3VO1A

Crystal structure of zea mays leaf ferredoxin-nadp+ reductase ii
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
295
structure length
295
Chain Sequence
b'SKKQEEGLVTNKYKPKEPYVGRCLLNTRITGDQAPGETWHMVFSTEGEVPYREGQSIGVIADGEDKNGKPHKLRLYSIASSALGDFGDSKTVSLCVKRLVYTNDQGEVVKGVCSNFLCDLKPGAEVKITGPVGKEMLMPKDPNATIIMLATGTGIAPFRSFLWKMFFEEHEDYKYTGLAWLFLGVPTSDTLLYKEELEKMKEMAPDNFRLDFAVSREQTNAAGEKMYIQTRMAEYKEELWELLKKDNTYVYMCGLKGMEKGIDDIMLDLAAKDGINWLDYKKQLKKSEQWNVEVY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferredoxin
publication title N-terminal structure of maize ferredoxin:NADP+ reductase determines recruitment into different thylakoid membrane complexes
pubmed doi rcsb
source organism Zea mays
molecule tags Oxidoreductase
total genus 98
structure length 295
sequence length 295
chains with identical sequence B
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2012-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 3vo1A01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 3vo1A02
1JA0A 2BSAA 1QGZA 4M1KA 1ZM2A 2DEUA 1N0VC 1NDHA 1VQLB 1OGJA 1F60A 2VNIA 4ZGNB 3MCAA 1G7SA 2OTJB 4M0LA 2QEXB 3P26A 1KK3A 4QFMA 1KK0A 4MYTA 4UAJA 3CCVB 1VQ4B 4RD1A 5GV7A 5DSZA 3VNUA 1AIPA 3AVXA 1ZUNB 4TMXA 3CW2A 1I7PA 4PGOA 1TVCA 3I56B 3E20A 2RC6A 2XEXA 4HE6A 3QE2A 1CNFA 1VQOB 3LYUA 2VNHA 1EFUA 2YWFA 1FNMA 4RCYA 1EP3B 2B7BA 1FRNA 1F20A 3B8HA 3ZBUA 4YHBA 3QSYA 1QH0A 3JQPA 3CD6B 1JA1A 4AF6A 2QA4B 4Y9RA 1CNEA 3ZZ0A 2ZITA 2J7KA 2QDXA 4ZCLA 4Y7CA 3LVBA 4Q7JB 1YI2B 1EP1B 4B48A 3ES9A 1VQKB 1XE1A 2XNJA 1ZM3A 4Y9UA 4RD4A 2VZLA 3CC7B 1EXMA 4P3YA 3CCLB 2OK8A 3CCEB 2GQFA 1W2BB 3AGQA 2PLFA 3QFTA 4ZGQB 3J81k 1DDGA 1W87A 3AGPA 2DY1A 4ZCMA 3U6KA 3E1YE 1H42A 2BV3A 5TV2A 3WYAA 4AC9A 2EIXA 3PENA 1HA3A 3G71B 3CC4B 3WY9A 3FPKA 1KK2A 2BVNA 1TUIA 3U6BA 3CRZA 2X3UA 1FRQA 3WNDA 3CCSB 4P6VF 4AF7A 2DETA 3OJXA 4LBVA 4PC2A 4TMWA 3WBJA 4C0SA 2VYQA 3AVWA 2HCJB 1QFYA 2EFGA 3MHPA 1VQMB 5TY0A 1Q82D 4BPRA 1E64A 1QGAA 4RJLA 2XNCA 5FA6A 1H85A 4RD6A 4LBYA 3U2QA 1TTTA 3W5UA 3QFCA 2BF4A 4M4SA 3W2GA 5THXA 1CQXA 1SM4A 4B47A 3ZC3A 3CCMB 1AMOA 3WNCA 3CMAB 3OW2B 1E62A 2AHOA 1TLLA 1GAQA 2CNDA 1QUEA 3B82A 3JQRA 2BN4A 1YHQB 2BGJA 4N3NA 1OGIA 4F7DA 4TMVA 3CB4A 3I1FA 4B44A 4N3GA 1EFTA 1GR1A 1GJRA 1KTVA 3VO1A 1U2RA 1VQPB 1J9ZA 3ZZUA 4FWTA 3JQQA 2BM1A 3WXMA 3AVTA 3W5HA 1KRHA 1JNYA 2QMUA 5TR9A 2QN6A 1BQEA 1UMKA 2QTZA 3OJWA 4RD3A 1GAWA 1D1NA 3W5VA 4G1BA 1ELOA 4C43A 4K1XA 4IW3B 2VNJA 1G7TA 3ZZTA 1A8PA 1D8TA 4PC3A 2E1RA 2NPFA 4TMTA 4DQKA 4DQLA 1IJEA 3CMEB 1B2RA 1JB9A 3OZWA 4YALA 1FNDA 1B23P 2HMAA 4B3XA 2OTLB 2OK7A 1EFCA 4EH1A 4TMZA 5KSWB 1KQSB 1ZM4A 4PC6A 2PIAA 1GO2A 4B4DA 3I55B 2PMDA 3W2HA 2RC5A 2YWGA 1YJWB 1N8RD 1YJ9B 1ZM9A 1BX0A 4FK8A 1YJNB 3VNVA 2B5OA 4RCZA 1QFZA 1Q7YD 1WDTA 4H9GA 4YAFA 1QGYA 2VNKA 3QFSA 4YAUA 3LRXA 3AVUA 5EMNA 3CCQB 3CXCB 3FJOA 1QX4A 1QUFA 3W2FA 4ZCIA 2CRVA 1VQ6B 5H5JA 1VQ5B 5AN9A 2DCUA 3AVVA 3P27A 1W34A 1N0UA 3CC2B 2D74A 1QG0A 1KC8D 2BM0A 1GVHA 4WQMA 4YAWA 2YWHA 2QTLA 1VQ8B 1R5OA 3G6EB 1S72B 1KD1D 2BPOA 2GPJA 3VO2A 3MMPA 4J0QA 1VQNB 4G5GA 1G7RA 4PC7A 3W2IA 1K73D 1FDRA 1DARA 1EP2B 2FX3A 3LO8A 1JJ2B 4B43A 1KJZA 1M1KD 1Q81D 3WNBA 1YIJB 2BGIA 4HE5A 1E63A 1QVGB 1DDIA 4MYUA 5GV8A 3CCJB 4M53A 4LC0A 5HXBA 2BMWA 2DERA 3ZBTA 3AVYA 1YITB 1OB5A 4G1VA 4ACBA 1K9MD 1IJFA 1BX1A 3CCUB 1XB2A 1S0UA 4YAOA 1EWYA 3A1FA 3B78A 4U9UA 2R6HA 4ACAA 2B7CA 3CPWB 4NBSA 3SJZA 4LBWA 4LBZA 1DG1G 4R71A 4RD0A 1SKQA 3OZUA 3OZVA 4FN5A 1R5BA 2YWEA 3G4SB 3V76A 5JBQA 2C78A 1G7CA 5H59A 1Q86D 2HDNB 4NCNA 1QFJA 1KK1A 3W2EA 4PC1A 4QHYA 3QFRA 1K8AD 1VQ9B 1VQ7B 2C77A 4M2LA 1M90D 4RD2A 1W35A 3CCRB 4TN1A 1R5NA 1IB0A 4ZV4A 1FNCA 1D2EA 3WBKA 1NJID 1OB2A 3VMFA 1FNBA 1BJKA 1QVFB
chains in the Genus database with same CATH superfamily
1KIFA 3OQBA 2XA1A 3FWYA 2ZJ1A 3BCUA 3VPXA 5KNLA 2HTEA 5NLLA 4YQEA 4LECA 4R4JA 2YV3A 3NYRA 2A1UA 2J7PA 2R68A 3K6JA 1YXMA 1DX9A 5DBFA 2WSYB 1PSDA 2A67A 3G1TA 3ZS9A 2PUGA 1GFSA 5JJLA 2REQA 1ZHHA 3TNFA 4IINA 4XGRA 3VHRA 3ZHRA 1Z36A 2XBUA 4MV6A 3OKAA 2BLLA 2Y05A 2ZPTX 1N7JA 4J43A 4QFMA 1ZN8A 2BZ0A 2OCIA 5AW0A 1E6UA 2FFAA 4FX2A 2J30A 3SLGA 1QH8B 1S9DA 3IYLW 4M38A 3SDZA 2I99A 1BCSA 5B4VA 3UAOA 1QP8A 1SKBA 3BGOS 1UP7A 5FPTA 2OO7A 1D9XA 1S2OA 2G0NA 2IJGX 2QN9A 2ZFUA 3I4CA 3KAPA 3IE1A 2XIQA 1E2GA 2Y1FA 1U3WA 4KQIA 1MU0A 3GLHE 4YRLA 5CVEA 1IDN1 2GD1O 4KDRA 4CV3A 5CYFA 5A6VA 4LI0A 1BE8A 4QHSA 4DLPA 3QLUA 1YB6A 1VJSA 5LUBA 1Z2DA 4P2NA 2LGJA 2FPMA 3PRJA 3FDXA 3ZI0A 2QPTA 2ORYA 3T7IA 5GJWC 1WZCA 4Z4VA 1I01A 2ZQ5A 3UCEA 5C5DA 4WINA 4YRPA 5AESA 2O2XA 3Q7IA 3CEAA 5EE0A 1PT9A 4EMBA 4XLHA 1DCKA 1H2BA 3DXFA 4HE6A 5AVTA 1N7IA 1WKVA 4XD2A 3FCXA 3IPLA 2RAFA 4FNOA 5HJ2A 5EFOA 5CFQA 5A9RA 1CZUA 4WEQA 1YVDA 3LT2A 2VJQA 3IHKA 1MA3A 3ROXA 5EJEA 3WL7A 3D26A 4YC7A 3KEWA 5CVUA 5BNWA 5I7EA 3U4AA 2WNIA 1MT3A 1VBKA 3PD1A 4NOJA 4I55B 4BOYA 1NY5A 4TTJA 3W3AD 1VE5A 4JI0B 3BJMA 5E6SB 3OHMA 4EG5A 4YRRA 2A7XA 3QYPA 3LBFA 4EY7A 4O4LA 1VMKA 4WBNB 3AB3A 5IBCA 1TW3A 1B14A 2V7WA 2DE0X 4QYSA 1VJCA 3EPPA 3N0XA 1A8SA 1J2JA 3KKNA 5JS7A 1E1DA 1U1GA 4HN2A 1CUGA 1N2JA 3C3EA 1ADYA 1LW6E 5GZ3A 4A15A 4FFDA 1L1RA 2IEYA 2AN9A 2I6TA 5KDLA 5TXGA 4S1WA 1Y6RA 4QUIA 5A4MS 4GP9A 1DQNA 1Q5PA 1VKRA 3DS8A 4JH0A 4REOA 5K4HA 1YZTA 2C2HA 3QWHA 4NS1A 2ID7A 4Z0TA 1HK7A 1N6HA 3M82A 3S4YA 1MTZA 3AR5A 4UQPA 3MB5A 1JFLA 3GQBA 1BWQA 2C9OA 4Q48A 4RJJA 5K8JB 4RD4A 4LOAA 1R1DA 2VJKA 3FSJX 4DQ0A 2P3MA 2PGDA 1X7YA 4L7QA 3H11B 1NXTA 2AE1A 4YDQA 2CNLA 2YASA 3OQIA 4YELA 1RLOA 5CCDA 5HGXA 3L7LA 4BX9A 2EJVA 2RH9B 4JVOA 4FS8A 1KAQA 5ELXA 3L7AA 2MYPA 3CT6A 4QUKA 5CU7A 1LV8A 3DV0B 5CAEB 5K45A 4HZIA 4HUTA 1K97A 4L4YA 4IYRA 1J2RA 1JKJB 1NVWQ 1HE5A 1NIPA 3TTUA 1U9JA 2JIOA 4DQVA 1CE8B 3CPXA 4QUAA 3TTSA 4CU5A 1T6BY 4G6ZA 1T35A 2O8FB 1JXAA 2WV7A 3KUCA 1IAQA 4O0LA 4P54A 5E7IA 5IJ0B 1ST3A 3HKDB 1ISSA 4K6KA 5B6IA 4R69A 3HM2A 5AVYA 4YGYA 4IXNA 5JTTA 2Q9AA 4HDNA 2XKJE 5KVQA 1JW9B 2AVDA 3L7OA 3R7NA 3RW9A 4OI0A 3PQ6A 3AY7A 2H1LA 2XTJA 4F0JA 1U7PA 1JGTA 1RW4A 3ZVKA 1UBJS 1GLNA 4Y2SA 1IHOA 1WLYA 2HXYA 2GM5A 3BMCA 1YI0A 2QSJA 1QV7A 1HT0A 1BKYA 2V45A 3EIHA 3PVCA 4JUDX 4R1MA 5LKAA 2AD5A 2C4HA 3BRWD 1UQTA 2FMIA 3B6MA 4RH0A 5LKRA 2AFIB 2B21A 1ZK0A 2HJHA 2VATA 5LYJF 3HC7A 521PA 3FIUA 3UAWA 4D1YA 4FMDB 1QB8A 3HWRA 1Q1EA 3RRXA 4W5RA 2C9BA 3OJOA 1IY8A 1HOTA 4R1OA 4ZVLA 1Y3BE 1R4MA 4NAVA 3H2SA 5F1PA 2XCOA 2I7XA 1C3JA 2ORIA 3WAGA 4AWAA 4NHEA 1J20A 3UBMA 1F8YA 1NJ2A 4UUMA 4YVFA 4Z53A 3E2IA 2X0JA 3SF8B 1GRVA 4EJSB 3CVUA 2EKLA 3E9NA 2G09A 3I34X 4UDXX 1XPUA 3EIXA 1U7DA 3RT1A 2AOUB 1JSRA 2N1MA 1QE3A 1Q82D 1Q0QA 1ZMXA 3E3MA 3P2JA 4BO3A 4ER3A 3SJAA 1BGVA 4FSXA 4XJSA 1QYVA 4XX0A 3TJMA 3LA8A 3GDGA 2IYVA 4I50A 1PTJC 3WP1B 3RAGA 3I5AA 4N54A 1RRFA 5LU8A 1FSGA 3I04M 6ADHA 3QY0A 4G97A 2OLJA 3M6AA 3FKQA 4AMVA 8MHTA 3ASTA 3ONEA 5AK3A 4XN0A 1CZHA 4QPNA 4EY6A 1K3UB 1I1NA 3DNFA 3EUFA 1E2KA 1OH6A 4BRSA 3PJRA 4KH1A 1JYSA 1KQPA 4KC0A 1SGWA 3GMSA 4A03A 1FFSA 2NV2B 5JO0A 1QK5A 1SBQA 1J8FA 1QZZA 3GJ0A 4A6EA 1SWWA 2O3SA 1ZI9A 3WISA 1RNLA 3H2HA 1UBGA 2YY5A 3NAGA 5FULA 4X94A 5ES4B 1AMOA 5ICMA 4LZWA 3QUTA 3UBTA 1ZJYA 3MT9A 4DG8A 2NUBA 5F35A 4YJGA 3Q8MA 1Y7TA 3KQMA 5AM4A 1OXSC 1NVEA 5KYUB 3TJZA 3H0CA 3JARA 4Z4TA 4C0QC 3GJQA 5CA0B 3BRCA 3D7LA 3TQOA 1BWRA 4CGYA 3P4UA 2B4TO 3B2NA 2GAFA 4O4HB 3ROEA 3EDQA 4MRPA 2XZPA 4A3SA 1OGIA 4PXYA 2QR2A 3HCCA 1RRPA 1M74A 4B35A 1DJNA 1GL3A 2GN2A 1T24A 2G9RA 2R1UA 3FZNA 3QUQA 4E5YA 1ULZA 5JISA 3S29A 1DJQA 1KL7A 1W75A 2GHTA 2WTXA 5HOEA 4A10A 4RACA 3WGOA 3ZWAA 2AWNA 1ZXLA 2YH2A 2IZ1A 2O2IA 5TEVA 1AQJA 3BD7A 3W9YA 3TJRA 1QP7A 3VPGA 1QV9A 1F17A 1RZRA 3IQXA 1DIRA 1EG7A 1B0AA 3SZLA 3EFOA 3HA3A 4JOQA 1VZ2A 1YJXA 2ACVA 1ZISA 4OKIA 4Y3UA 3WGLA 4B74A 4DIKA 4E21A 2BM1A 1F2VA 1YHYA 4QV2A 2WMYA 3GV0A 4FGWA 2O2SA 3FF1A 1KRHA 1NOIA 2FZVA 1YT5A 3LYLA 4OHOA 4Q9AA 5DYTA 1MGOA 1SIWA 4POAA 3D6VA 1P6XA 2D1SA 3DTVA 3ZKWB 1QM5A 3F7MA 1GARA 5T64A 4N4AA 2QN6A 1N92A 1YE3A 1SK9A 3PDCA 5B7PA 1P18A 1J8YF 1DXYA 1UMKA 3B1VA 1HORA 1QHEA 3HJFA 2VYVA 2Q41A 5K2MA 4BO9A 4AJ1A 2GN4A 1JIKA 1CJVC 3QUBA 1WABA 2H1RA 2GT1A 3FLEA 4XR4A 2CLSA 2XODA 1QPZA 3LQQA 1EWVA 3X1MA 1Z5GA 2WIFA 3NH9A 5CB4F 4XWWA 2PKYX 3VX3A 2AZXA 5K6TA 5DBHX 4NX2A 3D3JA 3D8UA 4LIPD 3LL4A 3NYWA 1EIZA 4S1VA 3K32A 3O92A 4XI9A 5HIMA 2VK1A 4QTTB 2VJIA 1PZHA 1UBCA 2HQSA 2JNWA 4WOCA 4BEBA 4NL4H 2BBTA 5L40A 4DLAA 1KE1A 1PW7A 3L04A 3N8NA 3AF3A 4YR7A 4RPCA 4ZO9A 1C3LA 4HNHA 1RYYA 3DDCA 2DBZA 4E1BA 4XMYA 1XLUA 3KKOA 4MUKA 5IF3A 1O0SA 2PXHA 1I7DA 4MJ3A 4FOOA 5KQMA 2H4XA 3FH0A 3RUCA 1N77A 2R6AA 1ZD8A 2HFKA 2V65A 1LPBB 5AK5A 5AWFC 1N3LA 1UZUA 3CE9A 1BH2A 1P1BA 2P0AA 2ZGVA 1LJLA 3KYCA 1UWCA 4GI2A 4HHEA 1EE9A 4PSUA 3M81A 2JHAA 3M9XA 1E4OA 1KEEB 2OLEA 1T36B 1XJ0A 2AG5A 3QPUA 4RMIA 4ZOAA 4OQZA 3LW7A 1JEQA 4HRXA 4KXLA 1PEYA 4GHWA 4KN8A 1P5FA 3T8YA 4CQMA 2YHIB 2QM8A 2EP5A 2ADOA 3DZKA 4OHFA 3ZDEA 1MB4A 2CNKA 1EFCA 3L8CA 1V47A 3U4DA 1CQIB 2QT9A 2G1JA 2XAAA 5L46A 2I2DA 2X9LA 4P3NA 5AI4A 5COQA 1ZD3A 3Q2IA 4G1UC 5IVDA 3Q7RA 3QF4B 1OPRA 2G5CA 4UNSA 4EFKA 4BFLA 1KDVA 4YYZA 3D8BA 1SHKA 1THMA 3EBOA 4DOMA 3ZWOA 4UM7A 3ZDAA 2A14A 1TAQA 4Q05A 2QZJA 4WOJA 4FQ8A 4HAOA 1E9AA 4BNMA 4OSOA 3OOYA 1N6OA 2QSZA 2WD7B 1JP7A 2N1BA 3PFIA 3TEMA 1WZIA 1ZGBA 3FLBA 4GMGA 1SU7A 3IBFA 3PPIA 4MW6A 5EHIA 4D0GA 3IOCA 3K0EA 4WGFA 3EQ7A 3QFSA 1CFJA 2BFBA 4MP6A 5BUSA 3H5RA 4LF5B 1KRWA 1EAYA 4MP3A 3QTBA 4IDCA 1NJ8A 5FFFA 1L4EA 1WL8A 3J80A 2ZBGA 4RHEA 1CY1A 3T94A 3IMGA 3UA4A 2VTKA 4JELA 4X6YA 3TGLA 2Q1UA 5SZHB 1E0AA 3AL0C 1PLKA 4EGAA 1J0DA 2H5JA 4ZFNA 3GAMA 2ZRPA 5AXCA 1ZX1A 3NAQA 1JAXA 3NG1A 3P9CA 3VGPA 1PEKE 3N3BC 5AW3A 4ZTUB 2WUFA 1WPXA 1RHJA 2YXNA 4Q7LA 4BP3A 4RS4A 5BQ5A 1G98A 1TQ6A 5BWBA 1H69A 4O2RA 2B69A 2Z8XA 4R2JA 1QVRA 2CL7X 1LPMA 1PV2A 4HK4A 4CDNA 5MN6A 3LBYA 1BYUA 5CLLA 1RYDA 3SX4A 4U0JA 4ABYA 3AW8A 3R75A 2XTMA 1MA0A 4CKCA 4DMFA 2OAEA 1KD1D 4PLZA 1CS0A 4LRUA 1GCAA 3M34A 4U63A 2PUDA 3HA5A 4NEGA 3DFKA 3HZOA 2OEPA 3OVMA 4LDZA 3W2IA 1IZ8A 3OQ6A 3ZWNA 2XUKA 1FDRA 1NF9A 3KPWA 4GI7A 4XGQA 5HOQA 3SU8A 2J48A 4MUBA 2XQFA 1RADA 3BHIA 1AGXA 1N2SA 3QVWA 4L9SA 1R9JA 1YRHA 2ZTUA 3NPAA 1XROA 1V4NA 4ZVUA 2QBYB 4QOHA 4ADSG 4EF6A 3SNKA 3Q9NA 1JHRA 3L8HA 5TMDA 3U4CA 1KFJB 2WABA 3WGQA 4YK7A 5ARCA 4TQUS 2Z8ZA 3VR3D 4P7JA 2IDMA 1YBAA 4B85A 2WIAA 3UHAA 1C30B 1KPHA 1I4OA 2I2CA 2W2LA 5ALDA 3GJXC 3WSWA 4GL4A 3IMEA 5LLTA 4Y0NA 1QFSA 2ZEJA 1MB2A 2GZ2A 4WKGA 1K2WA 1DG3A 3NWJA 2GBCA 4F3YA 3BZBA 3HBNA 3ADOA 2NSHA 5BRAA 1RM0A 2FPLA 3MF4A 1FLVA 4IDPA 3WGTA 4F4IA 4D44A 4IOJA 3ZWMA 3KDAA 1DAFA 3PDHA 5BT8A 5LQNA 4HF7A 3GEEA 2MYUA 3H86A 5K3BA 4PSDA 2VYNA 4FS3A 1Y4AE 1R0CA 4IIFA 2CJYA 3EXG2 3REOA 3UK1A 3ZX4A 4CR8A 3ICPA 5HS4A 1Z75A 3AFOA 2F3PA 1V7ZA 4E22A 3L0BA 5AVUA 1CQJB 4RKQA 4WFIA 1QTNA 1UANA 2VJOA 3IH5A 2YQ4A 3DFIA 3O3OB 4CIVA 1KJWA 4EYSA 2O8CA 3GRAA 4RWEA 4YREA 2NO1A 1Q1BA 4ND2A 1XRJA 8AT1A 3FWZA 3KELA 4C6TA 3QPCA 3OF3A 1MEOA 3JQAA 3T9EA 1DWUA 1RJWA 1IIRA 2WDZA 2QEQA 3G2OA 3BFJA 3RC8A 4CZ2A 1CZKA 1XFOA 1JQAA 2D2EA 3USES 3FYTA 5IAGA 3TCKA 3LT1A 5DH9A 5EQJB 1VJ5A 4WXYB 3KYDB 1LH0A 4F4HA 1UBSB 1VRWA 2UAGA 4IJVA 4KFCA 4BJ5A 1SKYB 3OD5A 1X3SA 5KYYA 1H6AA 3ZGVA 3U4MA 3RVPA 1N1DA 1RS0A 2CLDX 3FPPA 2I6SA 3TIGA 3D5QA 1FNCA 1D2EA 4YRFA 4BN5A 5AIAA 2ZBPA 3Q6MA 4KYUA 4EG0A 3PKJA 4YCDA 4E32A 4I3HA 4TYYA 1CEYA 3HCWA 4R54A 3H5AA 2J5XA 4YH1A 3E9ZA 4EL0A 4B33A 1XA3A 1N9GA 3A9RA 1LI5A 3E8XA 3CISA 3EGEA 3KTDA 3PCRB 5B3LA 4OM7A 1JG1A 3DUWA 4KL8S 1VRVA 2BEWA 1KOLA 1K5HA 3AEXA 3NQ41 1R6AA 1NBOA 2YC4C 3B3GA 2HX1A 3OQPA 4JD5A 3AEKA 3FPCA 1L4KA 1QSGA 4I0WB 2PRJA 4LJ5A 3ZY6A 1DRVA 1OFIA 1O97D 2NO4A 3CLTD 3PITA 1REQA 1WX1A 3LVFO 5LWQA 3UKDA 3QVKA 1O08A 1T15A 4W5HA 3N39C 4XORA 4BGVA 2QRJA 2JLVA 2X8JA 1FNSA 1GT6A 4M0MA 2VJJA 2CSUA 4F4DA 3DLHA 1WV1A 2QVXX 5AIBA 2RB4A 4P32A 1BFDA 2N9UA 3HLKA 3V7NA 5JXHA 5IYQA 1P0QA 1T0BA 2Q2WA 3H42B 3N8DA 4BX3A 4BJ6A 2JH3A 4R51A 1KI6A 2YXLA 2AJCA 2CVOA 3EF0A 3EZ6A 4BAGA 5LP6A 1E79D 1ISJA 2X4IA 3AH8A 2GJ8A 2ZPAA 3N6VA 3EC7A 1XYVA 3J7AC 3TS1A 3RF6A 3IR6A 4CTOA 4EO7A 4H7EA 3VC1A 3VPAA 5J2TA 4A16A 3TSCA 1ZIXA 1ZH6A 5T5QA 3LCCA 1GL7A 1JIIA 4IILA 1T1JA 1KI1A 2VWPA 4MQFA 2HHHB 2J85A 2WZQA 2VWGA 4GI3A 1I18A 4LXQA 4BMCA 1YB7A 1O89A 4A0HA 2LKCA 3EGOA 4J16C 4DC1A 1QCDA 2DMRA 2BI7A 3JTEA 1L7RA 4G4GA 1ZL0A 4A0FA 3LKDA 3TE6A 4PGOA 4UD2A 5TPZD 6Q21A 1LU9A 3WL8A 4OTZA 3ZDQA 4H4EA 4BBJA 1KGSA 1NUHA 2OBBA 1X1SA 3TUZC 4DY6A 1N9ZA 2M6KA 1Y48E 4UTVA 1JFFB 1AHPA 5HUQA 3OWXA 1YLOA 2VNHA 1ZD4A 1UUFA 3Q7EA 2PT9A 2YWFA 2VAVA 4NWIA 4RK6A 3DQQA 4MCIA 4WZAA 5DLDA 3DLPX 4DNQA 4A2CA 2OCAA 5JYEA 5KUTA 1CY7A 3PKZA 2IHJA 3ND9A 3TQHA 1QNFA 2ZJBA 4KO2S 1ICEA 1O97C 4ETNA 1USUA 4EW3A 5D3MB 1QHIA 2VDVE 3OEEA 4JROA 2A58A 3ZBUA 3LLUA 1H2YA 1CYDA 1FPMA 1A5BB 3FVWA 1M7HA 1X9GA 2DLNA 1V6CA 1JT2A 2VPXA 2Y6VA 3FKSA 3CF4G 1ECFA 2ETXA 4H7IA 4LHSA 4X8IA 2GVDC 2KHZA 3ZNPA 1Q0HA 4R2XA 4Q0MA 1FVXA 1Y6GA 4QDOA 3Q6NA 1BLIA 2UDPA 1FK8A 4Y9TA 2XGGA 4FFVA 1KXZA 3I2KA 4U9HS 2G4VA 1KFKB 1G0NA 1V9LA 1XU7A 3DWEX 4TTAA 2Q46A 4AMGA 5SV2A 4EW1A 3GAFA 4W63A 3NHMA 2PU5A 4UBNA 4U9IS 1W581 4G2TA 4LRSB 3ROFA 2NPIA 4GZ6A 3RHTA 4E09A 3EODA 2H00A 3FDZA 4MKHA 1J1UA 3ICCA 3HKBB 3OZTA 1J1IA 1W4LA 2B1QA 1A7UA 2WF7A 3I1IA 2XMSA 4J1QA 5DX8A 1FLAA 1JI0A 3OUZA 3T3EA 1EHYA 2VPWA 4S2UA 3O4JA 3WV4A 1DS6A 2R6DA 3X2SA 3BZUA 5AI0A 2P79A 4M8SA 4G4SP 2DT5A 4OIFA 2O5EA 3I28A 4N0DA 4UASA 1LI7A 4Q1DA 5DKFA 3CVVA 3FYHA 1E1QA 1Q15A 4ARZB 5F33A 3LOQA 1IH8A 2ZYDA 3IAUA 2NT4A 2UZIR 3KDPA 1QLHA 4NYIQ 4C7XA 2D2IA 3S81A 3ETEA 3WK7A 3ZD9A 1WOMA 1TM1E 5T6BA 3EEFA 4XOPA 4Q3LA 3EVCA 4IFIA 2A9KA 4JV5B 3REGA 5CK4A 1F0YA 4BHTA 2LXNA 5TJ9A 1K08A 1EVZA 4AVZA 1SXJB 1VCNA 3AJRA 3I3SR 3SQMA 3V48A 1P45A 4FD2A 2IU6A 1GVNB 3DM9B 4JU9A 3GNQA 3K1YA 1WZEA 3H8SA 2Z5VA 4RY9A 1HDZA 1KYQA 4ZZ2A 2QW0X 2D6FA 3GLGA 2Z1MA 2IV3A 1O5IA 5F76A 1L5GB 1BPLA 4KVZA 4JIMA 5EKTA 1I80A 5TF0A 4ZQBA 4BUJA 3FPKA 2DR0A 5FX2A 1D2NA 1GHTA 2HPAA 3SJCA 5BWOA 4DR4B 1I3NA 3ZJ5A 5IWAB 1YK1A 5BN3A 2JLQA 3FFBA 1G9SA 2YWRA 3NWBA 3CRZA 1ULTA 1YQDA 1XOIA 4TRNA 3IEUA 4DCTA 3PFCA 4B17A 5FAKA 3U3RA 3UXYA 3UHJA 5AVRA 1G5PA 3PHLA 1J5XA 1R00A 5IYRA 2DETA 3F5FA 3NEJA 5C1BA 1SD2A 4IKOA 4MWDA 3AR4A 5JJBA 3ENZA 2V7BA 1TI7A 5F7ZA 3TK1A 5KYXB 1RM4A 2JGDB 4O2AB 2DQKA 4RULA 4QL3A 4E4TA 1Z8DA 5F7OA 1BHO1 2XUIA 4YI3A 2SKCA 2KWIA 4JWTA 4IHKA 4XZ3A 1HX7A 2R6CA 4LOKA 1ZRMA 3B7WA 4MYDA 1VQMB 2OAGA 2GYYA 1IONA 4FUQA 3X1DA 4BO6A 3SHTA 4TVKA 3IVXA 1QGAA 1V26A 2WDPA 3ADCA 1YIOA 3P8ZA 5JWOA 4MS3B 4ZODA 1UDRA 3GVJA 2AOTB 4MR8A 5FLYA 5B1HA 3OZEA 1RCFA 3KB6A 4F5DA 4K9DA 2XCSB 4DNOA 1DAIA 1X7XA 1MPXA 1AQUA 2PRSA 4EHAA 5I4BA 3RVBA 4U6NA 5H9VA 4IO1A 4QXRA 4CKYA 4A36A 2W6JA 4PX5A 2ODBA 1ZPDA 1Z6AA 3KHKA 5KX5F 5JRDS 1V71A 1CJTC 3ZYCA 5FBRB 3HXOA 1Y1RA 1EGMB 1FA9A 1JN0A 1HYEA 1AKMA 1UAYA 1PGPA 1V37A 1S8OA 3L07A 4WLEA 5AHKA 3P5BA 3CCMB 5BSUA 3S70A 2HDOA 4QYWA 3SMQA 3K5PA 1OXXK 3VHLB 3EVAA 3RIYA 3ANSA 3F4KA 5EMLA 4C4XA 1E62A 1FCJA 1OZAA 4CCSA 4YXWA 1T2AA 1YJ5A 2BMVA 4G0NA 1QUEA 1M3SA 1YBHA 3A05A 4PLFA 5JBIA 5IYZB 3UKOA 1G20B 1QLWA 1U0TA 3VBCA 3CE6A 2BN4A 1V5FA 2RHWA 2X8WA 2M6LA 3ESDA 3K8YA 3STHA 3R6KA 1II9A 3BRQA 4JUBA 4DLNA 5B58C 2P2YA 2BGJA 4KACA 1D7OA 1CERA 1ULSA 3LX8A 3QMVA 4WD3A 4DYDA 4MYSA 1TGYA 4ML3A 3DTNA 4RVUA 1C7QA 1OX4B 2WJIA 3W5CA 1A2BA 3VKGA 2A33A 3FNFA 4QO7A 1ONPA 3H87A 4Q3DA 3U39A 5FEUA 3OZAA 4HX2A 1VXRA 2ATEA 4ROTA 3W05A 5ER6A 3DOFA 4ETMA 2FP3A 2IW3A 4HQ0A 4BO8A 5C37A 1PT7A 1JLLA 4KIFA 3GIWA 5KQLA 2ZJFA 4R98A 5BO5A 1JEDA 1K4MA 2VF8A 1GQQA 2QWXA 3NBKA 2C3YA 2FX2A 3HXTA 5HKAA 1UXOA 2YW2A 4BLOA 1JH8A 1WUTA 2GBPA 3AIMA 4I8DA 3Q8XB 1YHNA 2BKUA 3OOCA 1G19A 2KLBA 3L46A 5EJ6A 1Q44A 3RC9A 4K9RA 4HGZA 4BNHA 1GZ3A 3W5HA 3O93A 5COBA 1XVAA 5BN4B 1V1RB 1JNYA 1MRZA 4KR7A 2JAWA 1R8XA 2QN1A 1KF0A 3CRRA 2OMKA 2DIEA 3KLMX 2EJBA 5CNKA 5KYVA 1KQFA 4H16A 4H1WA 2VF2A 5IDVA 3HP7A 4KVGA 1DBWA 3DW1X 5AM5A 1QXSA 1KZ9A 1T9GR 1AZLA 1T8UA 2O7RA 4K3UA 5T8KC 3TRFA 4CIWA 3PJFA 3PWKA 5U4XA 1T1GA 4PTZA 1ODIA 1UF9A 3U1VA 1RQXA 3OC0A 2MSLA 4FJ1A 1HNNA 1CQPA 1ELOA 1QQ7A 1VMIA 2QQGA 1C3EA 3I6MA 2QAGB 3PSHA 5JSZA 1XTQA 3N9IA 3WWYA 3R9WA 3NBYC 1G8HA 3GBPA 1T91A 4WY5A 5KWJA 1O96B 1G7TA 3MFYA 1TUEA 4LYYA 4JI2B 3TZBA 4HV4A 2Y1KA 4Y2TA 3RUIA 5AXDA 4U02A 1D6MA 1MP0A 4ZRNA 3WJ2A 5I7FA 2O52A 1P33A 2ZSEA 3D3WB 4EA8A 2RGYA 2Q4EA 3K53A 3PEYA 1FDOA 1G8MA 1L8OA 4AN4A 1B42A 4X0CA 1AGRA 2OCBA 2VDLB 3BVPA 3JCZA 3KJQA 3E7PA 2N0SA 4C06A 5KOHB 5A5EA 4ZC1A 5C4GB 4EUSA 1Q19A 4EGFA 2HBYA 3EB9A 1OREA 4JP8A 4O4IF 4F5EA 5CCEA 3RVKA 2IEBA 5EJ9A 1NL3A 2EFYA 4IGEA 3WFZA 1FNDA 5FBVB 4IGIA 4PGGA 6NULA 3IP6A 4FB5A 2E0IA 2PIDA 4JBNA 3SLRA 6REQB 10MHA 4H1VA 2OGSA 1PG0A 2JI7A 1KMNA 4YBZA 3DZFA 4Q3CA 4G9BA 1JWBB 4H7PA 4PSVA 2OTLB 2BHSA 3I0MA 3M8KA 3PUMA 4DMGA 1XMSA 2OP1A 3AETA 4LOJA 2OGZA 3D3QA 4C87A 2JGIA 3PT9A 4C01A 4RHUA 2BHNA 4JBGA 3NT5A 4PG4A 5CG2A 1J24A 3HXMA 3TSWA 3TZQA 1AB6A 5FI0B 5EZQA 1K6XA 3SDSA 2CZCA 1L7XA 4M9XA 2C9DA 3WLQA 4XPZA 4DCNA 3D1JA 3HY3A 4FXOA 4IEEA 2H1VA 1I6MA 3VNVA 3KP1A 1QYWA 4RZXA 1M2JA 4CFYA 1XMVA 3PUNA 3VSCA 4RENA 4HPWA 4C2TA 3ANNA 3I9V6 3PGKA 4MEAA 4UTNA 1TJYA 1M2WA 2YHBA 3EVDA 4G0UA 3R5KA 4J1NA 5G3YA 4HKTA 4KUHA 3FWKA 4Z86A 1HURA 1Q50A 1Z2OX 5FTKA 4EPTA 1GQOA 5IAAA 4LN1A 2C2YA 1RZRD 4K6GA 1YASA 2QNBA 4HNRA 4S0ZA 2O9JA 5FA8A 5LQMA 2BEUB 4F2GA 3SQDA 3O73A 3CNBA 3QPDA 1E0SA 1TCAA 3QK7A 5CPFA 4EJFA 3M7IA 1Z18A 2GJAA 1WIWA 2C0CA 3OM1A 4MO9A 4OPMA 3S40A 3UAVA 1QC5B 3R7AA 5LQRA 3G2HA 4YQZA 6CHYA 4F3KA 1HMPA 2GB4A 3EAFA 3GVHA 4L4ZA 1O0BA 5DTIA 2V6GA 4RVNA 5EGSA 4WQMA 2KS6A 3A4YA 3TXYA 4QELA 1OI2A 4NDZA 1XZNA 4NP6A 3T7KA 4MH0R 3TOSA 2A5DA 4BKMA 2FUCA 2OBTA 4RH3A 4HYEA 1D3AA 2B1JA 4TTQA 3SFZA 5IPFA 2G76A 5FLEX 1K92A 4UUQA 1X2EA 2OM2A 3UICA 5B57C 3BT7A 3P9KA 4I2VA 3RM3A 3RVJA 3K6SB 3FPFA 2FPUA 1XZGA 4C7BA 3DZGA 3CEPB 4M86A 1R4NA 1KS2A 4P4SB 4D42A 2V7XA 1ZK4A 1WORA 2WF8A 1VHTA 3K16A 5DP1A 2PVSA 1SA0B 1JNXX 2FMHA 4FVTA 3ONDA 2FX3A 3GXBA 5G02A 2BCJQ 3HYSA 4Q02A 5ITWA 4I4LA 2N46A 5JVDB 4M8IA 5DV9A 1II8A 3F97A 4A1FA 4Y2JA 2FXIA 3DTYA 3PR2B 1MIOA 4HE5A 3DM5A 1FBNA 3HNPA 4BLUA 3I8SA 4F06A 1H4QA 1E2EA 2F1JA 3VV2A 4V24A 1R0SA 3LDAA 4MB6A 4M60A 5ALYA 1OBCA 3BTOA 2AXPA 1JHZA 1N5MA 3OHPA 3W6UA 4NQRA 4H7DA 4EL5A 2V3WA 4CKEB 3RVOA 1MAWA 1WSWA 5FWXA 4OPOA 2P5UA 3KB2A 4QBFA 2Y67A 3VDXA 2JI8A 4LZOA 4F93B 1VHWA 5H0IA 5BXYA 4E51A 1B4DA 1ECPA 3BY2A 3C48A 1M8GA 5I9NA 1YJBA 5K20A 2ZS8A 4OQYA 5DJ5A 1KORA 4YAOA 5ARDA 1EXNA 1XHEA 1R2QA 1H5UA 3A1FA 1Y1TA 2V5UA 5C1DA 1ZHOA 1JHOA 4CMEA 1Z7BA 2YOHA 3A70A 5EJAA 5JXWA 2UUBB 3UFXA 1SJ9A 2DSNA 1XMOB 4KJZA 3GRUA 4EIWA 1GAXA 2VXBA 2O19A 2I6XA 1VG9B 3KTOA 2V7VA 1NTOA 2GZSA 3QENA 1EJBA 4NPCA 2BGMA 1Z73A 3JQBC 3K09A 3F6EX 1G42A 5BMVB 2JGJA 3K7EA 4ZU6X 3LQRA 2EIHA 1WV0A 2OSBA 4LV8B 4O0MA 4V02A 3GVKA 5AJUA 4F2PA 1EDOA 4TYQA 1J5PA 2CXHA 3BFVA 3ZHYA 3F5DA 4ID3A 4IDFA 2WD9A 2PLWA 5CB8A 1PS0A 4GGMX 2P9BA 1N6PA 2NZWA 1D1PA 2VTEA 3PEVA 4ZHQB 1Y5NA 2A0UA 2FPRA 3PTZA 4QJ4A 3TLXA 1V1MA 2DPMA 2V74B 4PGMA 5TQ2A 1Z33A 3W5IA 1L5WA 2DUUA 4FU0A 1PJZA 1USIA 1WZ2A 1FDVA 3HVKA 1A82A 2GAIA 2ZQZA 2RAPA 4I7EA 3T41A 4UM5A 1GNTA 1RXEA 721PA 3R5SA 3EWAA 1GZVA 2XVAA 1M90D 1MZVA 2HDHA 4M6WB 4Q3NA 4BO1A 2IBMA 3KOZA 1NKTA 1ZZEA 3B9QA 5CT6A 4H60A 2PRYA 2VN8A 3DTTA 4J75A 5LDGA 2QUHA 5ICGA 2JEOA 2FR8C 2L18A 1E6MA 1NVAA 1PJCA 1ZIPA 3K2QA 4ANFA 1FFBA 2C84A 5KNDA 1OLXA 4O4LF 3AUKA 1YZFA 1ZN9A 3Q85A 1GNVA 4MKFA 1YNSA 4MRVA 3C3BA 4BAUA 4MW1A 1IZ9A 2ZSUA 1QGZA 3IERA 5HEKA 4YUWA 1E6CA 4LX0A 4OHYA 1OBVA 2WUVA 3EMDA 2A1TR 3BCFA 4YLGA 3RUEA 3IODA 4KQHA 1QYRA 3TXAA 2QL6A 2YICA 4DJAA 3J81A 3K2EA 2OQVA 3LBAA 2OV4A 4TMKA 4Z4HA 4ZN6A 1H2RS 1C4XA 2LDXA 2QM7A 1T34A 3RWOA 3TIVA 3MCAA 2C4MA 3H2GA 3PU6A 4Q4DA 5AJTA 4P93A 1QHGA 5IJ9A 4N0PA 2XNDA 3DEYX 1GEEA 1N32B 5JR3A 3ZDBA 2Z09A 3RYIA 4JXXA 1GGEA 2EP8A 1SH7A 3I37X 5FFMA 1GP2A 1Q3KA 3PXAA 1M1NA 1TJNA 2WWVD 3TXXA 1R64A 4HWSA 5JS6A 3N0TA 2VHYA 1ONSA 1ZYUA 5FBHA 2VBFA 3VFDA 3OFSA 3OSUA 4DSTA 5ED4A 1WQ3A 2AYXA 3JQ8A 4B4WA 5AFSA 1ZUWA 3R0XA 1FDIA 3DR5A 4MOWA 2HCBA 5ALTA 3U44A 1EB9A 3RCBA 2H2GA 1V1JA 4ZV7A 4BKQA 1ZUNB 2W2LD 4TMXA 2J6BA 3LX5A 4HWKA 4KPYA 1LPPA 1QJCA 2BBOA 1DEXA 3QSGA 3IRVA 5AH0A 3ILXA 2J07A 2D8AA 5IBPA 2WYUA 1OZFA 1KMQA 3CUKA 1OT3A 4AMBA 5INTA 4WPGA 1IBSA 1TYZA 3JQGA 3DLBA 2WILA 4EQZA 2XRMA 4JP3A 4Z7JA 1XSEA 1Z0KA 2D00A 4AJ4A 4U7FA 1TD9A 2E5FA 3C7TA 3HL0A 3MWJA 2M32A 1RJDA 3O8OA 4U7GA 2O59A 5DCWA 1H4TA 4UJ3A 2VYND 2Q8PA 1EFUA 4YNBA 3QEBZ 1GG5A 1T13A 3OX2A 2CL6X 4LV6A 4TV9A 4EKGA 4CKWA 3K71B 5TVGA 4AQ7A 1N07A 2Z6BD 1ZGHA 4QYIA 3JYNA 4MQLA 1ODJA 5B3JA 3FYUA 1IU9A 4F5WA 2G63A 3GROA 1I5RA 1DUSA 2RG1A 4YLEA 4AY3A 1BCRB 2CFIA 1ZN7A 2WM9B 3ZZ1A 4BE9A 1EQUA 3D4BA 4OYHA 2AFIE 1L1FA 4YRCA 2QQ5A 4KE6A 1PZXA 4MVXA 4RHTA 1MB3A 4I4CA 1QAQA 4Y9RA 3ESXA 3NKVA 4Z4UA 3WYEA 4YPFA 2SCUB 5ALIA 1W44A 4OHMA 3KT6A 4WGGA 2QJTA 4I1UA 4Y7CA 4HPXB 4IXTA 4MWTA 4ZAGA 1IMOA 1XRNA 3LHIA 3PNPA 3AOGA 3RRYA 4HX9A 4I50F 2O2EA 1K7EB 3LUPA 3AZPA 4ASUA 3GCDA 1VQKB 1XD9A 2A9VA 1XTUA 3BXGA 4OXKA 4TWAA 4ZREA 3BWVA 1M6HA 1I2BA 3K9QO 3LDFA 3QA9A 4JJ7A 4EHIA 3O7MA 1L6RA 2AG0A 4QSHA 3GGGA 1Q92A 2GUGA 2FMTA 5LU9A 1XWFA 4NU8X 5KAMA 4M87A 1N78A 1DDOA 2DR3A 3ASPA 2Q7OE 1A9PA 1NQUA 3O91A 2AEEA 4P34A 2FLWA 4D9CA 2IS1A 1Z83A 1RE0A 2A88A 1N4AA 1ES9A 2O4CA 2VF4X 1ISGA 2ZR9A 3UMMA 1HT1E 3AJ9A 2EVWX 1M0SA 2VQ3A 4F8YA 1D0IA 2G08A 1G41A 3PR1A 3AR6A 1SNYA 1AB5A 4YDSA 2BV3A 1RMYA 1E9VA 1Z4JA 4MVJE 3ASUA 4BEJA 1KVUA 3GVLA 2FSVC 2VDQB 4XM2A 5CIQA 4DCSA 4YIKA 1XZLA 1VCIA 1GTZA 1Q0PA 4RU1A 3WLHA 2M1ZA 3HMKA 5BW4A 5K8VA 5L3SB 3IBSA 2NZ2A 5EHGA 1PKEA 5DASA 3KL4A 3PCXA 1HC7A 5KPJA 3I5YA 1WHSA 1YTLA 3AZOA 2HSZA 3VQTA 1NW4A 2QD1A 2P2ZA 3G0DA 2GS9A 2VJYA 3QPWA 2OXIA 1GIAA 2NXCA 3AHIA 5L51A 3TAHA 3X44A 3ZE1B 3D4NA 5C80A 3WLJA 1OYVA 1JG2A 3KZXA 1P4RA 3NV7A 4PLPA 4CMGA 3L6UA 1FLDA 3NT2A 5C1PA 4EB3A 3NHKA 3FNHA 2FR0A 5CR9A 2FUNB 4MRRA 3U6BA 3BMOA 4UZUA 1UC8A 1E3ZA 1TO6A 3CUSA 3M89A 4RY0A 3SBXA 4RMHA 4EI9A 4P6VF 1B7GO 3D6UA 3EIUA 3OX1A 4PG7A 4AF7A 2FUG6 1OW3B 2QMHA 1VSTA 5EKDA 1YDWA 1Z5PA 3PUJA 4YRNA 5EJFA 5E9WA 1P3Y1 1ZSNA 3UC5A 2XSZA 1GL9B 3SX0A 4BWYA 3ISVA 5D5QA 5JH7A 1QAMA 4PSCA 3UMGA 4X8OA 2QRNA 2OO3A 2E55A 4BNNA 4BDTA 4L8JA 1C8LA 1RWNA 3SYNA 3T15A 2AA3A 2BTQB 3OEED 3DAOA 3LUAA 3DH0A 4XSVA 3UAZA 3V4VB 3E9MA 2OP0A 5ESDA 4IWXA 1DTWA 1QHSA 5FJIA 2XNCA 1YCFA 2CFOA 1QYCA 3FKSD 3LHFA 5C8YA 4R7TA 1CUXA 3VR1A 2YZNA 4MYRA 3G23A 2YV1A 3AF1A 4D3XA 5LP6C 2E5LB 2XDWA 3WQRA 4RJTA 2YYAA 4W9NA 3IDSA 2ZU6A 5ALSA 4B3FX 1DKRA 1XNGA 5F7JA 4CR7A 2V1XA 1K6JA 1U9IA 5JPIA 3QFCA 1R4AA 1LK7A 1H8HA 2ZT6A 4E88A 1DC6A 1GKIA 3LQYA 3HJCA 4OGKA 3UH0A 4B47A 2FOLA 3H1FA 3A3NA 5AO9A 1YKGA 4P7GA 5ELMA 4JJFA 3G85A 3OW2B 3IDAA 3QRWA 5CX1A 2H1IA 2CDBA 3C3DA 1NJFA 3H97A 4MR7B 3DJFA 3GT7A 4HFMA 2BZSA 1A1VA 5F4OA 3HDQA 1B1CA 4OH7A 4YXFA 2Q07A 1GCIA 2Q28A 3L4EA 3LP5A 3R5XA 4MI3A 4B87A 2J0SA 1IB6A 1T25A 1FF9A 2IOYA 3NBAA 2AOXA 4R5HA 5EHNA 1HEYA 2GVZC 4DLZA 5KOIA 1AN0A 4URVR 3WIUA 4B1FA 3IEPA 3HABA 1M73E 3WKDA 4PNZA 2WJWA 4QPDA 1RCTE 1N7HA 2FQYA 4NHOA 3AKCA 4ZDKA 2CHVA 1E1QD 2B25A 2EBUA 4TKMA 1PVDA 5TQ0A 3RJZA 1V3TA 4H7FA 4PN7A 1UMCB 4UBIA 4WKBA 1TYCA 5T4BA 2HRQA 4B4KA 4YV0A 2R8RA 2DJ5A 2R5WA 3LUCA 2FETA 1ZINA 4OLBA 3KQKA 4FI3F 2H1SA 1KEWA 3ZTWA 5TLSA 3PUHA 2FMFA 5FXMA 3ZCRA 3FFTA 5CXXA 5AKZA 4RA6B 4LE0A 4YUYA 4WL0A 2WY2D 2PGAA 4X61A 3T3DA 3Q1LA 1I14A 2O5CA 5B64A 3AKEA 3RIXA 4P3XA 1TZ2A 3MTBA 3RNLA 4CIDA 5A9SB 3THYB 1HDRA 2H0AA 4AJIA 1T6YA 3EHEA 1JDJA 1TC1A 2P7HA 4JYBA 3F9IA 4WZBA 3P0EA 3TFQA 3SHWA 4MLDA 3BXPA 3KT3A 1VA5A 1ZA1A 4NLLA 3RROA 2CHGA 2QRZA 2PFGA 2R65A 4JWKA 3T1VA 4D46A 3OTOB 1LTHR 1C1HA 2EWWA 4I6EA 1X7GA 1Y1PA 2X41A 3EDYA 4MVYA 4JENA 1Y4DE 1E2JA 4WJZA 1XDBA 3T4UA 2RGBA 4RSGA 2BEKA 3VPCA 5JPDA 2VK2A 3KNZA 1RI3A 3IIIA 4CKBB 1L7MA 1KETA 2PKWA 3DVAB 4CCWA 1ENPA 3TKAA 2QUAA 3LIIA 5CJJA 4QDTA 4F1KA 2FW8A 3NBZC 3ZIAA 3KXPA 3ONNA 1PHRA 5T3YA 1ZIYA 3HKCA 2JFHA 2G72A 1TAGA 4Q4AA 3BSSA 2OBYA 1UJCA 4NOLA 2G9VA 5J23A 4DRXA 2F3TA 3C0KA 4B7XA 2OR3A 4ZJPA 1E1MA 1QZTA 1VBNA 2R11A 1AHHA 2R4QA 1O77A 4P4GA 1K28D 1MCZA 1GZUA 5HE9A 1Z2AA 2GXQA 1YUMA 3K15A 4D5GA 2F43A 4B81A 1K4KA 4XARA 1IHDA 1RJFA 2OHFA 3F3MA 3I5UA 2R4UA 4YV7A 3B3JA 5JCXA 2I7DA 3L7DA 1A27A 4OU5A 5IKXA 2GDJA 4AP5A 3ZHQA 1XK7A 3EIFA 3VDMA 3W5DA 2VRWA 1PZNA 2UVPA 1YI1A 1O9HA 2IZ6A 4NARA 4D9MA 2OHHA 1CIJA 4HLNA 4RYLA 4DRZA 4JSRA 3Q3CA 1D7AA 1OYOA 4XGKA 2K2QB 3K4HA 5DLPA 3W4KA 1T5LA 2W6JD 2QX9A 1Z5WA 2O2YA 3KXIA 4I3FA 2AMVA 4MUHA 1GITA 4NBTA 1YB1A 3GOHA 4Q5IA 3TLGB 3T53B 4OFWA 1IN1A 1PTKA 4N6GA 4EEZA 4B3XA 2XYHA 4Z1OA 2FW7A 3RUPA 2H51A 4IHJF 5GQSA 1Q7TA 4UATA 1WMSA 2OHOA 2VJPA 4DA6A 2MMGA 2NG1A 2YFKA 1I13A 4X44A 4GZMA 4ITRC 1SEVA 3SS7X 4DNXA 4YXWD 4GQIA 1SVIA 3AMVA 2CNNA 4TQ9A 4PYMA 2QSYA 4GSLA 1BIFA 2A92A 4FZVA 3OPXA 4K9SA 4S35A 3QKSA 4A0GA 1OTXA 3IPCA 1CY6A 4J90A 3D7SA 1UBLS 3LTNC 4E5VA 3DOCA 3HCAA 1YJWB 3PNBA 1XHFA 2EL7A 1V5VA 4J0GA 5EC8A 3TPCA 3ENKA 4MMXB 2PZMA 2XECA 4TSFA 5KNBA 3SY8A 3JZDA 1T4GA 4MTCA 5CB4B 3RHFA 4PZYA 3QOFA 4US2R 4LFBB 3OLCX 2LIVA 3HSSA 3D4PA 4AN0A 4YAFA 3DMYA 1OU4A 2K7FA 3IB3A 4DR2B 2HIHA 2GEBA 3I64A 4D9EA 5EUMA 5F1OA 3LXRA 1YD7A 4JAVC 3KJGA 4KPFC 1QRDA 5KQGA 1KKUA 4DPLA 5EMNA 5L7WA 5B55A 4IVPA 3BG5A 2IC5A 4ZDWA 2CW5A 1VDMA 3EAGA 1WXQA 2OGWA 4R68A 1RI2A 2CRVA 4G6IA 1SU6A 3I1JA 4KYTA 1MZPA 5AM0A 1EK0A 4WN9B 4DXAA 2DCUA 1OH8A 5CHEA 2NAFA 1N0UA 2B82A 1J8QA 4JYPA 2GO1A 2VDRB 5KDOA 1FSPA 4Z4EA 3C45A 2Q6IA 4MI9A 2NUPA 3BOSA 3KSMA 2YWHA 1UC4B 3SHOA 4UAUA 3CCFA 4A5SA 1U2QA 3LJKA 4RABA 1C5KA 1JSXA 1VQ8B 2ZBRA 2PZ8A 2YDXA 2KQUA 4LZJA 3A0UA 2PR2A 1JXOA 1GG8A 1F8XA 4JITA 5EWJA 2ZYSA 5SY9A 1WD7A 1IFXA 2O6LA 4LFCB 1Y8QA 2XMQA 1I3MA 3T56B 2X8BA 1SAYA 1Z2EA 3QXGA 4HTFB 5IHXA 1SKYE 3L0ZA 2X9VA 3KK0A 1FFGA 4XLCA 1B41A 3CJTA 3DP7A 4FFOA 4GKJB 1MRNA 1MV5A 4MXDA 1FP2A 2EJCA 3CTMA 4GGOA 3VUFA 5L6LB 4YAIA 3PX7A 2D4AA 2HV9A 3RQSA 1IM8A 2ORVA 5BUCA 4X8HA 5IW8A 5FJJA 3ESCA 3NB0A 3V7UA 1ZVQA 2BELA 2GSDA 2BGIA 3HFJA 3OLVA 1KDOA 5IBRA 4YYEA 4KLZA 5GV8A 4RZQA 1KYXA 4RF4A 1OH5A 5AKGA 3F6BX 1WB9A 2WE8A 1YMQA 4ZA2A 4LC0A 3UKJA 3WKCA 7REQB 3G79A 2VBSA 4BE7B 2DERA 4UU0A 1E18A 4QM7A 1QRRA 1RXUA 3RPEA 2WKWA 5J35A 4FW9A 4G0OA 3REQB 2G83A 1VB5A 5CB6A 1Y80A 3FOFC 2FH5B 4OBWA 4X5OA 3HDVA 1O57A 5CT9A 3PC8A 1K9MD 2Q4TA 2QT0A 4OOEA 4BVAA 4LYGA 1SQFA 3RUHA 1XKQA 2D7CA 1KY5A 2RJ3A 1RQPA 4BLPA 5TRDA 1VGQA 2Z6AA 3PUYA 2HAEA 1EFHA 2KPOA 2PCLA 2Y77A 4IXWA 4J07A 4KQKA 1C2YA 3LPNA 5J2TF 4FYIA 1PFKA 5E6SA 3ISXA 2J3LA 2Q6LA 5AICA 4F60A 4F8JA 1BVRA 1S2MA 4Q9LA 1XEXB 4V0OA 3QBEA 5L7TA 2C2MA 4NZMA 2D3TA 1UC9A 5I4IA 3D2LA 3L1KA 3M49A 4ITUA 1BDJA 2YWEA 2J5RA 5A7GA 1XLTA 3LG2A 1C0EA 4F91B 3PZRA 1WJGA 1OV4A 1THZA 4JK3A 1AKQA 3RK4A 4DNFA 1Q2XA 3TOZA 3GA7A 1Y7PA 3EDMA 1WUJS 1G7CA 2F64A 3WMXA 3BL5A 2Q8NA 3CCBA 2ACWA 4FE3A 2ZULA 5C7LO 3WBFA 4CM4B 3Q0IA 5K05A 2HRZA 3Q6RA 4V0QA 5DU2A 3S6JA 4ZI7A 2BHTA 1XDDA 3R3ZA 4KMSA 1LNSA 2GI4A 2P1DA 3C87A 3OT1A 3WWZA 1XZEA 5JRZA 1G4AE 2J0EA 1LNZA 3B6EA 5AUOB 5F21A 4K9KA 3A9UA 3QVGA 4JMLA 2FY8A 3VR2A 1Z22A 2YZ7A 3M9WA 3H11A 2I78A 5JQGB 2QVYX 4ATNA 3DDSA 1E4VA 4L9RA 2A8YA 5DTMA 4ZV4A 4EJ2A 3O9VA 1EVYA 1NUTA 3CINA 1ZC4A 4PAOA 5EI5A 2WNSA 3HFRA 4QYTA 2GASA 5I7OA 1XZQA 1PEDA 2FUG1 3DV0A 4PV7A 5CAEA 1ZD5A 2PV7A 3RSHA 4P35A 3TIIA 1U0EA 1JKJA 1VSVA 2AJ8A 4P0TA 3IQIX 3LBIA 1MB0A 3GIDA 3RYCB 2M2IA 3GWGA 3UWKA 4AICA 1CE8A 1EM6A 4I14A 3AO0B 4O2BA 3JAKB 2O8FA 3M6VA 1PFUA 1UPCA 2VAMA 4W8HA 4EYKA 4AFNA 2BDUA 5BSEA 3RADC 2FN7A 1D03A 3HKDA 4NE9A 3X1YA 1MORA 2X1LA 4DIFA 5AI5A 4JLPA 3R3UA 5G40A 1OE0A 3I01A 4GLOA 4XM1A 2HQBA 2F8TA 3K6RA 4R9SA 1CY0A 3HWSA 4QQNA 2BBWA 3SSNA 1T2DA 1KK3A 3K9WA 3PFWO 4KGZA 4Y2HA 3S2ZA 5C34B 4TROA 3C5WP 2V0CA 3KVYA 4DWOA 4PANA 4EVIA 4R3UC 3ORFA 2AFIA 4NCXA 1FS4A 5B36A 5BR8B 2Z9BA 4KQWA 4MW7A 2Q3FA 3NP7A 1FOEB 2J9FA 1PR6A 1WHTA 3RC7A 2WKSA 2JFPA 3SM3A 4DV5B 3NGLA 3UAGA 2FCAA 5HJ5A 1M0EA 1YE5A 4DFDA 1CB7A 1KDTA 2ZBUA 2A4MA 2VQSA 3HWWA 5IP5A 4B6RA 3ME5A 1V95A 1E92A 3CW2A 3Q1KA 2EF0A 1VIYA 5CVJA 1U6IA 1T4BA 3SXUB 1ADCA 3TYXA 4YJ3B 1OXVA 3ZXXA 1IEQA 1O03A 1E5XA 2AOUA 4BBAA 4BVFA 3Q11A 5MFZA 2DFDA 1KJQA 5HBGA 1UEXC 4JVNA 4P31A 1E7RA 2KB0A 3ET5A 2VDJA 3LYUA 2W2PA 2VYCA 4CQNA 3ZWKA 5KW9A 1LDBA 1SXJE 1UJMA 3B3AA 5DN9A 3ZOZA 2PT7A 4OX9Y 4NE2A 3WDKA 1TVEA 3SYLA 4HO1X 1YFLA 3A36A 1ADJA 4EF4A 5M7EA 2OB2A 1XF1A 4GQNA 2W90A 4TXLA 3B8HA 2B2CA 1FFEA 5G4LA 2IUEA 4MVJA 1VKOA 3DPUA 3KWLA 3OWHA 3CNLA 2QIOA 4DBZA 5KVAA 5DMXA 1FB5A 4DQXA 4YP5A 1XTRA 2RHMA 5BQXA 3CKMA 1HE1C 1WTCA 1C9NA 2MWMA 2PDAA 4JBYA 4GZ3A 4AF6A 5KYUA 4XUEA 9ABPA 4OHWA 4X7FA 1COZA 4KXXA 3FCYA 5CA0A 3M4JA 4GOMD 4NCKA 1JKFA 3SEJA 3NASA 4FFMA 4NDAA 3QVSA 3PQ7A 1VJTA 2XJ4A 3WP0A 2R85A 2VXOA 2CLIB 2DBVO 4O4HA 2CWWA 3O0DA 4Q7JB 3N07A 3ROKA 3QWAA 5SYMA 1YI2B 3AQ4A 2Q99A 1QHFA 1Y6JA 1E3XA 3TB4A 1AURA 3RC3A 1UC5B 5DGTA 5F9HA 3EG5A 2I66A 3KCQA 1TPZA 4IIBA 3ILVA 2NYAA 4YRMA 3W78A 5ALRA 4BZWA 2ZJYA 4EFNA 2OM6A 5C81A 4OJMX 2VZLA 2IYFA 3E9YA 5CNIA 2PE5A 1E5TA 2P6OA 3O94A 2NU9B 1QIJA 4BNTA 1KI7A 1BDIA 3CNOA 4B4UA 3LCVB 3RD5A 3JZMA 5HIIA 3K09C 4Z0HO 1QO0A 3TO5A 1TCBA 2J31A 2F7SA 1T8WA 4YMVA 4BL5A 2ZT7A 1H2AS 5JC1A 4ZK2A 2CBXA 4TM7A 1X7ZB 4OQXA 2XNDD 3WLPA 5IKPA 1NVBA 4CHTA 4C9BA 3K6KA 1X0VA 2MYTA 3VC7A 4FFNA 1YS2X 5E7MA 1MF7A 3ESBA 5JARA 4LGMA 2G88A 2OAP1 3K2IA 1RYHA 1NYQA 3NRCA 1BXGA 3QEOA 4EO9A 1J25A 4N3AA 3C8HA 5DT2A 4DHEA 3LW8A 2EL9A 1Q17A 3CG0A 4HDOB 3L93A 3U7GA 4IEFB 2Q5EA 1VLYA 2PPVA 2QD2A 5HGJA 1BXRB 1HA3A 1U4NA 1OFVA 2OILA 3L4BC 1NMSA 1G20E 2R5NA 4FYWA 3K0AA 1EX9A 1FTNA 4LNAA 4WCFB 3T9DA 1IPFA 2G70A 4W5QA 4XIFA 4UTPA 1JEAA 1TM4E 3HB7A 1X1DA 1GZ4A 2I8CA 4HB0A 3FWPA 1RPZA 2CL0X 3VMMA 1WOOA 3ZHTA 3OP1A 2X86A 1SZJG 2ZKIA 3SM9A 3VGJA 2X3UA 5JASA 2NYVA 2YMMA 1UBFA 5DNWA 3T5DA 4KOEC 2EBFX 2R00C 1S3SA 4PXSA 4JC5A 3BWXA 1X14A 1SZDA 4BX0A 3BY1A 4M1OA 4V39A 2L17A 1MX5A 3OM8A 1SBTA 2OZPA 2QP3A 2ZRCA 4KZPA 5GY7A 3CB2A 5D7BA 3PWTA 4EJ0A 2VH5R 4D4KA 3ODGA 2HMUA 5IH3A 3TCXB 3GJZA 1KJJA 1VIAA 2MOKA 1UZLA 2WC1A 1ZMTA 2MCFA 4L0CA 4NJMB 1R0WA 1E99A 3MXTA 4ZVRA 2H07A 2L69A 2P9HA 4P6YA 1N2IA 3GB9A 4LYFA 4Z9YA 4R16A 2YHIA 4IVRA 1DFHA 2X6XA 4ARBA 5IJWA 2R3SA 2B7LA 4YMUA 3QE0A 1AK9A 4RYDA 2JBAB 1F6WA 4X1KB 3NVMB 3HY6A 5BPHA 4XA8A 1JAIA 1KVSA 4LZPA 1FVOA 2GK4A 1UT5A 2RAUA 4J0IA 3QF4A 4RK1A 4E2WA 3O95A 5AHOA 1NBAA 4IDHA 1G8GA 4HYYA 4EABA 5LP1A 3ZZNA 1EA5A 2Y9PB 2WHRA 5HKLA 4ENPA 4TGLA 4FZRA 2OBXA 3O26A 1PS9A 3SYRA 4WCDA 3WLEA 4CM9A 2AV6A 1RLMA 4RXTA 3T7SA 5M2QA 1AO0A 2WJZB 1B26A 3KR0A 4MHOA 1KQNA 5T4HA 1MQ9A 3H4MA 2EW2A 5GJCA 4ASUD 4N7BA 1XL0A 3UWDA 1B74A 3NALA 5G3ZA 1N08A 2CYCA 1B1AA 1XZFA 3Q5GA 2WZNA 4QQ8A 4CUJA 5IT4A 1CXZA 1E94E 3CTPA 4PPQA 2HRBA 4C3ZA 4CLRB 1NG1A 5AUPB 4D9FA 3QWFA 4MUEA 1AA9A 4PBRA 3ZDFA 4GFDA 4ZYWA 2VUTA 1XNRB 4Q6WA 2ZKLA 4H7JA 2NO7A 2OECA 3RGWS 5LD2C 1DELA 2GUWA 1EVIA 4NZOA 1NSYA 1QYXA 3AOEC 4K8RB 4K9QA 4OJYA 3PG5A 4RFSB 2O8BA 3H05A 2ZIZA 3R7WB 1XFAA 2GDZA 3CX6A 4RGBA 1P7PA 3W6PA 1K88A 3WLMA 4EAQA 3UQYS 1UK6A 1PWYE 1QU2A 4WCVA 2EGHA 4XWAA 1X3LA 4M1WA 2WFMA 4O1MA 3RT9A 3W7AA 4L51A 4RWZA 4Q3OA 3K0KA 2WTAA 1WDLA 4TOIA 3CPHA 2C2BA 4AJEA 3TRJA 2EARA 5TR9A 2AEMA 2EXXA 2V9ZA 1AGYA 1XZAA 2HK7A 3CT4A 3AHCA 2I5PO 2Z2XA 3EEBA 3QM1A 4I19A 4NEHB 1OLUB 5KU1A 1HQDA 2WG0A 4OEHA 3HADA 1U7XA 4QBTA 5EQDA 1TZCA 5G2OA 2TS1A 3RS0A 2BL4A 5HZHA 3T0IA 1J0XO 4OXNA 1EFLA 2O6HA 3I6IA 1UKVY 3NBUA 1JV2B 3HDYA 3NC4A 4L15A 4OOXA 2FPSA 1I7QB 5EIEA 4LMRA 1P4JA 3V1NA 5FYDA 3G0BA 3IDFA 3F7NA 2DG2A 3NNDA 4JI6B 2J3HA 4OQPA 4AUMA 4NMWA 2XSZD 1Z37A 2Q0HA 3QVLA 4E0FA 3SIRA 2QGGA 3QU9A 1Q1ZA 5KYGA 3RJ9A 1NP7A 2FZKA 2WE7A 3QBTA 4RZSA 5JMOA 1O0CA 1QIKA 3UMYA 4DQKA 4UEQA 4RVOA 4RKFA 5FB3A 1V9SA 3GHYA 1RLIA 5EJ4A 2DPLA 3DYVA 4R7ZA 1GPBA 3B85A 2ATVA 4JLVA 4UHCA 3GP3A 4PZ0A 3NBXX 3QE9Y 4BQNA 4PHHA 4R1SA 3NXKA 2EDAA 1ACJA 1CX9B 3B9BA 1W36D 3L0PA 2FWMX 5KSYA 1MH1A 3LCJA 2BGWA 1DCFA 1XXLA 5LQDA 2FRDC 1ESEA 2F8LA 3PNMA 1AUVA 4QEKA 4BATA 4ZKDA 1H8HD 3IO3A 3QOXA 1GU1A 1CQJA 1R9NA 5DFAA 1V0JA 4Z4CA 2H4HA 3T1TA 2E1BA 2AKAB 3KFXA 5E1BA 3PHHA 4TMZA 1U8FO 3DE1X 3KO8A 1NBEA 1NE2A 3JQDA 4ND7A 2ZLBA 1SVLA 3AFMA 3M3DA 1UM8A 3O9ZA 4E4RA 1NYRA 2XMDA 5JS2A 5KU7A 1UMDB 4CF6A 1J97A 3GZNB 4G25A 1NBIA 2QZZA 4L5BA 4OMFG 4LJ7A 4D6XA 3KYDA 2OGUA 3NW9A 3PPVA 3ANMA 5EHZA 2AMFA 3EQZA 3MOSA 1ZM9A 1AKWA 1Z8HA 2E3JA 1OFTA 5A5VA 1JU3A 3M6IA 2HIGA 1WNTA 3CH5A 3QMWA 3QVVA 5AVQA 3HDGA 1KU0A 1CUIA 1DX6A 2H65A 4BUCA 4G5OA 3LPLA 4UHEA 4H9GA 5FI5A 2IWRA 2X1VA 2OO5A 2AF4C 1KR2A 1FXWA 2YMLA 3CSDA 3MQ2A 2CJWB 3CTAA 2J59A 1NW9B 5HQ3B 1O95A 3CCQB 2QG6A 3ICVA 4ONEA 3VPFA 4YI5A 3WZMA 1CU1A 1V5IA 3RU7A 1N6LA 2OFXA 1PG5A 3BWYA 1LVHA 4JOSA 3W9BA 4EY5A 4QZVA 4W9NC 2W48A 1QOPB 4QDJA 1ZJWA 3L7CA 1NM5C 2ABWA 4DCGA 5HZMA 5EJ7A 2EJWA 2HBQA 4O4IB 3UM9A 1U0HC 2ZR8A 5DX0A 5KNCA 4IIHA 3QFFA 3JQ9C 3LAWA 3E2MA 1RPAA 1F0PA 4Q4LA 1ZLYA 5FWXB 5JT1A 2CV0A 3BIFA 2EYQA 3DAPA 2EQAA 4UVEA 3ZWCA 5GM1A 4K28A 2CMFA 1ZWKA 2PUVA 2QTLA 4RETA 1DCTA 3ZCXA 4RSMA 4W9RA 4M0EA 1L1QA 2CLLB 3EXHC 4K6CA 3ZIAD 1IHXA 1U2GA 1T8YA 2C29D 3RF7A 2C83A 1J7JA 4ZOBA 2YZKA 2QAIA 2WJGA 3QELB 2F3SA 3AB7A 4J0QA 1TF7A 4BNXA 1FS6A 1ZVMA 2H7XA 2H5LA 4DA4A 1WMBA 2ZRIA 3GDHA 2UZ4A 2H2AA 4M0FA 4KXWA 1U28A 4QPZA 1UWKA 1ECJA 4H1HA 3L8DA 2CK3A 4LPKA 3UUFA 3KPVA 2I1VB 3ADPA 3PIIA 3FWHA 1KJZA 4NENB 2Y9MB 2E89A 3S5UA 1XRQA 2J3EA 3UG6A 1ORTA 5GONB 4FKMA 2ZJ3A 1XJ5A 5F4BA 1Y4ZA 1QVGB 5DCUA 2F3QA 4WXRA 5IXJA 3F49S 3NWOA 3A1SA 3AWDA 3K20A 3L1HA 4OMUA 3OOJA 4OHKA 3ZE7A 5LYYA 3EZNA 4JLKA 3JU4A 2QUBA 4L3OA 4D9GA 1M2FA 1DJOA 4GVPA 3L2OB 2ENUA 3JRWA 5DM1A 3GMDA 2Q3BA 1SC6A 3UNXA 4Y6OA 2XMPA 3LUJA 3B7PA 3A2KA 1YU9A 3G7UA 1S1CA 4WHMA 3WJ7A 1AKVA 5I7SA 3C3JA 3ROMA 2V31A 2XV1A 3VC2A 2FPXA 2ZXFA 5DS0A 5ABPA 4NECA 3A9WA 3IRUA 1XD8A 4WASA 3LGSA 1AG9A 5CM8B 2PSHA 4N18A 4MDEA 4P36A 3EUAA 4NQZA 1DBVO 1S9HA 4KP7A 1PWZA 3OZUA 2E4ZA 2OTCA 2XHEA 3A4TA 2JLSA 3PF8A 5EE5B 3NETA 1ID8A 3IE0A 4XH9B 3KVNA 4BFWA 2AGVA 3NI2A 2OC9A 3V5NA 3NHSA 3U4GA 2PBFA 2GD0A 4TSFD 4ZRDA 3NBQA 4RSRA 3L4KA 2C8LA 1PJRA 2VUIB 4O1HA 1Q86D 3VDRA 4GVLA 4R7GA 1ZR4A 5LC1A 3F4BA 3NIWA 3W2EA 1XV5A 1N0IA 2J3IA 4FCVA 1B8PA 1P73A 1EE1A 2JIRA 2O48X 2H4WA 1NHWA 1ZICA 2ZE7A 2ZSFA 1K8AD 2H52A 3EQ2A 4TV9F 1NAIA 1QG4A 2HJWA 3B89A 5HM6A 4KUEA 4X7PA 3UHPA 5TNXA 2C5HA 4G5SA 2PT6A 5IDYA 1JLRA 2VS1A 3H9QA 3Q3GE 4ZEOA 3RWMB 3CCRB 3C3XA 2W37A 2X7HA 4B8WA 2NQTA 4FYHA 4E1AA 1HWYA 4MARA 3A4NA 4LVNA 1AMUA 4ARZA 3V2HA 5L95A 2P8SA 3BD6A 3A6KA 1UL1X 3MINB 3P4YA 5TDHA 4G07A 2ZJ7A 3OECA 5B6PA 3INGA 4BFYA 1I32A 2B37A 5KEIA 1V39A 5FBZA 1XMXA 3O8QB 3WAJA 4OJTA 4PGAA 1YHZA 2HF2A 4DUPA 2V4DA 3TCNA 2XVZA 2NV6A 3DV2A 3IAAA 3PA8A 5JWRA 5LN1A 2GZAA 4V0ME 3B70A 3LOUA 2R62A 4K0KB 5LCXA 2PYDA 1VOTA 2J6CA 2VNAA 4MCHA 1P0FA 2XOXA 1EDEA 3IV9A 4JJ8A 1C7ZA 1PJ2A 2WIBA 1MIHA 2VRBA 3I9OA 1ODLA 3UXEA 4MPJA 1HY3A 2GJ9A 1D1QA 2V7PA 4HG2A 4PZZA 4U6SA 3UJDA 3PXDA 5SYAA 2Z5GA 5CM2Z 1XO1A 4KLAA 3P5SA 2C5LA 1Y0RA 1TYDE 5E95A 1EFKA 2ODEA 5EZSA 3D64A 4ED9A 4PNEA 2ZYWX 4GZ5A 4DR3B 2PVPA 1SRQA 4Y67A 5GV7A 4CRWB 3MSCA 1GKLA 3KZ1E 4MV3A 4BV8A 2E1PA 3BB4A 3QHQA 5FWNA 5ILOA 2YVKA 4DLUA 1DHTA 2CWDA 2XE8A 3B9PA 3UPDA 3I9MA 4ZQGA 4PSKA 4V3CA 1Z4QA 4XVQA 4WZLA 3GL9A 3VNUA 1A0OA 1L7BA 4PYRA 2AK3A 2VJLA 3ZGLA 3P9RA 2A0YA 4M9UA 3E18A 2QNRA 2D0PB 1TU0A 3ESZA 1ZNZA 3P0RA 2DM6A 4X6LA 4YASA 3UWMA 3MD0A 5I4CA 2G67A 1XEWX 1L7DA 2JGEA 2G1PA 2PLRA 3QUSA 4BAZA 1GFIA 3COZA 4JKOA 5ALZA 4D6PA 4RA9B 1J23A 1W29A 4RIGA 5FI3A 3SR3A 4HS9A 4Z7OB 5KS2A 2OZLA 2JK0A 4CW7A 4D26A 2E6UX 3EVTA 4J7UA 3MK31 2AWOA 2W0SA 4RDCA 2DC1A 2Z1NA 4MR9B 3T7JA 2NIPA 4O4LB 1IC6A 2J09A 5JIBA 2AOTA 1T5BA 4EHHA 1LBHA 4CF5A 4CNBA 2ZBQA 4Q3BA 4EKNB 4QJBA 4ZCSA 4DMLA 2Q2QA 3L7BA 4RMJA 4X7RA 4AUNA 3JXEA 3LYAA 1I7LA 3T1NA 3UJ7A 3UHOA 4ZZ3A 1DJLA 4UQLA 5EERA 3IELA 1VE3A 3DQPA 3VR6H 4P0PB 3TOCA 2B94A 2HJVA 2DQSA 3AIIA 3MAAC 3DMFA 4FBGA 621PA 4CIYA 2FVXA 2Q1YA 1QG2A 2X4LA 3U4HA 5CFLA 1E1LA 1R0XA 3K05A 1JJIA 2W4IA 4HFRA 3VH3A 1ENYA 1Q57A 3OU7A 2R6FA 3WL4A 5HKKA 1H0SA 3AJ8A 3WKAA 4MWSA 4AAYA 1YIAA 5IJ0A 5JH7F 2R0QC 3EK2A 2BGKA 4YAEA 2IEIA 1LPAB 3GEDA 3GRCA 5IYZA 3IJRA 1G20A 2QYSA 1X7YB 2BZ1A 2QORA 3BGWA 3VR2D 3VSEA 2HIMA 4RAOA 4WXEA 4AJLA 2H3EA 3AHGA 3RWBA 2ZITA 7ABPA 4CF7A 4D43A 4PIMA 3LVBA 1MEEA 2WU4A 2VTVA 2BHLA 1P74A 1K66A 1TMKA 1LLFA 1ZK1A 1OX4A 2IA5A 3BYZA 3DBHB 3WIVA 1Q21A 1EP1B 1MVOA 1TMOA 5C8YF 2XB4A 4Z4FA 4B48A 3CZ9A 3HCFA 4IHQA 1IZ7A 3WGHA 2VAXA 2AEJA 3FTNA 1AU9A 4HWOA 4F3RA 2GBLA 4C03A 2WFAA 1WO8A 4X7CA 2W83A 1YJAA 1YL6A 3COWA 3GG2A 3IP3A 4HTAA 3MT0A 2ACKA 4EMTA 1SOAA 5EIWA 1EE2A 3ELWA 1EXMA 3HXPA 2MT9A 4XSHA 2DTEA 4ZT5A 1NJ5A 5CLJA 4EPXA 2VWQA 4GM1A 1NATA 1RWBA 3MA0A 4KLCA 1Q7EA 4RQAA 4ZANA 5JCJA 4BNVA 4P12A 3M6FA 2PLFA 4DW8A 5BN4A 4H7HA 4OPSA 3HXQA 3FPHA 2OL4A 3RTCA 1DDGA 2H31A 2GRJA 3PHGA 2PH5A 4D6YA 3KXKA 5IF9A 1CJBA 4JKYA 4KFSA 1V8BA 3AY6A 3I4FA 5FORA 4CCYA 1DHRA 3BNWA 4BC1A 5BSRA 2FZCA 3UW3A 4X92A 3B60A 5DBGA 1J39A 2P78A 4OHCA 4L75A 1ZUHA 2XCTB 4C4YA 4U0KA 1OZGA 4RVCA 1X7WA 3PENA 2I1QA 3DNMA 4D9HA 3BSYA 3OU6A 5CA1B 1Y82A 2RGGA 4H2DA 2DJIA 4BU1A 1T1RA 2VXYA 1AQ6A 3B6KA 3OQ1A 4QTXA 2QAGA 1JALA 2AYZA 2H2DA 1F0NA 1NB9A 1ZDMA 2JFOA 3MQ4A 4MDHA 1RXSA 1O96A 4A27A 3HYRA 4A2PA 1AUPA 3FOZA 1NKSA 5HFAA 1OU0A 3ZEAA 3SKBA 3D3WA 4KE7A 5J3JA 4PFSA 3HBMA 2W6OA 1W5BA 2H11A 1RC1A 2ODWA 5KOHA 4JJZA 5BR7A 1VPEA 3RBVA 3EDRA 3EBLA 1VB3A 4LY9A 5FOVA 4GYYA 3VU8A 4RDJA 3FLMA 4CMAA 4BIMA 2ECKA 2WKQA 3C8MA 3GNTA 1U4SA 3WBJA 2EZ4A 1I33A 1QIMA 2QGZA 3P4XA 3M70A 2ZAIA 3U4IA 4YONB 4EM6A 3H8WA 4GR9A 4HDKA 3ZVMA 1JKXA 2QP9X 4HXGA 5E3JA 4YJFA 4XQEA 3FPGA 1IXKA 2IL1A 2JFXA 3EXIA 3MJDA 3FVTA 5ADUS 3LFTA 4IF4A 4FPXA 1PAUA 4LQCA 4C08A 2C2KA 4REQB 3R9KA 1T9DA 3VI3B 2W6QA 1B8OA 3OWOA 3PEFA 3E8MA 4HAIA 4MVJD 1AO3A 1UH5A 1BOOA 3VZBA 3K0CC 1ZH2A 2IX9A 3R6WA 2O7VA 1MHTA 3OCXA 5D51S 4R2KA 3JARB 3PA1A 1O58A 2HO5A 4MQBA 4EVRA 5HF5A 1FUYB 3W5UA 3LSYA 3CQ9A 1MW8X 1NN1A 3R8CA 3QF7A 1IJBA 4LHXA 1FRVA 1PN3A 1ULBA 4G0PA 1BWPA 1CLUA 3GDWA 4OXRA 4QE3A 3SOPA 1R16A 2NSJA 2VBGA 3KV3O 3GUUA 3TDKA 4HAYA 3CMAB 2A6PA 4EJSC 5AVOA 3SLDA 1GNLA 1HDGO 4R41A 2VHVA 4RIFA 3T9BA 5AW6A 1GAQA 3AG5A 3IPXA 3L7KA 3WKBA 4ITVA 4UNNA 4DCJA 3E4DA 4X85A 3JQRA 3GN2A 3OEHA 2R8EA 3MQFA 4ND8B 4LF4B 1WE2A 3H9UA 5EKSA 4D80A 2BEUA 4M98A 1QO0D 4PPNA 1ESMA 2JA1A 3X2FA 1W5AA 3Q5EA 4LJRA 3OFNA 4FLFA 3I1FA 3QHPA 2GNOA 3IP8A 4Q15A 3RKSA 2Q6TA 4OOVA 4NCJA 2Z08A 3UV6A 3DTVB 1EGVB 4L50A 3TRKA 1KTVA 1HO3A 3SR0A 1H1LA 2HA2A 2B36A 1WCWA 3E5NA 1PRYA 4FIZA 4PVCA 4UCWA 2RSLA 4HDRB 4HNAB 5JZSA 1P8AA 1P9NA 4HGPA 4DIUA 2ISCA 3EDCA 4RGQA 1A2OA 3BFPA 3JQQA 1TADA 2OB1A 2Z04A 3BERA 3CONA 2ZXHA 4F9TA 4ENRA 4A2QA 3OZCA 4JEHA 1RFLA 5AW8A 1QIIA 1SUSA 3LQ2A 1F6BA 1EUCA 1U0OC 4H3HB 3L01A 3HB1A 4AX4A 1SBHA 4GT1A 3K6SA 2XI4A 1EVLA 3FAKA 4P4SA 1TIKA 5HRUA 3OOWA 3A2NA 3U9TA 3OD1A 4MUIA 4YUAA 1SA0A 1G18A 2GLXA 3DEZA 2R8OA 3HKEA 4IXDA 4JC0A 5AK6A 5FUXA 3S2GA 1AQLA 1JB1A 2C5FA 2ZUSA 2ENWA 4QNNA 1PR9A 5F4MA 1C9KA 4J1SA 1U3CA 2VBCA 1JDUA 1HZZC 3K5IA 1E3QA 4JGGA 2QU8A 4H6XA 3OIWA 4L27A 4QSMA 4EDFA 1I4DD 1IE3A 5E0OA 3OF2A 5I47A 3TFOA 1K7XB 1P2TA 1CWUA 4JI7B 1NONA 2BR5A 2CMKA 1A2QA 3LUHA 3Q40A 4X3CA 3LPMA 2DY0A 1HUQA 3IS3A 1WR8A 1M33A 5FEMA 4JI3B 1NQVA 3MD9A 4JKIA 4EVQA 1Z12A 1DIBA 5LFAA 2HHJA 1QQTA 5HXAA 3CJRA 1GLGA 3VVBA 1J56A 4IIGA 1MEJA 2Q9CA 3A28A 5E2AA 2AQHA 5C8ZA 1IJEA 5G1NA 3WRYA 3CMEB 3KOOA 3W5JA 1LV7A 4CQMB 1K86A 4H0FA 4LS3A 2BFAA 2V4UA 3KR1A 3RLFA 4A0QA 3TX2A 4XLAA 1NMZA 2IIQA 2Q27A 3G88A 4Y0AA 5L3RA 4CEHB 4NE7A 1RQGA 4A8JC 3L7NA 1GL6A 1QWOA 1YI8A 2O2ZA 2WQ7A 2FWAA 3K9LA 5L53A 3LH5A 5KNDH 2BMDA 2BGRA 3OM9A 5BMVA 2H1WA 3K0SA 1OZHA 3PNLA 2H5EA 2ZRQA 1B0ZA 4J91A 1I0IA 3GFPA 4TRJA 5TIIA 2YHUA 4DA8A 2YXBA 5CJ2A 1JQ5A 4J6EA 1BJRE 2QZPA 1L4YA 4CM9D 1FSFA 2NOAA 1YL5A 3DP9A 1Z2PX 3U3KA 4GLFA 1N2BA 1ABFA 4AMYA 3STUA 2WF9A 1XXHA 1YBMA 1LX6A 4J2OA 2CV1A 3AW9A 1H4SA 5BNFA 4B3JA 4HGNA 1VJGA 1EX6A 3ZGXA 1KQSB 2CT8A 4DR7B 3OLZA 2KBFA 1W9MA 4WMLA 2PL5A 2BFBB 3SKVA 4PHFA 4EMUA 5D6NA 4BMXA 5JEEA 3T34A 4LW8A 4WRRA 3D54D 3A1DA 4IQ4A 2RC5A 2WI8A 3EULA 3HXLA 2MSNA 4FONA 4P8RA 4M6WA 3S8MA 4AK9A 1XI2A 1WPQA 3WRXC 1YJ9B 2YWCA 3DWIA 2TYSB 4FHDA 3D7MA 1YJNB 2BF7A 2FJPA 2PG3A 3ONYA 1SBCA 1RM3A 3LD9A 3QITA 3AU9A 3VOAA 4Y9DA 4FE7A 5FP0A 2Q0QA 1U0JA 4YQYA 5HUHA 2VL7A 1HDCA 4MGIR 3SAJA 4EGSA 1U5AA 3Q7PA 4KREA 4G24A 4PCUA 5TB5A 3FJYA 1P0CA 2JRCA 1ZK2A 3ML1A 5KIAA 2VKTA 2P41A 5KOJB 1NVKA 3L1IA 1JVBA 4BU0A 2B98A 5ULLA 1DQSA 3FJOA 1M6VB 4N1AA 2HW8A 1Q0TA 1XP8A 3DDOA 3E3LA 5K3CA 2AE2A 2NN3C 4TXJA 4CKCB 3CHYA 4CMIB 2HD4A 3C7CB 4BZPA 5ICEA 1FXUA 4D8WA 1TM7E 2C7VA 2DQZA 3LX4A 4HEHA 1VQ6B 4QEDA 1VQ5B 1NRIA 3UH1A 4WNAB 4M49A 1J90A 4KK3A 4UE6A 4ZI7F 2WQ6A 2O3QA 3MSXA 4C2AA 2VOJA 3KVRA 3D6AA 1RACA 4Z54A 3NAMA 1WP9A 3EOBI 1QIDA 2H92A 1HNXB 5LNK6 1SQSA 2VRNA 3TVYA 3NATA 4MJXA 3L1UA 2XUQA 2GJRA 3ETJA 3GFFA 2WSIA 4IHJB 4YRKA 3ZJTA 5EIBD 4KV7A 1CEQA 4EZEA 2C3PA 1KEPA 2ZZFA 3V7FA 3RTEA 4KUGA 1V35A 4G5GA 1WOSA 1T2CA 5EXXA 5CBKA 4ZICA 3O8BA 3RVSA 2Y8EA 4JQOA 1P91A 3LBHA 4I08A 2ODAA 1PKVA 5ISMA 5AQEA 1OASA 4C1NA 3HYNA 3K73O 1L4NA 3GPDG 4H77A 4O2BF 5GGYA 5JZBA 2H7CA 3B6IA 5HSGA 1SUIA 2UYGA 4IRMA 4Q9IA 4TYMA 1BDHA 1NQAO 3UCXA 5FA5A 2VLIA 3MJTA 1RXWA 4M53A 2G9ZA 5BN5B 3PGXA 4GVXA 4N7MA 2ZIAA 4RDIA 4TRMA 3C1TA 5CDGA 1AZWA 4JBWA 1DO0A 1JHYA 4PQEA 1NZJA