4P25A

Structure of the p domain from a gi.7 norovirus variant in complex with ley hbga.
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
295
structure length
288
Chain Sequence
LTVPNIPLNNLANSRVPAMINKMTVSTDQNQVVQFQNGRCTLEGQLLGTTPVSASQVARIRGKVFSTASGKGLNLTELDGTPYHAFESPAPLGFPDIGACDWHVSTFKVLSGDPMSRLDVKQNAPFAPHLGSIEFTSDQDPTGDQLGTLAWVSPSTSGARVDPWKIPSYGSTVTTHLAPPIFPPGFGEAIVYFMSDFPIVSGAQVPCTLPQEFVSHFVEQQAPVRGEAALLHYVDPDTHRNLGEFKLYPDGFITCVPNTGGGPQNLPTNGVFVFSSWVSRYYQLKPVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords Major capsid protein
publication title Structural analysis of determinants of histo-blood group antigen binding specificity in genogroup I noroviruses.
pubmed doi rcsb
source organism Norovirus hu/gi.7/tch-060/usa/2003
total genus 63
structure length 288
sequence length 295
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-03-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.120 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Positive stranded ssRNA viruses 4p25A02
2.40.510.10 Mainly Beta Beta Barrel Nucleoplasmin-like/VP (viral coat and capsid proteins) Positive stranded ssRNA viruses 4p25A01
3BY2A 5HZAA 5IYNA 3ASPA 2ZL6A 5HZBA 3ASRA 4RM0A 4OOSA 4QVAA 2ZL5A 1IHMA 3Q6QA 4QUZA 4X7CA 2OBTA 4Z4UA 4X06A 4P25A 4X7EA 4WZLA 4Z4YA 4RPBA 4X0CA 3ASTA 3SLDA 4Z4SA 4X7FA 4RPDA 4X07A 4OPOA 3SEJA 5IYQA 4OPSA 3PUMA 5IYWA 3SLNA 3ONUA 4WZKA 4P3IA 4X7DA 5F4OA 4P1VA 5E6TA 4Z4RA 2ZL7A 3RY8A 4P2NA 4Z4VA 3SKBA 5IYPA 4OOVA 4Z4ZA 5IYRA 4Z4TA 5J35A 5J3OA 4QVJA 3Q38A 3PVDA 3R6KA 5BSXA 3Q3AA 3SJPA 4OOXA 4RLZA 3Q6RA 3BY1A 5BSYA 3LQ6A 2OBRA 3R6JA 4ROXA 4P26A 3PUNA 3PA2A 3PA1A 4QV2A 4OPVA 4X05A 4P12A 5F4MA 3ASQA 3V7AA 4OP7A 3ONYA 4WZTA 4RDKA 4Z4WA 2OBSA 4RDLA 3ASSA 5KW9A 3LQEA 3D26A 4RDJA 3Q39A 4WZEA 5F4JA 3BQJA
chains in the Genus database with same CATH superfamily
3AVWA 1YX2A 2X0KA 5IYNA 4M53A 4P6YA 4M1KA 4G1VA 1UD2A 2XNJA 3GIRA 3CB4A 3HAGA 1E1RA 1UD5A 1XB2A 1IHMA 2ZITA 3B82A 2JIZA 3FPPA 4X7CA 5DS0A 1PJ5A 4Z4UA 3LVBA 4G7WA 2OTLB 2ZTGA 1UD8A 4R71A 4FXUA 2GJPA 1KZLA 5HKKA 4X0CA 4XLAA 3WXMA 4F7DA 4RD1A 3W2IA 3GQBA 3WBKA 4B3FX 1FNMA 4YAWA 5FO1A 5TY0A 3V76A 4M2LA 1JB9A 1G7TA 2C2WA 2AHOA 4X07A 4X8IA 1VQPB 3A8KA 3SEJA 3U2QA 3CCLB 3ZZUA 1N0VC 5A88A 3PUMA 3BCDA 3QFCA 5IYWA 3SLNA 3ONUA 3CPWB 1K8AD 4RCZA 2E1BA 4P3IA 3AVUA 1R5NA 1MRZA 1CNEA 4P3YA 1GJRA 4BPRA 1E63A 2BGIA 1EXMA 1BPLA 2ZL7A 1NB9A 3CP8A 4P2NA 2XNDA 3A8IA 4UAJA 5IYPA 3WYAA 2Z6BD 4Z4ZA 1KK1A 4Z4TA 1H8HA 2VNKA 3MHPA 5BSXA 1VHEA 3H9NA 4ACAA 2V7TA 1VQOB 3OFNA 1KQSB 1WP6A 1RQRA 1VQ9B 1R5OA 2WZNA 4OOXA 4TKOB 1QUEA 1FX0A 4RLZA 1QVFB 1SKYB 3W2GA 1EP1B 3I55B 2GJKA 3VO1A 3CCVB 1YIJB 4B44A 1OB2A 4Y7CA 4ZGQB 1N8RD 2JN9A 4XKVA 1IJEA 3H94A 4PGOA 4YELA 2JDIA 1F20A 3QFSA 1I18A 4ROXA 1AIPA 3KL9A 4P26A 3G6EB 4U9UA 2C77A 4M4SA 2BM1A 1W34A 2CRVA 2R9VA 2ZZFA 4QV2A 3T53B 1XFOA 2V7VA 4ACBA 2QEXB 4NNJA 2X53S 5GV7A 3A1PA 4KKSA 1EFTA 1BX0A 4X05A 4P12A 3OW7A 4B43A 3CC7B 1Q82D 2HMAA 4YALA 5F4MA 3P26A 4WQMA 1D1NA 5A89A 3V7AA 1Q86D 3AVXA 2YWHA 1WPCA 3LO8A 4LBWA 4WZTA 3KEWA 3WY9A 4PC7A 3BC9A 1ZM2A 4RDLA 3ASSA 2VNIA 5KW9A 2VJIA 1W0JA 1OGIA 1BQEA 3W5VA 1A8PA 2Q6LA 4WZEA 5H59A 4IW3B 5H5JA 2HDNB 2PMDA 2C5BA 4RD6A 1W9XA 2PIAA 1VLYA 3AGPA 5FL7A 3W5HA 4DK0A 3E1YE 4RCYA 2GPJA 3ZPNA 3CTAA 4PC2A 2ZL6A 3ASPA 1M1KD 5HZBA 1QUFA 4CQJA 1GVHA 2BVNA 1FNBA 2CF4A 1Q9SA 2X85A 1UMKA 2ZL5A 1E62A 4TMVA 1QGAA 1HA3A 1BMFA 1S4MA 1VJSA 3CCSB 4C0SA 1T6ZA 1WDTA 2RC6A 3G4SB 2QTLA 2P3MA 4YEJA 4X06A 5TR9A 1DDGA 4XQFA 4FWTA 4XNFA 3VMFA 3OEHA 1ZM4A 3CESA 1W87A 4AF7A 1YI2B 1H8EA 2XEXA 3BNWA 3VO2A 4ZCIA 4XR6A 3CCJB 1E43A 4RPDA 1YJWB 5A8AA 4HIZA 4OPOA 1JNYA 1YJ9B 2FVGA 5IYQA 4TMTA 1QGYA 1KK3A 3GVJA 4N3GA 3AVYA 1FNCA 2F1LA 4WZKA 4EH1A 1N08A 5TV2A 1AMOA 1QH0A 4HE5A 3I56B 1VQ4B 3ZZTA 1Y0RA 3OEEA 3T56B 1WSRA 2EIXA 3CMMA 4P1VA 5E6TA 3FJOA 2R6HA 3AGQA 4Z4RA 3G71B 4RD4A 4KKTA 3CRZA 1EFRA 2W6IA 3B78A 3RY8A 4KKUA 1E64A 4P22A 4Z4VA 2WSSA 3CXCB 4RD2A 1OB5A 1CQXA 4PC6A 5J35A 1DDIA 1J9ZA 1DARA 2F1MA 3Q3AA 3A3GA 3PENA 2CC2A 4L8JA 1N07A 3SJPA 1TLLA 2X8KA 4J0QA 1E3XA 2D3LA 1I8DA 4XOPA 2WZPP 4TN1A 1EP2B 3T51B 2ZZEA 1D2EA 5DN6A 4XLHA 2V7QA 4ZCLA 3WNDA 2OBRA 1VLOA 1YITB 1XQBA 4QHYA 2WJYA 3R6JA 3G05A 1N06A 1JA1A 3CCEB 4P9SA 4GQNA 3QFTA 4AC9A 2BGJA 2NV4A 4XD7A 2E1RA 4B4DA 1UD3A 2V7WA 3OPOA 1NDHA 1PKVA 1WOSA 3OP1A 4AF6A 1TVCA 2JJ2A 2D9RA 2W6JA 1RQPA 3WBJA 4OP7A 3ONYA 2ZZGA 4LBVA 2OBSA 1P4MA 1G7RA 5CDFA 1OGJA 2YWGA 1T6XA 2VBSA 4XONA 3BCFA 5JBQA 1GAWA 4MYUA 1M90D 1CNFA 1ZM9A 3WNBA 2C4UA 5HZAA 3JU4A 1Q7YD 3BH4A 4TSFA 5HXBA 1D8TA 2DYIA 3NE5B 3ASRA 1TTTA 3ES9A 1BX1A 4OOSA 3A8JA 4QVAA 3CCQB 1VQ7B 4TMXA 1SKQA 1VQLB 2DCUA 1IB0A 2BSAA 3OE7A 1QFJA 2X6YA 2OYNA 2GREA 2ZTNA 2JJ1A 3DDYA 1NBMA 1QFYA 2BF4A 3ZC3A 1NJID 3OAAA 4X7EA 4QFMA 4Z1MA 4WZLA 1H42A 1QFZA 3SLDA 3W2HA 1B23P 2CNDA 2VBUA 3CC4B 1FNDA 1G7SA 4G5GA 5L46A 3ISXA 2NPFA 2HCJB 1KC8D 4XMYA 2I1LA 4RJLA 1HZEA 2OTJB 4DQKA 3MCAA 5F4OA 3CD6B 1VHOA 4UZFA 1YLOA 3OJXA 5EMNA 3A3BA 1N05A 1V0EA 2XOKA 4Y9RA 2Q6KA 4PAAA 2D3NA 4XM3A 2DOGA 1IJFA 1Y0YA 3W2EA 1S0UA 3CW2A 5KSWB 3Q38A 2CBXA 2X6XA 4UZEA 3W2FA 1KRHA 1ZM3A 2YWEA 2XZLA 2X6WA 2ZXHA 4XLFA 1WSVA 2YWFA 4RD3A 1N0UA 4B47A 2OK7A 1EP3B 1W0KA 3CC2B 2VJJA 4FN5A 1VQKB 2WPDA 4TMZA 3MMPA 3P27A 2HLDA 3Q6RA 1ELOA 1KK0A 1KD1D 2B7BA 2X3UA 5BSYA 1KTVA 1W35A 4II3A 2BN4A 1I7PA 3LQ6A 4C43A 1QVGB 5FO0A 1Q81D 1U2RA 2VBTA 3JQPA 3WNCA 4ZGNB 3CMEB 4ZCMA 3SJZA 2FX3A 3FKSA 1WORA 3PA2A 1HVXA 4UZUA 2XNCA 1MABA 5IK2A 1EFCA 2D74A 2VYQA 2WYRA 3I1FA 3ZZ0A 1GO2A 4OPVA 2V4DA 2LZJA 4TMWA 3CCMB 5FA6A 2GK7A 1K28D 4E0FA 2Q6IA 3CCUB 2VZLA 4LBZA 4M0LA 4Z4WA 2CK3A 1VF7A 4TT3A 4XKWA 2XZOA 1T5EA 4XL9A 3Q39A 1ZUNB 1FDRA 3FPKA 3OZUA 2ZBVA 1QX4A 1KMHA 3BY2A 4WWVA 3VR6A 3CMAB 2F43A 2DY1A 3B8HA 2KVOA 1E1QA 3OZVA 3OKXA 2PE3A 4LC0A 3A35A 4RM0A 1B2RA 4PC3A 3OW2B 4Y9UA 3E20A 4YAOA 2B7CA 4DQLA 3ZIAA 1WOOA 5THXA 2ZZQA 3Q6QA 4QUZA 3VNVA 1UD4A 2V7XA 4FK8A 2XGJA 2OBTA 1EFUA 3QFRA 5DSZA 3W5UA 2QMUA 4DK1A 3CP2A 3CCRB 2QDXA 2V7UA 4P25A 1SM4A 1DG1G 4Z4YA 4JMQA 4P6VF 4MYTA 4RPBA 3ASTA 4YAFA 4Z4SA 3AVTA 1BLIA 4N3NA 3VNUA 1GAQA 4ZV4A 5AN9A 4X7FA 4XLCA 4H9GA 1E79A 2F4NA 2Q6OA 3JQRA 2QGGA 4K1XA 3GVLA 1V5VA 1GR1A 4OPSA 1FRNA 1PJ6A 2WJVA 2XZPA 4YAUA 1V0FA 1TUIA 2BM0A 3ZBTA 2VNJA 2EFGA 2GJRA 2PLFA 1OHHA 3GVKA 5TRDA 1PJ7A 1OB0A 4X7DA 2VNHA 4XN3A 2DEUA 1W2BB 4ASUA 4G6IA 3WQZA 4XN0A 1UD6A 2QE7A 3SKBA 4OOVA 5IYRA 1K9MD 1VQ6B 1K73D 5J3OA 4QVJA 1BJKA 1KK2A 4G7XA 3PVDA 1VQMB 3R6KA 4XLEA 4HE6A 1NRKA 1G7CA 3OZWA 4NCNA 5FNZA 2GQFA 1VQ8B 2QN6A 3J81k 2BV3A 1WU8A 4YXWA 3CPXA 1T6YA 2GK6A 3BY1A 4Q7JB 3JQQA 1VQ5B 4B3XA 3QSYA 1YJNB 2QTZA 3ZBUA 1EWYA 1R5BA 2C4TA 1KJZA 4PABA 4XOTA 4XORA 2CW5A 2WR8A 4II2A 4YHBA 5FIUA 3AVVA 2J7KA 5B6IA 2RC5A 4B3GA 3PUNA 4DNTB 3PA1A 4NBSA 1FRQA 3LNNA 1VQNB 1JJ2B 2BPOA 4AVZA 2OK8A 1QGZA 2ZBUA 1JA0A 2VBVA 1NB0A 2BMWA 1F60A 2DIEA 2M5SA 3OJWA 4G1BA 4DNRB 5LMZA 3U6BA 2C5HA 1WTHD 4RD0A 3U6KA 1S72B 3ASQA 4B48A 1COWA 1E3ZA 3ZUGA 2DERA 4RDKA 5KNLA 2QA4B 3QE2A 4PC1A 1QG0A 2C78A 3LQEA 3D26A 1H85A 4RDJA 3GSIA 2B5OA 2ZXIA 3OOCA 4LBYA 3BQJA 2V31A 5F4JA 5GV8A 1YHQB 1WOPA 2DETA 1XE1A
chains in the Genus database with same CATH topology
3BY2A 5HZAA 5IYNA 3ASPA 2ZL6A 5HZBA 3ASRA 4RM0A 4OOSA 4QVAA 2ZL5A 1IHMA 3Q6QA 4QUZA 4X7CA 2OBTA 4Z4UA 4X06A 4P25A 4X7EA 4WZLA 4Z4YA 4RPBA 4X0CA 3ASTA 3SLDA 4Z4SA 4X7FA 4RPDA 4X07A 4OPOA 3SEJA 5IYQA 4OPSA 3PUMA 5IYWA 3SLNA 3ONUA 4WZKA 4P3IA 4X7DA 5F4OA 4P1VA 5E6TA 4Z4RA 2ZL7A 3RY8A 4P2NA 4Z4VA 3SKBA 5IYPA 4OOVA 4Z4ZA 5IYRA 4Z4TA 5J35A 5J3OA 4QVJA 3Q38A 3PVDA 3R6KA 5BSXA 3Q3AA 3SJPA 4OOXA 4RLZA 3Q6RA 3BY1A 5BSYA 3LQ6A 2OBRA 3R6JA 4ROXA 4P26A 3PUNA 3PA2A 3PA1A 4QV2A 4OPVA 4X05A 4P12A 5F4MA 3ASQA 3V7AA 4OP7A 3ONYA 4WZTA 4RDKA 4Z4WA 2OBSA 4RDLA 3ASSA 5KW9A 3LQEA 3D26A 4RDJA 3Q39A 4WZEA 5F4JA 3BQJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BY2 A;  5HZA A;  5IYN A;  3ASP A;  2ZL6 A;  5HZB A;  3ASR A;  4RM0 A;  4OOS A;  4QVA A;  2ZL5 A;  1IHM A;  3Q6Q A;  4QUZ A;  4X7C A;  2OBT A;  4Z4U A;  4X06 A;  4P25 A;  4X7E A;  4WZL A;  4Z4Y A;  4RPB A;  4X0C A;  3AST A;  3SLD A;  4Z4S A;  4X7F A;  4RPD A;  4X07 A;  4OPO A;  3SEJ A;  5IYQ A;  4OPS A;  3PUM A;  5IYW A;  3SLN A;  3ONU A;  4WZK A;  4P3I A;  4X7D A;  5F4O A;  4P1V A;  5E6T A;  4Z4R A;  2ZL7 A;  3RY8 A;  4P2N A;  4Z4V A;  3SKB A;  5IYP A;  4OOV A;  4Z4Z A;  5IYR A;  4Z4T A;  5J35 A;  5J3O A;  4QVJ A;  3Q38 A;  3PVD A;  3R6K A;  5BSX A;  3Q3A A;  3SJP A;  4OOX A;  4RLZ A;  3Q6R A;  3BY1 A;  5BSY A;  3LQ6 A;  2OBR A;  3R6J A;  4ROX A;  4P26 A;  3PUN A;  3PA2 A;  3PA1 A;  4QV2 A;  4OPV A;  4X05 A;  4P12 A;  5F4M A;  3ASQ A;  3V7A A;  4OP7 A;  3ONY A;  4WZT A;  4RDK A;  4Z4W A;  2OBS A;  4RDL A;  3ASS A;  5KW9 A;  3LQE A;  3D26 A;  4RDJ A;  3Q39 A;  4WZE A;  5F4J A;  3BQJ A; 
#chains in the Genus database with same CATH topology
 3AVW A;  1YX2 A;  2X0K A;  5IYN A;  4M53 A;  4P6Y A;  4M1K A;  4G1V A;  1UD2 A;  2XNJ A;  3GIR A;  3CB4 A;  3HAG A;  1E1R A;  1UD5 A;  1XB2 A;  1IHM A;  2ZIT A;  3B82 A;  2JIZ A;  3FPP A;  4X7C A;  5DS0 A;  1PJ5 A;  4Z4U A;  3LVB A;  4G7W A;  2OTL B;  2ZTG A;  1UD8 A;  4R71 A;  4FXU A;  2GJP A;  1KZL A;  5HKK A;  4X0C A;  4XLA A;  3WXM A;  4F7D A;  4RD1 A;  3W2I A;  3GQB A;  3WBK A;  4B3F X;  1FNM A;  4YAW A;  5FO1 A;  5TY0 A;  3V76 A;  4M2L A;  1JB9 A;  1G7T A;  2C2W A;  2AHO A;  4X07 A;  4X8I A;  1VQP B;  3A8K A;  3SEJ A;  3U2Q A;  3CCL B;  3ZZU A;  1N0V C;  5A88 A;  3PUM A;  3BCD A;  3QFC A;  5IYW A;  3SLN A;  3ONU A;  3CPW B;  1K8A D;  4RCZ A;  2E1B A;  4P3I A;  3AVU A;  1R5N A;  1MRZ A;  1CNE A;  4P3Y A;  1GJR A;  4BPR A;  1E63 A;  2BGI A;  1EXM A;  1BPL A;  2ZL7 A;  1NB9 A;  3CP8 A;  4P2N A;  2XND A;  3A8I A;  4UAJ A;  5IYP A;  3WYA A;  2Z6B D;  4Z4Z A;  1KK1 A;  4Z4T A;  1H8H A;  2VNK A;  3MHP A;  5BSX A;  1VHE A;  3H9N A;  4ACA A;  2V7T A;  1VQO B;  3OFN A;  1KQS B;  1WP6 A;  1RQR A;  1VQ9 B;  1R5O A;  2WZN A;  4OOX A;  4TKO B;  1QUE A;  1FX0 A;  4RLZ A;  1QVF B;  1SKY B;  3W2G A;  1EP1 B;  3I55 B;  2GJK A;  3VO1 A;  3CCV B;  1YIJ B;  4B44 A;  1OB2 A;  4Y7C A;  4ZGQ B;  1N8R D;  2JN9 A;  4XKV A;  1IJE A;  3H94 A;  4PGO A;  4YEL A;  2JDI A;  1F20 A;  3QFS A;  1I18 A;  4ROX A;  1AIP A;  3KL9 A;  4P26 A;  3G6E B;  4U9U A;  2C77 A;  4M4S A;  2BM1 A;  1W34 A;  2CRV A;  2R9V A;  2ZZF A;  4QV2 A;  3T53 B;  1XFO A;  2V7V A;  4ACB A;  2QEX B;  4NNJ A;  2X53 S;  5GV7 A;  3A1P A;  4KKS A;  1EFT A;  1BX0 A;  4X05 A;  4P12 A;  3OW7 A;  4B43 A;  3CC7 B;  1Q82 D;  2HMA A;  4YAL A;  5F4M A;  3P26 A;  4WQM A;  1D1N A;  5A89 A;  3V7A A;  1Q86 D;  3AVX A;  2YWH A;  1WPC A;  3LO8 A;  4LBW A;  4WZT A;  3KEW A;  3WY9 A;  4PC7 A;  3BC9 A;  1ZM2 A;  4RDL A;  3ASS A;  2VNI A;  5KW9 A;  2VJI A;  1W0J A;  1OGI A;  1BQE A;  3W5V A;  1A8P A;  2Q6L A;  4WZE A;  5H59 A;  4IW3 B;  5H5J A;  2HDN B;  2PMD A;  2C5B A;  4RD6 A;  1W9X A;  2PIA A;  1VLY A;  3AGP A;  5FL7 A;  3W5H A;  4DK0 A;  3E1Y E;  4RCY A;  2GPJ A;  3ZPN A;  3CTA A;  4PC2 A;  2ZL6 A;  3ASP A;  1M1K D;  5HZB A;  1QUF A;  4CQJ A;  1GVH A;  2BVN A;  1FNB A;  2CF4 A;  1Q9S A;  2X85 A;  1UMK A;  2ZL5 A;  1E62 A;  4TMV A;  1QGA A;  1HA3 A;  1BMF A;  1S4M A;  1VJS A;  3CCS B;  4C0S A;  1T6Z A;  1WDT A;  2RC6 A;  3G4S B;  2QTL A;  2P3M A;  4YEJ A;  4X06 A;  5TR9 A;  1DDG A;  4XQF A;  4FWT A;  4XNF A;  3VMF A;  3OEH A;  1ZM4 A;  3CES A;  1W87 A;  4AF7 A;  1YI2 B;  1H8E A;  2XEX A;  3BNW A;  3VO2 A;  4ZCI A;  4XR6 A;  3CCJ B;  1E43 A;  4RPD A;  1YJW B;  5A8A A;  4HIZ A;  4OPO A;  1JNY A;  1YJ9 B;  2FVG A;  5IYQ A;  4TMT A;  1QGY A;  1KK3 A;  3GVJ A;  4N3G A;  3AVY A;  1FNC A;  2F1L A;  4WZK A;  4EH1 A;  1N08 A;  5TV2 A;  1AMO A;  1QH0 A;  4HE5 A;  3I56 B;  1VQ4 B;  3ZZT A;  1Y0R A;  3OEE A;  3T56 B;  1WSR A;  2EIX A;  3CMM A;  4P1V A;  5E6T A;  3FJO A;  2R6H A;  3AGQ A;  4Z4R A;  3G71 B;  4RD4 A;  4KKT A;  3CRZ A;  1EFR A;  2W6I A;  3B78 A;  3RY8 A;  4KKU A;  1E64 A;  4P22 A;  4Z4V A;  2WSS A;  3CXC B;  4RD2 A;  1OB5 A;  1CQX A;  4PC6 A;  5J35 A;  1DDI A;  1J9Z A;  1DAR A;  2F1M A;  3Q3A A;  3A3G A;  3PEN A;  2CC2 A;  4L8J A;  1N07 A;  3SJP A;  1TLL A;  2X8K A;  4J0Q A;  1E3X A;  2D3L A;  1I8D A;  4XOP A;  2WZP P;  4TN1 A;  1EP2 B;  3T51 B;  2ZZE A;  1D2E A;  5DN6 A;  4XLH A;  2V7Q A;  4ZCL A;  3WND A;  2OBR A;  1VLO A;  1YIT B;  1XQB A;  4QHY A;  2WJY A;  3R6J A;  3G05 A;  1N06 A;  1JA1 A;  3CCE B;  4P9S A;  4GQN A;  3QFT A;  4AC9 A;  2BGJ A;  2NV4 A;  4XD7 A;  2E1R A;  4B4D A;  1UD3 A;  2V7W A;  3OPO A;  1NDH A;  1PKV A;  1WOS A;  3OP1 A;  4AF6 A;  1TVC A;  2JJ2 A;  2D9R A;  2W6J A;  1RQP A;  3WBJ A;  4OP7 A;  3ONY A;  2ZZG A;  4LBV A;  2OBS A;  1P4M A;  1G7R A;  5CDF A;  1OGJ A;  2YWG A;  1T6X A;  2VBS A;  4XON A;  3BCF A;  5JBQ A;  1GAW A;  4MYU A;  1M90 D;  1CNF A;  1ZM9 A;  3WNB A;  2C4U A;  5HZA A;  3JU4 A;  1Q7Y D;  3BH4 A;  4TSF A;  5HXB A;  1D8T A;  2DYI A;  3NE5 B;  3ASR A;  1TTT A;  3ES9 A;  1BX1 A;  4OOS A;  3A8J A;  4QVA A;  3CCQ B;  1VQ7 B;  4TMX A;  1SKQ A;  1VQL B;  2DCU A;  1IB0 A;  2BSA A;  3OE7 A;  1QFJ A;  2X6Y A;  2OYN A;  2GRE A;  2ZTN A;  2JJ1 A;  3DDY A;  1NBM A;  1QFY A;  2BF4 A;  3ZC3 A;  1NJI D;  3OAA A;  4X7E A;  4QFM A;  4Z1M A;  4WZL A;  1H42 A;  1QFZ A;  3SLD A;  3W2H A;  1B23 P;  2CND A;  2VBU A;  3CC4 B;  1FND A;  1G7S A;  4G5G A;  5L46 A;  3ISX A;  2NPF A;  2HCJ B;  1KC8 D;  4XMY A;  2I1L A;  4RJL A;  1HZE A;  2OTJ B;  4DQK A;  3MCA A;  5F4O A;  3CD6 B;  1VHO A;  4UZF A;  1YLO A;  3OJX A;  5EMN A;  3A3B A;  1N05 A;  1V0E A;  2XOK A;  4Y9R A;  2Q6K A;  4PAA A;  2D3N A;  4XM3 A;  2DOG A;  1IJF A;  1Y0Y A;  3W2E A;  1S0U A;  3CW2 A;  5KSW B;  3Q38 A;  2CBX A;  2X6X A;  4UZE A;  3W2F A;  1KRH A;  1ZM3 A;  2YWE A;  2XZL A;  2X6W A;  2ZXH A;  4XLF A;  1WSV A;  2YWF A;  4RD3 A;  1N0U A;  4B47 A;  2OK7 A;  1EP3 B;  1W0K A;  3CC2 B;  2VJJ A;  4FN5 A;  1VQK B;  2WPD A;  4TMZ A;  3MMP A;  3P27 A;  2HLD A;  3Q6R A;  1ELO A;  1KK0 A;  1KD1 D;  2B7B A;  2X3U A;  5BSY A;  1KTV A;  1W35 A;  4II3 A;  2BN4 A;  1I7P A;  3LQ6 A;  4C43 A;  1QVG B;  5FO0 A;  1Q81 D;  1U2R A;  2VBT A;  3JQP A;  3WNC A;  4ZGN B;  3CME B;  4ZCM A;  3SJZ A;  2FX3 A;  3FKS A;  1WOR A;  3PA2 A;  1HVX A;  4UZU A;  2XNC A;  1MAB A;  5IK2 A;  1EFC A;  2D74 A;  2VYQ A;  2WYR A;  3I1F A;  3ZZ0 A;  1GO2 A;  4OPV A;  2V4D A;  2LZJ A;  4TMW A;  3CCM B;  5FA6 A;  2GK7 A;  1K28 D;  4E0F A;  2Q6I A;  3CCU B;  2VZL A;  4LBZ A;  4M0L A;  4Z4W A;  2CK3 A;  1VF7 A;  4TT3 A;  4XKW A;  2XZO A;  1T5E A;  4XL9 A;  3Q39 A;  1ZUN B;  1FDR A;  3FPK A;  3OZU A;  2ZBV A;  1QX4 A;  1KMH A;  3BY2 A;  4WWV A;  3VR6 A;  3CMA B;  2F43 A;  2DY1 A;  3B8H A;  2KVO A;  1E1Q A;  3OZV A;  3OKX A;  2PE3 A;  4LC0 A;  3A35 A;  4RM0 A;  1B2R A;  4PC3 A;  3OW2 B;  4Y9U A;  3E20 A;  4YAO A;  2B7C A;  4DQL A;  3ZIA A;  1WOO A;  5THX A;  2ZZQ A;  3Q6Q A;  4QUZ A;  3VNV A;  1UD4 A;  2V7X A;  4FK8 A;  2XGJ A;  2OBT A;  1EFU A;  3QFR A;  5DSZ A;  3W5U A;  2QMU A;  4DK1 A;  3CP2 A;  3CCR B;  2QDX A;  2V7U A;  4P25 A;  1SM4 A;  1DG1 G;  4Z4Y A;  4JMQ A;  4P6V F;  4MYT A;  4RPB A;  3AST A;  4YAF A;  4Z4S A;  3AVT A;  1BLI A;  4N3N A;  3VNU A;  1GAQ A;  4ZV4 A;  5AN9 A;  4X7F A;  4XLC A;  4H9G A;  1E79 A;  2F4N A;  2Q6O A;  3JQR A;  2QGG A;  4K1X A;  3GVL A;  1V5V A;  1GR1 A;  4OPS A;  1FRN A;  1PJ6 A;  2WJV A;  2XZP A;  4YAU A;  1V0F A;  1TUI A;  2BM0 A;  3ZBT A;  2VNJ A;  2EFG A;  2GJR A;  2PLF A;  1OHH A;  3GVK A;  5TRD A;  1PJ7 A;  1OB0 A;  4X7D A;  2VNH A;  4XN3 A;  2DEU A;  1W2B B;  4ASU A;  4G6I A;  3WQZ A;  4XN0 A;  1UD6 A;  2QE7 A;  3SKB A;  4OOV A;  5IYR A;  1K9M D;  1VQ6 B;  1K73 D;  5J3O A;  4QVJ A;  1BJK A;  1KK2 A;  4G7X A;  3PVD A;  1VQM B;  3R6K A;  4XLE A;  4HE6 A;  1NRK A;  1G7C A;  3OZW A;  4NCN A;  5FNZ A;  2GQF A;  1VQ8 B;  2QN6 A;  3J81 k;  2BV3 A;  1WU8 A;  4YXW A;  3CPX A;  1T6Y A;  2GK6 A;  3BY1 A;  4Q7J B;  3JQQ A;  1VQ5 B;  4B3X A;  3QSY A;  1YJN B;  2QTZ A;  3ZBU A;  1EWY A;  1R5B A;  2C4T A;  1KJZ A;  4PAB A;  4XOT A;  4XOR A;  2CW5 A;  2WR8 A;  4II2 A;  4YHB A;  5FIU A;  3AVV A;  2J7K A;  5B6I A;  2RC5 A;  4B3G A;  3PUN A;  4DNT B;  3PA1 A;  4NBS A;  1FRQ A;  3LNN A;  1VQN B;  1JJ2 B;  2BPO A;  4AVZ A;  2OK8 A;  1QGZ A;  2ZBU A;  1JA0 A;  2VBV A;  1NB0 A;  2BMW A;  1F60 A;  2DIE A;  2M5S A;  3OJW A;  4G1B A;  4DNR B;  5LMZ A;  3U6B A;  2C5H A;  1WTH D;  4RD0 A;  3U6K A;  1S72 B;  3ASQ A;  4B48 A;  1COW A;  1E3Z A;  3ZUG A;  2DER A;  4RDK A;  5KNL A;  2QA4 B;  3QE2 A;  4PC1 A;  1QG0 A;  2C78 A;  3LQE A;  3D26 A;  1H85 A;  4RDJ A;  3GSI A;  2B5O A;  2ZXI A;  3OOC A;  4LBY A;  3BQJ A;  2V31 A;  5F4J A;  5GV8 A;  1YHQ B;  1WOP A;  2DET A;  1XE1 A; 
#chains in the Genus database with same CATH homology
 3BY2 A;  5HZA A;  5IYN A;  3ASP A;  2ZL6 A;  5HZB A;  3ASR A;  4RM0 A;  4OOS A;  4QVA A;  2ZL5 A;  1IHM A;  3Q6Q A;  4QUZ A;  4X7C A;  2OBT A;  4Z4U A;  4X06 A;  4P25 A;  4X7E A;  4WZL A;  4Z4Y A;  4RPB A;  4X0C A;  3AST A;  3SLD A;  4Z4S A;  4X7F A;  4RPD A;  4X07 A;  4OPO A;  3SEJ A;  5IYQ A;  4OPS A;  3PUM A;  5IYW A;  3SLN A;  3ONU A;  4WZK A;  4P3I A;  4X7D A;  5F4O A;  4P1V A;  5E6T A;  4Z4R A;  2ZL7 A;  3RY8 A;  4P2N A;  4Z4V A;  3SKB A;  5IYP A;  4OOV A;  4Z4Z A;  5IYR A;  4Z4T A;  5J35 A;  5J3O A;  4QVJ A;  3Q38 A;  3PVD A;  3R6K A;  5BSX A;  3Q3A A;  3SJP A;  4OOX A;  4RLZ A;  3Q6R A;  3BY1 A;  5BSY A;  3LQ6 A;  2OBR A;  3R6J A;  4ROX A;  4P26 A;  3PUN A;  3PA2 A;  3PA1 A;  4QV2 A;  4OPV A;  4X05 A;  4P12 A;  5F4M A;  3ASQ A;  3V7A A;  4OP7 A;  3ONY A;  4WZT A;  4RDK A;  4Z4W A;  2OBS A;  4RDL A;  3ASS A;  5KW9 A;  3LQE A;  3D26 A;  4RDJ A;  3Q39 A;  4WZE A;  5F4J A;  3BQJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...