5IYWA

Protruding domain of gii.4 human norovirus chdc2094 in complex with 3-fucosyllactose (3fl)
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
305
structure length
303
Chain Sequence
KPFTVPILTVEEMSNSRFPIPLEKLYTGPSSAFVVQPQNGRCTTDGVLLGTTQLSAVNICNFRGDVTRVGISHDYTMNLVSQNWNNYDPTEEIPAPLGTPDFVGKIQGLLTQTTRADGSTRAHKATVSTGSVHFTPKLGSVQFTTDTNNDFQTGQNTKFTPVGVIQDGHQNEPQQWVLPNYSGTSGHNVHLAPAVAPTFPGEQLLFFRSTMPGCSGYPNMNLDCLLPQEWVSHFYQEAAPAQSDVALLRFVNPDTGRVLFECKLHKSGYITVAHTGPYDLVIPPNGYFRFDSWVNQFYTLAPM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords VP1
publication title Structural basis for GII.4 norovirus inhibition by human milk oligosaccharides.
rcsb
source organism Norovirus hu/gii.4/chdc2094/1974/us
total genus 69
structure length 303
sequence length 305
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-03-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.120 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Positive stranded ssRNA viruses 5iywA02
2.40.510.10 Mainly Beta Beta Barrel Nucleoplasmin-like/VP (viral coat and capsid proteins) Positive stranded ssRNA viruses 5iywA01
4X7EA 2OBSA 4X07A 4OOVA 3Q3AA 5IYRA 5E6TA 5F4OA 3PA2A 3PVDA 5J35A 4OOXA 4OPSA 4Z4TA 4WZKA 4RDLA 4P12A 4OPOA 5F4MA 2ZL5A 5BSXA 5IYNA 3PUNA 4WZLA 2ZL6A 4QVJA 4P26A 4RDKA 4X06A 4Z4SA 4OP7A 2OBRA 3Q6QA 2ZL7A 4Z4RA 3V7AA 3SLNA 4RPDA 4ROXA 4Z4YA 5KW9A 4QVAA 3R6KA 3LQEA 5F4JA 3SEJA 2OBTA 3ASTA 3ASSA 4OPVA 3ASPA 3Q38A 3LQ6A 3ASQA 4Z4WA 3ONUA 3BY2A 3D26A 5IYWA 4RDJA 4X7FA 3BY1A 3ASRA 4OOSA 3R6JA 4P2NA 3Q6RA 5BSYA 1IHMA 4X7CA 4RM0A 4X0CA 4WZEA 4Z4UA 5HZBA 3SJPA 4P25A 3SLDA 3SKBA 3ONYA 3PA1A 4RPBA 3BQJA 4P3IA 3RY8A 4QV2A 4X7DA 4WZTA 4QUZA 5J3OA 5IYPA 5HZAA 4Z4ZA 5IYQA 4Z4VA 4RLZA 4X05A 3PUMA 4P1VA 3Q39A
chains in the Genus database with same CATH superfamily
1TLLA 4X7EA 3WNBA 1UD4A 4Q7JB 4XQFA 3W2HA 3VO2A 2EFGA 2VNIA 1WOPA 4E0FA 2Q6OA 4KKUA 2JN9A 2YWEA 1VQLB 3PA2A 2V7XA 1K73D 1F20A 4LBWA 3MMPA 2W6IA 1QH0A 3ZC3A 4Z4TA 1QFYA 4QFMA 1YX2A 1DARA 1FRQA 1I7PA 5BSXA 5EMNA 4WZLA 1HVXA 1BX1A 4C0SA 3CESA 2ZZQA 3W2IA 1WPCA 3PENA 4Z4SA 1OGJA 3CW2A 4OP7A 3FKSA 3OJWA 1QGZA 2V7TA 4G7XA 4YALA 1V5VA 1OGIA 2KVOA 2OBRA 1V0EA 1Q86D 5FO1A 2ZL7A 2V7UA 2OTJB 4Z4RA 2BM1A 2BSAA 4JMQA 3WBJA 3SLNA 2VYQA 4RPDA 2OTLB 4Z4YA 3WYAA 4DNRB 1VLYA 2E1RA 5KW9A 2D3NA 1W2BB 3DDYA 1Y0YA 5DSZA 3W2GA 2BN4A 1KRHA 1W0JA 2OBTA 2XOKA 2ZTGA 3ASSA 3ASPA 4TMVA 3CCVB 4M2LA 1UD3A 1M90D 1PJ5A 1VQ6B 1K8AD 3AVXA 3W5UA 5FA6A 2DCUA 1FNDA 2R6HA 2WZNA 3ES9A 3BY2A 3CCEB 2VBTA 3ZBTA 4RDJA 3BNWA 3CCJB 1T5EA 2V7VA 1PKVA 1GO2A 1EFCA 1VQKB 4XLFA 2DETA 4UZFA 3FPPA 1QG0A 4LBVA 2XNDA 1E64A 4XOPA 3AVYA 1AIPA 1VQMB 1Y0RA 4GQNA 4H9GA 4PC2A 4X7CA 4RJLA 4X0CA 1BLIA 1HZEA 2BMWA 1WP6A 2F1LA 1HA3A 4M1KA 2NV4A 4XLEA 5HZBA 4P25A 4FK8A 1S4MA 1E79A 2BPOA 3SKBA 3LNNA 5IK2A 1QX4A 2BGJA 4XOTA 3RY8A 1BX0A 3CP8A 2WSSA 1ELOA 1VJSA 3ZBUA 2OK7A 4WZTA 4QUZA 2ZZFA 3ZIAA 4B3FX 3FPKA 5HZAA 1EP1B 1JB9A 4QHYA 5GV8A 3A8IA 1T6ZA 1KTVA 3A8KA 2ZITA 2OYNA 3JQRA 1KK3A 2VNHA 4Y7CA 4TMZA 4Z4VA 1FNCA 4RLZA 1WSVA 4B3XA 2JJ2A 5HXBA 1N0VC 2JIZA 4P3YA 4UZEA 1TUIA 1NDHA 2CC2A 4XNFA 2VJJA 5CDFA 4Y9UA 1N06A 1E63A 4DNTB 1NB0A 3W2FA 4BPRA 5IYRA 2M5SA 2ZTNA 1NJID 4RD0A 2YWGA 4DQKA 3PVDA 1VQ4B 2VBVA 5J35A 1E43A 1QUEA 2W6JA 3OOCA 4AVZA 4WZKA 4L8JA 1EWYA 4P12A 4OPOA 2ZL5A 4TMTA 4PC1A 1QVFB 1R5NA 4PGOA 1BPLA 1QFJA 2WZPP 4PC7A 1SM4A 3WQZA 1NRKA 4YAUA 4QVJA 4X06A 4XLAA 1Q82D 1KD1D 2CW5A 5DS0A 5L46A 4UZUA 3G4SB 4KKTA 4YHBA 2B5OA 1GAQA 2QEXB 2QE7A 1BQEA 1VHOA 2WYRA 3ZPNA 4HIZA 3T53B 4UAJA 3V7AA 2FVGA 3U6KA 2JDIA 2QGGA 4RCZA 1H85A 3LO8A 3OJXA 4U9UA 1FDRA 5AN9A 2CF4A 1QGAA 4II3A 4XD7A 3WNCA 1B23P 1JA0A 4ACAA 3SEJA 4P9SA 2DEUA 4G1VA 1YJNB 3B8HA 3G05A 1EFTA 3MCAA 3LQ6A 3OE7A 1IB0A 1E62A 1UD6A 3T56B 5FIUA 3H94A 3GVLA 5A8AA 4ZCMA 3AGPA 3WBKA 3D26A 5IYWA 4XLCA 1YITB 4X7FA 3A3GA 3B82A 4OOSA 3VO1A 5GV7A 4C43A 2GQFA 2DERA 2BV3A 5TV2A 2CBXA 2VBSA 5TR9A 3P26A 2ZBVA 2PIAA 4XR6A 2XZOA 1MRZA 2CK3A 5JBQA 4WQMA 2V31A 4XN3A 2HDNB 1P4MA 4RM0A 3CMEB 3OFNA 4RCYA 2V4DA 4WZEA 4DK0A 1EFUA 4Z4UA 3CB4A 1KQSB 4G7WA 1UD2A 1COWA 1H42A 1D2EA 4RD4A 1OB5A 1RQPA 4J0QA 3SLDA 4B43A 3JU4A 4RPBA 3G71B 5LMZA 3G6EB 3BQJA 4WWVA 4P3IA 1W34A 1N8RD 1A8PA 4QV2A 2XZPA 2C5HA 2QA4B 1W0KA 1W9XA 2XNCA 4X7DA 4DK1A 1DDIA 1ZM2A 4XN0A 4TMWA 1I18A 3QFCA 1G7RA 3GQBA 3W5VA 5IYPA 4B48A 2GK6A 1W87A 1KZLA 3KL9A 5TRDA 1YHQB 1T6YA 2V7QA 1BMFA 3CMMA 4NNJA 1DG1G 4TSFA 3QFRA 1E3ZA 1OB2A 3I55B 4XKVA 4YELA 3QSYA 2DY1A 1T6XA 1N08A 4XMYA 1KK1A 1FRNA 1YJ9B 3MHPA 1G7TA 2HMAA 3GVJA 3CPWB 3QFSA 2OBSA 1MABA 1EP3B 4X07A 1IJFA 1GR1A 5A89A 3CXCB 1E3XA 4PC3A 3Q3AA 3J81k 5F4OA 4P6YA 1NBMA 2BM0A 4ZCIA 3BH4A 2Q6IA 3A3BA 2GK7A 4ACBA 3GVKA 1VQ7B 2X6XA 1W35A 4AC9A 3PUNA 3CC7B 1KC8D 2ZL6A 1OHHA 2FX3A 4EH1A 3U6BA 1QFZA 4P26A 4RDKA 4AF6A 3QE2A 2V7WA 4XONA 2X6YA 2QN6A 3A8JA 5THXA 4CQJA 4M4SA 1IJEA 1J9ZA 3P27A 3OZWA 3Q6QA 4HE6A 2RC5A 2R9VA 4M53A 2GJKA 2X6WA 5KSWB 2ZXHA 3AVTA 3CPXA 4PAAA 4ROXA 4DQLA 2B7BA 3OEHA 2GJPA 1D8TA 1QUFA 1EFRA 3R6KA 1VQ9B 1YLOA 4XORA 4LBYA 3LVBA 1H8HA 4N3GA 1YI2B 5H5JA 2DOGA 3ASTA 4YXWA 4OPVA 5TY0A 4B4DA 3OKXA 1Q7YD 3BC9A 4II2A 3CCLB 3ASQA 2D74A 4Z4WA 1GAWA 2GREA 2D3LA 3E1YE 5B6IA 3H9NA 4Z1MA 3AVWA 2I1LA 4ZV4A 1TVCA 4B47A 3CCMB 3BY1A 3I56B 2F1MA 3R6JA 2C77A 4P2NA 1N07A 2VJIA 2C2WA 2XGJA 1KK2A 1G7CA 3Q6RA 2D9RA 1PJ7A 2HLDA 2BGIA 5BSYA 1IHMA 2WR8A 4X8IA 4ZGNB 4RD6A 1FNBA 4RD2A 3VMFA 3VNUA 5FL7A 4HE5A 2X0KA 1U2RA 4M0LA 5H59A 3SJPA 1VQOB 3CC4B 4G1BA 2RC6A 3W2EA 3PA1A 1EP2B 3OP1A 1WORA 3ZZTA 2QDXA 4FXUA 3OZUA 3E20A 1WOOA 2C4TA 1ZM9A 5FO0A 1KJZA 2HCJB 1KK0A 4RD3A 4B3GA 4TN1A 1XFOA 4ASUA 1YJWB 3B78A 5IYQA 1Q9SA 2VNKA 3KEWA 4MYTA 2AHOA 1WDTA 4ZGQB 4B44A 3WNDA 3AVVA 1VF7A 4X05A 3PUMA 4MYUA 4P1VA 4Z4ZA 3Q39A 1QVGB 2X3UA 2Z6BD 1K9MD 3ISXA 3OAAA 2GPJA 2WJYA 2CRVA 2BF4A 4OOVA 1AMOA 3FJOA 1N0UA 2VBUA 3NE5B 1VLOA 5E6TA 3A1PA 1GJRA 4K1XA 3QFTA 4RD1A 1S72B 1WU8A 1CQXA 5DN6A 3WXMA 4XM3A 4OOXA 1E1RA 1VHEA 1WOSA 1XB2A 4OPSA 4YAWA 2DIEA 2PMDA 4RDLA 1CNFA 1UMKA 5A88A 2P3MA 5F4MA 2WPDA 5IYNA 1WTHD 3BCDA 1E1QA 1Q81D 1S0UA 1M1KD 3A35A 4XL9A 1JJ2B 1JA1A 1R5BA 4LBZA 5HKKA 1N05A 2B7CA 3VNVA 3CCQB 3HAGA 2NPFA 2WJVA 1V0FA 4IW3B 3BCFA 1WSRA 1PJ6A 1FNMA 4FN5A 2LZJA 2QTLA 1TTTA 1JNYA 1I8DA 3CRZA 4QVAA 2C4UA 3SJZA 1VQNB 2X85A 2VNJA 3ZZUA 1VQ5B 2CNDA 1B2RA 3LQEA 4P6VF 4NCNA 5F4JA 1XE1A 1UD5A 4XKWA 3AVUA 1BJKA 4N3NA 3Q38A 4Y9RA 2F4NA 2PLFA 1FX0A 4R71A 2DYIA 4AF7A 1SKYB 3ZZ0A 1ZM3A 1KMHA 1EXMA 4KKSA 4TT3A 4F7DA 2Q6KA 2X53S 2ZZEA 3GSIA 2YWHA 3ONUA 1NB9A 3CCUB 3OZVA 3W5HA 2ZZGA 1YIJB 3ASRA 3CC2B 1XQBA 4YAOA 1ZM4A 4XLHA 1VQ8B 1GVHA 1CNEA 1SKQA 1D1NA 3CMAB 1H8EA 3AGQA 1QGYA 3GIRA 1ZUNB 2GJRA 2J7KA 2YWFA 1K28D 2JJ1A 4FWTA 3JQQA 2E1BA 3JQPA 2C78A 2QTZA 4P22A 4PABA 2Q6LA 3CD6B 1VQPB 3ONYA 2BVNA 3I1FA 1OB0A 4TMXA 4G6IA 2C5BA 2F43A 3WY9A 3CCSB 3OW2B 1F60A 2ZXIA 3OPOA 4TKOB 1G7SA 1R5OA 2EIXA 4NBSA 4YAFA 3CTAA 4ZCLA 3VR6A 2XZLA 1RQRA 2XEXA 1UD8A 5J3OA 3U2QA 2PE3A 5FNZA 2VZLA 3CP2A 1DDGA 5KNLA 3ZUGA 4PC6A 2XNJA 4LC0A 2ZBUA 3OW7A 2QMUA 3T51B 2OK8A 3V76A 4G5GA 3OEEA 2X8KA 4YEJA 3CCRB
chains in the Genus database with same CATH topology
4X7EA 2OBSA 4X07A 4OOVA 3Q3AA 5IYRA 5E6TA 5F4OA 3PA2A 3PVDA 5J35A 4OOXA 4OPSA 4Z4TA 4WZKA 4RDLA 4P12A 4OPOA 5F4MA 2ZL5A 5BSXA 5IYNA 3PUNA 4WZLA 2ZL6A 4QVJA 4P26A 4RDKA 4X06A 4Z4SA 4OP7A 2OBRA 3Q6QA 2ZL7A 4Z4RA 3V7AA 3SLNA 4RPDA 4ROXA 4Z4YA 5KW9A 4QVAA 3R6KA 3LQEA 5F4JA 3SEJA 2OBTA 3ASTA 3ASSA 4OPVA 3ASPA 3Q38A 3LQ6A 3ASQA 4Z4WA 3ONUA 3BY2A 3D26A 5IYWA 4RDJA 4X7FA 3BY1A 3ASRA 4OOSA 3R6JA 4P2NA 3Q6RA 5BSYA 1IHMA 4X7CA 4RM0A 4X0CA 4WZEA 4Z4UA 5HZBA 3SJPA 4P25A 3SLDA 3SKBA 3ONYA 3PA1A 4RPBA 3BQJA 4P3IA 3RY8A 4QV2A 4X7DA 4WZTA 4QUZA 5J3OA 5IYPA 5HZAA 4Z4ZA 5IYQA 4Z4VA 4RLZA 4X05A 3PUMA 4P1VA 3Q39A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X7E A;  2OBS A;  4X07 A;  4OOV A;  3Q3A A;  5IYR A;  5E6T A;  5F4O A;  3PA2 A;  3PVD A;  5J35 A;  4OOX A;  4OPS A;  4Z4T A;  4WZK A;  4RDL A;  4P12 A;  4OPO A;  5F4M A;  2ZL5 A;  5BSX A;  5IYN A;  3PUN A;  4WZL A;  2ZL6 A;  4QVJ A;  4P26 A;  4RDK A;  4X06 A;  4Z4S A;  4OP7 A;  2OBR A;  3Q6Q A;  2ZL7 A;  4Z4R A;  3V7A A;  3SLN A;  4RPD A;  4ROX A;  4Z4Y A;  5KW9 A;  4QVA A;  3R6K A;  3LQE A;  5F4J A;  3SEJ A;  2OBT A;  3AST A;  3ASS A;  4OPV A;  3ASP A;  3Q38 A;  3LQ6 A;  3ASQ A;  4Z4W A;  3ONU A;  3BY2 A;  3D26 A;  5IYW A;  4RDJ A;  4X7F A;  3BY1 A;  3ASR A;  4OOS A;  3R6J A;  4P2N A;  3Q6R A;  5BSY A;  1IHM A;  4X7C A;  4RM0 A;  4X0C A;  4WZE A;  4Z4U A;  5HZB A;  3SJP A;  4P25 A;  3SLD A;  3SKB A;  3ONY A;  3PA1 A;  4RPB A;  3BQJ A;  4P3I A;  3RY8 A;  4QV2 A;  4X7D A;  4WZT A;  4QUZ A;  5J3O A;  5IYP A;  5HZA A;  4Z4Z A;  5IYQ A;  4Z4V A;  4RLZ A;  4X05 A;  3PUM A;  4P1V A;  3Q39 A; 
#chains in the Genus database with same CATH topology
 1TLL A;  4X7E A;  3WNB A;  1UD4 A;  4Q7J B;  4XQF A;  3W2H A;  3VO2 A;  2EFG A;  2VNI A;  1WOP A;  4E0F A;  2Q6O A;  4KKU A;  2JN9 A;  2YWE A;  1VQL B;  3PA2 A;  2V7X A;  1K73 D;  1F20 A;  4LBW A;  3MMP A;  2W6I A;  1QH0 A;  3ZC3 A;  4Z4T A;  1QFY A;  4QFM A;  1YX2 A;  1DAR A;  1FRQ A;  1I7P A;  5BSX A;  5EMN A;  4WZL A;  1HVX A;  1BX1 A;  4C0S A;  3CES A;  2ZZQ A;  3W2I A;  1WPC A;  3PEN A;  4Z4S A;  1OGJ A;  3CW2 A;  4OP7 A;  3FKS A;  3OJW A;  1QGZ A;  2V7T A;  4G7X A;  4YAL A;  1V5V A;  1OGI A;  2KVO A;  2OBR A;  1V0E A;  1Q86 D;  5FO1 A;  2ZL7 A;  2V7U A;  2OTJ B;  4Z4R A;  2BM1 A;  2BSA A;  4JMQ A;  3WBJ A;  3SLN A;  2VYQ A;  4RPD A;  2OTL B;  4Z4Y A;  3WYA A;  4DNR B;  1VLY A;  2E1R A;  5KW9 A;  2D3N A;  1W2B B;  3DDY A;  1Y0Y A;  5DSZ A;  3W2G A;  2BN4 A;  1KRH A;  1W0J A;  2OBT A;  2XOK A;  2ZTG A;  3ASS A;  3ASP A;  4TMV A;  3CCV B;  4M2L A;  1UD3 A;  1M90 D;  1PJ5 A;  1VQ6 B;  1K8A D;  3AVX A;  3W5U A;  5FA6 A;  2DCU A;  1FND A;  2R6H A;  2WZN A;  3ES9 A;  3BY2 A;  3CCE B;  2VBT A;  3ZBT A;  4RDJ A;  3BNW A;  3CCJ B;  1T5E A;  2V7V A;  1PKV A;  1GO2 A;  1EFC A;  1VQK B;  4XLF A;  2DET A;  4UZF A;  3FPP A;  1QG0 A;  4LBV A;  2XND A;  1E64 A;  4XOP A;  3AVY A;  1AIP A;  1VQM B;  1Y0R A;  4GQN A;  4H9G A;  4PC2 A;  4X7C A;  4RJL A;  4X0C A;  1BLI A;  1HZE A;  2BMW A;  1WP6 A;  2F1L A;  1HA3 A;  4M1K A;  2NV4 A;  4XLE A;  5HZB A;  4P25 A;  4FK8 A;  1S4M A;  1E79 A;  2BPO A;  3SKB A;  3LNN A;  5IK2 A;  1QX4 A;  2BGJ A;  4XOT A;  3RY8 A;  1BX0 A;  3CP8 A;  2WSS A;  1ELO A;  1VJS A;  3ZBU A;  2OK7 A;  4WZT A;  4QUZ A;  2ZZF A;  3ZIA A;  4B3F X;  3FPK A;  5HZA A;  1EP1 B;  1JB9 A;  4QHY A;  5GV8 A;  3A8I A;  1T6Z A;  1KTV A;  3A8K A;  2ZIT A;  2OYN A;  3JQR A;  1KK3 A;  2VNH A;  4Y7C A;  4TMZ A;  4Z4V A;  1FNC A;  4RLZ A;  1WSV A;  4B3X A;  2JJ2 A;  5HXB A;  1N0V C;  2JIZ A;  4P3Y A;  4UZE A;  1TUI A;  1NDH A;  2CC2 A;  4XNF A;  2VJJ A;  5CDF A;  4Y9U A;  1N06 A;  1E63 A;  4DNT B;  1NB0 A;  3W2F A;  4BPR A;  5IYR A;  2M5S A;  2ZTN A;  1NJI D;  4RD0 A;  2YWG A;  4DQK A;  3PVD A;  1VQ4 B;  2VBV A;  5J35 A;  1E43 A;  1QUE A;  2W6J A;  3OOC A;  4AVZ A;  4WZK A;  4L8J A;  1EWY A;  4P12 A;  4OPO A;  2ZL5 A;  4TMT A;  4PC1 A;  1QVF B;  1R5N A;  4PGO A;  1BPL A;  1QFJ A;  2WZP P;  4PC7 A;  1SM4 A;  3WQZ A;  1NRK A;  4YAU A;  4QVJ A;  4X06 A;  4XLA A;  1Q82 D;  1KD1 D;  2CW5 A;  5DS0 A;  5L46 A;  4UZU A;  3G4S B;  4KKT A;  4YHB A;  2B5O A;  1GAQ A;  2QEX B;  2QE7 A;  1BQE A;  1VHO A;  2WYR A;  3ZPN A;  4HIZ A;  3T53 B;  4UAJ A;  3V7A A;  2FVG A;  3U6K A;  2JDI A;  2QGG A;  4RCZ A;  1H85 A;  3LO8 A;  3OJX A;  4U9U A;  1FDR A;  5AN9 A;  2CF4 A;  1QGA A;  4II3 A;  4XD7 A;  3WNC A;  1B23 P;  1JA0 A;  4ACA A;  3SEJ A;  4P9S A;  2DEU A;  4G1V A;  1YJN B;  3B8H A;  3G05 A;  1EFT A;  3MCA A;  3LQ6 A;  3OE7 A;  1IB0 A;  1E62 A;  1UD6 A;  3T56 B;  5FIU A;  3H94 A;  3GVL A;  5A8A A;  4ZCM A;  3AGP A;  3WBK A;  3D26 A;  5IYW A;  4XLC A;  1YIT B;  4X7F A;  3A3G A;  3B82 A;  4OOS A;  3VO1 A;  5GV7 A;  4C43 A;  2GQF A;  2DER A;  2BV3 A;  5TV2 A;  2CBX A;  2VBS A;  5TR9 A;  3P26 A;  2ZBV A;  2PIA A;  4XR6 A;  2XZO A;  1MRZ A;  2CK3 A;  5JBQ A;  4WQM A;  2V31 A;  4XN3 A;  2HDN B;  1P4M A;  4RM0 A;  3CME B;  3OFN A;  4RCY A;  2V4D A;  4WZE A;  4DK0 A;  1EFU A;  4Z4U A;  3CB4 A;  1KQS B;  4G7W A;  1UD2 A;  1COW A;  1H42 A;  1D2E A;  4RD4 A;  1OB5 A;  1RQP A;  4J0Q A;  3SLD A;  4B43 A;  3JU4 A;  4RPB A;  3G71 B;  5LMZ A;  3G6E B;  3BQJ A;  4WWV A;  4P3I A;  1W34 A;  1N8R D;  1A8P A;  4QV2 A;  2XZP A;  2C5H A;  2QA4 B;  1W0K A;  1W9X A;  2XNC A;  4X7D A;  4DK1 A;  1DDI A;  1ZM2 A;  4XN0 A;  4TMW A;  1I18 A;  3QFC A;  1G7R A;  3GQB A;  3W5V A;  5IYP A;  4B48 A;  2GK6 A;  1W87 A;  1KZL A;  3KL9 A;  5TRD A;  1YHQ B;  1T6Y A;  2V7Q A;  1BMF A;  3CMM A;  4NNJ A;  1DG1 G;  4TSF A;  3QFR A;  1E3Z A;  1OB2 A;  3I55 B;  4XKV A;  4YEL A;  3QSY A;  2DY1 A;  1T6X A;  1N08 A;  4XMY A;  1KK1 A;  1FRN A;  1YJ9 B;  3MHP A;  1G7T A;  2HMA A;  3GVJ A;  3CPW B;  3QFS A;  2OBS A;  1MAB A;  1EP3 B;  4X07 A;  1IJF A;  1GR1 A;  5A89 A;  3CXC B;  1E3X A;  4PC3 A;  3Q3A A;  3J81 k;  5F4O A;  4P6Y A;  1NBM A;  2BM0 A;  4ZCI A;  3BH4 A;  2Q6I A;  3A3B A;  2GK7 A;  4ACB A;  3GVK A;  1VQ7 B;  2X6X A;  1W35 A;  4AC9 A;  3PUN A;  3CC7 B;  1KC8 D;  2ZL6 A;  1OHH A;  2FX3 A;  4EH1 A;  3U6B A;  1QFZ A;  4P26 A;  4RDK A;  4AF6 A;  3QE2 A;  2V7W A;  4XON A;  2X6Y A;  2QN6 A;  3A8J A;  5THX A;  4CQJ A;  4M4S A;  1IJE A;  1J9Z A;  3P27 A;  3OZW A;  3Q6Q A;  4HE6 A;  2RC5 A;  2R9V A;  4M53 A;  2GJK A;  2X6W A;  5KSW B;  2ZXH A;  3AVT A;  3CPX A;  4PAA A;  4ROX A;  4DQL A;  2B7B A;  3OEH A;  2GJP A;  1D8T A;  1QUF A;  1EFR A;  3R6K A;  1VQ9 B;  1YLO A;  4XOR A;  4LBY A;  3LVB A;  1H8H A;  4N3G A;  1YI2 B;  5H5J A;  2DOG A;  3AST A;  4YXW A;  4OPV A;  5TY0 A;  4B4D A;  3OKX A;  1Q7Y D;  3BC9 A;  4II2 A;  3CCL B;  3ASQ A;  2D74 A;  4Z4W A;  1GAW A;  2GRE A;  2D3L A;  3E1Y E;  5B6I A;  3H9N A;  4Z1M A;  3AVW A;  2I1L A;  4ZV4 A;  1TVC A;  4B47 A;  3CCM B;  3BY1 A;  3I56 B;  2F1M A;  3R6J A;  2C77 A;  4P2N A;  1N07 A;  2VJI A;  2C2W A;  2XGJ A;  1KK2 A;  1G7C A;  3Q6R A;  2D9R A;  1PJ7 A;  2HLD A;  2BGI A;  5BSY A;  1IHM A;  2WR8 A;  4X8I A;  4ZGN B;  4RD6 A;  1FNB A;  4RD2 A;  3VMF A;  3VNU A;  5FL7 A;  4HE5 A;  2X0K A;  1U2R A;  4M0L A;  5H59 A;  3SJP A;  1VQO B;  3CC4 B;  4G1B A;  2RC6 A;  3W2E A;  3PA1 A;  1EP2 B;  3OP1 A;  1WOR A;  3ZZT A;  2QDX A;  4FXU A;  3OZU A;  3E20 A;  1WOO A;  2C4T A;  1ZM9 A;  5FO0 A;  1KJZ A;  2HCJ B;  1KK0 A;  4RD3 A;  4B3G A;  4TN1 A;  1XFO A;  4ASU A;  1YJW B;  3B78 A;  5IYQ A;  1Q9S A;  2VNK A;  3KEW A;  4MYT A;  2AHO A;  1WDT A;  4ZGQ B;  4B44 A;  3WND A;  3AVV A;  1VF7 A;  4X05 A;  3PUM A;  4MYU A;  4P1V A;  4Z4Z A;  3Q39 A;  1QVG B;  2X3U A;  2Z6B D;  1K9M D;  3ISX A;  3OAA A;  2GPJ A;  2WJY A;  2CRV A;  2BF4 A;  4OOV A;  1AMO A;  3FJO A;  1N0U A;  2VBU A;  3NE5 B;  1VLO A;  5E6T A;  3A1P A;  1GJR A;  4K1X A;  3QFT A;  4RD1 A;  1S72 B;  1WU8 A;  1CQX A;  5DN6 A;  3WXM A;  4XM3 A;  4OOX A;  1E1R A;  1VHE A;  1WOS A;  1XB2 A;  4OPS A;  4YAW A;  2DIE A;  2PMD A;  4RDL A;  1CNF A;  1UMK A;  5A88 A;  2P3M A;  5F4M A;  2WPD A;  5IYN A;  1WTH D;  3BCD A;  1E1Q A;  1Q81 D;  1S0U A;  1M1K D;  3A35 A;  4XL9 A;  1JJ2 B;  1JA1 A;  1R5B A;  4LBZ A;  5HKK A;  1N05 A;  2B7C A;  3VNV A;  3CCQ B;  3HAG A;  2NPF A;  2WJV A;  1V0F A;  4IW3 B;  3BCF A;  1WSR A;  1PJ6 A;  1FNM A;  4FN5 A;  2LZJ A;  2QTL A;  1TTT A;  1JNY A;  1I8D A;  3CRZ A;  4QVA A;  2C4U A;  3SJZ A;  1VQN B;  2X85 A;  2VNJ A;  3ZZU A;  1VQ5 B;  2CND A;  1B2R A;  3LQE A;  4P6V F;  4NCN A;  5F4J A;  1XE1 A;  1UD5 A;  4XKW A;  3AVU A;  1BJK A;  4N3N A;  3Q38 A;  4Y9R A;  2F4N A;  2PLF A;  1FX0 A;  4R71 A;  2DYI A;  4AF7 A;  1SKY B;  3ZZ0 A;  1ZM3 A;  1KMH A;  1EXM A;  4KKS A;  4TT3 A;  4F7D A;  2Q6K A;  2X53 S;  2ZZE A;  3GSI A;  2YWH A;  3ONU A;  1NB9 A;  3CCU B;  3OZV A;  3W5H A;  2ZZG A;  1YIJ B;  3ASR A;  3CC2 B;  1XQB A;  4YAO A;  1ZM4 A;  4XLH A;  1VQ8 B;  1GVH A;  1CNE A;  1SKQ A;  1D1N A;  3CMA B;  1H8E A;  3AGQ A;  1QGY A;  3GIR A;  1ZUN B;  2GJR A;  2J7K A;  2YWF A;  1K28 D;  2JJ1 A;  4FWT A;  3JQQ A;  2E1B A;  3JQP A;  2C78 A;  2QTZ A;  4P22 A;  4PAB A;  2Q6L A;  3CD6 B;  1VQP B;  3ONY A;  2BVN A;  3I1F A;  1OB0 A;  4TMX A;  4G6I A;  2C5B A;  2F43 A;  3WY9 A;  3CCS B;  3OW2 B;  1F60 A;  2ZXI A;  3OPO A;  4TKO B;  1G7S A;  1R5O A;  2EIX A;  4NBS A;  4YAF A;  3CTA A;  4ZCL A;  3VR6 A;  2XZL A;  1RQR A;  2XEX A;  1UD8 A;  5J3O A;  3U2Q A;  2PE3 A;  5FNZ A;  2VZL A;  3CP2 A;  1DDG A;  5KNL A;  3ZUG A;  4PC6 A;  2XNJ A;  4LC0 A;  2ZBU A;  3OW7 A;  2QMU A;  3T51 B;  2OK8 A;  3V76 A;  4G5G A;  3OEE A;  2X8K A;  4YEJ A;  3CCR B; 
#chains in the Genus database with same CATH homology
 4X7E A;  2OBS A;  4X07 A;  4OOV A;  3Q3A A;  5IYR A;  5E6T A;  5F4O A;  3PA2 A;  3PVD A;  5J35 A;  4OOX A;  4OPS A;  4Z4T A;  4WZK A;  4RDL A;  4P12 A;  4OPO A;  5F4M A;  2ZL5 A;  5BSX A;  5IYN A;  3PUN A;  4WZL A;  2ZL6 A;  4QVJ A;  4P26 A;  4RDK A;  4X06 A;  4Z4S A;  4OP7 A;  2OBR A;  3Q6Q A;  2ZL7 A;  4Z4R A;  3V7A A;  3SLN A;  4RPD A;  4ROX A;  4Z4Y A;  5KW9 A;  4QVA A;  3R6K A;  3LQE A;  5F4J A;  3SEJ A;  2OBT A;  3AST A;  3ASS A;  4OPV A;  3ASP A;  3Q38 A;  3LQ6 A;  3ASQ A;  4Z4W A;  3ONU A;  3BY2 A;  3D26 A;  5IYW A;  4RDJ A;  4X7F A;  3BY1 A;  3ASR A;  4OOS A;  3R6J A;  4P2N A;  3Q6R A;  5BSY A;  1IHM A;  4X7C A;  4RM0 A;  4X0C A;  4WZE A;  4Z4U A;  5HZB A;  3SJP A;  4P25 A;  3SLD A;  3SKB A;  3ONY A;  3PA1 A;  4RPB A;  3BQJ A;  4P3I A;  3RY8 A;  4QV2 A;  4X7D A;  4WZT A;  4QUZ A;  5J3O A;  5IYP A;  5HZA A;  4Z4Z A;  5IYQ A;  4Z4V A;  4RLZ A;  4X05 A;  3PUM A;  4P1V A;  3Q39 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...