3E20A

Crystal structure of s.pombe erf1/erf3 complex
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
196
structure length
196
Chain Sequence
b'APFIMPIASKYKDLGTILEGKIEAGSIKKNSNVLVMPINQTLEVTAIYDEADEEISSSICGDQVRLRVRGDDSDVQTGYVLTSTKNPVHATTRFIAQIAILELPSILTTGYSCVMHIHTAVEEVSFAKLLHKLDKTNRKSKKPPMFATKGMKIIAELETQTPVCMERFEDYQYMGRFTLRDQGTTVAVGKVVKILD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Eukaryotic peptide chain release factor GTP-binding subunit
publication title Structural insights into eRF3 and stop codon recognition by eRF1
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Translation
total genus 32
structure length 196
sequence length 196
chains with identical sequence D, E, J
ec nomenclature
pdb deposition date 2008-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03143 GTP_EFTU_D3 Elongation factor Tu C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 3e20A02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 3e20A01
5H5JA 3CC4B 4K1XA 1Q82D 4B48A 4YAUA 3W2FA 1VQKB 3LO8A 2QEXB 3WBJA 4TMXA 2VYQA 2VNJA 1NJID 1ELOA 5FA6A 1JB9A 3W2HA 1S72B 4EH1A 2R6HA 3WY9A 1EFTA 1CQXA 5HXBA 3OZUA 1YJWB 1BJKA 1FNDA 3AVTA 4M4SA 5EMNA 3E1YE 4WQMA 4TN1A 4MYTA 4TMTA 1YJ9B 2XEXA 2QDXA 4Y9RA 1UMKA 4NBSA 1B23P 2VZLA 2GPJA 5THXA 1QGAA 4ZCLA 2BMWA 3MCAA 1TLLA 2QMUA 2BVNA 4ZCMA 3CCEB 1EP1B 2YWFA 1JNYA 4H9GA 2XNJA 3W5UA 3QFSA 1H85A 1DDGA 3CPWB 4G1BA 2VNKA 2QA4B 1YHQB 3WXMA 4ZCIA 1VQ5B 1FRQA 1TTTA 1KK2A 4M0LA 1QFZA 1KC8D 1CNFA 1YI2B 3VO2A 2BM1A 2HDNB 3B8HA 1W87A 1SM4A 4DQKA 3VMFA 1GAWA 3AGPA 1IB0A 4YHBA 1VQPB 3B82A 3P26A 1OB2A 3E20A 3OZVA 1GJRA 1XB2A 2XNCA 2RC6A 3MHPA 2OTLB 3OJWA 4QFMA 3CCRB 4LBWA 1VQ7B 1DDIA 1EP2B 1E62A 1FDRA 2QTLA 4RD0A 1F60A 3AGQA 3JQPA 4M1KA 3CCJB 1EWYA 3QE2A 4B3XA 2B7BA 2BGIA 2BSAA 1DARA 4ZGQB 4G5GA 1BQEA 1ZM3A 2B5OA 1QVFB 3FJOA 3I56B 2YWGA 1VQLB 4F7DA 1M1KD 1D2EA 4YAOA 2NPFA 3WBKA 3CD6B 4B44A 4N3NA 5JBQA 3AVXA 1YIJB 4LC0A 3ZBUA 1QVGB 1QH0A 2C78A 1VQNB 2J7KA 3ZZ0A 4AF6A 3CCUB 3V76A 1GAQA 4P6VF 1JA1A 1KK0A 2EIXA 1QG0A 3WNBA 1D1NA 1S0UA 3ZZTA 1K8AD 4PC3A 4HE5A 3CCSB 1KK1A 4RD1A 2DCUA 2DY1A 2QN6A 1E63A 1GO2A 2PIAA 5KSWB 4TMZA 3QSYA 3B78A 2DEUA 4LBYA 4LBVA 3OW2B 4YAFA 3MMPA 3J81k 1ZM9A 3LVBA 4YAWA 3CCVB 2CNDA 3OJXA 4C0SA 3ZZUA 4FK8A 1G7RA 4QHYA 3G4SB 3OZWA 1VQOB 1JA0A 3W2EA 4U9UA 4RCZA 1VQ8B 4M53A 4P3YA 4AC9A 3U6BA 1NDHA 1QFYA 2PMDA 4FWTA 1YITB 1FNCA 4FN5A 1BX1A 1M90D 4RD4A 1ZM4A 3W2IA 1B2RA 3W5HA 4R71A 1KTVA 3QFCA 3W5VA 1F20A 4HE6A 3AVWA 4NCNA 1EFUA 3CC7B 1G7TA 5GV7A 4Y7CA 1AIPA 1W34A 2BV3A 4ACBA 1EXMA 3CC2B 2C77A 3CMEB 3CMAB 4BPRA 3ZC3A 3W2GA 3JQRA 1VQMB 3CB4A 4G1VA 2DERA 2BPOA 1Q86D 1FNBA 4AF7A 3JQQA 1KJZA 1SKQA 2X3UA 1QX4A 5TR9A 1OGIA 3QFTA 4Y9UA 1N0UA 1H42A 1J9ZA 4B47A 2YWHA 1JJ2B 4LBZA 1W2BB 1BX0A 3VO1A 2GQFA 3CCLB 4YALA 2BGJA 3CCMB 1FNMA 2OK7A 3AVVA 2BM0A 3CXCB 1XE1A 4B43A 2VNHA 2EFGA 1EFCA 1R5BA 1TUIA 3PENA 1E64A 4RCYA 2OK8A 4ZV4A 3WNDA 4PC2A 1KD1D 1D8TA 1WDTA 2HMAA 1G7CA 2BN4A 3ES9A 4PGOA 1K9MD 3G6EB 1QUFA 3AVUA 5H59A 4PC6A 4PC7A 4TMWA 4ZGNB 1N8RD 2QTZA 2CRVA 5TV2A 2D74A 1G7SA 3AVYA 1K73D 4TMVA 3VNUA 2ZITA 1YJNB 1U2RA 4RD3A 4J0QA 1QGYA 3WYAA 2PLFA 1FRNA 4N3GA 3I1FA 1N0VC 3QFRA 1VQ9B 1IJEA 1EP3B 3SJZA 2B7CA 4C43A 4ACAA 1GVHA 1W35A 1OGJA 1QGZA 1DG1G 3CW2A 2DETA 4Q7JB 1CNEA 5TY0A 2FX3A 3U6KA 5AN9A 3ZBTA 1ZM2A 4B4DA 1OB5A 3CRZA 1QUEA 1I7PA 1R5OA 2VNIA 1R5NA 3CCQB 3P27A 2E1RA 1Q81D 2RC5A 4PC1A 1KQSB 3I55B 4RJLA 4DQLA 2YWEA 3G71B 3FPKA 3VNVA 3WNCA 4M2LA 1GR1A 1ZUNB 1KRHA 1TVCA 1VQ4B 4UAJA 4RD6A 2HCJB 2BF4A 5GV8A 1VQ6B 4IW3B 4RD2A 1AMOA 2OTJB 1IJFA 1KK3A 2AHOA 1Q7YD 1A8PA 1HA3A 1QFJA 4MYUA 5DSZA 3U2QA
chains in the Genus database with same CATH superfamily
5H5JA 3CC4B 4K1XA 3Q6RA 1Q82D 1H8HA 2V7XA 4B48A 4YAUA 3W2FA 1VQKB 1OB0A 3LO8A 1V0EA 4X07A 4XNFA 2QEXB 3WBJA 4TMXA 4XM3A 3R6KA 2VYQA 4XONA 5E6TA 2VNJA 1NJID 1ELOA 5DS0A 5FA6A 2GK6A 1JB9A 1UD3A 3W2HA 1S72B 4EH1A 2R6HA 3WY9A 1H8EA 1EFTA 1RQPA 2F1MA 2ZXIA 3H9NA 3D26A 1CQXA 5HXBA 4WZLA 3OE7A 1BPLA 3OZUA 1YJWB 1T6YA 2JN9A 1VF7A 1HVXA 1BJKA 1FNDA 2W6JA 5IYNA 3AVTA 3ZUGA 4M4SA 5J35A 2ZBUA 5EMNA 4PAAA 1E43A 2VBVA 3FKSA 1KZLA 3E1YE 3RY8A 4WQMA 4TN1A 4MYTA 4TMTA 1YJ9B 5F4MA 2XEXA 2QDXA 4Y9RA 1T6XA 1UMKA 2ZL5A 4NBSA 4P6YA 1B23P 3ZPNA 2VZLA 2GPJA 2VBTA 5THXA 5BSXA 1QGAA 4XOTA 4ZCLA 2BMWA 1E1RA 3MCAA 1TLLA 2WPDA 2QMUA 5HZAA 5HZBA 2BVNA 3LNNA 4XKVA 4ZCMA 3GQBA 3CCEB 5F4JA 3BY1A 1EP1B 2YWFA 5BSYA 1JNYA 4OP7A 1E79A 3GVLA 4H9GA 4RLZA 4XLHA 2XNJA 5F4OA 3W5UA 3QFSA 5LMZA 1H85A 2WJYA 3OKXA 2M5SA 1DDGA 3CPWB 3A1PA 3BH4A 2VNKA 4G1BA 3BCFA 3Q6QA 2QA4B 1YHQB 4UZEA 5J3OA 3PA2A 3WXMA 4Z4WA 2D3NA 4ZCIA 1I18A 1VQ5B 1FRQA 3GVJA 1TTTA 2WSSA 3CP8A 4G7XA 3T53B 4TKOB 1KK2A 4M0LA 1QFZA 1YLOA 3VR6A 1KC8D 3T56B 2V7UA 1CNFA 1YI2B 2GJKA 3GIRA 2OYNA 3CESA 3VO2A 1SKYB 5L46A 2BM1A 2HDNB 3B8HA 1W87A 1SM4A 2ZZQA 3SJPA 4DQKA 3VMFA 5FIUA 5CDFA 1FX0A 4QVAA 1GAWA 4XMYA 3LQEA 2X6YA 4X7DA 4WZTA 3ONUA 3AGPA 2XZLA 1IB0A 1UD2A 4YHBA 1VQPB 3B82A 3P26A 4P2NA 1OB2A 3E20A 3OZVA 1GJRA 1XB2A 3G05A 2XNCA 2RC6A 4RDKA 3MHPA 2OTLB 3CPXA 1Y0RA 3OJWA 4QFMA 3CCRB 2V7TA 4LBWA 1VQ7B 1PJ7A 1WOOA 2C5BA 2X6WA 2WJVA 1WORA 4YELA 2XZOA 1DDIA 1EP2B 1BMFA 1N05A 3SLNA 1E62A 2XOKA 1UD8A 4DK0A 2C5HA 1FDRA 4RDLA 4TSFA 2VJIA 1OHHA 2QE7A 1WSVA 2QTLA 4RD0A 1F60A 2ZZGA 3AGQA 3JQPA 1VLOA 4M1KA 3CCJB 4E0FA 1EWYA 3QE2A 3SEJA 4B3XA 2B7BA 2BGIA 1XFOA 1UD5A 2BSAA 3GSIA 4XQFA 1DARA 2CK3A 4CQJA 3KL9A 4ZGQB 4G5GA 1BQEA 4II2A 1K28D 2GJPA 4WWVA 3ASSA 4QV2A 1ZM3A 2B5OA 1QVFB 5FL7A 3FJOA 3I56B 2X8KA 2YWGA 3PUMA 1VQLB 1T5EA 2ZBVA 2QGGA 2GREA 4X06A 5IK2A 4F7DA 1M1KD 1D2EA 4YAOA 3PA1A 2NPFA 4DK1A 1KQSB 3WBKA 3CD6B 1KMHA 4B44A 4N3NA 5JBQA 3AVXA 1YIJB 4LC0A 3Q38A 2DIEA 5HKKA 3ZBUA 5IYQA 4YXWA 1QVGB 2OBRA 4X7EA 1QH0A 2C78A 1VQNB 2J7KA 3ZZ0A 4AF6A 3CCUB 3V76A 4JMQA 3H94A 4XORA 1GAQA 4P6VF 1JA1A 1KK0A 2EIXA 4XR6A 1QG0A 3WNBA 3A35A 1PJ6A 1S0UA 1D1NA 1WP6A 2F43A 3ZZTA 2ZL6A 1K8AD 5A89A 4P26A 4XLAA 3Q39A 4PC3A 4HE5A 3CCSB 1COWA 3JU4A 1KK1A 4RD1A 4L8JA 4DNTB 4Z4UA 1WPCA 2DCUA 2C4UA 2Q6OA 1VHEA 1NRKA 3CMMA 4NNJA 2DY1A 2QN6A 1E63A 2ZTGA 4XLFA 1GO2A 2OBSA 2PIAA 5KSWB 4OPOA 2ZL7A 5FO1A 1N06A 4TMZA 4RPDA 2Q6KA 4KKUA 4Z4SA 3QSYA 3B78A 2DEUA 4LBYA 4LBVA 2CBXA 4YAFA 3OW2B 3MMPA 2F4NA 3J81k 1ZM9A 1N08A 3LVBA 4DNRB 4YAWA 4P25A 2NV4A 3CCVB 2LZJA 2CNDA 1T6ZA 3OJXA 1BLIA 3ZZUA 4C0SA 4FK8A 2Q6IA 1G7RA 4QHYA 3G4SB 3OZWA 4RPBA 4Z4YA 3OP1A 2FVGA 1VQOB 2R9VA 3A8KA 1JA0A 3W2EA 4U9UA 4RCZA 2ZTNA 1VQ8B 4RDJA 1WU8A 1W0KA 4X7CA 4M53A 4P3YA 4AC9A 3U6BA 1NDHA 1QFYA 2PMDA 3NE5B 4FWTA 1YITB 3A3BA 1FNCA 2V31A 4P1VA 4FN5A 1BX1A 4WZEA 3SLDA 3ASPA 1V0FA 1M90D 4RD4A 4Z4VA 1ZM4A 3W2IA 1B2RA 3W5HA 4R71A 1KTVA 1WOPA 3QFCA 3W5VA 4ROXA 1F20A 4HE6A 4AVZA 3AVWA 1S4MA 4NCNA 1EFUA 3CC7B 2V4DA 1G7TA 4P22A 5GV7A 4OOXA 4Y7CA 1AIPA 1W34A 5A88A 2BV3A 1WOSA 4ACBA 1EXMA 1NB9A 3CC2B 2Q6LA 5IYWA 2C77A 2WYRA 3CMEB 5DN6A 1E1QA 1VLYA 3R6JA 2XGJA 3CMAB 4BPRA 4X7FA 4G6IA 3ZC3A 1WTHD 3W2GA 1Q9SA 3OOCA 2WR8A 3JQRA 1VQMB 3CB4A 4G1VA 2DERA 2BPOA 2JJ2A 4OOSA 2P3MA 2KVOA 4GQNA 1Q86D 1YX2A 1FNBA 4AF7A 3JQQA 1KJZA 4KKSA 1HZEA 4OPSA 1SKQA 2D9RA 2V7QA 2X3UA 1QX4A 2ZXHA 4PABA 5TR9A 1OGIA 3QFTA 3V7AA 3BC9A 1PJ5A 4Y9UA 1N0UA 1H42A 1J9ZA 2VBSA 4B47A 2YWHA 1JJ2B 3Q3AA 2X85A 3SKBA 4LBZA 1XQBA 1W2BB 5KNLA 1BX0A 2CW5A 3VO1A 2CF4A 2GQFA 4XD7A 1EFRA 1P4MA 4YALA 3CCLB 4HIZA 3GVKA 2BGJA 3BY2A 3CCMB 1FNMA 2OK7A 5FNZA 3AVVA 1N07A 2BM0A 3CXCB 1XE1A 4B43A 5FO0A 2VNHA 3DDYA 2EFGA 4P9SA 2CC2A 1EFCA 1R5BA 2ZZFA 1TUIA 2X53S 2DOGA 2X6XA 3PENA 4II3A 4XOPA 1E64A 4RCYA 2WZNA 2OK8A 1MRZA 4ZV4A 3BNWA 4PC2A 3OW7A 3WNDA 1KD1D 1D8TA 5A8AA 1WDTA 3OPOA 2HMAA 3CTAA 1G7CA 2C4TA 4OOVA 2BN4A 3ES9A 4G7WA 4PGOA 2GJRA 3WQZA 1K9MD 3LQ6A 1NBMA 1MABA 4YEJA 3G6EB 4XLEA 1QUFA 2ZZEA 3KEWA 2WZPP 3AVUA 2GK7A 4UZUA 5H59A 2E1BA 4QUZA 4Z4RA 3OEEA 4PC6A 4PC7A 1IHMA 3ISXA 4TMWA 5TRDA 3ZIAA 4ZGNB 1N8RD 4RM0A 2W6IA 2QTZA 1E3XA 4XN0A 5IYRA 2VJJA 2CRVA 5TV2A 2D74A 1G7SA 1VJSA 3AVYA 1K73D 4TMVA 4X0CA 3VNUA 1W9XA 2D3LA 2ZITA 4XLCA 2V7VA 2XZPA 1YJNB 1U2RA 4OPVA 3ONYA 4P12A 4RD3A 4J0QA 3CP2A 1QGYA 3WYAA 1V5VA 1Y0YA 2PLFA 1FRNA 3PVDA 4N3GA 2HLDA 3I1FA 1N0VC 3QFRA 1VQ9B 1IJEA 1WSRA 1EP3B 2OBTA 3ASQA 3SJZA 1PKVA 4KKTA 3FPPA 2B7CA 4C43A 4ACAA 1GVHA 1W35A 4FXUA 4X05A 5B6IA 5KW9A 1OGJA 3OFNA 2X0KA 4P3IA 4QVJA 1QGZA 1DG1G 4XL9A 3HAGA 2JJ1A 3CW2A 2DETA 1VHOA 4Q7JB 2JIZA 1CNEA 5TY0A 2FX3A 4Z4ZA 3U6KA 1I8DA 3T51B 5AN9A 3ZBTA 2PE3A 1ZM2A 2I1LA 1W0JA 4B4DA 4Z4TA 1OB5A 3CRZA 2JDIA 1QUEA 1I7PA 1R5OA 2VNIA 1R5NA 3BCDA 4TT3A 3P27A 3CCQB 2E1RA 4XKWA 4Z1MA 4WZKA 1Q81D 2RC5A 4PC1A 2XNDA 1RQRA 4B3FX 4RJLA 4DQLA 3I55B 1UD6A 2DYIA 2F1LA 2YWEA 1UD4A 3BQJA 3OAAA 3PUNA 3G71B 3FPKA 1NB0A 3VNVA 3WNCA 3A3GA 4M2LA 1GR1A 1ZUNB 1KRHA 3OEHA 3ASTA 3A8JA 1TVCA 1VQ4B 4UAJA 4RD6A 3A8IA 2HCJB 2BF4A 3ASRA 5GV8A 4IW3B 4ASUA 2C2WA 1VQ6B 4XN3A 2Z6BD 4RD2A 4B3GA 1AMOA 2OTJB 1IJFA 1KK3A 2V7WA 2AHOA 1E3ZA 2VBUA 5IYPA 1Q7YD 4X8IA 1A8PA 1HA3A 1QFJA 4MYUA 4UZFA 5DSZA 3U2QA
chains in the Genus database with same CATH topology
5H5JA 3CC4B 4K1XA 1Q82D 4B48A 4YAUA 3W2FA 1VQKB 3LO8A 2QEXB 3WBJA 4TMXA 2VYQA 2VNJA 1NJID 1ELOA 5FA6A 1JB9A 3W2HA 1S72B 4EH1A 2R6HA 3WY9A 1EFTA 1CQXA 5HXBA 3OZUA 1YJWB 1BJKA 1FNDA 3AVTA 4M4SA 5EMNA 3E1YE 4WQMA 4TN1A 4MYTA 4TMTA 1YJ9B 2XEXA 2QDXA 4Y9RA 1UMKA 4NBSA 1B23P 2VZLA 2GPJA 5THXA 1QGAA 4ZCLA 2BMWA 3MCAA 1TLLA 2QMUA 2BVNA 4ZCMA 3CCEB 1EP1B 2YWFA 1JNYA 4H9GA 2XNJA 3W5UA 3QFSA 1H85A 1DDGA 3CPWB 4G1BA 2VNKA 2QA4B 1YHQB 3WXMA 4ZCIA 1VQ5B 1FRQA 1TTTA 1KK2A 4M0LA 1QFZA 1KC8D 1CNFA 1YI2B 3VO2A 2BM1A 2HDNB 3B8HA 1W87A 1SM4A 4DQKA 3VMFA 1GAWA 3AGPA 1IB0A 4YHBA 1VQPB 3B82A 3P26A 1OB2A 3E20A 3OZVA 1GJRA 1XB2A 2XNCA 2RC6A 3MHPA 2OTLB 3OJWA 4QFMA 3CCRB 4LBWA 1VQ7B 1DDIA 1EP2B 1E62A 1FDRA 2QTLA 4RD0A 1F60A 3AGQA 3JQPA 4M1KA 3CCJB 1EWYA 3QE2A 4B3XA 2B7BA 2BGIA 2BSAA 1DARA 4ZGQB 4G5GA 1BQEA 1ZM3A 2B5OA 1QVFB 3FJOA 3I56B 2YWGA 1VQLB 4F7DA 1M1KD 1D2EA 4YAOA 2NPFA 3WBKA 3CD6B 4B44A 4N3NA 5JBQA 3AVXA 1YIJB 4LC0A 3ZBUA 1QVGB 1QH0A 2C78A 1VQNB 2J7KA 3ZZ0A 4AF6A 3CCUB 3V76A 1GAQA 4P6VF 1JA1A 1KK0A 2EIXA 1QG0A 3WNBA 1D1NA 1S0UA 3ZZTA 1K8AD 4PC3A 4HE5A 3CCSB 1KK1A 4RD1A 2DCUA 2DY1A 2QN6A 1E63A 1GO2A 2PIAA 5KSWB 4TMZA 3QSYA 3B78A 2DEUA 4LBYA 4LBVA 3OW2B 4YAFA 3MMPA 3J81k 1ZM9A 3LVBA 4YAWA 3CCVB 2CNDA 3OJXA 4C0SA 3ZZUA 4FK8A 1G7RA 4QHYA 3G4SB 3OZWA 1VQOB 1JA0A 3W2EA 4U9UA 4RCZA 1VQ8B 4M53A 4P3YA 4AC9A 3U6BA 1NDHA 1QFYA 2PMDA 4FWTA 1YITB 1FNCA 4FN5A 1BX1A 1M90D 4RD4A 1ZM4A 3W2IA 1B2RA 3W5HA 4R71A 1KTVA 3QFCA 3W5VA 1F20A 4HE6A 3AVWA 4NCNA 1EFUA 3CC7B 1G7TA 5GV7A 4Y7CA 1AIPA 1W34A 2BV3A 4ACBA 1EXMA 3CC2B 2C77A 3CMEB 3CMAB 4BPRA 3ZC3A 3W2GA 3JQRA 1VQMB 3CB4A 4G1VA 2DERA 2BPOA 1Q86D 1FNBA 4AF7A 3JQQA 1KJZA 1SKQA 2X3UA 1QX4A 5TR9A 1OGIA 3QFTA 4Y9UA 1N0UA 1H42A 1J9ZA 4B47A 2YWHA 1JJ2B 4LBZA 1W2BB 1BX0A 3VO1A 2GQFA 3CCLB 4YALA 2BGJA 3CCMB 1FNMA 2OK7A 3AVVA 2BM0A 3CXCB 1XE1A 4B43A 2VNHA 2EFGA 1EFCA 1R5BA 1TUIA 3PENA 1E64A 4RCYA 2OK8A 4ZV4A 3WNDA 4PC2A 1KD1D 1D8TA 1WDTA 2HMAA 1G7CA 2BN4A 3ES9A 4PGOA 1K9MD 3G6EB 1QUFA 3AVUA 5H59A 4PC6A 4PC7A 4TMWA 4ZGNB 1N8RD 2QTZA 2CRVA 5TV2A 2D74A 1G7SA 3AVYA 1K73D 4TMVA 3VNUA 2ZITA 1YJNB 1U2RA 4RD3A 4J0QA 1QGYA 3WYAA 2PLFA 1FRNA 4N3GA 3I1FA 1N0VC 3QFRA 1VQ9B 1IJEA 1EP3B 3SJZA 2B7CA 4C43A 4ACAA 1GVHA 1W35A 1OGJA 1QGZA 1DG1G 3CW2A 2DETA 4Q7JB 1CNEA 5TY0A 2FX3A 3U6KA 5AN9A 3ZBTA 1ZM2A 4B4DA 1OB5A 3CRZA 1QUEA 1I7PA 1R5OA 2VNIA 1R5NA 3CCQB 3P27A 2E1RA 1Q81D 2RC5A 4PC1A 1KQSB 3I55B 4RJLA 4DQLA 2YWEA 3G71B 3FPKA 3VNVA 3WNCA 4M2LA 1GR1A 1ZUNB 1KRHA 1TVCA 1VQ4B 4UAJA 4RD6A 2HCJB 2BF4A 5GV8A 1VQ6B 4IW3B 4RD2A 1AMOA 2OTJB 1IJFA 1KK3A 2AHOA 1Q7YD 1A8PA 1HA3A 1QFJA 4MYUA 5DSZA 3U2QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5H5J A;  3CC4 B;  4K1X A;  1Q82 D;  4B48 A;  4YAU A;  3W2F A;  1VQK B;  3LO8 A;  2QEX B;  3WBJ A;  4TMX A;  2VYQ A;  2VNJ A;  1NJI D;  1ELO A;  5FA6 A;  1JB9 A;  3W2H A;  1S72 B;  4EH1 A;  2R6H A;  3WY9 A;  1EFT A;  1CQX A;  5HXB A;  3OZU A;  1YJW B;  1BJK A;  1FND A;  3AVT A;  4M4S A;  5EMN A;  3E1Y E;  4WQM A;  4TN1 A;  4MYT A;  4TMT A;  1YJ9 B;  2XEX A;  2QDX A;  4Y9R A;  1UMK A;  4NBS A;  1B23 P;  2VZL A;  2GPJ A;  5THX A;  1QGA A;  4ZCL A;  2BMW A;  3MCA A;  1TLL A;  2QMU A;  2BVN A;  4ZCM A;  3CCE B;  1EP1 B;  2YWF A;  1JNY A;  4H9G A;  2XNJ A;  3W5U A;  3QFS A;  1H85 A;  1DDG A;  3CPW B;  4G1B A;  2VNK A;  2QA4 B;  1YHQ B;  3WXM A;  4ZCI A;  1VQ5 B;  1FRQ A;  1TTT A;  1KK2 A;  4M0L A;  1QFZ A;  1KC8 D;  1CNF A;  1YI2 B;  3VO2 A;  2BM1 A;  2HDN B;  3B8H A;  1W87 A;  1SM4 A;  4DQK A;  3VMF A;  1GAW A;  3AGP A;  1IB0 A;  4YHB A;  1VQP B;  3B82 A;  3P26 A;  1OB2 A;  3E20 A;  3OZV A;  1GJR A;  1XB2 A;  2XNC A;  2RC6 A;  3MHP A;  2OTL B;  3OJW A;  4QFM A;  3CCR B;  4LBW A;  1VQ7 B;  1DDI A;  1EP2 B;  1E62 A;  1FDR A;  2QTL A;  4RD0 A;  1F60 A;  3AGQ A;  3JQP A;  4M1K A;  3CCJ B;  1EWY A;  3QE2 A;  4B3X A;  2B7B A;  2BGI A;  2BSA A;  1DAR A;  4ZGQ B;  4G5G A;  1BQE A;  1ZM3 A;  2B5O A;  1QVF B;  3FJO A;  3I56 B;  2YWG A;  1VQL B;  4F7D A;  1M1K D;  1D2E A;  4YAO A;  2NPF A;  3WBK A;  3CD6 B;  4B44 A;  4N3N A;  5JBQ A;  3AVX A;  1YIJ B;  4LC0 A;  3ZBU A;  1QVG B;  1QH0 A;  2C78 A;  1VQN B;  2J7K A;  3ZZ0 A;  4AF6 A;  3CCU B;  3V76 A;  1GAQ A;  4P6V F;  1JA1 A;  1KK0 A;  2EIX A;  1QG0 A;  3WNB A;  1D1N A;  1S0U A;  3ZZT A;  1K8A D;  4PC3 A;  4HE5 A;  3CCS B;  1KK1 A;  4RD1 A;  2DCU A;  2DY1 A;  2QN6 A;  1E63 A;  1GO2 A;  2PIA A;  5KSW B;  4TMZ A;  3QSY A;  3B78 A;  2DEU A;  4LBY A;  4LBV A;  3OW2 B;  4YAF A;  3MMP A;  3J81 k;  1ZM9 A;  3LVB A;  4YAW A;  3CCV B;  2CND A;  3OJX A;  4C0S A;  3ZZU A;  4FK8 A;  1G7R A;  4QHY A;  3G4S B;  3OZW A;  1VQO B;  1JA0 A;  3W2E A;  4U9U A;  4RCZ A;  1VQ8 B;  4M53 A;  4P3Y A;  4AC9 A;  3U6B A;  1NDH A;  1QFY A;  2PMD A;  4FWT A;  1YIT B;  1FNC A;  4FN5 A;  1BX1 A;  1M90 D;  4RD4 A;  1ZM4 A;  3W2I A;  1B2R A;  3W5H A;  4R71 A;  1KTV A;  3QFC A;  3W5V A;  1F20 A;  4HE6 A;  3AVW A;  4NCN A;  1EFU A;  3CC7 B;  1G7T A;  5GV7 A;  4Y7C A;  1AIP A;  1W34 A;  2BV3 A;  4ACB A;  1EXM A;  3CC2 B;  2C77 A;  3CME B;  3CMA B;  4BPR A;  3ZC3 A;  3W2G A;  3JQR A;  1VQM B;  3CB4 A;  4G1V A;  2DER A;  2BPO A;  1Q86 D;  1FNB A;  4AF7 A;  3JQQ A;  1KJZ A;  1SKQ A;  2X3U A;  1QX4 A;  5TR9 A;  1OGI A;  3QFT A;  4Y9U A;  1N0U A;  1H42 A;  1J9Z A;  4B47 A;  2YWH A;  1JJ2 B;  4LBZ A;  1W2B B;  1BX0 A;  3VO1 A;  2GQF A;  3CCL B;  4YAL A;  2BGJ A;  3CCM B;  1FNM A;  2OK7 A;  3AVV A;  2BM0 A;  3CXC B;  1XE1 A;  4B43 A;  2VNH A;  2EFG A;  1EFC A;  1R5B A;  1TUI A;  3PEN A;  1E64 A;  4RCY A;  2OK8 A;  4ZV4 A;  3WND A;  4PC2 A;  1KD1 D;  1D8T A;  1WDT A;  2HMA A;  1G7C A;  2BN4 A;  3ES9 A;  4PGO A;  1K9M D;  3G6E B;  1QUF A;  3AVU A;  5H59 A;  4PC6 A;  4PC7 A;  4TMW A;  4ZGN B;  1N8R D;  2QTZ A;  2CRV A;  5TV2 A;  2D74 A;  1G7S A;  3AVY A;  1K73 D;  4TMV A;  3VNU A;  2ZIT A;  1YJN B;  1U2R A;  4RD3 A;  4J0Q A;  1QGY A;  3WYA A;  2PLF A;  1FRN A;  4N3G A;  3I1F A;  1N0V C;  3QFR A;  1VQ9 B;  1IJE A;  1EP3 B;  3SJZ A;  2B7C A;  4C43 A;  4ACA A;  1GVH A;  1W35 A;  1OGJ A;  1QGZ A;  1DG1 G;  3CW2 A;  2DET A;  4Q7J B;  1CNE A;  5TY0 A;  2FX3 A;  3U6K A;  5AN9 A;  3ZBT A;  1ZM2 A;  4B4D A;  1OB5 A;  3CRZ A;  1QUE A;  1I7P A;  1R5O A;  2VNI A;  1R5N A;  3CCQ B;  3P27 A;  2E1R A;  1Q81 D;  2RC5 A;  4PC1 A;  1KQS B;  3I55 B;  4RJL A;  4DQL A;  2YWE A;  3G71 B;  3FPK A;  3VNV A;  3WNC A;  4M2L A;  1GR1 A;  1ZUN B;  1KRH A;  1TVC A;  1VQ4 B;  4UAJ A;  4RD6 A;  2HCJ B;  2BF4 A;  5GV8 A;  1VQ6 B;  4IW3 B;  4RD2 A;  1AMO A;  2OTJ B;  1IJF A;  1KK3 A;  2AHO A;  1Q7Y D;  1A8P A;  1HA3 A;  1QFJ A;  4MYU A;  5DSZ A;  3U2Q A; 
#chains in the Genus database with same CATH topology
 5H5J A;  3CC4 B;  4K1X A;  3Q6R A;  1Q82 D;  1H8H A;  2V7X A;  4B48 A;  4YAU A;  3W2F A;  1VQK B;  1OB0 A;  3LO8 A;  1V0E A;  4X07 A;  4XNF A;  2QEX B;  3WBJ A;  4TMX A;  4XM3 A;  3R6K A;  2VYQ A;  4XON A;  5E6T A;  2VNJ A;  1NJI D;  1ELO A;  5DS0 A;  5FA6 A;  2GK6 A;  1JB9 A;  1UD3 A;  3W2H A;  1S72 B;  4EH1 A;  2R6H A;  3WY9 A;  1H8E A;  1EFT A;  1RQP A;  2F1M A;  2ZXI A;  3H9N A;  3D26 A;  1CQX A;  5HXB A;  4WZL A;  3OE7 A;  1BPL A;  3OZU A;  1YJW B;  1T6Y A;  2JN9 A;  1VF7 A;  1HVX A;  1BJK A;  1FND A;  2W6J A;  5IYN A;  3AVT A;  3ZUG A;  4M4S A;  5J35 A;  2ZBU A;  5EMN A;  4PAA A;  1E43 A;  2VBV A;  3FKS A;  1KZL A;  3E1Y E;  3RY8 A;  4WQM A;  4TN1 A;  4MYT A;  4TMT A;  1YJ9 B;  5F4M A;  2XEX A;  2QDX A;  4Y9R A;  1T6X A;  1UMK A;  2ZL5 A;  4NBS A;  4P6Y A;  1B23 P;  3ZPN A;  2VZL A;  2GPJ A;  2VBT A;  5THX A;  5BSX A;  1QGA A;  4XOT A;  4ZCL A;  2BMW A;  1E1R A;  3MCA A;  1TLL A;  2WPD A;  2QMU A;  5HZA A;  5HZB A;  2BVN A;  3LNN A;  4XKV A;  4ZCM A;  3GQB A;  3CCE B;  5F4J A;  3BY1 A;  1EP1 B;  2YWF A;  5BSY A;  1JNY A;  4OP7 A;  1E79 A;  3GVL A;  4H9G A;  4RLZ A;  4XLH A;  2XNJ A;  5F4O A;  3W5U A;  3QFS A;  5LMZ A;  1H85 A;  2WJY A;  3OKX A;  2M5S A;  1DDG A;  3CPW B;  3A1P A;  3BH4 A;  2VNK A;  4G1B A;  3BCF A;  3Q6Q A;  2QA4 B;  1YHQ B;  4UZE A;  5J3O A;  3PA2 A;  3WXM A;  4Z4W A;  2D3N A;  4ZCI A;  1I18 A;  1VQ5 B;  1FRQ A;  3GVJ A;  1TTT A;  2WSS A;  3CP8 A;  4G7X A;  3T53 B;  4TKO B;  1KK2 A;  4M0L A;  1QFZ A;  1YLO A;  3VR6 A;  1KC8 D;  3T56 B;  2V7U A;  1CNF A;  1YI2 B;  2GJK A;  3GIR A;  2OYN A;  3CES A;  3VO2 A;  1SKY B;  5L46 A;  2BM1 A;  2HDN B;  3B8H A;  1W87 A;  1SM4 A;  2ZZQ A;  3SJP A;  4DQK A;  3VMF A;  5FIU A;  5CDF A;  1FX0 A;  4QVA A;  1GAW A;  4XMY A;  3LQE A;  2X6Y A;  4X7D A;  4WZT A;  3ONU A;  3AGP A;  2XZL A;  1IB0 A;  1UD2 A;  4YHB A;  1VQP B;  3B82 A;  3P26 A;  4P2N A;  1OB2 A;  3E20 A;  3OZV A;  1GJR A;  1XB2 A;  3G05 A;  2XNC A;  2RC6 A;  4RDK A;  3MHP A;  2OTL B;  3CPX A;  1Y0R A;  3OJW A;  4QFM A;  3CCR B;  2V7T A;  4LBW A;  1VQ7 B;  1PJ7 A;  1WOO A;  2C5B A;  2X6W A;  2WJV A;  1WOR A;  4YEL A;  2XZO A;  1DDI A;  1EP2 B;  1BMF A;  1N05 A;  3SLN A;  1E62 A;  2XOK A;  1UD8 A;  4DK0 A;  2C5H A;  1FDR A;  4RDL A;  4TSF A;  2VJI A;  1OHH A;  2QE7 A;  1WSV A;  2QTL A;  4RD0 A;  1F60 A;  2ZZG A;  3AGQ A;  3JQP A;  1VLO A;  4M1K A;  3CCJ B;  4E0F A;  1EWY A;  3QE2 A;  3SEJ A;  4B3X A;  2B7B A;  2BGI A;  1XFO A;  1UD5 A;  2BSA A;  3GSI A;  4XQF A;  1DAR A;  2CK3 A;  4CQJ A;  3KL9 A;  4ZGQ B;  4G5G A;  1BQE A;  4II2 A;  1K28 D;  2GJP A;  4WWV A;  3ASS A;  4QV2 A;  1ZM3 A;  2B5O A;  1QVF B;  5FL7 A;  3FJO A;  3I56 B;  2X8K A;  2YWG A;  3PUM A;  1VQL B;  1T5E A;  2ZBV A;  2QGG A;  2GRE A;  4X06 A;  5IK2 A;  4F7D A;  1M1K D;  1D2E A;  4YAO A;  3PA1 A;  2NPF A;  4DK1 A;  1KQS B;  3WBK A;  3CD6 B;  1KMH A;  4B44 A;  4N3N A;  5JBQ A;  3AVX A;  1YIJ B;  4LC0 A;  3Q38 A;  2DIE A;  5HKK A;  3ZBU A;  5IYQ A;  4YXW A;  1QVG B;  2OBR A;  4X7E A;  1QH0 A;  2C78 A;  1VQN B;  2J7K A;  3ZZ0 A;  4AF6 A;  3CCU B;  3V76 A;  4JMQ A;  3H94 A;  4XOR A;  1GAQ A;  4P6V F;  1JA1 A;  1KK0 A;  2EIX A;  4XR6 A;  1QG0 A;  3WNB A;  3A35 A;  1PJ6 A;  1S0U A;  1D1N A;  1WP6 A;  2F43 A;  3ZZT A;  2ZL6 A;  1K8A D;  5A89 A;  4P26 A;  4XLA A;  3Q39 A;  4PC3 A;  4HE5 A;  3CCS B;  1COW A;  3JU4 A;  1KK1 A;  4RD1 A;  4L8J A;  4DNT B;  4Z4U A;  1WPC A;  2DCU A;  2C4U A;  2Q6O A;  1VHE A;  1NRK A;  3CMM A;  4NNJ A;  2DY1 A;  2QN6 A;  1E63 A;  2ZTG A;  4XLF A;  1GO2 A;  2OBS A;  2PIA A;  5KSW B;  4OPO A;  2ZL7 A;  5FO1 A;  1N06 A;  4TMZ A;  4RPD A;  2Q6K A;  4KKU A;  4Z4S A;  3QSY A;  3B78 A;  2DEU A;  4LBY A;  4LBV A;  2CBX A;  4YAF A;  3OW2 B;  3MMP A;  2F4N A;  3J81 k;  1ZM9 A;  1N08 A;  3LVB A;  4DNR B;  4YAW A;  4P25 A;  2NV4 A;  3CCV B;  2LZJ A;  2CND A;  1T6Z A;  3OJX A;  1BLI A;  3ZZU A;  4C0S A;  4FK8 A;  2Q6I A;  1G7R A;  4QHY A;  3G4S B;  3OZW A;  4RPB A;  4Z4Y A;  3OP1 A;  2FVG A;  1VQO B;  2R9V A;  3A8K A;  1JA0 A;  3W2E A;  4U9U A;  4RCZ A;  2ZTN A;  1VQ8 B;  4RDJ A;  1WU8 A;  1W0K A;  4X7C A;  4M53 A;  4P3Y A;  4AC9 A;  3U6B A;  1NDH A;  1QFY A;  2PMD A;  3NE5 B;  4FWT A;  1YIT B;  3A3B A;  1FNC A;  2V31 A;  4P1V A;  4FN5 A;  1BX1 A;  4WZE A;  3SLD A;  3ASP A;  1V0F A;  1M90 D;  4RD4 A;  4Z4V A;  1ZM4 A;  3W2I A;  1B2R A;  3W5H A;  4R71 A;  1KTV A;  1WOP A;  3QFC A;  3W5V A;  4ROX A;  1F20 A;  4HE6 A;  4AVZ A;  3AVW A;  1S4M A;  4NCN A;  1EFU A;  3CC7 B;  2V4D A;  1G7T A;  4P22 A;  5GV7 A;  4OOX A;  4Y7C A;  1AIP A;  1W34 A;  5A88 A;  2BV3 A;  1WOS A;  4ACB A;  1EXM A;  1NB9 A;  3CC2 B;  2Q6L A;  5IYW A;  2C77 A;  2WYR A;  3CME B;  5DN6 A;  1E1Q A;  1VLY A;  3R6J A;  2XGJ A;  3CMA B;  4BPR A;  4X7F A;  4G6I A;  3ZC3 A;  1WTH D;  3W2G A;  1Q9S A;  3OOC A;  2WR8 A;  3JQR A;  1VQM B;  3CB4 A;  4G1V A;  2DER A;  2BPO A;  2JJ2 A;  4OOS A;  2P3M A;  2KVO A;  4GQN A;  1Q86 D;  1YX2 A;  1FNB A;  4AF7 A;  3JQQ A;  1KJZ A;  4KKS A;  1HZE A;  4OPS A;  1SKQ A;  2D9R A;  2V7Q A;  2X3U A;  1QX4 A;  2ZXH A;  4PAB A;  5TR9 A;  1OGI A;  3QFT A;  3V7A A;  3BC9 A;  1PJ5 A;  4Y9U A;  1N0U A;  1H42 A;  1J9Z A;  2VBS A;  4B47 A;  2YWH A;  1JJ2 B;  3Q3A A;  2X85 A;  3SKB A;  4LBZ A;  1XQB A;  1W2B B;  5KNL A;  1BX0 A;  2CW5 A;  3VO1 A;  2CF4 A;  2GQF A;  4XD7 A;  1EFR A;  1P4M A;  4YAL A;  3CCL B;  4HIZ A;  3GVK A;  2BGJ A;  3BY2 A;  3CCM B;  1FNM A;  2OK7 A;  5FNZ A;  3AVV A;  1N07 A;  2BM0 A;  3CXC B;  1XE1 A;  4B43 A;  5FO0 A;  2VNH A;  3DDY A;  2EFG A;  4P9S A;  2CC2 A;  1EFC A;  1R5B A;  2ZZF A;  1TUI A;  2X53 S;  2DOG A;  2X6X A;  3PEN A;  4II3 A;  4XOP A;  1E64 A;  4RCY A;  2WZN A;  2OK8 A;  1MRZ A;  4ZV4 A;  3BNW A;  4PC2 A;  3OW7 A;  3WND A;  1KD1 D;  1D8T A;  5A8A A;  1WDT A;  3OPO A;  2HMA A;  3CTA A;  1G7C A;  2C4T A;  4OOV A;  2BN4 A;  3ES9 A;  4G7W A;  4PGO A;  2GJR A;  3WQZ A;  1K9M D;  3LQ6 A;  1NBM A;  1MAB A;  4YEJ A;  3G6E B;  4XLE A;  1QUF A;  2ZZE A;  3KEW A;  2WZP P;  3AVU A;  2GK7 A;  4UZU A;  5H59 A;  2E1B A;  4QUZ A;  4Z4R A;  3OEE A;  4PC6 A;  4PC7 A;  1IHM A;  3ISX A;  4TMW A;  5TRD A;  3ZIA A;  4ZGN B;  1N8R D;  4RM0 A;  2W6I A;  2QTZ A;  1E3X A;  4XN0 A;  5IYR A;  2VJJ A;  2CRV A;  5TV2 A;  2D74 A;  1G7S A;  1VJS A;  3AVY A;  1K73 D;  4TMV A;  4X0C A;  3VNU A;  1W9X A;  2D3L A;  2ZIT A;  4XLC A;  2V7V A;  2XZP A;  1YJN B;  1U2R A;  4OPV A;  3ONY A;  4P12 A;  4RD3 A;  4J0Q A;  3CP2 A;  1QGY A;  3WYA A;  1V5V A;  1Y0Y A;  2PLF A;  1FRN A;  3PVD A;  4N3G A;  2HLD A;  3I1F A;  1N0V C;  3QFR A;  1VQ9 B;  1IJE A;  1WSR A;  1EP3 B;  2OBT A;  3ASQ A;  3SJZ A;  1PKV A;  4KKT A;  3FPP A;  2B7C A;  4C43 A;  4ACA A;  1GVH A;  1W35 A;  4FXU A;  4X05 A;  5B6I A;  5KW9 A;  1OGJ A;  3OFN A;  2X0K A;  4P3I A;  4QVJ A;  1QGZ A;  1DG1 G;  4XL9 A;  3HAG A;  2JJ1 A;  3CW2 A;  2DET A;  1VHO A;  4Q7J B;  2JIZ A;  1CNE A;  5TY0 A;  2FX3 A;  4Z4Z A;  3U6K A;  1I8D A;  3T51 B;  5AN9 A;  3ZBT A;  2PE3 A;  1ZM2 A;  2I1L A;  1W0J A;  4B4D A;  4Z4T A;  1OB5 A;  3CRZ A;  2JDI A;  1QUE A;  1I7P A;  1R5O A;  2VNI A;  1R5N A;  3BCD A;  4TT3 A;  3P27 A;  3CCQ B;  2E1R A;  4XKW A;  4Z1M A;  4WZK A;  1Q81 D;  2RC5 A;  4PC1 A;  2XND A;  1RQR A;  4B3F X;  4RJL A;  4DQL A;  3I55 B;  1UD6 A;  2DYI A;  2F1L A;  2YWE A;  1UD4 A;  3BQJ A;  3OAA A;  3PUN A;  3G71 B;  3FPK A;  1NB0 A;  3VNV A;  3WNC A;  3A3G A;  4M2L A;  1GR1 A;  1ZUN B;  1KRH A;  3OEH A;  3AST A;  3A8J A;  1TVC A;  1VQ4 B;  4UAJ A;  4RD6 A;  3A8I A;  2HCJ B;  2BF4 A;  3ASR A;  5GV8 A;  4IW3 B;  4ASU A;  2C2W A;  1VQ6 B;  4XN3 A;  2Z6B D;  4RD2 A;  4B3G A;  1AMO A;  2OTJ B;  1IJF A;  1KK3 A;  2V7W A;  2AHO A;  1E3Z A;  2VBU A;  5IYP A;  1Q7Y D;  4X8I A;  1A8P A;  1HA3 A;  1QFJ A;  4MYU A;  4UZF A;  5DSZ A;  3U2Q A; 
#chains in the Genus database with same CATH homology
 5H5J A;  3CC4 B;  4K1X A;  1Q82 D;  4B48 A;  4YAU A;  3W2F A;  1VQK B;  3LO8 A;  2QEX B;  3WBJ A;  4TMX A;  2VYQ A;  2VNJ A;  1NJI D;  1ELO A;  5FA6 A;  1JB9 A;  3W2H A;  1S72 B;  4EH1 A;  2R6H A;  3WY9 A;  1EFT A;  1CQX A;  5HXB A;  3OZU A;  1YJW B;  1BJK A;  1FND A;  3AVT A;  4M4S A;  5EMN A;  3E1Y E;  4WQM A;  4TN1 A;  4MYT A;  4TMT A;  1YJ9 B;  2XEX A;  2QDX A;  4Y9R A;  1UMK A;  4NBS A;  1B23 P;  2VZL A;  2GPJ A;  5THX A;  1QGA A;  4ZCL A;  2BMW A;  3MCA A;  1TLL A;  2QMU A;  2BVN A;  4ZCM A;  3CCE B;  1EP1 B;  2YWF A;  1JNY A;  4H9G A;  2XNJ A;  3W5U A;  3QFS A;  1H85 A;  1DDG A;  3CPW B;  4G1B A;  2VNK A;  2QA4 B;  1YHQ B;  3WXM A;  4ZCI A;  1VQ5 B;  1FRQ A;  1TTT A;  1KK2 A;  4M0L A;  1QFZ A;  1KC8 D;  1CNF A;  1YI2 B;  3VO2 A;  2BM1 A;  2HDN B;  3B8H A;  1W87 A;  1SM4 A;  4DQK A;  3VMF A;  1GAW A;  3AGP A;  1IB0 A;  4YHB A;  1VQP B;  3B82 A;  3P26 A;  1OB2 A;  3E20 A;  3OZV A;  1GJR A;  1XB2 A;  2XNC A;  2RC6 A;  3MHP A;  2OTL B;  3OJW A;  4QFM A;  3CCR B;  4LBW A;  1VQ7 B;  1DDI A;  1EP2 B;  1E62 A;  1FDR A;  2QTL A;  4RD0 A;  1F60 A;  3AGQ A;  3JQP A;  4M1K A;  3CCJ B;  1EWY A;  3QE2 A;  4B3X A;  2B7B A;  2BGI A;  2BSA A;  1DAR A;  4ZGQ B;  4G5G A;  1BQE A;  1ZM3 A;  2B5O A;  1QVF B;  3FJO A;  3I56 B;  2YWG A;  1VQL B;  4F7D A;  1M1K D;  1D2E A;  4YAO A;  2NPF A;  3WBK A;  3CD6 B;  4B44 A;  4N3N A;  5JBQ A;  3AVX A;  1YIJ B;  4LC0 A;  3ZBU A;  1QVG B;  1QH0 A;  2C78 A;  1VQN B;  2J7K A;  3ZZ0 A;  4AF6 A;  3CCU B;  3V76 A;  1GAQ A;  4P6V F;  1JA1 A;  1KK0 A;  2EIX A;  1QG0 A;  3WNB A;  1D1N A;  1S0U A;  3ZZT A;  1K8A D;  4PC3 A;  4HE5 A;  3CCS B;  1KK1 A;  4RD1 A;  2DCU A;  2DY1 A;  2QN6 A;  1E63 A;  1GO2 A;  2PIA A;  5KSW B;  4TMZ A;  3QSY A;  3B78 A;  2DEU A;  4LBY A;  4LBV A;  3OW2 B;  4YAF A;  3MMP A;  3J81 k;  1ZM9 A;  3LVB A;  4YAW A;  3CCV B;  2CND A;  3OJX A;  4C0S A;  3ZZU A;  4FK8 A;  1G7R A;  4QHY A;  3G4S B;  3OZW A;  1VQO B;  1JA0 A;  3W2E A;  4U9U A;  4RCZ A;  1VQ8 B;  4M53 A;  4P3Y A;  4AC9 A;  3U6B A;  1NDH A;  1QFY A;  2PMD A;  4FWT A;  1YIT B;  1FNC A;  4FN5 A;  1BX1 A;  1M90 D;  4RD4 A;  1ZM4 A;  3W2I A;  1B2R A;  3W5H A;  4R71 A;  1KTV A;  3QFC A;  3W5V A;  1F20 A;  4HE6 A;  3AVW A;  4NCN A;  1EFU A;  3CC7 B;  1G7T A;  5GV7 A;  4Y7C A;  1AIP A;  1W34 A;  2BV3 A;  4ACB A;  1EXM A;  3CC2 B;  2C77 A;  3CME B;  3CMA B;  4BPR A;  3ZC3 A;  3W2G A;  3JQR A;  1VQM B;  3CB4 A;  4G1V A;  2DER A;  2BPO A;  1Q86 D;  1FNB A;  4AF7 A;  3JQQ A;  1KJZ A;  1SKQ A;  2X3U A;  1QX4 A;  5TR9 A;  1OGI A;  3QFT A;  4Y9U A;  1N0U A;  1H42 A;  1J9Z A;  4B47 A;  2YWH A;  1JJ2 B;  4LBZ A;  1W2B B;  1BX0 A;  3VO1 A;  2GQF A;  3CCL B;  4YAL A;  2BGJ A;  3CCM B;  1FNM A;  2OK7 A;  3AVV A;  2BM0 A;  3CXC B;  1XE1 A;  4B43 A;  2VNH A;  2EFG A;  1EFC A;  1R5B A;  1TUI A;  3PEN A;  1E64 A;  4RCY A;  2OK8 A;  4ZV4 A;  3WND A;  4PC2 A;  1KD1 D;  1D8T A;  1WDT A;  2HMA A;  1G7C A;  2BN4 A;  3ES9 A;  4PGO A;  1K9M D;  3G6E B;  1QUF A;  3AVU A;  5H59 A;  4PC6 A;  4PC7 A;  4TMW A;  4ZGN B;  1N8R D;  2QTZ A;  2CRV A;  5TV2 A;  2D74 A;  1G7S A;  3AVY A;  1K73 D;  4TMV A;  3VNU A;  2ZIT A;  1YJN B;  1U2R A;  4RD3 A;  4J0Q A;  1QGY A;  3WYA A;  2PLF A;  1FRN A;  4N3G A;  3I1F A;  1N0V C;  3QFR A;  1VQ9 B;  1IJE A;  1EP3 B;  3SJZ A;  2B7C A;  4C43 A;  4ACA A;  1GVH A;  1W35 A;  1OGJ A;  1QGZ A;  1DG1 G;  3CW2 A;  2DET A;  4Q7J B;  1CNE A;  5TY0 A;  2FX3 A;  3U6K A;  5AN9 A;  3ZBT A;  1ZM2 A;  4B4D A;  1OB5 A;  3CRZ A;  1QUE A;  1I7P A;  1R5O A;  2VNI A;  1R5N A;  3CCQ B;  3P27 A;  2E1R A;  1Q81 D;  2RC5 A;  4PC1 A;  1KQS B;  3I55 B;  4RJL A;  4DQL A;  2YWE A;  3G71 B;  3FPK A;  3VNV A;  3WNC A;  4M2L A;  1GR1 A;  1ZUN B;  1KRH A;  1TVC A;  1VQ4 B;  4UAJ A;  4RD6 A;  2HCJ B;  2BF4 A;  5GV8 A;  1VQ6 B;  4IW3 B;  4RD2 A;  1AMO A;  2OTJ B;  1IJF A;  1KK3 A;  2AHO A;  1Q7Y D;  1A8P A;  1HA3 A;  1QFJ A;  4MYU A;  5DSZ A;  3U2Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...