5IYWA

Protruding domain of gii.4 human norovirus chdc2094 in complex with 3-fucosyllactose (3fl)
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
305
structure length
303
Chain Sequence
KPFTVPILTVEEMSNSRFPIPLEKLYTGPSSAFVVQPQNGRCTTDGVLLGTTQLSAVNICNFRGDVTRVGISHDYTMNLVSQNWNNYDPTEEIPAPLGTPDFVGKIQGLLTQTTRADGSTRAHKATVSTGSVHFTPKLGSVQFTTDTNNDFQTGQNTKFTPVGVIQDGHQNEPQQWVLPNYSGTSGHNVHLAPAVAPTFPGEQLLFFRSTMPGCSGYPNMNLDCLLPQEWVSHFYQEAAPAQSDVALLRFVNPDTGRVLFECKLHKSGYITVAHTGPYDLVIPPNGYFRFDSWVNQFYTLAPM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VP1
publication title Structural basis for GII.4 norovirus inhibition by human milk oligosaccharides.
rcsb
source organism Norovirus hu/gii.4/chdc2094/1974/us
molecule tags Viral protein
total genus 69
structure length 303
sequence length 305
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-03-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.120 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Positive stranded ssRNA viruses 5iywA02
2.40.510.10 Mainly Beta Beta Barrel Nucleoplasmin-like/VP (viral coat and capsid proteins) Positive stranded ssRNA viruses 5iywA01
3PVDA 4OPOA 4OPSA 3Q39A 4QVJA 5J35A 4WZLA 4RLZA 4Z4TA 3V7AA 4RDKA 4RPDA 3ASRA 3R6JA 4Z4SA 4Z4UA 3ASQA 3SLNA 5IYWA 4Z4ZA 5J3OA 3LQ6A 3BY2A 4OPVA 4ROXA 3SLDA 5HZAA 3PA1A 5IYRA 4QV2A 4X7EA 4RDLA 4P3IA 4X07A 4X7CA 3SEJA 3D26A 3RY8A 3PA2A 4Z4VA 4Z4RA 2ZL5A 4RDJA 4WZKA 4X7DA 3SJPA 5IYQA 4OP7A 3PUNA 2ZL7A 3Q6RA 3SKBA 4QVAA 4X7FA 4X0CA 4RPBA 5F4OA 3ASSA 3BQJA 3ONYA 4WZEA 3R6KA 3ASTA 2OBTA 5HZBA 5F4JA 5E6TA 4RM0A 5IYNA 2OBSA 2OBRA 4Z4YA 4P25A 3Q3AA 5F4MA 4OOXA 3ONUA 4Z4WA 4X05A 3Q6QA 3LQEA 1IHMA 3Q38A 3PUMA 4WZTA 5BSYA 5BSXA 5IYPA 4OOVA 4X06A 3BY1A 4P12A 5KW9A 4P1VA 4QUZA 4P2NA 3ASPA 2ZL6A 4P26A 4OOSA
chains in the Genus database with same CATH superfamily
1RQRA 1QGZA 3GVLA 1TUIA 3WBKA 4EH1A 2C78A 3OP1A 2JDIA 2Z6BD 5A89A 3MCAA 4QVJA 3GVJA 4Z4TA 2F1LA 1W9XA 2PLFA 3ASRA 4G1BA 4Z4UA 1JNYA 5J3OA 3A1PA 1EFUA 3OOCA 2BF4A 2ZZEA 2BSAA 3ISXA 4Z4ZA 5IYWA 4P6YA 1OGIA 1XFOA 1ZUNB 2CRVA 2QA4B 2GJPA 2KVOA 3CD6B 4YAUA 4WWVA 2WZPP 2QGGA 4ROXA 2PE3A 2X0KA 2ZTNA 2BPOA 4P6VF 5FO1A 2HLDA 2ZZGA 4RD3A 4UZFA 3AGPA 1EP1B 4AF6A 2VZLA 1OB5A 1YHQB 4G7WA 1I7PA 2C5HA 4G5GA 3W2FA 3J81k 4DK1A 3CCSB 3PA2A 3P27A 4Z4VA 1NBMA 4UZEA 2HCJB 4X8IA 1BPLA 5TR9A 5TV2A 1WP6A 5EMNA 1H42A 3JQQA 4LBYA 2ZZQA 4PGOA 3SJZA 3W5HA 3WNCA 2XNDA 1DARA 1FNMA 2QN6A 3CB4A 4ZCIA 2X53S 1VQMB 2DCUA 4QVAA 2X6YA 3WYAA 4XLAA 4XN0A 3CW2A 2VJJA 3CC2B 4XNFA 4XN3A 1K8AD 4WZEA 2WPDA 3OPOA 4DQLA 4NCNA 5HZBA 5THXA 5E6TA 1PJ6A 1WORA 1ZM3A 1FX0A 5FL7A 3FPKA 2W6IA 3ZBTA 3OJWA 2WZNA 3GVKA 1Q9SA 2WJVA 2OBSA 4P9SA 1H85A 1WPCA 5LMZA 3ES9A 1GAWA 1UMKA 4Z1MA 4Z4YA 4ZGNB 3KL9A 2ZZFA 2XGJA 3A8IA 1R5BA 1VQKB 4P3YA 4CQJA 4Q7JB 2DIEA 4Y9RA 4FK8A 5JBQA 4PABA 4Z4WA 4LBZA 4XMYA 1VQPB 1T6ZA 5A88A 2BN4A 2GREA 3I55B 1PKVA 2CNDA 3Q6QA 1FRQA 1K73D 3Q38A 2PMDA 2V7VA 1E62A 1I8DA 3ZC3A 3A8KA 4U9UA 2X3UA 4GQNA 4DNRB 2E1RA 4YAOA 4X06A 3CTAA 5B6IA 4XM3A 2ZITA 3JQRA 4YALA 5FO0A 4P1VA 4PC6A 4IW3B 1B2RA 3CMMA 1E63A 2XNCA 4LC0A 3VR6A 1KQSB 1QVFB 2VBVA 2ZTGA 1W0KA 1UD3A 2V7UA 4P2NA 3AGQA 5IK2A 3CCRB 3ASPA 2ZL6A 1CNEA 5GV7A 2D3LA 2BM0A 1OHHA 2VNIA 2F43A 3PVDA 1AMOA 3CCVB 2ZXHA 3DDYA 3WQZA 1ZM2A 2E1BA 2R6HA 3BCFA 1BX1A 3Q39A 4II3A 4XKWA 2QDXA 1KD1D 1ELOA 4XOPA 1TTTA 2ZBUA 4ZCLA 1KTVA 2VNKA 2ZBVA 4TMWA 4XORA 2RC6A 4RPDA 3R6JA 1FNBA 3SLNA 4WQMA 3AVXA 1DDIA 3LQ6A 3BY2A 2C2WA 3P26A 4OPVA 3BNWA 4TSFA 5HZAA 3G4SB 5IYRA 4XD7A 2CC2A 4PC7A 4B47A 2DERA 3G05A 3A35A 4X7CA 1YIJB 1KJZA 4JMQA 3RY8A 2CBXA 1G7CA 2V7XA 2OTLB 1WOOA 3WBJA 3CESA 1KK2A 2FVGA 2QTLA 4ZGQB 4RDJA 2BM1A 4WZKA 4X7DA 2VBSA 4QFMA 3W2HA 3SJPA 1DG1G 2V7WA 4QHYA 2ZL7A 4N3GA 3QFRA 2BGIA 5AN9A 1H8HA 2GJKA 1D2EA 3ZZTA 1XB2A 2XZLA 1G7SA 3ASSA 3LO8A 1D1NA 2BVNA 1K28D 3WXMA 3BQJA 1JJ2B 4B3XA 1HA3A 3ONYA 1K9MD 1FNDA 4UZUA 3A3GA 5H5JA 1QVGB 1NB9A 2V31A 4NNJA 1GR1A 1UD6A 3ASTA 4C43A 3A3BA 3T56B 1E1RA 3U6BA 3VNVA 4MYTA 2X6XA 4XLHA 1QUFA 1F60A 1VHEA 4RM0A 2OK8A 3JQPA 4G1VA 1GAQA 1QGYA 2Q6KA 3BC9A 1DDGA 3W2GA 3B82A 1JB9A 2DETA 1VQNB 3Q3AA 3W5VA 4AVZA 2GK7A 3AVTA 1KMHA 2AHOA 2VBTA 2Q6IA 1WOPA 2Q6LA 3OEEA 5HKKA 1E79A 1HZEA 2GK6A 5L46A 4L8JA 2OYNA 1P4MA 3H9NA 5TY0A 1IHMA 4PC2A 4RJLA 2X8KA 4R71A 1T5EA 3QSYA 3PUMA 1VQ5B 1UD2A 3AVYA 3H94A 3CPWB 2QE7A 3CC7B 5BSXA 1WDTA 3G6EB 1YJWB 4P12A 5KW9A 4M2LA 2GPJA 4KKTA 1PJ5A 3FPPA 2HMAA 4ASUA 3E1YE 4P22A 2QTZA 1IJEA 2V7TA 2ZXIA 4HIZA 3U2QA 4HE5A 3ZUGA 1EFCA 2D9RA 2XEXA 1RQPA 3WY9A 3CCQB 1UD8A 3GSIA 1T6XA 2BMWA 2C5BA 3OKXA 4ZV4A 4OPOA 2X6WA 3QFSA 4LBVA 1OB2A 1G7RA 4XONA 5GV8A 2VNHA 1E43A 1QFZA 2JIZA 1U2RA 1KC8D 4RD6A 4WZLA 3T51B 1EXMA 4RD2A 4RDKA 3OAAA 4RD4A 1F20A 4Z4SA 5FNZA 3B78A 1SKQA 1N0VC 4C0SA 1A8PA 2CF4A 2JJ2A 1Y0YA 4FXUA 3WNBA 3SLDA 1OB0A 2VJIA 4B3FX 4QV2A 4X7EA 1GO2A 1W2BB 4X07A 3W2EA 2YWGA 3OZVA 3SEJA 5KNLA 2EIXA 1VQOB 4AC9A 2BGJA 4RD0A 3U6KA 1E3XA 3OW7A 3G71B 2C77A 1Y0RA 2R9VA 3JU4A 4NBSA 1VHOA 4PAAA 4M53A 1MRZA 2DEUA 1WSVA 3PUNA 1JA1A 3CCMB 3CMAB 3SKBA 4X7FA 1QFJA 1CQXA 1VQ4B 3OFNA 4RPBA 2B7BA 2C4UA 4KKSA 1BMFA 2RC5A 1UD5A 1WTHD 1IB0A 2YWHA 3R6KA 1MABA 4DQKA 3V76A 5F4JA 4PC3A 1G7TA 1EFRA 2HDNB 4TKOB 5IYNA 2VYQA 4XLEA 2C4TA 5H59A 2OBRA 3CCUB 1M90D 1BX0A 3ZPNA 1VQ9B 1ZM9A 1EWYA 3KEWA 2JN9A 3OZWA 2BV3A 3BCDA 3ZBUA 5DS0A 1V5VA 2VBUA 2FX3A 4YHBA 1VLOA 3VMFA 5F4MA 1W34A 2DYIA 4Y7CA 4X05A 2XOKA 3OW2B 3FKSA 1XQBA 3CPXA 2PIAA 3CP2A 1N07A 4B4DA 2V7QA 4M0LA 2NV4A 2P3MA 2DOGA 3QFTA 4XQFA 2M5SA 1WOSA 1IJFA 5IYPA 4OOVA 1M1KD 3AVUA 1QFYA 4M4SA 2QMUA 3BY1A 3E20A 3W5UA 4TMVA 3MHPA 5KSWB 5HXBA 1D8TA 1BLIA 4B3GA 4TT3A 1KZLA 1R5NA 1N06A 4RCZA 2W6JA 3LVBA 1ZM4A 4DNTB 3CCEB 2VNJA 4OOSA 4P26A 5A8AA 2F4NA 1V0FA 4B44A 1BJKA 1NDHA 2B5OA 2OK7A 1Q86D 4G6IA 2LZJA 4OPSA 3OE7A 1J9ZA 4XOTA 2D74A 4Y9UA 3VO2A 1BQEA 5J35A 1N8RD 3A8JA 4RLZA 1FNCA 3V7AA 1YLOA 2NPFA 1WSRA 2WYRA 4YELA 4RD1A 1YITB 1QG0A 1Q7YD 1NJID 1AIPA 3ASQA 1W0JA 4HE6A 1XE1A 4G7XA 2OTJB 4ACBA 1TVCA 2YWFA 2GJRA 4XR6A 3CXCB 3FJOA 2DY1A 3AVWA 2CK3A 2J7KA 3ZIAA 1PJ7A 3T53B 3B8HA 3PA1A 3I56B 3NE5B 1QUEA 2F1MA 4P3IA 4RDLA 1Q81D 5FA6A 3D26A 4TN1A 1CNFA 4Z4RA 1OGJA 2B7CA 1NB0A 1I18A 4XLCA 4ACAA 1E64A 5DN6A 2ZL5A 1QH0A 3QFCA 1JA0A 5IYQA 4OP7A 1W87A 4KKUA 4XLFA 2D3NA 1UD4A 3CC4B 5DSZA 4YAFA 3OZUA 1QX4A 3Q6RA 2CW5A 4J0QA 4AF7A 1Q82D 3VNUA 2YWEA 4PC1A 4F7DA 1SKYB 4X0CA 1E3ZA 3LNNA 1V0EA 2V4DA 5F4OA 5FIUA 1R5OA 4LBWA 1FDRA 1VQ7B 3CMEB 2Q6OA 4B48A 3BH4A 1T6YA 1COWA 3PENA 4TMXA 2OBTA 1QGAA 1N08A 1W35A 1KK0A 1YJ9B 1EP2B 4TMTA 4MYUA 3CCLB 4DK0A 4RCYA 2I1LA 3OEHA 3HAGA 2XZOA 1S0UA 2WJYA 4N3NA 3GQBA 1TLLA 1VLYA 3CRZA 1GVHA 4UAJA 4YEJA 3ZZUA 1HVXA 1VF7A 1N05A 1VQLB 3WNDA 4P25A 1GJRA 4YXWA 1VQ6B 2JJ1A 2XZPA 4OOXA 1YJNB 3AVVA 3ONUA 2EFGA 1KK1A 1YX2A 1S4MA 4FN5A 1EP3B 4H9GA 3MMPA 4ZCMA 4II2A 1YI2B 4YAWA 1S72B 3LQEA 1N0UA 3CP8A 1VQ8B 1WU8A 3CCJB 3I1FA 1B23P 4BPRA 2GQFA 2XNJA 4WZTA 3OJXA 5BSYA 3QE2A 4B43A 1E1QA 5CDFA 3ZZ0A 1VJSA 1FRNA 1KRHA 4XL9A 4FWTA 5TRDA 2WSSA 4QUZA 3W2IA 4K1XA 1EFTA 2QEXB 2X85A 3VO1A 4XKVA 1KK3A 1NRKA 4E0FA 4TMZA 2WR8A 4M1KA 1H8EA 1SM4A 3GIRA
chains in the Genus database with same CATH topology
3PVDA 4OPOA 4OPSA 3Q39A 4QVJA 5J35A 4WZLA 4RLZA 4Z4TA 3V7AA 4RDKA 4RPDA 3ASRA 3R6JA 4Z4SA 4Z4UA 3ASQA 3SLNA 5IYWA 4Z4ZA 5J3OA 3LQ6A 3BY2A 4OPVA 4ROXA 3SLDA 5HZAA 3PA1A 5IYRA 4QV2A 4X7EA 4RDLA 4P3IA 4X07A 4X7CA 3SEJA 3D26A 3RY8A 3PA2A 4Z4VA 4Z4RA 2ZL5A 4RDJA 4WZKA 4X7DA 3SJPA 5IYQA 4OP7A 3PUNA 2ZL7A 3Q6RA 3SKBA 4QVAA 4X7FA 4X0CA 4RPBA 5F4OA 3ASSA 3BQJA 3ONYA 4WZEA 3R6KA 3ASTA 2OBTA 5HZBA 5F4JA 5E6TA 4RM0A 5IYNA 2OBSA 2OBRA 4Z4YA 4P25A 3Q3AA 5F4MA 4OOXA 3ONUA 4Z4WA 4X05A 3Q6QA 3LQEA 1IHMA 3Q38A 3PUMA 4WZTA 5BSYA 5BSXA 5IYPA 4OOVA 4X06A 3BY1A 4P12A 5KW9A 4P1VA 4QUZA 4P2NA 3ASPA 2ZL6A 4P26A 4OOSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PVD A;  4OPO A;  4OPS A;  3Q39 A;  4QVJ A;  5J35 A;  4WZL A;  4RLZ A;  4Z4T A;  3V7A A;  4RDK A;  4RPD A;  3ASR A;  3R6J A;  4Z4S A;  4Z4U A;  3ASQ A;  3SLN A;  5IYW A;  4Z4Z A;  5J3O A;  3LQ6 A;  3BY2 A;  4OPV A;  4ROX A;  3SLD A;  5HZA A;  3PA1 A;  5IYR A;  4QV2 A;  4X7E A;  4RDL A;  4P3I A;  4X07 A;  4X7C A;  3SEJ A;  3D26 A;  3RY8 A;  3PA2 A;  4Z4V A;  4Z4R A;  2ZL5 A;  4RDJ A;  4WZK A;  4X7D A;  3SJP A;  5IYQ A;  4OP7 A;  3PUN A;  2ZL7 A;  3Q6R A;  3SKB A;  4QVA A;  4X7F A;  4X0C A;  4RPB A;  5F4O A;  3ASS A;  3BQJ A;  3ONY A;  4WZE A;  3R6K A;  3AST A;  2OBT A;  5HZB A;  5F4J A;  5E6T A;  4RM0 A;  5IYN A;  2OBS A;  2OBR A;  4Z4Y A;  4P25 A;  3Q3A A;  5F4M A;  4OOX A;  3ONU A;  4Z4W A;  4X05 A;  3Q6Q A;  3LQE A;  1IHM A;  3Q38 A;  3PUM A;  4WZT A;  5BSY A;  5BSX A;  5IYP A;  4OOV A;  4X06 A;  3BY1 A;  4P12 A;  5KW9 A;  4P1V A;  4QUZ A;  4P2N A;  3ASP A;  2ZL6 A;  4P26 A;  4OOS A; 
#chains in the Genus database with same CATH topology
 1RQR A;  1QGZ A;  3GVL A;  1TUI A;  3WBK A;  4EH1 A;  2C78 A;  3OP1 A;  2JDI A;  2Z6B D;  5A89 A;  3MCA A;  4QVJ A;  3GVJ A;  4Z4T A;  2F1L A;  1W9X A;  2PLF A;  3ASR A;  4G1B A;  4Z4U A;  1JNY A;  5J3O A;  3A1P A;  1EFU A;  3OOC A;  2BF4 A;  2ZZE A;  2BSA A;  3ISX A;  4Z4Z A;  5IYW A;  4P6Y A;  1OGI A;  1XFO A;  1ZUN B;  2CRV A;  2QA4 B;  2GJP A;  2KVO A;  3CD6 B;  4YAU A;  4WWV A;  2WZP P;  2QGG A;  4ROX A;  2PE3 A;  2X0K A;  2ZTN A;  2BPO A;  4P6V F;  5FO1 A;  2HLD A;  2ZZG A;  4RD3 A;  4UZF A;  3AGP A;  1EP1 B;  4AF6 A;  2VZL A;  1OB5 A;  1YHQ B;  4G7W A;  1I7P A;  2C5H A;  4G5G A;  3W2F A;  3J81 k;  4DK1 A;  3CCS B;  3PA2 A;  3P27 A;  4Z4V A;  1NBM A;  4UZE A;  2HCJ B;  4X8I A;  1BPL A;  5TR9 A;  5TV2 A;  1WP6 A;  5EMN A;  1H42 A;  3JQQ A;  4LBY A;  2ZZQ A;  4PGO A;  3SJZ A;  3W5H A;  3WNC A;  2XND A;  1DAR A;  1FNM A;  2QN6 A;  3CB4 A;  4ZCI A;  2X53 S;  1VQM B;  2DCU A;  4QVA A;  2X6Y A;  3WYA A;  4XLA A;  4XN0 A;  3CW2 A;  2VJJ A;  3CC2 B;  4XNF A;  4XN3 A;  1K8A D;  4WZE A;  2WPD A;  3OPO A;  4DQL A;  4NCN A;  5HZB A;  5THX A;  5E6T A;  1PJ6 A;  1WOR A;  1ZM3 A;  1FX0 A;  5FL7 A;  3FPK A;  2W6I A;  3ZBT A;  3OJW A;  2WZN A;  3GVK A;  1Q9S A;  2WJV A;  2OBS A;  4P9S A;  1H85 A;  1WPC A;  5LMZ A;  3ES9 A;  1GAW A;  1UMK A;  4Z1M A;  4Z4Y A;  4ZGN B;  3KL9 A;  2ZZF A;  2XGJ A;  3A8I A;  1R5B A;  1VQK B;  4P3Y A;  4CQJ A;  4Q7J B;  2DIE A;  4Y9R A;  4FK8 A;  5JBQ A;  4PAB A;  4Z4W A;  4LBZ A;  4XMY A;  1VQP B;  1T6Z A;  5A88 A;  2BN4 A;  2GRE A;  3I55 B;  1PKV A;  2CND A;  3Q6Q A;  1FRQ A;  1K73 D;  3Q38 A;  2PMD A;  2V7V A;  1E62 A;  1I8D A;  3ZC3 A;  3A8K A;  4U9U A;  2X3U A;  4GQN A;  4DNR B;  2E1R A;  4YAO A;  4X06 A;  3CTA A;  5B6I A;  4XM3 A;  2ZIT A;  3JQR A;  4YAL A;  5FO0 A;  4P1V A;  4PC6 A;  4IW3 B;  1B2R A;  3CMM A;  1E63 A;  2XNC A;  4LC0 A;  3VR6 A;  1KQS B;  1QVF B;  2VBV A;  2ZTG A;  1W0K A;  1UD3 A;  2V7U A;  4P2N A;  3AGQ A;  5IK2 A;  3CCR B;  3ASP A;  2ZL6 A;  1CNE A;  5GV7 A;  2D3L A;  2BM0 A;  1OHH A;  2VNI A;  2F43 A;  3PVD A;  1AMO A;  3CCV B;  2ZXH A;  3DDY A;  3WQZ A;  1ZM2 A;  2E1B A;  2R6H A;  3BCF A;  1BX1 A;  3Q39 A;  4II3 A;  4XKW A;  2QDX A;  1KD1 D;  1ELO A;  4XOP A;  1TTT A;  2ZBU A;  4ZCL A;  1KTV A;  2VNK A;  2ZBV A;  4TMW A;  4XOR A;  2RC6 A;  4RPD A;  3R6J A;  1FNB A;  3SLN A;  4WQM A;  3AVX A;  1DDI A;  3LQ6 A;  3BY2 A;  2C2W A;  3P26 A;  4OPV A;  3BNW A;  4TSF A;  5HZA A;  3G4S B;  5IYR A;  4XD7 A;  2CC2 A;  4PC7 A;  4B47 A;  2DER A;  3G05 A;  3A35 A;  4X7C A;  1YIJ B;  1KJZ A;  4JMQ A;  3RY8 A;  2CBX A;  1G7C A;  2V7X A;  2OTL B;  1WOO A;  3WBJ A;  3CES A;  1KK2 A;  2FVG A;  2QTL A;  4ZGQ B;  4RDJ A;  2BM1 A;  4WZK A;  4X7D A;  2VBS A;  4QFM A;  3W2H A;  3SJP A;  1DG1 G;  2V7W A;  4QHY A;  2ZL7 A;  4N3G A;  3QFR A;  2BGI A;  5AN9 A;  1H8H A;  2GJK A;  1D2E A;  3ZZT A;  1XB2 A;  2XZL A;  1G7S A;  3ASS A;  3LO8 A;  1D1N A;  2BVN A;  1K28 D;  3WXM A;  3BQJ A;  1JJ2 B;  4B3X A;  1HA3 A;  3ONY A;  1K9M D;  1FND A;  4UZU A;  3A3G A;  5H5J A;  1QVG B;  1NB9 A;  2V31 A;  4NNJ A;  1GR1 A;  1UD6 A;  3AST A;  4C43 A;  3A3B A;  3T56 B;  1E1R A;  3U6B A;  3VNV A;  4MYT A;  2X6X A;  4XLH A;  1QUF A;  1F60 A;  1VHE A;  4RM0 A;  2OK8 A;  3JQP A;  4G1V A;  1GAQ A;  1QGY A;  2Q6K A;  3BC9 A;  1DDG A;  3W2G A;  3B82 A;  1JB9 A;  2DET A;  1VQN B;  3Q3A A;  3W5V A;  4AVZ A;  2GK7 A;  3AVT A;  1KMH A;  2AHO A;  2VBT A;  2Q6I A;  1WOP A;  2Q6L A;  3OEE A;  5HKK A;  1E79 A;  1HZE A;  2GK6 A;  5L46 A;  4L8J A;  2OYN A;  1P4M A;  3H9N A;  5TY0 A;  1IHM A;  4PC2 A;  4RJL A;  2X8K A;  4R71 A;  1T5E A;  3QSY A;  3PUM A;  1VQ5 B;  1UD2 A;  3AVY A;  3H94 A;  3CPW B;  2QE7 A;  3CC7 B;  5BSX A;  1WDT A;  3G6E B;  1YJW B;  4P12 A;  5KW9 A;  4M2L A;  2GPJ A;  4KKT A;  1PJ5 A;  3FPP A;  2HMA A;  4ASU A;  3E1Y E;  4P22 A;  2QTZ A;  1IJE A;  2V7T A;  2ZXI A;  4HIZ A;  3U2Q A;  4HE5 A;  3ZUG A;  1EFC A;  2D9R A;  2XEX A;  1RQP A;  3WY9 A;  3CCQ B;  1UD8 A;  3GSI A;  1T6X A;  2BMW A;  2C5B A;  3OKX A;  4ZV4 A;  4OPO A;  2X6W A;  3QFS A;  4LBV A;  1OB2 A;  1G7R A;  4XON A;  5GV8 A;  2VNH A;  1E43 A;  1QFZ A;  2JIZ A;  1U2R A;  1KC8 D;  4RD6 A;  4WZL A;  3T51 B;  1EXM A;  4RD2 A;  4RDK A;  3OAA A;  4RD4 A;  1F20 A;  4Z4S A;  5FNZ A;  3B78 A;  1SKQ A;  1N0V C;  4C0S A;  1A8P A;  2CF4 A;  2JJ2 A;  1Y0Y A;  4FXU A;  3WNB A;  3SLD A;  1OB0 A;  2VJI A;  4B3F X;  4QV2 A;  4X7E A;  1GO2 A;  1W2B B;  4X07 A;  3W2E A;  2YWG A;  3OZV A;  3SEJ A;  5KNL A;  2EIX A;  1VQO B;  4AC9 A;  2BGJ A;  4RD0 A;  3U6K A;  1E3X A;  3OW7 A;  3G71 B;  2C77 A;  1Y0R A;  2R9V A;  3JU4 A;  4NBS A;  1VHO A;  4PAA A;  4M53 A;  1MRZ A;  2DEU A;  1WSV A;  3PUN A;  1JA1 A;  3CCM B;  3CMA B;  3SKB A;  4X7F A;  1QFJ A;  1CQX A;  1VQ4 B;  3OFN A;  4RPB A;  2B7B A;  2C4U A;  4KKS A;  1BMF A;  2RC5 A;  1UD5 A;  1WTH D;  1IB0 A;  2YWH A;  3R6K A;  1MAB A;  4DQK A;  3V76 A;  5F4J A;  4PC3 A;  1G7T A;  1EFR A;  2HDN B;  4TKO B;  5IYN A;  2VYQ A;  4XLE A;  2C4T A;  5H59 A;  2OBR A;  3CCU B;  1M90 D;  1BX0 A;  3ZPN A;  1VQ9 B;  1ZM9 A;  1EWY A;  3KEW A;  2JN9 A;  3OZW A;  2BV3 A;  3BCD A;  3ZBU A;  5DS0 A;  1V5V A;  2VBU A;  2FX3 A;  4YHB A;  1VLO A;  3VMF A;  5F4M A;  1W34 A;  2DYI A;  4Y7C A;  4X05 A;  2XOK A;  3OW2 B;  3FKS A;  1XQB A;  3CPX A;  2PIA A;  3CP2 A;  1N07 A;  4B4D A;  2V7Q A;  4M0L A;  2NV4 A;  2P3M A;  2DOG A;  3QFT A;  4XQF A;  2M5S A;  1WOS A;  1IJF A;  5IYP A;  4OOV A;  1M1K D;  3AVU A;  1QFY A;  4M4S A;  2QMU A;  3BY1 A;  3E20 A;  3W5U A;  4TMV A;  3MHP A;  5KSW B;  5HXB A;  1D8T A;  1BLI A;  4B3G A;  4TT3 A;  1KZL A;  1R5N A;  1N06 A;  4RCZ A;  2W6J A;  3LVB A;  1ZM4 A;  4DNT B;  3CCE B;  2VNJ A;  4OOS A;  4P26 A;  5A8A A;  2F4N A;  1V0F A;  4B44 A;  1BJK A;  1NDH A;  2B5O A;  2OK7 A;  1Q86 D;  4G6I A;  2LZJ A;  4OPS A;  3OE7 A;  1J9Z A;  4XOT A;  2D74 A;  4Y9U A;  3VO2 A;  1BQE A;  5J35 A;  1N8R D;  3A8J A;  4RLZ A;  1FNC A;  3V7A A;  1YLO A;  2NPF A;  1WSR A;  2WYR A;  4YEL A;  4RD1 A;  1YIT B;  1QG0 A;  1Q7Y D;  1NJI D;  1AIP A;  3ASQ A;  1W0J A;  4HE6 A;  1XE1 A;  4G7X A;  2OTJ B;  4ACB A;  1TVC A;  2YWF A;  2GJR A;  4XR6 A;  3CXC B;  3FJO A;  2DY1 A;  3AVW A;  2CK3 A;  2J7K A;  3ZIA A;  1PJ7 A;  3T53 B;  3B8H A;  3PA1 A;  3I56 B;  3NE5 B;  1QUE A;  2F1M A;  4P3I A;  4RDL A;  1Q81 D;  5FA6 A;  3D26 A;  4TN1 A;  1CNF A;  4Z4R A;  1OGJ A;  2B7C A;  1NB0 A;  1I18 A;  4XLC A;  4ACA A;  1E64 A;  5DN6 A;  2ZL5 A;  1QH0 A;  3QFC A;  1JA0 A;  5IYQ A;  4OP7 A;  1W87 A;  4KKU A;  4XLF A;  2D3N A;  1UD4 A;  3CC4 B;  5DSZ A;  4YAF A;  3OZU A;  1QX4 A;  3Q6R A;  2CW5 A;  4J0Q A;  4AF7 A;  1Q82 D;  3VNU A;  2YWE A;  4PC1 A;  4F7D A;  1SKY B;  4X0C A;  1E3Z A;  3LNN A;  1V0E A;  2V4D A;  5F4O A;  5FIU A;  1R5O A;  4LBW A;  1FDR A;  1VQ7 B;  3CME B;  2Q6O A;  4B48 A;  3BH4 A;  1T6Y A;  1COW A;  3PEN A;  4TMX A;  2OBT A;  1QGA A;  1N08 A;  1W35 A;  1KK0 A;  1YJ9 B;  1EP2 B;  4TMT A;  4MYU A;  3CCL B;  4DK0 A;  4RCY A;  2I1L A;  3OEH A;  3HAG A;  2XZO A;  1S0U A;  2WJY A;  4N3N A;  3GQB A;  1TLL A;  1VLY A;  3CRZ A;  1GVH A;  4UAJ A;  4YEJ A;  3ZZU A;  1HVX A;  1VF7 A;  1N05 A;  1VQL B;  3WND A;  4P25 A;  1GJR A;  4YXW A;  1VQ6 B;  2JJ1 A;  2XZP A;  4OOX A;  1YJN B;  3AVV A;  3ONU A;  2EFG A;  1KK1 A;  1YX2 A;  1S4M A;  4FN5 A;  1EP3 B;  4H9G A;  3MMP A;  4ZCM A;  4II2 A;  1YI2 B;  4YAW A;  1S72 B;  3LQE A;  1N0U A;  3CP8 A;  1VQ8 B;  1WU8 A;  3CCJ B;  3I1F A;  1B23 P;  4BPR A;  2GQF A;  2XNJ A;  4WZT A;  3OJX A;  5BSY A;  3QE2 A;  4B43 A;  1E1Q A;  5CDF A;  3ZZ0 A;  1VJS A;  1FRN A;  1KRH A;  4XL9 A;  4FWT A;  5TRD A;  2WSS A;  4QUZ A;  3W2I A;  4K1X A;  1EFT A;  2QEX B;  2X85 A;  3VO1 A;  4XKV A;  1KK3 A;  1NRK A;  4E0F A;  4TMZ A;  2WR8 A;  4M1K A;  1H8E A;  1SM4 A;  3GIR A; 
#chains in the Genus database with same CATH homology
 3PVD A;  4OPO A;  4OPS A;  3Q39 A;  4QVJ A;  5J35 A;  4WZL A;  4RLZ A;  4Z4T A;  3V7A A;  4RDK A;  4RPD A;  3ASR A;  3R6J A;  4Z4S A;  4Z4U A;  3ASQ A;  3SLN A;  5IYW A;  4Z4Z A;  5J3O A;  3LQ6 A;  3BY2 A;  4OPV A;  4ROX A;  3SLD A;  5HZA A;  3PA1 A;  5IYR A;  4QV2 A;  4X7E A;  4RDL A;  4P3I A;  4X07 A;  4X7C A;  3SEJ A;  3D26 A;  3RY8 A;  3PA2 A;  4Z4V A;  4Z4R A;  2ZL5 A;  4RDJ A;  4WZK A;  4X7D A;  3SJP A;  5IYQ A;  4OP7 A;  3PUN A;  2ZL7 A;  3Q6R A;  3SKB A;  4QVA A;  4X7F A;  4X0C A;  4RPB A;  5F4O A;  3ASS A;  3BQJ A;  3ONY A;  4WZE A;  3R6K A;  3AST A;  2OBT A;  5HZB A;  5F4J A;  5E6T A;  4RM0 A;  5IYN A;  2OBS A;  2OBR A;  4Z4Y A;  4P25 A;  3Q3A A;  5F4M A;  4OOX A;  3ONU A;  4Z4W A;  4X05 A;  3Q6Q A;  3LQE A;  1IHM A;  3Q38 A;  3PUM A;  4WZT A;  5BSY A;  5BSX A;  5IYP A;  4OOV A;  4X06 A;  3BY1 A;  4P12 A;  5KW9 A;  4P1V A;  4QUZ A;  4P2N A;  3ASP A;  2ZL6 A;  4P26 A;  4OOS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...