3VO1A

Crystal structure of zea mays leaf ferredoxin-nadp+ reductase ii
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
295
structure length
295
Chain Sequence
SKKQEEGLVTNKYKPKEPYVGRCLLNTRITGDQAPGETWHMVFSTEGEVPYREGQSIGVIADGEDKNGKPHKLRLYSIASSALGDFGDSKTVSLCVKRLVYTNDQGEVVKGVCSNFLCDLKPGAEVKITGPVGKEMLMPKDPNATIIMLATGTGIAPFRSFLWKMFFEEHEDYKYTGLAWLFLGVPTSDTLLYKEELEKMKEMAPDNFRLDFAVSREQTNAAGEKMYIQTRMAEYKEELWELLKKDNTYVYMCGLKGMEKGIDDIMLDLAAKDGINWLDYKKQLKKSEQWNVEVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Ferredoxin
publication title N-terminal structure of maize ferredoxin:NADP+ reductase determines recruitment into different thylakoid membrane complexes
pubmed doi rcsb
source organism Zea mays
total genus 98
structure length 295
sequence length 295
chains with identical sequence B
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2012-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 3vo1A01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 3vo1A02
4EH1A 3WYAA 1SKQA 3FJOA 1BJKA 1FRNA 2VNJA 3MHPA 2HDNB 1KTVA 2EIXA 1ZUNB 1B23P 3G4SB 4ZGNB 1ZM2A 5DSZA 4QHYA 1YJWB 2QDXA 3WBKA 3ES9A 3CW2A 4RCYA 4ZCLA 1BX0A 1DDGA 4R71A 3CD6B 1OB5A 4Q7JB 1EFCA 3ZBUA 3W5HA 3JQRA 1CQXA 5KSWB 1G7TA 1VQPB 3CB4A 1YJNB 1KC8D 2AHOA 3CCUB 4MYTA 4HE6A 4B48A 3AGQA 1BX1A 1CNFA 2C78A 2BF4A 1FNBA 1QGZA 5GV8A 4MYUA 1FNMA 4H9GA 1ZM4A 1QVGB 1UMKA 2QEXB 4YALA 3W5VA 1J9ZA 1N0VC 1FNCA 1QGYA 2BMWA 3B78A 3LRXA 3CXCB 1E64A 1D8TA 3B82A 1D1NA 5JBQA 2XNCA 3AVUA 2BVNA 1AIPA 1VQ5B 5HXBA 1YJ9B 1VQLB 1GVHA 2B5OA 4ZGQB 3WBJA 2ZITA 2HCJB 1R5NA 1ELOA 1EWYA 3E20A 4RD4A 5H5JA 1KK0A 1YIJB 1EFTA 1KQSB 3AVWA 3VMFA 3LYUA 1YHQB 4LBWA 4RD2A 1VQNB 3AVYA 4Y9UA 1XB2A 1FNDA 1W34A 1E63A 1R5OA 4G1BA 1VQ9B 3OJXA 4B3XA 1QH0A 1KK1A 4HE5A 3ZZUA 4LBZA 2YWHA 4DQKA 3P26A 3VO1A 1I7PA 4C43A 1TVCA 4M2LA 3JQPA 3CMAB 4ZV4A 3QFCA 1IB0A 2FX3A 1E62A 2BSAA 5GV7A 4LC0A 2BPOA 1VQMB 5TV2A 2GQFA 4FN5A 2EFGA 3CCJB 3JQQA 4NBSA 4J0QA 5TY0A 3WNBA 4M1KA 4G1VA 1QGAA 4ZCIA 2J7KA 2QA4B 4F7DA 2OK8A 3B8HA 3ZC3A 5EMNA 1TLLA 1VQ8B 4P3YA 4K1XA 4RD1A 3OJWA 2BM0A 3CCSB 3ZZTA 1W35A 5THXA 1G7RA 4TMTA 1EFUA 4PC3A 4TN1A 1Q7YD 3CCQB 3CCVB 1QVFB 3VO2A 4RCZA 1GAQA 3W2IA 2CRVA 1S72B 3OW2B 2BM1A 1YITB 4Y7CA 2VZLA 4IW3B 3W2GA 3CPWB 3CC4B 3WNCA 3OZVA 1TUIA 3WY9A 4DQLA 5H59A 1ZM9A 2BV3A 4P6VF 1GAWA 2YWFA 4YAOA 3CCRB 1DDIA 2X3UA 2QN6A 1WDTA 2OK7A 4C0SA 3CC7B 1Q81D 3CMEB 1G7CA 4ACBA 2PIAA 4B4DA 1W87A 2CNDA 1R5BA 1JJ2B 4AF7A 1CNEA 3LVBA 1EP2B 3MMPA 3U6BA 1K9MD 4RD3A 1EXMA 2RC5A 3G71B 2VNKA 4UAJA 1G7SA 2VYQA 1EP1B 3QSYA 1KJZA 1JB9A 4M4SA 3WXMA 1GO2A 3CCMB 4AC9A 3PENA 3AVVA 1VQKB 1S0UA 5AN9A 2B7CA 1KRHA 3AVXA 2VNIA 2OTJB 4RJLA 4NCNA 4N3GA 4PGOA 1YI2B 3CRZA 2NPFA 3QFTA 1QUEA 4TMZA 4B43A 4G5GA 4RD0A 2DERA 3AVTA 1DG1G 2YWEA 2BGIA 1VQ6B 1QUFA 3CCLB 1Q82D 3J81k 5FA6A 2QTLA 3A1FA 1GR1A 1OGJA 4YAWA 4YHBA 3VNVA 2B7BA 2QMUA 1JNYA 2XEXA 3W2FA 3ZZ0A 4PC2A 2QTZA 4YAUA 1K8AD 1NDHA 2BGJA 2HMAA 4ACAA 3W2EA 4M0LA 4PC1A 4ZCMA 3QFRA 1F20A 1KK3A 1GJRA 3I55B 4PC6A 2D74A 1FRQA 2PLFA 2OTLB 3CC2B 3P27A 3VNUA 1U2RA 1DARA 4TMVA 3U6KA 4M53A 1QFJA 3LO8A 3AGPA 2DETA 1K73D 1JA0A 2DY1A 1IJFA 3I1FA 4QFMA 3QFSA 1IJEA 4U9UA 4RD6A 1FDRA 2C77A 4WQMA 1H42A 3W2HA 1XE1A 1HA3A 1EP3B 1D2EA 1VQOB 1KD1D 2DEUA 2E1RA 1SM4A 1B2RA 1BQEA 1F60A 3OZWA 3ZBTA 1JA1A 4YAFA 3W5UA 1N0UA 2XNJA 5TR9A 1ZM3A 3OZUA 1QFYA 4B47A 1KK2A 1QG0A 4BPRA 3E1YE 1A8PA 4LBVA 1OB2A 4FWTA 1VQ7B 3FPKA 1QFZA 2PMDA 2VNHA 4B44A 3U2QA 4AF6A 3G6EB 1N8RD 3WNDA 1AMOA 2GPJA 1Q86D 4PC7A 2YWGA 1H85A 3MCAA 1QX4A 3I56B 1VQ4B 2R6HA 2BN4A 1W2BB 3V76A 1M90D 1OGIA 2DCUA 1NJID 3QE2A 2RC6A 4N3NA 4LBYA 3SJZA 1M1KD 4TMXA 3CCEB 4FK8A 4Y9RA 1TTTA 4TMWA
chains in the Genus database with same CATH superfamily
2A84A 4LZAA 4W8OA 4GFDA 5J1SB 4MHTA 2W4QA 4NWIA 3V48A 4U7FA 2VAPA 2QTRA 2ZAGA 1II0A 4QUEA 4PXAA 1BJKA 2FRXA 1KFKB 1Z2CA 3E2PA 1OCEA 3E48A 4K1LA 2BR3A 4N5MA 3HCDA 1LK5A 3G2OA 1E2JA 1ZIOA 2Q2OA 4F71A 1IWBB 4UBOA 3HJTA 1PEKE 2AKYA 3L8YA 5TB5A 4LDPA 2OC9A 3RS4A 3X1JA 4RTKA 3DZFA 5CMLA 4D74A 2OESA 3BIXA 4EOGA 3S2IA 5DFAA 1PU2A 1DIGA 3GLHB 1EK0A 3FDIA 1TM1E 3PZBA 2J4DA 4QPNA 3WQBA 3RIGA 1J2EA 2V1UA 1K2WA 2CKDA 4X1YA 1LSSA 3MYYA 2ZWIA 5JMOA 2WPNA 1S2OA 3GT7A 4N7JA 4Q3AA 1JSRA 3DMFA 3ZHUA 1KY2A 1KZHA 3T1HB 2IRWA 4JBYA 3T6KA 5JSUA 5BRNA 3PJRA 4H3KB 2PNJA 4Q4HB 4HATA 1JMKC 1I51A 4G5RA 3A1PA 3DAPA 3R24A 4NK4A 3DTVA 3SZGA 3RAEC 1LPAB 4U02A 1NX9A 1Z25A 2I2XB 3URKA 3VISA 2I9KA 3E3LA 4JC0A 1JAZA 2AHOA 1WKCA 4MYTA 1QXSA 1VMAA 2WMOB 3JQ7B 4MA0A 4KYIB 5GZ6A 4DCPA 3JYOA 5IC4A 3H5IA 5AM3A 1Q3KA 3H5RA 1AE1A 1CT9A 1ID1A 2WHRA 2JFFA 4MCAA 3EGVA 2RBKA 2FSUA 1HOTA 1CNFA 4JUCA 1X70A 4MJ3A 2HPAA 2ZR9A 5DGHA 4NC9A 4CZ2A 1THTA 3O2NA 4AXBA 1H4SA 2C9OA 2UUOA 4OKIA 5CBPB 4BLOA 1ZMBA 1R15A 5JO9A 2WFAA 3HDVA 3TR0A 1GNLA 3AESB 5FNVB 5KNBA 2Q3HA 3MIZA 2P6UA 2A3RA 1WTCA 4B6RA 4B3MB 4E22A 5LZ4A 4FI3C 1EYZA 3PWZA 5G1OA 4RPDA 2QRQA 2DY0A 2ZCVA 5KKAA 3TZCA 2Z83A 2E0IA 1GLVA 3BRQA 1WMBA 2GD2A 5IABA 4KWHA 1Y6GA 1GQ2A 1VCMA 4LOAA 1WOPA 1J20A 3GGOA 1RHQA 2JIPA 3RRMA 2XF8A 3U4HA 5MN5A 2GPWA 2UZIR 1T2CA 1TMYA 3G7NA 1FNCA 4N9QA 2FPPA 3QELB 2DE0X 1V41E 3HHPA 4MGHA 3LWNA 1LDEA 2QM0A 4JYAB 4JLOA 1AQLA 4IJ5A 4A0FA 3DMTC 3UK6A 2XTJA 4A03A 4O2LA 3FWHA 1BYUA 3PXGA 1ZIPA 4UOEA 3PTAA 1QAMA 1NOKA 2I33A 3D8BA 1FP4A 4TUYA 1D8TA 3B82A 4QJ5A 2WA2A 3BK1A 1J7KA 2F17A 1Y4ZA 2XT9A 2PUTA 5F52A 4C0XA 4WD3A 2VBFA 2BVNA 4MKFA 1KSFX 4K28A 1VQ5B 1O4VA 2D00A 2FSSA 2PKWA 4YO8A 2FSIA 4ZAVA 4JLAA 2OO3A 3ITKA 4ZU3A 1U7XA 2ZI3A 2G4CA 5FP0A 1K8RA 5AK5A 2F3RA 4EYOA 2R8ZA 4BMXA 4EG0A 2FPXA 3WLFA 3EY4A 3NGMA 3OZEA 4ZEMA 1D4OA 2IZ0A 1HLPA 3FFXA 3RR2A 5JXHA 4Z4EA 5IJXA 1OGYA 3GZ4A 1Z5PA 2PH7A 2CJXA 1QO0A 3C6BA 3EXEA 2C4HA 1LBEA 2QRHA 2OBTA 4OQ4A 4QUZA 1U5BA 1BXZA 1ZD5A 4A36A 3ZWXA 2OLJA 3I83A 3RSQA 3WMRA 1QHIA 2DPYA 4IOKA 4BMYA 1K8QA 3ZYZA 2WFZA 5FF9A 5AM2A 4E2XA 5LXTF 1ZZEA 3MUFA 5DEIA 3V7WA 4YRDA 2TS1A 3MFQA 1N7IA 1Q17A 3QYJA 1U3DA 4IJQA 5CRIA 3STYA 4C7MA 4W8HA 1E2GA 1L9KA 2ZTSA 4J76A 3ZCTA 4C1BA 1KH2A 1BH6A 1VQNB 4X1OA 3RT1A 3O1LA 2WPDD 2XQFA 2H52A 2VQEB 3PKZA 4AX4A 4KQCA 2H2GA 4OHPA 4QTZA 2IEDA 4U2EA 5AW8A 3D6HA 4KHZA 2WSYB 4NPHA 1KO1A 1RXSA 1FYVA 1JJBA 1M33A 1O54A 2F3PA 3FCYA 2AV6A 4NDNE 4P4GA 3T3PB 1GL9B 4NX2A 4A6XA 3GP8A 4MQBA 1GU7A 1SJ9A 4LHYA 4HE5A 1MOQA 5K8CA 2IXDA 4BGVA 2JJYA 3CNHA 4QDTA 5CJJA 4G67A 1PKVA 3HB0A 4FQ7A 4ES6A 1SVNA 4U2KA 4CIYA 3RSLA 4IFIA 2IW3A 3CMAB 1ORHA 1DXHA 3LGAA 2VDLB 4DQXA 2YKGA 4KNWA 2R7KA 1Z5NA 1NE7A 4DQDA 3KEMA 2E85A 3OESA 5GV7A 3MTBA 4C4SA 1ZD9A 5T57A 4ERNA 5FAXA 3S8YA 3T38A 3BEOA 5TV2A 5TPWB 1NXVA 5HKAA 5AK3A 1E1QA 5HKKA 2M1ZA 2YJ4A 2JKYA 3CF4G 5K0FA 1YBAA 5K05A 1Y5IA 1YK0A 3H1AA 5F4BA 1FQKA 2GMWA 3QA9A 1MCZA 1NG9A 2ZCJA 4KUEA 3L6UA 2BKEA 4QV2A 4N9WA 4LRYA 4LJAA 4OYYA 3S2ZA 4B3DA 3DWIA 2E1PA 4UJ3A 3VHLB 1FY2A 4DW8A 1NXQA 4HUTA 2XVMA 3MPOA 2HIHA 4RXTA 3B8HA 3L8DA 3LPLA 4WN3A 3OM8A 3DXZA 3WLAA 3E8SA 2XUGA 3IQDB 3JD1A 2QTFA 3FBWA 1VIMA 3DT6A 5B1IA 4DQUA 4EKDA 1DCMA 1JR2A 4G63A 2QBYA 1G19A 2FGKA 2LBPA 2ZWVA 2LP4Y 3IMKA 2ZEJA 4HAUA 1O0SA 4MRVA 4PGMA 4WPGA 4H4DA 2VJIA 3NEPX 4LV6A 3ZKWA 1ICEA 4A8JC 4QGSA 4PYLA 3ZCUA 3T54A 1BEZA 4CL0A 3CMMA 4YP9A 4D26A 1JECA 1GRNA 4MGYR 4BNZA 5F5LA 1T6NA 3P32A 4YTEA 2AW3A 4MQMA 1YFKA 1OYWA 1P4RA 1KY5A 3LPDA 5LNK6 3CZ9A 2I8AA 1A8UA 5CB4F 1EXWA 4ZOLB 3UB4A 4ZPJA 3J7TA 2JAHA 3M83A 4LRWA 4FJ0A 5GZ3A 3N6XA 3QPUA 4K6CA 4AULA 3CIFA 5GP1A 3SG0A 3H17A 3T41A 1OH5A 2AE1A 1MXHA 1X19A 2J5BA 3PHGA 1EDDA 1Q77A 3WMWA 3OQOA 3FYUB 3AEXA 3GP5A 3W4KA 2DWUA 3GFBA 1O1YA 1UKBA 2P3LA 3KG2A 4F5YA 1MJGA 1XL1A 2C7BA 2H59A 2R65A 3O8QB 4TKVB 4Y2YA 2PSJA 1GAJA 3ROZA 3UXHA 2PKXA 1Y1TA 4HRYA 5LB4A 1YITB 3QPBA 1TVMA 1YJ5A 1NAIA 1FX0B 2Q0HA 1KZ7B 3D0QA 2V9ZA 2IHVA 2CD7A 3WYDA 4Y1RA 1JHZA 3JR7A 3K9LA 1JQAA 2HPHA 5TQVA 2F00A 2JCYA 4EJSC 1P3Y1 1PR4A 3GQBB 4YJ3F 2C2WA 3FNBA 3GEPA 1H66A 5EKTA 3L4KA 3BIWA 1M1NA 4ZU1X 2ONYA 1HO3A 4OJQA 4PZCA 1KO8A 1G20B 1Z4OA 2BBWA 1AK2A 5CA1B 5KJ1A 1KYZA 3HSYA 4R4JA 4BLTA 1MB0A 2J3IA 1SVSA 1NVFA 2WBLC 4JJIA 2Q3FA 1BMQA 2L82A 2NTEA 2FQWA 4W5RA 2JFOA 4Z8YA 2VUIB 4R84A 1IZ9A 1NI4B 2GBLA 2VWPA 3MCUA 4TKOB 3TUJC 4NAHA 4Y6QA 3J81A 4AF8A 3OW7A 1FDSA 2XSZD 4UUOA 1ZOLA 1T1IA 1HFWA 2A67A 3CKYA 3CMEB 1LFAA 2WICA 3B6ZA 4XWGA 4JB3A 4B81A 1T35A 2WABA 2ZYAA 1C3EA 2QX8A 3NS7A 1ULZA 3EE6A 4PYQA 1V8PA 2I03A 4QAQA 3KZOA 3LAWA 1HLGA 3DR3A 4AF7A 2BKLA 4A2PA 5EIEA 4UBKA 3KSRA 4GAEA 1XK7A 3HQ4O 2Y3IA 3HCFA 1NTRA 2J67A 4RTLA 1N0HA 4E07A 1RXVA 4KQ1A 4Z9FA 3V6LA 2AEEA 3E22B 4L8JA 3EFOA 2GJ8A 1JN0A 2Y1EA 5LQMA 1LLCA 3LX5A 3RDPA 1CG6A 5JJBA 3T0IA 4OUKX 3RRBA 2YJ6A 3EY9A 2QRZA 3KKLA 3AJDA 1TIPA 4TV8B 3X43A 2CFSA 4B3FX 1PL8A 1PWZA 1OTHA 3F71A 3H7AA 1Y82A 4U0KA 4L4ZA 5K3CA 4DIBA 2D2IA 4PPGA 3SYRA 5IYRA 2VCEA 4TWIA 3JWJA 4LZZA 4R31A 2PQ0A 3FPBA 3NTLA 4TL9A 1YQUA 1F0KA 3TSOA 2FOLA 5E7MA 4BNDA 1LPPA 2IY9A 1O9GA 1Z4LA 2D2XA 1WW2A 4DRXB 4W1PA 1M3SA 2ZQYA 1TUBA 2WJVA 2NT3A 1A04A 5A2GA 4RJLA 1GOTA 2YFYA 1QTQA 2FH5B 4KAFA 5AOCA 2H0QA 4CDMA 2C5BA 1AY0A 1WUKS 4PU0A 2WWTA 3E3OA 3HO1A 1AS0A 1MEJA 1QQ5A 4DK1A 3M6IA 3VAZA 4G5GA 1RRMA 3KO8A 3KWMA 4QYSA 4F9FA 3H5LA 1ZCZA 3MJCA 4CTOA 2BGIA 3R40A 1SBCA 3B3AA 1DC7A 3VU1A 3MT8A 1P0FA 1TLTA 2Z9BA 5K4HA 2B4KA 1A71A 2ZP1A 4IS3A 3E2MA 3KLNA 1IY0A 4AVZA 1VSQA 3A10A 5ALNA 5GAJA 5AXCA 3RRZA 3ZY3A 5K8VA 2IYRA 1TM7E 1TF2A 3RPEA 1OWOA 2KMLA 1Z88A 2FMUA 3C5EA 3IQEA 1VXRA 2QLFA 3A9RA 4W5HA 1CE8B 5IAJA 4D9GA 4F4DA 3DEFA 4ESVA 4V3BA 1A0OA 2C29D 4LMBA 4RO0A 5HKBA 2VQ3A 2DVMA 3P5BA 3PDHA 4RIEA 4HLQB 1GEGA 3ZZ0A 3T53B 2X8LA 2ZJ6A 3PUMA 3AUSA 4PAWA 2YZ2A 1LA2A 1WDLA 1C0PA 4HHEA 1W4BA 5C18A 1VGRA 1IIRA 3EQ2A 4Q6BA 1P4SA 1LZLA 4UD2A 5I7HA 4EVRA 1OSNA 2ISCA 2DFNA 4R2JA 2DFPA 3W3ZB 2Z6AA 2WFLA 3LUBA 4GD3Q 3U48A 1YZ3A 1U9IA 4Y1GA 4MS3B 2J32A 1MB2A 3GW8A 3A1WA 4ILEA 3TBKA 2JATA 3O38A 4YQZA 5K9ZA 3F5MA 1VG8A 1LB1B 1SB8A 3EBOA 2BGLA 1XWWA 4NESA 5CVEA 3Q3GE 1VJGA 7REQB 3GMDA 3UWDA 5FO1A 3LO8A 1OMOA 3EC7A 2SCUA 1BW9A 3EF3A 4MB2A 3Q9UA 1D4AA 1K73D 1DC8A 5BN1A 5KWJA 1ORWA 2UZ3A 3WISA 4RHCA 1WXHA 2HRRA 4C07A 3U56A 1CFJA 3SIRA 2X7JA 1U8CB 3QI2A 5LMCA 3E1SA 1IJFA 3I1FA 4DR3B 3B5EA 2QL7A 4Y7DA 3U4QA 1WLSA 4XIGS 4Z53A 3B1VA 4EPTA 4RD6A 1Y1QA 1PGQA 5A62A 1J1ZA 4FHDA 4C4OA 3BFVA 1Y7TA 4OA8A 4X60A 1MIHA 2RAUA 3B38A 5LM3A 3K2BA 4LVOA 1DRWA 4N0DA 2AYZA 4WZAA 2B8EA 2PT9A 5FOXA 4GDMA 2FN8A 1CEQA 1UDBA 3I05A 4KLNA 1NRJB 1ZISA 3U17A 3ZCQA 3I32A 4AWAA 5EWMA 4DM4A 5KDLA 2EYQA 2JIBA 2H06A 4UHBA 4DMCA 4BAGA 1U0GA 3EEYA 1K28D 3V4LA 2OBSA 1UMCA 2Q4BA 3THYB 2ERYA 1MHPA 3QM1A 4GWGA 5ALGA 4DY6A 5JRDS 1AQJA 3MM4A 1NJ2A 4MPRA 2ZL6A 1GTRA 3PHJA 3PQCA 3QSGA 1N08A 1L4MA 1K97A 5T3UA 1RXIA 4AO7A 2VI5A 3W5UA 4BIMA 1A9TA 3L1VA 1ZI6A 4I1YA 4ZAXA 3ZLBA 1I1HA 2QA5A 5BUQA 2VUHB 2VDWB 4BZXA 1PTJA 2BHNA 1R16A 4XLAA 4J0IA 1XWFA 3DZKA 4EHLA 4G01B 1E1DA 3FI9A 1C14A 1CY2A 2O7QA 2P69A 1N2IA 3DL2A 4GL4A 4DRYA 3H65A 2QLBA 2BJVA 1UL1X 2HWUA 1JHQA 4QFDA 3CLTC 3CLUC 2F43A 3VUFA 3UPUA 1ZGCA 1AS2A 1GEEA 2UYHA 1LPOA 1PYOA 4NAUA 5IJ9A 4ZOBA 2GFHA 4Y0NA 4AN4A 2JW5A 3WMGA 3LC0A 2B3DA 5IF3A 1ESCA 1D6JA 4RMIA 4RTRA 5LA6F 2FR8C 4N82A 1WORA 1HDOA 1PQPA 1UK6A 1VKOA 2AOTB 2PSSA 3NAQA 3R5JA 1NXTA 1PFWA 4X7MA 1I01A 5DCWA 2ZVDA 4F21A 5KYYA 5MGBA 1JEYA 5IBPA 3VGPA 1XXHB 3UKOA 3E0XA 3HBJA 1DAPA 2WWGA 1JWBB 4OQQA 4FDUA 4RPGA 4Q3NA 4ZV7A 1Y9DA 2X5XA 3NGLA 2WD7A 4A3SA 3AR4A 3L46A 2G5GX 2ECKA 4DXDA 1RYBA 3W5CA 3TTUA 2P0EA 3I3OA 3M70A 5ERXA 3PRHA 1T8RA 5CM8B 1DAOA 1P5JA 3G0HA 5ITVA 1YB6A 4F0JA 2X0JA 3M3DA 5BXYA 2DCUA 4RADA 3C1OA 5HQTA 3OFNA 1ZLYA 3R5SA 4DWOA 2CMHA 2RC6A 1ND6A 2PLAA 3K5PA 1M8PA 5I4IA 2RJOA 1GCOA 5CLHA 4CG1A 2UUAB 4K9KA 1KRWA 2PL5A 4OFXA 4XN3A 4Y9RA 1ZY2A 4B45A 5EHXA 3HDYA 3S1AB 2CHEA 2ZWPA 1A50B 3MGCA 2QG4A 4TM8A 5HF9A 1BMDA 5ALIA 4EA6A 3K0BA 4PSCA 4DMKA 2BMEA 5FTLA 2FG5A 1NW8A 2NYVA 3PQ4A 1ULBA 2D8AA 3O8CA 5HP4A 3SXUB 3HTXA 1DHRA 4GRIA 2L69A 1A9PA 3OICA 2CVOA 1FRNA 2GARA 1A5SB 4GLBA 3WQHA 4YI3A 3IDFA 4P25A 1A9ZA 4QE3A 1CQWA 3M8KA 1G8AA 1BGVA 2OSVA 2FW6A 4KSCA 5DHSA 5FD8A 1IBKB 1LVHA 1M66A 3BEDA 4HWKA 3DLCA 1V7PC 1Q84A 4BNVA 2HDWA 1MVLA 5THQA 5KTSA 4Q7LA 4JX9A 1O0CA 1JEDA 4L9WA 3N74A 4G09A 1E2UA 1Z2NX 2Y0DA 3NBUA 3U9SA 3NDRA 4C88A 2FJUA 4CV3A 3DL7A 4AKHA 1RZVA 5IVIA 3SS8A 3I5YA 2MSWA 1RLMA 4N18A 2GEUA 3D54D 4TROA 5SZJA 3SEAA 1P19A 5CYGA 5SYMA 3LLCA 1ZPDA 5IH7A 3RARA 3IVRA 2M6KA 3DBOB 2DZDA 3ANSA 1CQXA 5I9BA 3BS4A 4V0RA 4GMGA 3ONUA 1XP8A 1PNVA 4MAFA 4N8DA 3CB4A 1XRQA 1OWLA 1YZLA 2NU6A 4H1VA 3WKDA 3FBTA 4CF5A 1DO2A 3O84A 2PAAA 1TADA 1ZINA 4QOJA 4ENVA 3MWEA 1A9YA 2L17A 2WSIA 1HR0B 1CLUA 2OBBA 3COPA 4DA7A 3DMPA 4IHAA 3NBFA 4MVJI 1ZGHA 3EUEA 3U16A 3HVKA 3HVUA 1VLQA 1Z4PX 3CRQA 4IINA 2PKCA 3AGQA 1WNTA 4P2BA 4NBTA 3DEHA 4AZ3B 1Q7TA 1P4AA 1JG3A 2VJKA 1FNBA 1RTTA 4WBNF 1ZVVA 4UFOA 3SBOA 4NVRA 4Z4UA 1TT7A 4BASA 5BR7A 3N53A 1W88A 1BIFA 4FLMA 4MKHA 4MR9A 2QMQA 1QVGB 3AIKA 1YI1A 1GL6A 4JLUA 4MVJM 2YFKA 1XZBA 5JZ9A 1QOPB 1T5HX 1K86A 2P1ZA 3HSSA 4IIEA 5ALWA 2FWIA 4EJFA 3L0YA 2XRZA 4JC4A 3UK2A 5KVCA 5GINE 1RJ9B 4FOTA 4MI9A 2ZXUA 1BDHA 3GT4A 4NYJR 4P08A 1UEJA 2CUNA 1ZRMA 1U1IA 2FZWA 4HXYA 1ZVQA 4IL5A 4TYPA 4RMGA 9LDBA 3VJKA 1IRXA 4BQQA 4ZMBA 2O8FB 2YWRA 4FU0A 4PRLA 2WJYA 4MVJE 1ZN8A 4NBKA 4D9EA 1E3TA 3ORQA 4BYGA 1P2TA 2JGLA 2CVHA 4YCCA 4CL3A 1WCIB 3QW2A 3GLGE 4EF5A 1WX1A 2PTGA 4L9RA 2VPIA 1HZEA 2DUWA 1TZBA 2ZS7A 3LX4A 1Q15A 3ZQKA 1YI0A 3UMMA 1MPTA 1NBME 4YRSA 2W9XA 5ULLA 1EHYA 4ZGQB 1ZU5A 2H5EA 2IYZA 3GVLA 4PAOA 5AD1A 4H35A 3I0ZA 2QX4A 1R5NA 1QMGA 1Y37A 3K0KA 3D6JA 2X9QA 3O0TA 4FT2A 4N49A 4TYMA 5D7BA 4QFCA 1RM0A 2VSQA 2JBWA 3GROA 4BS9A 1L7DA 4MDYA 2R84A 4C78A 4DLKA 3BA1A 5DTMA 5LDHA 3I5AA 4LYJA 1HT0A 221PA 2JKVA 3AY0A 5EZYB 1YIJB 4XWAA 2H1LA 4HWTA 2PE5A 3KKZA 3WBBA 3I2YX 4A91A 3IEMA 4QYIA 5ALQA 2FB9A 5B4TA 2BZSA 1WWKA 2GZ1A 4BU0A 1R4MA 3WDKA 3DSRA 4V0ME 2OZVA 1DOAA 4ISCA 4E21A 5DYNA 3T1OA 3BMNB 4RD2A 1GHTA 2PY6A 1I8TA 3G1UA 4FGJA 1SKBA 4CM8A 3WGIA 2P8SA 3VVLA 2WU3A 3IAAA 3OEED 3N5KA 2VAWA 2VSXA 3ICEA 4BQFA 4OJMX 3ZI4A 4UMFA 5G1NA 1N7JA 3GHYA 3SC3A 2P2ZA 3ZWWA 4F4JA 3H2IA 1BVYF 4KFRA 4NZMA 1GWNA 2PJRA 4KQ9A 1SRRA 1TIBA 4IZHA 3D7NA 3RC8A 4U2GA 1Z0DA 2Z6UA 4OQXA 4RHFA 5CW2A 1U2SA 5E4TA 5J2TF 3B9RA 2C1EA 4QDKA 4X1YB 3RUPA 3GRKA 2JVIA 3JQGB 4HX9A 4RDHA 4F8EA 4LDAA 1E7YA 3AEKB 4L76A 3KZ1E 3ROEA 1E62A 2P9GA 1RWNA 4HS9A 1OAKA 3TPFA 4DV5B 1BG6A 2ZJAA 3UAXA 1UPUA 4WY8A 3COJA 2AIRA 2MSKA 2SKEA 2XY4A 3HABA 3WQSB 3KSZO 2F59A 3DTVB 4CN8A 1BROA 3ETDA 4YACA 5LU8A 3PUVA 1GRRA 3BPSA 3NKVA 2I8CA 2ZU6A 3CO0S 3A4LA 3HFJA 3T9EA 4L50A 4AY6A 3U1BA 3ASZA 4ATNA 4KQXA 3C48A 1GTZA 4PAAA 4IDEA 3DUFA 2AA3A 5J5CA 2BD0A 5BYBA 4M1KA 1CF2O 4XQCA 2JJ2A 4FFMA 1ZK0A 1XHLA 2F48A 3GVXA 1GSHA 4G6IA 4XI9A 3ABOB 3NHWA 4RETA 3MQ4A 2GNOA 3S2UA 4B3HA 1JGTA 2WG1A 1JQBA 3CCFA 1TLLA 2QROA 2C5SA 1LC3A 3FPLA 2FFJA 3FRIA 3KOXA 3UATA 4YMLA 1VPEA 1G0NA 5JSKA 4TLEA 4TT3A 5JZBA 5GOTA 2BM0A 3CCSB 3KOWA 2EBWA 3SR0A 3UMJA 3K5IA 4XL9A 2QI9F 3T9BA 1LD3A 1UXGA 3B36A 4NRDA 5F5XA 5INTA 4B3TB 2HWXA 4Q4AB 4B7CA 2R5WA 2R86A 2YJTD 3O4FA 2ZTGA 2UXCB 2RI0A 4D0LB 1QP4A 1GA4A 1I0ZA 1N6HA 1X3SA 1K7YA 2IELA 1SQ5A 4FJ2A 1ZJZA 1P74A 5T7BA 2I2AA 5C8YF 1U63A 4IQ0A 2I2WA 1PR5A 3UOAB 4QDJA 5FBVB 1JIJA 1U9JA 3AUTA 3LC2O 3QGMA 4NONA 4WN9A 5ERYA 4UBLA 5BN5B 3JD3A 1W0KA 1DX4A 1Q95A 4QEZA 4YYZA 1FP4B 3R77A 3L7AA 2YDYA 1FTYA 4ALLA 2XCRB 3GJ3A 1V71A 4YFYA 4D9KA 2NZYA 3CE9A 4A15A 4MB6A 5E6RB 5KYXA 1RI5A 4F1KA 3ABQB 3DDNA 2IUUA 3RHZA 3C7AA 2DTEA 1E6LA 3VR3D 3V5NA 1IBCA 4ER7A 3CLHA 5B2EA 3KDAA 2P9ZA 3LSTA 1C30A 2QR2A 2PXAA 1SC1A 3NAZA 4E88A 1JR3A 2HM7A 1RYMA 3DQQA 3NEAA 4OB7A 2A6PA 3UHOA 3X1MA 4EM6A 3DD1A 3M2PA 4PRYA 2H5IA 5C34B 2G5PA 1WHSA 1SU4A 5CTAA 1DL5A 3DMHA 2O8CB 3H2JA 3OZTA 1VI5A 3T4XA 2G4VA 3SJUA 4OI0A 5JQWA 1U5BB 2C3YA 2ON6A 1HM5A 2XGSA 3F8SA 3OJOA 3CPWB 1M8FA 1OTXA 4Q03A 1I1QB 4UNQA 2DT8A 4QC2A 1DBRA 4HUQB 2FDXA 3VZRA 5BNTA 2GPTA 5LQDA 5C7OO 2QYSA 2IYSA 4AJ2A 2C0PA 2G6BA 1FSSA 4Z1MA 4E33A 2Y05A 4ER6A 2RHDA 1W2HA 2DPGA 2QZJA 3JX9A 4ZTBA 4HH0A 3RLIA 3C87A 4ND7A 4AMYA 4D8UA 1WETA 3JQ8B 2X9LA 3L79A 4KJZA 3MOIA 3MGKA 1L7BA 3FPHA 3KP1A 1Z4NA 2V8BA 4ZYXA 2C4VA 4OEHA 1HT3A 2XUZA 1K4MA 1I3NA 2VZ8A 3IIIA 2Q49A 4CMCA 4GQIA 2GCGA 3UIEA 4B4DA 5IVDA 3Q3EA 1FVFA 5JCXA 4KXWA 2WVHA 5AUNB 3RAPR 1UKVY 1LDMA 4H7FA 4Y2QA 1WA5A 4NOMA 4F4IA 1JG4A 3O8NA 4ESOA 2WJAA 3DE4X 2D2EA 2FWMX 1VYVA 1XQXA 1ZH2A 4JLVA 4LG1A 4YMSA 1YIDA 1ECGA 1PJZA 1YKSA 4HQ6A 2BGWA 3R9XA 1MEOA 1SBYA 3E58A 4F2DA 5IZ4A 5F7JA 3H9CA 4GPEA 4DA6A 1EP1B 1U98A 1UBFA 2Q1WA 3A9TA 1NZFA 3IAUA 5D5QA 2QY6A 4NCXA 2OZEA 2B4RO 2KVOA 3DVLA 2GM4A 2OZLB 4PZZA 2GUGA 4DUGA 3O8OB 1XTQA 3HU1A 3ET5A 3VR2A 3HZHA 1BN6A 1NLZA 2PBLA 3OCVA 1O9HA 1MQSA 5HKLA 2OVBA 3CNLA 3P97A 1IJKA 3MCTA 5A9SB 3ESAA 1RCUA 3AUUA 4OCZA 4ABTA 3ZH2A 1OHHD 2QTVB 1ODKA 1UD2A 2PSHA 1FVHA 1QZUA 2OV3A 4ZDJA 3GCGA 1L5MA 5EIBD 5T5QA 1L4HA 4W6ZA 3SR4A 2YNMD 3K72B 4BFLA 2EQBA 1D6NA 1CF9A 2CFCA 3NG1A 4HNAA 3ZQ6A 1WZNA 1P3JA 2H1CA 2WI8A 1C9NA 3KAJA 4O29A 5IAKA 4B4UA 5KSYA 1Z7BA 3A7EA 3DHYA 3NYWA 4EG4A 2CCGA 5TEWA 2IZ7A 2NO6A 4XUGB 3V3KA 1CLEA 1YMUA 4ISBA 1P5FA 1VHQA 2DTDA 5EZ5A 4I46A 5EQDA 1MJFA 3CO5A 3K0AA 1V6AA 3GGJA 4B4WA 1M2FA 4PQFA 1T3GA 3V34A 1MTOA 1WB6A 1KC1A 4OA5A 1ZNYA 2D3TA 4V0KA 3VSEA 8GPBA 3DKVA 4ZZ3A 3R5HA 5K0GA 1WUIS 2B69A 2FEKA 3AIIA 4E5NA 1P2SA 2G77B 4K86A 2AN3A 3JYQA 1T5BA 3P9IA 4JJ6A 1T2EA 1YJ8A 2Q62A 1PLLA 2RH5A 3A6ZA 3U3RA 5CFPA 2ZE7A 1COZA 3KJGA 1KMNA 3LO5A 3L6EA 3D6VA 5J9FA 2F1JA 1OC2A 2X0EA 1G5FA 1T9AA 5C51B 1YAJA 2W11A 4L74A 2Y6UA 1U3UA 1UZMA 3FIJA 4RV4A 3QVJA 4XIYA 3N2ZB 5HGJA 3IQZA 4NS1A 3SD7A 3VZQA 1X87A 3RC1A 3I64A 2EL9A 4X7PA 2QRKA 3OWHA 2ATEA 2BFCA 4MUKA 2PEYA 4LW8A 4DLPA 4K9PA 3W8FA 1U2RA 4NYIQ 1KF0A 3H1FA 1W1UA 2R44A 2ZYGA 3C4VA 1VG1A 5CLQA 5ALJA 2O23A 4AYWA 4EATA 1YE3A 2H2DA 2HHCA 2ZREA 4JBLA 4D3FA 4TZ0A 2LNDA 5EESA 1Z6YA 1CUSA 3PXEA 1HX7A 2QL6A 2NACA 1SCQA 3OT4A 4IV8A 4EYEA 1JLLA 1X9HA 5BVGB 1PJ3A 2FXVA 1KA9H 5EMLA 2W2KB 4UTPA 2VH1A 1XKTA 1ZI9A 1VE6A 2BFBB 2RHRA 5BPHA 3AF6A 3AM1A 4L07A 2WF5A 1KI1A 3W78A 1RRKA 4UQLA 2VPZA 4TTAA 1NW5A 3IP7A 1ETHA 2WDPA 2DEUA 3LCVB 4GNKA 1JDBC 5DBGA 1B41A 1FC0A 3OX4A 4EW1A 2ZKLA 4O5OA 5DX8A 2D1YA 2OR3A 1RWOA 3JQ9C 1NWHA 1F60A 4PG8A 2Z0MA 1V95A 4ND4A 2NWQA 4PLCA 3CZRA 1J0EA 1FX1A 4KPUB 4N03A 3TIGA 2XZOA 3L8MA 4K5QA 3RO7A 1QRTA 1VLLA 5CHEA 2IWRA 2ID9A 1CZHA 2CNOA 3F1LA 2QIPA 3DZDA 3IEPA 3A6HA 3OF2A 3OT1B 4GKBA 4Q1CA 3UXEA 2VC2B 4P5PA 1Z4IA 4L3VA 4ZGBA 5BNZA 5IMSA 1UKAA 4CV0A 2EKLA 4DCGA 1GSOA 4V1CI 3Q8MA 4AAYA 3VZDA 3QENA 3T3NA 2AK3A 3F9CA 4BNJA 4QQKA 1BNCA 1M8GA 3TD6A 4K6FA 3QXSA 2V0NA 2C5LA 4BE9A 4Z9AA 3UXMA 2WEKA 3WGMA 2Y92A 4X62B 2QT9A 1KJ8A 4LXTA 3JAKA 3RFTA 1ABEA 3CVJA 1JTFA 2IP2A 1J5XA 2F4NA 2ODPA 3TMAA 2PKEA 1O6GA 4XCVA 5AI0A 2QY9A 3L18A 4QUKA 3T5DA 3PU6A 1K7SN 1EJBA 5A7GA 2JLWA 3I9FA 1ZD3A 3AK4A 3C8UA 2GPAA 2JIDA 2JFNA 4IF6A 2YIMA 4IFEA 4CYMA 5IX8A 3I53A 5AOBA 2WYUA 3NHFA 1P9NA 2CUKA 3KUCA 4FFPA 4I1RA 1T9BA 3T12A 3TDKA 3GLIA 4HBGA 3RYHB 1OR8A 1H85A 3MCAA 4Z4ZA 3AW9A 4ZWNA 5JCOA 4NENA 5AR1A 5C5EA 1ST2A 5CYFA 1FPQA 5CX1B 4OP2A 1NN1A 1NNSA 3L8EA 3SAJA 4X07A 1EA5A 5CGZA 4EGCB 3QNUA 3IPXA 3QYPA 5JI2E 2JBAB 3OT5A 4BFSA 3PD7A 3O3NB 2JFPA 5EP4A 2PR7A 4F11A 2ZI5A 2V8OA 4PLYA 1JH9A 3WP1B 1KI8A 2WD8A 1UADA 3F47A 2BZ1A 4LY6A 5KYGA 3KOOA 1ZK3A 4GOJA 4H6VA 1L1FA 1DIBA 1KPHA 2G88A 3JSXA 1IXSB 2IUEA 2BFOA 4A8HA 2I78A 2YCBA 4BZQA 5JJCA 2ZRHA 2SHKA 1FTSA 3CY6A 4LYHA 2AXEA 3DV9A 1QJCA 2QN2A 4OH1A 2ONJA 2OBLA 3RIHA 2BH2A 3KCQA 2O7RA 2QRGA 4EA8A 4ENPA 3IVGA 1ES9A 4NZPA 4PG7A 4B8ZA 3FJOA 2EX0A 2KJQA 1P6QA 4OFZA 2ZIAA 2Z1DA 4PW0A 4ZP1A 5HKOA 4CLEA 1BXRA 5HCNA 1QB7A 2D8MA 5EGNA 4JLKA 2C9MA 1Z3IX 4WFJA 1Z34A 3TMKA 3KQYA 3THOA 1ZKDA 4ZI2A 2DWPA 2WLTA 4U2FA 2GAOA 4PTLA 3DKIA 4LZNA 1QHYA 2WHQA 3PDIB 1X14A 2CCKA 2HHHB 1LRLA 2ZATA 2WPDA 3H2ZA 3I2JA 4B6JA 2SCUB 1BW9B 1GRQA 3OMLA 5A02A 4HNQA 1X8XA 1WABA 3B1FA 4ZCLA 2NZUG 3GK3A 1PFGA 3GJ7A 3WFIA 3TTYA 3FZQA 4EHJA 4FNOA 2ETXA 3CX6A 1D03A 5CNMA 2JLVA 2DCMA 2Q1TA 2WKQA 3ENNA 3RVSA 3VTKA 3K6SB 4TSFD 3WB9A 3V55A 3RSOA 1MVNA 5ITSA 1XLTA 4YRBA 2R79A 5AMXA 3QVOA 4EHAA 2B83A 1GLGA 2H29A 3BXXA 4PE5B 4EHNA 4AY2A 3KKQA 3NT2A 1NQTA 3GRPA 3PC8C 1EUDB 1RFGE 1A98A 1XYYA 1YJNB 2C1XA 1KQOA 2ZIFA 3NHBA 4C3UA 5C2JB 1W94A 2N1BA 3QQPA 4NCJA 4PEVA 5H3CA 2DHRA 4EKEA 2WMYA 3RKSA 3TQRA 1UMCB 1PK7A 3EH2A 2FP4A 2R5NA 3EUAA 3P9PA 4GRDA 3PGXA 4M8LA 4MPDA 4KK3A 2W42A 3BB1A 5CAEB 4LPKA 2RGNC 4UFNA 3GBPA 4BYMA 5C1BA 2V9PA 1HXHA 3OFSA 4RMNA 2FOXA 1R0ZA 3WK9A 4UTOA 4JENA 4M1EA 5A4JA 2IYXA 2QAIA 1QNFA 3EMKA 4BGEA 5C5DA 2ZSUA 3DNMA 4BNUA 5FDFA 2ZVQX 1NLYA 3WLEA 2A0UA 2ZYDA 1RAHA 2I7XA 2OCGA 2AFIE 4UHJA 1N6NA 4YRCA 1XRPA 2ZTVA 4UHKA 4CMJA 3AR6A 5CA1F 2FQYA 2PX2A 8ADHA 1R8XA 1O89A 3FOBA 1XTUA 2QT1A 4PSAA 1P9LA 5DXFA 5I8PA 4YDHB 3RUIA 4AZVA 4DABA 2WSBA 3HDTA 1J8FA 3FZEA 4IMJB 4JYPA 4PCAA 2OOSA 5KJEA 2REQB 4G1CA 3S2GA 4EKYA 2AF3C 3BMCA 2CLLB 5B2ZA 3IRUA 4JGGA 1OJ7A 5E1BA 5IJWA 3MJRA 1SOMA 3OSUA 4FXOA 1XGKA 4H7EA 5D1HA 1HQYE 1XHEA 1R9GA 3MTEA 2VF8A 3IEXA 3MAJA 4MX8A 5I5GA 4CIXA 1MU0A 2I4OA 1V1MB 3GRAA 3UJPA 3IELA 1RWPA 3R5XA 5HCUA 2PS1A 3B1YA 3TM5A 5C5IA 2VHVA 4UXIA 2F9FA 4ZA2A 1TJ3A 4FYYA 3OPOA 3IURA 4OM7A 1U04A 5DGDA 4I55A 1OVMA 1XZCA 2WZBA 5CYOA 4JGBA 5LP6C 1R4ZA 4Y6PA 3IB3A 3ZI0A 5H16A 4EQ6A 1XZLA 3AP2A 3IB6A 3SU8A 4CTMA 2NW6A 3NHLA 1Z4QA 2Q3LA 4K05A 3NEJA 5H68A 1XELA 4NY1A 3SOZA 4B71A 4BQRA 1M5UA 4YA6A 4CLOB 4DWJA 3PEYA 1BEEA 2VBTA 3FFTA 2IOHA 3KXDA 4TV8F 4DDHA 1VE9A 1WMFA 2VYCA 5DT9A 3NHJA 5CPFA 2RHMA 1L5RA 5GZ1A 4G8CA 1LQUA 1QPGA 1QH1B 2X0RA 3DAYA 1VYHA 3FYCA 1JQEA 1UXKA 4NTZA 3A4YA 3WLRA 2AJTA 3DXXA 3LHKA 1L8AA 4KSBA 1F8UA 3ZIAD 4BZZA 2HTEA 1J8YF 1DBPA 5K51A 2HV9A 1EGVB 2NQ8A 4KVGA 2IS2A 2W2VA 1TQDA 3TZLA 1BKYA 1J23A 1V4NA 2ES4A 2VF5X 2ZTMA 5DGIA 4S04A 5ER9A 5H83A 2B8JA 4R8VA 1P7ZA 4DDTA 1AOXA 4RH0A 1QQAA 2EZ9A 4WI1A 5TS2A 2JEYA 1HURA 3LYAA 4JA2A 1L5GB 4NXMB 1ONNA 1OBCA 2W6JD 4DANA 5KBYA 2XSZA 4NOJA 4W1RA 3WOHA 5L51A 1MABB 5ELXA 1CUVA 4YMVA 2XI4A 3IALA 2R48A 4C43A 1ZJJA 5PGMA 4XM2A 5AW4A 2BZ0A 2HPZA 3GBSA 3H3XA 1G3IA 3ABRB 3DLIA 1T2FA 4FOLA 1KJJA 3R8XA 3LUFA 3EC2A 4A6PA 1N3BA 4MV9A 3ZWMA 3P0RA 1JFFA 3KE8A 2BFEB 1SXJB 2CLMB 2FFBA 2YASA 1FFAA 3CRMA 5K3FB 1JL3A 3VM6A 4UFPA 3JQFA 4OXKA 1Q0HA 2J6IA 3DTTA 3K1YA 4CL2A 3QA3E 2XDQB 1D9XA 2G28A 1KAOA 2RHWA 4KFTA 1VCOA 3KEWA 1VBKA 5IYQA 4LQ4A 3NONA 4N54A 4IDCA 3AMVA 4ZYWA 1OV6A 3S5UA 1EFKA 1JAIA 1KZGB 3M9LA 4IDGA 4PRKA 3T1TA 3RYTC 2G0NA 1W9XA 2FFRA 2QJOA 3VNBA 4EHHA 4TWRA 2ZYIA 3OWOA 3L7KA 5IXYA 4Q24A 1E6UA 4Q3BA 2O19A 5KOJB 1KIFA 1UJ5A 2QG9A 3FHOA 3Q5EA 3ZGVA 3IAXA 5HNKA 1LTQA 1U8XX 2E5WA 1CC1S 1ZJ4A 3A1DA 3DAHA 3KZCA 3L1UA 5EIXA 1Z6AA 3AUAA 4O4HF 2GYYA 2GXQA 3KVRA 1Y4SA 1GGNA 4LXQA 4BMVA 2OMEA 2B1JA 1ACJA 3TW8A 1QYVA 3A9SA 2J7PD 3O03A 3VBEA 5THXA 1QTRA 1ZD8A 3ENZA 3C6YA 2H4XA 3F74A 4RDCA 5E3IA 2VAXA 3DVRX 4UTVA 3GN2A 1S2IA 1G8MA 2AEFA 2HSDA 4P2NA 1QVWA 4ZT6A 4CQLB 1EK5A 3SXPA 4A2CA 5LKAA 3UT5B 5LB2A 1AKMA 1ZHOA 1E3SA 3V2GA 1R12A 4BKPA 3CN9A 3IR5A 5EMKA 1Q7YD 1C3LA 3SC2A 1P0IA 4ADSG 2C83A 3VU8A 3LT5A 3L8CA 4GE0A 2VP6A 1R9JA 5F1PA 3PGA1 1P0QA 1GAQA 1SU6A 4IWYA 3SBXA 1CUWA 3QOFA 4D8XA 3P2JA 1J21A 5F2OA 2BEWA 4Q7MB 1KETA 1O94D 3CH6A 1ACLA 1YRYE 2LDXA 2VJBA 3OE4A 2ZXIA 1JP7A 2YUIA 3SWWA 2I4RA 5F4ZA 4HDOB 3AF2A 2QRPA 2CJFA 1NUTA 2M6LA 2OCXA 3H86A 3PE3A 5A5EA 1XZGA 3GT0A 3A2MA 3JVDA 1GXSB 5BR1A 3IERA 1GGHA 4KO8A 2P35A 1Q12A 3GR6A 3ANLA 3L6BA 4JZYA 4ENQA 1YQ9A 4FFNA 3HYCA 4CKCB 2P9JA 4X90A 2MMCA 3GUUA 3DZ8A 1Q1EA 4YRAA 3T7TA 5ICMA 1KDRA 3D6FA 10MHA 2YIDA 4LWPA 1K6JA 5HUQA 3FTNA 5IKEA 3BFXA 1YKGA 1XRRA 3HNPA 4LWOA 2V6IA 3LL4A 3OBIA 1B2LA 3WY9A 2V6GA 1KEPA 1DC5A 4DQLA 3K0CA 3BGOS 3GRCA 1TL7C 4LXHA 5IKOA 2E3JA 4UHFA 2A0FA 3F1KA 5KSPA 3AU9A 1RRGA 3C4JA 4NFLA 3V9AA 5J43A 5I7UA 1DDIA 3QVGA 2X40A 3W6PA 3HPRA 3NRBA 4QWMA 5C1IA 4PO1A 4PIMA 4WZ6A 3VOTA 2Z6VA 1EQ2A 4PRZA 3W3AH 4BJ3A 4ESHA 5A4FS 1G6HA 1UEIA 2ENWA 1DLIA 2IZOA 1QYWA 2Y4NA 2J3DA 4KUGA 3ZCVA 2P1RA 5KTTA 1T4MA 1PQ4A 1U65A 3GDHA 5LDGA 4LJ4A 2ID8A 5T64A 2MYTA 1P1RA 1JJ2B 1T36B 3K9NA 1KAEA 5EUBA 4D9NA 4IJ6A 1NUQA 2XTMA 4BO0A 3P9QA 4MUMA 3ZE8A 1E94E 1Y8QA 4DG9A 1VHLA 2R47A 1ZNQO 4LDNA 2HSJA 3N86A 3N7AA 1M6YA 3HKDA 1G2PA 1ZD4A 1B0ZA 1AB5A 2YVUA 4PPFA 3TB4A 2P0AA 4C1NA 2HMYB 1OPXA 1VLMA 1A5BB 3JU4A 1M0WA 1Y1PA 2CY0A 2HT6A 1DRVA 4KIFA 5ECYA 3DFIA 2QS9A 2XTZA 1AM4D 4KIGA 4Q7KA 1ZAYA 3TJMA 4HWGA 1E2NA 1KJZA 2JANA 2GTIA 4FB5A 1ECJA 1EIWA 1H0HA 3N2KB 1GO2A 2QI9C 3GFGA 3QXXA 2GLXA 2VUUA 3HFGA 3QVTA 3DUFB 3PFWO 1A9OA 1M1YA 1SCUB 2W2LD 1R8JA 1U3GA 3HB5X 2QX9A 3ICCA 2ZUWA 1N2EA 3NASA 5JD3A 5CA0B 5LMZA 3L0IB 2FLWA 3N7UA 2XGGA 1GL7A 2ZUSA 1NUUA 3P9CA 4EFLA 4MXDA 1VI6A 1C0IA 4QTUB 1PGNA 2EEPA 1SZCA 1OY1A 3LBHA 1TMGE 2VLIA 3AF0A 1RQGA 3Q6IA 1JDZA 2OYNA 1Z8HA 1BFDA 4X95A 2B1RA 1R74A 3HE3A 2WWHA 4PG4A 5LN1A 3HPQA 4DIOA 5BV0A 1HE5A 3ZJ5A 3ZCPA 1QV9A 2QP3A 3QU9A 4HYYA 2AG8A 5DGCA 2QQEA 4URFA 3FRHA 1ISSA 2P62A 5AKIA 3GOQA 1HZJA 3HWRA 1FDOA 1Y7IA 3PNQA 3Q2KA 1E59A 2J3LA 4WKGA 5HA5A 1WY7A 1DBIA 2DHEA 2HQSA 2B2CA 2HY7A 3A36A 3KAPA 2AI1A 2OGWA 1EK6A 4MRPA 1MUUA 1NSFA 4E12A 3OJFA 1QDLB 3CZAA 3QX9A 3U1TA 3ZVMA 1P75A 4GZ6A 3T3MB 3PTLA 1YVRA 4PLTA 3PDJA 4TTQA 4Q9JA 3GEMA 4R7GA 5CIYA 3SE0A 3UKDA 4QYTA 5AW7A 4MI1A 4D6YA 4J4BA 4KFUA 1NB0A 4AZTA 2YN0A 1V16A 5HXAA 5FOSA 1T1JA 3P9NA 4LJ6A 2OXEA 1BJTA 2B5VA 3C39A 4N4AA 2GK6A 4RKWA 5TRTA 3CNNA 1UAAA 3DFKA 2RGBA 4YAIA 4EPRA 3E9CA 2O07A 3UC9A 1T34A 3E9ZA 4P81A 3PJDA 3D4PA 2GASA 1BD4A 4YRTA 4FFSA 1H1TA 2C9DA 2N42A 3A11A 2QVZX 3I8XA 3U4IA 4YDQA 5AVTA 2FI1A 3IE1A 1WHSB 4FEAA 5K0TA 4NCAA 4HC4A 4HSGA 3PE6A 1JNXX 4MWBA 3OOEA 4C2AA 2R97A 1QWSA 1J07A 1Z9BA 3OQ1A 5TVGA 3RTCA 2IGBA 3EZ2A 4JQZA 4WLFA 3ENVA 4TMVA 3OA0A 2ST1A 1DIAA 3T5TA 2EHJA 5JHGB 4X0CA 1IDOA 1V37A 1CZLA 4C4ZA 1KMHA 2J08A 4MUHA 5ALUA 4BLQA 3VC3A 4K0KB 1OLUA 3A1TA 2WINI 4KXNA 1G2OA 2PMKA 4LXYA 1I32A 3BRWD 4XR4A 4P84A 4QHSA 2FDRA 3SBDA 2C5FA 2XWPA 3WV4A 4WQMA 2DX7A 3A4IA 5LP1A 1DJQA 3F0TA 3HB1A 4JT9A 1V11A 6CHYA 3FCXA 5EY5B 3AHIA 5ALFA 3UB3A 4BGDA 5B7PA 3BA6A 1G4AE 3H4VA 2V0GA 3DQPA 1WP9A 3UGQA 3PLNA 1VQOB 2FMKA 4IDBA 2D0IA 4CTJA 5I7OA 1SVOA 1E3DA 3RYCA 4Q7EA 3RYFB 2IDZA 2O52A 2W0SA 5FOTA 5GTDA 5KINB 4JQSA 3QU5A 3SZUA 5CEEA 5ALHA 3FSGA 1HEIA 4G2TA 4LNHA 1MH9A 4OL9A 1NP3A 1H9CA 1ECFA 4K9OA 4WFKA 4G4JA 4IGAA 2BGNA 3TTTA 4MCJA 3CNBA 1KH3A 3EZ7A 1YQQA 2IE0A 1T24A 1D07A 3EXHA 3QVSA 2TMDA 4FGKA 1L4FA 5J3OA 1QZTA 3OF5A 5DU2A 3SF0A 3U37A 3PNOA 4L16A 4FE4A 4MCHA 4D42A 1JWAB 3LGXA 4PLPA 5KO2A 3OBBA 3ZK9A 4UDXX 3A1SA 1E7QA 3DWFA 3U4MA 1FQOA 3TXXA 3HV2A 3P8ZA 5TF0A 2HEIA 2FPIA 2QUIA 3M6UA 1UMDB 3PS9A 4H4CA 2JLYA 5BSFA 4EARA 4LJ5A 1ABBA 2A1UB 1WM1A 3L5OA 3PNSA 4KMOA 2DUNA 3ZVRA 2Z2IA 1HNWB 1VXOA 3FH0A 2VNHA 4S2EA 4YVFA 5FHQA 2GS9A 5AFSA 1UIMA 4HN4B 4YJ2F 5BSGA 5DK4A 3I62A 1YDHA 4JNCA 2R1TA 1XF9A 3N76A 1QHFA 2GJRA 5NLLA 1SWWA 3VXKA 3MRTA 3BXOA 4GOOD 3TJRA 4V2IA 1XQBA 2JA1A 2J9GA 3STTA 1U0RA 5JDCC 4WAUA 1P2FA 2N0SA 4O0MA 2A9JA 4CIVA 4B3BA 1KEZA 1MN6A 3D31A 1ZOOA 2BRUA 1IEXA 3W5BA 4M9RA 5FXMA 2AJCA 2QYTA 4HQ0A 5HBRA 3N0XA 1DWPA 2IHKA 1ATZA 3TFQA 2H1SA 3VZSA 3WRYC 4AZ0A 1VB5A 3GDGA 3H75A 1G9TA 1QPBA 4UNIA 3VNSA 2LIVA 2X42A 3RRFA 4N3NA 4I5EA 2GWHA 5DM1A 4E5UA 3SLKA 5JH7B 1T9CA 3OHSX 1S2DA 1BHSA 3FVQA 2NN3C 1SWVA 1JFRA 4RQBA 2VH5R 2WHPA 3PXBA 4O4LA 2MSDB 3FMOB 1TTTA 1VE7A 5AXAA 2WUGA 4JT8A 2O2GA 2W6CX 2W00A 3B9BA 3K3PA 4LGMA 4P4LA 4PNPA 3FCSB 5BQ3A 1N78A 4PFSA 4YROA 5AP9A 1M83A 5B36A 1SU8A 1ZUD1 3O5AA 2QUKA 4ASUD 1JEEA 4B8YA 4D8TA 1KEKA 4TS4A 3Q41A 1JJAA 4ZFNA 2P2LA 1KPIA 3OE7D 3FHTA 3MHPA 2A9QA 3ILHA 3L4SO 1RADA 4YNBA 1UM9B 3ORRA 4QGHA 3DXYA 2P3OA 3BDAA 3OPYA 1IY9A 3NWPA 3OLYA 4JASB 4ND2A 1PFVA 2X4DA 1LSUA 4E13A 1CUFA 1QSGA 2BJHA 4Q9LA 1PF7E 1BGXT 4ARBA 4L5AA 2FRVA 2G63A 3OEEA 1E4YA 1EAMA 1NBOA 4JDPA 4R1UA 4RZUA 3S3TA 1HTTA 2PRIA 3T95A 5JSQA 5JTTA 4OI4A 1SVLA 2OO5C 3R9IA 1OB5A 4Q7JB 3ESBA 4E46A 3I61A 3DAOA 4L6IA 4DS3A 1P5HA 2VT6A 5EYPA 3ZBUA 5DM4A 3SDZA 2ZTUA 3B3GA 1GAEO 4XDGA 4ENUA 1IN4A 3TSWA 4BNXA 2GYWA 2ZANA 4P4TA 3CF2A 3HMKA 3GF4A 2G80A 3AM4A 4XDYA 3VKGA 5FA8A 1VFNA 3DBHA 3IQFA 4FJ1A 3ITEA 5HMMA 1I3MA 2QRJA 1L5YA 2O2JA 5DX0A 1P6XA 1PFYA 2VJYA 1C1DA 3TRDA 2OOKA 4LN1A 4BAZA 5A7HA 1E3XA 2RGXA 2C3UA 1FP6A 1OXMA 2MTBA 3MF4A 3VSBA 2C4TA 2GZ3A 3GVCA 2QAGA 4QU8A 4OIFA 2PGAA 3RBXA 4LE2A 1X7YA 1SBTA 1QONA 2XB9A 3GWZA 3TL6A 1BA2A 3DMGA 3EGCA 3HWWA 3K8QA 4EFMA 1P7PA 4FC7A 5AKHA 4ZCPA 2ZZFA 4LFCB 2NTNA 4CNQA 2P2SA 1GTMA 5FAKA 1VECA 5HZGA 4NNJA 4QATA 4MKIA 4DARA 4DXHA 2Q9BA 2HHAA 3BCRA 3CM0A 3IAM1 2Y0BA 3UGKA 2HU5A 3TCXB 5JDIA 4J9VA 3AFIA 2H7YA 3KS9A 1XRSB 3EWNA 1QU3A 1JQLB 1I33A 3OUZA 3GLVA 4DY4A 1M2GA 1SZPA 1S7CA 1RXCA 2R2AA 3PNYA 2VPYA 1L5HB 1LW6E 4XYGA 4EFKA 1JTEA 2ATIA 2J09A 3MFYA 3OOHA 1KKLA 4JUDX 1YUMA 4Q3CA 4UHCA 4J0GA 4X9XA 2WU1A 2HCFA 4XYMA 1H3FA 1VBNA 4OF4A 2W6OA 5F9MA 3ONEA 3Q7SA 4KQKA 4W7SA 4KOAA 4UM9D 4AIIA 1HY3A 1TYAE 1M34A 1PV1A 4NPCA 4NENB 3TFOA 1VJSA 4GIBA 3W6NA 2YQ4A 3A9CA 3CKLA 4ZVOA 1UZNA 4C7JA 4PN3A 3OU2A 1YJ9B 2RSLA 3D2BA 4KO2S 3KRTA 4BLRA 1Z8NA 3KOMA 1XVAA 1K27A 1RPZA 1OXSC 4PYJA 4QKQA 1NY6A 1R0KA 1Z36A 2WE7A 3EIWA 4PANA 1EESA 1EINA 1YIOA 4URWR 4WKPA 2NO5A 3RE1A 5FHRA 1OH8A 2QVCA 4PPYA 3C3MA 3VR3A 5KQGA 2ZZEA 2DYIA 2PFSA 4KQFA 2FPWA 4KVZA 2BSQA 1P2GA 3PA2A 3DEKA 3JVVA 3N8KA 2ZJBA 4N0MA 1HE8B 4DMUB 3K5HA 3QKUA 2M5SA 1U0LA 2P30A 2VJLA 1LKZA 5A5GA 5IUNC 4M1QA 1IOWA 3I9V6 4OPOA 1KC3A 2ZIUB 4JP5A 1R0CA 1B3BA 2XGMA 1B42A 1RIFA 2X77A 5TQ0B 4BXOA 4RSMA 1K3UB 2G1PA 2A8YA 4NXNB 1H9BA 1J39A 4UBIA 4HYQA 1SG0A 2GN9A 4X64B 3DF7A 3BC9A 3OLWA 1F8YA 1X8JA 2FRDC 4ZZ1A 1BXRB 1VMEA 4GPAA 5A4IS 4IIJA 4NCBA 5IM4A 3OM9A 1ZH4A 2BEUA 3HCPA 3B1XA 4J1SA 4Q4JB 5BT9A 2W6MA 3X2SA 4DLYA 4H27A 4XDZA 2CW5A 1ESZA 3A1NA 1HH4A 3A4MA 3MTJA 4BVKA 5MHTA 2O5RA 4L0CA 2GBFA 1DEHA 4PX9A 2Q1SA 4MUAA 4QQ8A 3WSWA 2QL5A 2CMGA 1UP7A 4YMUA 2XE8A 4RDIA 3O9MA 3BH7A 3LXRA 3M6MD 2KE5A 2Q5FA 3VTZA 2BKUA 2HA7A 5EUMA 4GEKA 3QFCA 3PRKE 2HQOA 1IB0A 4X6LA 1F2DA 5LR6A 3ICWA 4JCOA 4PZEA 3CC8A 1FOEB 2O20A 4J1NA 1E9SA 5B58T 3MJVA 9ATCA 2NTJA 2VHZA 5EI5A 2YL2A 3FOEC 3DFFA 1WBBA 1PIWA 2BFFA 2EFGA 3OLZA 1JLMA 4LIPD 1XX6A 4QYXA 4B3SB 2VYVD 2PJDA 1IPEA 1DWOA 4FFOA 1B8VA 1IHOA 4BN0A 2UZ1A 3KWFA 1XEXA 4C21A 2CEAA 3HUEA 1M1ZA 2GPSA 3BFKA 1M0SA 1NRIA 4LXIA 2UVDA 4UUBA 5AKLA 3R6TA 2XH8A 3IVAA 4ZVPA 4ROXA 4EG3A 3LZ6A 4CEJA 5JE8A 1GFSA 3B1ZA 1JHDA 3TNYA 3SK0A 3SSNA 4CR8A 5JNTA 3BD9A 1VCIA 2I2BA 4HN2A 1VF7A 1BRMA 1D3AA 1FQWA 3CW8X 4GSKA 4HEQA 4POOA 1U6KA 2XXBA 1FXUA 5A5VA 1DQPA 4MUEA 2YHBA 3B12A 4RA6A 5EE3A 4XKJA 1OHHA 3PA8A 1ISRA 3G13A 2FPMA 1CB7A 3KE9A 3V1NA 2XUPA 5JQGA 1VJTA 3ZWKA 4D5EA 1QVRA 3OE5A 3HJRA 5FB3A 4F04A 4I7EA 3ZX4A 3IPAA 3H4MA 2DJ5A 3MWLA 3NJ8A 1E92A 4XB2A 3T0FA 8OHMA 1T5TA 4HLDA 3ZLJA 1ZHHA 1E2BA 4JKIA 2PMEA 5K7SA 2ZJYA 4J43A 1E2EA 5KVQA 2AJBA 5EZQA 5E9AA 4TN1A 5I48A 4HS4A 1TKCA 1KERA 5IMBA 2CJWA 4JWTA 3IAS6 4WCFA 2CNBA 3CCQB 5E4FA 1KVSA 1QVFB 5HM8A 2Y1DA 4B6OA 2PS9A 3BKXA 1E6WA 1M2VB 1B1AA 4JLNA 4RGVA 4UOQA 1RU3A 1GPDG 2XV1A 3NFRA 1UPTA 3QQ5A 4FZ3A 1JDTA 2QZ9A 2ZAMA 2QT0A 1Y6JA 4GOLD 5EMMA 4C6HA 1BDBA 1O96A 4RK5A 4HQLA 4B73A 4RZXA 1H4TA 4LFBB 2LCFA 4R3NA 4IDDA 1QTIA 4EZBA 1UR5A 4EQ6B 3WWDA 4RL6A 2V7UA 2OILA 4XFDA 5KCMA 1PDOA 5E9WA 4RKQA 1JT9A 4OJTA 3D5EA 4HQFA 1J97A 3KSDO 2YV4A 1HNNA 1XA0A 2CXHA 4O2BF 1B3RA 2HLPA 3LC7O 1NQAO 1SZDA 4M55A 1K6XA 1BU5A 4OMCA 5AVKA 5IKXA 3IQWA 3THXB 4EELA 1YA6A 5JPIA 1RVV1 3S7TA 2FN7A 5IPFA 4EEXA 2LW7A 4X7DA 1SHTX 3PVSA 1P2UA 3CYFA 1KO5A 3KEQA 3X44A 3OWXA 4YI5A 4OP7A 4EG6A 1PNOA 2DP4E 3LLMA 4JP3A 1B8OA 2C7GA 1QS0B 3HRIA 3C3PA 4YMWA 3RS3A 4F8YA 2Q3CA 5HM6A 5JCJD 2NU8A 2YHUA 3WGLA 4G85A 1QE5A 4YJHA 1V8DA 3WE7A 3TQSA 5BT8A 3EK2A 4G1UC 3BIJA 3GJ0A 5EWJA 3ZBQA 3ZHXA 4AZWA 4AX8A 3CC7B 5KYTA 2RB5A 5LQAA 1GZVA 2VT3A 4IXMA 3LIPA 3Q0EA 4NF2A 5IANA 3GNSA 2PD4A 2OZPA 1Y3BE 1CS4C 4RPCA 3OKXA 1Z18A 2C8VA 3M1AA 3X1WA 2IE8A 1MKYA 1GUFA 5GGXA 1EXVA 1FSPA 2RG1A 4OLJA 3D43A 1IBSA 4WERA 1FUEA 4JT2A 4LQDA 3TR6A 2O9JA 4KXLA 5CT5A 4YCLA 1A7KA 1Q7GA 2IC5A 5BO5A 1MA0A 1T8PA 2XMQA 5J2UB 2GAFA 3E9QA 3NORA 4LXUA 4MSUA 5CDTA 1LRKA 1U0SY 3A3PA 3ONDA 4MKRA 4E11A 2GBCA 2P7HA 5JS2A 3NZEA 2R6FA 2DF8A 2GTHA 1DE0A 3FROA 4CLRA 3OKCA 5BNIA 4W8GA 4QPCA 3ZZMA 4LQCA 1Q7EA 2EKQA 1UJ2A 2ZIVB 2PS0A 3D7SA 3VI4B 3WMFA 3PHIA 1CYDA 3H2HA 4RESA 4S0XA 5GGYA 4PR0A 2OTJB 4NHOA 4L5BA 3SBEA 3PGLA 4CM6A 1PVVA 4C2UA 3P9SA 3C2QA 1ABFA 4X0EA 4E3WA 2XVAA 4OHBA 4FLEA 4NE7A 3VPSA 1YS7A 2JIRA 3TW8B 2QE7D 4IWNA 4EY4A 4GLFA 2C99A 3GJRA 4AMBA 1WE2A 3FYTA 2JLXA 1N8NA 4MWDA 5BORA 1XRLA 4RC9A 2Z58A 2NYAA 1JG7A 4DA9A 2JHFA 4IEFB 1H6BA 5A04A 5KTYA 1MT0A 3ZJUA 1PL7A 1GGMA 2N1MA 4H7HA 2GZRA 5BYKA 4G5QA 3MBKA 2FEWB 5THKA 1CHNA 3L7NA 1CJTC 3SKXA 3EWSA 2CDCA 5JD6A 2RGGA 3K30A 2D1SA 4JWKA 1C8VB 1PEYA 4NE2A 2V1XA 3SICE 5H8WA 5IJAA 4Z4VA 1PQWA 2DH6A 2KBEA 3DE3X 5EKUA 4OQMA 1WL8A 2A2ZA 4ED9A 3EVFA 3F9RA 3ELUA 3G23A 1G8SA 4ZALA 1ESNA 3RS2A 3SPXA 3HCOA 1FPMA 3YASA 1SRQA 2PT5A 2PJUA 3UJBA 3TAHA 4PC1A 3CLKA 1H94A 1RKXA 2JIMA 4JYMA 3UT0A 3PFBA 3ZUGA 3U3OA 4PC6A 2KLBA 2XIJA 1TD1A 1UJBA 3G6WA 1RFLA 4Y98A 3WZ2A 5L3QB 3MS2A 4AN0A 3GJQA 2FR1A 1JE0A 3IO3A 2C8LA 3O95A 3UHAA 3B6MA 1YOVA 2FW0A 1Z0IA 3BWMA 3MJEA 1G55A 2O2HA 5D6OA 3BH4A 2JAUA 5FUYA 1SH7A 3TFWA 1PHRA 3GEGA 3QLVA 2B5WA 4QUBA 3LPCA 4M7WA 4RVCA 3ZE6A 4DWVA 2FZVA 4CV2A 3H5AA 2HF7A 5JMPA 4QFMA 1HDYA 1MEEA 1NX6A 3QI7A 4QBHA 3EOAI 4LC1A 5L3RA 3PL1A 1XQWA 3RK1A 3BWEA 5C35A 1AHNA 3C3YA 4HWSA 3OFKA 5E6UB 1GT91 1S4MA 3BNWA 1MO2A 3I6ZA 1K6IA 2V5VA 1AUOA 1F14A 2XD4A 2ZT5A 1EP3B 3BIOA 4GX2A 1NXPA 2C03A 2ASVA 3VR0A 3T1QA 1NMYA 4TSFA 2P40A 2AYYA 2PX5A 1JDPA 2D1QA 3H9NA 1KZ4A 4RF5A 4TZKA 4YCJA 2GH1A 2ZBGA 3EGDB 1LX6A 3F7OA 3T7SA 3EPLA 3NDPA 1AG9A 2JFBA 1IDN1 3RK4A 5GOZA 1P44A 2QTWB 4FMDB 4JLBA 4UOZA 1XTKA 3UF0A 2F1MA 2Q8QA 3FF4A 4M7OA 1DWUA 4NOKA 1ZL0A 5IBQA 1XTPA 1Y8QB 4J49A 3F3MA 3KQSA 4BEVA 3DONA 1V48A 1N8SA 3L06A 2GK3A 2AFHA 4GRAA 4JKOA 4LHVA 3R5TA 4PZLA 4DLWA 5JAMA 4PO3X 1EXNA 3L43A 1ZN7A 3NM6B 4CLHA 1QG0A 3ND8A 4B2LA 3BL8A 3H3FA 2Z9CA 3GPDG 1E3ZA 4KI7A 5AVXA 4S0ZA 2KI5A 3ORFA 3BIFA 3HU3A 4REQB 5LC1A 3RSSA 3F2VA 4BN4A 3MTGA 4TWZA 4V0NA 4ZVTA 2DBVO 3N59A 2Z57A 4QQFA 4B1FA 2AH5A 3N75A 2ZRQA 1VQ7B 1F06A 3VZCA 4TWAA 5DCYA 2ZE6A 1SKYE 4V24A 3ASRA 3RT9A 5I3ZA 1C81A 1MQAA 5K09A 2RAFA 4AF6A 2ZSAA 2HA5A 3BGDA 3ETCA 2J9ZB 3MT9A 1P29A 1YACA 3TQQA 3TG8A 1WW8A 2G9ZA 2IU0A 3D6TB 4U8GA 4AMGA 2HA2A 2JJ1D 3MHTA 1IM5A 4QJBA 2G0TA 1YU9A 3HBAA 1WU8A 2W2TA 4IHQA 4L73A 1A3CA 4CPDA 4S1PA 1GV1A 2PUJA 4CF4A 5JFTA 4CGYA 4R6WA 4MVWA 3WP0A 2NO0A 4ZI7F 1VB3A 3ADOA 2D5LA 3AEQB 3CVOA 2B8TA 1D2CA 5E6SA 5F1YA 4YRKA 3DLPX 3TL2A 3O3CA 3BQJA 2YV1A 3JATA 4BGIA 2V59A 4NU0A 4CMEA 4G0VA 4CRWB 1W93A 2I66A 4KHPB 2DUUA 1G20E 4II7A 1Q19A 3CNEA 5IASA 4X8HA 3ZJTA 2EJVA 4XWOA 4G4GA 4YV0A 4QODA 1FXSA 2NSLA 2QMEA 3KZVA 4P4NA 2VSOA 4TMWA 2BC9A 3KBOA 4WJLA 1XRJA 2HRDA 3OQHA 4OSEA 2OM6A 4ALIA 4XFKA 4WZBA 4DV1B 3NIGB 3MBIA 3UJDA 2X6RA 5CEFA 3EXG1 5CLIA 1WXFA 2GEVA 4BRUA 3B6JA 3EXAA 5AJZA 1JEJA 5I51A 1V26A 4RKYA 1SIWA 2O57A 4HDCA 3T15A 3BY2A 1WZCA 2FW1A 2G8NA 1YE8A 4BFXA 4Q16A 2GJ4A 1USVA 1E0DA 2AQHA 5DLYA 4W1SA 4LWZA 4BDTA 5KREA 3ZH9B 1WR8A 3IRVA 5A88A 1H2AS 3ESDA 3ZIAA 3H13A 3RIEA 3U4GA 5DP2A 4DCCA 2P91A 1FMTA 5DSZA 1GNPA 3P2EA 2YOHA 3P9XA 5FORA 1YJWB 5UKDA 5IRCD 1IN8A 4ZN6A 2QDXA 3H04A 1Q1QA 3V32A 5AKKA 1FSGA 3TSCA 2UXDB 3FNRA 2D3WA 2R751 4XONA 3P71T 1KMHB 5B5SA 1G8PA 2PUVA 5LXTA 2AUTA 2WU8A 1OWNA 1RQXA 2DM6A 4U2BA 1YQDA 4Z8XA 1EFCA 4I1VA 2J0UB 3B89A 4QXQA 2ZBQA 2FZCA 3N3BC 4DCTA 1ZEMA 2WC1A 2E21A 3JQRA 2C2OA 2ECPA 1V11B 1YRAA 2YS7A 3Q39A 4WXPA 3RHTA 2BTQB 2OCYC 2QZZA 5JLAA 2D59A 3H5OA 4BQOA 1J0XO 2VEOA 1M0TA 1KMIY 1RYNA 3ZU4A 4EO7A 5HQ3B 4KO3S 1Z82A 1SQSA 1KC8D 2EZTA 3DDSA 3EYWA 1QZ3A 3EYAA 3KHUA 3ZY2A 3RYCB 2QZPA 2B1QA 3WHLA 3BORA 1T2UA 2ERXA 3TQOA 2RI1A 3WYGA 3FKQA 1XZJA 1W85A 2G1UA 3FWKA 4Y18A 3GUVA 4B75A 3CLVA 3HR4A 1EGQA 1XZ8A 1QIGA 3BZUA 3V8RA 4BRZA 1QHXA 3K0SA 5AKXA 1Y63A 4DTCA 7MDHA 4ZYTA 1ISIA 1WW3A 2BF4A 1C0EA 3ACBA 4OXQA 4R0MA 2CMDA 5HUJA 1DQZA 1JX6A 3KEOA 3PA1A 1SQ6A 4DFDA 1V1JA 3B1JA 3FY4A 2GFIA 4LWQA 4XLCA 4WUTA 1VG0B 2JGJA 5SYAA 2D9RA 2IPXA 3GZNB 2O5EA 2AS0A 4Z7OB 2C7VA 4IH1A 3M4NA 3IUYA 2ZJ1A 3Q9SA 2WRZA 2O3RA 1AKQA 1DDOA 4Z49A 2JAQA 2YYZA 1WMDA 5FOWA 5M29A 5LMNB 3OURA 3VHQA 4WZZA 4BKRA 1U0OC 5CVUA 1OOEA 2EFDB 3PF9A 3VOSA 2J7PA 4BTEA 4EJ6A 4ZTUB 5FA5A 2D1TA 2OG1A 3G9ZA 2AN4A 3K2QA 3D4IA 1Q5PA 5E95A 3KUXA 1AKEA 3SQNA 3LYLA 1EWTA 2BTEA 2ALJA 1O5OA 3AKEA 4IIVA 3LRXA 2R1TB 1CWUA 4FQ5A 4DLVA 2VHUA 3TOCA 4K26A 1D1NA 5B3JA 2B0JA 2GPBA 4BLSA 1IG0A 3TGLA 4ITRC 1AUVA 2HFKA 1N5JA 2DU8A 4L8VA 3OAAD 4ZRDA 3C4QA 3ETEA 1XAIA 2X8AA 3F67A 1EJ0A 4LYFA 1OX5A 3TN7A 2VRWA 2FTKE 2H17A 3JSAA 3KTOA 4RHTA 3RG2A 1WSWA 1KJNA 1YBFA 1I8DA 2Y8EA 3BBLA 3PI7A 1OH6A 5AJYA 3RRJA 3H2BA 3N2GA 2JI4A 2GVNA 2O7SA 2OHHA 4ZQIA 3II6X 2P11A 3DMRA 1E3JA 4PWYA 1O94A 5EPEA 1E7MA 1DT3A 4A5OA 5G2OA 4EW6A 2AK2A 3FPEA 4GSYA 2OVFA 4A0HA 4ARZB 2ROQA 1ZGZA 3D7RA 3LUDA 1JHAA 3A3BA 2EVWX 3NYQA 3LBIA 2IEAA 5EQJB 1CZNA 4P53A 3VVMA 2JLUA 1D1SA 1J1UA 2NQTA 1EWVA 1X0VA 3OEYA 4F3CA 2VTVA 1DKOA 1TT5A 5EJEA 3CZ5A 4QO7A 1NV9A 1VG9B 4FFBA 4NL4H 4QXAA 4Z4YA 4A8JB 3PG5A 5FRDA 1CQJB 4FPXA 3SIWA 4BNNA 1MIOA 5FBQB 3QFFA 4WKOA 1YE5A 4DILA 3NTVA 1F7VA 4UVDA 1IYZA 3TLEA 2H9YA 1UPCA 4BMOB 3ECAA 4ROTA 5E7IA 2ECOA 4OREX 1Q20A 1JDJA 5J40A 1JMVA 2I1QA 2DXIA 1E63A 3UICA 4XD7A 3AEYA 1FYDA 1LWNA 5ENDA 2OAGA 1QTNA 4U4AA 1O9BA 1OZ0A 3SX0A 1TQ6A 2UYYA 5TARA 1Q83A 1C3OA 3W5AA 3MTAA 3OX1A 4AP6A 4Y2HA 5KYWB 5BURA 5KU7A 2ZT6A 1S96A 3RUEA 1NBAA 2L0XA 1FFEA 2Q2VA 3LLUA 1CVRA 2Q28A 3SHTA 4CQMB 1STOA 3DDHA 5JSZA 1GVNB 1U2PA 2A5FA 4MYHA 2H3HA 2FX3A 1L1QA 5ADWA 5I9MA 4DMHA 1QE0A 4B34A 1I36A 2OB1A 1QANA 4HRAA 3AM3A 1IXRC 5T4FA 2EG5A 2X8JB 5A4MS 3F7MA 3MLEA 4N47A 4EJSB 1J00A 4Y2GA 3TIFA 4KSYA 5MFPA 2V6FA 5HILA 4MUIA 4GOXA 1JIKA 3FPPA 2J6BA 5BN3A 3QIAA 4YAJA 1G9SA 1UDAA 3HLYA 4G1VA 4GX1A 2R8RA 2FMHA 2HYDA 3S1SA 4XVRA 2QAGB 5E4JA 3NQ41 2WAAA 1EFRA 3OC6A 1YR2A 3U09A 4BQPA 5DNUA 2HW8A 2HK8A 3ZC3A 2W4MA 1T4CA 2XMRA 5IW8A 4D56A 4FE3A 5REQB 1YONA 2W2LA 4OH7A 1ZMXA 3UCXA 4TQGA 1F12A 4MW9A 1DVRA 1XD2A 3KJNA 3RU7A 3RVOA 3C7TA 1JPNA 4BLPA 5K6AC 3V4SA 2OAQ1 1CUAA 4KGVA 1EDBA 2J3HA 4TQAA 3JALA 3QY9A 4LSWA 3KC2A 4NQRA 5FBHA 2BH9A 3LPAA 4F6RA 1M67A 3DP9A 1H2BA 3C3JA 4YRRA 1XNRB 2SNIE 1Y9EA 3WAJA 3ZD7A 4RPBA 4O1HA 3WJ2A 2QM8A 3Q0TA 3JRNA 2WYHA 3Q7IA 3QXCA 4NATA 1SUPA 4MLZA 1YZHA 4CKWB 2IZ6A 3NC4A 4MV3A 4D92A 2JCSA 3O75A 2QP4A 3HFSA 4EGSA 1F4PA 5KHLB 4TZTA 1G17A 3H9JA 5KQRA 2ZDGA 4N1AA 3REOA 5AHXA 1P7CA 3FOZA 1JSZA 1WSVA 4ZCRA 4G07A 2R60A 4U7JA 4ZMSA 2R9VA 1QRAA 1AQ6A 3GIRA 5TQJA 3ZEAA 3ZD6A 1RRPA 4ITVA 2ZJ5A 3WLMA 1HYQA 4GPIB 4YT2A 5E3JA 2OD7A 3JWIA 5ESDA 2DOGA 4MNTA 4OLBA 4MW4A 3H2YA 2XT0A 2DLDA 3EJWA 1DWQA 4ZK2A 4FXUA 3AR5A 4EY6A 3K70C 1UH5A 3LCUA 2BKVA 3LKZA 4NABA 1TZ2A 1KP3A 4NP6A 4EABA 4JROA 2JJ8A 4H1UA 4Q1DA 3TDNA 3C14C 1F6DA 2YHIB 1H23A 2QLLA 4GXNA 5U1PA 2Q5QA 3MAAC 2HMWA 2J3JA 3PNLA 4DMLA 1TLFA 3BKWA 3WNCA 2GM5A 1TTQB 3A04A 1OBOA 1JW9B 3E6AA 2HXYA 2QSYA 1TK2A 4D4KA 3S70A 3P0JA 2G1KA 4D5GA 4HLUA 5F9HA 4OVKA 4MAAA 5BOVA 5JMTA 3S8EA 2B8NA 1CRWG 1I4TD 2VUSA 1LLUA 4CMIA 3I01M 1JQJC 4UNPA 1Y1KE 3KAKA 1Z0FA 3BXPA 3LA6A 3QLUC 2ZUFA 1AZTA 1X7DA 4C6TB 1Z7EA 4NZYA 5CFNA 2AG6A 3A4NA 5IAOA 2VK2A 4C0SA 1UF9A 3BRWA 3ND6A 4MV0A 1M73E 3H8WA 4PTYA 5AYVA 3UMCA 5K4GA 1R6VA 1RCFA 1XD9A 4O25A 3OIWA 3PL5A 1SUDA 3ULKA 3SF8A 4AN1A 4RH1A 4ZVMA 1BXGA 3W6UA 1E1RD 2OB2A 4NBRA 1SXGA 3AO0B 2P2GA 2O8BA 2AX4A 2AJ8A 2OXFA 1TJ4A 2Y1OA 2HSWA 1S8FA 3FIUA 5KMGA 3R3WA 4JI2B 1Y6RA 4KK4A 1CUGA 3L40A 4UVEA 4F92B 4OQLA 4L3OA 2O4CA 2Y1WA 3VVBA 3ZQ4A 2YTZA 2J9FA 2QUAA 1UINA 2VTDA 3CISA 1ZG3A 3DE5X 3PXDA 4MYCA 4N3CA 1OX4B 3B3JA 4HB4A 1W0JD 4AP9A 1OI2A 4GM1A 3P2MA 3A05A 2BFFB 1KEEA 1XKQA 2FQQA 1WQ4A 4H17A 5G53C 3AW8A 3VA7A 2CL6X 2ZJ4A 2IHNA 1GQYA 3N0WA 2UZ1B 1RLJA 3SHOA 1X9IA 2Q1UA 1XEXB 3OIGA 2GAIA 4ER3A 9MHTA 1UQRA 1T9KA 1J49A 2WAXA 2GN0A 2Q6LA 1F0PA 1N6RA 4LZLA 1T9ZA 2IOQA 1E1KA 4NICA 4CETA 3LS2A 5ICFA 1L4LA 2OQIA 3RG8A 1RPAA 1RQLA 1N4DA 2ZAIA 4MEJA 4ZT3A 5BWNA 4EB8A 1E77A 1A9SA 1QAOA 2ZYUX 1KU0A 3NC0C 4URUR 1U8UA 4JLWA 5E9JA 2DB3A 1UK8A 1U1FA 2ZIXA 4RA6B 3CP8A 3JQAA 4ZEOA 1Y8AA 4CEIA 3RIYA 5CX4A 1JG6A 1T6ZA 1GN9A 1G21E 1VQ6B 1W47A 3AETB 3EQ7A 3CCLB 3U4AA 4G4IA 4HL6A 4UAGA 5FUWA 5HFJA 5ESRA 3DYBA 1XWIA 2JGEA 5CVJA 5HMLA 2BHTA 2NSJA 3N8IA 3TZHA 3UV6A 1HUQA 3L92A 1IOLA 1Y34E 1OGJA 1TKBA 2GI4A 3O2SB 5LA6A 1MB3A 5JWOA 2HIAA 3HH8A 2DYKA 3BXGA 1SCNE 1WPRA 3R20A 4LRSB 3B7PA 2NU9B 3V7FA 3DEJA 3FCEA 3FLMA 3L5KA 1F51E 2BBOA 4OI1A 3HDJA 3REQA 4F91B 3QLJA 4KN8A 3WLTA 4CNBA 1YH3A 3DD5A 4MP8A 1Q2UA 3ELDA 3FGPA 4KTVE 4MW6A 4PC2A 4QSHA 2RAVA 3M5CA 4JSRA 4X61A 1PZFA 4XJTA 2G04A 3ZZ1A 4FBLA 3DPSA 1S2LA 3JVIA 2IXAA 4NFSA 5K3OA 2J5KA 4RSGA 5BSWA 3ORHA 2R8YA 1MO3A 1B8UA 4JFRA 1JYSA 3PTZA 1DRKA 4BNFA 4IJVA 3QUSA 4GMKA 4NEGA 3VGJA 5FWYA 4F06A 3IUMA 3UK7A 2EQ5A 1EUCA 4YAKA 4ASUA 1CV2A 3M82A 4YMTA 1N2XA 1C4WA 3OE7A 4A27A 3GLFA 1B15A 1U81A 2BEVB 4JELA 1R6DA 2UYGA 3ILSA 4HP8A 4EB6A 2BGTA 4WOPA 2DY1A 2B2XA 4L8LA 4S35A 1R9MA 3BXHA 1UJ6A 3KETA 3E9EA 1IZZA 1WMSA 2QDKA 2ZJ8A