4P25A

Structure of the p domain from a gi.7 norovirus variant in complex with ley hbga.
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
295
structure length
288
Chain Sequence
LTVPNIPLNNLANSRVPAMINKMTVSTDQNQVVQFQNGRCTLEGQLLGTTPVSASQVARIRGKVFSTASGKGLNLTELDGTPYHAFESPAPLGFPDIGACDWHVSTFKVLSGDPMSRLDVKQNAPFAPHLGSIEFTSDQDPTGDQLGTLAWVSPSTSGARVDPWKIPSYGSTVTTHLAPPIFPPGFGEAIVYFMSDFPIVSGAQVPCTLPQEFVSHFVEQQAPVRGEAALLHYVDPDTHRNLGEFKLYPDGFITCVPNTGGGPQNLPTNGVFVFSSWVSRYYQLKPVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Major capsid protein
publication title Structural analysis of determinants of histo-blood group antigen binding specificity in genogroup I noroviruses.
pubmed doi rcsb
source organism Norovirus hu/gi.7/tch-060/usa/2003
molecule tags Viral protein
total genus 63
structure length 288
sequence length 295
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-03-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.120 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Positive stranded ssRNA viruses 4p25A02
2.40.510.10 Mainly Beta Beta Barrel Nucleoplasmin-like/VP (viral coat and capsid proteins) Positive stranded ssRNA viruses 4p25A01
4RDKA 4P2NA 3PVDA 3SLDA 4X0CA 4OOXA 3R6KA 4ROXA 4OPOA 4Z4ZA 3Q3AA 4RDJA 4QVJA 2ZL7A 3ASPA 4Z4SA 1IHMA 4WZLA 3Q6QA 3PA2A 5F4JA 4OPVA 4X7EA 4X7FA 4P12A 5HZBA 3BQJA 3SJPA 5IYWA 3PA1A 4P25A 5F4MA 3SLNA 5HZAA 5IYQA 3LQEA 3SEJA 4X06A 4QUZA 4OOVA 4QV2A 3Q6RA 3PUNA 4RPDA 3ASQA 5IYNA 3R6JA 4Z4YA 4OPSA 3ONUA 5BSYA 5IYPA 2OBRA 5KW9A 4RM0A 4WZTA 3SKBA 3Q38A 3LQ6A 3V7AA 3BY1A 5IYRA 3Q39A 4P26A 5J35A 4OOSA 4WZKA 4OP7A 3ONYA 5F4OA 3ASRA 3ASTA 4X7DA 4RPBA 3BY2A 4Z4VA 4P1VA 4X05A 4Z4RA 4P3IA 4WZEA 4RLZA 2ZL6A 4X7CA 2OBSA 2ZL5A 4Z4UA 3RY8A 4Z4TA 5E6TA 4QVAA 3ASSA 4Z4WA 4RDLA 5J3OA 2OBTA 3PUMA 3D26A 5BSXA 4X07A
chains in the Genus database with same CATH superfamily
1Q9SA 1V5VA 5H5JA 3PVDA 3SLDA 1H8HA 4M1KA 1EXMA 4L8JA 2BM1A 2X6XA 4X0CA 3R6KA 1K9MD 2E1BA 1JNYA 1WOSA 1VQNB 4DK0A 2BSAA 1KMHA 3J81k 1KZLA 3Q3AA 4RDJA 1Q81D 1VQ4B 1BMFA 4AF7A 4P9SA 4XLFA 2E1RA 1H85A 5L46A 4AC9A 4ZGQB 2WPDA 1FNMA 5F4JA 1QFZA 4B47A 4X7EA 2V7VA 4TKOB 2J7KA 2KVOA 2VNIA 1UD4A 4Y7CA 5IYWA 3PA1A 3ZIAA 3CCQB 4P25A 4QHYA 4C43A 3CC4B 4XLAA 2QMUA 4WQMA 2CC2A 3SLNA 3G71B 4QFMA 4YAFA 1IB0A 3G05A 4TMVA 2LZJA 2I1LA 1K28D 1E1RA 2GREA 1HVXA 1JB9A 2C4TA 3WBJA 4C0SA 4XR6A 2XEXA 2X6YA 1W0JA 1VHEA 1KK3A 1W34A 2RC5A 1W35A 5IYNA 3U6BA 3CXCB 5GV8A 1N08A 1FNDA 4Z4YA 4ZCIA 4B48A 1CNEA 2CNDA 4LBZA 2YWHA 3SJZA 4G5GA 1T6XA 2WJVA 1KK0A 5CDFA 2V7WA 4X8IA 1FX0A 1VF7A 3OEHA 3A1PA 2CK3A 1EFRA 4FWTA 3Q38A 4U9UA 3W2GA 4HE5A 1W2BB 4YAUA 3A35A 2C2WA 4MYUA 4OP7A 4B3FX 2OYNA 4B3GA 3OFNA 1T6ZA 4LBVA 4II2A 4TMTA 2BN4A 3OW2B 4RPBA 3BY2A 3MHPA 1Q86D 2CW5A 4P1VA 1GO2A 2QGGA 4M0LA 4Z4RA 3I1FA 2NPFA 3CMEB 1KC8D 1VQOB 2C5HA 1XQBA 2VNJA 2WYRA 2ZL6A 1YITB 4MYTA 4XNFA 3OW7A 3WNCA 5TV2A 2FX3A 3RY8A 2V4DA 5E6TA 4ZV4A 3ASSA 4LC0A 3JQQA 5TRDA 4XLEA 3WY9A 1EFUA 1WSVA 2QDXA 4G1VA 2ZZGA 4XN3A 4YELA 5TR9A 1YJNB 1D2EA 1VHOA 1WOOA 1N05A 4XMYA 4YHBA 3G4SB 3CPWB 3AVWA 4N3GA 1QUEA 4PAAA 5DS0A 1XE1A 4EH1A 4OOXA 4YXWA 2M5SA 3A8IA 3CMMA 3GVJA 5AN9A 3OPOA 4CQJA 4ROXA 5FO1A 1OB5A 3OKXA 4XORA 4ACAA 2XOKA 4YALA 2ZL7A 5A88A 3B78A 1AMOA 2DERA 2WZNA 1DG1G 1YHQB 3Q6QA 1I7PA 4TMZA 2BMWA 4KKSA 1OGIA 2GQFA 1AIPA 3AVYA 3CCRB 3CMAB 4Y9RA 4P12A 2QTLA 1V0FA 3BCFA 2GK7A 2OK8A 4ACBA 3BQJA 3AVUA 2VBSA 3CESA 2XNDA 3GIRA 5F4MA 1TVCA 2PLFA 1DARA 1Y0YA 2VJJA 4TMWA 4XQFA 2D9RA 5HZAA 4ZCMA 1G7CA 2YWFA 3ISXA 3E20A 2BGIA 1VLOA 2DETA 1NDHA 3LQEA 1QG0A 3W2IA 1V0EA 1NB9A 4WWVA 1QX4A 2NV4A 4X06A 2V7TA 4XOTA 2PE3A 4OOVA 2ZXIA 1I8DA 3PUNA 2GPJA 3KL9A 1UD6A 1BJKA 3PENA 4XLCA 3V76A 1N8RD 1ZM4A 2X6WA 3AVXA 1GR1A 2C4UA 3OEEA 3ONUA 1B2RA 1OHHA 1EWYA 3BH4A 3VR6A 1Y0RA 1YLOA 4PC6A 4H9GA 2ZZFA 1VQLB 4YAOA 4NCNA 2X53S 5BSYA 5IYPA 4G7XA 2DY1A 3QFCA 2DEUA 1UD3A 1VQ7B 3SKBA 1GVHA 2F1MA 2X85A 1Q82D 3VMFA 3LQ6A 3JU4A 2EIXA 3WNBA 1MABA 1EP1B 2BPOA 4B3XA 3I56B 1QH0A 2DYIA 3OOCA 4PGOA 4J0QA 1FRNA 1A8PA 4OOSA 1S4MA 2BV3A 4WZKA 3ONYA 3ASRA 4X7DA 2GJKA 2ZZQA 2B5OA 1KK1A 3E1YE 4Z4VA 4PC1A 4F7DA 1E3XA 2HLDA 2ZBUA 3FPPA 4RLZA 2VBUA 1YI2B 2QA4B 1KRHA 1M90D 4UAJA 2ZL5A 2EFGA 2YWGA 1FDRA 3BNWA 3QFSA 4XONA 2V7UA 1J9ZA 1F60A 1E62A 2XNCA 4Y9UA 3GVLA 4ASUA 4G1BA 4Z4WA 1KK2A 2BM0A 3A8KA 3ZBUA 1JA0A 5IK2A 4M2LA 2OBTA 2OK7A 3LNNA 2YWEA 1WDTA 3OZUA 3G6EB 2VBTA 3D26A 4UZUA 1E43A 3WNDA 3CP2A 3WQZA 1S0UA 1YJ9B 1JA1A 2PIAA 3CW2A 3P26A 1E79A 1P4MA 3ZUGA 3ES9A 2CRVA 4RDKA 4P2NA 4P22A 1PJ5A 1H42A 1VQ8B 2DCUA 3OZVA 3AVTA 2QN6A 4R71A 1GAWA 3CCUB 1QGZA 1WOPA 2VNHA 4DNTB 1B23P 3CP8A 4JMQA 3U6KA 2ZTGA 4OPOA 2JIZA 3W5HA 1PJ7A 1H8EA 3AGPA 4P6VF 2VZLA 4RCZA 3ASPA 1YX2A 1UD2A 4Z4SA 1IHMA 4B43A 3KEWA 5DN6A 2GJPA 1TUIA 1W0KA 4HIZA 5TY0A 1K8AD 2HCJB 1VQPB 4OPVA 4KKTA 4TSFA 4RD0A 3A3BA 1ZM3A 2ZITA 4X7FA 2D3LA 3CD6B 3ZBTA 2OTJB 1ZUNB 5HZBA 1D8TA 1E63A 3SJPA 1WPCA 3I55B 3CCVB 1KJZA 2B7BA 1NB0A 4UZFA 5FO0A 4XLHA 3FPKA 1VQ6B 4DQKA 1RQRA 1SM4A 1N07A 2DOGA 4B4DA 3SEJA 2GK6A 3DDYA 4P6YA 2CF4A 4QUZA 1IJFA 1K73D 1WORA 4XD7A 1EP2B 5FA6A 3CB4A 3CCJB 2ZTNA 3JQRA 1GJRA 3W2EA 4RPDA 2WJYA 5FL7A 3LVBA 3NE5B 4DNRB 1VQ5B 1MRZA 2W6JA 3WBKA 3B82A 1R5NA 4RD6A 2QE7A 3ZC3A 4OPSA 4G6IA 4LBYA 2F1LA 2VBVA 3ZPNA 2RC6A 1VJSA 3MCAA 1F20A 3OAAA 1Q7YD 1PKVA 3OZWA 4B44A 2OBRA 5KW9A 4FK8A 2JJ2A 4NNJA 4RM0A 3AGQA 2BGJA 3A8JA 3HAGA 4FXUA 3OP1A 3WYAA 2X8KA 1BX1A 1D1NA 2WR8A 5EMNA 4DQLA 4ZGNB 3Q39A 5A8AA 1N0VC 4P26A 5J35A 2ZXHA 4M53A 1TTTA 4XOPA 3OE7A 3CCMB 2X3UA 4RCYA 4AVZA 3ASTA 3CPXA 2C77A 3ZZTA 1W87A 1G7RA 4TT3A 4X05A 1BPLA 1NRKA 3GVKA 1QFYA 1ELOA 1E64A 2QTZA 3LO8A 5DSZA 4X7CA 2OBSA 5KNLA 2FVGA 2BVNA 4P3YA 2F4NA 2WZPP 2XNJA 4QVAA 1G7TA 2Z6BD 1TLLA 1WTHD 1EP3B 2W6IA 4KKUA 4RDLA 5J3OA 1UD5A 5LMZA 3PUMA 2R6HA 2QEXB 1WSRA 3CCLB 1HA3A 2ZZEA 2VNKA 1WU8A 5BSXA 1KD1D 1NBMA 5JBQA 4X07A 1COWA 3H94A 1E1QA 1I18A 3T56B 1CNFA 4PABA 4RD3A 4XL9A 1VQ9B 3P27A 4ZCLA 2JN9A 3OJWA 3U2QA 1EFTA 1R5OA 4XKWA 1QVFB 4K1XA 2DIEA 1HZEA 4Z4ZA 2F43A 5FIUA 3OJXA 4QVJA 1BLIA 1U2RA 1KQSB 1VQKB 3CC7B 3CC2B 3MMPA 1ZM2A 1QUFA 2V7XA 4WZLA 5HKKA 2V7QA 3QFRA 5FNZA 3PA2A 4G7WA 2D74A 4Q7JB 1KTVA 3VNVA 4AF6A 1WP6A 1NJID 2R9VA 1CQXA 1EFCA 4PC3A 3W2HA 1S72B 4RJLA 4NBSA 4IW3B 3JQPA 4RD1A 3VO1A 1M1KD 5IYQA 2CBXA 1G7SA 1RQPA 2B7CA 2X0KA 5HXBA 2ZBVA 1E3ZA 3CCSB 3QSYA 3GQBA 1T5EA 1OGJA 4UZEA 4GQNA 5H59A 4TN1A 3CTAA 4QV2A 3Q6RA 2VYQA 2D3NA 3AVVA 4DK1A 3ASQA 4E0FA 4M4SA 3R6JA 1FNCA 2Q6OA 2V31A 2C78A 1FNBA 1VLYA 2VJIA 4PC2A 4YEJA 1PJ6A 4HE6A 1SKQA 5A89A 4RD4A 3A3GA 1R5BA 4XM3A 3QFTA 3T51B 3VNUA 4YAWA 2Q6KA 1BX0A 5GV7A 4WZTA 3QE2A 3BCDA 4Z1MA 1N0UA 1QFJA 5KSWB 4N3NA 1QGYA 2WSSA 3V7AA 1IJEA 3CRZA 3BY1A 5THXA 5IYRA 1XB2A 2XGJA 3FJOA 3ZZUA 2XZPA 2Q6IA 4LBWA 1SKYB 1XFOA 5F4OA 5B6IA 1ZM9A 1VQMB 2XZLA 2JJ1A 1W9XA 3BC9A 2P3MA 2AHOA 1BQEA 4P3IA 1DDGA 4PC7A 4FN5A 3W5UA 2JDIA 4XKVA 4WZEA 3H9NA 2HMAA 2Q6LA 4II3A 3FKSA 3VO2A 3GSIA 1UMKA 1QVGB 4Z4UA 1FRQA 4Z4TA 4XN0A 1GAQA 2PMDA 3ZZ0A 1YJWB 2GJRA 2BF4A 1DDIA 4BPRA 1OB2A 1JJ2B 1T6YA 3W5VA 1N06A 3T53B 4RD2A 3WXMA 3W2FA 1OB0A 2XZOA 3B8HA 2HDNB 1UD8A 2C5BA 1QGAA 4TMXA 3CCEB 1YIJB 2OTLB
chains in the Genus database with same CATH topology
4RDKA 4P2NA 3PVDA 3SLDA 4X0CA 4OOXA 3R6KA 4ROXA 4OPOA 4Z4ZA 3Q3AA 4RDJA 4QVJA 2ZL7A 3ASPA 4Z4SA 1IHMA 4WZLA 3Q6QA 3PA2A 5F4JA 4OPVA 4X7EA 4X7FA 4P12A 5HZBA 3BQJA 3SJPA 5IYWA 3PA1A 4P25A 5F4MA 3SLNA 5HZAA 5IYQA 3LQEA 3SEJA 4X06A 4QUZA 4OOVA 4QV2A 3Q6RA 3PUNA 4RPDA 3ASQA 5IYNA 3R6JA 4Z4YA 4OPSA 3ONUA 5BSYA 5IYPA 2OBRA 5KW9A 4RM0A 4WZTA 3SKBA 3Q38A 3LQ6A 3V7AA 3BY1A 5IYRA 3Q39A 4P26A 5J35A 4OOSA 4WZKA 4OP7A 3ONYA 5F4OA 3ASRA 3ASTA 4X7DA 4RPBA 3BY2A 4Z4VA 4P1VA 4X05A 4Z4RA 4P3IA 4WZEA 4RLZA 2ZL6A 4X7CA 2OBSA 2ZL5A 4Z4UA 3RY8A 4Z4TA 5E6TA 4QVAA 3ASSA 4Z4WA 4RDLA 5J3OA 2OBTA 3PUMA 3D26A 5BSXA 4X07A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RDK A;  4P2N A;  3PVD A;  3SLD A;  4X0C A;  4OOX A;  3R6K A;  4ROX A;  4OPO A;  4Z4Z A;  3Q3A A;  4RDJ A;  4QVJ A;  2ZL7 A;  3ASP A;  4Z4S A;  1IHM A;  4WZL A;  3Q6Q A;  3PA2 A;  5F4J A;  4OPV A;  4X7E A;  4X7F A;  4P12 A;  5HZB A;  3BQJ A;  3SJP A;  5IYW A;  3PA1 A;  4P25 A;  5F4M A;  3SLN A;  5HZA A;  5IYQ A;  3LQE A;  3SEJ A;  4X06 A;  4QUZ A;  4OOV A;  4QV2 A;  3Q6R A;  3PUN A;  4RPD A;  3ASQ A;  5IYN A;  3R6J A;  4Z4Y A;  4OPS A;  3ONU A;  5BSY A;  5IYP A;  2OBR A;  5KW9 A;  4RM0 A;  4WZT A;  3SKB A;  3Q38 A;  3LQ6 A;  3V7A A;  3BY1 A;  5IYR A;  3Q39 A;  4P26 A;  5J35 A;  4OOS A;  4WZK A;  4OP7 A;  3ONY A;  5F4O A;  3ASR A;  3AST A;  4X7D A;  4RPB A;  3BY2 A;  4Z4V A;  4P1V A;  4X05 A;  4Z4R A;  4P3I A;  4WZE A;  4RLZ A;  2ZL6 A;  4X7C A;  2OBS A;  2ZL5 A;  4Z4U A;  3RY8 A;  4Z4T A;  5E6T A;  4QVA A;  3ASS A;  4Z4W A;  4RDL A;  5J3O A;  2OBT A;  3PUM A;  3D26 A;  5BSX A;  4X07 A; 
#chains in the Genus database with same CATH topology
 1Q9S A;  1V5V A;  5H5J A;  3PVD A;  3SLD A;  1H8H A;  4M1K A;  1EXM A;  4L8J A;  2BM1 A;  2X6X A;  4X0C A;  3R6K A;  1K9M D;  2E1B A;  1JNY A;  1WOS A;  1VQN B;  4DK0 A;  2BSA A;  1KMH A;  3J81 k;  1KZL A;  3Q3A A;  4RDJ A;  1Q81 D;  1VQ4 B;  1BMF A;  4AF7 A;  4P9S A;  4XLF A;  2E1R A;  1H85 A;  5L46 A;  4AC9 A;  4ZGQ B;  2WPD A;  1FNM A;  5F4J A;  1QFZ A;  4B47 A;  4X7E A;  2V7V A;  4TKO B;  2J7K A;  2KVO A;  2VNI A;  1UD4 A;  4Y7C A;  5IYW A;  3PA1 A;  3ZIA A;  3CCQ B;  4P25 A;  4QHY A;  4C43 A;  3CC4 B;  4XLA A;  2QMU A;  4WQM A;  2CC2 A;  3SLN A;  3G71 B;  4QFM A;  4YAF A;  1IB0 A;  3G05 A;  4TMV A;  2LZJ A;  2I1L A;  1K28 D;  1E1R A;  2GRE A;  1HVX A;  1JB9 A;  2C4T A;  3WBJ A;  4C0S A;  4XR6 A;  2XEX A;  2X6Y A;  1W0J A;  1VHE A;  1KK3 A;  1W34 A;  2RC5 A;  1W35 A;  5IYN A;  3U6B A;  3CXC B;  5GV8 A;  1N08 A;  1FND A;  4Z4Y A;  4ZCI A;  4B48 A;  1CNE A;  2CND A;  4LBZ A;  2YWH A;  3SJZ A;  4G5G A;  1T6X A;  2WJV A;  1KK0 A;  5CDF A;  2V7W A;  4X8I A;  1FX0 A;  1VF7 A;  3OEH A;  3A1P A;  2CK3 A;  1EFR A;  4FWT A;  3Q38 A;  4U9U A;  3W2G A;  4HE5 A;  1W2B B;  4YAU A;  3A35 A;  2C2W A;  4MYU A;  4OP7 A;  4B3F X;  2OYN A;  4B3G A;  3OFN A;  1T6Z A;  4LBV A;  4II2 A;  4TMT A;  2BN4 A;  3OW2 B;  4RPB A;  3BY2 A;  3MHP A;  1Q86 D;  2CW5 A;  4P1V A;  1GO2 A;  2QGG A;  4M0L A;  4Z4R A;  3I1F A;  2NPF A;  3CME B;  1KC8 D;  1VQO B;  2C5H A;  1XQB A;  2VNJ A;  2WYR A;  2ZL6 A;  1YIT B;  4MYT A;  4XNF A;  3OW7 A;  3WNC A;  5TV2 A;  2FX3 A;  3RY8 A;  2V4D A;  5E6T A;  4ZV4 A;  3ASS A;  4LC0 A;  3JQQ A;  5TRD A;  4XLE A;  3WY9 A;  1EFU A;  1WSV A;  2QDX A;  4G1V A;  2ZZG A;  4XN3 A;  4YEL A;  5TR9 A;  1YJN B;  1D2E A;  1VHO A;  1WOO A;  1N05 A;  4XMY A;  4YHB A;  3G4S B;  3CPW B;  3AVW A;  4N3G A;  1QUE A;  4PAA A;  5DS0 A;  1XE1 A;  4EH1 A;  4OOX A;  4YXW A;  2M5S A;  3A8I A;  3CMM A;  3GVJ A;  5AN9 A;  3OPO A;  4CQJ A;  4ROX A;  5FO1 A;  1OB5 A;  3OKX A;  4XOR A;  4ACA A;  2XOK A;  4YAL A;  2ZL7 A;  5A88 A;  3B78 A;  1AMO A;  2DER A;  2WZN A;  1DG1 G;  1YHQ B;  3Q6Q A;  1I7P A;  4TMZ A;  2BMW A;  4KKS A;  1OGI A;  2GQF A;  1AIP A;  3AVY A;  3CCR B;  3CMA B;  4Y9R A;  4P12 A;  2QTL A;  1V0F A;  3BCF A;  2GK7 A;  2OK8 A;  4ACB A;  3BQJ A;  3AVU A;  2VBS A;  3CES A;  2XND A;  3GIR A;  5F4M A;  1TVC A;  2PLF A;  1DAR A;  1Y0Y A;  2VJJ A;  4TMW A;  4XQF A;  2D9R A;  5HZA A;  4ZCM A;  1G7C A;  2YWF A;  3ISX A;  3E20 A;  2BGI A;  1VLO A;  2DET A;  1NDH A;  3LQE A;  1QG0 A;  3W2I A;  1V0E A;  1NB9 A;  4WWV A;  1QX4 A;  2NV4 A;  4X06 A;  2V7T A;  4XOT A;  2PE3 A;  4OOV A;  2ZXI A;  1I8D A;  3PUN A;  2GPJ A;  3KL9 A;  1UD6 A;  1BJK A;  3PEN A;  4XLC A;  3V76 A;  1N8R D;  1ZM4 A;  2X6W A;  3AVX A;  1GR1 A;  2C4U A;  3OEE A;  3ONU A;  1B2R A;  1OHH A;  1EWY A;  3BH4 A;  3VR6 A;  1Y0R A;  1YLO A;  4PC6 A;  4H9G A;  2ZZF A;  1VQL B;  4YAO A;  4NCN A;  2X53 S;  5BSY A;  5IYP A;  4G7X A;  2DY1 A;  3QFC A;  2DEU A;  1UD3 A;  1VQ7 B;  3SKB A;  1GVH A;  2F1M A;  2X85 A;  1Q82 D;  3VMF A;  3LQ6 A;  3JU4 A;  2EIX A;  3WNB A;  1MAB A;  1EP1 B;  2BPO A;  4B3X A;  3I56 B;  1QH0 A;  2DYI A;  3OOC A;  4PGO A;  4J0Q A;  1FRN A;  1A8P A;  4OOS A;  1S4M A;  2BV3 A;  4WZK A;  3ONY A;  3ASR A;  4X7D A;  2GJK A;  2ZZQ A;  2B5O A;  1KK1 A;  3E1Y E;  4Z4V A;  4PC1 A;  4F7D A;  1E3X A;  2HLD A;  2ZBU A;  3FPP A;  4RLZ A;  2VBU A;  1YI2 B;  2QA4 B;  1KRH A;  1M90 D;  4UAJ A;  2ZL5 A;  2EFG A;  2YWG A;  1FDR A;  3BNW A;  3QFS A;  4XON A;  2V7U A;  1J9Z A;  1F60 A;  1E62 A;  2XNC A;  4Y9U A;  3GVL A;  4ASU A;  4G1B A;  4Z4W A;  1KK2 A;  2BM0 A;  3A8K A;  3ZBU A;  1JA0 A;  5IK2 A;  4M2L A;  2OBT A;  2OK7 A;  3LNN A;  2YWE A;  1WDT A;  3OZU A;  3G6E B;  2VBT A;  3D26 A;  4UZU A;  1E43 A;  3WND A;  3CP2 A;  3WQZ A;  1S0U A;  1YJ9 B;  1JA1 A;  2PIA A;  3CW2 A;  3P26 A;  1E79 A;  1P4M A;  3ZUG A;  3ES9 A;  2CRV A;  4RDK A;  4P2N A;  4P22 A;  1PJ5 A;  1H42 A;  1VQ8 B;  2DCU A;  3OZV A;  3AVT A;  2QN6 A;  4R71 A;  1GAW A;  3CCU B;  1QGZ A;  1WOP A;  2VNH A;  4DNT B;  1B23 P;  3CP8 A;  4JMQ A;  3U6K A;  2ZTG A;  4OPO A;  2JIZ A;  3W5H A;  1PJ7 A;  1H8E A;  3AGP A;  4P6V F;  2VZL A;  4RCZ A;  3ASP A;  1YX2 A;  1UD2 A;  4Z4S A;  1IHM A;  4B43 A;  3KEW A;  5DN6 A;  2GJP A;  1TUI A;  1W0K A;  4HIZ A;  5TY0 A;  1K8A D;  2HCJ B;  1VQP B;  4OPV A;  4KKT A;  4TSF A;  4RD0 A;  3A3B A;  1ZM3 A;  2ZIT A;  4X7F A;  2D3L A;  3CD6 B;  3ZBT A;  2OTJ B;  1ZUN B;  5HZB A;  1D8T A;  1E63 A;  3SJP A;  1WPC A;  3I55 B;  3CCV B;  1KJZ A;  2B7B A;  1NB0 A;  4UZF A;  5FO0 A;  4XLH A;  3FPK A;  1VQ6 B;  4DQK A;  1RQR A;  1SM4 A;  1N07 A;  2DOG A;  4B4D A;  3SEJ A;  2GK6 A;  3DDY A;  4P6Y A;  2CF4 A;  4QUZ A;  1IJF A;  1K73 D;  1WOR A;  4XD7 A;  1EP2 B;  5FA6 A;  3CB4 A;  3CCJ B;  2ZTN A;  3JQR A;  1GJR A;  3W2E A;  4RPD A;  2WJY A;  5FL7 A;  3LVB A;  3NE5 B;  4DNR B;  1VQ5 B;  1MRZ A;  2W6J A;  3WBK A;  3B82 A;  1R5N A;  4RD6 A;  2QE7 A;  3ZC3 A;  4OPS A;  4G6I A;  4LBY A;  2F1L A;  2VBV A;  3ZPN A;  2RC6 A;  1VJS A;  3MCA A;  1F20 A;  3OAA A;  1Q7Y D;  1PKV A;  3OZW A;  4B44 A;  2OBR A;  5KW9 A;  4FK8 A;  2JJ2 A;  4NNJ A;  4RM0 A;  3AGQ A;  2BGJ A;  3A8J A;  3HAG A;  4FXU A;  3OP1 A;  3WYA A;  2X8K A;  1BX1 A;  1D1N A;  2WR8 A;  5EMN A;  4DQL A;  4ZGN B;  3Q39 A;  5A8A A;  1N0V C;  4P26 A;  5J35 A;  2ZXH A;  4M53 A;  1TTT A;  4XOP A;  3OE7 A;  3CCM B;  2X3U A;  4RCY A;  4AVZ A;  3AST A;  3CPX A;  2C77 A;  3ZZT A;  1W87 A;  1G7R A;  4TT3 A;  4X05 A;  1BPL A;  1NRK A;  3GVK A;  1QFY A;  1ELO A;  1E64 A;  2QTZ A;  3LO8 A;  5DSZ A;  4X7C A;  2OBS A;  5KNL A;  2FVG A;  2BVN A;  4P3Y A;  2F4N A;  2WZP P;  2XNJ A;  4QVA A;  1G7T A;  2Z6B D;  1TLL A;  1WTH D;  1EP3 B;  2W6I A;  4KKU A;  4RDL A;  5J3O A;  1UD5 A;  5LMZ A;  3PUM A;  2R6H A;  2QEX B;  1WSR A;  3CCL B;  1HA3 A;  2ZZE A;  2VNK A;  1WU8 A;  5BSX A;  1KD1 D;  1NBM A;  5JBQ A;  4X07 A;  1COW A;  3H94 A;  1E1Q A;  1I18 A;  3T56 B;  1CNF A;  4PAB A;  4RD3 A;  4XL9 A;  1VQ9 B;  3P27 A;  4ZCL A;  2JN9 A;  3OJW A;  3U2Q A;  1EFT A;  1R5O A;  4XKW A;  1QVF B;  4K1X A;  2DIE A;  1HZE A;  4Z4Z A;  2F43 A;  5FIU A;  3OJX A;  4QVJ A;  1BLI A;  1U2R A;  1KQS B;  1VQK B;  3CC7 B;  3CC2 B;  3MMP A;  1ZM2 A;  1QUF A;  2V7X A;  4WZL A;  5HKK A;  2V7Q A;  3QFR A;  5FNZ A;  3PA2 A;  4G7W A;  2D74 A;  4Q7J B;  1KTV A;  3VNV A;  4AF6 A;  1WP6 A;  1NJI D;  2R9V A;  1CQX A;  1EFC A;  4PC3 A;  3W2H A;  1S72 B;  4RJL A;  4NBS A;  4IW3 B;  3JQP A;  4RD1 A;  3VO1 A;  1M1K D;  5IYQ A;  2CBX A;  1G7S A;  1RQP A;  2B7C A;  2X0K A;  5HXB A;  2ZBV A;  1E3Z A;  3CCS B;  3QSY A;  3GQB A;  1T5E A;  1OGJ A;  4UZE A;  4GQN A;  5H59 A;  4TN1 A;  3CTA A;  4QV2 A;  3Q6R A;  2VYQ A;  2D3N A;  3AVV A;  4DK1 A;  3ASQ A;  4E0F A;  4M4S A;  3R6J A;  1FNC A;  2Q6O A;  2V31 A;  2C78 A;  1FNB A;  1VLY A;  2VJI A;  4PC2 A;  4YEJ A;  1PJ6 A;  4HE6 A;  1SKQ A;  5A89 A;  4RD4 A;  3A3G A;  1R5B A;  4XM3 A;  3QFT A;  3T51 B;  3VNU A;  4YAW A;  2Q6K A;  1BX0 A;  5GV7 A;  4WZT A;  3QE2 A;  3BCD A;  4Z1M A;  1N0U A;  1QFJ A;  5KSW B;  4N3N A;  1QGY A;  2WSS A;  3V7A A;  1IJE A;  3CRZ A;  3BY1 A;  5THX A;  5IYR A;  1XB2 A;  2XGJ A;  3FJO A;  3ZZU A;  2XZP A;  2Q6I A;  4LBW A;  1SKY B;  1XFO A;  5F4O A;  5B6I A;  1ZM9 A;  1VQM B;  2XZL A;  2JJ1 A;  1W9X A;  3BC9 A;  2P3M A;  2AHO A;  1BQE A;  4P3I A;  1DDG A;  4PC7 A;  4FN5 A;  3W5U A;  2JDI A;  4XKV A;  4WZE A;  3H9N A;  2HMA A;  2Q6L A;  4II3 A;  3FKS A;  3VO2 A;  3GSI A;  1UMK A;  1QVG B;  4Z4U A;  1FRQ A;  4Z4T A;  4XN0 A;  1GAQ A;  2PMD A;  3ZZ0 A;  1YJW B;  2GJR A;  2BF4 A;  1DDI A;  4BPR A;  1OB2 A;  1JJ2 B;  1T6Y A;  3W5V A;  1N06 A;  3T53 B;  4RD2 A;  3WXM A;  3W2F A;  1OB0 A;  2XZO A;  3B8H A;  2HDN B;  1UD8 A;  2C5B A;  1QGA A;  4TMX A;  3CCE B;  1YIJ B;  2OTL B; 
#chains in the Genus database with same CATH homology
 4RDK A;  4P2N A;  3PVD A;  3SLD A;  4X0C A;  4OOX A;  3R6K A;  4ROX A;  4OPO A;  4Z4Z A;  3Q3A A;  4RDJ A;  4QVJ A;  2ZL7 A;  3ASP A;  4Z4S A;  1IHM A;  4WZL A;  3Q6Q A;  3PA2 A;  5F4J A;  4OPV A;  4X7E A;  4X7F A;  4P12 A;  5HZB A;  3BQJ A;  3SJP A;  5IYW A;  3PA1 A;  4P25 A;  5F4M A;  3SLN A;  5HZA A;  5IYQ A;  3LQE A;  3SEJ A;  4X06 A;  4QUZ A;  4OOV A;  4QV2 A;  3Q6R A;  3PUN A;  4RPD A;  3ASQ A;  5IYN A;  3R6J A;  4Z4Y A;  4OPS A;  3ONU A;  5BSY A;  5IYP A;  2OBR A;  5KW9 A;  4RM0 A;  4WZT A;  3SKB A;  3Q38 A;  3LQ6 A;  3V7A A;  3BY1 A;  5IYR A;  3Q39 A;  4P26 A;  5J35 A;  4OOS A;  4WZK A;  4OP7 A;  3ONY A;  5F4O A;  3ASR A;  3AST A;  4X7D A;  4RPB A;  3BY2 A;  4Z4V A;  4P1V A;  4X05 A;  4Z4R A;  4P3I A;  4WZE A;  4RLZ A;  2ZL6 A;  4X7C A;  2OBS A;  2ZL5 A;  4Z4U A;  3RY8 A;  4Z4T A;  5E6T A;  4QVA A;  3ASS A;  4Z4W A;  4RDL A;  5J3O A;  2OBT A;  3PUM A;  3D26 A;  5BSX A;  4X07 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...