RA6A 1KOLA 4ZEWA 4EHFA 5CYFA 5C52B 1JX6A 1PDVA 3PPVA 1RAAA 4G4JA 1YTLA 1GV1A 4IIDA 3HWX1 3AJEA 2AN4A 4Y6RA 4R6XA 1I2CA 4D4MA 1S3FA 3EVAA 1A2BA 1K8YB 1DHTA 4K9QA 3R0IA 1IDOA 2WUGA 1ZVVA 3ICPA 3DBVO 2R1VB 1IWPB 3L0IB 1PYOA 1ZM7A 4HNQA 4D7AA 1C0EA 1QHEA 4JI7B 3OCYA 5DH9A 3KTDA 2KS6A 3EXFB 2XCSB 3BAZA 4F4JA 2Q28A 1OBOA 3ASQA 2JRCA 2P3OA 1V6CA 4C14A 1AZLA 3ZCTA 5KTPA 3IPRA 3K3PA 1MRSA 1X7YB 3QWBA 4ZARA 4QVIA 3L9WA 4XCQA 3SLDA 1CG6A 1M90D 3STVA 1Q57A 3ZGVA 5AW4A 4D99A 4EHKA 3JQBC 3E5MA 4F9EA 1FP2A 5JPDA 1QIDA 2REBA 2ZXFA 4NYIR 3STXA 2A3RA 3W1EA 2QRKA 3MWEA 4BX3A 5AVOA 1FMTA 4MDEA 2O0HA 3OSUA 1VHJA 2YIJA 3IAFA 1C7QA 4NFHA 1G8FA 2IP1A 1BMTA 4MUHA 4MW6A 1ZD9A 1AZTA 4RAQA 2GEFA 1DCFA 1ZJJA 3WIBA 1M74A 1Y5RA 3ENNA 3F8TA 2YMLA 4QEDA 3VR3A 1O4VA 2WU1A 3DHVA 4G01B 4CCYB 4WNYA 1FVXA 3EC1A 1UJ5A 1MOSA 4U7PB 3WGTA 1JALA 5ALJA 4BX9A 2V3CC 4MUAA 1S4MA 5DGHA 2QSZA 3K1ZA 3BB3A 3VXKA 4C7BA 1F8YA 2P2YA 4ITVA 1YJXA 1ZSYA 1T3SA 1GGFA 4OREX 3RVPA 3UAGA 4BFTA 1UANA 2YJNA 2IDZA 4XLAA 2QRPA 1Z63A 5B1DA 1RU3A 2L82A 2PPVA 4DC0A 2ZYHA 3BA1A 4NOLA 3ZLVA 4ZXPA 1HH4A 2DHQA 3QVTA 3MMNA 3L0YA 5BNIA 1Y6RA 1ELOA 2BI7A 2ZL6A 3LOPA 5HCNA 4DTIA 3EYWA 1Y81A 1LTKA 1NXQA 3QKSA 1W36C 2DETA 2V4MA 1K97A 3I04M 3H2HA 4UEKA 1H1TA 3GJ7A 4OXYA 3IKTA 3PPIA 2JC3A 1BMDA 2V9PA 1AGXA 4UCFA 4D3DA 1P4AA 2I4LA 4HQKA 3NEAA 4P7FA 4MHOA 1SXJC 3E7DA 4TV9B 1S1CA 2BHNA 3P0RA 3VHLB 3RTAA 5ECGC 4HOYA 3WLHA 5HWSA 5AW9A 3ZQUA 4JLKA 1VGRA 4XDYA 5FOTA 1XLVA 4F8JA 4K1LA 3KT3A 3E22A 3AI3A 3MCUA 1AQJA 4CM9A 3BMNB 2OCGA 3MGBA 1K7FB 1ZJZA 4KKVA 4OHYA 4XVHA 2FPOA 5IJWA 1C14A 3OPOA 1JI3A 1AKVA 1QS0B 1U8XX 1VHLA 2V6IA 3JXEA 3QUCA 5FBRB 2OOSA 2CF4A 2FZ4A 4HEJA 4M53A 3L1HA 4BNUA 5JD6A 4EQZA 2PZFA 4WD3A 4AAYA 2RI6A 5BSXA 1M5UA 1TB4A 2EFDB 1BXRB 2QXUA 1JQJC 3SQWA 1V0JA 4AKIA 3D8BA 1ZM2A 2BIFA 1X7XB 3A3KA 4X1OA 4UFPA 3PNOA 4CCSA 2C7OA 5DNEA 4MKHA 4Q01A 5B64A 4J0FA 5ALZA 3QKWA 4DBVO 3FHCB 5BOVA 2NNWB 3BILA 4QXAA 4YNBA 3JASB 4GMXA 5LD2C 3H1FA 2FSVC 2GOYA 1N3LA 3HZHA 2Y66A 3U6BA 3TN7A 4ZTZB 5KYKA 1QPZA 3GT0A 3WR5A 1XFAA 2NXEA 1PZHA 3DE4X 1VJDA 1WD7A 1RHRA 3GX1A 1VBMA 4EI9A 4F3KA 3BA6A 2Y0EA 4D9FA 3I6YA 3IQFA 3MFQA 4MV4A 3MGGA 1Q0SA 5BSYA 1QIKA 5EZYF 2JLUA 4YAEA 4BNKA 1FA9A 1LLFA 4QTUB 2OCKA 1ZOOA 4I55B 1TMYA 2A59A 4OA5A 4LXXA 5G4LA 2QPLA 2C8VA 1N5RA 1UBTS 1Q1NA 1XMPA 4NJEB 3RSQA 3UFBA 2XUDA 3VZRA 3HK2A 1C41A 2AFVA 1BDJA 2IOHA 4ML3A 5A3QA 5EP4A 1P8JA 2IUTA 3ANLA 3H6KA 4DNFA 5ALEA 3GLIA 2Q7XA 3ZHTA 1XQXA 1Q1AA 3DWGA 3RUIA 4RWEA 2I87A 1BN6A 2GQ0A 1FLDA 4M1TA 1GDDA 1TM7E 3L4EA 3P97A 5FBLB 1RXVA 3O2JA 1SA0A 4TS9A 3TLXA 3H5VA 1OXKB 3PUYA 4YWHA 1CCWA 1Y4DE 1FBTA 3A3PA 3FCXA 4PGGA 5E1OA 1G7TA 4FFDA 3CCQB 2QMHA 3E81A 4N49A 4BMSA 4HNRA 1KI4A 1J8VA 4P35A 2Z4TA 4YV7A 2I7DA 3F0TA 3PLNA 5ES3A 3H0EA 3BORA 4P36A 3FWNA 4DMCA 2JFNA 2EBUA 1T9KA 3GIRA 1JKJA 1YDEA 4QBHA 3MMPA 4WACA 1W44A 3E5RA 3FDZB 1E99A 1Z6ZA 2X76A 2J0VA 3G71B 2XA2A 1RBZA 5LOVB 3L7AA 1B6TA 3T5CA 4JBLA 2HT1A 2A30A 3ZIDA 2EC5A 2OO7A 4IV8A 2QE7D 2BM0A 4Q4AB 2NQ8A 5FUYA 2EKZA 1ZN7A 3EGVA 4MTCA 3QSYA 3ABIA 5H82A 1D03A 1O96A 1HEUA 3ENKA 3CMEB 1ZRHA 5J58A 1L4MA 3A1NA 3DO5A 5IYQA 1JJVA 2ZB4A 1PO7A 1R3DA 2ZATA 2CJWB 3QVWA 1EWQA 1U2GC 2PSDA 4U6QA 3SM3A 2Z6AA 2FEPA 2HYDA 1XQVA 3SIPA 1X1QA 2VQ6A 3OFKA 2R6AA 4PZZA 5FOUA 3T1QA 1U1CA 4HQRA 1PZXA 5BRAA 3I39X 3KUDA 4UNSA 2DP4E 4X3PA 3SG0A 1E58A 1ID1A 2EVWX 4G2NA 4EPVA 3BJMA 4O02B 4MV3A 3IQXA 4C0KA 1D0VA 1ZY2A 3MGKA 3FROA 2VQEB 4WVLA 2RBGA 1R5JA 4LUCA 4HNUA 2XXJA 1LJLA 3EEIA 3HVIA 3R5TA 4AJ2A 3L4JA 4E6EA 3B6KA 3LNCA 3OT4A 2P2DA 1PJSA 2QRMA 2Q3CA 1GN9A 1P44A 2WWTA 4GOLD 4P9NA 4PLTA 4DT1A 2YRWA 3RHTA 1G59A 1RWPA 4EG8A 3AIIA 3CLSC 3PE4A 4G41A 4YJDA 1JPJA 2JGDA 4MRRA 4BV9A 4N41A 1H5NA 5DF1A 4BTEA 3HXTA 2HCFA 3GGGA 3EULA 1QAQA 3DCIA 4A8JB 1W9XA 4QOHA 3G02A 4OPSA 3T35A 3N58A 3TSAA 2W00A 2Q1XA 4OV6B 1WTHD 5D7NA 5HIIA 2C57A 2HEGA 3ZPNA 2D7JA 1S7GA 4RZHA 1EUYA 5JJLA 3WTCA 3O03A 1UBHS 1M6EX 2H16A 4TRJA 1TL7C 1K7YA 2B9VA 4XDHA 4AX8A 3D8UA 4R6WA 1XU4A 5BT9A 3T12A 3B2QA 3TKAA 4UNRA 1RM5A 2YQ4A 4YX9A 1NW8A 2YWCA 5FL7D 3ANYB 3CGGA 3U4QA 5EJ5A 5GADl 1R4AA 3ICWA 4O4HB 3ZHBA 3RVBA 3HXKA 2VYNA 3FPPA 3W4KA 4XUDA 3NHYA 4YCCA 4G4IA 5BW4A 2B5VA 1YO6A 4ZODA 4CQLA 5AIAA 5KKCA 2OWDA 2L18A 4PS0A 3QI2A 1B6GA 1LVGA 2G08A 1AE1A 3QFRA 2O2EA 2ZSBA 5E1MA 5DSTA 2ZVQX 3P9YA 5HCIA 4M1WA 4QGGA 4IJWA 3RE1A 1CHNA 1DSSG 1LA2A 2DFLA 4LXGA 5ED0A 2CHEA 1VLLA 3AVQA 5CH5A 4Y9SA 2X0JA 5COAA 3B82A 4MVJF 4CGZA 2H1LA 4B81A 4DSZA 3CZAA 2R1UA 3CSSA 4J29A 2ODAA 3HI6A 4RLHA 3VR4D 3WDLA 5I6DA 5JY1A 3EGXB 1IXZA 1NNSA 3LECA 1P3DA 4PAWA 2OG1A 4TS3A 3SJCA 2DLNA 2O8DB 2OHVA 1OC2A 4H31A 2JKZA 1A82A 1HRKA 1PS8A 4V38A 5EXTA 2WHYA 4LXHA 1H6AA 1WKVA 2BGRA 4XDZA 3I45A 4L7QA 1RPZA 3IHLA 1K6EA 2G1UA 4INPA 4ARZA 2UYYA 1L6IA 2WHQA 3P9QA 2A33A 1S2GA 4OFWA 2W98A 4L5IA 2O07A 2XJ9A 1M6VA 2FJ0A 2HIAA 5AM0A 1TUIA 5BOSB 5KWEA 2LP4Y 3ANMA 3IIJA 1I1OA 2DG2A 3B3GA 1V43A 3IP3A 4RH0A 3TQFA 4EVQA 4YV1A 1MHTA 3ZW9A 4G0OA 4B40A 4Q39A 5CX4A 3N59A 2B4KA 4AW9A 2AD5A 1KC1A 1M67A 1RXIA 2IHZA 2HCBA 5FJIA 1I4OA 2GBIA 3LGAA 3QY0A 1IIRA 1XFDA 4X44A 4G8BA 2BUAA 4QYTA 1GPUA 4IWNA 4X7FA 2QPOA 3WRXC 3C39A 3ZY4A 2RI0A 1JP7A 1O5TA 1ZRMA 1CRZA 1KMMA 2I2XB 2XUJA 5TS2A 3SFZA 4W5QA 5TE9A 4WZAA 3FWPA 3P9RA 1J8MF 2WU8A 4PYMA 1IN8A 1OIXA 5DP1A 5FPQA 3AVVA 3PC8A 1BDMA 4HDAA 1RJFA 1XHEA 2COUA 3C85A 1BGVA 3FLAA 3A37A 3IPAA 2RC5A 4I4NA 4J1TA 1P7WA 4W1SA 3JAKA 4IS2A 4TZ0A 2CYCA 5K1ZA 6LDHA 4K03A 3TUIC 1GZ3A 5J1SB 1ZHOA 2PR7A 4XOUA 2OUKA 3DFZA 3IAS1 2HDNB 1LQUA 3TOXA 4BNFA 4CEIA 3HGTA 2PFKA 3R0QA 2CBZA 4EITA 3DF9A 1COWD 1P62B 5LKRA 4Q34A 4LZZA 5ALIA 5CFRA 1R5NA 1S72B 4PNEA 4GWKA 1XQ6A 3RK1A 3WL3A 2P77A 2M1ZA 2QN1A 4COKA 2FHPA 4Z4VA 4OP2A 2E0IA 2JIRA 3AEYA 3PFCA 4FUQA 4BP9A 3A10A 5FADA 3ADBA 4PZDA 3H05A 1IJBA 1TO1E 1UD6A 4JLVA 3QYPA 5CTJA 2FLVA 1YGPA 2A1UB 2HO4A 3PENA 3MTDA 4FHDA 4ZRDA 2G9ZA 4YRJA 2WYIA 4AFNA 1HL3A 3PVDA 4DM7A 3I09A 3L93A 4RO0A 3Q8XB 3OZEA 4UBMA 1MO4A 2Q6IA 4AIRA 1T0JB 2H4JA 2PX4A 3MN1A 4JC5A 2ZKIA 3GELA 5JQGA 1T2EA 8GPBA 2PUHA 2JLXA 3RLIA 3GLKA 2AZXA 4BQQA 1QH0A 5TR9A 1P5JA 2SKDA 1TZCA 1JAIA 1SY7A 1X8LA 4UZSA 3ZWWA 2ZOSA 3MCWA 1RKUA 2WUDA 2VWPA 1YDWA 1VHQA 3HKDA 5E7IA 3K05A 1AJEA 1H9BA 2GERA 1ETUA 2PGAA 3QEMA 3TQCA 3IESA 3UT5B 5KS2A 5EAIA 5P8WA 1CIPA 1CUDA 1Q0HA 3VQTA 1CV2A 3SY8A 3LDUA 2C3PA 5EI5A 3PXGA 3DEAA 2PMBA 4OGFA 3N2KA 1OA0A 1R66A 1C9MA 4RJIA 1O89A 3T3OA 2WT9A 4IRMA 4BEBA 3PNVA 1XA3A 1I9CA 2NWQA 2TRSB 2VUIB 1XJ5A 1XF1A 1B6RA 1PR0A 1U3CA 2NZXA 3B1WA 3PKIA 1Y3FE 1UQRA 2FFBA 1FDVA 1KORA 1SZCA 3CD6B 1PDOA 3L5OA 3PQFA 3S40A 4RORA 3VYWA 3BTUA 4C2AA 1J0BA 1PNTA 3ZUGA 1RWKA 1TKAA 1X70A 3GQVA 1VKRA 4FYPA 2ZRQA 1MQ8B 3V4LA 2WTUA 3CO5A 2NU7B 4JP8A 4XUGB 3RSSA 4RD3A 2PHZA 3T4PA 5ALFA 2PSEA 1XCLA 3A9CA 1P19A 4BJ5A 3JAWB 3OZIA 2GCGA 1U6KA 3H1BA 4MJXA 5AW3A 2E55A 3IALA 3ZWQA 4M88A 2FQQA 3EZFA 2YWFA 1CRLA 1N25A 4BLRA 4XYEA 3GEPA 5DM1A 2QE7A 2ZPTX 3QNMA 1UH5A 4A0GA 1OBVA 1W2BB 5A5VA 1VE5A 3OU6A 1O87A 3WLAA 1HC7A 1K1EA 3AHGA 1KY2A 1L4NA 1MO5A 1V39A 3BSFA 3IERA 1CJVC 2PRJA 2ZFUA 3MMZA 4M83A 1U8AA 2WYVA 3UAZA 4GR5A 5EN4A 5IHXA 1LD3A 2X86A 2OD9A 4EB6B 4YMSA 3G13A 1WNTA 16PKA 2ZJ6A 3AK4A 4ABTA 3ZE8A 1T10A 2Y6UA 3W1VA 1OASA 1ODIA 5JZBA 1DBVO 2VP0A 4Y1RA 2P1DA 4U7HA 4RVFA 5AK3A 1QE3A 2NV0A 2OPBA 1O57A 2WVHA 3AL2A 3HCPA 4S0XA 4UASA 2E1RA 2B4YA 5EWLA 1VQPB 5LYJB 4JI5B 1UJNA 3IAXA 2KPOA 3OX1A 3QSGA 3RJMA 2EW1A 1R6AA 3KUCA 1W4CA 5AW1A 1Z6AA 3QPUA 1USWA 5IYZF 2FSGA 3NJRA 2GPTA 3FJOA 1F0YA 5AKZA 1NV9A 2LE0A 4WN3A 1H85A 1I2ZA 5JROA 1VXRA 5KYNA 2O2XA 3EXIA 5CUQA 3AOEA 1UBSB 2G0AA 1L4LA 4WXEA 3TIXB 3KWFA 4NG4A 4RK4A 3F5SA 3WGLA 1UAAA 1PFYA 3CPWB 1TJ3A 1E6LA 1WV0A 3GGDA 1HYEA 4OK6A 3OECA 4LXUA 5AK5A 4EHLA 4AJHA 4BASA 5BNFA 2BTQB 5C4GB 5SYAA 4DPMA 5AVSA 3RIXA 3UGKA 1MHPA 1IZ9A 3ECCA 4L0MA 3HEMA 5AW5A 4ZYUA 4NNOA 3RDPA 1A1VA 1SBZA 3N2GB 2W22A 3JWJA 2WSLA 3NAZA 3NIFB 5FFFA 3USCS 1L4FA 3VR1A 4X1IB 1ZH4A 2AK3A 4FHGA 4NU8X 2G1JA 4KQIA 4QWMA 3HO1A 4REMA 1CZUA 2LZ0A 3NUQA 4H3SA 2KHZA 1EFCA 4H3VA 5JMPA 3AFIA 3PT5A 4X0CA 1JPUA 1VJGA 3B6JA 1KBQA 3I9FA 4WDRA 3DAFA 3S28A 4Q24A 4CDMA 4UZFA 1JEOA 1Y6GA 4MB0A 3N8KA 3KETA 2IBSA 1VPDA 4KKTA 1W9HA 2BM8A 3PR3A 4LHZA 1I32A 3E9DA 3OZWA 1MN6A 1NR1A 1SQSA 3QV2A 4PG5A 5BRNA 1FRFS 5G4KA 5IK2D 2XVZA 2FSFA 3CCEB 4NY1A 2C2HA 4ZVTA 2WTMA 1Y4ZA 1B8VA 1YVUA 3PDUA 3EQ2A 1C1DB 1R5OA 1NBIA 2EFEB 5LA6B 2J33A 2J5QA 1QK4A 4B6QA 2WU4A 2WJGA 1MTZA 2VSQA 1F14A 3LCUA 3HBAA 3KUXA 2XQIA 4FNMA 4GQNA 5K7SA 3VR4A 1JR6A 3Q6IA 5TVGA 1KEUA 3X1YA 1BG6A 3BL5A 3E1YE 3GJ0A 1QHYA 1SBHA 1ZNWA 5HQ3A 4P54A 1C4KA 1GXSB 4N5DA 5FTLA 4P38A 2G4CA 1SOMA 2ROQA 4S0ZA 4D9KA 1X9GA 2YMMA 1R3UA 2YTZA 4M99A 3LX6A 5JVDA 1HFEL 5KDDA 2OK8A 1JAXA 1RSZA 1ZI8A 1G9XA 4Q4AA 2TMDA 2FHSA 2WD8A 5TRDA 2ZRHA 3AHCA 1YJQA 3EZ6A 3KWMA 4NJMB 4RGVA 2MR6A 1VCHA 3BMQA 4IWXA 3CWZA 4RMHA 5JDCC 4PO8A 2UUAB 2F8SA 1G6Q1 1H22A 2JCYA 4BO5A 2V1UA 5K01A 1R0ZA 5KTKA 2W4IA 3L7CA 1EK2A 1JQEA 3ANXA 3NBAA 4JNKA 1AV6A 4E0BA 2RAPA 3VNBA 2ZR9A 1ATIA 1IMJA 2O48X 1YIDA 1M2NA 3BD8A 4TT8A 4Y98A 5K20A 1I4WA 4AUNA 2ZRPA 3H5NA 1J33A 3HB9A 1ESNA 2WMDA 4RMIA 4QRDA 3VYTB 2ASVA 5C31A 1SRQA 1JIXA 4QGBA 2HTEA 3IEPA 2F55A 4L4RA 3ZY3A 1UJMA 4QC2A 8ATCA 2HBRA 1E79A 4AZTA 4MS3B 4QOIA 3A8JA 2AR7A 1N3BA 1L1RA 4R9SA 3F2VA 3KTOA 1YB4A 3AYZB 1VQ9B 1AS2A 3AZPA 3JQFC 1N06A 3OWXA 1N2EA 1U80A 3I28A 3NWOA 4L5AA 3BBPA 1JI0A 4G8CA 3B9QA 3HRHA 3WLMA 1W5FA 3AEQB 3I2KA 3LCRA 5DFAA 2AG8A 3QIAA 4Y1EA 1OHHD 4QJ4A 5GM1A 3ZXIA 4A1FA 3ZHVA 3VZSA 4KQCA 3GH3A 4NR0A 5J2TB 1EESA 4QFBA 1UMCA 2VBSA 1G41A 1UBJS 2MINA 5FHRA 5KDOA 4FB5A 1T1SA 1PQYA 2V7UA 2RH4A 4WESB 1COWA 5A1TA 1YQTA 3GVKA 1H42A 4OMUA 4EGCB 2FA9A 1N0VC 3IRVA 1JZTA 1NYQA 2H5JA 4MVWA 3P5BA 4V0MA 2ZU0C 2VBGA 2D2FA 1PR2A 3Q9SA 3AW9A 1VYHA 5DBFA 5CA0F 4RDLA 2FPIA 5IAOA 1ZJWA 1K5GA 4O8ZA 2YQZA 3ND6A 1XTPA 2C3YA 3GRYA 4HB2A 4QDXA 2CE7A 2HSJA 2H1OA 3DBHA 4I9HA 1IRXA 3H2GA 4Z99A 1VQLB 1IHDA 3N75A 3PQ6A 121PA 1W0JD 5I7AA 5TC4A 3A4MA 5ALHA 4YJFA 5JXWA 1TPZA 1M5TA 2J7PD 5A5DA 3CPXA 1OXXK 4MICA 2Z9BA 3A2LA 4DIDA 5IYPA 1GSAA 3AM5A 5KNBH 2ZI7A 3GH1A 2RHTA 3AONB 3I55B 4F3TA 2L0XA 1AZSC 2ZTUA 2QM0A 4L51A 1YR2A 1QLJA 3NHRA 3QYJA 3LUJA 4AO7A 3UQYS 5IBPA 2XT6A 4Q7KA 1MB9A 3V8PA 4I4TF 1AVTA 1IZZA 3W8DA 3OPYB 1JLLA 4EECA 3LLMA 2AG0A 1XNJA 2E2WA 1C7FA 2ZL5A 2VWQA 2LD4A 1XKQA 2GF9A 1I2DA 2RARA 4RH1A 5KYUB 5D3MA 4EG4A 1PJAA 1B00A 2CY0A 1L7OA 1RYNA 2NT3A 2Q27A 4CM8B 5EPEA 4DCTA 1ORIA 3Q3AA 2I4NA 4G63A 4DNXA 4ZI7B 1WLSA 1RE0A 2QVZX 1WF3A 4IDNA 4DZTA 1PJ5A 1Z4KA 5AKKA 3LNNA 1H2FA 2D06A 1ECBA 3LBAA 1WXFA 2IYVA 4RHCA 5D6OA 2CCJA 4IDAA 1QR6A 4XLHA 3T06B 3ITNA 3OT5A 4E32A 3N1UA 3PD0A 3QIVA 4P2GA 1E8DA 1GR1A 1VG9B 1FCJA 3I2FA 3IELA 3QVGA 4KIWA 5E9JA 4QUZA 3N0XA 2N75A 4R2KA 5F2EA 1PK8A 1P7ZA 5DW3A 1XCMA 4DF3A 5FBHA 4HLUC 4RHUA 1JVSA 4IGFA 2I91A 2WWHA 4M87A 2A9FA 1ZH0A 3E03A 1FUYB 4WCFC 3KSZO 3ZNPA 3X2FA 5I9TA 3VA7A 4B4OA 4KU4A 4CU5A 3HG7A 2QR2A 3LOQA 4RFSA 3SJUA 1TOAA 3FDJA 4Y0VA 1NV8A 5ELMA 3RYFB 1KHHA 2PUVA 1VLYA 2SBTA 3WADA 3BH7A 3PIRA 4WLUA 4DHEA 4DGQA 1S3SA 4OKIA 4OP3A 4F9FA 4QGFA 1Y33E 2AMLA 4I5IA 4GE3A 3RVOA 1Z5GA 3GAMA 2QRUA 4EABA 2L42A 2AOVA 2QZZA 4RSMA 1I51A 4EG1A 5C81A 3H2IA 5DU2A 5K4GA 3LCCA 1XQBA 1V4NA 2I54A 3A3YA 3TDMA 4S1NA 4Z4QA 4NXMB 3OCWA 4LDNA 4J2HA 3RHZA 4PSUA 3HFSA 4JDPA 3S7ZA 4B3CA 2QG6A 4WZBE 4NCKA 2WKSA 1I18A 1NXXA 2AYXA 4BLSA 1S9HA 2ZTLA 1NU8A 2VYCA 4NZPA 5IVIA 1CR0A 4FDTA 4M0FA 4URWR 5KNDH 4KXNA 2DUMA 2J30A 1LB1B 2YFKA 3KALA 5F3DA 4DANA 1N5LA 2E18A 4H60A 1M6YA 2EL7A 3INRA 4AZVA 4L02A 4J3JA 3TI9A 3KU1A 1P7VA 4TL7A 4BZXA 2J8ZA 3QXHA 1M1NA 3TTSA 2RGWA 2PE5A 2P9YA 2XUAA 2BFNA 3ZDYB 2HJVA 1XZHA 1XJWA 3H9BA 1JDZA 2RHBA 4V0ME 5DRTA 3KXDA 3W34A 4J1QA 5LBIA 4HUTA 4MYCA 4UE2A 2DZDA 3PC4A 4X8HA 4ZVSA 3TZ6A 5JAZA 2H3EA 1TU0A 2RCNA 4Y2JA 4YS6A 3ONYA 3W0LB 1FMFA 1MNQA 3IPXA 3DYVA 5DM70 1MBZA 3D6HA 2QNRA 3CLHA 2EEZA 2SKEA 3H4VA 1JQKA 3QBVA 1PGNA 2AWNA 1XSEA 1VDMA 5JNRA 1T25A 1Z28A 2ZR7A 4U02A 2EJWA 2GPNA 3PX2A 3OAAD 4HN2A 3JQGA 4WKOA 2MWMA 2CVHA 3CPHA 2OENG 2X9NA 3E8SA 2YMPA 3KYIB 4R8RA 3BRQA 2NP6A 1E2DA 3WL6A 3WAGA 7REQA 2FSSA 1ZMRA 4I3FA 4Q82A 3T1HB 5F4ZA 1T2AA 3WKBA 4DWWA 1AXGA 2YIVX 1JIUA 1ISIA 3OZRA 2AOUB 3D4BA 1PJCA 2X13A 4D4GA 1V47A 2ARKA 2OYSA 3DBRA 3EQ8A 1PJZA 4HYYA 4JA2A 5HFAA 1U0GA 3LGXA 4B7UA 3E1KA 4NMMA 4J0QA 4JXZA 2GVZC 1WSAA 2I78A 3F9RA 2ZWIA 3G2NA 4AZ3A 2NZWA 4YT2A 1GNTA 1C4WA 1NVGA 3JD0A 2R8EA 4EO4A 4DR3B 5BSUA 1DX6A 5KKAA 3UAYA 2VHWA 3CH4B 4J6EA 2IOQA 5ES4B 3NP9A 3WK9A 2B8JA 2EBFX 1MNAA 3ZD7A 3PKZA 4WN9B 3W7BA 5J43A 3DL7A 5C34B 1VJ5A 4KAJA 2DPMA 1M1YB 1RJEA 3AXTA 4TTRA 2W4MA 4XKJA 3UGTA 4C2TA 4Z3DA 5ESWA 4RETA 3FCOA 1FU7A 4EVIA 1E5LA 2BOVA 3KEOA 2PY6A 3FSEA 1N33B 3LQFA 2W6QA 5B3LA 2MMGA 3BEOA 1X6VA 2WTXA 3QXCA 1ACMA 5F77A 1PL8A 1N6OA 1XDWA 2B1IA 1KIMA 2QXTA 2WFAA 3DSRA 3TIIA 5K8UA 1HRDA 2EKQA 1KDTA 3F1LA 1EJ0A 4OQZA 2OV1A 4WKCA 1O9GA 2CLSA 3SX2A 2G09A 1TXGA 3L3BA 2C88A 3UJ8A 1B14A 1KJ8A 2ID9A 1N2ZA 1VLHA 4HADA 1GL9B 3RG8A 1FNNA 3F7TA 1ORHA 3WBJA 4MI6A 5U9CA 1BIFA 3DV9A 4X3CA 2OAEA 1KSJA 1MVOA 3IUEA 4QXMA 4B8YA 1WB4A 4R83A 2FWMX 2C42A 3AM4A 1H2ZA 5EJFA 5F35A 3ZS9A 5FPSA 3HCOA 2H59A 1Z8NA 4XLZA 2RGRA 3LRTA 1U3TA 2DWUA 3F3SA 1R6TA 3JVEA 3GRAA 4MQ6A 2AQHA 3SX4A 4BMCA 4CFYA 1L9XA 2BD0A 2D62A 3D59A 3WQSB 1CJUC 1DPFA 5DZSA 1E0KA 1GG9A 1NNLA 3OH8A 5A2GA 4EYSA 5LCXA 3P2YA 2IBTA 1U4NA 4LYYA 5HF6A 3V8VA 1VJSA 4D3SA 1HYHA 1MP0A 5J4KA 2G9NA 1OHHA 2QE6A 4BAGA 2ZAYA 2BGJA 3WAKA 4W5OA 1HFJA 1KEEA 4CFSA 2CT8A 1TYBE 4EDFA 3L0OA 1BQEA 1PFUA 3GZJA 3FTFA 2XRMA 3SDZA 2YBEA 1MDBA 5COBA 5GV7A 1XHFA 1KFBB 3D8RA 2XNSA 3LCVB 2VDLB 2ZYAA 5HJEA 2VF4X 4QJ3A 5JAIA 5AI5A 4D5GA 1E7YA 4CIXA 4BLTA 5FF9A 4PX2A 4ZALA 4IIVA 1N4AA 3AM1A 4TTVA 5B3KA 4KXFB 1GGKA 4X8MA 3L79A 1B42A 1PFWA 2Y4OA 3FNRA 4QUJA 4HUQB 3EEOA 4YEDA 1HX7A 2H2DA 5LMZA 1R6DA 3HC7A 1BROA 1EFUA 1KZ1A 4NMWA 5MGBA 5TMEA 2Q1YA 2XTJA 1A5BB 1M1XB 1P9LA 2C4WA 2K2WA 4TV8F 4HNAB 3OCVA 3HR7A 1PJ4A 1GFWA 3BK2A 2J7PA 4PSVA 3RTCA 4F2DA 3GZNB 1T1RA 1ZW1A 3M1AA 4H7EA 3MB8A 4QJ5A 3ZY6A 1OIVA 1FUUA 4XLCA 2NV4A 2Z2ZA 2ZQYA 1SKUA 3FBTA 5KEIA 4O4IB 4V0LA 2AVDA 4OSOA 1NNI1 4RTKA 1M34B 1PS9A 1W581 1GM5A 1YVPA 2AHRA 2WILA 3VFDA 4EENA 4UPEA 2IS6A 2DMRA 2OAGA 1HVXA 5KYWA 1MB4A 3KZCA 2QPAA 2GXQA 3BGIA 3RTDA 3QLVA 3ZI7A 4Q66C 2O1XA 2JBWA 3BSWA 3SZRA 4W5JA 3SWWA 4XD2A 2GXAA 1OJ7A 1L7EA 5TT1A 2V98A 4U5XA 3ZJ4A 1ENYA 1O8CA 4B6GA 1XWWA 4E4YA 3CGWA 1AV7A 1G4AE 2ZAOA 3A4YA 3GAZA 4GI3A 4OJNA 4XDGA 4HO1X 4D02A 4HDMB 3QEOA 2ZAIA 3LRXA 3WE7A 1F4PA 1O5OA 1YDMA 4B4UA 4R1LA 2RJ3A 3V2GA 5LBTA 5LLTA 3E20A 3CLVA 4KXVA 3WL4A 1KDVA 2Q6OA 3D8HA 1UXKA 5INTA 4DM3A 2FH5B 1QQBA 4Z4ZA 3ZIAA 2ZT5A 5H5JA 3R24A 3LK6A 1RWQA 4OBWA 4X07A 1YR8A 2WV7A 5CA1F 1Q6YA 1IBLB 4N7BA 1T6YA 1AN0A 1TK2A 3OLWA 1AK1A 4IHAA 2A1TR 5GONF 2XHEA 1N5KA 4MVJP 2DKFA 2XYGA 1J8YF 4U8GA 2Y71A 3HDQA 3BRSA 2X0DA 1KRXA 4CKBB 5LQMA 2QSUA 1WZEA 2XMSA 5UKDA 3FHJA 4RVSA 4UD2A 3ZU2A 4DRYA 2H00A 4EG3A 5L3SA 2HI0A 4NONA 4CG3A 5M5BA 4KH1A 4IVRA 3GHYA 1QX3A 5SZIA 4LF4B 2QM7A 3ROPA 3EIQA 2F17A 4XIFA 1Q82D 5CH8A 3QOFA 1CY1A 3NO4A 1U1EA 3TW6A 4IIHA 4OI0A 4PC3A 5B4VA 1T3GA 2AN1A 1KJWA 4ZZ3A 2R5WA 4B9AA 5CDFA 4WMLA 3KBOA 4LF5B 2DPGA 2XBLA 4FFOA 5EUQB 4LQDA 4MQMA 4IZ6A 4M8NE 1QVGB 3UT0A 4BNWA 3WO0A 4D4LA 4BVLA 4KQKA 1ZIOA 2GK4A 4QTXA 1UEXC 5HZAA 3PT9A 4DV2B 1E9AA 1X13A 3S3TA 4NLLA 1MDFA 4XX1A 3FBWA 2O2SA 1ZRSA 3HMQA 3NIDB 3LSTA 3EQ9A 2J08A 1TZKA 1IDN1 2PXXA 3GUUA 4QOGA 1P2BA 3DTVB 4I50F 1TUGA 5GOZA 2VHUA 3BAFA 3BE8A 3UKDA 3MT9A 4DZZA 3CR3C 3IE1A 5AKIA 2CNWD 3PHBE 1G3IA 4DNRB 4DEXA 4ENTA 2RHMA 1EVKA 1XZQA 3WOVA 1PWHA 1YX2A 3JYQA 2J3LA 1P2UA 1Z2DA 4W6QA 1C4XA 3EQ6A 3AF3A 2YWEA 1XZFA 2WAYA 3PYLA 4N3BA 1XVTA 1UMDA 2C9ZA 3EQZA 5IG2A 3AVOA 1VQ7B 2OBMA 2JAOA 3K72B 3FTCA 4PHGA 1IBRA 3E4CA 4EFLA 4EPWA 2VQFB 2Q45A 4XUCA 2Q4EA 2QVLA 3D1JA 1U4SA 3M9WA 2DYKA 3ZDXB 3RFCA 4PPNA 4Y6LA 1GA6A 1JJIA 4P1VA 1KYIA 4S35A 1H2BA 5F2KA 3H9CA 3OAAA 2ASEA 1NW5A 4ND8B 2KYRA 9ABPA 2UVPB 3C70A 3PC8C 4NEQA 4XKWA 1V1MB 2A9JA 2R60A 5KYVA 4B33A 1CQWA 3VH2A 2ZYUX 4J1TC 2WZPP 1IOLA 4GL2A 2VHXA 5CITA 4OLJA 3C6BA 1XP8A 5K8IA 1QCYA 4PR0A 1OREA 4EATA 3EFHA 3F7OA 4KQ2A 1FDRA 2DVMA 2SNIE 4PX3A 1GCGA 4ALJA 1QP7A 2GTHA 4WLOA 3D4NA 2ZT6A 4QYSA 1F1BA 1KF0A 1NX6A 2O4CA 3WY9A 3BD7A 3G2PA 3QVUA 4IOJA 4LJYA 4Q05A 3JQPA 4TQAA 3H9NA 2Q4RA 1EX6A 4V0KA 3ZS8A 5JZVA 5J3JA 1NJGA 3O1HB 4QEKA 3NRBA 4NAHA 4LIPD 1YHQB 3NAGA 1E66A 3FLBA 4PHHA 2CFRA 1Z06A 4XFDA 1KPGA 2FDXA 5JJBA 4CUZA 4FFMA 2XDQB 1PVOA 2PGLA 4G0QA 5TRTA 4B4DA 1U3FA 4GEKA 4RE6A 4CDNA 4IMPA 1QGED 1EHIA 1H65A 3GD7A 3M34A 4LCJA 3SSNA 3ZDCA 2O8CB 4WOCA 1I24A 3EIFA 3S27A 4KH0A 4ZOQI 5JANA 1I8DA 2XAAA 3QELA 4NZ9A 3FWHA 2X5JO 2A78A 4NH4A 1Q2XA 3QX8A 3C16C 3NNDA 4N5IX 3VTZA 5DCLA 1A3CA 4NDNE 1N2GA 1L5KA 1N78A 5H80A 4E15A 4QNNA 3P2JA 4XQ9A 3K0SA 3F4KA 4BWYA 1Y3BE 4Z9FA 4C3ZA 3VR0A 3ASVA 3L8GA 4U7WA 1USGA 3PJDA 4GLBA 2AXNA 5KQMA 2HW8A 3UANA 3ZV6A 5ALGA 4K8RB 2JFGA 4RNDB 4L9SA 3A25A 1TD1A 2R7MA 1M66A 5KMGB 1N6RA 1UXOA 1CETA 2O5VA 2ZTNA 1WY7A 3M89A 4MUMA 4M8KA 2R9VA 3A0RB 1UDAA 5CDFE 4G86A 3LT1A 5HEKA 3HYSA 2DYIA 3TJRA 2J0UB 1S7CA 1GDHA 3MYYA 1HXHA 4BPBA 2B1RA 3KQLA 2WIJA 4GDFA 3DEYX 5IAEA 3T34A 1NJ2A 3WICA 4WRRA 4YBRA 2WLSA 3G49A 3HNOA 3GQBB 2FEWB 1WCXA 2GI4A 3P2KA 3UJCA 1KK1A 1E2EA 2PMDA 3A1UA 1N2CB 2VJDA 3GLTA 3IHTA 4GPIB 5TQ2A 3SEFA 4B80A 1YCFA 4R05A 3V8RA 2QJWA 3BFKA 4M1QA 2YJ3A 4JVMA 4AIIA 3G4SB 3CRQA 2F4NA 3KQVA 4BMPB 2NPFA 1LI5A 1QYIA 4E1AA 2QQFA 4IFEA 4R9UC 5D5PA 1G8YA 4ENRA 2YWBA 1YJNB 3DXZA 1L7MA 4M8LA 3G2QA 3IIMA 1AHHA 1R0SA 1XEWY 1Z26A 2AJBA 2JHGA 4DQ0A 3STWA 4GMGA 3T7TA 1YI8A 3D8SA 1KZYC 3DF7A 5CVEA 1QJCA 4H15A 1X1TA 5FNVB 5L8VA 5DM60 3TH5A 1I7NA 3OF3A 3NVKI 3BQMB 2GJ9A 1S3GA 3TGWA 5C80A 3BERA 2Y1FA 1W5SA 1V8PA 1AGYA 1W6RA 1ZVMA 4FMCF 4QATA 3W6ZA 2QUBA 1P60A 4HR7A 2OFWA 4LXTA 1MQSA 2BCEA 1BE0A 4HUJA 4DIMA 4RTNA 1GA4A 3CRW1 1X7GA 4M9RA 1V0EA 4NI5A 3VU9B 3PP8A 3OOYA 2NU9B 3TR0A 1KGDA 1P4GA 1UUFA 1Y7PA 4RIFA 2PN1A 3ANTA 2WJ4A 3ESXA 5DTEA 3GLFA 3W8RA 4O4LB 5DNVA 3WHKA 2PV7A 3QEAZ 3VUFA 2GQFA 1SAYA 1ZUWA 2CLHB 4C9BA 4XYLA 2GPSA 2IZZA 2V6FA 3TLKA 1XQ9A 4OLHA 4DCMA 2OB1A 2SECE 2GPAA 3ETCA 2XMGA 2Z8YM 5E9WA 2UUOA 1P2FA 1I0LA 4YRLA 4EY3A 3AOEC 4ASUA 3NKVA 3B85A 5EXPA 3RANA 5C7YA 1UPTA 3NQ41 4Q1FA 1X1CA 3ESDA 1G64A 4FYHA 1EWKA 4PIPA 1Q3TA 2GZRA 4FPXA 3OEYA 2PCLA 3PQ4A 5DGCA 2OILA 3S1AB 2VLIA 3WISA 4QXRA 3GN1A 4R0MA 2IYEA 1Z3IX 2IRWA 4TL9A 5BWBA 3DOCA 2QL6A 1NONA 3L0PA 3P19A 5JBQA 1DAIA 4K87A 1DWQA 1T8SA 1TJYA 2VIIA 2QRVB 2QRZA 4MIEA 5AHOA 4R2LA 3ZCUA 5JFTA 5BW5A 4L8VA 1Y5LA 2YVUA 3TDKA 2IHNA 4MRNA 4H9GA 3MWDA 1DTSA 1Z17A 3G0OA 1V16A 5SZKB 3NAQA 3EF0A 2CW5A 1W93A 5ELLA 1Z2OX 3AF2A 1XLUA 2Q07A 3C6QA 3GJSA 3WGOA 5LZ2A 3VX3A 4PO1A 3HFRA 3VVBA 4DSOA 3UBTA 1J5PA 3TFWA 2Z6UA 5I7RA 5CJJA 1U1GA 1L1FA 4QSHA 3NCTA 3MZ0A 5B2EA 2CVQA 4S05A 1E77A 4W5NA 2XR1A 4Y1FA 1GT91 2GA8A 3LQYA 3P94A 1B2LA 1RPJA 1S3IA 1NP7A 2GEVA 2ZYIA 4HX2A 5HE8A 3TBKA 4UW9A 3N76A 3HVHA 2Q8NA 4PX5A 1MAUA 1VJTA 2MYPA 3H1PA 4YJ2F 4ZK2A 5F2NA 2C8JA 4G0ZA 1EK6A 1OZAA 3I3OA 1Z29A 4TWZA 4HAWA 4WKNA 5TPZD 4DXHA 5KSZA 3MBIA 1L7QA 1E63A 3V1LA 3RVKA 2W5UA 2B9EA 3KL4A 1TAUA 3OQ1A 3W06A 5HUQA 3JZAA 1SHJA 3BXPA 4LVCA 3G85A 1U98A 3HUUA 3IAEA 2C8KA 2HTFA 3DR3A 3K2IA 3E7PA 4AVYA 2NAFA 3UV6A 4LF8B 1XZGA 2BBSA 2OT3B 4C4TA 3EPKA 4EW1A 1P9WA 2GRUA 5G1NA 3UB2A 1V5FA 4FCCA 3FPJA 3MTGA 4IL5A 1UXIA 1SBNE 3HGMA 1TT5A 4Q1BA 1BCSA 1TCVA 2EYQA 3B1YA 3ZV5A 2RI1A 3A9TA 1VI2A 1XYVA 4L0CA 2FN9A 2CNWA 5DBHX 1NUHA 1N3YA 1QO9A 2AJDA 2ZJBA 1W34A 4J4TA 4C4YA 1R7RA 2AS0A 3DL2A 4EUFA 1SXPA 1E4EB 3CCCA 1A77A 4JKYA 4G67A 3P27A 3OBBA 3ZUPA 1FTWA 1P5FA 3DE5X 1G21B 5LNK1 4OHXA 1NWCA 3JW8A 3MLAA 4PCLA 1EXNA 3JQEA 2VTKA 5CT5A 4B79A 4YFVA 4S1PA 2HWYA 2VH5R 3MG9A 5C7OO 5JCOC 2XUKA 1JW9B 1LQTA 2HU8A 4GM4A 1P80A 1L8OA 4WOBA 3CRRA 1SCDA 3QVSA 4X95A 1E4VA 4M46A 2B3DA 5CT9A 4OXNA 4LSZA 1IQUA 3GAFA 2H1IA 1J7KA 3GGOA 4MKGA 4Q3BA 1VLQA 2HSZA 5G02A 3WA7A 1Y1KE 4UE3S 2H4ZA 1T1IA 2WHPA 3DLIA 4NYMQ 3SC4A 4BKOA 4LYHA 4N8EA 4HN4B 1U1IA 3C3MA 4PINA 4PLFA 3ZBTA 2J1LA 4W7HA 4ZAYA 3H3XA 3RFUA 2QZ9A 4DADA 1KYVA 3RRNA 4MP6A 4E13A 1US8A 2EX4A 3EPLA 3LT0A 1JG4A 5EPUA 3BJIC 3QF7A 4BKMA 5IXJA 1J2TA 2VBCA 5J2UA 2AEEA 3MLBA 1DUIA 3OLQA 2VSFA 4B43A 5FV7A 1SIOA 4B6EA 2W8ZA 3H5LA 3QXSA 3KYBA 2CLCX 3L05A 1MEJA 2XHZA 3ZDFA 2BKLA 1FTGA 1KFKB 3MF4A 4UCQA 4RYLA 2WA2A 3BJZA 3RC2A 2ZCUA 2CKMA 4MRPA 2VDWA 4YR7A 3A27A 3FOZA 1HLDA 3AQ4A 2FR1A 1JSXA 1A9OA 1GGMA 1NY6A 4D9EA 4YK7A 1JJ7A 3EG9B 1GU7A 4FGJA 3MT8A 1JH8A 10MHA 5B12A 3B9BA 4WFQA 1I5RA 5CHYA 3CMAB 4UDNA 1XV5A 2YC4C 3DZGA 2NLOA 1NVVQ 2W2XA 3HRKA 3BBLA 2NVUB 3K9FC 3LQ6A 4RADA 1SHZA 2P62A 4OYHA 4PIMA 1IM8A 2HK6A 3C1AA 5EXXA 4GX0A 5I8ZA 1DFHA 2BZ1A 3NHBA 3Q6RA 1WZ2A 3OZVA 4P25A 3U6KA 1UEIA 3EPHA 1KYXA 3SHFA 1TO2E 2FZCA 3WYDA 1G4HA 2GLXA 3YASA 3K09A 1JLMA 4R9NA 3ZU3A 4CVNA 1QHNA 1FQOA 1K0FA 2EARA 5DHFA 5T6BA 1LRLA 4BB9A 3HKBA 3LAWA 1K8ZB 3IEMA 1VE9A 3QXGA 4CIDA 3UXEA 4MS1B 4D9NA 4MQ4A 2WSSD 3BC1A 3DZIA 2WWRA 4FM9A 4G0UA 3CSUA 3CBGA 4JMLA 2WJPA 1AURA 3GLSA 3T51B 4W99A 4WWVA 3S2SA 2C4UA 2QK4A 4CHTA 4QVAA 5IJ9B 1K86A 1CQIB 2BF4A 2F3PA 1MB2A 2C4KA 4Q1CA 3VZPA 1PCXA 4NC9A 3ZW8A 5M2QA 1NVEA 2Q6LA 4MV1A 3RREA 3LHKA 1QRRA 3QHAA 2CNOA 1L5MA 2FRVA 1DX9A 2C2OA 4Q4HA 3RU9A 4FZVA 4AMGA 3ZZ0A 3B3QA 5ABPA 5CYGA 4EQ6A 4FC6A 3ZY5A 1EVLA 1TVKA 4D0RA 2FW9A 3R44A 4JENA 4Z4HA 3CPSA 4K28A 4F3RA 3QKUA 1V2HE 4RL4A 3RRZA 4ZDIA 3LXXA 3OO0A 2ZXHA 1TU4A 5AK6A 3K92A 1VBFA 3BREA 4E2ZA 4MCHA 2BV3A 2IDMA 3KQOA 2FY8A 3I56B 1YAHA 2QY6A 2Y1OA 1NW3A 2ZRCA 4I1SA 3WSTA 1Y8CA 1DAEA 3FHTA 3DQPA 1FSFA 3NM4A 4L16A 1NA5A 2OWEA 1UF9A 3LP6A 4YP0A 1JLRA 5FAXA 3RIYA 1D4FA 2OECA 5JAMA 1IQ0A 1K3TA 5LP6B 2C3UA 2LRHA 3AJ8A 1OKKA 2QW8A 5MDHA 3GPDG 3ZZUA 3RIHA 3OY2A 4Y2UA 3D8TA 5C1BA 1HQYE 2R66A 2ZVDA 3N2IA 2J9FB 4KOAA 4BDSA 3QLJA 1IMOA 2FVXA 5HA5A 4G5XA 2XMCA 1YB7A 4H7PA 1SBYA 5B1SA 4WJLA 5GAJA 1LBHA 2PNJA 2X58A 5AVXA 1RQLA 1JG2A 2OVBA 1J25A 1DJLA 3GEMA 3JARA 3JCZA 3AUXA 2R00A 1H2XA 3RQIA 5HP4A 1W59A 5CT8A 3Q8MA 2C1XA 5CDSA 2O3SA 3G8CA 4CJXA 4ECAA 5LMNB 6CHYA 1S96A 1U9YA 5JSUA 4DCUA 2ZP1A 2DIEA 1EB8A 4J90A 3LIPA 2C61A 4HVAA 3OQJA 3ZV3A 1HNWB 4UEOA 1Z38A 3O0TA 1DWPA 1RVV1 1UZMA 3JS5A 4GRDA 5CNIA 4ZKEA 5F2OA 4DWJA 1Q14A 2IP4A 2QEXB 1OBCA 1YZGA 4ANFA 4J4BA 2V31A 3AVTA 4NP6A 4KRGA 5LMUB 3OCZA 4DSAA 4X20A 3B6EA 1KAHA 1GAQA 2G72A 3HJCA 4FKMA 1ACJA 4HKTA 3PXDA 3W6NA 3V4RA 3Q7QA 4ZGWA 1CULC 3KJZA 3Q7SA 4IEIA 4ZOBA 2JNWA 1PDWA 1A4XA 1Y37A 1ZM4A 1CR6A 2XNKA 1HY3A 4OQXA 1JNYA 1CDDA 4V39A 3TX6A 1OF1A 2YY7A 2BFPA 4XYGA 1H4TA 1KERA 1WR8A 1P0MA 4TUYF 4WLVA 4R5HA 4G0XA 3WSVA 4TRMA 4HIZA 3CCUB 4JBXA 1WSBA 2APJA 2FSPA 2RAFA 2X5NA 3PUHA 5A9SB 1V1RA 3W2TA 3DMGA 2EKPA 4Q1DA 3DMDA 3NYWA 5DKFA 3VX4A 4CG2A 4PRZA 2BFEB 1XZJA 1K2VN 5CCXA 1O08A 1AK9A 1W19A 1FDWA 1YIOA 4W8OA 5H4HA 3ZD6A 3KZMA 5EZSA 1G5IA 5EJAA 2VSNA 2P6MA 4B2IA 5BN5A 4DV3B 1XDZA 3M6IA 2B4RO 4M7WA 1V7ZA 1KI3A 4BBAA 5A7FA 5C1IA 4CODB 1Z36A 1YZYA 1AMUA 2JASA 2J87A 1KK2A 2ST1A 3QVOA 4NCJA 1E9VA 4XQEA 5CAEA 4C4SA 1Q7CA 3A06A 4KXWA 1VL1A 3ESRA 5KAPA 5HS6A 3VOSA 3DKRA 2VXCA 3PNKA 1XCGB 4D96A 5KOHB 3F8SA 2FEKA 3DE1X 1UK8A 4YLGA 1CUVA 3ENQA 2AJTA 1XTZA 3Q3EA 4BXOB 2C5FA 2ZIXB 1IJKA 5J40A 2P4HX 3ZXXA 2W43A 3HA7A 3G5MA 1SIUA 4MKXA 4YROA 2CEKA 4LZNA 4FDUA 4NICA 4MWEA 1SOWA 5TPZA 3FAKA 2FG6C 3LWNA 1DT3A 5HILA 5F21A 4GX2A 3EWIA 4FFBA 2YXNA 4FMBB 4C0QC 5CM8B 3EIHA 4MWDA 4EY8A 1UZLA 3ZVKA 2IDKA 3BGVA 1D6MA 4KDFA 4H0CA 1AS3A 5ECWA 3KE8A 1JPNA 3AR8A 4JYMA 2IIQA 1HE2A 3WWOA 4RESA 3DYIA 4F46A 2R62A 1XT6A 3C8MA 3MINB 2G7MC 1NRIA 4BQRA 1CZKA 1RYDA 5JR3A 2CV0A 3ET4A 1TIPA 4J9UE 4WOJA 1QKIA 4A6DA 4BQNA 2XADA 3DBLB 4DR2B 2OZPA 1ISJA 1A9XB 2WM3A 5GWXA 3RNLA 3A11A 5JCZA 2PJDA 2C00A 4IHJA 3ROEA 3RRFA 3S44A 4INZA 2ATXA 1JF8A 1JA0A 4RKEA 3FMVA 1WVIA 4JUAA 2R4TA 1GVNB 4IOMA 4YJGB 1QPGA 4K9LA 5I01A 2QLTA 3ZD8A 2RJNA 4LXIA 3EASA 4OAQA 4OMDA 1IXKA 1DFGA 1IVYA 1J9GA 1KARA 1V96A 4NG5A 4ZZ0A 3L1VA 1ZVQA 4CLHA 4M4SA 3CX3A 1N5DA 1W9MA 2GNPA 1P1IA 2IYWA 5E7QA 3O8OB 1XNGA 3QJGA 2ILTA 2VJKA 2BDEA 3CRNA 4OQ4A 3WQQA 4V3BA 3ASPA 1TFUA 1MOZA 4H4DA 3TXYA 3A2KA 4H0FA 2HA6A 4F6CA 4UTRA 1H3EA 1T4CB 1ZH6A 1EAYA 4UUPA 3U3MA 2R6CA 1CNEA 1N2BA 2EGGA 3AUTA 2JI9A 3GVJA 4GUDA 4X7DA 5AVJA 3SFVA 3W5IA 3AY3A 5EE1A 1JHAA 3TR5A 3MJDA 1GTRA 2QBYB 3QY9A 2OHGA 1Z74A 4F4FA 2CMDA 4GXQA 1HQKA 3T52A 4XWKA 3SKBA 4M9UA 2BCGY 4U3JB 3DHNA 1U90A 1U3VA 3C1TA 3IMKA 2WQZA 3DZHA 3LDAA 3SZMA 5J4VA 1ORTA 2ACWA 2FX2A 4UAGA 3UMMA 4ERNA 4HZIA 4BBJA 3G0CA 1IATA 1SNYA 4J1SA 3THYB 2P9BA 2C7PA 1CUUA 2YYAA 3M6VA 4LJSA 1UEJA 3V4FA 3PCXA 4EFMA 1MOPA 5AUPB 3LPLA 5B1EA 3BH0A 5DM4A 3PNSA 2PUDA 4J91A 5EQFA 4XPZA 1E20A 1U8CB 4F06A 2CK3D 1QIMA 5AM3A 2B3TA 5KU7A 2CJXA 3FX2A 3GRFA 2H08A 1HE3A 2X15A 3EW9A 3ZXSA 4HVTA 3WLOA 4EWLA 3G1TA 3JQ7B 3T41A 1EXWA 4ISCA 4BFSA 1Z5VA 3WFIA 1VKOA 4GPEA 4L2IA 3MSXA 1L5GB 3FCYA 1BOFA 1ZS9A 5E3HA 4Q5IA 1AF7A 3F90A 2Q5IA 4DJDC 1E6UA 3KB8A 5HUHA 3T0IA 1YE8A 1RCFA 1N3IA 3IURA 3EAQA 4C0XA 2AXEA 3PIIA 4G1CA 4AJOA 1W52X 2IW3A 3E2PA 4PBRA 4QLAA 1P4HA 1GTSA 2AYYA 4AZ0A 1CIVA 5I9SA 2V3WA 3VMFA 4I66A 1CNMA 2D59A 4ZOLA 1EG2A 3IAM6 1ADBA 3VNVA 2SCUA 3NOOA 4RS4A 3OQNA 4RTLA 4EF4A 5FH9A 1G55A 1YZHA 3GLHE 5KC9A 2FEXA 2ZUWA 4CYMA 4QLBA 2OC4A 2Z1DA 1KI2A 2VPWA 2X2EA 4EF5A 4B3FX 2UVDA 2WSSA 4I3GA 3H19A 5CK5A 3ZBUA 1CRQA 1YB6A 1U7TA 2JGNA 1ZAYA 3GMTA 3QLVC 1MX1A 2PYZA 2DULA 2F1KA 2WHEA 2W7TA 2YICA 3D1VA 3LT4A 4OLFA 1F5NA 3DE6X 3T4EA 3AEKB 3F7NA 2DSNA 2W2NA 5HKOA 2BTEA 2QTVB 1R6UA 2MSCB 2DY1A 3NGXA 4JXKA 1IY2A 4X60A 4BLOA 4XVRA 3ZX5A 1RI1A 3AEUB 3HYCA 2MHCA 5ER6A 1J07A 1Z4NA 3KQNA 4IJ6A 4LE1A 4P12A 4FN4A 4U7JA 2OQVA 1YDGA 4OSPA 5AK0A 1Q0TA 3ENVA 3AHHA 3IP1A 1VMIA 3BGWA 5GJBA 4HDQB 4PYRA 4F93B 3V9AA 2XGOA 4PSDA 5IRCD 1YS4A 3G9XA 5CK4A 4N82A 5IT5A 4G2TA 1CEEA 1UL1X 1RC0A 4IH4A 3L0BA 4FR2A 4W9NA 3FB4A 2PUBA 3WVNA 5JSZA 4IH9A 4BAZA 3G1UA 2NVOA 4FINA 5KBYA 1OZHA 5HZBA 4JEUA 3QWIA 4XR6A 4E6PA 3EXHB 4OHUA 2ZEJA 3C4JA 3ZNNA 1OFIA 2RGNA 3LLSA 4FE3A 1EGAA 1TFRA 1TYEB 2IK8A 3LL7A 5TNXA 3UBMA 1P73A 3K1YA 1Z4JA 4A0QA 1L4HA 4P34A 1E2IA 4YBZA 4CCYA 2FPSA 1TQ2A 4QJBA 3SBOA 4BMXA 4D1YA 3D3QA 1V0FA 3DOOA 2TMKA 3EEBA 1JVNA 1WPQA 2F9FA 1NQOA 3ORRA 1PL6A 2VT2A 2DCUA 1G1AA 1SCQA 3ZR4B 1U7HA 4ESEA 2DHDA 4BPRA 1ATZA 1M2OA 1SB9A 3OTWA 2P9GA 2D1RA 2VDNB 2N3ZA 1FDTA 2XT0A 4AZSA 5IAAA 1PUXA 4BE9A 1TNDA 2ADMA 2BH9A 1TTHA 5EPOA 1KYQA 4MARA 2OP1A 2RSLA 1DTWB 1LLCA 1X1EA 3IDFA 3EE6A 3KQPA 1TVMA 4XM1A 3CZ9A 3O4HA 1WEHA 1UM9B 4FYIA 3DJFA 1ESZA