4P25A

Structure of the p domain from a gi.7 norovirus variant in complex with ley hbga.
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
295
structure length
288
Chain Sequence
LTVPNIPLNNLANSRVPAMINKMTVSTDQNQVVQFQNGRCTLEGQLLGTTPVSASQVARIRGKVFSTASGKGLNLTELDGTPYHAFESPAPLGFPDIGACDWHVSTFKVLSGDPMSRLDVKQNAPFAPHLGSIEFTSDQDPTGDQLGTLAWVSPSTSGARVDPWKIPSYGSTVTTHLAPPIFPPGFGEAIVYFMSDFPIVSGAQVPCTLPQEFVSHFVEQQAPVRGEAALLHYVDPDTHRNLGEFKLYPDGFITCVPNTGGGPQNLPTNGVFVFSSWVSRYYQLKPVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Major capsid protein
publication title Structural analysis of determinants of histo-blood group antigen binding specificity in genogroup I noroviruses.
pubmed doi rcsb
source organism Norovirus hu/gi.7/tch-060/usa/2003
molecule tags Viral protein
total genus 63
structure length 288
sequence length 295
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-03-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.120 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Positive stranded ssRNA viruses 4p25A02
2.40.510.10 Mainly Beta Beta Barrel Nucleoplasmin-like/VP (viral coat and capsid proteins) Positive stranded ssRNA viruses 4p25A01
4Z4YA 4Z4TA 3BQJA 2OBSA 4RPBA 4X06A 4X7DA 4X7CA 3Q39A 5E6TA 4OOXA 4RDKA 4P2NA 4WZKA 5F4MA 3SLNA 3PUNA 4QVJA 3SEJA 3ASTA 2ZL7A 3BY2A 5IYPA 4P26A 3Q3AA 5J3OA 4RM0A 5IYQA 4OPOA 5BSYA 4QUZA 4WZEA 5HZBA 4P25A 5IYNA 3SJPA 3ASPA 5BSXA 3RY8A 4OOSA 5KW9A 3Q6QA 4RPDA 4Z4RA 3BY1A 4X7EA 3LQEA 4OP7A 3Q38A 5F4JA 3PA1A 3ASRA 3PUMA 5IYRA 4Z4UA 4Z4WA 4QV2A 2OBRA 4RDJA 4RLZA 3ONUA 4OPVA 3V7AA 4OPSA 4P1VA 4ROXA 3SLDA 4P12A 4RDLA 4OOVA 1IHMA 4WZTA 2ZL5A 5F4OA 4Z4VA 5IYWA 4Z4ZA 3SKBA 3R6KA 3R6JA 5J35A 2OBTA 3ASSA 4X07A 3ONYA 4X05A 2ZL6A 4Z4SA 3D26A 3PVDA 4X0CA 3Q6RA 4P3IA 4X7FA 4QVAA 3LQ6A 3ASQA 4WZLA 5HZAA 3PA2A
chains in the Genus database with same CATH superfamily
2E1RA 2BGJA 1FNBA 1UMKA 4AF7A 2B5OA 2M5SA 4XLAA 5E6TA 1Q7YD 1CQXA 3WXMA 1VJSA 1R5BA 4RD6A 4YEJA 1Q86D 1WU8A 1E63A 1BJKA 3WY9A 1WPCA 1HZEA 2ZXIA 3PUNA 1KC8D 3OJXA 4G6IA 4L8JA 3CP2A 1VLOA 3ASTA 2D9RA 5IYPA 2J7KA 4ZCLA 4XKVA 3OPOA 1OB5A 4XN3A 4XORA 4C0SA 2XZPA 1QGZA 1H42A 2OTLB 3CW2A 1PJ6A 3CD6B 1NBMA 4ZCMA 1W0JA 3W2FA 3G71B 4RM0A 2ZBUA 1Q81D 4TMVA 1MRZA 4M1KA 4PGOA 2QMUA 1PJ7A 3HAGA 4TMZA 5H5JA 2ZTNA 3CCQB 3B8HA 3OFNA 5BSYA 3FKSA 3LVBA 4YHBA 4ZCIA 3WYAA 2BVNA 5HZBA 3CCJB 2C5HA 4P25A 2V7XA 4XM3A 3QFRA 5KSWB 4FXUA 4RCZA 4YAFA 3SJPA 1E43A 4UAJA 4PC6A 5BSXA 2DOGA 4G1VA 2XEXA 3A8KA 4C43A 4ZGQB 2F43A 1A8PA 2XNJA 1M90D 1TLLA 2WYRA 4PC1A 2YWFA 3QFCA 5DSZA 5KW9A 1VQPB 1DARA 3WQZA 3A8IA 1EFCA 4X7EA 2BM1A 2AHOA 4ACBA 1KMHA 4ASUA 2CF4A 4MYUA 3PA1A 1JNYA 2GREA 3ASRA 4PAAA 3MMPA 1D2EA 2V31A 5DN6A 5FO1A 2C4UA 3AGPA 2JJ2A 3FPPA 3CCSB 2WJVA 3V7AA 2V7TA 1HA3A 3I56B 4P1VA 1EXMA 4K1XA 2QTZA 4IW3B 5HKKA 1T6YA 1NB9A 2WPDA 4WZTA 5JBQA 3AVWA 1F20A 2D3NA 4Z4VA 2RC6A 4H9GA 1E1RA 1N07A 3U6KA 1N8RD 3U6BA 3ZUGA 4P6YA 2ZZQA 2GJKA 1OB2A 3R6JA 3W2GA 1H8HA 2GK6A 4HE6A 3JU4A 1XQBA 3CC4B 1MABA 4P9SA 4ZGNB 1YIJB 4LBYA 3MHPA 2ZL6A 4Z4SA 2QEXB 2VBUA 1PKVA 1T6ZA 2Q6OA 4NNJA 1YJWB 1SKYB 1QX4A 3WBJA 3B78A 3ZPNA 1H8EA 5THXA 4P3IA 1GAWA 2GPJA 1VQ7B 4QVAA 1Q82D 4XONA 1E64A 5HZAA 1JB9A 1ELOA 1QUFA 2XZOA 2HLDA 1I8DA 4KKSA 4HE5A 2I1LA 2E1BA 3OOCA 1B23P 4X7CA 4XL9A 2WZPP 4OOXA 4RDKA 3J81k 2BSAA 2DYIA 3FJOA 1ZM2A 1K8AD 4P2NA 5F4MA 5FL7A 3SLNA 1NJID 1TUIA 1TVCA 2WJYA 1G7RA 4XOPA 3W2HA 1QVFB 3CCRB 2ZL7A 3BY2A 1UD2A 4RD3A 5LMZA 1FX0A 3P26A 2DIEA 5TV2A 2V7WA 2BGIA 1YITB 1BMFA 5J3OA 1KK2A 4N3GA 4LC0A 3WNDA 1RQRA 3PENA 4DNTB 1N08A 3OZVA 3E20A 4DK0A 2JJ1A 1QFJA 2C77A 3CB4A 3VO1A 5AN9A 2BN4A 2D3LA 4Y9UA 3ZBTA 2YWEA 4Y9RA 4M2LA 2WR8A 4TT3A 2FX3A 3BH4A 2Z6BD 4TN1A 3W5UA 3T51B 3OKXA 1E3ZA 1FRNA 4RJLA 2QDXA 3JQRA 4EH1A 1VQ5B 3KL9A 2W6IA 4WQMA 4DQKA 3WBKA 5IYNA 4G1BA 4XLCA 1WDTA 1K9MD 2CC2A 4DNRB 1QGYA 1QH0A 3GVLA 5HXBA 1IB0A 1R5OA 2VZLA 1G7CA 4QFMA 3A8JA 2HCJB 4B44A 3T56B 2F4NA 2QA4B 1GO2A 2P3MA 5A88A 1M1KD 4F7DA 1N05A 5TRDA 3BY1A 4LBVA 2RC5A 1P4MA 4KKUA 3Q38A 4RD4A 1IJFA 4B47A 3PUMA 1VQ4B 3ZIAA 1W0KA 4X8IA 1CNEA 3G4SB 4Z4UA 4Z4WA 1N0UA 4N3NA 4QV2A 3VNVA 2PIAA 5FA6A 4PC7A 4XQFA 3CMAB 1VQKB 2XNDA 2BM0A 1NRKA 4M0LA 3CMEB 3WNCA 3OAAA 4TMTA 2JDIA 3NE5B 1YHQB 4XNFA 3VMFA 1UD5A 1KQSB 3OP1A 1BPLA 4TKOB 2WZNA 2BPOA 1KK1A 3R6KA 1W87A 3SKBA 2VBVA 2XGJA 1BX1A 1KK3A 2V4DA 2NV4A 2EFGA 2OBTA 3V76A 1I7PA 4PC2A 3ZZTA 3ZZ0A 1NDHA 1UD4A 1GAQA 2JIZA 1G7SA 4XLEA 3ASSA 4X05A 4II2A 3W5HA 3OE7A 3PVDA 4X0CA 4Y7CA 5FNZA 4R71A 3ZBUA 1YJNB 3CCLB 3OZWA 4TMXA 3ASQA 1UD6A 1XFOA 4RCYA 2HDNB 4WZLA 3I55B 2V7UA 3I1FA 4UZFA 2QN6A 3LNNA 1V0EA 4XMYA 4AVZA 1ZM4A 1VQLB 4Z4YA 2ZZGA 2C5BA 2X6WA 4Z4TA 3BQJA 2B7CA 1ZUNB 1I18A 4RPBA 2VNIA 4YALA 1FDRA 3Q39A 1PJ5A 1N0VC 4YAWA 4FWTA 5DS0A 4WZKA 3CPXA 1RQPA 4GQNA 4QVJA 3VNUA 1AMOA 2Q6KA 3W5VA 5L46A 1EFRA 1ZM3A 2OK8A 1TTTA 1QFYA 1T5EA 2C4TA 1FNCA 3Q3AA 1VQ8B 2X85A 1S4MA 2DY1A 1HVXA 1N06A 3OEEA 3DDYA 4TSFA 2VBSA 3AVXA 2VBTA 1CNFA 5IYQA 2JN9A 1VQOB 3BNWA 1OGIA 1H85A 1E79A 1KJZA 1EP2B 3A35A 2PE3A 2WSSA 3ES9A 1G7TA 4QHYA 3BCFA 4PC3A 4RD2A 1UD3A 3G05A 1SKQA 2EIXA 4B3GA 3ASPA 2XNCA 1JJ2B 1F60A 5B6IA 1QVGB 2R9VA 4B3FX 4XKWA 4AF6A 3AVVA 3AGQA 4DQLA 5IK2A 1JA0A 3Q6QA 4Z4RA 2KVOA 1E62A 4YAOA 4G7XA 4OP7A 1BQEA 1FRQA 5F4JA 5CDFA 2XZLA 2OK7A 4YELA 1QUEA 3CC7B 4Z1MA 1VLYA 2NPFA 3P27A 4RLZA 3ONUA 4OPVA 3CXCB 4FN5A 2C78A 3GIRA 2CW5A 3CCVB 4ROXA 3SLDA 3SJZA 4P12A 3GQBA 4DK1A 3OW7A 1KZLA 2ZZEA 2CBXA 4RDLA 2VNHA 4J0QA 4XLHA 2ZL5A 2CK3A 4WWVA 1GVHA 1YX2A 2XOKA 4Z4ZA 1WSVA 3CPWB 5GV8A 1BX0A 1E3XA 2GJRA 3KEWA 4ZV4A 2CNDA 5KNLA 1D1NA 5H59A 2GJPA 4B43A 1V0FA 1W34A 3QFTA 4E0FA 1VF7A 1BLIA 3ONYA 1YJ9B 3B82A 3G6EB 5FIUA 1KD1D 3ISXA 1DDIA 2B7BA 3D26A 3CTAA 2YWGA 3QFSA 5FO0A 3JQQA 4B4DA 3CCUB 2F1MA 1R5NA 1K73D 3LQ6A 4NBSA 1COWA 1ZM9A 2F1LA 3VR6A 4JMQA 4BPRA 1DDGA 1J9ZA 3PA2A 3A3GA 1Q9SA 1EFTA 3AVYA 2OBSA 1IJEA 1EP3B 3GVKA 4LBZA 1W9XA 4X06A 2QE7A 4X7DA 2X3UA 4RD1A 1YI2B 3OZUA 2FVGA 1DG1G 3AVUA 4YXWA 5GV7A 3OW2B 4G7WA 4YAUA 2BF4A 1QGAA 3ZZUA 2OTJB 4M53A 3SEJA 1WP6A 1VQMB 3ZC3A 1VQ6B 1VHOA 4P26A 1UD8A 1OGJA 1WSRA 2YWHA 4PABA 4Q7JB 3CRZA 1K28D 3A3BA 4UZUA 4G5GA 1D8TA 2PMDA 3T53B 2X53S 2X6YA 4P6VF 4B48A 2HMAA 1Y0YA 2D74A 4XD7A 2W6JA 4OPOA 2BV3A 1FNMA 1WOPA 2QGGA 2BMWA 2PLFA 2V7VA 2C2WA 3GVJA 1B2RA 4QUZA 2CRVA 1GJRA 4M4SA 5TY0A 4WZEA 3CC2B 2ZTGA 1OHHA 1XB2A 2V7QA 2QTLA 4RD0A 3FPKA 2OYNA 1Y0RA 3CESA 5EMNA 4ACAA 1KRHA 2DETA 1EP1B 4TMWA 3RY8A 2VNKA 1WORA 1V5VA 2ZBVA 4MYTA 1KK0A 1VHEA 1YLOA 3A1PA 4OOSA 4RPDA 2DERA 2ZITA 3LQEA 1U2RA 1WOOA 4P3YA 3QSYA 1OB0A 2VYQA 3E1YE 3AVTA 3QE2A 1WOSA 4P22A 5IYRA 3CCMB 3GSIA 2OBRA 1NB0A 4RDJA 1E1QA 2GQFA 3JQPA 3MCAA 2LZJA 4FK8A 1S72B 4OPSA 2ZXHA 2X0KA 4II3A 2ZZFA 4XR6A 3BC9A 4OOVA 1T6XA 2Q6IA 1IHMA 4CQJA 2DEUA 1XE1A 2X6XA 5F4OA 1WTHD 2Q6LA 2VJIA 4NCNA 5IYWA 3WNBA 1QFZA 1GR1A 3OJWA 4U9UA 5A89A 1FNDA 1AIPA 5J35A 3CCEB 3LO8A 2VNJA 3H9NA 3VO2A 5A8AA 1KTVA 4XOTA 1W35A 4X07A 2R6HA 1W2BB 1QG0A 4AC9A 1JA1A 1EFUA 2DCUA 1SM4A 3H94A 2X8KA 4HIZA 4XN0A 3W2IA 3BCDA 3CP8A 3Q6RA 4UZEA 4XLFA 2VJJA 2GK7A 3U2QA 3CMMA 4LBWA 4X7FA 5TR9A 1VQNB 4B3XA 1EWYA 3OEHA 1VQ9B 1S0UA 4KKTA 3W2EA
chains in the Genus database with same CATH topology
4Z4YA 4Z4TA 3BQJA 2OBSA 4RPBA 4X06A 4X7DA 4X7CA 3Q39A 5E6TA 4OOXA 4RDKA 4P2NA 4WZKA 5F4MA 3SLNA 3PUNA 4QVJA 3SEJA 3ASTA 2ZL7A 3BY2A 5IYPA 4P26A 3Q3AA 5J3OA 4RM0A 5IYQA 4OPOA 5BSYA 4QUZA 4WZEA 5HZBA 4P25A 5IYNA 3SJPA 3ASPA 5BSXA 3RY8A 4OOSA 5KW9A 3Q6QA 4RPDA 4Z4RA 3BY1A 4X7EA 3LQEA 4OP7A 3Q38A 5F4JA 3PA1A 3ASRA 3PUMA 5IYRA 4Z4UA 4Z4WA 4QV2A 2OBRA 4RDJA 4RLZA 3ONUA 4OPVA 3V7AA 4OPSA 4P1VA 4ROXA 3SLDA 4P12A 4RDLA 4OOVA 1IHMA 4WZTA 2ZL5A 5F4OA 4Z4VA 5IYWA 4Z4ZA 3SKBA 3R6KA 3R6JA 5J35A 2OBTA 3ASSA 4X07A 3ONYA 4X05A 2ZL6A 4Z4SA 3D26A 3PVDA 4X0CA 3Q6RA 4P3IA 4X7FA 4QVAA 3LQ6A 3ASQA 4WZLA 5HZAA 3PA2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z4Y A;  4Z4T A;  3BQJ A;  2OBS A;  4RPB A;  4X06 A;  4X7D A;  4X7C A;  3Q39 A;  5E6T A;  4OOX A;  4RDK A;  4P2N A;  4WZK A;  5F4M A;  3SLN A;  3PUN A;  4QVJ A;  3SEJ A;  3AST A;  2ZL7 A;  3BY2 A;  5IYP A;  4P26 A;  3Q3A A;  5J3O A;  4RM0 A;  5IYQ A;  4OPO A;  5BSY A;  4QUZ A;  4WZE A;  5HZB A;  4P25 A;  5IYN A;  3SJP A;  3ASP A;  5BSX A;  3RY8 A;  4OOS A;  5KW9 A;  3Q6Q A;  4RPD A;  4Z4R A;  3BY1 A;  4X7E A;  3LQE A;  4OP7 A;  3Q38 A;  5F4J A;  3PA1 A;  3ASR A;  3PUM A;  5IYR A;  4Z4U A;  4Z4W A;  4QV2 A;  2OBR A;  4RDJ A;  4RLZ A;  3ONU A;  4OPV A;  3V7A A;  4OPS A;  4P1V A;  4ROX A;  3SLD A;  4P12 A;  4RDL A;  4OOV A;  1IHM A;  4WZT A;  2ZL5 A;  5F4O A;  4Z4V A;  5IYW A;  4Z4Z A;  3SKB A;  3R6K A;  3R6J A;  5J35 A;  2OBT A;  3ASS A;  4X07 A;  3ONY A;  4X05 A;  2ZL6 A;  4Z4S A;  3D26 A;  3PVD A;  4X0C A;  3Q6R A;  4P3I A;  4X7F A;  4QVA A;  3LQ6 A;  3ASQ A;  4WZL A;  5HZA A;  3PA2 A; 
#chains in the Genus database with same CATH topology
 2E1R A;  2BGJ A;  1FNB A;  1UMK A;  4AF7 A;  2B5O A;  2M5S A;  4XLA A;  5E6T A;  1Q7Y D;  1CQX A;  3WXM A;  1VJS A;  1R5B A;  4RD6 A;  4YEJ A;  1Q86 D;  1WU8 A;  1E63 A;  1BJK A;  3WY9 A;  1WPC A;  1HZE A;  2ZXI A;  3PUN A;  1KC8 D;  3OJX A;  4G6I A;  4L8J A;  3CP2 A;  1VLO A;  3AST A;  2D9R A;  5IYP A;  2J7K A;  4ZCL A;  4XKV A;  3OPO A;  1OB5 A;  4XN3 A;  4XOR A;  4C0S A;  2XZP A;  1QGZ A;  1H42 A;  2OTL B;  3CW2 A;  1PJ6 A;  3CD6 B;  1NBM A;  4ZCM A;  1W0J A;  3W2F A;  3G71 B;  4RM0 A;  2ZBU A;  1Q81 D;  4TMV A;  1MRZ A;  4M1K A;  4PGO A;  2QMU A;  1PJ7 A;  3HAG A;  4TMZ A;  5H5J A;  2ZTN A;  3CCQ B;  3B8H A;  3OFN A;  5BSY A;  3FKS A;  3LVB A;  4YHB A;  4ZCI A;  3WYA A;  2BVN A;  5HZB A;  3CCJ B;  2C5H A;  4P25 A;  2V7X A;  4XM3 A;  3QFR A;  5KSW B;  4FXU A;  4RCZ A;  4YAF A;  3SJP A;  1E43 A;  4UAJ A;  4PC6 A;  5BSX A;  2DOG A;  4G1V A;  2XEX A;  3A8K A;  4C43 A;  4ZGQ B;  2F43 A;  1A8P A;  2XNJ A;  1M90 D;  1TLL A;  2WYR A;  4PC1 A;  2YWF A;  3QFC A;  5DSZ A;  5KW9 A;  1VQP B;  1DAR A;  3WQZ A;  3A8I A;  1EFC A;  4X7E A;  2BM1 A;  2AHO A;  4ACB A;  1KMH A;  4ASU A;  2CF4 A;  4MYU A;  3PA1 A;  1JNY A;  2GRE A;  3ASR A;  4PAA A;  3MMP A;  1D2E A;  2V31 A;  5DN6 A;  5FO1 A;  2C4U A;  3AGP A;  2JJ2 A;  3FPP A;  3CCS B;  2WJV A;  3V7A A;  2V7T A;  1HA3 A;  3I56 B;  4P1V A;  1EXM A;  4K1X A;  2QTZ A;  4IW3 B;  5HKK A;  1T6Y A;  1NB9 A;  2WPD A;  4WZT A;  5JBQ A;  3AVW A;  1F20 A;  2D3N A;  4Z4V A;  2RC6 A;  4H9G A;  1E1R A;  1N07 A;  3U6K A;  1N8R D;  3U6B A;  3ZUG A;  4P6Y A;  2ZZQ A;  2GJK A;  1OB2 A;  3R6J A;  3W2G A;  1H8H A;  2GK6 A;  4HE6 A;  3JU4 A;  1XQB A;  3CC4 B;  1MAB A;  4P9S A;  4ZGN B;  1YIJ B;  4LBY A;  3MHP A;  2ZL6 A;  4Z4S A;  2QEX B;  2VBU A;  1PKV A;  1T6Z A;  2Q6O A;  4NNJ A;  1YJW B;  1SKY B;  1QX4 A;  3WBJ A;  3B78 A;  3ZPN A;  1H8E A;  5THX A;  4P3I A;  1GAW A;  2GPJ A;  1VQ7 B;  4QVA A;  1Q82 D;  4XON A;  1E64 A;  5HZA A;  1JB9 A;  1ELO A;  1QUF A;  2XZO A;  2HLD A;  1I8D A;  4KKS A;  4HE5 A;  2I1L A;  2E1B A;  3OOC A;  1B23 P;  4X7C A;  4XL9 A;  2WZP P;  4OOX A;  4RDK A;  3J81 k;  2BSA A;  2DYI A;  3FJO A;  1ZM2 A;  1K8A D;  4P2N A;  5F4M A;  5FL7 A;  3SLN A;  1NJI D;  1TUI A;  1TVC A;  2WJY A;  1G7R A;  4XOP A;  3W2H A;  1QVF B;  3CCR B;  2ZL7 A;  3BY2 A;  1UD2 A;  4RD3 A;  5LMZ A;  1FX0 A;  3P26 A;  2DIE A;  5TV2 A;  2V7W A;  2BGI A;  1YIT B;  1BMF A;  5J3O A;  1KK2 A;  4N3G A;  4LC0 A;  3WND A;  1RQR A;  3PEN A;  4DNT B;  1N08 A;  3OZV A;  3E20 A;  4DK0 A;  2JJ1 A;  1QFJ A;  2C77 A;  3CB4 A;  3VO1 A;  5AN9 A;  2BN4 A;  2D3L A;  4Y9U A;  3ZBT A;  2YWE A;  4Y9R A;  4M2L A;  2WR8 A;  4TT3 A;  2FX3 A;  3BH4 A;  2Z6B D;  4TN1 A;  3W5U A;  3T51 B;  3OKX A;  1E3Z A;  1FRN A;  4RJL A;  2QDX A;  3JQR A;  4EH1 A;  1VQ5 B;  3KL9 A;  2W6I A;  4WQM A;  4DQK A;  3WBK A;  5IYN A;  4G1B A;  4XLC A;  1WDT A;  1K9M D;  2CC2 A;  4DNR B;  1QGY A;  1QH0 A;  3GVL A;  5HXB A;  1IB0 A;  1R5O A;  2VZL A;  1G7C A;  4QFM A;  3A8J A;  2HCJ B;  4B44 A;  3T56 B;  2F4N A;  2QA4 B;  1GO2 A;  2P3M A;  5A88 A;  1M1K D;  4F7D A;  1N05 A;  5TRD A;  3BY1 A;  4LBV A;  2RC5 A;  1P4M A;  4KKU A;  3Q38 A;  4RD4 A;  1IJF A;  4B47 A;  3PUM A;  1VQ4 B;  3ZIA A;  1W0K A;  4X8I A;  1CNE A;  3G4S B;  4Z4U A;  4Z4W A;  1N0U A;  4N3N A;  4QV2 A;  3VNV A;  2PIA A;  5FA6 A;  4PC7 A;  4XQF A;  3CMA B;  1VQK B;  2XND A;  2BM0 A;  1NRK A;  4M0L A;  3CME B;  3WNC A;  3OAA A;  4TMT A;  2JDI A;  3NE5 B;  1YHQ B;  4XNF A;  3VMF A;  1UD5 A;  1KQS B;  3OP1 A;  1BPL A;  4TKO B;  2WZN A;  2BPO A;  1KK1 A;  3R6K A;  1W87 A;  3SKB A;  2VBV A;  2XGJ A;  1BX1 A;  1KK3 A;  2V4D A;  2NV4 A;  2EFG A;  2OBT A;  3V76 A;  1I7P A;  4PC2 A;  3ZZT A;  3ZZ0 A;  1NDH A;  1UD4 A;  1GAQ A;  2JIZ A;  1G7S A;  4XLE A;  3ASS A;  4X05 A;  4II2 A;  3W5H A;  3OE7 A;  3PVD A;  4X0C A;  4Y7C A;  5FNZ A;  4R71 A;  3ZBU A;  1YJN B;  3CCL B;  3OZW A;  4TMX A;  3ASQ A;  1UD6 A;  1XFO A;  4RCY A;  2HDN B;  4WZL A;  3I55 B;  2V7U A;  3I1F A;  4UZF A;  2QN6 A;  3LNN A;  1V0E A;  4XMY A;  4AVZ A;  1ZM4 A;  1VQL B;  4Z4Y A;  2ZZG A;  2C5B A;  2X6W A;  4Z4T A;  3BQJ A;  2B7C A;  1ZUN B;  1I18 A;  4RPB A;  2VNI A;  4YAL A;  1FDR A;  3Q39 A;  1PJ5 A;  1N0V C;  4YAW A;  4FWT A;  5DS0 A;  4WZK A;  3CPX A;  1RQP A;  4GQN A;  4QVJ A;  3VNU A;  1AMO A;  2Q6K A;  3W5V A;  5L46 A;  1EFR A;  1ZM3 A;  2OK8 A;  1TTT A;  1QFY A;  1T5E A;  2C4T A;  1FNC A;  3Q3A A;  1VQ8 B;  2X85 A;  1S4M A;  2DY1 A;  1HVX A;  1N06 A;  3OEE A;  3DDY A;  4TSF A;  2VBS A;  3AVX A;  2VBT A;  1CNF A;  5IYQ A;  2JN9 A;  1VQO B;  3BNW A;  1OGI A;  1H85 A;  1E79 A;  1KJZ A;  1EP2 B;  3A35 A;  2PE3 A;  2WSS A;  3ES9 A;  1G7T A;  4QHY A;  3BCF A;  4PC3 A;  4RD2 A;  1UD3 A;  3G05 A;  1SKQ A;  2EIX A;  4B3G A;  3ASP A;  2XNC A;  1JJ2 B;  1F60 A;  5B6I A;  1QVG B;  2R9V A;  4B3F X;  4XKW A;  4AF6 A;  3AVV A;  3AGQ A;  4DQL A;  5IK2 A;  1JA0 A;  3Q6Q A;  4Z4R A;  2KVO A;  1E62 A;  4YAO A;  4G7X A;  4OP7 A;  1BQE A;  1FRQ A;  5F4J A;  5CDF A;  2XZL A;  2OK7 A;  4YEL A;  1QUE A;  3CC7 B;  4Z1M A;  1VLY A;  2NPF A;  3P27 A;  4RLZ A;  3ONU A;  4OPV A;  3CXC B;  4FN5 A;  2C78 A;  3GIR A;  2CW5 A;  3CCV B;  4ROX A;  3SLD A;  3SJZ A;  4P12 A;  3GQB A;  4DK1 A;  3OW7 A;  1KZL A;  2ZZE A;  2CBX A;  4RDL A;  2VNH A;  4J0Q A;  4XLH A;  2ZL5 A;  2CK3 A;  4WWV A;  1GVH A;  1YX2 A;  2XOK A;  4Z4Z A;  1WSV A;  3CPW B;  5GV8 A;  1BX0 A;  1E3X A;  2GJR A;  3KEW A;  4ZV4 A;  2CND A;  5KNL A;  1D1N A;  5H59 A;  2GJP A;  4B43 A;  1V0F A;  1W34 A;  3QFT A;  4E0F A;  1VF7 A;  1BLI A;  3ONY A;  1YJ9 B;  3B82 A;  3G6E B;  5FIU A;  1KD1 D;  3ISX A;  1DDI A;  2B7B A;  3D26 A;  3CTA A;  2YWG A;  3QFS A;  5FO0 A;  3JQQ A;  4B4D A;  3CCU B;  2F1M A;  1R5N A;  1K73 D;  3LQ6 A;  4NBS A;  1COW A;  1ZM9 A;  2F1L A;  3VR6 A;  4JMQ A;  4BPR A;  1DDG A;  1J9Z A;  3PA2 A;  3A3G A;  1Q9S A;  1EFT A;  3AVY A;  2OBS A;  1IJE A;  1EP3 B;  3GVK A;  4LBZ A;  1W9X A;  4X06 A;  2QE7 A;  4X7D A;  2X3U A;  4RD1 A;  1YI2 B;  3OZU A;  2FVG A;  1DG1 G;  3AVU A;  4YXW A;  5GV7 A;  3OW2 B;  4G7W A;  4YAU A;  2BF4 A;  1QGA A;  3ZZU A;  2OTJ B;  4M53 A;  3SEJ A;  1WP6 A;  1VQM B;  3ZC3 A;  1VQ6 B;  1VHO A;  4P26 A;  1UD8 A;  1OGJ A;  1WSR A;  2YWH A;  4PAB A;  4Q7J B;  3CRZ A;  1K28 D;  3A3B A;  4UZU A;  4G5G A;  1D8T A;  2PMD A;  3T53 B;  2X53 S;  2X6Y A;  4P6V F;  4B48 A;  2HMA A;  1Y0Y A;  2D74 A;  4XD7 A;  2W6J A;  4OPO A;  2BV3 A;  1FNM A;  1WOP A;  2QGG A;  2BMW A;  2PLF A;  2V7V A;  2C2W A;  3GVJ A;  1B2R A;  4QUZ A;  2CRV A;  1GJR A;  4M4S A;  5TY0 A;  4WZE A;  3CC2 B;  2ZTG A;  1OHH A;  1XB2 A;  2V7Q A;  2QTL A;  4RD0 A;  3FPK A;  2OYN A;  1Y0R A;  3CES A;  5EMN A;  4ACA A;  1KRH A;  2DET A;  1EP1 B;  4TMW A;  3RY8 A;  2VNK A;  1WOR A;  1V5V A;  2ZBV A;  4MYT A;  1KK0 A;  1VHE A;  1YLO A;  3A1P A;  4OOS A;  4RPD A;  2DER A;  2ZIT A;  3LQE A;  1U2R A;  1WOO A;  4P3Y A;  3QSY A;  1OB0 A;  2VYQ A;  3E1Y E;  3AVT A;  3QE2 A;  1WOS A;  4P22 A;  5IYR A;  3CCM B;  3GSI A;  2OBR A;  1NB0 A;  4RDJ A;  1E1Q A;  2GQF A;  3JQP A;  3MCA A;  2LZJ A;  4FK8 A;  1S72 B;  4OPS A;  2ZXH A;  2X0K A;  4II3 A;  2ZZF A;  4XR6 A;  3BC9 A;  4OOV A;  1T6X A;  2Q6I A;  1IHM A;  4CQJ A;  2DEU A;  1XE1 A;  2X6X A;  5F4O A;  1WTH D;  2Q6L A;  2VJI A;  4NCN A;  5IYW A;  3WNB A;  1QFZ A;  1GR1 A;  3OJW A;  4U9U A;  5A89 A;  1FND A;  1AIP A;  5J35 A;  3CCE B;  3LO8 A;  2VNJ A;  3H9N A;  3VO2 A;  5A8A A;  1KTV A;  4XOT A;  1W35 A;  4X07 A;  2R6H A;  1W2B B;  1QG0 A;  4AC9 A;  1JA1 A;  1EFU A;  2DCU A;  1SM4 A;  3H94 A;  2X8K A;  4HIZ A;  4XN0 A;  3W2I A;  3BCD A;  3CP8 A;  3Q6R A;  4UZE A;  4XLF A;  2VJJ A;  2GK7 A;  3U2Q A;  3CMM A;  4LBW A;  4X7F A;  5TR9 A;  1VQN B;  4B3X A;  1EWY A;  3OEH A;  1VQ9 B;  1S0U A;  4KKT A;  3W2E A; 
#chains in the Genus database with same CATH homology
 4Z4Y A;  4Z4T A;  3BQJ A;  2OBS A;  4RPB A;  4X06 A;  4X7D A;  4X7C A;  3Q39 A;  5E6T A;  4OOX A;  4RDK A;  4P2N A;  4WZK A;  5F4M A;  3SLN A;  3PUN A;  4QVJ A;  3SEJ A;  3AST A;  2ZL7 A;  3BY2 A;  5IYP A;  4P26 A;  3Q3A A;  5J3O A;  4RM0 A;  5IYQ A;  4OPO A;  5BSY A;  4QUZ A;  4WZE A;  5HZB A;  4P25 A;  5IYN A;  3SJP A;  3ASP A;  5BSX A;  3RY8 A;  4OOS A;  5KW9 A;  3Q6Q A;  4RPD A;  4Z4R A;  3BY1 A;  4X7E A;  3LQE A;  4OP7 A;  3Q38 A;  5F4J A;  3PA1 A;  3ASR A;  3PUM A;  5IYR A;  4Z4U A;  4Z4W A;  4QV2 A;  2OBR A;  4RDJ A;  4RLZ A;  3ONU A;  4OPV A;  3V7A A;  4OPS A;  4P1V A;  4ROX A;  3SLD A;  4P12 A;  4RDL A;  4OOV A;  1IHM A;  4WZT A;  2ZL5 A;  5F4O A;  4Z4V A;  5IYW A;  4Z4Z A;  3SKB A;  3R6K A;  3R6J A;  5J35 A;  2OBT A;  3ASS A;  4X07 A;  3ONY A;  4X05 A;  2ZL6 A;  4Z4S A;  3D26 A;  3PVD A;  4X0C A;  3Q6R A;  4P3I A;  4X7F A;  4QVA A;  3LQ6 A;  3ASQ A;  4WZL A;  5HZA A;  3PA2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...