5IYWA

Protruding domain of gii.4 human norovirus chdc2094 in complex with 3-fucosyllactose (3fl)
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
305
structure length
303
Chain Sequence
KPFTVPILTVEEMSNSRFPIPLEKLYTGPSSAFVVQPQNGRCTTDGVLLGTTQLSAVNICNFRGDVTRVGISHDYTMNLVSQNWNNYDPTEEIPAPLGTPDFVGKIQGLLTQTTRADGSTRAHKATVSTGSVHFTPKLGSVQFTTDTNNDFQTGQNTKFTPVGVIQDGHQNEPQQWVLPNYSGTSGHNVHLAPAVAPTFPGEQLLFFRSTMPGCSGYPNMNLDCLLPQEWVSHFYQEAAPAQSDVALLRFVNPDTGRVLFECKLHKSGYITVAHTGPYDLVIPPNGYFRFDSWVNQFYTLAPM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VP1
publication title Structural basis for GII.4 norovirus inhibition by human milk oligosaccharides.
rcsb
source organism Norovirus hu/gii.4/chdc2094/1974/us
molecule tags Viral protein
total genus 69
structure length 303
sequence length 305
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-03-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.120 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Positive stranded ssRNA viruses 5iywA02
2.40.510.10 Mainly Beta Beta Barrel Nucleoplasmin-like/VP (viral coat and capsid proteins) Positive stranded ssRNA viruses 5iywA01
3R6JA 2OBTA 4Z4WA 3PVDA 3SJPA 3ASPA 3PUNA 4QVAA 3BQJA 4X0CA 4Z4VA 3ASSA 2OBSA 3Q6QA 3Q6RA 4Z4RA 4X7CA 5BSYA 3BY2A 4P12A 3SLDA 5IYNA 4X7EA 5J3OA 3Q3AA 3V7AA 4X7DA 4X07A 4Z4ZA 2OBRA 3ASRA 4OOVA 4RDLA 4WZKA 4X06A 5F4MA 4OOXA 1IHMA 4Z4TA 3LQEA 4OPVA 4P1VA 4WZTA 4OPOA 4OOSA 4RLZA 2ZL5A 3PA1A 4P2NA 4Z4YA 3RY8A 3SKBA 3ONYA 4QVJA 3ONUA 5IYRA 4RPBA 4P26A 4ROXA 3PA2A 4X05A 2ZL6A 3PUMA 3ASQA 5IYPA 4Z4UA 5IYWA 4QV2A 3BY1A 3SEJA 5KW9A 5F4JA 4X7FA 4OP7A 5IYQA 4Z4SA 3Q39A 4WZEA 3ASTA 3SLNA 2ZL7A 4RDJA 3Q38A 3R6KA 5HZAA 5HZBA 3D26A 4WZLA 5J35A 4P3IA 4RDKA 4P25A 5E6TA 3LQ6A 5F4OA 4QUZA 4RPDA 4OPSA 5BSXA 4RM0A
chains in the Genus database with same CATH superfamily
1MABA 2ZTGA 3R6JA 1VJSA 4G1VA 1G7SA 2GREA 1I18A 4TMVA 3CESA 3SJPA 1DG1G 2QTLA 1D1NA 4ACBA 1E63A 3PUNA 1KK0A 1JNYA 1BMFA 1T5EA 4ZCLA 1WSVA 1Q82D 5TY0A 2GJKA 1OB2A 2ZTNA 4MYUA 4PC1A 3KEWA 1WSRA 1JA1A 1KK1A 3BY2A 4Y9RA 1EWYA 2KVOA 4DNTB 2D9RA 3QSYA 1Q7YD 3I55B 1ZM9A 3BNWA 3V7AA 1UD5A 4FK8A 4X7DA 2XGJA 1EFTA 2PE3A 1W9XA 3FJOA 4EH1A 2V7TA 4XORA 4Z4ZA 2JN9A 3VNUA 2GK6A 3B8HA 1FNCA 3CPWB 4WZKA 2XNCA 2PLFA 4P6YA 2FVGA 4ZCMA 4OOXA 2C5HA 1ELOA 1KMHA 2YWEA 1U2RA 2YWHA 2DCUA 1KTVA 3ZUGA 2WYRA 3WBKA 4OOSA 1WOSA 1GVHA 3VNVA 2B7BA 3WQZA 1B23P 1K9MD 4LBVA 4B48A 3RY8A 4B3FX 4ZV4A 3CC2B 3ZC3A 4P9SA 2ZBVA 1E64A 4TKOB 1E43A 2C78A 1EP2B 3VO1A 4U9UA 2QN6A 4PC6A 4LBYA 4X05A 2RC5A 1FNBA 4Q7JB 2WJVA 1JA0A 2QDXA 4X8IA 2WZPP 3A8KA 5KW9A 1AMOA 4TT3A 2BGJA 3QE2A 4YALA 2JJ1A 1WOPA 4B3GA 3Q39A 4B47A 2GK7A 3B82A 3W2IA 3WYAA 2ZL7A 1E79A 4RDJA 1YI2B 2XNDA 1EXMA 2JIZA 3R6KA 4UZEA 1W0JA 4ZCIA 3CMMA 1E1QA 1VQ6B 3D26A 2ZITA 3OZWA 1I8DA 3GVJA 3GVLA 2R9VA 4WZLA 3I56B 4RJLA 5EMNA 4J0QA 1JJ2B 1R5NA 1ZUNB 2W6JA 1EFCA 2PMDA 4TMXA 1VLYA 1QFYA 2VNIA 3W2EA 4LBWA 2WSSA 4ZGNB 4MYTA 4PC7A 2BM1A 3BCDA 3BCFA 4TN1A 1QVFB 4G7XA 1Q86D 5H59A 1XB2A 1IJFA 4RD2A 1N06A 3A3BA 3P26A 1SM4A 4XL9A 2Q6IA 3OJWA 3BQJA 4X0CA 3OZUA 3OE7A 4TMZA 5FIUA 1S4MA 3W2GA 1VQ7B 1CQXA 3ASSA 4FXUA 5A88A 2XZPA 3MHPA 4TSFA 1KD1D 2V7XA 5BSYA 2B5OA 3JQPA 4P12A 1CNEA 4Y7CA 5DSZA 5KNLA 2P3MA 3SLDA 2VNKA 2HLDA 5IYNA 4AF6A 4NNJA 3MCAA 5J3OA 3Q3AA 2R6HA 3GVKA 4XLHA 4R71A 4YAOA 2BV3A 4L8JA 5TRDA 1M90D 1BPLA 2GJPA 1RQPA 4X07A 1Y0RA 3OZVA 3T51B 1KQSB 1DDGA 3CB4A 4M4SA 1QUEA 3AVUA 2GJRA 2ZZQA 3ASRA 4M53A 2GQFA 4OOVA 1GO2A 3QFCA 3SJZA 1G7CA 1K8AD 3QFSA 3CCUB 4X06A 3WY9A 3ES9A 4YELA 2EFGA 1W87A 3GQBA 2QE7A 1IHMA 4GQNA 2CC2A 3LQEA 3OFNA 4P1VA 2C77A 4WZTA 4Z4TA 4OPOA 1NB0A 4RLZA 3G4SB 5KSWB 4XLCA 2ZL5A 4P2NA 1VQ9B 1KK3A 2F43A 3GIRA 3LO8A 4H9GA 1H8EA 4G5GA 1SKQA 4RPBA 4RD1A 4JMQA 3LVBA 1PJ6A 4AVZA 5A89A 1W34A 3E1YE 1VQOB 3PA2A 3WNBA 3OEHA 1VQLB 2DYIA 3CCJB 1YJ9B 3AGQA 1Y0YA 2C4TA 1BJKA 3ASQA 5HXBA 1Q9SA 4Z4UA 5IYPA 1PKVA 2X53S 4XD7A 1UMKA 3ZBTA 2CRVA 2NV4A 1BX0A 3BY1A 4ACAA 1MRZA 3P27A 3U6BA 1PJ7A 2VJJA 4PC3A 4OP7A 1E1RA 4PABA 2OK7A 4KKSA 1TTTA 2X6XA 3W5VA 3QFRA 3ASTA 3CTAA 1QGZA 2DOGA 4LBZA 4YAFA 2YWFA 4DK0A 3FPKA 1QGAA 2CBXA 4DK1A 3Q38A 5HZAA 5HZBA 3CPXA 1KC8D 4B43A 4KKTA 1RQRA 3U6KA 5L46A 1T6ZA 5FO1A 4B4DA 4XOTA 1IB0A 4PGOA 1YJWB 4P3IA 1GAQA 1QFZA 2OTLB 3AVWA 1VQ4B 3JU4A 4P25A 4PC2A 4UZFA 4QHYA 5F4OA 1N8RD 2X8KA 4QUZA 3CMAB 2ZZEA 1FNDA 3V76A 2ZBUA 4N3NA 1ZM3A 2VZLA 4RD3A 3A1PA 3ZPNA 4OPSA 1EFRA 2CF4A 1UD4A 4RM0A 4CQJA 5BSXA 5IK2A 2Q6LA 1QUFA 4K1XA 4XLAA 5AN9A 4XOPA 1WORA 2OBTA 3JQQA 1P4MA 4Z4WA 2JJ2A 4TMWA 5FL7A 1D2EA 4AC9A 3OEEA 4QVAA 1YJNB 3CC7B 2Q6OA 4G7WA 2J7KA 1YHQB 1NBMA 3OOCA 2OBSA 2WJYA 2WZNA 2NPFA 3GSIA 3T56B 4Z4RA 3Q6RA 2VBTA 1HZEA 4X7CA 2B7CA 4XKWA 3CCLB 1B2RA 2CNDA 3ZIAA 3CXCB 2GPJA 2C2WA 3H9NA 4YAUA 3CC4B 1BQEA 4XNFA 5FNZA 3CCEB 3CD6B 1J9ZA 1WP6A 2F4NA 2VBSA 3VO2A 2X85A 1AIPA 3W2FA 1WU8A 2V7UA 1WOOA 3AGPA 3AVVA 2XEXA 4YXWA 4XKVA 4RD6A 3NE5B 3VR6A 3G71B 2OBRA 1UD2A 1FX0A 3HAGA 4ZGQB 1SKYB 1E3XA 5HKKA 1K73D 4RDLA 5B6IA 4FN5A 4NBSA 3G6EB 1T6YA 1A8PA 1VF7A 2QGGA 4OPVA 1OGIA 1COWA 5FO0A 1XE1A 5GV7A 1TUIA 3CP8A 5A8AA 4M1KA 1OGJA 2Z6BD 2E1BA 1VHEA 3OKXA 4II2A 1FRQA 2ZZFA 3WXMA 3ONUA 3KL9A 4B3XA 1K28D 2E1RA 3W5HA 4YHBA 4P26A 5DS0A 2ZXHA 4ASUA 4YAWA 3OJXA 3ZZUA 1KJZA 4P6VF 1G7RA 1VQ5B 2VNJA 1S72B 4XLEA 2ZL6A 3PUMA 1PJ5A 3OW2B 1QGYA 2CK3A 3QFTA 4XM3A 2F1LA 1QG0A 1HVXA 1UD6A 3DDYA 4WWVA 1H85A 3CRZA 2EIXA 2D3NA 2X6WA 4XLFA 1VQPB 4F7DA 3OP1A 4M0LA 4YEJA 5F4JA 1NJID 4XN0A 3OPOA 4WQMA 2F1MA 1Q81D 4WZEA 1W2BB 1WPCA 1UD3A 3E20A 4HIZA 3ZBUA 3B78A 1OB5A 4XN3A 4P3YA 1GJRA 4RD0A 2ZXIA 3ZZ0A 2DY1A 2X6YA 1QH0A 3A3GA 1NB9A 1WDTA 2VBUA 2XOKA 3CW2A 5TR9A 3ZZTA 2DEUA 1DDIA 1F60A 1XQBA 3WNDA 2YWGA 3CCRB 2BVNA 1EFUA 1R5OA 2JDIA 5JBQA 3CCMB 2C4UA 4P22A 4RDKA 1W0KA 1FNMA 1VQKB 1KK2A 1N05A 1V0FA 4M2LA 2FX3A 5E6TA 1BLIA 4XR6A 2WPDA 1NDHA 2X0KA 3G05A 1T6XA 1N08A 4DQLA 2W6IA 2BPOA 3AVYA 2OYNA 3PVDA 5FA6A 3W5UA 3ASPA 4II3A 1YLOA 1N07A 4Z4VA 4HE5A 4FWTA 3ISXA 1I7PA 3CCQB 2QA4B 3Q6QA 2DERA 3A8JA 2OK8A 1KZLA 1YX2A 2XZOA 1E62A 4PAAA 4UZUA 3A35A 4X7EA 2BSAA 2X3UA 3MMPA 3CCSB 1V5VA 5GV8A 2VNHA 3CMEB 2VYQA 1FDRA 4HE6A 4XMYA 4DQKA 2HDNB 1N0VC 2HMAA 2PIAA 2RC6A 4NCNA 1QX4A 1XFOA 3WBJA 3OAAA 1ZM4A 2V7QA 5DN6A 1GAWA 1F20A 2BM0A 2QTZA 1D8TA 1VQ8B 5F4MA 1VQMB 1VLOA 1TLLA 1ZM2A 3AVTA 4BPRA 1QVGB 1CNFA 1VQNB 4QFMA 3BH4A 2D74A 4Z1MA 3VMFA 3PA1A 4RCYA 1QFJA 1OB0A 4Z4YA 1YIJB 3SKBA 3ONYA 4QVJA 2XZLA 2QEXB 3FKSA 3LNNA 2ZZGA 1R5BA 5IYRA 2XNJA 5LMZA 1H42A 4UAJA 2I1LA 2M5SA 2VBVA 3WNCA 4G1BA 4B44A 4C0SA 1TVCA 2D3LA 4G6IA 2BMWA 4ROXA 2DIEA 4TMTA 4XONA 3H94A 1H8HA 5TV2A 1IJEA 1HA3A 1V0EA 2V7WA 1S0UA 1G7TA 2VJIA 3U2QA 5IYWA 1E3ZA 2HCJB 1W35A 4QV2A 5CDFA 3A8IA 4XQFA 2V31A 4Y9UA 3W2HA 1EP1B 2LZJA 3SEJA 1M1KD 4DNRB 2DETA 5H5JA 1YITB 4X7FA 1KRHA 3CP2A 4IW3B 5IYQA 4Z4SA 1VHOA 2BGIA 2AHOA 2BN4A 3SLNA 3CCVB 5THXA 1N0UA 1WTHD 3FPPA 3AVXA 1DARA 3BC9A 2CW5A 2BF4A 1JB9A 1EP3B 2QMUA 2C5BA 2V4DA 4RCZA 1OHHA 3T53B 4AF7A 4E0FA 1NRKA 2V7VA 2WR8A 4LC0A 5J35A 3OW7A 1BX1A 3JQRA 4N3GA 3PENA 2OTJB 3I1FA 3LQ6A 4C43A 4KKUA 4RPDA 1UD8A 4RD4A 3J81k 1FRNA 1GR1A 2Q6KA
chains in the Genus database with same CATH topology
3R6JA 2OBTA 4Z4WA 3PVDA 3SJPA 3ASPA 3PUNA 4QVAA 3BQJA 4X0CA 4Z4VA 3ASSA 2OBSA 3Q6QA 3Q6RA 4Z4RA 4X7CA 5BSYA 3BY2A 4P12A 3SLDA 5IYNA 4X7EA 5J3OA 3Q3AA 3V7AA 4X7DA 4X07A 4Z4ZA 2OBRA 3ASRA 4OOVA 4RDLA 4WZKA 4X06A 5F4MA 4OOXA 1IHMA 4Z4TA 3LQEA 4OPVA 4P1VA 4WZTA 4OPOA 4OOSA 4RLZA 2ZL5A 3PA1A 4P2NA 4Z4YA 3RY8A 3SKBA 3ONYA 4QVJA 3ONUA 5IYRA 4RPBA 4P26A 4ROXA 3PA2A 4X05A 2ZL6A 3PUMA 3ASQA 5IYPA 4Z4UA 5IYWA 4QV2A 3BY1A 3SEJA 5KW9A 5F4JA 4X7FA 4OP7A 5IYQA 4Z4SA 3Q39A 4WZEA 3ASTA 3SLNA 2ZL7A 4RDJA 3Q38A 3R6KA 5HZAA 5HZBA 3D26A 4WZLA 5J35A 4P3IA 4RDKA 4P25A 5E6TA 3LQ6A 5F4OA 4QUZA 4RPDA 4OPSA 5BSXA 4RM0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R6J A;  2OBT A;  4Z4W A;  3PVD A;  3SJP A;  3ASP A;  3PUN A;  4QVA A;  3BQJ A;  4X0C A;  4Z4V A;  3ASS A;  2OBS A;  3Q6Q A;  3Q6R A;  4Z4R A;  4X7C A;  5BSY A;  3BY2 A;  4P12 A;  3SLD A;  5IYN A;  4X7E A;  5J3O A;  3Q3A A;  3V7A A;  4X7D A;  4X07 A;  4Z4Z A;  2OBR A;  3ASR A;  4OOV A;  4RDL A;  4WZK A;  4X06 A;  5F4M A;  4OOX A;  1IHM A;  4Z4T A;  3LQE A;  4OPV A;  4P1V A;  4WZT A;  4OPO A;  4OOS A;  4RLZ A;  2ZL5 A;  3PA1 A;  4P2N A;  4Z4Y A;  3RY8 A;  3SKB A;  3ONY A;  4QVJ A;  3ONU A;  5IYR A;  4RPB A;  4P26 A;  4ROX A;  3PA2 A;  4X05 A;  2ZL6 A;  3PUM A;  3ASQ A;  5IYP A;  4Z4U A;  5IYW A;  4QV2 A;  3BY1 A;  3SEJ A;  5KW9 A;  5F4J A;  4X7F A;  4OP7 A;  5IYQ A;  4Z4S A;  3Q39 A;  4WZE A;  3AST A;  3SLN A;  2ZL7 A;  4RDJ A;  3Q38 A;  3R6K A;  5HZA A;  5HZB A;  3D26 A;  4WZL A;  5J35 A;  4P3I A;  4RDK A;  4P25 A;  5E6T A;  3LQ6 A;  5F4O A;  4QUZ A;  4RPD A;  4OPS A;  5BSX A;  4RM0 A; 
#chains in the Genus database with same CATH topology
 1MAB A;  2ZTG A;  3R6J A;  1VJS A;  4G1V A;  1G7S A;  2GRE A;  1I18 A;  4TMV A;  3CES A;  3SJP A;  1DG1 G;  2QTL A;  1D1N A;  4ACB A;  1E63 A;  3PUN A;  1KK0 A;  1JNY A;  1BMF A;  1T5E A;  4ZCL A;  1WSV A;  1Q82 D;  5TY0 A;  2GJK A;  1OB2 A;  2ZTN A;  4MYU A;  4PC1 A;  3KEW A;  1WSR A;  1JA1 A;  1KK1 A;  3BY2 A;  4Y9R A;  1EWY A;  2KVO A;  4DNT B;  2D9R A;  3QSY A;  1Q7Y D;  3I55 B;  1ZM9 A;  3BNW A;  3V7A A;  1UD5 A;  4FK8 A;  4X7D A;  2XGJ A;  1EFT A;  2PE3 A;  1W9X A;  3FJO A;  4EH1 A;  2V7T A;  4XOR A;  4Z4Z A;  2JN9 A;  3VNU A;  2GK6 A;  3B8H A;  1FNC A;  3CPW B;  4WZK A;  2XNC A;  2PLF A;  4P6Y A;  2FVG A;  4ZCM A;  4OOX A;  2C5H A;  1ELO A;  1KMH A;  2YWE A;  1U2R A;  2YWH A;  2DCU A;  1KTV A;  3ZUG A;  2WYR A;  3WBK A;  4OOS A;  1WOS A;  1GVH A;  3VNV A;  2B7B A;  3WQZ A;  1B23 P;  1K9M D;  4LBV A;  4B48 A;  3RY8 A;  4B3F X;  4ZV4 A;  3CC2 B;  3ZC3 A;  4P9S A;  2ZBV A;  1E64 A;  4TKO B;  1E43 A;  2C78 A;  1EP2 B;  3VO1 A;  4U9U A;  2QN6 A;  4PC6 A;  4LBY A;  4X05 A;  2RC5 A;  1FNB A;  4Q7J B;  2WJV A;  1JA0 A;  2QDX A;  4X8I A;  2WZP P;  3A8K A;  5KW9 A;  1AMO A;  4TT3 A;  2BGJ A;  3QE2 A;  4YAL A;  2JJ1 A;  1WOP A;  4B3G A;  3Q39 A;  4B47 A;  2GK7 A;  3B82 A;  3W2I A;  3WYA A;  2ZL7 A;  1E79 A;  4RDJ A;  1YI2 B;  2XND A;  1EXM A;  2JIZ A;  3R6K A;  4UZE A;  1W0J A;  4ZCI A;  3CMM A;  1E1Q A;  1VQ6 B;  3D26 A;  2ZIT A;  3OZW A;  1I8D A;  3GVJ A;  3GVL A;  2R9V A;  4WZL A;  3I56 B;  4RJL A;  5EMN A;  4J0Q A;  1JJ2 B;  1R5N A;  1ZUN B;  2W6J A;  1EFC A;  2PMD A;  4TMX A;  1VLY A;  1QFY A;  2VNI A;  3W2E A;  4LBW A;  2WSS A;  4ZGN B;  4MYT A;  4PC7 A;  2BM1 A;  3BCD A;  3BCF A;  4TN1 A;  1QVF B;  4G7X A;  1Q86 D;  5H59 A;  1XB2 A;  1IJF A;  4RD2 A;  1N06 A;  3A3B A;  3P26 A;  1SM4 A;  4XL9 A;  2Q6I A;  3OJW A;  3BQJ A;  4X0C A;  3OZU A;  3OE7 A;  4TMZ A;  5FIU A;  1S4M A;  3W2G A;  1VQ7 B;  1CQX A;  3ASS A;  4FXU A;  5A88 A;  2XZP A;  3MHP A;  4TSF A;  1KD1 D;  2V7X A;  5BSY A;  2B5O A;  3JQP A;  4P12 A;  1CNE A;  4Y7C A;  5DSZ A;  5KNL A;  2P3M A;  3SLD A;  2VNK A;  2HLD A;  5IYN A;  4AF6 A;  4NNJ A;  3MCA A;  5J3O A;  3Q3A A;  2R6H A;  3GVK A;  4XLH A;  4R71 A;  4YAO A;  2BV3 A;  4L8J A;  5TRD A;  1M90 D;  1BPL A;  2GJP A;  1RQP A;  4X07 A;  1Y0R A;  3OZV A;  3T51 B;  1KQS B;  1DDG A;  3CB4 A;  4M4S A;  1QUE A;  3AVU A;  2GJR A;  2ZZQ A;  3ASR A;  4M53 A;  2GQF A;  4OOV A;  1GO2 A;  3QFC A;  3SJZ A;  1G7C A;  1K8A D;  3QFS A;  3CCU B;  4X06 A;  3WY9 A;  3ES9 A;  4YEL A;  2EFG A;  1W87 A;  3GQB A;  2QE7 A;  1IHM A;  4GQN A;  2CC2 A;  3LQE A;  3OFN A;  4P1V A;  2C77 A;  4WZT A;  4Z4T A;  4OPO A;  1NB0 A;  4RLZ A;  3G4S B;  5KSW B;  4XLC A;  2ZL5 A;  4P2N A;  1VQ9 B;  1KK3 A;  2F43 A;  3GIR A;  3LO8 A;  4H9G A;  1H8E A;  4G5G A;  1SKQ A;  4RPB A;  4RD1 A;  4JMQ A;  3LVB A;  1PJ6 A;  4AVZ A;  5A89 A;  1W34 A;  3E1Y E;  1VQO B;  3PA2 A;  3WNB A;  3OEH A;  1VQL B;  2DYI A;  3CCJ B;  1YJ9 B;  3AGQ A;  1Y0Y A;  2C4T A;  1BJK A;  3ASQ A;  5HXB A;  1Q9S A;  4Z4U A;  5IYP A;  1PKV A;  2X53 S;  4XD7 A;  1UMK A;  3ZBT A;  2CRV A;  2NV4 A;  1BX0 A;  3BY1 A;  4ACA A;  1MRZ A;  3P27 A;  3U6B A;  1PJ7 A;  2VJJ A;  4PC3 A;  4OP7 A;  1E1R A;  4PAB A;  2OK7 A;  4KKS A;  1TTT A;  2X6X A;  3W5V A;  3QFR A;  3AST A;  3CTA A;  1QGZ A;  2DOG A;  4LBZ A;  4YAF A;  2YWF A;  4DK0 A;  3FPK A;  1QGA A;  2CBX A;  4DK1 A;  3Q38 A;  5HZA A;  5HZB A;  3CPX A;  1KC8 D;  4B43 A;  4KKT A;  1RQR A;  3U6K A;  5L46 A;  1T6Z A;  5FO1 A;  4B4D A;  4XOT A;  1IB0 A;  4PGO A;  1YJW B;  4P3I A;  1GAQ A;  1QFZ A;  2OTL B;  3AVW A;  1VQ4 B;  3JU4 A;  4P25 A;  4PC2 A;  4UZF A;  4QHY A;  5F4O A;  1N8R D;  2X8K A;  4QUZ A;  3CMA B;  2ZZE A;  1FND A;  3V76 A;  2ZBU A;  4N3N A;  1ZM3 A;  2VZL A;  4RD3 A;  3A1P A;  3ZPN A;  4OPS A;  1EFR A;  2CF4 A;  1UD4 A;  4RM0 A;  4CQJ A;  5BSX A;  5IK2 A;  2Q6L A;  1QUF A;  4K1X A;  4XLA A;  5AN9 A;  4XOP A;  1WOR A;  2OBT A;  3JQQ A;  1P4M A;  4Z4W A;  2JJ2 A;  4TMW A;  5FL7 A;  1D2E A;  4AC9 A;  3OEE A;  4QVA A;  1YJN B;  3CC7 B;  2Q6O A;  4G7W A;  2J7K A;  1YHQ B;  1NBM A;  3OOC A;  2OBS A;  2WJY A;  2WZN A;  2NPF A;  3GSI A;  3T56 B;  4Z4R A;  3Q6R A;  2VBT A;  1HZE A;  4X7C A;  2B7C A;  4XKW A;  3CCL B;  1B2R A;  2CND A;  3ZIA A;  3CXC B;  2GPJ A;  2C2W A;  3H9N A;  4YAU A;  3CC4 B;  1BQE A;  4XNF A;  5FNZ A;  3CCE B;  3CD6 B;  1J9Z A;  1WP6 A;  2F4N A;  2VBS A;  3VO2 A;  2X85 A;  1AIP A;  3W2F A;  1WU8 A;  2V7U A;  1WOO A;  3AGP A;  3AVV A;  2XEX A;  4YXW A;  4XKV A;  4RD6 A;  3NE5 B;  3VR6 A;  3G71 B;  2OBR A;  1UD2 A;  1FX0 A;  3HAG A;  4ZGQ B;  1SKY B;  1E3X A;  5HKK A;  1K73 D;  4RDL A;  5B6I A;  4FN5 A;  4NBS A;  3G6E B;  1T6Y A;  1A8P A;  1VF7 A;  2QGG A;  4OPV A;  1OGI A;  1COW A;  5FO0 A;  1XE1 A;  5GV7 A;  1TUI A;  3CP8 A;  5A8A A;  4M1K A;  1OGJ A;  2Z6B D;  2E1B A;  1VHE A;  3OKX A;  4II2 A;  1FRQ A;  2ZZF A;  3WXM A;  3ONU A;  3KL9 A;  4B3X A;  1K28 D;  2E1R A;  3W5H A;  4YHB A;  4P26 A;  5DS0 A;  2ZXH A;  4ASU A;  4YAW A;  3OJX A;  3ZZU A;  1KJZ A;  4P6V F;  1G7R A;  1VQ5 B;  2VNJ A;  1S72 B;  4XLE A;  2ZL6 A;  3PUM A;  1PJ5 A;  3OW2 B;  1QGY A;  2CK3 A;  3QFT A;  4XM3 A;  2F1L A;  1QG0 A;  1HVX A;  1UD6 A;  3DDY A;  4WWV A;  1H85 A;  3CRZ A;  2EIX A;  2D3N A;  2X6W A;  4XLF A;  1VQP B;  4F7D A;  3OP1 A;  4M0L A;  4YEJ A;  5F4J A;  1NJI D;  4XN0 A;  3OPO A;  4WQM A;  2F1M A;  1Q81 D;  4WZE A;  1W2B B;  1WPC A;  1UD3 A;  3E20 A;  4HIZ A;  3ZBU A;  3B78 A;  1OB5 A;  4XN3 A;  4P3Y A;  1GJR A;  4RD0 A;  2ZXI A;  3ZZ0 A;  2DY1 A;  2X6Y A;  1QH0 A;  3A3G A;  1NB9 A;  1WDT A;  2VBU A;  2XOK A;  3CW2 A;  5TR9 A;  3ZZT A;  2DEU A;  1DDI A;  1F60 A;  1XQB A;  3WND A;  2YWG A;  3CCR B;  2BVN A;  1EFU A;  1R5O A;  2JDI A;  5JBQ A;  3CCM B;  2C4U A;  4P22 A;  4RDK A;  1W0K A;  1FNM A;  1VQK B;  1KK2 A;  1N05 A;  1V0F A;  4M2L A;  2FX3 A;  5E6T A;  1BLI A;  4XR6 A;  2WPD A;  1NDH A;  2X0K A;  3G05 A;  1T6X A;  1N08 A;  4DQL A;  2W6I A;  2BPO A;  3AVY A;  2OYN A;  3PVD A;  5FA6 A;  3W5U A;  3ASP A;  4II3 A;  1YLO A;  1N07 A;  4Z4V A;  4HE5 A;  4FWT A;  3ISX A;  1I7P A;  3CCQ B;  2QA4 B;  3Q6Q A;  2DER A;  3A8J A;  2OK8 A;  1KZL A;  1YX2 A;  2XZO A;  1E62 A;  4PAA A;  4UZU A;  3A35 A;  4X7E A;  2BSA A;  2X3U A;  3MMP A;  3CCS B;  1V5V A;  5GV8 A;  2VNH A;  3CME B;  2VYQ A;  1FDR A;  4HE6 A;  4XMY A;  4DQK A;  2HDN B;  1N0V C;  2HMA A;  2PIA A;  2RC6 A;  4NCN A;  1QX4 A;  1XFO A;  3WBJ A;  3OAA A;  1ZM4 A;  2V7Q A;  5DN6 A;  1GAW A;  1F20 A;  2BM0 A;  2QTZ A;  1D8T A;  1VQ8 B;  5F4M A;  1VQM B;  1VLO A;  1TLL A;  1ZM2 A;  3AVT A;  4BPR A;  1QVG B;  1CNF A;  1VQN B;  4QFM A;  3BH4 A;  2D74 A;  4Z1M A;  3VMF A;  3PA1 A;  4RCY A;  1QFJ A;  1OB0 A;  4Z4Y A;  1YIJ B;  3SKB A;  3ONY A;  4QVJ A;  2XZL A;  2QEX B;  3FKS A;  3LNN A;  2ZZG A;  1R5B A;  5IYR A;  2XNJ A;  5LMZ A;  1H42 A;  4UAJ A;  2I1L A;  2M5S A;  2VBV A;  3WNC A;  4G1B A;  4B44 A;  4C0S A;  1TVC A;  2D3L A;  4G6I A;  2BMW A;  4ROX A;  2DIE A;  4TMT A;  4XON A;  3H94 A;  1H8H A;  5TV2 A;  1IJE A;  1HA3 A;  1V0E A;  2V7W A;  1S0U A;  1G7T A;  2VJI A;  3U2Q A;  5IYW A;  1E3Z A;  2HCJ B;  1W35 A;  4QV2 A;  5CDF A;  3A8I A;  4XQF A;  2V31 A;  4Y9U A;  3W2H A;  1EP1 B;  2LZJ A;  3SEJ A;  1M1K D;  4DNR B;  2DET A;  5H5J A;  1YIT B;  4X7F A;  1KRH A;  3CP2 A;  4IW3 B;  5IYQ A;  4Z4S A;  1VHO A;  2BGI A;  2AHO A;  2BN4 A;  3SLN A;  3CCV B;  5THX A;  1N0U A;  1WTH D;  3FPP A;  3AVX A;  1DAR A;  3BC9 A;  2CW5 A;  2BF4 A;  1JB9 A;  1EP3 B;  2QMU A;  2C5B A;  2V4D A;  4RCZ A;  1OHH A;  3T53 B;  4AF7 A;  4E0F A;  1NRK A;  2V7V A;  2WR8 A;  4LC0 A;  5J35 A;  3OW7 A;  1BX1 A;  3JQR A;  4N3G A;  3PEN A;  2OTJ B;  3I1F A;  3LQ6 A;  4C43 A;  4KKU A;  4RPD A;  1UD8 A;  4RD4 A;  3J81 k;  1FRN A;  1GR1 A;  2Q6K A; 
#chains in the Genus database with same CATH homology
 3R6J A;  2OBT A;  4Z4W A;  3PVD A;  3SJP A;  3ASP A;  3PUN A;  4QVA A;  3BQJ A;  4X0C A;  4Z4V A;  3ASS A;  2OBS A;  3Q6Q A;  3Q6R A;  4Z4R A;  4X7C A;  5BSY A;  3BY2 A;  4P12 A;  3SLD A;  5IYN A;  4X7E A;  5J3O A;  3Q3A A;  3V7A A;  4X7D A;  4X07 A;  4Z4Z A;  2OBR A;  3ASR A;  4OOV A;  4RDL A;  4WZK A;  4X06 A;  5F4M A;  4OOX A;  1IHM A;  4Z4T A;  3LQE A;  4OPV A;  4P1V A;  4WZT A;  4OPO A;  4OOS A;  4RLZ A;  2ZL5 A;  3PA1 A;  4P2N A;  4Z4Y A;  3RY8 A;  3SKB A;  3ONY A;  4QVJ A;  3ONU A;  5IYR A;  4RPB A;  4P26 A;  4ROX A;  3PA2 A;  4X05 A;  2ZL6 A;  3PUM A;  3ASQ A;  5IYP A;  4Z4U A;  5IYW A;  4QV2 A;  3BY1 A;  3SEJ A;  5KW9 A;  5F4J A;  4X7F A;  4OP7 A;  5IYQ A;  4Z4S A;  3Q39 A;  4WZE A;  3AST A;  3SLN A;  2ZL7 A;  4RDJ A;  3Q38 A;  3R6K A;  5HZA A;  5HZB A;  3D26 A;  4WZL A;  5J35 A;  4P3I A;  4RDK A;  4P25 A;  5E6T A;  3LQ6 A;  5F4O A;  4QUZ A;  4RPD A;  4OPS A;  5BSX A;  4RM0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...