3VO1A

Crystal structure of zea mays leaf ferredoxin-nadp+ reductase ii
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
295
structure length
295
Chain Sequence
SKKQEEGLVTNKYKPKEPYVGRCLLNTRITGDQAPGETWHMVFSTEGEVPYREGQSIGVIADGEDKNGKPHKLRLYSIASSALGDFGDSKTVSLCVKRLVYTNDQGEVVKGVCSNFLCDLKPGAEVKITGPVGKEMLMPKDPNATIIMLATGTGIAPFRSFLWKMFFEEHEDYKYTGLAWLFLGVPTSDTLLYKEELEKMKEMAPDNFRLDFAVSREQTNAAGEKMYIQTRMAEYKEELWELLKKDNTYVYMCGLKGMEKGIDDIMLDLAAKDGINWLDYKKQLKKSEQWNVEVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferredoxin
publication title N-terminal structure of maize ferredoxin:NADP+ reductase determines recruitment into different thylakoid membrane complexes
pubmed doi rcsb
source organism Zea mays
molecule tags Oxidoreductase
total genus 98
structure length 295
sequence length 295
chains with identical sequence B
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2012-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 3vo1A01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 3vo1A02
1S0UA 2QA4B 2GPJA 4TMVA 2VYQA 1EFTA 3JQPA 3CCVB 3JQRA 3CC2B 3WBKA 2DETA 1EFUA 2BVNA 1YJ9B 1Q82D 1ZM2A 1EP3B 2VNHA 4B47A 1ZUNB 3I1FA 3OJXA 4RD3A 3FPKA 4C0SA 2GQFA 4EH1A 3WNCA 1FNMA 3VNVA 1H42A 1IJFA 3G71B 1VQ6B 3CD6B 2QEXB 2BPOA 2DCUA 2B7BA 3CCEB 1QUEA 1XE1A 1VQKB 3QE2A 2YWGA 3CW2A 4NBSA 4TMZA 1W34A 1Q81D 1N8RD 1BJKA 3VMFA 1QG0A 3CMAB 1OB5A 2RC6A 4H9GA 1E63A 3B8HA 2PMDA 3CCUB 5H5JA 1WDTA 2FX3A 4M53A 4B43A 1DDGA 3G6EB 3CMEB 1KRHA 1GVHA 5GV8A 1ZM4A 3J81k 2R6HA 2HCJB 1I7PA 3CRZA 2BGIA 1GR1A 1HA3A 1H85A 4PGOA 4Q7JB 1BQEA 1EP2B 3OZUA 3CC4B 3ZC3A 1B2RA 3VO1A 3W5UA 3A1FA 3MMPA 3W2GA 2C78A 4ACAA 1IB0A 1VQNB 1QX4A 1NJID 3ZZTA 4YAWA 1EWYA 3U2QA 4AF6A 2C77A 2ZITA 1S72B 4K1XA 3E20A 1W2BB 4G1VA 2QDXA 1FNDA 3P27A 1YI2B 4RD4A 4QHYA 1DARA 1OGIA 1JB9A 4B44A 1QVFB 4ZCIA 1OGJA 5KSWB 2RC5A 3MCAA 2YWEA 1GAWA 2YWFA 4RJLA 3LO8A 5TR9A 3CCRB 3CB4A 4ZV4A 2QMUA 4ZCMA 3LYUA 4PC3A 2VNJA 4ZGQB 1JA0A 2BN4A 2XEXA 4RCZA 3U6KA 1EP1B 2BF4A 4PC2A 4G1BA 1GO2A 2D74A 1NDHA 4LBYA 3W2HA 1CNFA 3CCMB 1M90D 4RD2A 1QGZA 3I56B 3WXMA 1VQ7B 2X3UA 1TVCA 2OK8A 2OTJB 1W35A 4M2LA 3FJOA 3AVWA 4IW3B 5H59A 1QUFA 1J9ZA 2NPFA 4ZCLA 1ELOA 3SJZA 3QFCA 1D8TA 1SM4A 1FDRA 4YHBA 4YAUA 2PIAA 3OJWA 4TMWA 4ACBA 4AF7A 5FA6A 1VQ8B 5EMNA 3ZZUA 1YITB 4R71A 1KJZA 3LVBA 2QTZA 4Y9RA 3OZVA 1UMKA 4DQLA 1QH0A 4N3NA 4FWTA 1KK2A 5GV7A 2B7CA 3V76A 1FRNA 3WBJA 3QFRA 1QFJA 3OW2B 4BPRA 2EFGA 4LBVA 1FRQA 3CC7B 1R5BA 1TUIA 2BM0A 3QSYA 1QGAA 1EXMA 3I55B 1YJWB 5AN9A 4YALA 2XNCA 1G7TA 1QFYA 2AHOA 4YAOA 1VQ5B 4HE6A 3ZBTA 3VNUA 1YIJB 1GJRA 1FNBA 3AVUA 3ZBUA 1YJNB 4G5GA 4C43A 2QN6A 4Y7CA 4TN1A 3CCSB 4TMXA 3AGPA 1Q7YD 3AGQA 4B48A 3WY9A 1KC8D 1K8AD 1VQ9B 3ES9A 2B5OA 3QFSA 2XNJA 1DDIA 2VZLA 3PENA 5THXA 4WQMA 4N3GA 3VO2A 3W5VA 1DG1G 4M1KA 3CXCB 1G7RA 1XB2A 5HXBA 2J7KA 3ZZ0A 4M0LA 4YAFA 1K9MD 4PC6A 2OK7A 1R5NA 4PC7A 1YHQB 1TTTA 1KK3A 4FN5A 2CRVA 1D1NA 3AVTA 2EIXA 3P26A 3W5HA 1EFCA 2VNKA 4M4SA 1FNCA 4MYTA 1E62A 4P3YA 5DSZA 1VQLB 4MYUA 5JBQA 3G4SB 1TLLA 4RCYA 3OZWA 1F20A 1QFZA 1U2RA 1VQMB 1IJEA 3W2FA 4Y9UA 2BSAA 1M1KD 1B23P 4F7DA 4NCNA 3AVVA 4QFMA 1ZM3A 1JNYA 1AMOA 4B3XA 1ZM9A 1G7SA 4RD1A 1R5OA 3W2EA 1G7CA 1E64A 3CCJB 4AC9A 3CPWB 2VNIA 1Q86D 1A8PA 4FK8A 1KD1D 3LRXA 1VQOB 1OB2A 1CNEA 1BX1A 1CQXA 1N0UA 3W2IA 4LC0A 1KK1A 1D2EA 1K73D 2PLFA 1QGYA 3WNDA 1VQ4B 1VQPB 3JQQA 4RD6A 1W87A 3WYAA 4PC1A 1BX0A 4P6VF 3AVXA 5TV2A 1GAQA 2E1RA 4LBWA 3U6BA 3QFTA 3AVYA 2HMAA 3CCLB 2QTLA 2HDNB 2DEUA 4UAJA 3E1YE 2DY1A 3B78A 3MHPA 1N0VC 1AIPA 4RD0A 1SKQA 3B82A 1KK0A 2YWHA 1JJ2B 4LBZA 4J0QA 2CNDA 1F60A 3CCQB 4U9UA 1JA1A 4B4DA 2BV3A 4TMTA 2DERA 4HE5A 4DQKA 2BMWA 1KQSB 2BM1A 2OTLB 3WNBA 4ZGNB 1QVGB 1KTVA 5TY0A 2BGJA
chains in the Genus database with same CATH superfamily
5TF0A 3OCJA 3OEEA 3IUJA 3NYRA 5MN4A 2WJPA 4RX1A 1Q3HA 3FKSD 4HYQA 5AJHA 2Y1GA 4D8TA 4XR6A 1E32A 2J33A 3HJTA 4E3ZA 5BP7A 1NVEA 2G17A 1VJSA 2OAEA 3HPQA 1MRZA 4U7FA 4POOA 2QI9F 3I9V6 3WYBA 5JAHA 4ER7A 3RJZA 1F0PA 3C14C 3FXAA 1LFAA 2FN9A 4FMBB 4I4TF 4E46A 4E6PA 2HRBA 3ZVRA 4RZUA 3KVOA 4MUNA 1UXJA 2DJ5A 2FPGA 3BDVA 3R41A 1IIBA 1OXXK 1C0LA 3ORRA 3QMMA 4HRXA 1DMRA 1V3QE 1YJ9B 3LF1A 2WJAA 4JJIA 4RVCA 4AROA 4DNTB 2RI1A 1P7CA 2G5TA 4I8DA 4FYHA 4N8SA 4B71A 4BNHA 3NOOA 4OP1A 5AW9A 1AGPA 2GM5A 1JIQA 3EVCA 3LDGA 4OU5A 5G3YA 3R7LA 3SZGA 5ADUS 3S70A 5I45A 2OL4A 4BJ5A 1B0ZA 5I7WA 3ADPA 4RDHA 4L2IB 2FEKA 4AP9A 3PWSA 1F3OA 1G21E 2AF4C 4I14A 4J16A 2ZJAA 5AM1A 4ZOEA 2CXHA 1IJKA 1FDUA 4Z4YA 1J2YA 1VLZA 2HK9A 4BAUA 1FC0A 1KQFA 2FPPA 1N5LA 4DARA 2F8SA 2C4VA 2OEPA 4PZDA 4PTZA 3PDJA 5ECYA 1DUSA 2HHCA 2WSIA 4OQNA 2FPOA 1M7HA 4MS3A 1RDFA 3DLHA 1GZHB 2XUAA 3DDCA 1VQKB 1VKOA 5E7IA 4R1LA 3CW2A 1T9BA 4KNYA 2VRCD 4LRXA 4F1JA 2AI2A 4F5EA 1LDGA 4MAAA 2LP4Y 3HV2A 3OO0A 1N0HA 3OH8A 4YGXB 4N0MA 5KJ6A 2HCTA 4G63A 4IXWA 1JQLB 4PFKA 4RK0A 13PKA 3SSAA 3TINA 3Q9LA 3UBTA 1TA0A 4MQ5A 3B8HA 4LRWA 2PMDA 3DMTC 3MFQA 1YB7A 3ED5A 3ONVA 1JIJA 2AZMA 5LB2A 3TVDA 2X6WA 2RB5A 4L4XA 2HJ9A 4TKZA 1E4EB 1SVNA 3T9AA 5K3CA 2EZ8A 4DJTA 1MJGM 2VSQA 3AETB 2MDTA 4MV0A 2I5PO 1TZMA 3GGGA 2PSDA 1MRNA 4PPFA 2FEMA 2BMDA 3DAPA 1IMJA 2B35A 4KUHA 2QM0A 2XYPA 5DBEX 2GD1O 3I6ZA 3CXRA 1K92A 1BEUB 1P17A 1KRHA 2NQ8A 4XTCS 4R1OA 4KOEC 2OBMA 2R86A 3X1KA 3JPWA 1JJ7A 1MT0A 3WKBA 2ERXA 2PXAA 3KSMA 2C4KA 1XTBA 3PWTA 1OFVA 2ADFA 4IGIA 1PEDA 3TRDA 5L8VA 2FP4B 4XLZA 1GR1A 3FJ1A 3KAJA 1V9LA 5AVJA 3ZW7A 4BB9A 2J85A 4FW8A 1KETA 1VKZA 3CZ9A 2DAPA 2EFHB 2UVQA 3D0OA 1Z7WA 3W5UA 4QVJA 2Q46A 4UBLA 5B2ZA 1E69A 4OH7A 4GXNA 1EDZA 5BUQA 3GPBA 1TQ6A 1KYZA 2ZB8A 1TLTA 2JJ1D 4V1CI 1E1LA 1QF9A 1ZRMA 2BHSA 2HTFA 3H2ZA 1NQ5A 4YC7A 1J0DA 2OPHA 3DDUA 4MIYA 8LDHA 4OI0A 4QO8A 1UC5B 1AJEA 3IOCA 1WMBA 1M2WA 3CQ9A 4HPWA 5AJXA 4E5VA 3SKBA 4UAGA 3PEYA 5CLLA 2YS6A 3IE0A 2NQ2C 1AQ6A 3MWJA 3U19A 4G4IA 2YVUA 2QS9A 5DNEA 6GPBA 2H4HA 2MINA 3EA5A 4ZYXA 2BC9A 4AMBA 2CY0A 3H1FA 2L2QA 2YC4C 3F8WA 1J0XO 4LYHA 4EFNA 4XONA 1K3FA 1DWQA 2C03A 1K7EB 4OM8A 4C03A 3T7SA 3DLCA 4LVCA 1OGIA 3KPJA 4IHJA 821PA 3SYLA 1ENYA 1RJEA 1YSCA 2VH5R 2HL6A 2YOFA 1QYXA 1M1XB 4NVRA 3UC5A 2ZXEA 4MO9A 3H4MA 4N1AA 4HLNA 4Q4HB 1PZEA 4PHTA 2C2GA 3DOEA 1N2CB 1A88A 3ENZA 3EXG1 4PIVA 4YLEA 3R7BA 1WL8A 3RUHA 4FB5A 3MCAA 4RJLA 1GLNA 1ZH4A 4P1ZA 3UICA 5JASA 4EVRA 4GMDA 1ECLA 4O5OA 4ZV4A 3LYUA 3MEQA 1B8UA 3BILA 4MUJA 3UPUA 1DJNA 2HXYA 3PVZA 4L5IA 4YROA 4BZZA 1U0FA 1VPWA 3EFOA 2RAUA 1YDGA 3PF9A 4OAQA 5TB5A 2V4DA 2A9VA 4ENSA 1P1HA 1CD5A 1Z4JA 8OHMA 3EH1A 2Z2IA 1E1QD 1Z9BA 1OC4A 2GN4A 5B3JC 3FOFC 2QYHA 2VO1A 2G4LA 1L7QA 2HC9A 1X7YA 1US8A 1V16B 2O3QA 4KAXA 5LDGA 4TYMA 5CMLA 1CNFA 4EHJA 3F3MA 1ZO8A 3ZWKA 1HC7A 1O2DA 2C97A 2H2AA 3AR8A 1N34B 2QD4A 4LJYA 3A7DA 3ITDA 4HZGA 5FO0A 1JV2B 3ANNA 1EX6A 4NU8X 1E2UA 3B1VA 3D6NB 5DLDA 1AS3A 4HEA1 1PS0A 4UFPA 1V1MB 3UEOA 2XSZA 5JEEA 1CQZA 5DOZA 1M2VB 4ZV7A 4DLZA 2RDMA 3JZIA 3PFNA 3U7QA 3EQ6A 1P61B 1XJWA 2Q5HA 3G0BA 1RWKA 1UANA 3WHLA 1P2TA 3BGSA 3MWDA 1OILA 4DMGA 4G7WA 3NOVA 1LDNA 1XNJA 2QUBA 5HJ5A 4MR7B 3M5PA 3RQIA 2ZIWB 3ZHCA 3A2NA 4YHBA 3NHUA 2ZR0A 2PBZA 4IWNA 4XN0A 5DSXA 4E3WA 4C7XA 4DC1A 5HZKA 3RRMA 2VHJA 4DDWA 1TUGA 2X1HA 2D2IA 5K0JA 3S28A 3FHJA 4KQCA 2D06A 1KJJA 3LCCA 5CVJA 3DOJA 2A6PA 2W70A 3TEJA 1FYXA 4LQDA 5KJFA 1VTKA 2A14A 3PXCX 2NTVA 3UJDA 3AW9A 1AF7A 1X74A 4DJDC 2BYTA 1KORA 1U1DA 3FIUA 1I8TA 3IR6A 5CAEB 5A6VA 2BKUA 4MI9A 2P3OA 1TCVA 5BMOA 1N1EA 2OZVA 1NN0A 2IYOA 2GN2A 3NCHA 3VHXB 1OE0A 2CZGA 4BGDA 1P0MA 1C50A 1KJ8A 1AG9A 1KDVA 2WZNA 4AJ9A 1SQSA 3EGDB 4IDQA 5EEGA 1J8YF 1UKAA 3NV7A 4HWOA 3E8MA 2XODA 4BOYA 4YDSA 1DAFA 4JX9A 4MDEA 1KK2A 1HFJA 2JNWA 3U4QA 1OXKB 3KQTA 2WM2A 4QU9A 3MIIA 3EJWA 3UPTA 3RVBA 1UBUS 5AVXA 8MHTA 1PJ6A 3OW2B 3BORA 1JEYA 3K70B 2CLEB 2B1QA 2WM8A 1O6CA 3O90A 4BWYA 4TWZA 1EP9A 1Z0ZA 4IIJF 3ZK7A 2JLBA 1C7FA 1V11B 3C3JA 3M1IA 2WAMA 1LPAB 1E7MA 1UMCA 4H18A 4HC4A 4KQEA 4QLOA 2OHHA 1EVQA 3RUPA 4CU2A 1N05A 2C83A 1SD5A 2WG0A 4EO9A 2W6QA 1VQ5B 1RNLA 2A5JA 5CX4A 2P68A 1GU0A 1KNXA 2IH5A 4F2GA 2QD1A 3EPKA 3C7CB 4BX0A 4DV6B 5CIQA 4OUDB 3GEEA 1QRSA 5DISB 4A91A 5MN6A 3M6LA 4X9XA 1II9A 1L7NA 1T5EA 4BX9A 1ZAYA 1TCUA 3LQ1A 2AFIB 5B4VA 2WPNA 3X2EA 4HGRA 4II2A 3WK7A 3HSYA 3DW1X 4OXIA 4JJ8A 1E2EA 2AQHA 4ZICA 3ROPA 1BH2A 2W2NA 2ZS7A 2Q49A 2XUJA 2ODBA 2BFNA 3BQNB 3IKJA 3K2IA 4QGSA 2C2ZA 3DC7A 2G63A 3PJDA 3GLTA 3HKEB 1X0VA 1Z0SA 1Z68A 3MGBA 3BOSA 3R77A 4JHXA 3REOA 2QAJA 3FVTA 1TJPB 4KV7A 1I1QB 1TK9A 5FPKA 1XZIA 2HO4A 3NHYA 4X8LA 3IMGA 2X9NA 4J1SA 4TTVA 1Q0LA 4YNBA 4X95A 2IZ7A 3QF4B 2X8AA 5C7IO 4DRXB 5EXTA 3NT4A 4L4SA 1ZCJA 5D6NA 2NUTA 1P7VA 3VX3A 1V37A 4UXHA 1Q1GA 2H5IA 3FMOB 3CLUC 1MD9A 1MF7A 3EF0A 2EKZA 1C7JA 2FSVC 1QONA 3MXTA 4B84A 1NBME 4RZSA 3T12A 1Y63A 2XYGA 4MV3A 5HXBA 2HSJA 2ZTNA 1RJ9A 1VMIA 3FF1A 4CCYA 1QJCA 1YVRA 1ZXLA 3TOZA 2Q0SA 4UPVA 3KWLA 4KTTE 1M67A 1M1NB 1KVUA 1T0BA 1YIOA 4GF5A 4KQXA 4EGCB 4EIWA 5K09A 2RK3A 3AZOA 1IJBA 3T3GA 5KSOA 5TGDA 1AXGA 1NJ8A 4L15A 4B2YA 3VH2A 2XUQA 3OZIA 5A9SB 3KQUA 5JANA 1QK5A 2X4DA 1CIVA 5JJCA 3OIFA 1FLDA 1TQHA 5BV0A 4Y18A 5HQTA 3SXPA 1JFTA 1K7FB 2PFSA 221PA 2EZTA 4FN5A 2BGLA 3MWFA 3GVHA 5EWLA 4CM7A 5E6SB 4MVJI 2D6FA 1T2FA 5I4IA 1V5VA 2FWRA 2QL9A 5IFLA 2YHSA 3LE8A 3FMFA 4MKGA 5AWFC 4C08A 3D8SA 3KVYA 3GY0A 2C5HA 2UV8A 3AKDA 2WAYA 2QRLA 4DPLA 5L3SA 2BKVA 1PUJA 3HBNA 4JLNA 4ZOLA 3RARA 1ULZA 3HR8A 4XXHA 2BP7A 3E3OA 5B3AA 4D9IA 4OD0A 2HN9A 4KNVA 3M4XA 2GDJA 2IE0A 3ANTA 3EE6A 2BFEA 1KMHB 3Q3AA 4BMCA 4EMBA 2IYPA 2OO3A 1E3QA 1HTWA 2B34A 1XDDA 4LG1A 5DGDA 4XNFA 2D1QA 1YJ5A 2G8NA 2PRYA 4BEWA 3EVTA 2ZJFA 3NIFB 3LX8A 4OBWA 4S2UA 5DOVA 1XI2A 5GJCA 5BV8A 5EJ4A 2VK4A 3C7TA 2AT1A 3DBIA 3IMEA 4Q48A 1U5BB 3U3DA 5C7YA 4G09A 4DCUA 3HCNA 3T5AA 3HRIA 4EJSA 5JIBA 1GSIA 1M34A 3D5TA 1XZNA 4FZRA 4HNRA 1GTJ1 2GJ9A 1JPNA 1SC4A 4M1MA 4K81B 4BLPA 1Q92A 3WQSB 4B2PA 1JSLA 2J6BA 3BVPA 3DTNA 5DBOA 4ZGGA 3ROKA 4S05A 2J7PD 4FGKA 1GDDA 4FHGA 1BZYA 1I2BA 2HZ7A 3BH7A 3G0DA 4HP8A 1NRKA 1TAUA 3E23A 3W1EA 3T06B 4IJWA 2DQZA 1JXAA 2NV2B 1KJIA 2GYYA 2CL7X 3VV3A 2IS1A 2FPRA 4N5DA 5CVUA 1NN1A 2IS4A 4I6EA 4ITRC 2BZGA 4ZI7A 5TJHA 1JIVA 3GBPA 4R1UA 3SF8A 2VPWA 4AY3A 4F1WA 4C4AA 3WAJA 4O02B 3DLIA 2RKWA 1KI2A 4DCPA 1VHWA 4CETA 1U0SY 4HCJA 4DQUA 1WDLA 2GBLA 5KNLA 4MCAA 4ATNA 4CFYA 2QUJA 4HYYA 1WOSA 1Q17A 4I9FA 4LWZA 3VR3A 3V8PA 4EP1A 5ITWA 2VT3A 1WUJS 3OX3A 1PEKE 1C1XA 2FPUA 2NO4A 3HVUA 4V0RA 4OQXA 2DMRA 4NKRA 5KWJA 5TMPA 3RKUA 1K7SN 4Z4GA 1V96A 1D2EA 2J3KA 2PLFA 3L6RA 1OV4A 1N08A 2IX3A 3C74A 2RJNA 3PS9A 2ACKA 4OHUA 2Z1MA 1XZMA 4R2XA 1L3CA 2A3RA 4YACA 5K9ZA 2VWQA 4ZVSA 1XRQA 4BWGA 4C5AA 5IU6A 2Z95A 3QEAZ 2HU5A 2DHQA 2EG5A 1ENOA 4Q4CA 1GYQA 3AR5A 1IWPB 1YJBA 1ZC3A 1SPBS 4MVJE 1W96A 4P82A 2AN3A 4ND3A 2O0KA 2O5VA 3IT1A 3CCLB 3AB3A 3LKVA 2FMFA 4LECA 1BAPA 1XQ1A 3JQEA 4MQUA 1N5MA 4R9VA 4WXYB 3EW7A 1GZ6A 4QYTA 2ZJ4A 4B3IA 2JB9A 4K9KA 3D9QX 1GFSA 1ZISA 3DP7A 3MJCA 2PPLA 3U3MA 3HM9A 4DR1B 5KMGA 4YRIA 3LY8A 3FPCA 3Q39A 5ALPA 2P6MA 3KKEA 5AKZA 2X0KA 3S68A 2NXWA 3VU8A 3ER8A 3LU1A 2OBNA 3CBQA 4X41A 2DXIA 1XQYA 3FOBA 1WA5A 5DNWA 4FR2A 4JVSB 4KAFA 4RLQA 3HMQA 2Z5LA 4OHOA 2HQBA 3F6RA 3ENWA 3P19A 3ZGOA 4EM6A 3CCQB 1NIJA 1YE3A 3F2IA 3VGPA 2ZDQA 1T8UA 4RW0A 1NVVR 3BWXA 1V8OA 2GUWA 3JQ9C 4OQFA 4OJYA 3VYWA 3I2YX 2E85A 4K6OA 5I7HA 1IUPA 2W2OA 4NTZA 4NIMA 4QEKA 4EG5A 2G5CA 2LDBA 2IY7A 3IV7A 3F5FA 3FLEA 1BCSA 2WYVA 1T24A 2CSXA 2J0SA 4OFWA 1O9HA 5F5LA 1N5OX 2GA9A 4HLCA 5FAKA 3QBEA 3X1ZA 3NHFA 2GYVA 1PZFA 2PZEA 5B7GA 4JNKA 1H6DA 4LXGA 4DEXA 1Z2DA 1A4RA 2OORA 5BSTA 4RGYA 2JS7A 4XVRA 2F3TA 5B1DA 1LVHA 1HZZA 3NNNA 4WHMA 3IR5A 3ZHYA 4HEQA 4BJ1A 2IW1A 3V4VB 2QENA 3UFBA 4MIKA 1FDVA 3F7OA 4JBHA 4L22A 2CLKB 2V0CA 4DLNA 1HDRA 3N07A 4YV1A 3L7KA 2XNDA 2P79A 3TOXA 3HE3A 2KX7A 4AJOA 1A9QA 2JD2A 4R8SA 2HMTA 2X76A 4UNSA 1F2UA 4JUBA 1ZVVA 5AIBA 3OUZA 1LVGA 2WYHA 1TO2E 4PYRA 2QTNA 1L7VC 1R50A 3DB2A 1B1AA 3E9CA 5E9JA 4D6YA 1AN9A 3W3AD 4XM3A 1XO1A 3IEVA 3AKYA 3PYXA 2PM8A 1IONA 3HYRA 1TUBA 2OG1A 1GT91 3I1FA 4X3CA 2XB4A 3DAHA 2IS2A 1GYRA 1MA0A 1T3TA 3MGGA 1GCAA 4M0KA 4V38A 2D3LA 2BGTA 5GTDA 5HIIA 5KWVA 1RAIA 2OV3A 3CF2A 3RFCA 2DQYA 1X92A 2NSJA 2A78A 3K8QA 4NC9A 4MS1A 1O6FA 4REQB 3SDZA 1XKLA 5H3HA 2BFBB 2HI0A 2O2IA 1NLZA 2VRBA 3C41J 2WSLA 5LXTF 1JJBA 1CFJA 2EFEB 3F3SA 1VQ6B 2CHFA 5LZ5A 3WGHA 1JR3E 3ZHVA 3HA2A 4S12A 2DWQA 1FMCA 2C2KA 4CLRB 3ONUA 1MBZA 2CWDA 3QUQA 4C7BA 2J45A 5JLAA 4ETMA 1MO6A 1M8KA 2QRZA 3C6QA 2JCXA 3O1LA 3UH0A 1JTVA 2O07A 4JH0A 4OEHA 2V74B 3VI4B 3B9RA 3R6KA 4MA5A 3VMFA 1OYYA 3GZNB 4FFVA 3C5HA 4GPIB 1V48A 3N9IA 4YJHA 1QHFA 4K9NA 1F12A 5EINA 3QG5A 3CCUB 2HDWA 4XPIA 4LOHA 1CUVA 1MT3A 5A88A 2QN7A 5DEIA 5GINE 3GNSA 3I8XA 3OCZA 3FX2A 2XT9A 4M1QA 2P9EA 1FRFS 1PV1A 3C8DA 3RVOA 4ZOCA 1XL0A 2AZ4A 1G3IA 5AVQA 4F4JA 3EMKA 3RS2A 4B3JA 1D7OA 1Y9ZA 2G77B 3ETJA 2G6BA 5F9MA 5BW6B 5BR7A 1SXJE 1U3VA 1BHO1 2UZ3A 3EQ2A 1MB3A 1P9WA 3FNIA 3MTGA 4TLCA 4F96A 1BG6A 2I7TA 2IGTA 1N2EA 3H5TA 2OQVA 3C3BA 1ZUIA 1Q0QA 2GRUA 3H1BA 2CLCX 1R00A 3AWDA 4P9SA 3OIWA 2I2WA 2YW9A 1J5EB 1RS0A 2IOYA 2YXEA 4ZU3A 1E79D 2VPTA 3LW8A 2YXBA 2WIBA 2BFCB 3ZDXB 1FBNA 1E6KA 1T5LA 4DNRB 1X1AA 2YY5A 3D6HA 3QPCA 3QUSA 3UVEA 5MGNA 2VDQB 4E7PA 1Q7BA 4FXUA 4KO3S 3MLBA 4KLZA 3VI3B 1K5DA 2NU8B 1NTOA 1DAEA 4QYIB 4J49A 4EKEA 3UW3A 3TRFA 2EX0A 4EOGA 1APBA 1E2GA 1MAVA 4EATA 2H0QA 4TSFD 3CEHA 2CC2A 1NNUA 5FX2A 5IS2A 3AFNA 5KUTA 4PANA 3CBGA 1Z2AA 3IIMA 2HFKA 2KVOA 1O95D 4MP3A 1T5OA 2YHIA 2GUGA 4DCOA 4EA6A 1GTRA 3ZLJA 2YY6A 4HTAA 3FVVA 3NP7A 2D3WA 2IDMA 2VZ8A 3LHIA 4DCVA 4DSTA 2VDPB 3WRYC 3OECA 2Q3HA 4C29A 4UHJA 1MAWA 1UQUA 1Z16A 2E4UA 2LZ0A 3NORA 3PNQA 1PYOA 4DJFC 2VUIB 2E6KA 1SUSA 2RI0A 2YJ6A 1GPWB 3BWDD 3PC2A 5CDYA 2RKOA 2C92A 2P11A 2R96A 3P4XA 4RVHA 3FPJA 3K09A 4Y6PA 1JDNA 1W59A 4GFDA 3NVMB 1JB9A 2ZT6A 1QU2A 2PX3A 1O6BA 3OZEA 2HT1A 5EJEA 1N9GB 3ZVMA 2QM7A 2HGSA 3DOUA 5BOSA 2Y0BA 5AKKA 4FZ5A 4TV8B 4ISCA 3PNMA 1XZAA 4BKUA 2QOEA 4QUIA 3SVTA 3CZCA 2NO7A 2XW6A 2AOUA 3F49S 3KQYA 3UGTA 2XV1A 3F2VA 1D1SA 1P4GA 2DUMA 3CCRB 4HEA6 2RHCA 1NZJA 5T3YA 2DC1A 1QFMA 4E1VA 1CE8B 4KR3A 5CM8B 4EGAA 1GZVA 2WWYA 1UBCA 3LLUA 4OQMA 1MOPA 4OHRA 5EWMB 1BTOA 4N82A 2B37A 1FK8A 3UG6A 3U6KA 1W52X 5FHQA 1VQ1A 4HQKA 3EOAI 4KYVA 5J4LA 4PSCA 3K1JA 1NDHA 2C4HA 2JAPA 2QX8A 4X92A 1QYDA 5KSPA 3TNYA 1JR4A 4U9HS 1I14A 1L5SA 1Y7PA 2FLKA 2QZZA 2XKAA 4MVJP 3W6NA 1NU6A 2W2KA 4L51A 4MXDA 4R8MA 1PR2A 1NTRA 2QR2A 5IDYA 4FKBA 4CEIB 2K7FA 4CV2A 3GWGA 1IHXA 2HPZA 2NMVA 1VQ7B 2CSUA 2G83A 2JFBA 4KAAA 1IDN1 1XEXA 4AIRA 1T2NA 1U0TA 2V7EA 3CRMA 4HOYA 5EZ5A 4ZJUA 5F1KA 2AHRA 3T1VA 3TMKA 5HIKA 5C31A 2Z56A 2JLYA 1FP2A 3LTEA 3ND6A 5HKLA 1MB9A 1E0DA 1OJ7A 1Z7EA 5KDLA 4O2AF 1QO0A 4IKEA 4LXIA 4LY9A 4XASA 2R1VA 2YYAA 3G13A 3SBXA 2KS6A 3JSXA 4Z7QB 4WFJA 3IDQA 1J7JA 3MCTA 4NFYA 4EHBA 4Y2RA 4X8IA 1S4MA 3HN2A 4DYDA 4PPYA 2YRFA 3VU3A 4WI1A 1A7UA 3WKCA 4E09A 1DQSA 1MQ8B 1U3TA 1Z6AA 3TW0A 1KVTA 4F3KA 5CDHA 2FAXA 3N2EA 2NYUA 1OBOA 5DI3B 3OQPA 4JLKA 4JT2A 2O2EA 4FWBA 4FONA 1SK9A 2WM9B 3N2GB 4Q82A 3HRHA 3KZMA 4DE5A 1XA3A 4RZQA 4GX0A 1XE3A 2DFVA 3GRAA 3LWZA 3J80A 1Y33E 3L0IB 3TQHA 3KJHA 5IYZB 2OGZA 1PI3A 2WVAA 2QBYB 1DAKA 5ADVA 3FAZA 3ABQB 3PQ3A 5LSAA 3PJRA 2WT8A 1N8TA 3I5AA 5LMCA 3ZDCA 3WO0A 3I39X 2BFWA 2AC2A 5ERYA 1VHQA 1BE1A 4Z4HA 2NG1A 5C7OO 3I04M 2C82A 1FLVA 2BI8A 4NDAA 3W77A 1YBHA 1GDHA 3KUCA 1P81A 4YVFA 4I4NA 4PY2A 3ODGA 4NAUA 3V8BA 4MAFA 3WHIA 4TSKA 5EG5A 4FIDA 5FTWA 5KYUA 1S01A 2PBFA 3EPHA 1V25A 2OHIA 2ZJ1A 1Q44A 1IBMB 5CP8A 3GVCA 2BDTA 4WJLA 1E3WB 5KOYA 1KBQA 1L7EA 1L5YA 1P0PA 2VQSA 3IA2A 3NVAA 1PR6A 4UHCA 2LNDA 3L46A 1WXWA 4NF2A 3GJXC 4FSHA 3OG9A 5KNDD 1J1IA 4PWYA 4GUDA 3WTBA 5L3QA 1ZS9A 5TT1A 4D56A 4W6QA 3VPSA 3RFTA 1R0WA 5C32A 2HIAA 3O03A 5KTPA 3A1CA 5DU2A 2OV4A 4Q9AA 2FE4A 1FQWA 3AVUA 3Q7PA 1PBTA 5ICGA 3F0TA 3KZXA 4JU8A 4H0CA 1TXGA 1FQOA 1R6DA 2V0NA 1PJ2A 4JD5A 2D8AA 3VDMA 4V39A 4OFZA 4F4CA 1G21B 2C0PA 3ORQA 1ZKMA 4O6VA 1GLGA 3GO4A 4LTMA 5CLIA 4AQDA 2F55A 3HUEA 4AJKA 3GD5A 4TLDA 4DS3A 1B3RA 1P3DA 2QY9A 2AB0A 3G5AA 3NDIA 4ZCRA 4L9RA 2IHYA 1HL3A 1NRWA 4DT1A 4E15A 2C2OA 2J67A 4P83A 4IHKA 2AVNA 3CGGA 4W5TA 2R8BA 4G6IA 3K20A 5I7UA 4FGZA 3TRJA 1OY1A 1Y8AA 1Z7BA 4CT4B 1MB2A 4JEMA 5JYDA 1CT9A 3WGUA 3D3QA 4Q4JB 5TT0A 2GHIA 1WOMA 2WG1A 4I5DA 4ZGBA 3AY7A 1RXVA 1OFHA 4R1NA 3UB3A 5JARA 4BV3A 2QROA 5AM5A 3AEKA 1JLRA 3VO2A 1K5GA 3KJXA 4IEEA 1UBSB 3M3HA 1CPYA 5DYIA 2G5PA 4TM7A 2GPYA 2XADA 1CYDA 2ATEA 2HIGA 3KJEA 1A9XB 1Y8QB 1LRLA 1YU6A 4RTMA 4IV8A 5M29A 3VR4D 2E4XA 4GKVA 4RPDA 3VAYA 2VJIA 1DPFA 1P7ZA 2FF5A 3DDSA 3ILYA 4CM9A 4EHHA 5K6TA 1EK2A 1EQAA 3W5SA 4RHTA 1I3KA 5LNK1 4BNLA 3VZPA 1CUJA 2ACVA 5D5PA 1UK7A 3OZSA 1FVHA 4O0LA 3MS4A 3WK9A 5DGCA 3H4IA 2PX8A 1U7UA 3UGQA 1SG9A 1M5TA 1WQ3A 2FWMX 3D6JA 4KIUA 4M0EA 4PU0A 4QGHA 1ZU5A 2V3WA 3EDCA 5BQOA 2I67A 3FRHA 2B92A 1T1RA 2E21A 3PE4A 1R5NA 3TLGB 4F7WA 5EJFA 5FBQB 1O95C 4GU5A 4Y2TA 1NR1A 3UOWA 1E18A 3A3BA 1VRWA 4PO3X 2OXRA 3I52A 3KBOA 4NONA 4NS1A 2COUA 4AZWA 4U7TB 2C2BA 4UU8A 5CT5A 3GJZA 1J7KA 3HDJA 5K8CA 4CF5A 5IWCA 2PZFA 2C8KA 5KU1A 4KIJA 1PVDA 4B7AA 1HPLA 2J6HA 5HS6A 3GJ6A 4BBAA 4QODA 2OV8A 4P3YA 3GP3A 1DC5A 1SIUA 4BCBA 2JCVA 4G5QA 1RYNA 5BWCA 5AW3A 5CFNA 2W6ZA 5BVGA 5JAZA 2I91A 2DSNA 3HGQA 3EXG2 2VUHB 1RJWA 1PJCA 2H08A 4E4RA 1Y0RA 5B1YA 2PUCA 1NQXA 1ADBA 3ELUA 4EUNA 4LRQA 1Z8HA 3PIIA 1QHGA 4RUKA 4B33A 4LYAA 1IJEA 3CLHA 3AJ8A 1DKUA 3EULA 5D8DA 1Y4DE 3AHGA 1KS2A 1E0AA 1C3OA 1AHNA 1EA7A 2X6RA 3RK1A 5LZ4A 5BR1A 1C1HA 5JQGF 2VZEA 1DEAA 5TSDA 1YL7A 4G0OA 4XSGA 2QG6A 3QLVA 3SQDA 5GJBA 4J0KA 4TLMB 3UBMA 1AUQA 3E3AA 1XPUA 3RVPA 3HACA 4GSYA 1SZPA 2X8JA 4LWPA 2X85A 1OLXA 2APJA 2FEPA 2R6FA 3IDSA 5EIHA 2AC7A 2RBGA 3UXEA 7AT1A 1BD3A 3SR0A 4A4DA 2C4NA 2DVMA 1ZGBA 3H0KA 2W7TA 4K8OA 4E2ZA 4RSRA 2C57A 4EKGA 2H29A 4IPTA 1CZOA 5ETJA 3DE3X 2FEAA 2H00A 3JQFA 4LY6A 5FTJA 4PG5A 1RWOA 3NW9A 1P5RA 2YZ7A 2EFYA 5BNWA 1DQYA 1T8WA 1EH5A 3ISJA 1OW3B 3V4PB 4NCBA 5AHKA 3GQVA 5EQTA 1MV5A 1C7QA 4IX9A 4QD3A 1UBLS 1GKIA 2Q5FA 1E8NA 1ML4A 1RZ3A 2Q1TA 1QTNA 1VSBA 4B46A 1QLWA 4J7AA 3A3NA 1VYTA 3L40A 5F1YA 5EZYB 2NV6A 1NBEA 2GNOA 4ARVA 2VIIA 2B94A 4R9RA 2IL1A 2A86A 1RJGA 3LM8A 5KWEA 1YZQA 1MJ5A 1IHUA 4TWRA 4OOVA 5AVTA 1TU3A 3M8KA 1G4AE 4HAWA 2B4TO 5ICFA 4QRIA 1W9MA 2GZ1A 4NEQA 2Y05A 3TVTA 1YRYE 3ZWOA 5EWJA 1ZGJA 5TIIA 1O89A 4MVJD 4GPAA 4DJJA 1QGYA 1KIMA 3I23A 4R5MA 3IQHX 2I3ZA 2RGGA 3PT9A 4KMMA 4UHFA 1Q1EA 3N8KA 3WZLA 1C1DB 4ZZ3A 4TRMA 4W9MC 4GR9A 1GNRA 2XT0A 3QWFA 2FDXA 5TQVA 4IDFA 1WUTA 4E31A 2J0VA 1CY4A 1PR1A 2A0YA 2WF6A 3CUYA 1H8HD 3OETA 4I5FA 2J4FA 5JNWA 2WHPB 2IUFA 1CWUA 3R44A 1WMFA 4D9NA 4MWCA 5DX1A 1B6TA 4MQ6A 1E2PA 5ALLA 3H42B 3KOOA 4IIYA 5HIJA 2I4TA 2I3AA 4C3VA 3W9YA 3S1LA 4ABYA 1N1MA 2IEIA 4GC9A 5EPEA 3RFUA 4OH1A 1I4DD 2CXRA 2XYVA 1Y3FE 3DL0A 4IQ4A 5CHEA 5ISMA 1KJNA 2CXXA 5CDFA 2LE0A 3S0JA 1N0VC 5CBKA 3TVYA 1DL5A 1P2SA 2WSSD 2VXCA 3JYPA 4B3BA 2MT9A 3B6KA 3DFFA 4YJFA 5BNFA 4AMYA 3VKUA 3GH1A 4C4TA 3BIWA 5G02A 1MRSA 4CLEA 3BMOB 1U94A 4CDGA 4LV8B 3L18A 4YO8A 1P4SA 2AK2A 3OOSA 3EVDA 3AVOA 3UCFA 3E1KA 1BMFA 4XVQA 4XVHA 3D6TB 4DR3B 3PWKA 1PJLA 1GG8A 2QORA 3PNSA 5L3RA 3Q12A 1UBHS 4YRQA 3R7WB 1D6JA 4HPJB 3QV2A 1HURA 3L7BA 4KPGA 3BH0A 2V59A 3LO5A 4I1SA 4F21A 2NXEA 1OA1A 4EB0A 1N3YA 4E5SA 1UDWA 2WWFA 2J3QA 1MCZA 2PU7A 1CULC 3W05A 4ERXA 3UATA 4DW8A 5JUWA 5F51A 4Z4ZA 2QW0X 4YRMA 2EP7A 1W9XA 5E6RB 4C0KA 2H1VA 4AP5A 4FUTA 5F4JA 3L7CA 1CY2A 3RTAA 1P72A 1W19A 2FMIA 3TIVA 4YJ3F 3ZR4B 2B30A 4J03A 3L02A 4U5QA 1LS6A 3QVSA 4WOKA 1IHDA 2VTBA 1NN5A 3BHIA 1GN8A 3ZCTA 3ICEA 4ZK6A 2NT4A 2V0GA 3OEHA 2WM3A 2H5EA 3N0XA 3E82A 1XMQB 5T4HA 2I0FA 4XLAA 4JGIA 4DG5A 3M5CA 1ZONA 4FQ7A 1G2OA 1TCCA 1X42A 2RGBA 4PE5B 5CYPA 5J2TF 4P0QB 3LY5A 4A0SA 3CJRA 5C52B 5DN6D 5KOHA 1WUYA 3IXMA 2J4CA 3FJYA 4RPCA 1HDIA 1Q1ZA 1NM5A 1XP5A 2BHNA 2F9MA 2NNWB 1SKMA 3NH9A 2XAAA 2OC9A 5ALJA 5JC8A 1P9LA 4IH9A 2GBFA 1JTFA 4JL6A 4RK6A 4E5UA 2NXJA 4KQIA 1KC1A 3W8RA 3JZDA 2OFFA 1CX9B 5KSZA 2OAQ1 1IEWA 5IKXA 2BVNA 2H92A 4ZRMA 2W6PA 4HN4B 2AJ8A 2VNHA 3MMSA 4CMIA 4XRGA 3PGXA 1E7QA 3F67A 2EKPA 4RVNA 3T41A 1XTUA 5MDHA 3L0CA 2F8TA 3ZLTA 2VUSA 2D9RA 3MINA 1PYGA 2IZ1A 2XAUA 3CISA 4ITUA 1IN6A 5JSQA 1DP4A 2ISCA 4HWGA 3SZLA 1DGQA 2OGSA 3P32A 4MB2A 1FNMA 4MUYA 4TVBA 4MVYA 5K2MA 2YL2A 2IYQA 3LHDA 2CXOA 5CURA 3TTTA 5LKRA 4QUEA 1TEHA 1Z7YA 1R0BA 2JBAB 3IDOA 5ARCA 3A6PC 4QUAA 2J08A 1UOEA 6PFKA 1QUEA 4MUAA 5HOEA 1MGOA 2YMPA 3MJEA 3RSLA 3H5OA 2WU1A 4S04A 1XJQA 1N0IA 1ARZA 3Q7TA 3M81A 1AC5A 1J56A 4NBSA 1W49A 4X6LA 4XMYA 1H4SA 1ZH2A 1COWA 2HWXA 1OLUB 4RSGA 5FOWA 4ZC1A 3O4JA 4J0DA 5LKAA 4E2YA 4RYDA 2YJ4A 3OZ7A 4D26A 1XYYA 2CE7A 2BKAA 2PT6A 4C7VA 5LA6B 3RU9A 3K0CC 3FPHA 2HXSA 4ZZ1A 5JAMA 3DG9A 3PKJA 3ZTWA 5C1BA 2OT3B 1GQYA 3U60B 1T5HX 4C6SA 1CR2A 3KT8A 3KVRA 4IUYA 4GNRA 4DLBA 4ER6A 2AF3C 4F8JA 1LB1B 4ZEMA 4NU5A 1M8JA 2WICA 3QKSB 4B43A 1WOPA 3SC3A 3FR7A 4Y98A 4TTPA 4Z8YA 2AXNA 2A0XA 4BWFB 2AKEA 1C2YA 4R4JA 4A36A 2QUAA 3DXXA 1GVHA 1M0TA 3QVXA 5DV9A 4ALKA 3Q8LA 4HXEB 4QVAA 1TM2A 4Q4HA 4ZP1A 5BXQC 1C4XA 2O05A 2VZ9A 4WPGA 1N2CA 3V8VA 3GXBA 2O8CB 5H70A 3MAJA 5CLGA 2FUNB 3FLMA 3V2GA 1TJNA 1E1NA 4MYDA 3COVA 1DU4A 1TYBE 4XPZA 2GAIA 3WWEA 4ALMA 4WKNA 1MPTA 1PW7A 5C37A 1Z29A 4RIHA 2F1LA 1RXCA 1FXUA 1OZHA 5A7GA 3VNSA 3D6FA 2F1HA 2WWGA 3ZY6A 3W79A 1E5QA 2H11A 3Q11A 3NKVA 1XEWX 4CTKA 5KVSA 1H2YA 2FZLA 2RONA 2JVKA 1T35A 4XEHA 1E7WA 4GT1A 1N6HA 1KJQA 1QB7A 1RQGA 1IZZA 4JLBA 3KLPX 2PZMA 4MO2A 5IEJA 1V16A 3HFJA 3DM9B 2LD4A 2XJ9A 2XTZA 1WMAA 3RNOA 2QN2A 3KIPA 3RSZA 1W2BB 3JAWB 5SICE 5IAOA 4XWTA 3WDLA 4EABA 3TLBA 3HCFA 3BA1A 1O03A 1FNDA 2IW3A 2MSWA 1G0OA 1ORDA 2YCLA 1BDHA 4MWGA 4KE9A 1UD4A 4OQYA 4I1VA 1V1MA 3JCZA 4MR9B 1DX4A 3I6MA 3P2KA 3L4JA 1M2VA 5AKEA 1GARA 4RV9A 4R7TA 3EH2A 3P0FA 2VK2A 4QG7A 2NM0A 2QRQA 3KD3A 2PX6A 1CLUA 3I58A 4PR0A 3ZXYA 1XRNA 3LL4A 5I9MA 1QE0A 1E3MA 4GI5A 4HQNA 4MZXA 5B3JA 1YE8A 3KFLA 2Y1DA 1DUIA 3SN6A 5AW6A 4AS1A 2W22A 1LBTA 3ISXA 3B1WA 1Z0KA 3PUMA 3VC7A 1N7JA 4X0CA 1OBHA 4ZCMA 1W48A 4NCIA 4P93A 3V8QA 1JA0A 1DE0A 2C9ZA 4HGOA 5KYNA 2OG2A 4DZTA 2IYYA 3D64A 3PQCA 1I33A 2BF4A 1NQAO 1PN3A 2EZ4A 3F6BX 5CAEA 5LR6A 1X13A 3AY3A 4QPPA 3IQFA 3PTAA 1WM1A 1KFBB 1RPJA 3ADKA 3FHLA 5IT0A 1LNQA 4IF6A 1G3MA 3AINA 3EGDA 3KXKA 5C3MA 3FTFA 1EEHA 1VI5A 2C99A 5JD3A 4B81A 5IK2D 1Z8NA 2W2TA 4EVSA 1VOTA 2IK8A 1L6RA 4Y1RB 5INTA 4W82A 1SA0B 4XDHA 4CIAA 3HYSA 3LG2A 2VF2A 5TMEA 1TVCA 2IUSA 2LWIA 3TSZA 2V1UA 3GJ4A 4YR7A 1VCNA 1T8YA 2OTJB 4UZEA 4NMXB 3SHWA 3KAQA 1FFXB 4FFBB 3U0VA 4WGFA 3U7QB 4LJ7A 1YA6A 3DXFA 2Z8YA 3IB6A 3ZI0A 5IYNA 4C78A 2GJKA 3CCBA 1FTSA 1QC5B 1QYVA 3RASA 1AZWA 1N0WA 1ZNZA 2XVMA 2CLDX 4Q6BA 4EQZA 3K0HA 1M9NA 1V11A 4JBIA 4OK6A 3VPCA 4ZHQB 4EF6A 5L46A 4UFOA 1EZ1A 2BE7A 2ZAMA 5H9VA 4NE2A 4BMOB 2VJMA 3P0EA 3EDYA 1XZFA 5CJPA 4DMHA 5C80A 1Y9AA 4FSDA 1GPAA 1GYPA 3AXSA 4OFBA 2VAVA 1XLVA 2Q2VA 1DC3A 2JI9A 3HU5A 5LNK6 1NXQA 4UD6A 4HX2A 4AG3A 1LRKA 1CVLA 2GS9A 3JVVA 2G4VA 2M32A 4R71A 5IAGA 4EECA 5GMOA 1AO3A 1D2NA 1QZUA 2CYAA 4I3FA 4I4IA 1Z4MA 1UBRS 4LUCA 4UTVA 2J3MA 3OZVA 4WW0A 3KSAC 4RPHA 4HV4A 1JFVA 4ODIA 2JAUA 2XF2A 2XE7A 1IH8A 5CK4A 4DSOA 4MI1A 4UQLA 2PSHA 2QV0A 1T0IA 1EKXA 1P62B 2X41A 2ZWVA 1S3IA 1ENPA 1Y6RA 2CF5A 2H1SA 3D4OA 3HKEA 2JI6A 4JVOA 2JPDA 4KSYA 3K1ZA 5BSHA 2D5CA 3I1YA 3P0JA 4X65B 2PBLA 2C8LA 4PBTA 3EN0A 4FYWA 1KAEA 1N6LA 1VI2A 1AVTA 3CC7B 3KR2A 3KQWA 2OWEA 1RYHA 2GB4A 1ONSA 3HXKA 3K6RA 4TQUS 4A0GA 2ZU0C 3HLKA 4Z54A 4JJFA 4RFLA 1UXHA 4IIDA 2ZYUX 4YALA 4FT4A 1M6VB 3DONA 2RGYA 3HJNA 2QL7A 2YZMA 1E6CA 5KU7A 3PA8A 1Z5VA 2W8BB 3CLVA 5CX1B 2I6TA 7MDHA 4A6DA 3ZWXA 4ND6A 1C41A 1WVIA 4MR8B 1YL5A 3GN2A 2VDLB 4R7GA 5KX5B 1UBNA 3EPPA 3HVJA 3RTEA 2VVTA 3R9XA 2DPGA 5GONF 4IO1A 2H4XA 4YEJA 5I6DA 1LTQA 3V7UA 4WA8A 4X1KB 2AFHE 5A9SA 3JARA 4ZOBA 2YJ5A 1HTBA 1F0KA 4GOOD 3CF0A 1A97A 1TI7A 3EXEB 1HH4A 1CQJA 1H1LB 2Z5FA 3HU2A 1OIWA 1XU9A 3ND8A 3NKFA 3OEYA 4ZN6A 2JANA 2QU8A 1VP3A 3PTZA 3F3KA 3TTYA 3ES9A 5KEIA 2BJVA 2OM6A 3DCNA 3AI1A 1NW7A 1E3EA 4RMNA 1Y4UA 2AMYA 3IAHA 2PGOA 4I55B 4XYMA 5E9WA 5U1PA 1UFQA 2HFJA 3H13A 5DHSA 4MB6A 2VZLA 1SXJC 1T1EA 3HR4A 1W1UA 1J2JA 5C8YF 1S9DA 3VJRA 3WNVA 2AMVA 1L1QA 4XWKA 4WQMA 4TTIA 3MBIA 4DBLE 2XNKA 3FNHA 4L4UA 4QEDA 4AZ0A 3PXUA 3SJ7A 1ZH6A 2OCLA 5JDCC 4EW1A 2CXUA 3K9QO 4PRLA 2DCMA 4UVIA 2I1VB 1RE1A 3WXBA 2NU7A 3U26A 3H9QA 2C5AA 3OT5A 3CXCB 4LSZA 1KMHA 2WLSA 5JNRA 4ZYVA 1OZ0A 3CZRA 4EW3A 2Q27A 2PUJA 5BOVA 1G7RA 2ES4A 1YS9A 3HUTA 2JD1A 4LWQA 1C8BA 3L49A 4P81A 1U2DC 1NXSA 3IRUA 2WWWA 3LDHA 3MUOA 4KPUB 2PT7A 4N9WA 4YPVA 1OI3A 3QVLA 1U5BA 2J3IA 3Q4GA 4O0MA 1SXJB 1GTG1 2YZKA 2R85A 3PQ2A 5D5QA 3U4CA 5JBIA 1FSPA 1TFRA 5AK3A 2C4WA 2BHRA 4C89A 1AK2A 2Q3JA 1WY5A 2ST1A 3BFJA 1S2IA 4G0QA 1NVMB 4LZJA 3L6CA 4HAZA 3DQQA 1LWOA 4IG4A 5JJKA 1PZXA 2F59A 3IQWA 2PX2A 1Z88A 1ODCA 3T3EA 4LTDA 1NB9A 3VPGA 2QAGC 4A8PA 3WYEA 1VB3A 2VYVD 4DC9A 1J2EA 5B6JA 3ZCXA 4Z9BA 5M7EA 2BFFA 3IALA 4QJIA 3K32A 1XKTA 4DLUA 3KHTA 3LUDA 3TMAA 2IYNA 4A27A 3DKRA 1EE1A 3SK0A 1WDWB 1LD3A 3A3KA 2H57A 4W5WA 3O1IC 4EB3A 5JR3A 3I42A 3JV7A 2GPTA 2X0IA 3GOHA 1SPXA 2O8EA 1B14A 1YMVA 3DA8A 2HLDD 3DGEC 4P08A 4PLZA 4ZDWA 4HDAA 2PLRA 4MP6A 2OBSA 2FP3A 4OSOA 1Q5PA 4CM8B 3OLQA 3RPEA 4RCYA 2D59A 2ZBPA 2OYNA 3ZU3A 2FQQA 5CRIA 3T5TA 1CG6A 3LCRA 2B36A 1AO0A 4XOPA 3K8OE 2F62A 2VT2A 3L0ZA 4Z5XA 5LQNA 4N01A 3FCXA 1Z2OX 1F51E 4D25A 1QB8A 5DNVA 3OPNA 5GOZA 1O94C 2GM3A 3I1IA 3I8SA 4GW3A 4PX2A 1E92A 3SZUA 3AL0C 1C4KA 3TQCA 2YS7A 2Q6VA 1YBAA 1NMXA 2HQ1A 4B7CA 4OXQA 4FDTA 2XDWA 1T26A 2ZTVA 3H97A 3QUCA 4KI0A 4L50A 3UFXB 4WFKA 3SC6A 3TMYA 3GGJA 3PRYA 3KCQA 1VKNA 2VK8A 3O0TA 1Y4SA 2O2YA 4FMDB 4BY9E 3ZY3A 4KTVE 3SSOA 1KI3A 1KQGA 1AKWA 1P80A 4BMDA 1RM3A 1IU9A 1E9VA 3QUTA 1KFCB 2ZE8A 4YV7A 4PHCA 1I3CA 3CPXA 1ZD2P 3MSXA 2OHFA 3KL9A 4RANA 3HCCA 4NAHA 5JCOC 3I5XA 4ALLA 3U7IA 1NZFA 3BS4A 3OPYI 4RDIA 4WV3A 4YO7A 4P33A 3PGKA 1R6XA 2EJUA 4BX2A 2IZZA 3OQVA 4J0FA 1G20E 1RYMA 3QQPA 1KPGA 1RTTA 3KLBA 1XNRB 5AOAA 4W1SA 3RM3A 4ZQEA 4WLOA 1OB2A 4F46A 3ZY2A 3RS9A 3TI9A 4LSMA 3DTTA 4CR8A 1AMUA 4PEVA 4GXQA 3IYLW 3S99A 2CYCA 3EGOA 3DCIA 3B48A 4GPBA 3QEKA 4DY6A 3JTEA 4BE7B 2VPZA 3BGOS 3BYZA 4L5JA 3LFTA 4NNPA 5THKA 1OX6A 1U8YA 4C2BA 3KWJA 3RAEC 4OP7A 1PL7A 3Q0EA 1AUXA 4GM4A 1FNNA 4XVCA 3D7MA 4WKCA 4PV7A 4JAVC 1QNLA 2A1TR 1SBZA 1HLDA 4WOJA 1VHTA 2ZM5A 1PGJA 3TX2A 5FI5A 3LDFA 3H86A 1RYDA 4O33A 4YQEA 3QWIA 3W5CA 4ABTA 3O8CA 5H83A 3M89A 2AYYA 2PKRA 1UM9B 4BLQA 5LOVB 3PQ4A 2ZJ0A 4BV2A 3C8UA 5ITVA 3LL7A 1WXHA 2PZGA 3OF5A 1RWXA 5EPOA 3L0SA 4BNTA 2QNBA 1KA9H 3H8JA 1OFIA 3RK4A 4KGXA 3D5EA 3TQOA 5I7SA 4X1IB 4NZZA 2REQB 3L8HA 2HDHA 4DK0A 1FDWA 3SXJA 4CTJA 1CHNA 4G9EA 4NFLA 4DRZA 3UWKA 4TLEA 2H4ZA 3KXDA 4EMTA 1CDDA 1U9IA 1KHHA 4EG8A 1GPMA 3OY7A 5AFSA 3PA1A 3M9LA 5FLKA 1P7WA 4L9WA 4DBVO 3R4CA 1LQUA 1Q7RA 4COOA 2ZWMA 1QFSA 1ZMRA 2P65A 2H31A 3HB0A 2P9BA 1M6YA 3H11A 3LQ2A 3K9FC 1ESZA 4GLBA 2JDID 3G6WA 1KWGA 3WIOA 3HCAA 4Q3NA 4L9AA 3OOJA 3O8QA 4DQKA 4W4TA 2HMVA 1ZNXA 3GHYA 2HA3A 2BFBA 4PLCA 5F64A 4MW2A 2YKGA 2PE3A 4Q01A 1G41A 2BMEA 4LDJA 3WTCA 1UC8A 3MWEB 3GH3A 4YCNA 1BH6A 2ZE6A 1RM4A 3NTLA 2A5LA 4ZO4A 1XZDA 2GXSA 1UFKA 3PFBA 4E13A 2WHYA 5CA0A 2QMZA 1SURA 4P0TA 1YACA 3VISA 4C7JA 2JAWA 1A72A 1Q0PA 1UJ4A 4KPYA 4AULA 2GN6A 2BTQB 1ND5A 3ZJYA 5IBRA 2GWRA 3ANXA 3HDTA 1BMQA 4KNWA 3VM6A 4F12A 5I01A 3I34X 4I50A 3KKNA 3SEAA 3H1GA 3B3QA 1KNQA 5JTUA 1G8SA 2CGEA 3OFKA 1HZJA 3F5SA 3N2KA 4K9MA 1YQ9A 2D0PB 1Z4IA 3GMIA 4P3KA 4R0NA 5KREA 1PD0A 1S9HA 1Q14A 2YN0A 1BS9A 3D31A 3VZSA 1QV6A 1NMSA 1PHPA 2X2OA 4UHKA 4KFTA 1R8QA 5BWOA 1ZM7A 2FDCA 1HO3A 5JD4A 1LZLA 1CY6A 1QDUA 4FOTA 5C7LO 3AL2A 3PDIB 3IOYA 4D9EA 1VIYA 2GTHA 3H0CA 1THTA 5HCNA 4DSZA 2X7XA 1ZUNB 3ZHOA 4F04A 5JD6A 2E7ZA 1F5NA 1L8QA 1X1CA 2HBZA 3F4KA 1JDVA 1CP2A 3FE2A 3AIIA 5E3JA 4LZOA 1Y7TA 4LGMA 2JCBA 5DULA 3DTVD 3TZCA 5IJZA 4LN1A 4YUWA 4MUIA 3DB1A 4YIHA 4QDKA 4XWAA 1E3SA 2W6ID 1BSVA 1C8VB 4N5IX 4DMRA 2PKQP 2P75A 4L7VA 4B17A 3G71B 3DJYA 2JHGA 3NBYC 3NI2A 4A5OA 4CKEB 4GD3Q 5EJ9A 3RU3A 4F2HA 5C51B 4WAUA 2QXYA 3W1WA 2QZ4A 2FRDA 2NU8A 3SHVA 1E9RA 4G37A 4BB5A 4BPBA 2Z2ZA 5G1PA 1NVTA 1QZZA 1WCXA 4JT8A 4JEIA 2WVGA 1ZK4A 4RE5A 4NPCA 4PGGA 2G5GX 3TTXA 1FXWA 2VQDA 3OTIA 2C2HA 1OTYA 2K87A 2XRYA 4ER5A 5A4AA 4KSCA 5JWOA 1UPCA 4N6NA 1XUOA 4IKPA 3EZ6A 3UK6A 1S4QA 4M3NA 3E5HA 3COWA 3O2NA 4JI1B 3RU7A 1E63A 2CLOB 4LVUA 4PQYA 5AM4A 1JAZA 2IYSA 3E03A 4LI3X 4PTYA 3HO6A 4LMPA 3UCEA 2NVBA 4G36A 2ZJ7A 4NI5A 3S2YA 2HMWA 2JHAA 2N47A 4XLFA 1V8DA 4M53A 2GFIA 4H08A 5TQJA 4BLVA 1WZ2A 3TZLA 2F1KA 1TGYA 2J3JA 4MMZB 5J5AA 3ZV5A 4BMSA 4EJ0A 4V3CA 1U2PA 4OQQA 3NU1A 3PRKE 4JI3B 4M9UA 2YBDA 3TZQA 3K0FA 5JAPA 3EUFA 1ZJ6A 1N9GA 1XELA 1AK9A 3OT1B 4I1PA 1NULA 2ODTX 1XTRA 4WXRA 4FKZA 1JEDA 4C14A 3DDOA 3MJVA 3FFXA 1T15A 4EL0A 3GZ4A 4OU4A 3I5UA 721PA 3L7JA 1I13A 1Z5GA 2ZRAA 1E1CA 1FYWA 1P73A 3F8TA 5BV7A 1JI0A 4NBWA 5BW8A 4LC1A 2Q8PA 2R6AA 3R20A 2VSXA 3WJ2A 1CE8A 3P0RA 5ALKA 3DBLB 2ZSEA 3ETNA 1JQDA 5FP0A 3FYDA 2FGJA 5EWMA 2P4SA 4EITA 1JPVA 1MG0A 2TRSB 1GZ7A 2QTVA 3AB7A 3UC9A 1IB0A 1FMTA 2BEWA 3AHCA 4QNMA 1QPZA 3PUIA 1FX0A 1QX4A 2VBCA 3BWEA 3ZWCA 3I62A 3H9NA 2QGNA 1JKMA 4AWXA 4F72A 4YAWA 1VL2A 4MITA 1GTVA 3KJIA 5FJJA 2X9VA 1E77A 4KQKA 5TQ2B 5CYFA 2D2FA 3L4BC 1DDOA 2QK4A 2UYQA 3QE0A 4TYYA 2XQKA 4MV6A 2DKFA 2ZYVX 3KOZA 2WTXA 3TOSA 1BU8A 2CXNA 1OX5A 1XRSB 2YMQA 1E9AA 3R9KA 4C3OB 5KYYA 1YFJA 2YYZA 2RH5A 2O8DB 2RGEA 5A6SB 2D13A 1XXHE 2HBRA 3G8DA 4V0ME 2WK1A 1YDFA 2X42A 3GLUA 3QUAA 4PZEA 3RWBA 3SSMA 5ESRA 3ERCA 2ZWPA 1AGYA 2PGJA 3FMIA 4JP2A 5AKXA 1XWWA 3JALA 4C0LA 4U6SA 3O82A 1JNXX 4US2R 1MHTA 4CMEA 2ZZFA 3SS9X 1M73E 4QVGA 4OG2A 1Y6ZA 1ZICA 3JQBA 3A0RB 2WJIA 3L6BA 2J1LA 3DWEX 1GAWA 1PX0A 2OFWA 2ZBRA 3UAWA 4QYWA 2FX2A 2XEDA 4QOIA 3MSCA 3A9CA 2OCKA 3T9EA 2G7MC 3PQ8A 4ZO6A 5DI3A 2B0JA 3TZHA 2XUKA 3TW6A 1JECA 1CJKC 4MQEA 2XEXA 2XE8A 3RS4A 4HB3A 2N9UA 3QA3E 3QVGB 4JQCA 1P29A 5FEMA 3LBYA 4XQCA 4KRFA 2ZI6A 2D74A 3LCMA 2G70A 5IYZA 1FDOA 4PNZA 1M2OA 3HUDA 3LZDA 4MCHA 5DMXA 3QF7A 1YB4A 3IX7A 1IK6A 1ITZA 3C45A 3SC2B 3H84A 3EIEA 4UM5A 4UARA 1MH1A 4O2RA 1QGZA 4L8FA 3TCKA 1XU7A 1N2ZA 2X3UA 3LUGA 3VKGA 4PGMA 1DTEA 3LPLA 3T4EA 4KMOA 3N74A 2ZBGA 3N86A 1SUCA 1DBVO 1H69A 3V00A 2WF9A 4AJNA 4YJ2A 2ZI3A 1EJ6A 2X1MA 1UK9A 3BIOA 1VYHA 3PRJA 4P31A 4QYXA 2HU2A 2RI6A 2C3UA 1WVGA 4MH0R 3TD9A 4OO3A 2V3CC 4ZCLA 1P6QA 1T0UA 1Y8RB 4GOLD 2B0CA 4JSTA 5KYKA 3QEBZ 1E3WA 2R7KA 3IXLA 3UZUA 1XC7A 2OHVA 4B4VA 2A35A 2OZLB 2X2FA 5FWYA 1N2IA 4JLVA 1FP1D 1NDUA 1HE8B 5CG2A 3VFDA 2FCRA 1WIWA 2FR1A 4IDOA 4JB2A 4REMA 3DMDA 1IWBB 1D6SA 2WTBA 1JMVA 2KE5A 4Q4DA 1ZGGA 4TKUB 5HQ3A 4NENB 1DZ3A 3BX1A 4H15A 4P3NA 2BLNA 2IYZA 4C0JA 4GX1A 1W29A 2FW6A 5AW5A 2R1TA 4G5SA 4Y2SA 5BV2P 1DO2A 1LSSA 4HDQB 4TLLB 3M3DA 2PH7A 3NBUA 4PNPA 2AE2A 1JEQB 1D3AA 3IAM6 2Q7OE 3NIGB 1HUQA 1MKYA 3BMNB 5CHYA 1CW2B 4JYPA 2LDXA 2IEBA 2FWIA 3ICCA 1S02A 2VXBA 3I4CA 3IP7A 3O8DA 3SSNA 2HCBA 2ZSFA 5ARDA 3IVGA 3HRKA 2QLBA 5AJYA 1DAMA 3ETDA 4GAEA 5ALSA 5LYJA 5HM6A 3FPPA 4TXHA 3IT0A 4MLZA 2H1OA 1A9SA 1QRUA 3THWA 5FFFA 4MUBA 4O2AA 3V7NA 1C9NA 3N6VA 1TO1E 3OFNA 4BMYA 1YS1X 1N25A 3CUTA 1FFYA 3U4AA 2VHEA 3GAZA 4WINA 1EDBA 1GZUA 1K98A 1EJ2A 1JKJA 2PRZA 3UA3A 4R2LA 4G4SP 5KVCA 3N8HA 1EXMA 1SBCA 2ZS9A 3LT1A 5AN9A 4IIGA 4FYXA 4BKRA 5IEBA 1Y8QA 2FSGA 3VGJA 2Y9MB 1Q7GA 1XTIA 3JZAA 3CP2A 3WQZA 3ZIUA 3G5UA 1GJRA 4TT3A 2VXYA 1EVZA 4PLHA 4GBED 3ABSB 2ETVA 2ODEA 1T9AA 1YB6A 2QGFA 3HJHA 4WD3A 4YB8A 5ALYA 3SZ3A 4ZDIA 1KQOA 4MI6A 5EJ6A 3OIUA 3COYA 4ROXA 4RJJA 2FQWA 1ZXBA 4BZPA 2NU9B 4AY6A 1Q7YD 3O0DA 4HSGA 1W36D 4PGHA 1LDMA 3BGWA 1XMVA 2SCUB 4BASA 2WJ6A 3QI2A 1LSOA 4IVPA 1ABFA 2CHUA 1J0AA 3EW9A 1V0EA 1JHRA 1WB4A 2XY4A 3IOEA 1KZ1A 1VQ9B 2B78A 3KZVA 2PXXA 4XUDA 1WQ4A 1SB8A 3QNWA 1HY3A 5MFPA 1OFUA 4UM8B 3ZLBA 1QYCA 4AKEA 2EJCA 3HU1A 2YNMA 2VPIA 1QLHA 3S2IA 1Y4AE 3PENA 4EA8A 3KYDB 3HWX1 1T5TA 2QRKA 4IDHA 3V9AA 4YDHB 1NATA 1DKQA 3GBSA 1UOOA 2PU5A 3UV7A 2L42A 2Y92A 4OHPA 4Q9NA 1PX2A 1MP0A 3QPVA 5B53A 4DMKA 1U9YA 3KOWA 1YHYA 1TCBA 1T6BY 2HF7A 4FXPA 4L74A 1E2JA 4HEHA 3LBFA 2I3GA 1WKVA 5A71A 3T4PA 4B0OA 1RLTA 1WP9A 3OQBA 3W8FA 1IMOA 1EFVA 4C06A 3TPCA 1CERA 1CUYA 3D4PA 1SZJG 4O1IA 3H3JA 1C4OA 1WPGA 4UTZA 4JP5A 1QAMA 2G07A 2ZI7A 2WVHA 4KXQA 2J9XB 5JS6A 4X66B 3HXMA 3HVKA 1U6JA 2H4JA 3PPVA 4RKWA 2IITA 3M4YA 4I1OA 5AQ1A 2X14A 1LDEA 1ZCBA 4F91B 3JWJA 1FOEB 3ZW8A 1J5PA 2IZ5A 2VCHA 3R5FA 4EG1A 4KKTA 3KJZA 5CCEA 1NJ1A 3OX1A 2ZWOA 1B41A 3BRSA 3ROTA 1XHEA 2A7XA 3MPOA 4K88A 1DBPA 1SCAA 4R9SA 4LS3A 4OHFA 3V46A 1H3EA 3TH5A 4FILA 2AC4A 2CJXA 1GFIA 2TMKA 3MRXA 4GMXA 3CB2A 4H7IA 5J5CA 2RD2A 4F6CA 4ZTZB 1NT2A 1K7CA 1E8DA 4KO8A 4BWVA 1KS9A 4LVOA 4Q9DA 3FGNA 1E9CA 4HGPA 1Z62A 4ZI5A 5AW8A 3ZUGA 3T52A 3B52X 3Q10A 1DHTA 1OHHD 1QH1B 4HB0A 1Z5ZA 4BHTA 5C8VA 1E2FA 4XLCA 3AR3A 1LA2A 2RHGB 1L5LA 1YGYA 3V2IA 1LC0A 1W73A 4MEAA 1QO9A 3VBEA 4AZ3B 3MOIA 3CR3C 1L4LA 1BRMA 4ZOAA 5JBQA 2DOKA 1MTOA 2CDRA 4CF6A 4KFSA 5DNDA 1O8BA 3GDGA 4LJKA 1QFZA 2Y1KA 4TV8F 2QVXX 4NNOA 2P9QA 3IBYA 4US1R 1K6XA 3PCTA 1YR7A 4IOJA 1ZIPA 5TQ0B 5IMSA 4B5KA 2CMFA 2WUVA 3ZDAA 4NBUA 4X90A 3S29A 3UF0A 4TTAA 3AESB 3WWOA 4P25A 1C1DA 4DMFA 5B4UA 3BJIC 5ALIA 4IXNA 1CUWA 4HYEA 4OGWA 5KCZA 3KRTA 1NJSA 3LYLA 4MHSA 4WVLA 2IUUA 3T7AA 1B3BA 1SQ0A 4IY1A 3TFWA 2Y1XA 4WX2B 1U80A 3WX0A 4B74A 3LX5A 4U3JA 1SULA 1PV2A 1VJ5A 3OZXA 4EGFA 1RABA 5CTJA 2W8ZA 3BFPA 1VA5A 4YT8A 2H06A 4HQ6A 5F52A 3U44B 3OZFA 5A3SA 4HWPA 1E64A 1DKPA 1ZITA 4TRJA 3ASVA 4IV0A 1NYTA 1JXQA 2AJCA 5JXGA 2AQIA 2C9OA 2H17A 3P9SA 10MHA 1EG2A 4O4JB 1DX9A 1NVWQ 5FR2A 4I9GA 1RKUA 3BMOA 1JW9B 1U7DA 2X19A 3Q3GE 3ZDRA 3QTTA 5FUQA 4XCXA 3VQTA 2CLFB 3ILXA 1G291 2JI8A 1ZK0A 1P2BA 2QRJA 2CLMB 3BAFA 3D8HA 4RLFA 3DWGA 4AAYA 4QNRA 1YZHA 2K5UA 4FINA 2OGTA 2F8MA 1XZPA 1K08A 1UWKA 4KN6A 3ZE6A 4TPKA 4Y1FA 2PGLA 5CDGA 1WZUA 5EFZA 1KJWA 2YY7A 3T5DA 2EX4A 3DMGA 3MOSA 4J4HA 4NYMR 2V98A 4Q9HA 1MNAA 3SFVA 1XEFA 2Z4SA 4BFUA 2JI4A 1GWNA 1NU8A 2E1BA 3KO8A 3RVKA 3HM2A 1C3JA 1QZ3A 3SHFA 3ZCUA 5I9NA 1KC3A 4OHMA 4D3FA 1BJTA 3QWAA 4YWJA 3WGOA 3U6BA 5HMMA 3D8TA 3ZQ4A 4YWHA 3RRXA 2Y2VA 3UAGA 4KEAA 1RKBA 5BMVB 3U16A 2Y93A 1KEPA 3K9CA 4NBRA 1JG1A 1R10A 1R5JA 5JPIA 4C21A 3OZCA 4LJ8A 3VR0A 3ZD9A 1GTSA 4QAQA 4Z2YA 1V5EA 2ZSKA 1HL7A 2QPTA 2X8BA 2XOEA 3FUWA 3ZBPA 3OCCA 1KDOA 5I9LA 4DJAA 2BGWA 3KOUA 4LZNA 4MCJA 2PUEA 1MOZA 1UEIA 1A71A 1PT9A 1WZEA 2O7SA 2WTEA 4LPKA 4D8XA 2A0UA 1IZ0A 2DR0A 4FE4A 3LJKA 2V7UA 3BPSA 4L3OA 4C9BA 2HJHA 2C2WA 5A4JA 3K1AA 2YJ3A 3DFIA 1UDAA 2A7QA 2P6PA 3UWDA 2AOTA 2ZIFA 4URHA 5WRFA 4BUZA 1RXWA 4XRRA 3QQ5A 3IKMB 1F38A 2OHJA 4WWHA 2PUFA 1GL7A 1FFCA 1GPKA 1GTMA 3CRNA 2FPIB 2KM1A 3R5TA 3OOHA 4L8JA 5IMBA 2QD2A 4YFVA 3SEFA 3DDYA 1HDOA 1XLTC 3ZCPA 1IN5A 4OIMA 4RESA 1Z0AA 1K88A 4PYQA 4MW4A 4MI3A 3MJSA 4EEKA 2ETXA 5TS2A 1YQUA 3DDWA 3WKEA 3GNTA 2ZR8A 4TM8A 2J9YB 4HFRA 2YDYA 4NDZA 4CM4B 4E21A 1ZUHA 1JLHA 4WESB 5CCBA 1TYEB 3A1TA 1QF6A 3B1ZA 4XGIA 2EKLA 2KW5A 1X7XA 2H2HA 2NYRA 3DKIA 2RGXA 1THGA 3GCWA 4OPVA 4HG2A 4X7BA 4MQFA 1KDZA 1GZ3A 2P2LA 5BWMA 1RR6A 2UAGA 4B82A 1I7SB 1Y3IA 2GRJA 5IBQA 1KH2A 1Z83A 2PH5A 1CC1S 1VFNA 5DF1A 2AQ8A 1A7JA 3BL5A 5DXAA 4AQYB 1RACA 5EIWA 3D4BA 3KU4A 1V5IA 4EY6A 5KHOC 4HVTA 1YVEI 4RJTA 1QXSA 5LIPA 2AFHB 2HHHB 1X9GA 1DVRA 2VJJA 1DAGA 3FYSA 2CF6A 4EHLA 2ODNA 2QA5A 3G0GA 1LS1A 2ZS8A 3Q3VA 1LCIA 1VG0B 3RUFA 3OPVA 3N7UA 3SMQA 3HG7A 2DFTA 3UJ6A 5IC4A 1JALA 2J87A 4B6SA 5AW7A 3W4IA 1XD2B 1MOSA 3C8HA 3LGXA 3O8OA 2P9GA 4PYIA 4CV1A 2BE9A 1C3LA 1WDMA 5TRDA 1ACMA 1E60A 1XLUA 1UIRA 2V7QD 4UREA 3TPZA 2QWXA 3LQ4A 4KQ6A 3G5MA 4CM3A 5CVDA 1MUUA 2XMDA 2HY7A 4F97A 1U2ZA 5M04A 4Q4AB 1YHNA 2HU8A 1NLMA 4ZARA 4AN0A 1UKVY 3FUVA 3AI7A 3RBVA 2NVOA 1XQBA 1B4DA 1CV2A 2ONJA 2WF5A 4BVFA 4C0BA 1L9KA 1T9HA 1GCIA 1P39A 4OIFA 4L28A 3LX6A 2FEWB 5EQDA 3OFJA 2I03A 3KALA 3IFSA 3OF2A 4US0R 5DRYA 1RHKA 4ARAA 3BY1A 4YTEA 5IJ9A 1UJ2A 2P6OA 3Q0TA 3TQSA 1T1IA 2ZE7A 3EA0A 1WWKA 2BGNA 1RLMA 4V2UA 5A2GA 2IZOA 3MILA 2V65A 3EC1A 4PYOA 3NEYA 4LCJA 4OFXA 3G2MA 3PX7A 3GELA 3WYFA 2QXUA 1Z6YA 3A6HA 3B60A 3FWYA 5IYWA 4H2DA 1NMZA 2NNLD 3ER6A 5A3VA 1IUOA 2PRIA 1BJKA 3D3NA 3EHDA 1XHLA 3HYLA 4G5HA 3AFMA 4NCKA 3ZV6A 1Z37A 4NZOA 4TTQA 3PXXA 1EUZA 5AH0A 2VJDA 1VSVA 1AXEA 5DHRA 1P31A 5C8XA 2K7ZA 2XXAB 1N9ZA 4P4UA 5EE3A 9ABPA 4A1FA 3FPGA 4M1OA 1KAQA 2HPVA 4HLUA 1FU4A 2C5EA 5J1TB 3VAZA 2AX4A 1W0KA 3W5JA 4EEZA 2ZRNA 1WDTA 4D0SA 3IEIA 4RDLA 4JLSA 1PT8A 4KGDA 4TRRA 2EDCA 4DNOA 4GI1A 3PZBA 2J31A 2KSQA 3G9UA 1EK6A 4KIWA 3TNLA 4D02A 4RH3A 3Q38A 5TF4A 2NU6A 4MUHA 1Z7GA 2WWXA 1E0SA 1P19A 2ID9A 3R23A 2AJDA 4OLJA 5CT4A 5J2UF 3MHTA 3PBKA 1Z0FA 2HHAA 4OKIA 1QX3A 2OV2A 1HZEA 1QDLB 4R2KA 2GPSA 1UBTS 4PVCA 4CL2A 1XXLA 1LX7A 2FJ0A 3PHLA 2E6UX 1AGRA 3PHHA 1BQEA 2BRUA 3OZUA 1G0NA 3CUSA 4RWEA 1EFKA 3WGLA 1F8YA 4J3FA 4BZWA 2ONKA 3ZE1B 3L41A 2DFLA 2WPDD 3MTBA 3NWOA 3G5TA 3VRHA 1DFHA 5CXSA 1R4AA 3QYAA 3DHVA 4TS4A 1UK6A 3MMPA 4NMLA 2NUBA 4WDQA 4YAIA 5BVHB 1ZR4A 2D62A 3E3MA 2MSEB 3JQ7A 4HWKA 4D79A 3NGXA 1GPNA 1MENA 3U17A 1XVTA 3JYQA 1I6WA 4YMSA 3GZJA 2XKBA 1GOTA 1DBQA 2QRVA 4V0KA 2BKEA 2XDYA 5IUKC 2HWWA 3ZGNA 2DUWA 3NTRA 4K1XA 3OWHA 2ZRQA 3WLKX 1RHJA 4O5AA 5EJIA 1K4MA 5T64A 1G8FA 1IBLB 1D4ZA 1ZIDA 2E82A 5A9RA 4Y1RA 3WMEA 2JIMA 1JJIA 4JXJA 1IZ8A 3FPBA 1LPNA 5CGZA 5K4HA 1G19A 4GOJA 3D2LA 3C7AA 3WK6A 3BMCB 3EVAA 3UCXA 3TF5A 5TMBA 3MMXA 1ZRNA 1FFXA 5B58C 3ND5A 1VHJA 4UTNA 1AN0A 1JPUA 1JH9A 3ASRA 1TEZA 1WP6A 2QW8A 3C3WA 4YLYA 1QC5A 2O1WA 2WP8J 1G20B 5H4HA 3NAQA 5HUJA 5K0LA 4X94A 2FFQA 3KT0A 2ZWIA 4WOBA 4H3VA 5ED0A 1O9BA 5JMPA 5C3UA 5JVDF 3JR3A 1M6EX 4P5PA 5EJAA 3K73O 1NXXA 2DTDA 3OEED 1TZKA 1NIPA 1A5AB 4LZPA 4LF7B 2I62A 4XIFA 3NFRA 3SYNA 4Q7MB 2X8KA 3V8MA 3LHSA 3GLIA 1QQBA 5E4FA 1YDHA 2JEYA 3NOXA 1NXWA 5DBFA 1Y6GA 1CJCA 2XA1A 3R7AA 3HYTA 4N12A 1ZWLA 3MJFA 1Y7LA 5G4LA 2IBSA 2AZXA 4QT4A 3WJ1A 3A8IA 3DQZA 1MFPA 2J3LA 4KVZA 3W2TA 3T8YA 1P4JA 1HYQA 1OCEA 1TTQB 4PW0A 3GVPA 4OLAA 2VUTA 3RVMA 3BB1A 4MWSA 1FJHA 1PWEA 1L7DA 2V97A 2Q4TA 2HLNA 3FVQA 1BYIA 1OWOA 4OJMX 3O8RA 2D2VA 2IT1A 3NV9A 3PE3A 1DCTA 1J2TA 1YK1A 2PGAA 2VTKA 4PAOA 4LMBA 4IH1A 1G8HA 3DZBA 5CFZA 2C7VA 2GHQA 4D4LA 4X8MA 4PYJA 1I1OA 3BGIA 4AN1A 4WXHA 4GM0A 1QUFA 1J9ZA 3E05A 2GZSA 2WD7B 3CUKA 4KXNA 4M54A 4C4SA 5J4YA 2OBRA 2WB2A 1SIOA 4NZYA 1W7AA 4M36A 4D96A 4Q37A 3KB1A 2HHLA 1M6VA 1R8SA 2XMCA 3LC0A 4K03A 4LYEA 4FPXA 3SHOA 1GSHA 2W8BA 1SBYA 5EN4A 4EQ6A 1BWRA 1DELA 1UKZA 5JWRA 1PSDA 1Z2CA 2MR6A 2VAMA 3D4LA 1QK3A 3LSTA 1ZJYA 5KX5A 2V6FA 3EIXA 5AVUA 2FZEA 4IGEA 1IQUA 3I12A 1TZ2A 5C0OE 1NT4A 2Q4EA 3BCHA 3R3YA 5GZ3A 4CM5A 1KYVA 1SQGA 4P4SB 2WWTA 3NYQA 3EXHB 2IPXA 1I24A 3BMQB 1YVDA 3C98A 3RJ9A 4D97A 3CRVA 3EXEA 1T36A 1H1LA 3L0OA 3ME5A 4KX3A 4Y2GA 2IV7A 1JR3A 1QH0A 3PK0A 5A4IS 1N2SA 2ENWA 2QP9X 2IZ0A 4R69A 4DQVA 5BW4A 1IB6A 2WFLB 4M88A 3KYCA 5HIMA 7REQB 1AY0A 1NV9A 1GL9B 3JATA 4F4HA 1TVKB 4E11A 3I72A 4IINA 4I55A 4MW5A 1FRNA 1N5JA 2R5FA 2CLLB 4FYIA 3IGFA 4V0NA 2A9RA 4HLQB 2IEAA 1E1MA 1QG6A 2PUVA 3HSKA 1P5HA 2R0QC 2B4YA 1TMKA 3CUUA 2PK3A 4MWZA 3WC4A 4G4JA 3TM5A 5HF5A 4UATA 1PEYA 4D43A 5JH7B 1G7TA 1EBBA 1NJFA 1U1IA 2ZYGA 1QIEA 1XR3A 3D43A 3D7RA 1U3CA 2HJVA 3FBGA 4M0CA 2I2FA 2R3SA 1YRBA 4Q7LA 5EGNA 2XGOA 4ZT3A 3VNUA 1YR9A 1NWCA 2GEJA 2ISSD 3TJMA 4J4BA 4DB2A 3GLQA 2B1IA 2IFTA 3CEPB 1SVMA 4LFCB 1O08A 3SNHA 3VOAA 1V1JA 1E6WA 3ZXSA 2YQ5A 1YJNB 3CUEF 3FPLA 3W5AA 1X7HA 2OO7A 2XXJA 4X64B 3PCXA 3ZVKA 1YLOA 4TN1A 1O9GA 1PNTA 2KBFA 4MKXA 5GY7A 1MDBA 4D9HA 4UCFA 5IWAB 2G1AA 1N5RA 2B3TA 2J41A 4MVJG 5ULLA 3QU9A 4BATA 5AVZA 4NXMB 1ZDMA 3WWDA 5ERXA 5ALDA 2ARKA 4EA9A 5B36A 3KEOA 1JXMA 1NUAA 4FCWA 1I3MA 3FOZA 2ZZMA 4OA8A 1V5FA 1EK1A 3N53A 2H1IA 5LA6F 2QZPA 5SZJA 3ADCA 1RBZA 1SVUA 3ZHTA 2C8JA 5ADHA 4NV1A 5CB8A 3COZA 2JRCA 1H65A 1YJQA 2ZB7A 4TKVB 3KQVA 4JC0A 3ZU5A 5HS4A 4COKA 2RGRA 1XKXA 3B70A 3FCOA 2R8PA 3IMFA 4KRYA 3WLIA 2ZAOA 3JWEA 4R9UC 5NULA 4CKBA 4DDTA 1N2JA 2PWZA 1RWBA 3P4UA 2B9EA 5KOJB 4XFKA 3V4OA 1HDYA 3R7NA 4P12A 3NXKA 5LVAA 1FS6A 4JX8A 1F17A 3C4JA 3WL8A 4CM8A 4R2MA 5FPQA 2YICA 1W4BA 3B13B 3AY6A 3KKOA 4AECA 4NZMA 4PRKA 3TUZC 1N8NA 3V2HA 1HNXB 3JQAD 4I99A 1GUAA 1FDIA 4RLHA 3PC6A 5F33A 3D8RA 3O1JC 5GONA 4RVGA 4WASA 4YCBA 1KO8A 4QU0A 1PS9A 1SCIA 4MGYR 2D0IA 2O2ZA 2X9GA 4IQ8A 2VYND 4EVIA 3UTDA 4EYEA 5L4LA 2V7TA 1SFRA 1UPBA 3ELDA 1M0WA 2D7DA 4BXOB 1UEXC 1T1SA 5KTYA 3NPMA 4YAFA 2WU3A 1FS4A 2ZYHA 1XVIA 3TLYA 2DWOA 4X61A 5JG7A 3W8EA 5LN1A 1K9MD 2YV2A 1FSFA 3WL5A 1XVVA 3ZKAA 1CY0A 3MAGA 2X0NA 3UFXA 4X85A 4IHAA 2XPCA 4CL8A 2IGBA 4HS9A 4DXDA 4KYTA 5F78A 3E58A 1QQAA 5H16A 1XYVA 2IKQA 3CR7A 4OHZA 5A7FA 1XQWA 3JD2A 2I4RA 4N47A 1D04A 2W2XA 1TU4A 2P27A 4ZYWA 1W30A 3ABOB 3K0KA 1WETA 2MMGA 1JHOA 4KBGA 3T7TA 2VNKA 4M4SA 3AUYA 3MUNA 3EWAA 2DQSA 3TLMA 2ZPTX 3BE5A 3T7RA 3V48A 5BPFA 2DBRA 4J4TA 5JADA 1WCIA 4ILKA 4OOEA 3OT4A 2C07A 3K5HA 3Q8XB 4J0HA 4KO2S 4U7JA 4Z6KA 5BYKA 3E3NA 2PA3A 4BMXA 5IXJA 2VLIA 4R84A 2E89A 4RVDA 1SCBA 2VHXA 3UJAA 4MTCA 5A1TA 1ZY2A 2C31A 2MSLA 3QW4B 3TIFA 4A2WA 2ZWAA 4KO4S 3V3KA 1QIFA 4N5MA 1XXHB 1U2RA 4RSHA 4R05A 2PFGA 5JCJD 2Z5GA 3FSEA 1V35A 5HKOA 4PFSA 5DTQA 3K7EA 4ZO8A 5H02A 4ARZB 4Z4CA 2ZGVA 1F7UA 4ZVPA 1M2NA 5J47A 1E66A 2IYRA 2QJWA 2V8BA 2XMBA 3FNBA 1NNI1 4NESA 5A7HA 3WGYA 1R4NB 4KQWA 4QUKA 3KNZA 2RHLA 4BP1A 3EZ2A 4YXFA 5EJ2A 1BXRA 2WUDA 4NNJA 5JDIA 2ATCA 2AN9A 3CRRA 1TQDA 5LQMA 1OU4A 4IVNA 4DDVA 1KTIA 1ZKDA 1ONPA 1JS1X 4B32A 3AOEA 5IZ4A 4YA6A 5GIOE 2WKWA 4FS8A 3HVRA 4IS2A 4B7ZA 2ZL6A 1AMOA 4Q02A 1ZM9A 2Q21A 4ER3A 5DCYA 1MEOA 4MVJF 5BNTA 1UM9A 4RD1A 5FBKA 5JSFA 1H2WA