4P25A

Structure of the p domain from a gi.7 norovirus variant in complex with ley hbga.
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
295
structure length
288
Chain Sequence
LTVPNIPLNNLANSRVPAMINKMTVSTDQNQVVQFQNGRCTLEGQLLGTTPVSASQVARIRGKVFSTASGKGLNLTELDGTPYHAFESPAPLGFPDIGACDWHVSTFKVLSGDPMSRLDVKQNAPFAPHLGSIEFTSDQDPTGDQLGTLAWVSPSTSGARVDPWKIPSYGSTVTTHLAPPIFPPGFGEAIVYFMSDFPIVSGAQVPCTLPQEFVSHFVEQQAPVRGEAALLHYVDPDTHRNLGEFKLYPDGFITCVPNTGGGPQNLPTNGVFVFSSWVSRYYQLKPVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of determinants of histo-blood group antigen binding specificity in genogroup I noroviruses.
pubmed doi rcsb
source organism Norovirus hu/gi.7/tch-060/usa/2003
molecule tags Viral protein
molecule keywords Major capsid protein
total genus 63
structure length 288
sequence length 295
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-03-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.120 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Positive stranded ssRNA viruses 4p25A02
2.40.510.10 Mainly Beta Beta Barrel Nucleoplasmin-like/VP (viral coat and capsid proteins) Positive stranded ssRNA viruses 4p25A01
3PVDA 4Z4UA 5F4OA 1IHMA 4P2NA 4Z4TA 5IYRA 2ZL7A 4RLZA 3SLNA 4OOXA 4X7EA 3ONYA 3RY8A 4ROXA 4QVJA 4QVAA 4OOVA 5HZAA 3PUMA 4X06A 3Q6QA 3PA1A 4X07A 5IYPA 3SKBA 4Z4RA 4Z4SA 5IYNA 4X05A 3PA2A 4QUZA 5HZBA 4P12A 3R6KA 4OPOA 4RM0A 5BSYA 3PUNA 2OBSA 4RDKA 4WZKA 4X7FA 3ONUA 4OOSA 3ASTA 4QV2A 3D26A 5KW9A 4Z4WA 4X0CA 5IYQA 3BQJA 4RDJA 5F4JA 3V7AA 2ZL6A 3BY2A 4RPBA 4WZLA 4WZTA 2OBRA 3Q6RA 2ZL5A 4X7CA 3BY1A 3R6JA 3LQEA 4OPSA 4OPVA 5F4MA 5J35A 5J3OA 3ASSA 5E6TA 3LQ6A 4P25A 4WZEA 4P26A 3Q39A 3SEJA 4RDLA 3Q3AA 4OP7A 3ASQA 4X7DA 2OBTA 4Z4ZA 3ASRA 4P1VA 5IYWA 3Q38A 3SJPA 3SLDA 4P3IA 4Z4YA 5BSXA 4RPDA 3ASPA 4Z4VA
chains in the Genus database with same CATH superfamily
1QX4A 1E3XA 1JB9A 4XM3A 3CPWB 2F4NA 3QFSA 4UZUA 3AVTA 3CD6B 2ZZFA 3QE2A 2QGGA 3W2FA 4Y9RA 4XN0A 3CB4A 3OZUA 5FIUA 2X85A 5KSWB 3LVBA 2AHOA 2BSAA 4BPRA 3I56B 1KC8D 4X7EA 2WZNA 1R5NA 3BNWA 2P3MA 3MCAA 1CQXA 4QVAA 4RD2A 2B5OA 4RD1A 3PA1A 3Q6QA 1COWA 1YLOA 3VMFA 1K28D 4JMQA 3SKBA 2WJYA 4Z4SA 1HVXA 1W0JA 5IYNA 4K1XA 1XE1A 2I1LA 1BQEA 2NV4A 4KKUA 2QA4B 1A8PA 3PA2A 1NDHA 5HZBA 2GK7A 1G7SA 3WBJA 4YXWA 4AF7A 1KMHA 3H9NA 5FO0A 3CCQB 4IW3B 5BSYA 1VQOB 4RCYA 1B2RA 1WOOA 2VNJA 4TMXA 2D74A 2OBSA 3AGPA 1NRKA 3GVKA 3CCRB 4X7FA 1Q7YD 1Y0YA 2WYRA 4LBVA 4PC2A 4EH1A 3GVJA 2NPFA 3GVLA 3D26A 4Z4WA 3JQPA 2JJ2A 1PJ6A 1V0EA 5IYQA 1F20A 3ZBUA 2ZL6A 1E43A 4XLCA 1GR1A 1N07A 2XNDA 5GV8A 5TY0A 3GSIA 2DCUA 4H9GA 2W6JA 1E1RA 3ZZTA 1TLLA 1E3ZA 2ZTGA 3G6EB 4TSFA 2BMWA 5KNLA 1K73D 2VNHA 3CW2A 1BJKA 3QSYA 2ZBVA 1Q82D 1FNCA 1IJFA 1XFOA 3OEHA 3CCEB 4II3A 3BY1A 3OZWA 3FPPA 2Q6OA 5TR9A 1EFCA 4RCZA 1N0VC 4OPSA 1P4MA 4OPVA 1PKVA 4RJLA 5EMNA 5F4MA 1S4MA 1G7RA 1MRZA 2PMDA 3MHPA 4ZCMA 3GIRA 5E6TA 1VQ5B 4WQMA 1DG1G 3LQ6A 4WZEA 3WYAA 3W2EA 3ZZ0A 3B8HA 4TT3A 4ACBA 1QGAA 3CC2B 1G7TA 2BPOA 2EFGA 3ZPNA 5IK2A 3VO1A 3SEJA 1YJ9B 4QHYA 3A8IA 4NNJA 1KJZA 2C2WA 3BCDA 3I55B 2V31A 3A8KA 2GPJA 3Q3AA 2JN9A 4ACAA 3CCUB 1QUEA 2GJPA 2JJ1A 2WR8A 4RD0A 4P1VA 3U2QA 1KD1D 4AC9A 4DNRB 4XNFA 4XR6A 3W2HA 1OB0A 1ZM3A 2YWHA 3LO8A 4ZGNB 1DDGA 3SLDA 4AVZA 4J0QA 2BGJA 2GJKA 3CMEB 5HXBA 2CW5A 4G6IA 4RPDA 1KTVA 2C4UA 4ZCIA 1OGJA 5FNZA 4RD4A 2X3UA 5DSZA 4P9SA 3W2IA 1WPCA 3OEEA 3PENA 2F1MA 1IHMA 4X8IA 1GVHA 2YWGA 2XZPA 4B47A 3AGQA 4B3GA 4NBSA 1UD6A 2DIEA 2ZL7A 1MABA 2BV3A 3ISXA 4RLZA 3V76A 1KK1A 1WSVA 1WSRA 5LMZA 1H8HA 3ES9A 4KKSA 2XEXA 2CK3A 1I7PA 1GO2A 3ONYA 3RY8A 4QVJA 2QTZA 1M90D 3VNUA 1FX0A 4OOVA 4X06A 2B7CA 4G7XA 1EWYA 3P26A 2Z6BD 4X07A 4B3FX 3OP1A 2X0KA 1GAQA 4HE5A 3WBKA 3E20A 3FPKA 1VQNB 1H85A 4P6VF 1IJEA 4XLEA 2XOKA 1ZM2A 1T6XA 2X8KA 2ZZGA 3FJOA 3G71B 1W2BB 2DETA 4P12A 3CCSB 1S72B 2VBUA 3R6KA 3MMPA 4OPOA 1NBMA 4GQNA 2GK6A 1K8AD 1FRNA 2CF4A 1UD5A 3OOCA 4WZKA 5AN9A 4RD3A 1CNEA 2V4DA 2OK8A 1QH0A 3A3GA 2W6IA 1EP1B 4QV2A 2XGJA 4PC7A 5KW9A 1TUIA 1WTHD 1FNMA 2CBXA 3WNBA 3BC9A 1BX0A 1N8RD 1JA0A 5F4JA 3P27A 4P3YA 5A89A 3A1PA 3BY2A 4UZEA 3OPOA 1VHOA 4CQJA 3A8JA 3CCMB 2VNIA 3CXCB 3A35A 4WZTA 1PJ7A 2VNKA 1KZLA 1VQ6B 1ZM4A 4XLFA 4X7CA 2BM0A 2PIAA 1RQPA 2BGIA 1RQRA 2J7KA 2PE3A 1F60A 1YJNB 4YHBA 1VF7A 1SKQA 5J35A 5J3OA 2ZTNA 2YWEA 4HIZA 1I8DA 2C4TA 1WOPA 2DYIA 4RDLA 1ZM9A 4YAFA 1XQBA 4XQFA 2XZOA 1VLOA 3QFTA 1EFRA 2OBTA 2QEXB 2V7WA 4M1KA 3WNCA 3A3BA 2ZZQA 3OAAA 1UMKA 1VLYA 1VQKB 1Y0RA 3Q38A 4XN3A 1G7CA 5FO1A 4M4SA 1IB0A 1E79A 1Q81D 2FX3A 4YALA 1T6YA 4M0LA 3B78A 1BPLA 1VQ8B 3WQZA 2DERA 1QFJA 3CTAA 4P3IA 5BSXA 2ZZEA 4XORA 1E63A 4PABA 3B82A 1B23P 2RC5A 3HAGA 4HE6A 4Z4VA 3G05A 3J81k 2JIZA 4R71A 2EIXA 1EFUA 5JBQA 1N0UA 1VQMB 4Z4TA 1YIJB 3CESA 3E1YE 1KK0A 2WSSA 2D3LA 4FK8A 1KK2A 2X6WA 5IYRA 1VQ7B 1VJSA 1VQPB 1BLIA 3OW2B 1YX2A 3T53B 2DEUA 1R5BA 2OTJB 1QFYA 3SLNA 3CMAB 1D1NA 2OYNA 4OOXA 2VBSA 2WPDA 1WP6A 3LNNA 4G1BA 4M2LA 4XL9A 4XD7A 1Q86D 4YAWA 1QVFB 2OK7A 1H42A 4P22A 4U9UA 5FA6A 1VQ9B 3CCLB 2X6YA 5HZAA 3PUMA 2DOGA 5HKKA 1JJ2B 2Q6IA 3BH4A 2VJIA 5A8AA 4XKVA 1BMFA 4ZCLA 2CNDA 2PLFA 2Q6KA 1WU8A 1PJ5A 1H8EA 4X05A 1W87A 2GQFA 2LZJA 2R9VA 1D2EA 5TV2A 1CNFA 1V5VA 4PC3A 2XZLA 1JA1A 4PGOA 4TMVA 3U6KA 4RM0A 3AVXA 1UD3A 3PUNA 1QGYA 1R5OA 4RDKA 2YWFA 4OOSA 4ASUA 1TTTA 2C77A 4XLAA 2VJJA 1UD8A 2CC2A 2QTLA 3WNDA 2HCJB 4TMTA 3W5HA 5L46A 4QFMA 3BQJA 4RDJA 3ZBTA 3V7AA 4LBYA 4RPBA 4XONA 4YELA 5H5JA 1TVCA 1U2RA 3JU4A 3T56B 1T5EA 4Z1MA 4F7DA 1EP3B 1W34A 2OTLB 3GQBA 3Q6RA 4B48A 2R6HA 2ZL5A 4G5GA 2JDIA 2C78A 1VQLB 3R6JA 3LQEA 1VQ4B 3VO2A 1EP2B 5A88A 4PAAA 4G1VA 3CPXA 4FN5A 4XKWA 3ZC3A 2QN6A 3ZUGA 1SM4A 2KVOA 5FL7A 1JNYA 4P26A 4XLHA 2WJVA 5H59A 2HMAA 3G4SB 2M5SA 4MYTA 4TMWA 1W0KA 4B43A 4B44A 4OP7A 2FVGA 4X7DA 1WORA 2BM1A 4Z4ZA 3ASRA 4TKOB 1GJRA 5IYWA 1XB2A 4DK1A 3ZZUA 4B4DA 4DNTB 4RD6A 2QMUA 2V7VA 1ZUNB 3VNVA 2V7UA 2XNJA 4FWTA 3SJPA 2E1RA 3NE5B 2XNCA 2BF4A 1GAWA 2QE7A 5TRDA 4Q7JB 2VBTA 4AF6A 3CCVB 3ASPA 3AVYA 5GV7A 4DQKA 1KQSB 3CC4B 1E62A 3CMMA 1QVGB 4LBZA 3PVDA 1AIPA 1AMOA 5CDFA 3OFNA 2HLDA 4Z4UA 5F4OA 1YHQB 4P2NA 3DDYA 2F1LA 4G7WA 2BVNA 2E1BA 1YJWB 2DY1A 1FNBA 1HZEA 1WOSA 3QFRA 1Q9SA 2BN4A 2V7XA 1S0UA 1KRHA 3KEWA 2X6XA 4PC6A 1N08A 4E0FA 3OJXA 1OGIA 4XMYA 2ZXHA 4N3NA 4TMZA 4ROXA 4WWVA 4YAUA 5DS0A 4P6YA 1FNDA 2C5HA 4Y9UA 1N05A 2HDNB 4UAJA 1D8TA 1T6ZA 5IYPA 1EXMA 1EFTA 1FRQA 4Z4RA 4XOPA 3OKXA 4YAOA 3AVVA 1DDIA 4DQLA 1VHEA 3AVWA 1NJID 1OHHA 1OB5A 3OE7A 5B6IA 1BX1A 1SKYB 4QUZA 4Y7CA 3T51B 4UZFA 3AVUA 3W2GA 1I18A 1NB0A 4NCNA 3W5VA 1W9XA 2CRVA 1V0FA 4YEJA 2VZLA 2ZXIA 3BCFA 2V7QA 3CP8A 2RC6A 4FXUA 3OZVA 3ONUA 1QFZA 3ASTA 3I1FA 4L8JA 4M53A 3CC7B 1QG0A 3KL9A 1YITB 3QFCA 2Q6LA 4X0CA 4KKTA 4ZV4A 3ZIAA 1QUFA 4WZLA 3OW7A 1UD2A 2GREA 3FKSA 1KK3A 4C0SA 4ZGQB 1E1QA 3W5UA 2ZITA 2F43A 2D3NA 2OBRA 2D9RA 4XOTA 3WY9A 1NB9A 4N3GA 1E64A 1ELOA 2QDXA 4LBWA 1J9ZA 3H94A 1YI2B 2ZBUA 3CP2A 3ASSA 4MYUA 3JQRA 4P25A 3CCJB 4II2A 2X53S 3SJZA 1N06A 5DN6A 3Q39A 1UD4A 1DARA 2C5BA 3CRZA 4C43A 3JQQA 2GJRA 3ASQA 1W35A 1HA3A 1M1KD 4B3XA 4LC0A 3U6BA 2B7BA 4TN1A 4DK0A 2V7TA 1QGZA 1FDRA 3VR6A 1WDTA 4PC1A 3WXMA 4Z4YA 1OB2A 3OJWA 1K9MD 2VYQA 5THXA 2VBVA 2WZPP
chains in the Genus database with same CATH topology
3PVDA 4Z4UA 5F4OA 1IHMA 4P2NA 4Z4TA 5IYRA 2ZL7A 4RLZA 3SLNA 4OOXA 4X7EA 3ONYA 3RY8A 4ROXA 4QVJA 4QVAA 4OOVA 5HZAA 3PUMA 4X06A 3Q6QA 3PA1A 4X07A 5IYPA 3SKBA 4Z4RA 4Z4SA 5IYNA 4X05A 3PA2A 4QUZA 5HZBA 4P12A 3R6KA 4OPOA 4RM0A 5BSYA 3PUNA 2OBSA 4RDKA 4WZKA 4X7FA 3ONUA 4OOSA 3ASTA 4QV2A 3D26A 5KW9A 4Z4WA 4X0CA 5IYQA 3BQJA 4RDJA 5F4JA 3V7AA 2ZL6A 3BY2A 4RPBA 4WZLA 4WZTA 2OBRA 3Q6RA 2ZL5A 4X7CA 3BY1A 3R6JA 3LQEA 4OPSA 4OPVA 5F4MA 5J35A 5J3OA 3ASSA 5E6TA 3LQ6A 4P25A 4WZEA 4P26A 3Q39A 3SEJA 4RDLA 3Q3AA 4OP7A 3ASQA 4X7DA 2OBTA 4Z4ZA 3ASRA 4P1VA 5IYWA 3Q38A 3SJPA 3SLDA 4P3IA 4Z4YA 5BSXA 4RPDA 3ASPA 4Z4VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PVD A;  4Z4U A;  5F4O A;  1IHM A;  4P2N A;  4Z4T A;  5IYR A;  2ZL7 A;  4RLZ A;  3SLN A;  4OOX A;  4X7E A;  3ONY A;  3RY8 A;  4ROX A;  4QVJ A;  4QVA A;  4OOV A;  5HZA A;  3PUM A;  4X06 A;  3Q6Q A;  3PA1 A;  4X07 A;  5IYP A;  3SKB A;  4Z4R A;  4Z4S A;  5IYN A;  4X05 A;  3PA2 A;  4QUZ A;  5HZB A;  4P12 A;  3R6K A;  4OPO A;  4RM0 A;  5BSY A;  3PUN A;  2OBS A;  4RDK A;  4WZK A;  4X7F A;  3ONU A;  4OOS A;  3AST A;  4QV2 A;  3D26 A;  5KW9 A;  4Z4W A;  4X0C A;  5IYQ A;  3BQJ A;  4RDJ A;  5F4J A;  3V7A A;  2ZL6 A;  3BY2 A;  4RPB A;  4WZL A;  4WZT A;  2OBR A;  3Q6R A;  2ZL5 A;  4X7C A;  3BY1 A;  3R6J A;  3LQE A;  4OPS A;  4OPV A;  5F4M A;  5J35 A;  5J3O A;  3ASS A;  5E6T A;  3LQ6 A;  4P25 A;  4WZE A;  4P26 A;  3Q39 A;  3SEJ A;  4RDL A;  3Q3A A;  4OP7 A;  3ASQ A;  4X7D A;  2OBT A;  4Z4Z A;  3ASR A;  4P1V A;  5IYW A;  3Q38 A;  3SJP A;  3SLD A;  4P3I A;  4Z4Y A;  5BSX A;  4RPD A;  3ASP A;  4Z4V A; 
#chains in the Genus database with same CATH topology
 1QX4 A;  1E3X A;  1JB9 A;  4XM3 A;  3CPW B;  2F4N A;  3QFS A;  4UZU A;  3AVT A;  3CD6 B;  2ZZF A;  3QE2 A;  2QGG A;  3W2F A;  4Y9R A;  4XN0 A;  3CB4 A;  3OZU A;  5FIU A;  2X85 A;  5KSW B;  3LVB A;  2AHO A;  2BSA A;  4BPR A;  3I56 B;  1KC8 D;  4X7E A;  2WZN A;  1R5N A;  3BNW A;  2P3M A;  3MCA A;  1CQX A;  4QVA A;  4RD2 A;  2B5O A;  4RD1 A;  3PA1 A;  3Q6Q A;  1COW A;  1YLO A;  3VMF A;  1K28 D;  4JMQ A;  3SKB A;  2WJY A;  4Z4S A;  1HVX A;  1W0J A;  5IYN A;  4K1X A;  1XE1 A;  2I1L A;  1BQE A;  2NV4 A;  4KKU A;  2QA4 B;  1A8P A;  3PA2 A;  1NDH A;  5HZB A;  2GK7 A;  1G7S A;  3WBJ A;  4YXW A;  4AF7 A;  1KMH A;  3H9N A;  5FO0 A;  3CCQ B;  4IW3 B;  5BSY A;  1VQO B;  4RCY A;  1B2R A;  1WOO A;  2VNJ A;  4TMX A;  2D74 A;  2OBS A;  3AGP A;  1NRK A;  3GVK A;  3CCR B;  4X7F A;  1Q7Y D;  1Y0Y A;  2WYR A;  4LBV A;  4PC2 A;  4EH1 A;  3GVJ A;  2NPF A;  3GVL A;  3D26 A;  4Z4W A;  3JQP A;  2JJ2 A;  1PJ6 A;  1V0E A;  5IYQ A;  1F20 A;  3ZBU A;  2ZL6 A;  1E43 A;  4XLC A;  1GR1 A;  1N07 A;  2XND A;  5GV8 A;  5TY0 A;  3GSI A;  2DCU A;  4H9G A;  2W6J A;  1E1R A;  3ZZT A;  1TLL A;  1E3Z A;  2ZTG A;  3G6E B;  4TSF A;  2BMW A;  5KNL A;  1K73 D;  2VNH A;  3CW2 A;  1BJK A;  3QSY A;  2ZBV A;  1Q82 D;  1FNC A;  1IJF A;  1XFO A;  3OEH A;  3CCE B;  4II3 A;  3BY1 A;  3OZW A;  3FPP A;  2Q6O A;  5TR9 A;  1EFC A;  4RCZ A;  1N0V C;  4OPS A;  1P4M A;  4OPV A;  1PKV A;  4RJL A;  5EMN A;  5F4M A;  1S4M A;  1G7R A;  1MRZ A;  2PMD A;  3MHP A;  4ZCM A;  3GIR A;  5E6T A;  1VQ5 B;  4WQM A;  1DG1 G;  3LQ6 A;  4WZE A;  3WYA A;  3W2E A;  3ZZ0 A;  3B8H A;  4TT3 A;  4ACB A;  1QGA A;  3CC2 B;  1G7T A;  2BPO A;  2EFG A;  3ZPN A;  5IK2 A;  3VO1 A;  3SEJ A;  1YJ9 B;  4QHY A;  3A8I A;  4NNJ A;  1KJZ A;  2C2W A;  3BCD A;  3I55 B;  2V31 A;  3A8K A;  2GPJ A;  3Q3A A;  2JN9 A;  4ACA A;  3CCU B;  1QUE A;  2GJP A;  2JJ1 A;  2WR8 A;  4RD0 A;  4P1V A;  3U2Q A;  1KD1 D;  4AC9 A;  4DNR B;  4XNF A;  4XR6 A;  3W2H A;  1OB0 A;  1ZM3 A;  2YWH A;  3LO8 A;  4ZGN B;  1DDG A;  3SLD A;  4AVZ A;  4J0Q A;  2BGJ A;  2GJK A;  3CME B;  5HXB A;  2CW5 A;  4G6I A;  4RPD A;  1KTV A;  2C4U A;  4ZCI A;  1OGJ A;  5FNZ A;  4RD4 A;  2X3U A;  5DSZ A;  4P9S A;  3W2I A;  1WPC A;  3OEE A;  3PEN A;  2F1M A;  1IHM A;  4X8I A;  1GVH A;  2YWG A;  2XZP A;  4B47 A;  3AGQ A;  4B3G A;  4NBS A;  1UD6 A;  2DIE A;  2ZL7 A;  1MAB A;  2BV3 A;  3ISX A;  4RLZ A;  3V76 A;  1KK1 A;  1WSV A;  1WSR A;  5LMZ A;  1H8H A;  3ES9 A;  4KKS A;  2XEX A;  2CK3 A;  1I7P A;  1GO2 A;  3ONY A;  3RY8 A;  4QVJ A;  2QTZ A;  1M90 D;  3VNU A;  1FX0 A;  4OOV A;  4X06 A;  2B7C A;  4G7X A;  1EWY A;  3P26 A;  2Z6B D;  4X07 A;  4B3F X;  3OP1 A;  2X0K A;  1GAQ A;  4HE5 A;  3WBK A;  3E20 A;  3FPK A;  1VQN B;  1H85 A;  4P6V F;  1IJE A;  4XLE A;  2XOK A;  1ZM2 A;  1T6X A;  2X8K A;  2ZZG A;  3FJO A;  3G71 B;  1W2B B;  2DET A;  4P12 A;  3CCS B;  1S72 B;  2VBU A;  3R6K A;  3MMP A;  4OPO A;  1NBM A;  4GQN A;  2GK6 A;  1K8A D;  1FRN A;  2CF4 A;  1UD5 A;  3OOC A;  4WZK A;  5AN9 A;  4RD3 A;  1CNE A;  2V4D A;  2OK8 A;  1QH0 A;  3A3G A;  2W6I A;  1EP1 B;  4QV2 A;  2XGJ A;  4PC7 A;  5KW9 A;  1TUI A;  1WTH D;  1FNM A;  2CBX A;  3WNB A;  3BC9 A;  1BX0 A;  1N8R D;  1JA0 A;  5F4J A;  3P27 A;  4P3Y A;  5A89 A;  3A1P A;  3BY2 A;  4UZE A;  3OPO A;  1VHO A;  4CQJ A;  3A8J A;  3CCM B;  2VNI A;  3CXC B;  3A35 A;  4WZT A;  1PJ7 A;  2VNK A;  1KZL A;  1VQ6 B;  1ZM4 A;  4XLF A;  4X7C A;  2BM0 A;  2PIA A;  1RQP A;  2BGI A;  1RQR A;  2J7K A;  2PE3 A;  1F60 A;  1YJN B;  4YHB A;  1VF7 A;  1SKQ A;  5J35 A;  5J3O A;  2ZTN A;  2YWE A;  4HIZ A;  1I8D A;  2C4T A;  1WOP A;  2DYI A;  4RDL A;  1ZM9 A;  4YAF A;  1XQB A;  4XQF A;  2XZO A;  1VLO A;  3QFT A;  1EFR A;  2OBT A;  2QEX B;  2V7W A;  4M1K A;  3WNC A;  3A3B A;  2ZZQ A;  3OAA A;  1UMK A;  1VLY A;  1VQK B;  1Y0R A;  3Q38 A;  4XN3 A;  1G7C A;  5FO1 A;  4M4S A;  1IB0 A;  1E79 A;  1Q81 D;  2FX3 A;  4YAL A;  1T6Y A;  4M0L A;  3B78 A;  1BPL A;  1VQ8 B;  3WQZ A;  2DER A;  1QFJ A;  3CTA A;  4P3I A;  5BSX A;  2ZZE A;  4XOR A;  1E63 A;  4PAB A;  3B82 A;  1B23 P;  2RC5 A;  3HAG A;  4HE6 A;  4Z4V A;  3G05 A;  3J81 k;  2JIZ A;  4R71 A;  2EIX A;  1EFU A;  5JBQ A;  1N0U A;  1VQM B;  4Z4T A;  1YIJ B;  3CES A;  3E1Y E;  1KK0 A;  2WSS A;  2D3L A;  4FK8 A;  1KK2 A;  2X6W A;  5IYR A;  1VQ7 B;  1VJS A;  1VQP B;  1BLI A;  3OW2 B;  1YX2 A;  3T53 B;  2DEU A;  1R5B A;  2OTJ B;  1QFY A;  3SLN A;  3CMA B;  1D1N A;  2OYN A;  4OOX A;  2VBS A;  2WPD A;  1WP6 A;  3LNN A;  4G1B A;  4M2L A;  4XL9 A;  4XD7 A;  1Q86 D;  4YAW A;  1QVF B;  2OK7 A;  1H42 A;  4P22 A;  4U9U A;  5FA6 A;  1VQ9 B;  3CCL B;  2X6Y A;  5HZA A;  3PUM A;  2DOG A;  5HKK A;  1JJ2 B;  2Q6I A;  3BH4 A;  2VJI A;  5A8A A;  4XKV A;  1BMF A;  4ZCL A;  2CND A;  2PLF A;  2Q6K A;  1WU8 A;  1PJ5 A;  1H8E A;  4X05 A;  1W87 A;  2GQF A;  2LZJ A;  2R9V A;  1D2E A;  5TV2 A;  1CNF A;  1V5V A;  4PC3 A;  2XZL A;  1JA1 A;  4PGO A;  4TMV A;  3U6K A;  4RM0 A;  3AVX A;  1UD3 A;  3PUN A;  1QGY A;  1R5O A;  4RDK A;  2YWF A;  4OOS A;  4ASU A;  1TTT A;  2C77 A;  4XLA A;  2VJJ A;  1UD8 A;  2CC2 A;  2QTL A;  3WND A;  2HCJ B;  4TMT A;  3W5H A;  5L46 A;  4QFM A;  3BQJ A;  4RDJ A;  3ZBT A;  3V7A A;  4LBY A;  4RPB A;  4XON A;  4YEL A;  5H5J A;  1TVC A;  1U2R A;  3JU4 A;  3T56 B;  1T5E A;  4Z1M A;  4F7D A;  1EP3 B;  1W34 A;  2OTL B;  3GQB A;  3Q6R A;  4B48 A;  2R6H A;  2ZL5 A;  4G5G A;  2JDI A;  2C78 A;  1VQL B;  3R6J A;  3LQE A;  1VQ4 B;  3VO2 A;  1EP2 B;  5A88 A;  4PAA A;  4G1V A;  3CPX A;  4FN5 A;  4XKW A;  3ZC3 A;  2QN6 A;  3ZUG A;  1SM4 A;  2KVO A;  5FL7 A;  1JNY A;  4P26 A;  4XLH A;  2WJV A;  5H59 A;  2HMA A;  3G4S B;  2M5S A;  4MYT A;  4TMW A;  1W0K A;  4B43 A;  4B44 A;  4OP7 A;  2FVG A;  4X7D A;  1WOR A;  2BM1 A;  4Z4Z A;  3ASR A;  4TKO B;  1GJR A;  5IYW A;  1XB2 A;  4DK1 A;  3ZZU A;  4B4D A;  4DNT B;  4RD6 A;  2QMU A;  2V7V A;  1ZUN B;  3VNV A;  2V7U A;  2XNJ A;  4FWT A;  3SJP A;  2E1R A;  3NE5 B;  2XNC A;  2BF4 A;  1GAW A;  2QE7 A;  5TRD A;  4Q7J B;  2VBT A;  4AF6 A;  3CCV B;  3ASP A;  3AVY A;  5GV7 A;  4DQK A;  1KQS B;  3CC4 B;  1E62 A;  3CMM A;  1QVG B;  4LBZ A;  3PVD A;  1AIP A;  1AMO A;  5CDF A;  3OFN A;  2HLD A;  4Z4U A;  5F4O A;  1YHQ B;  4P2N A;  3DDY A;  2F1L A;  4G7W A;  2BVN A;  2E1B A;  1YJW B;  2DY1 A;  1FNB A;  1HZE A;  1WOS A;  3QFR A;  1Q9S A;  2BN4 A;  2V7X A;  1S0U A;  1KRH A;  3KEW A;  2X6X A;  4PC6 A;  1N08 A;  4E0F A;  3OJX A;  1OGI A;  4XMY A;  2ZXH A;  4N3N A;  4TMZ A;  4ROX A;  4WWV A;  4YAU A;  5DS0 A;  4P6Y A;  1FND A;  2C5H A;  4Y9U A;  1N05 A;  2HDN B;  4UAJ A;  1D8T A;  1T6Z A;  5IYP A;  1EXM A;  1EFT A;  1FRQ A;  4Z4R A;  4XOP A;  3OKX A;  4YAO A;  3AVV A;  1DDI A;  4DQL A;  1VHE A;  3AVW A;  1NJI D;  1OHH A;  1OB5 A;  3OE7 A;  5B6I A;  1BX1 A;  1SKY B;  4QUZ A;  4Y7C A;  3T51 B;  4UZF A;  3AVU A;  3W2G A;  1I18 A;  1NB0 A;  4NCN A;  3W5V A;  1W9X A;  2CRV A;  1V0F A;  4YEJ A;  2VZL A;  2ZXI A;  3BCF A;  2V7Q A;  3CP8 A;  2RC6 A;  4FXU A;  3OZV A;  3ONU A;  1QFZ A;  3AST A;  3I1F A;  4L8J A;  4M53 A;  3CC7 B;  1QG0 A;  3KL9 A;  1YIT B;  3QFC A;  2Q6L A;  4X0C A;  4KKT A;  4ZV4 A;  3ZIA A;  1QUF A;  4WZL A;  3OW7 A;  1UD2 A;  2GRE A;  3FKS A;  1KK3 A;  4C0S A;  4ZGQ B;  1E1Q A;  3W5U A;  2ZIT A;  2F43 A;  2D3N A;  2OBR A;  2D9R A;  4XOT A;  3WY9 A;  1NB9 A;  4N3G A;  1E64 A;  1ELO A;  2QDX A;  4LBW A;  1J9Z A;  3H94 A;  1YI2 B;  2ZBU A;  3CP2 A;  3ASS A;  4MYU A;  3JQR A;  4P25 A;  3CCJ B;  4II2 A;  2X53 S;  3SJZ A;  1N06 A;  5DN6 A;  3Q39 A;  1UD4 A;  1DAR A;  2C5B A;  3CRZ A;  4C43 A;  3JQQ A;  2GJR A;  3ASQ A;  1W35 A;  1HA3 A;  1M1K D;  4B3X A;  4LC0 A;  3U6B A;  2B7B A;  4TN1 A;  4DK0 A;  2V7T A;  1QGZ A;  1FDR A;  3VR6 A;  1WDT A;  4PC1 A;  3WXM A;  4Z4Y A;  1OB2 A;  3OJW A;  1K9M D;  2VYQ A;  5THX A;  2VBV A;  2WZP P; 
#chains in the Genus database with same CATH homology
 3PVD A;  4Z4U A;  5F4O A;  1IHM A;  4P2N A;  4Z4T A;  5IYR A;  2ZL7 A;  4RLZ A;  3SLN A;  4OOX A;  4X7E A;  3ONY A;  3RY8 A;  4ROX A;  4QVJ A;  4QVA A;  4OOV A;  5HZA A;  3PUM A;  4X06 A;  3Q6Q A;  3PA1 A;  4X07 A;  5IYP A;  3SKB A;  4Z4R A;  4Z4S A;  5IYN A;  4X05 A;  3PA2 A;  4QUZ A;  5HZB A;  4P12 A;  3R6K A;  4OPO A;  4RM0 A;  5BSY A;  3PUN A;  2OBS A;  4RDK A;  4WZK A;  4X7F A;  3ONU A;  4OOS A;  3AST A;  4QV2 A;  3D26 A;  5KW9 A;  4Z4W A;  4X0C A;  5IYQ A;  3BQJ A;  4RDJ A;  5F4J A;  3V7A A;  2ZL6 A;  3BY2 A;  4RPB A;  4WZL A;  4WZT A;  2OBR A;  3Q6R A;  2ZL5 A;  4X7C A;  3BY1 A;  3R6J A;  3LQE A;  4OPS A;  4OPV A;  5F4M A;  5J35 A;  5J3O A;  3ASS A;  5E6T A;  3LQ6 A;  4P25 A;  4WZE A;  4P26 A;  3Q39 A;  3SEJ A;  4RDL A;  3Q3A A;  4OP7 A;  3ASQ A;  4X7D A;  2OBT A;  4Z4Z A;  3ASR A;  4P1V A;  5IYW A;  3Q38 A;  3SJP A;  3SLD A;  4P3I A;  4Z4Y A;  5BSX A;  4RPD A;  3ASP A;  4Z4V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...