5IYWA

Protruding domain of gii.4 human norovirus chdc2094 in complex with 3-fucosyllactose (3fl)
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
305
structure length
303
Chain Sequence
KPFTVPILTVEEMSNSRFPIPLEKLYTGPSSAFVVQPQNGRCTTDGVLLGTTQLSAVNICNFRGDVTRVGISHDYTMNLVSQNWNNYDPTEEIPAPLGTPDFVGKIQGLLTQTTRADGSTRAHKATVSTGSVHFTPKLGSVQFTTDTNNDFQTGQNTKFTPVGVIQDGHQNEPQQWVLPNYSGTSGHNVHLAPAVAPTFPGEQLLFFRSTMPGCSGYPNMNLDCLLPQEWVSHFYQEAAPAQSDVALLRFVNPDTGRVLFECKLHKSGYITVAHTGPYDLVIPPNGYFRFDSWVNQFYTLAPM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for GII.4 norovirus inhibition by human milk oligosaccharides.
rcsb
source organism Norovirus hu/gii.4/chdc2094/1974/us
molecule tags Viral protein
molecule keywords VP1
total genus 69
structure length 303
sequence length 305
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-03-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.120 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Positive stranded ssRNA viruses 5iywA02
2.40.510.10 Mainly Beta Beta Barrel Nucleoplasmin-like/VP (viral coat and capsid proteins) Positive stranded ssRNA viruses 5iywA01
4X7DA 4Z4RA 3R6KA 5E6TA 3ONUA 3RY8A 3PUMA 5J3OA 4P25A 3PA2A 3SEJA 5J35A 3PA1A 3Q6QA 4P26A 5KW9A 3R6JA 4RM0A 4OP7A 4OPSA 4X7EA 4Z4ZA 3BY1A 4P1VA 3BQJA 2OBTA 4RDKA 5F4JA 5IYWA 4OPVA 5HZAA 4QVJA 3Q6RA 5BSYA 4X05A 5BSXA 3SLNA 4RPDA 4OPOA 4OOXA 4RDJA 4WZEA 3SJPA 4X0CA 4X06A 3PVDA 4P12A 3Q38A 5F4OA 4X07A 3ASRA 4Z4UA 4RDLA 2OBRA 4Z4WA 3SLDA 4Z4YA 5IYRA 3BY2A 4QV2A 3V7AA 3ASTA 4WZTA 5HZBA 4X7CA 5F4MA 4Z4SA 3ASPA 4OOSA 2OBSA 1IHMA 4WZLA 4P2NA 4RPBA 2ZL6A 2ZL7A 3Q39A 4P3IA 4X7FA 3ONYA 3LQ6A 4RLZA 4Z4TA 3LQEA 4OOVA 5IYNA 4Z4VA 4ROXA 3D26A 3ASSA 2ZL5A 4WZKA 3Q3AA 4QUZA 3SKBA 3ASQA 5IYPA 3PUNA 5IYQA 4QVAA
chains in the Genus database with same CATH superfamily
2VYQA 1ZM3A 1FDRA 1QFYA 1FNBA 2ZZQA 5FO1A 4Z4RA 1DARA 1E1QA 4XLFA 2V31A 2V7TA 5JBQA 1IJFA 2VNHA 1FX0A 3ONUA 2VZLA 3OW7A 3RY8A 2ZBVA 4YHBA 3OZVA 1WSVA 1EP3B 1QUEA 3PUMA 4XD7A 5HXBA 3JQPA 3W2HA 1R5BA 4DK0A 1Q82D 2HDNB 4ZGQB 4B48A 1W87A 1T6ZA 1PJ5A 1V0EA 1W0KA 3Q6QA 4P26A 3I55B 3W5VA 1UD8A 4PAAA 3ZC3A 2GJRA 1QUFA 1J9ZA 4II3A 4Q7JB 2CNDA 1A8PA 1PKVA 3AGQA 1Q86D 3B82A 1YJWB 3LO8A 3CCRB 1QGAA 4XONA 2NV4A 2OK7A 2XEXA 5DN6A 3CC7B 4RD1A 1BX1A 2CC2A 2Q6LA 1FNCA 1YHQB 3H9NA 1ELOA 4RDKA 3GVLA 5F4JA 4Z1MA 3WQZA 3Q6RA 4PC1A 2FX3A 1VQNB 2XZOA 2D3LA 4OPOA 4RPDA 1COWA 2PLFA 3ZZTA 1E3XA 2X8KA 1ZM9A 3OE7A 2WJYA 3SJPA 1EWYA 4YALA 3ZUGA 3CC4B 2VNKA 4UAJA 1EP2B 1WP6A 2LZJA 3CB4A 3CCEB 3U6BA 3CCJB 3AVVA 4X07A 1HVXA 4XR6A 3ASRA 4Z4UA 1GAQA 4PGOA 1JA1A 4P9SA 1H8EA 3CW2A 5IYRA 4XKVA 4TKOB 4AC9A 1VHOA 4FK8A 1FRNA 3VO2A 3G71B 5GV7A 4C0SA 1VQPB 3ASTA 1GVHA 1U2RA 4YXWA 2JJ2A 1XE1A 2HCJB 1N8RD 4BPRA 1VQMB 3ISXA 2HMAA 2CRVA 3CCLB 4UZFA 1KRHA 4DNRB 4WZLA 4F7DA 4RD4A 1QG0A 5GV8A 3CMMA 3LVBA 3QE2A 1OB0A 3CCVB 3Q39A 3LQ6A 4XORA 5DSZA 2P3MA 4XOPA 2C4UA 4NNJA 2VJIA 2QMUA 3CPWB 2DYIA 4Z4VA 1WU8A 2F1LA 2OTJB 1I7PA 2AHOA 4PC2A 1K9MD 2XNCA 3ASSA 2ZL5A 1Q7YD 3AGPA 1XB2A 3OZUA 4WZKA 1KK1A 3CMEB 1E1RA 4Y9RA 2ZBUA 4QHYA 5IYPA 2X3UA 1WOPA 1N06A 2EIXA 3CD6B 4NBSA 1F20A 2OYNA 1W34A 3WY9A 5IYQA 1CNFA 1B23P 3W2IA 3VNVA 5DS0A 1NDHA 2ZXIA 1OB5A 1VQ8B 2YWEA 2WPDA 3GVJA 3BH4A 3HAGA 1RQRA 5TV2A 4ACBA 1VQ7B 2KVOA 4U9UA 4YAOA 1PJ7A 1AIPA 2XGJA 4DNTB 2EFGA 2XNJA 1I8DA 1B2RA 4DQLA 4YAWA 4Y9UA 2ZZEA 3SEJA 4YEJA 3AVWA 4GQNA 1YX2A 3G6EB 2F43A 1KTVA 4RM0A 4YAUA 4B3FX 2XOKA 1QFZA 4OPSA 1E62A 4G7WA 4B3XA 1OB2A 2DY1A 2JIZA 3CESA 1YJ9B 2BMWA 1YITB 4P1VA 3W5HA 3G4SB 4IW3B 2OTLB 2Z6BD 2QTLA 3BQJA 1KZLA 1G7RA 1PJ6A 4B44A 4N3NA 3CRZA 2C5HA 4ZV4A 4UZUA 4RD0A 4ZGNB 1NRKA 2W6JA 2YWFA 1D8TA 1HZEA 3GVKA 5HZAA 2D74A 4RCZA 3QSYA 4X05A 5H5JA 5TRDA 4X8IA 5IK2A 1UD2A 1KD1D 5TY0A 1E3ZA 2BVNA 2VNIA 3BC9A 4RDJA 1VQ6B 1W9XA 4WZEA 2V7QA 4LC0A 4X0CA 3AVYA 4XLEA 3FJOA 4YELA 1I18A 4PABA 2X53S 4FWTA 1YIJB 1VQKB 1KK0A 1RQPA 5LMZA 4TMWA 3OFNA 2F4NA 1N0UA 4Z4YA 3CP8A 2OK8A 1CQXA 4RD2A 4HE6A 4WWVA 2ZZFA 1H8HA 2RC5A 5B6IA 1BX0A 3CCMB 3ZBUA 3U2QA 1G7SA 3VO1A 4P6VF 4RCYA 3GSIA 2RC6A 1WPCA 1EP1B 4MYUA 4UZEA 4M1KA 4OOSA 4P6YA 2OBSA 3KEWA 1IHMA 2V7XA 1TVCA 5EMNA 3MMPA 2E1BA 3OOCA 5A88A 3OW2B 5FL7A 2ZL6A 4P3YA 4G1VA 3WXMA 2QA4B 2DETA 2DIEA 2QDXA 1BMFA 4TMZA 4RLZA 4XM3A 1N08A 4OOVA 5IYNA 2I1LA 2YWHA 1MRZA 2BGIA 2WZNA 3GIRA 4XLHA 3WBJA 4XQFA 3CPXA 5FNZA 2QE7A 3U6KA 4EH1A 3A35A 2QN6A 3CCUB 1S72B 4CQJA 3W2EA 4M53A 2GK7A 1R5NA 2D3NA 1GR1A 3ZZ0A 1DG1G 4J0QA 3I1FA 5AN9A 1K73D 3P26A 3WBKA 1UD4A 2VJJA 3BCDA 1N05A 4X7DA 4PC7A 3R6KA 3QFCA 2B7BA 2BPOA 3CCQB 3WNBA 5J3OA 3W2GA 1Y0RA 4P25A 1H85A 2V7WA 1G7TA 1R5OA 3DDYA 3J81k 3OEHA 3A3GA 2GPJA 3PA2A 5J35A 1S0UA 4XLCA 4Y7CA 3BNWA 1VLOA 2ZTNA 3PA1A 1KQSB 1EFRA 3QFSA 3ZPNA 3OPOA 3R6JA 2BN4A 1V0FA 4OP7A 2XNDA 1YLOA 2GJPA 2QEXB 1VQ4B 3BY1A 1EFUA 2E1RA 1QH0A 3GQBA 1E79A 1VQ9B 1TUIA 1BPLA 2DEUA 1T6YA 2J7KA 4KKSA 1Y0YA 1ZM2A 2B7CA 3CC2B 5A8AA 3CXCB 3E20A 2BV3A 3VR6A 5IYWA 4QVJA 1IB0A 4G1BA 1VF7A 2W6IA 2X6WA 1UMKA 2CBXA 1G7CA 1KJZA 4XL9A 3NE5B 1WORA 1E43A 4OOXA 3QFRA 4MYTA 3KL9A 2CF4A 3OZWA 4YAFA 4XN0A 3Q38A 5F4OA 2WJVA 3B78A 3JU4A 4RD3A 1TTTA 5L46A 1ZM4A 4AVZA 4TMTA 2OBRA 4LBZA 4Z4WA 2VBSA 3SLDA 3MCAA 1H42A 4KKTA 1MABA 3BY2A 5FO0A 2V7VA 1GO2A 4QV2A 3V7AA 3VNUA 4WZTA 2DOGA 3MHPA 2R6HA 4X7CA 5FIUA 2GQFA 4L8JA 2XZLA 2ZZGA 3ASPA 1KC8D 4TMXA 3OJXA 1JNYA 2JJ1A 4PC3A 1VJSA 1UD5A 4H9GA 4LBYA 3CTAA 1ZUNB 1WDTA 5TR9A 2ZL7A 1KMHA 4P3IA 4AF7A 3ONYA 1K8AD 4R71A 3A1PA 2VNJA 1NJID 1VQLB 1E64A 3OAAA 4HE5A 3T51B 1JA0A 4WQMA 4PC6A 4LBVA 4ZCLA 3LQEA 2V4DA 4FN5A 4E0FA 2B5OA 2GJKA 4II2A 1D1NA 1UD6A 4RJLA 3JQQA 5THXA 4B4DA 3CMAB 3JQRA 2WYRA 2ZITA 1XQBA 2QGGA 4ZCIA 4ZCMA 1K28D 2Q6KA 5A89A 3ASQA 2CK3A 1UD3A 2PMDA 3PUNA 4FXUA 4DQKA 4K1XA 4XOTA 1V5VA 4C43A 1AMOA 3WNCA 1KK2A 4B3GA 3I56B 4QVAA 1SKQA 1YJNB 3A3BA 3BCFA 3E1YE 2X0KA 4ACAA 1P4MA 2VBTA 3ZBTA 1SM4A 4TMVA 3SJZA 5E6TA 3W2FA 2X6YA 1EFCA 2BF4A 2XZPA 1M1KD 2X6XA 3G05A 3B8HA 5CDFA 2WSSA 1DDGA 4B43A 2D9RA 4JMQA 1QVGB 2DERA 1W35A 4B47A 3AVXA 3W5UA 5KW9A 3V76A 4TT3A 4G7XA 1CNEA 2GK6A 4X7EA 4XLAA 4Z4ZA 1S4MA 4N3GA 4G5GA 3VMFA 2YWGA 2BSAA 2CW5A 2F1MA 2M5SA 2WR8A 5HKKA 4ASUA 3PENA 3ZZUA 2JN9A 4RD6A 3A8IA 1FRQA 1EFTA 1EXMA 2VBUA 1W2BB 1M90D 2OBTA 3CP2A 1NBMA 4M4SA 2VBVA 1NB9A 3H94A 1GAWA 1QVFB 2ZXHA 1DDIA 1TLLA 4OPVA 4M2LA 2WZPP 3ZIAA 5BSYA 3OJWA 5BSXA 2C2WA 3SLNA 3OKXA 3OEEA 3T53B 1WSRA 1HA3A 3FPKA 3A8KA 2R9VA 3FPPA 4G6IA 1F60A 2QTZA 1T6XA 2BM1A 2X85A 1D2EA 2DCUA 2GREA 2C5BA 4TN1A 1VQOB 1XFOA 5H59A 4X06A 3PVDA 4P12A 1BQEA 4QFMA 3AVTA 4RDLA 3WYAA 1NB0A 3CCSB 1QFJA 1QX4A 4P22A 5KSWB 3A8JA 3T56B 3QFTA 1T5EA 4KKUA 4TSFA 4LBWA 4XKWA 1WOOA 2C4TA 1N0VC 1WTHD 5KNLA 1BLIA 1VLYA 5HZBA 4DK1A 1E63A 1Q81D 5F4MA 1JB9A 4Z4SA 1VQ5B 2C78A 3WNDA 3LNNA 4XNFA 1OGIA 2BGJA 4P2NA 3AVUA 1QGYA 1OHHA 4RPBA 2Q6IA 2ZTGA 1KK3A 4NCNA 1WOSA 4X7FA 1FNDA 1SKYB 2NPFA 4HIZA 3OP1A 3ES9A 1IJEA 5FA6A 4Z4TA 2PE3A 1YI2B 1BJKA 4ROXA 1N07A 4AF6A 3D26A 2FVGA 1W0JA 1FNMA 1GJRA 1VHEA 2C77A 3P27A 2Q6OA 3Q3AA 4QUZA 3SKBA 2JDIA 1QGZA 1OGJA 1Q9SA 2V7UA 2BM0A 4M0LA 1JJ2B 4XMYA 2HLDA 2PIAA 4XN3A 3FKSA
chains in the Genus database with same CATH topology
4X7DA 4Z4RA 3R6KA 5E6TA 3ONUA 3RY8A 3PUMA 5J3OA 4P25A 3PA2A 3SEJA 5J35A 3PA1A 3Q6QA 4P26A 5KW9A 3R6JA 4RM0A 4OP7A 4OPSA 4X7EA 4Z4ZA 3BY1A 4P1VA 3BQJA 2OBTA 4RDKA 5F4JA 5IYWA 4OPVA 5HZAA 4QVJA 3Q6RA 5BSYA 4X05A 5BSXA 3SLNA 4RPDA 4OPOA 4OOXA 4RDJA 4WZEA 3SJPA 4X0CA 4X06A 3PVDA 4P12A 3Q38A 5F4OA 4X07A 3ASRA 4Z4UA 4RDLA 2OBRA 4Z4WA 3SLDA 4Z4YA 5IYRA 3BY2A 4QV2A 3V7AA 3ASTA 4WZTA 5HZBA 4X7CA 5F4MA 4Z4SA 3ASPA 4OOSA 2OBSA 1IHMA 4WZLA 4P2NA 4RPBA 2ZL6A 2ZL7A 3Q39A 4P3IA 4X7FA 3ONYA 3LQ6A 4RLZA 4Z4TA 3LQEA 4OOVA 5IYNA 4Z4VA 4ROXA 3D26A 3ASSA 2ZL5A 4WZKA 3Q3AA 4QUZA 3SKBA 3ASQA 5IYPA 3PUNA 5IYQA 4QVAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X7D A;  4Z4R A;  3R6K A;  5E6T A;  3ONU A;  3RY8 A;  3PUM A;  5J3O A;  4P25 A;  3PA2 A;  3SEJ A;  5J35 A;  3PA1 A;  3Q6Q A;  4P26 A;  5KW9 A;  3R6J A;  4RM0 A;  4OP7 A;  4OPS A;  4X7E A;  4Z4Z A;  3BY1 A;  4P1V A;  3BQJ A;  2OBT A;  4RDK A;  5F4J A;  5IYW A;  4OPV A;  5HZA A;  4QVJ A;  3Q6R A;  5BSY A;  4X05 A;  5BSX A;  3SLN A;  4RPD A;  4OPO A;  4OOX A;  4RDJ A;  4WZE A;  3SJP A;  4X0C A;  4X06 A;  3PVD A;  4P12 A;  3Q38 A;  5F4O A;  4X07 A;  3ASR A;  4Z4U A;  4RDL A;  2OBR A;  4Z4W A;  3SLD A;  4Z4Y A;  5IYR A;  3BY2 A;  4QV2 A;  3V7A A;  3AST A;  4WZT A;  5HZB A;  4X7C A;  5F4M A;  4Z4S A;  3ASP A;  4OOS A;  2OBS A;  1IHM A;  4WZL A;  4P2N A;  4RPB A;  2ZL6 A;  2ZL7 A;  3Q39 A;  4P3I A;  4X7F A;  3ONY A;  3LQ6 A;  4RLZ A;  4Z4T A;  3LQE A;  4OOV A;  5IYN A;  4Z4V A;  4ROX A;  3D26 A;  3ASS A;  2ZL5 A;  4WZK A;  3Q3A A;  4QUZ A;  3SKB A;  3ASQ A;  5IYP A;  3PUN A;  5IYQ A;  4QVA A; 
#chains in the Genus database with same CATH topology
 2VYQ A;  1ZM3 A;  1FDR A;  1QFY A;  1FNB A;  2ZZQ A;  5FO1 A;  4Z4R A;  1DAR A;  1E1Q A;  4XLF A;  2V31 A;  2V7T A;  5JBQ A;  1IJF A;  2VNH A;  1FX0 A;  3ONU A;  2VZL A;  3OW7 A;  3RY8 A;  2ZBV A;  4YHB A;  3OZV A;  1WSV A;  1EP3 B;  1QUE A;  3PUM A;  4XD7 A;  5HXB A;  3JQP A;  3W2H A;  1R5B A;  4DK0 A;  1Q82 D;  2HDN B;  4ZGQ B;  4B48 A;  1W87 A;  1T6Z A;  1PJ5 A;  1V0E A;  1W0K A;  3Q6Q A;  4P26 A;  3I55 B;  3W5V A;  1UD8 A;  4PAA A;  3ZC3 A;  2GJR A;  1QUF A;  1J9Z A;  4II3 A;  4Q7J B;  2CND A;  1A8P A;  1PKV A;  3AGQ A;  1Q86 D;  3B82 A;  1YJW B;  3LO8 A;  3CCR B;  1QGA A;  4XON A;  2NV4 A;  2OK7 A;  2XEX A;  5DN6 A;  3CC7 B;  4RD1 A;  1BX1 A;  2CC2 A;  2Q6L A;  1FNC A;  1YHQ B;  3H9N A;  1ELO A;  4RDK A;  3GVL A;  5F4J A;  4Z1M A;  3WQZ A;  3Q6R A;  4PC1 A;  2FX3 A;  1VQN B;  2XZO A;  2D3L A;  4OPO A;  4RPD A;  1COW A;  2PLF A;  3ZZT A;  1E3X A;  2X8K A;  1ZM9 A;  3OE7 A;  2WJY A;  3SJP A;  1EWY A;  4YAL A;  3ZUG A;  3CC4 B;  2VNK A;  4UAJ A;  1EP2 B;  1WP6 A;  2LZJ A;  3CB4 A;  3CCE B;  3U6B A;  3CCJ B;  3AVV A;  4X07 A;  1HVX A;  4XR6 A;  3ASR A;  4Z4U A;  1GAQ A;  4PGO A;  1JA1 A;  4P9S A;  1H8E A;  3CW2 A;  5IYR A;  4XKV A;  4TKO B;  4AC9 A;  1VHO A;  4FK8 A;  1FRN A;  3VO2 A;  3G71 B;  5GV7 A;  4C0S A;  1VQP B;  3AST A;  1GVH A;  1U2R A;  4YXW A;  2JJ2 A;  1XE1 A;  2HCJ B;  1N8R D;  4BPR A;  1VQM B;  3ISX A;  2HMA A;  2CRV A;  3CCL B;  4UZF A;  1KRH A;  4DNR B;  4WZL A;  4F7D A;  4RD4 A;  1QG0 A;  5GV8 A;  3CMM A;  3LVB A;  3QE2 A;  1OB0 A;  3CCV B;  3Q39 A;  3LQ6 A;  4XOR A;  5DSZ A;  2P3M A;  4XOP A;  2C4U A;  4NNJ A;  2VJI A;  2QMU A;  3CPW B;  2DYI A;  4Z4V A;  1WU8 A;  2F1L A;  2OTJ B;  1I7P A;  2AHO A;  4PC2 A;  1K9M D;  2XNC A;  3ASS A;  2ZL5 A;  1Q7Y D;  3AGP A;  1XB2 A;  3OZU A;  4WZK A;  1KK1 A;  3CME B;  1E1R A;  4Y9R A;  2ZBU A;  4QHY A;  5IYP A;  2X3U A;  1WOP A;  1N06 A;  2EIX A;  3CD6 B;  4NBS A;  1F20 A;  2OYN A;  1W34 A;  3WY9 A;  5IYQ A;  1CNF A;  1B23 P;  3W2I A;  3VNV A;  5DS0 A;  1NDH A;  2ZXI A;  1OB5 A;  1VQ8 B;  2YWE A;  2WPD A;  3GVJ A;  3BH4 A;  3HAG A;  1RQR A;  5TV2 A;  4ACB A;  1VQ7 B;  2KVO A;  4U9U A;  4YAO A;  1PJ7 A;  1AIP A;  2XGJ A;  4DNT B;  2EFG A;  2XNJ A;  1I8D A;  1B2R A;  4DQL A;  4YAW A;  4Y9U A;  2ZZE A;  3SEJ A;  4YEJ A;  3AVW A;  4GQN A;  1YX2 A;  3G6E B;  2F43 A;  1KTV A;  4RM0 A;  4YAU A;  4B3F X;  2XOK A;  1QFZ A;  4OPS A;  1E62 A;  4G7W A;  4B3X A;  1OB2 A;  2DY1 A;  2JIZ A;  3CES A;  1YJ9 B;  2BMW A;  1YIT B;  4P1V A;  3W5H A;  3G4S B;  4IW3 B;  2OTL B;  2Z6B D;  2QTL A;  3BQJ A;  1KZL A;  1G7R A;  1PJ6 A;  4B44 A;  4N3N A;  3CRZ A;  2C5H A;  4ZV4 A;  4UZU A;  4RD0 A;  4ZGN B;  1NRK A;  2W6J A;  2YWF A;  1D8T A;  1HZE A;  3GVK A;  5HZA A;  2D74 A;  4RCZ A;  3QSY A;  4X05 A;  5H5J A;  5TRD A;  4X8I A;  5IK2 A;  1UD2 A;  1KD1 D;  5TY0 A;  1E3Z A;  2BVN A;  2VNI A;  3BC9 A;  4RDJ A;  1VQ6 B;  1W9X A;  4WZE A;  2V7Q A;  4LC0 A;  4X0C A;  3AVY A;  4XLE A;  3FJO A;  4YEL A;  1I18 A;  4PAB A;  2X53 S;  4FWT A;  1YIJ B;  1VQK B;  1KK0 A;  1RQP A;  5LMZ A;  4TMW A;  3OFN A;  2F4N A;  1N0U A;  4Z4Y A;  3CP8 A;  2OK8 A;  1CQX A;  4RD2 A;  4HE6 A;  4WWV A;  2ZZF A;  1H8H A;  2RC5 A;  5B6I A;  1BX0 A;  3CCM B;  3ZBU A;  3U2Q A;  1G7S A;  3VO1 A;  4P6V F;  4RCY A;  3GSI A;  2RC6 A;  1WPC A;  1EP1 B;  4MYU A;  4UZE A;  4M1K A;  4OOS A;  4P6Y A;  2OBS A;  3KEW A;  1IHM A;  2V7X A;  1TVC A;  5EMN A;  3MMP A;  2E1B A;  3OOC A;  5A88 A;  3OW2 B;  5FL7 A;  2ZL6 A;  4P3Y A;  4G1V A;  3WXM A;  2QA4 B;  2DET A;  2DIE A;  2QDX A;  1BMF A;  4TMZ A;  4RLZ A;  4XM3 A;  1N08 A;  4OOV A;  5IYN A;  2I1L A;  2YWH A;  1MRZ A;  2BGI A;  2WZN A;  3GIR A;  4XLH A;  3WBJ A;  4XQF A;  3CPX A;  5FNZ A;  2QE7 A;  3U6K A;  4EH1 A;  3A35 A;  2QN6 A;  3CCU B;  1S72 B;  4CQJ A;  3W2E A;  4M53 A;  2GK7 A;  1R5N A;  2D3N A;  1GR1 A;  3ZZ0 A;  1DG1 G;  4J0Q A;  3I1F A;  5AN9 A;  1K73 D;  3P26 A;  3WBK A;  1UD4 A;  2VJJ A;  3BCD A;  1N05 A;  4X7D A;  4PC7 A;  3R6K A;  3QFC A;  2B7B A;  2BPO A;  3CCQ B;  3WNB A;  5J3O A;  3W2G A;  1Y0R A;  4P25 A;  1H85 A;  2V7W A;  1G7T A;  1R5O A;  3DDY A;  3J81 k;  3OEH A;  3A3G A;  2GPJ A;  3PA2 A;  5J35 A;  1S0U A;  4XLC A;  4Y7C A;  3BNW A;  1VLO A;  2ZTN A;  3PA1 A;  1KQS B;  1EFR A;  3QFS A;  3ZPN A;  3OPO A;  3R6J A;  2BN4 A;  1V0F A;  4OP7 A;  2XND A;  1YLO A;  2GJP A;  2QEX B;  1VQ4 B;  3BY1 A;  1EFU A;  2E1R A;  1QH0 A;  3GQB A;  1E79 A;  1VQ9 B;  1TUI A;  1BPL A;  2DEU A;  1T6Y A;  2J7K A;  4KKS A;  1Y0Y A;  1ZM2 A;  2B7C A;  3CC2 B;  5A8A A;  3CXC B;  3E20 A;  2BV3 A;  3VR6 A;  5IYW A;  4QVJ A;  1IB0 A;  4G1B A;  1VF7 A;  2W6I A;  2X6W A;  1UMK A;  2CBX A;  1G7C A;  1KJZ A;  4XL9 A;  3NE5 B;  1WOR A;  1E43 A;  4OOX A;  3QFR A;  4MYT A;  3KL9 A;  2CF4 A;  3OZW A;  4YAF A;  4XN0 A;  3Q38 A;  5F4O A;  2WJV A;  3B78 A;  3JU4 A;  4RD3 A;  1TTT A;  5L46 A;  1ZM4 A;  4AVZ A;  4TMT A;  2OBR A;  4LBZ A;  4Z4W A;  2VBS A;  3SLD A;  3MCA A;  1H42 A;  4KKT A;  1MAB A;  3BY2 A;  5FO0 A;  2V7V A;  1GO2 A;  4QV2 A;  3V7A A;  3VNU A;  4WZT A;  2DOG A;  3MHP A;  2R6H A;  4X7C A;  5FIU A;  2GQF A;  4L8J A;  2XZL A;  2ZZG A;  3ASP A;  1KC8 D;  4TMX A;  3OJX A;  1JNY A;  2JJ1 A;  4PC3 A;  1VJS A;  1UD5 A;  4H9G A;  4LBY A;  3CTA A;  1ZUN B;  1WDT A;  5TR9 A;  2ZL7 A;  1KMH A;  4P3I A;  4AF7 A;  3ONY A;  1K8A D;  4R71 A;  3A1P A;  2VNJ A;  1NJI D;  1VQL B;  1E64 A;  3OAA A;  4HE5 A;  3T51 B;  1JA0 A;  4WQM A;  4PC6 A;  4LBV A;  4ZCL A;  3LQE A;  2V4D A;  4FN5 A;  4E0F A;  2B5O A;  2GJK A;  4II2 A;  1D1N A;  1UD6 A;  4RJL A;  3JQQ A;  5THX A;  4B4D A;  3CMA B;  3JQR A;  2WYR A;  2ZIT A;  1XQB A;  2QGG A;  4ZCI A;  4ZCM A;  1K28 D;  2Q6K A;  5A89 A;  3ASQ A;  2CK3 A;  1UD3 A;  2PMD A;  3PUN A;  4FXU A;  4DQK A;  4K1X A;  4XOT A;  1V5V A;  4C43 A;  1AMO A;  3WNC A;  1KK2 A;  4B3G A;  3I56 B;  4QVA A;  1SKQ A;  1YJN B;  3A3B A;  3BCF A;  3E1Y E;  2X0K A;  4ACA A;  1P4M A;  2VBT A;  3ZBT A;  1SM4 A;  4TMV A;  3SJZ A;  5E6T A;  3W2F A;  2X6Y A;  1EFC A;  2BF4 A;  2XZP A;  1M1K D;  2X6X A;  3G05 A;  3B8H A;  5CDF A;  2WSS A;  1DDG A;  4B43 A;  2D9R A;  4JMQ A;  1QVG B;  2DER A;  1W35 A;  4B47 A;  3AVX A;  3W5U A;  5KW9 A;  3V76 A;  4TT3 A;  4G7X A;  1CNE A;  2GK6 A;  4X7E A;  4XLA A;  4Z4Z A;  1S4M A;  4N3G A;  4G5G A;  3VMF A;  2YWG A;  2BSA A;  2CW5 A;  2F1M A;  2M5S A;  2WR8 A;  5HKK A;  4ASU A;  3PEN A;  3ZZU A;  2JN9 A;  4RD6 A;  3A8I A;  1FRQ A;  1EFT A;  1EXM A;  2VBU A;  1W2B B;  1M90 D;  2OBT A;  3CP2 A;  1NBM A;  4M4S A;  2VBV A;  1NB9 A;  3H94 A;  1GAW A;  1QVF B;  2ZXH A;  1DDI A;  1TLL A;  4OPV A;  4M2L A;  2WZP P;  3ZIA A;  5BSY A;  3OJW A;  5BSX A;  2C2W A;  3SLN A;  3OKX A;  3OEE A;  3T53 B;  1WSR A;  1HA3 A;  3FPK A;  3A8K A;  2R9V A;  3FPP A;  4G6I A;  1F60 A;  2QTZ A;  1T6X A;  2BM1 A;  2X85 A;  1D2E A;  2DCU A;  2GRE A;  2C5B A;  4TN1 A;  1VQO B;  1XFO A;  5H59 A;  4X06 A;  3PVD A;  4P12 A;  1BQE A;  4QFM A;  3AVT A;  4RDL A;  3WYA A;  1NB0 A;  3CCS B;  1QFJ A;  1QX4 A;  4P22 A;  5KSW B;  3A8J A;  3T56 B;  3QFT A;  1T5E A;  4KKU A;  4TSF A;  4LBW A;  4XKW A;  1WOO A;  2C4T A;  1N0V C;  1WTH D;  5KNL A;  1BLI A;  1VLY A;  5HZB A;  4DK1 A;  1E63 A;  1Q81 D;  5F4M A;  1JB9 A;  4Z4S A;  1VQ5 B;  2C78 A;  3WND A;  3LNN A;  4XNF A;  1OGI A;  2BGJ A;  4P2N A;  3AVU A;  1QGY A;  1OHH A;  4RPB A;  2Q6I A;  2ZTG A;  1KK3 A;  4NCN A;  1WOS A;  4X7F A;  1FND A;  1SKY B;  2NPF A;  4HIZ A;  3OP1 A;  3ES9 A;  1IJE A;  5FA6 A;  4Z4T A;  2PE3 A;  1YI2 B;  1BJK A;  4ROX A;  1N07 A;  4AF6 A;  3D26 A;  2FVG A;  1W0J A;  1FNM A;  1GJR A;  1VHE A;  2C77 A;  3P27 A;  2Q6O A;  3Q3A A;  4QUZ A;  3SKB A;  2JDI A;  1QGZ A;  1OGJ A;  1Q9S A;  2V7U A;  2BM0 A;  4M0L A;  1JJ2 B;  4XMY A;  2HLD A;  2PIA A;  4XN3 A;  3FKS A; 
#chains in the Genus database with same CATH homology
 4X7D A;  4Z4R A;  3R6K A;  5E6T A;  3ONU A;  3RY8 A;  3PUM A;  5J3O A;  4P25 A;  3PA2 A;  3SEJ A;  5J35 A;  3PA1 A;  3Q6Q A;  4P26 A;  5KW9 A;  3R6J A;  4RM0 A;  4OP7 A;  4OPS A;  4X7E A;  4Z4Z A;  3BY1 A;  4P1V A;  3BQJ A;  2OBT A;  4RDK A;  5F4J A;  5IYW A;  4OPV A;  5HZA A;  4QVJ A;  3Q6R A;  5BSY A;  4X05 A;  5BSX A;  3SLN A;  4RPD A;  4OPO A;  4OOX A;  4RDJ A;  4WZE A;  3SJP A;  4X0C A;  4X06 A;  3PVD A;  4P12 A;  3Q38 A;  5F4O A;  4X07 A;  3ASR A;  4Z4U A;  4RDL A;  2OBR A;  4Z4W A;  3SLD A;  4Z4Y A;  5IYR A;  3BY2 A;  4QV2 A;  3V7A A;  3AST A;  4WZT A;  5HZB A;  4X7C A;  5F4M A;  4Z4S A;  3ASP A;  4OOS A;  2OBS A;  1IHM A;  4WZL A;  4P2N A;  4RPB A;  2ZL6 A;  2ZL7 A;  3Q39 A;  4P3I A;  4X7F A;  3ONY A;  3LQ6 A;  4RLZ A;  4Z4T A;  3LQE A;  4OOV A;  5IYN A;  4Z4V A;  4ROX A;  3D26 A;  3ASS A;  2ZL5 A;  4WZK A;  3Q3A A;  4QUZ A;  3SKB A;  3ASQ A;  5IYP A;  3PUN A;  5IYQ A;  4QVA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...