3E20A

Crystal structure of s.pombe erf1/erf3 complex
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
196
structure length
196
Chain Sequence
APFIMPIASKYKDLGTILEGKIEAGSIKKNSNVLVMPINQTLEVTAIYDEADEEISSSICGDQVRLRVRGDDSDVQTGYVLTSTKNPVHATTRFIAQIAILELPSILTTGYSCVMHIHTAVEEVSFAKLLHKLDKTNRKSKKPPMFATKGMKIIAELETQTPVCMERFEDYQYMGRFTLRDQGTTVAVGKVVKILD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Eukaryotic peptide chain release factor GTP-binding subunit
publication title Structural insights into eRF3 and stop codon recognition by eRF1
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Translation
total genus 32
structure length 196
sequence length 196
chains with identical sequence D, E, J
ec nomenclature
pdb deposition date 2008-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03143 GTP_EFTU_D3 Elongation factor Tu C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 3e20A02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 3e20A01
1W35A 3AVYA 2BMWA 3WBKA 1E64A 3V76A 1GVHA 4M0LA 4LBWA 2BSAA 2BGJA 1FRNA 1N0VC 1KD1D 1FNBA 1AIPA 1VQLB 1Q7YD 3WNBA 4AC9A 1FRQA 4Y9UA 5H59A 4J0QA 3FJOA 1S72B 1EFTA 2PLFA 3U2QA 2VNHA 1JA1A 2QTZA 3CD6B 4B48A 1W2BB 1I7PA 3WNDA 1TUIA 4TMZA 1KK0A 4G1BA 3CRZA 1TTTA 4B4DA 1R5OA 3AVUA 3W2EA 3U6BA 1KRHA 1FNCA 3QE2A 3JQQA 4M1KA 5AN9A 1QFJA 3CB4A 1IJEA 2QMUA 2CRVA 2E1RA 1K9MD 1QFYA 4RD4A 3CCUB 3WBJA 3AGQA 3CCJB 1XE1A 1DDIA 3JQPA 1R5NA 1JJ2B 2BGIA 4M4SA 4ACAA 1KK2A 3CCEB 4ZV4A 1N8RD 4TMTA 2PIAA 1K73D 4UAJA 1GJRA 4N3GA 3AVTA 4ZGQB 3CCRB 3ZZTA 2BPOA 1TVCA 3WYAA 3CXCB 3QFTA 2QDXA 5FA6A 4LBVA 4P3YA 1J9ZA 4LBZA 1BX0A 2YWGA 2EIXA 1B23P 4YAUA 1GR1A 1ELOA 2VYQA 4LC0A 1VQ4B 1AMOA 1A8PA 3CMAB 3AVWA 3OW2B 4K1XA 3W2FA 1QVFB 4DQKA 1ZUNB 3I1FA 4PC7A 3W2IA 3CCMB 1QVGB 3E20A 3CC2B 1N0UA 4NCNA 2VNKA 2OK8A 1GAQA 2QN6A 3CCQB 1H42A 3LVBA 1SM4A 2OTLB 4TMVA 4PC3A 2C78A 1KQSB 1KJZA 1K8AD 1Q81D 2RC5A 2BVNA 4G1VA 1E62A 1VQOB 3P27A 3CMEB 1NJID 4M2LA 4Q7JB 4ZGNB 1F20A 4ACBA 3ZBTA 1EP3B 4YAFA 5HXBA 3QFSA 1QUEA 2DY1A 4HE6A 1R5BA 3ZC3A 4ZCMA 3CCVB 3PENA 4B47A 4RD0A 2B5OA 3G4SB 3WY9A 4PGOA 2QEXB 1YJWB 3WNCA 1E63A 2BF4A 4QHYA 2OTJB 1D2EA 3CCSB 1FDRA 3P26A 3VO2A 3W2HA 3VNVA 3G6EB 3JQRA 4FWTA 4C0SA 3G71B 4YHBA 4TMWA 4YAWA 4RD1A 4B3XA 3OJXA 3QFRA 2C77A 1KTVA 1CNEA 3SJZA 4MYTA 3CC4B 3AGPA 1F60A 3AVXA 3VMFA 1S0UA 4ZCIA 1YI2B 2GQFA 3QSYA 1NDHA 4N3NA 5H5JA 1HA3A 4TN1A 3I56B 1Q86D 4RD6A 1D1NA 2FX3A 4RJLA 4IW3B 4U9UA 1EFCA 1QGZA 4RCZA 3B82A 2R6HA 1UMKA 1B2RA 1VQKB 1EP2B 5TY0A 1Q82D 4MYUA 4F7DA 4BPRA 1OB5A 5GV8A 1FNDA 5DSZA 4FK8A 2VNIA 4B43A 2XNCA 4R71A 1VQ5B 1QG0A 1VQPB 1H85A 1EFUA 2PMDA 1W34A 5THXA 5EMNA 5KSWB 3ZZUA 2VNJA 3QFCA 3E1YE 4WQMA 2YWHA 2ZITA 1ZM4A 4RD2A 2HCJB 1KK3A 3OZUA 1GAWA 1G7CA 1W87A 3B78A 2RC6A 1CNFA 3OZWA 4Y9RA 2QTLA 1DG1G 3OZVA 1GO2A 3ZZ0A 4PC6A 3VNUA 1ZM3A 4C43A 2BN4A 2BM1A 1JA0A 2VZLA 3J81k 3ZBUA 2CNDA 4YAOA 1VQ7B 1YHQB 5GV7A 4H9GA 2BV3A 3WXMA 2DEUA 1FNMA 2HMAA 3B8HA 1JB9A 3MMPA 1OB2A 3U6KA 4RD3A 2HDNB 1CQXA 3VO1A 1BX1A 1IB0A 1XB2A 4RCYA 1IJFA 5JBQA 3MCAA 1VQ6B 4B44A 2YWEA 3OJWA 1ZM2A 2GPJA 2BM0A 3I55B 4AF6A 1QH0A 4Y7CA 2YWFA 1EXMA 1OGJA 1G7SA 1VQNB 1YITB 1TLLA 3W5VA 2DERA 1DARA 3CC7B 2OK7A 1YIJB 1G7RA 2X3UA 4AF7A 3FPKA 1M90D 1BQEA 4EH1A 3ES9A 2DCUA 2B7CA 1SKQA 4QFMA 5TV2A 1G7TA 1QX4A 2EFGA 4HE5A 2B7BA 1YJ9B 1KC8D 1QGYA 4TMXA 2XNJA 2XEXA 2AHOA 4NBSA 4DQLA 1YJNB 4P6VF 2J7KA 4PC1A 4ZCLA 1JNYA 1M1KD 1WDTA 4YALA 3W5HA 1VQ8B 2NPFA 1EP1B 1QGAA 1U2RA 3W5UA 1KK1A 1QFZA 1EWYA 4G5GA 5TR9A 3CW2A 4PC2A 1VQ9B 3W2GA 1OGIA 3CCLB 4LBYA 2DETA 1BJKA 1ZM9A 1DDGA 3AVVA 2D74A 1D8TA 1QUFA 3LO8A 1VQMB 4FN5A 3MHPA 4M53A 3CPWB 2QA4B
chains in the Genus database with same CATH superfamily
1W35A 3AVYA 2BMWA 3WBKA 1E64A 1P4MA 3ASQA 4X7CA 3V76A 5IK2A 1GVHA 5A8AA 4M0LA 4LBWA 2BSAA 4X8IA 2BGJA 1FRNA 1N0VC 2ZTGA 1KD1D 1FNBA 1AIPA 1VQLB 2WZPP 1Q7YD 3WNBA 4AC9A 1FRQA 4Y9UA 5H59A 4J0QA 3FJOA 4OPSA 1S72B 1EFTA 2PLFA 4Z4RA 3A8IA 3U2QA 2VNHA 1JA1A 4P1VA 2QTZA 3D26A 3ASTA 1YLOA 3CD6B 2C5BA 4B48A 5J3OA 1W2BB 1I7PA 3WNDA 1TUIA 4TMZA 3OEEA 2VBVA 1UD4A 1KK0A 4G1BA 3CRZA 1TTTA 1E1RA 4B4DA 2CC2A 1R5OA 2CW5A 3GSIA 3LNNA 3PA2A 4PAAA 4RPBA 3AVUA 2ZZGA 4TSFA 3W2EA 3U6BA 5J35A 1KRHA 5L46A 1FNCA 3QE2A 3JQQA 1T6ZA 4M1KA 5AN9A 2WPDA 1QFJA 2Q6KA 3CB4A 2X0KA 4CQJA 1IJEA 5F4JA 2QMUA 2CRVA 2E1RA 4JMQA 1K9MD 1QFYA 1T6XA 4NNJA 4DK0A 2V7VA 4RD4A 3CCUB 3WBJA 4X07A 4YXWA 5IYQA 3AGQA 2ZXIA 3CCJB 2ZBVA 1XE1A 1DDIA 2XNDA 3A3GA 3JQPA 5FIUA 1R5NA 2GK7A 2BGIA 1JJ2B 4P25A 2WR8A 4M4SA 4ACAA 4II2A 2VBUA 1KK2A 1PKVA 3Q6RA 3CCEB 4ZV4A 1N8RD 4WWVA 4TT3A 3PA1A 4TMTA 2PIAA 3SLDA 1K73D 4UAJA 1T5EA 1GJRA 3CMMA 3OPOA 2JN9A 1NBMA 2WJVA 4N3GA 4XLEA 1COWA 3OP1A 4ZGQB 3CCRB 3AVTA 3ZZTA 4G7XA 5E6TA 1WP6A 2DYIA 3A1PA 1UD3A 5IYWA 2BPOA 2X6YA 1TVCA 3WYAA 3CXCB 1SKYB 3QFTA 2QDXA 5FA6A 4LBVA 2VJIA 4P3YA 3OKXA 2VBSA 1RQRA 1J9ZA 4LBZA 1BX0A 2Q6IA 3H9NA 4OP7A 4Z4ZA 5FO0A 2YWGA 2EIXA 2ZZEA 1B23P 1UD5A 4X7FA 4WZKA 4YAUA 1GR1A 3RY8A 4X0CA 1ELOA 2VYQA 3OEHA 3CESA 4LC0A 1VQ4B 1AMOA 1A8PA 3CMAB 4YEJA 3AVWA 1PJ7A 3FPPA 4TKOB 3OW2B 4K1XA 3W2FA 1QVFB 4XL9A 4DQKA 1HVXA 1ZUNB 3I1FA 2JJ2A 4PC7A 3W2IA 3VR6A 2V7WA 2X85A 4DK1A 1WSVA 4XLAA 3CCMB 1OHHA 1QVGB 3E20A 3Q3AA 1VJSA 3CC2B 1BPLA 4X7DA 1N0UA 4NCNA 2C4UA 2VNKA 2OK8A 1GAQA 2V7TA 2QN6A 3CCQB 1H42A 3LVBA 1SM4A 2GJPA 1HZEA 2OTLB 4P3IA 4TMVA 4PC3A 3LQ6A 2C78A 2OYNA 3R6JA 1KQSB 1KJZA 1K8AD 2XOKA 4XM3A 5DS0A 1Q81D 2RC5A 2BVNA 4G1VA 1E62A 1VQOB 3GVJA 3P27A 1VLOA 3CMEB 1Y0RA 1NJID 3A3BA 3OE7A 4M2LA 1H8EA 2E1BA 2V31A 4Q7JB 1F20A 4ZGNB 4ACBA 3ZBTA 1EP3B 5KNLA 4YAFA 5HXBA 3QFSA 1QUEA 2R9VA 2DY1A 4HE6A 5KW9A 1R5BA 3ZC3A 4ZCMA 3CCVB 3PENA 4B47A 4RD0A 4Z4UA 2B5OA 3G4SB 3WY9A 1NB9A 4PGOA 3OFNA 2QEXB 2JJ1A 1YJWB 4XR6A 4X06A 3WNCA 5HZAA 1E63A 4RPDA 2BF4A 3CPXA 2V7UA 1W0KA 2QE7A 3LQEA 2V7QA 4QHYA 2OTJB 4PABA 1D2EA 4P9SA 3CCSB 1FDRA 1EFRA 3P26A 5F4MA 4XD7A 3Q38A 3VO2A 2DOGA 1E3XA 3W2HA 4Z4SA 3VNVA 3G6EB 5BSXA 3JQRA 2D9RA 4QVJA 4C0SA 2GJKA 3G71B 4FWTA 2C4TA 4YHBA 4TMWA 4YAWA 3SJPA 4RD1A 4B3XA 4Z4TA 3OJXA 3QFRA 2C77A 2ZL7A 1KTVA 4Z1MA 2OBTA 1CNEA 3SJZA 3NE5B 4MYTA 3CC4B 3AGPA 2X8KA 3Q6QA 1F60A 4XKWA 3AVXA 3VMFA 1S0UA 4ZCIA 2ZTNA 1YI2B 2GQFA 3QSYA 2DIEA 1WOPA 1NDHA 4DNRB 4X7EA 5FL7A 1KMHA 2X53S 4N3NA 5H5JA 2ZL6A 1UD6A 1HA3A 4TN1A 1WTHD 1YX2A 4RD6A 3I56B 1Q86D 1D1NA 1V0EA 3CP8A 2FX3A 3ISXA 4RJLA 1VHEA 1W0JA 4IW3B 3KL9A 4U9UA 1EFCA 1QGZA 4RCZA 3B82A 3PUNA 2R6HA 4OOSA 4UZEA 1UMKA 5IYPA 1B2RA 3T56B 1VQKB 4DNTB 2F4NA 2XZOA 1EP2B 3PVDA 5TY0A 1Q82D 3WQZA 4MYUA 2CBXA 5F4OA 4F7DA 4BPRA 1OB5A 4RM0A 4XNFA 4XN3A 5GV8A 1FNDA 1PJ5A 5DSZA 4FK8A 5B6IA 1W9XA 2VNIA 4B43A 2PE3A 2QGGA 2XNCA 3PUMA 3ASPA 4R71A 3ZIAA 1VQ5B 1QG0A 1VQPB 1H85A 1EFUA 3GVKA 2PMDA 1I18A 1W34A 3OAAA 5THXA 1UD8A 4L8JA 3BC9A 5EMNA 2VJJA 5FNZA 5TRDA 5KSWB 3ZZUA 3SKBA 2VNJA 4OOXA 2F1MA 2Q6LA 4XLCA 3QFCA 4AVZA 2XZPA 2I1LA 3E1YE 2WSSA 4G6IA 4WQMA 2YWHA 2ZITA 5BSYA 1ZM4A 4UZFA 4WZEA 2ZZQA 3KEWA 2HCJB 4RD2A 4XOPA 1KK3A 3OZUA 3ZUGA 1GAWA 1G7CA 1W87A 3B78A 2RC6A 1CNFA 3OZWA 4QUZA 4Y9RA 2QTLA 2C5HA 4P2NA 3ASSA 1N07A 1DG1G 1N08A 3OZVA 1K28D 3OOCA 4ASUA 3ONYA 3T51B 1GO2A 4UZUA 3ZZ0A 4PC6A 3VNUA 1ZM3A 2X6XA 2HLDA 4C43A 1H8HA 2BN4A 1XFOA 3T53B 2BM1A 3JU4A 2X6WA 4QV2A 4Z4VA 5IYNA 1E3ZA 1JA0A 2VZLA 3J81k 3ZBUA 3GVLA 2CNDA 4YAOA 1VQ7B 2GK6A 1YHQB 4OPOA 5GV7A 4H9GA 1BMFA 1NRKA 2ZZFA 2BV3A 4WZLA 1RQPA 2NV4A 3WXMA 1WORA 2V4DA 2XGJA 1N05A 2FVGA 2DEUA 1FX0A 1WSRA 4XORA 1FNMA 2HMAA 2P3MA 1PJ6A 4QVAA 3B8HA 1JB9A 3HAGA 3MMPA 4B3FX 3BCDA 5HKKA 1OB2A 1Q9SA 4P6YA 5A88A 3U6KA 4OOVA 1WPCA 4RD3A 2HDNB 1CQXA 3VO1A 1BLIA 1BX1A 1IB0A 1Y0YA 1XB2A 3CPWB 4RCYA 1IJFA 3A8JA 2ZL5A 4XLFA 5JBQA 3MCAA 1VQ6B 4G7WA 4P22A 4WZTA 4B44A 2KVOA 3GQBA 2YWEA 1IHMA 1E79A 3OJWA 3H94A 1ZM2A 3A35A 2GPJA 2BM0A 3I55B 3V7AA 4AF6A 1WU8A 4RDLA 1QH0A 4Y7CA 2YWFA 1WOOA 1EXMA 4KKTA 5FO1A 4P12A 1V0FA 4YELA 1OGJA 1G7SA 3ZPNA 1VQNB 2F43A 2W6IA 1YITB 1TLLA 3W5VA 2DERA 1DARA 4FXUA 3CC7B 2OK7A 1YIJB 1G7RA 2X3UA 4AF7A 3BNWA 3FPKA 3BY1A 4XQFA 2M5SA 1M90D 3A8KA 1BQEA 4EH1A 3ES9A 4X05A 2GJRA 3ASRA 2DCUA 2B7CA 2LZJA 4XMYA 2ZBUA 1MRZA 1SKQA 4QFMA 1OB0A 1E1QA 4RLZA 4RDKA 2CF4A 1G7TA 3DDYA 3G05A 5TV2A 1QX4A 2EFGA 4HE5A 2JIZA 4XONA 2B7BA 1YJ9B 4GQNA 4XKVA 2CK3A 2Z6BD 4KKSA 1KC8D 1XQBA 3GIRA 1T6YA 4ROXA 4E0FA 2C2WA 1QGYA 4RDJA 4B3GA 4TMXA 3BCFA 4OPVA 3BY2A 3SEJA 1MABA 2WZNA 3R6KA 2XNJA 2XEXA 2AHOA 2W6JA 4NBSA 1KZLA 1VHOA 4DQLA 1YJNB 4P6VF 2J7KA 3BQJA 4PC1A 4Z4YA 4ZCLA 4II3A 1JNYA 1M1KD 1WDTA 4YALA 3W5HA 1WOSA 5IYRA 1V5VA 2F1LA 1NB0A 2V7XA 1VQ8B 2NPFA 1EP1B 2WYRA 4P26A 1E43A 1QGAA 3ONUA 4XLHA 1U2RA 5HZBA 3W5UA 3Q39A 1VLYA 5DN6A 1KK1A 4HIZA 4XOTA 1QFZA 2VBTA 5A89A 4XN0A 1EWYA 5CDFA 4G5GA 5TR9A 3CW2A 2XZLA 4PC2A 1VQ9B 4Z4WA 3W2GA 2WJYA 1N06A 1OGIA 2ZXHA 2GREA 3CCLB 3BH4A 5LMZA 4LBYA 2DETA 1BJKA 1S4MA 1ZM9A 3OW7A 4KKUA 1DDGA 1VF7A 2D3LA 3AVVA 1I8DA 2OBSA 2D74A 1D8TA 1QUFA 3FKSA 2OBRA 3LO8A 3CTAA 3SLNA 1UD2A 2Q6OA 1VQMB 4FN5A 3CP2A 3MHPA 4M53A 2JDIA 2D3NA 2QA4B
chains in the Genus database with same CATH topology
1W35A 3AVYA 2BMWA 3WBKA 1E64A 3V76A 1GVHA 4M0LA 4LBWA 2BSAA 2BGJA 1FRNA 1N0VC 1KD1D 1FNBA 1AIPA 1VQLB 1Q7YD 3WNBA 4AC9A 1FRQA 4Y9UA 5H59A 4J0QA 3FJOA 1S72B 1EFTA 2PLFA 3U2QA 2VNHA 1JA1A 2QTZA 3CD6B 4B48A 1W2BB 1I7PA 3WNDA 1TUIA 4TMZA 1KK0A 4G1BA 3CRZA 1TTTA 4B4DA 1R5OA 3AVUA 3W2EA 3U6BA 1KRHA 1FNCA 3QE2A 3JQQA 4M1KA 5AN9A 1QFJA 3CB4A 1IJEA 2QMUA 2CRVA 2E1RA 1K9MD 1QFYA 4RD4A 3CCUB 3WBJA 3AGQA 3CCJB 1XE1A 1DDIA 3JQPA 1R5NA 1JJ2B 2BGIA 4M4SA 4ACAA 1KK2A 3CCEB 4ZV4A 1N8RD 4TMTA 2PIAA 1K73D 4UAJA 1GJRA 4N3GA 3AVTA 4ZGQB 3CCRB 3ZZTA 2BPOA 1TVCA 3WYAA 3CXCB 3QFTA 2QDXA 5FA6A 4LBVA 4P3YA 1J9ZA 4LBZA 1BX0A 2YWGA 2EIXA 1B23P 4YAUA 1GR1A 1ELOA 2VYQA 4LC0A 1VQ4B 1AMOA 1A8PA 3CMAB 3AVWA 3OW2B 4K1XA 3W2FA 1QVFB 4DQKA 1ZUNB 3I1FA 4PC7A 3W2IA 3CCMB 1QVGB 3E20A 3CC2B 1N0UA 4NCNA 2VNKA 2OK8A 1GAQA 2QN6A 3CCQB 1H42A 3LVBA 1SM4A 2OTLB 4TMVA 4PC3A 2C78A 1KQSB 1KJZA 1K8AD 1Q81D 2RC5A 2BVNA 4G1VA 1E62A 1VQOB 3P27A 3CMEB 1NJID 4M2LA 4Q7JB 4ZGNB 1F20A 4ACBA 3ZBTA 1EP3B 4YAFA 5HXBA 3QFSA 1QUEA 2DY1A 4HE6A 1R5BA 3ZC3A 4ZCMA 3CCVB 3PENA 4B47A 4RD0A 2B5OA 3G4SB 3WY9A 4PGOA 2QEXB 1YJWB 3WNCA 1E63A 2BF4A 4QHYA 2OTJB 1D2EA 3CCSB 1FDRA 3P26A 3VO2A 3W2HA 3VNVA 3G6EB 3JQRA 4FWTA 4C0SA 3G71B 4YHBA 4TMWA 4YAWA 4RD1A 4B3XA 3OJXA 3QFRA 2C77A 1KTVA 1CNEA 3SJZA 4MYTA 3CC4B 3AGPA 1F60A 3AVXA 3VMFA 1S0UA 4ZCIA 1YI2B 2GQFA 3QSYA 1NDHA 4N3NA 5H5JA 1HA3A 4TN1A 3I56B 1Q86D 4RD6A 1D1NA 2FX3A 4RJLA 4IW3B 4U9UA 1EFCA 1QGZA 4RCZA 3B82A 2R6HA 1UMKA 1B2RA 1VQKB 1EP2B 5TY0A 1Q82D 4MYUA 4F7DA 4BPRA 1OB5A 5GV8A 1FNDA 5DSZA 4FK8A 2VNIA 4B43A 2XNCA 4R71A 1VQ5B 1QG0A 1VQPB 1H85A 1EFUA 2PMDA 1W34A 5THXA 5EMNA 5KSWB 3ZZUA 2VNJA 3QFCA 3E1YE 4WQMA 2YWHA 2ZITA 1ZM4A 4RD2A 2HCJB 1KK3A 3OZUA 1GAWA 1G7CA 1W87A 3B78A 2RC6A 1CNFA 3OZWA 4Y9RA 2QTLA 1DG1G 3OZVA 1GO2A 3ZZ0A 4PC6A 3VNUA 1ZM3A 4C43A 2BN4A 2BM1A 1JA0A 2VZLA 3J81k 3ZBUA 2CNDA 4YAOA 1VQ7B 1YHQB 5GV7A 4H9GA 2BV3A 3WXMA 2DEUA 1FNMA 2HMAA 3B8HA 1JB9A 3MMPA 1OB2A 3U6KA 4RD3A 2HDNB 1CQXA 3VO1A 1BX1A 1IB0A 1XB2A 4RCYA 1IJFA 5JBQA 3MCAA 1VQ6B 4B44A 2YWEA 3OJWA 1ZM2A 2GPJA 2BM0A 3I55B 4AF6A 1QH0A 4Y7CA 2YWFA 1EXMA 1OGJA 1G7SA 1VQNB 1YITB 1TLLA 3W5VA 2DERA 1DARA 3CC7B 2OK7A 1YIJB 1G7RA 2X3UA 4AF7A 3FPKA 1M90D 1BQEA 4EH1A 3ES9A 2DCUA 2B7CA 1SKQA 4QFMA 5TV2A 1G7TA 1QX4A 2EFGA 4HE5A 2B7BA 1YJ9B 1KC8D 1QGYA 4TMXA 2XNJA 2XEXA 2AHOA 4NBSA 4DQLA 1YJNB 4P6VF 2J7KA 4PC1A 4ZCLA 1JNYA 1M1KD 1WDTA 4YALA 3W5HA 1VQ8B 2NPFA 1EP1B 1QGAA 1U2RA 3W5UA 1KK1A 1QFZA 1EWYA 4G5GA 5TR9A 3CW2A 4PC2A 1VQ9B 3W2GA 1OGIA 3CCLB 4LBYA 2DETA 1BJKA 1ZM9A 1DDGA 3AVVA 2D74A 1D8TA 1QUFA 3LO8A 1VQMB 4FN5A 3MHPA 4M53A 3CPWB 2QA4B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W35 A;  3AVY A;  2BMW A;  3WBK A;  1E64 A;  3V76 A;  1GVH A;  4M0L A;  4LBW A;  2BSA A;  2BGJ A;  1FRN A;  1N0V C;  1KD1 D;  1FNB A;  1AIP A;  1VQL B;  1Q7Y D;  3WNB A;  4AC9 A;  1FRQ A;  4Y9U A;  5H59 A;  4J0Q A;  3FJO A;  1S72 B;  1EFT A;  2PLF A;  3U2Q A;  2VNH A;  1JA1 A;  2QTZ A;  3CD6 B;  4B48 A;  1W2B B;  1I7P A;  3WND A;  1TUI A;  4TMZ A;  1KK0 A;  4G1B A;  3CRZ A;  1TTT A;  4B4D A;  1R5O A;  3AVU A;  3W2E A;  3U6B A;  1KRH A;  1FNC A;  3QE2 A;  3JQQ A;  4M1K A;  5AN9 A;  1QFJ A;  3CB4 A;  1IJE A;  2QMU A;  2CRV A;  2E1R A;  1K9M D;  1QFY A;  4RD4 A;  3CCU B;  3WBJ A;  3AGQ A;  3CCJ B;  1XE1 A;  1DDI A;  3JQP A;  1R5N A;  1JJ2 B;  2BGI A;  4M4S A;  4ACA A;  1KK2 A;  3CCE B;  4ZV4 A;  1N8R D;  4TMT A;  2PIA A;  1K73 D;  4UAJ A;  1GJR A;  4N3G A;  3AVT A;  4ZGQ B;  3CCR B;  3ZZT A;  2BPO A;  1TVC A;  3WYA A;  3CXC B;  3QFT A;  2QDX A;  5FA6 A;  4LBV A;  4P3Y A;  1J9Z A;  4LBZ A;  1BX0 A;  2YWG A;  2EIX A;  1B23 P;  4YAU A;  1GR1 A;  1ELO A;  2VYQ A;  4LC0 A;  1VQ4 B;  1AMO A;  1A8P A;  3CMA B;  3AVW A;  3OW2 B;  4K1X A;  3W2F A;  1QVF B;  4DQK A;  1ZUN B;  3I1F A;  4PC7 A;  3W2I A;  3CCM B;  1QVG B;  3E20 A;  3CC2 B;  1N0U A;  4NCN A;  2VNK A;  2OK8 A;  1GAQ A;  2QN6 A;  3CCQ B;  1H42 A;  3LVB A;  1SM4 A;  2OTL B;  4TMV A;  4PC3 A;  2C78 A;  1KQS B;  1KJZ A;  1K8A D;  1Q81 D;  2RC5 A;  2BVN A;  4G1V A;  1E62 A;  1VQO B;  3P27 A;  3CME B;  1NJI D;  4M2L A;  4Q7J B;  4ZGN B;  1F20 A;  4ACB A;  3ZBT A;  1EP3 B;  4YAF A;  5HXB A;  3QFS A;  1QUE A;  2DY1 A;  4HE6 A;  1R5B A;  3ZC3 A;  4ZCM A;  3CCV B;  3PEN A;  4B47 A;  4RD0 A;  2B5O A;  3G4S B;  3WY9 A;  4PGO A;  2QEX B;  1YJW B;  3WNC A;  1E63 A;  2BF4 A;  4QHY A;  2OTJ B;  1D2E A;  3CCS B;  1FDR A;  3P26 A;  3VO2 A;  3W2H A;  3VNV A;  3G6E B;  3JQR A;  4FWT A;  4C0S A;  3G71 B;  4YHB A;  4TMW A;  4YAW A;  4RD1 A;  4B3X A;  3OJX A;  3QFR A;  2C77 A;  1KTV A;  1CNE A;  3SJZ A;  4MYT A;  3CC4 B;  3AGP A;  1F60 A;  3AVX A;  3VMF A;  1S0U A;  4ZCI A;  1YI2 B;  2GQF A;  3QSY A;  1NDH A;  4N3N A;  5H5J A;  1HA3 A;  4TN1 A;  3I56 B;  1Q86 D;  4RD6 A;  1D1N A;  2FX3 A;  4RJL A;  4IW3 B;  4U9U A;  1EFC A;  1QGZ A;  4RCZ A;  3B82 A;  2R6H A;  1UMK A;  1B2R A;  1VQK B;  1EP2 B;  5TY0 A;  1Q82 D;  4MYU A;  4F7D A;  4BPR A;  1OB5 A;  5GV8 A;  1FND A;  5DSZ A;  4FK8 A;  2VNI A;  4B43 A;  2XNC A;  4R71 A;  1VQ5 B;  1QG0 A;  1VQP B;  1H85 A;  1EFU A;  2PMD A;  1W34 A;  5THX A;  5EMN A;  5KSW B;  3ZZU A;  2VNJ A;  3QFC A;  3E1Y E;  4WQM A;  2YWH A;  2ZIT A;  1ZM4 A;  4RD2 A;  2HCJ B;  1KK3 A;  3OZU A;  1GAW A;  1G7C A;  1W87 A;  3B78 A;  2RC6 A;  1CNF A;  3OZW A;  4Y9R A;  2QTL A;  1DG1 G;  3OZV A;  1GO2 A;  3ZZ0 A;  4PC6 A;  3VNU A;  1ZM3 A;  4C43 A;  2BN4 A;  2BM1 A;  1JA0 A;  2VZL A;  3J81 k;  3ZBU A;  2CND A;  4YAO A;  1VQ7 B;  1YHQ B;  5GV7 A;  4H9G A;  2BV3 A;  3WXM A;  2DEU A;  1FNM A;  2HMA A;  3B8H A;  1JB9 A;  3MMP A;  1OB2 A;  3U6K A;  4RD3 A;  2HDN B;  1CQX A;  3VO1 A;  1BX1 A;  1IB0 A;  1XB2 A;  4RCY A;  1IJF A;  5JBQ A;  3MCA A;  1VQ6 B;  4B44 A;  2YWE A;  3OJW A;  1ZM2 A;  2GPJ A;  2BM0 A;  3I55 B;  4AF6 A;  1QH0 A;  4Y7C A;  2YWF A;  1EXM A;  1OGJ A;  1G7S A;  1VQN B;  1YIT B;  1TLL A;  3W5V A;  2DER A;  1DAR A;  3CC7 B;  2OK7 A;  1YIJ B;  1G7R A;  2X3U A;  4AF7 A;  3FPK A;  1M90 D;  1BQE A;  4EH1 A;  3ES9 A;  2DCU A;  2B7C A;  1SKQ A;  4QFM A;  5TV2 A;  1G7T A;  1QX4 A;  2EFG A;  4HE5 A;  2B7B A;  1YJ9 B;  1KC8 D;  1QGY A;  4TMX A;  2XNJ A;  2XEX A;  2AHO A;  4NBS A;  4DQL A;  1YJN B;  4P6V F;  2J7K A;  4PC1 A;  4ZCL A;  1JNY A;  1M1K D;  1WDT A;  4YAL A;  3W5H A;  1VQ8 B;  2NPF A;  1EP1 B;  1QGA A;  1U2R A;  3W5U A;  1KK1 A;  1QFZ A;  1EWY A;  4G5G A;  5TR9 A;  3CW2 A;  4PC2 A;  1VQ9 B;  3W2G A;  1OGI A;  3CCL B;  4LBY A;  2DET A;  1BJK A;  1ZM9 A;  1DDG A;  3AVV A;  2D74 A;  1D8T A;  1QUF A;  3LO8 A;  1VQM B;  4FN5 A;  3MHP A;  4M53 A;  3CPW B;  2QA4 B; 
#chains in the Genus database with same CATH topology
 1W35 A;  3AVY A;  2BMW A;  3WBK A;  1E64 A;  1P4M A;  3ASQ A;  4X7C A;  3V76 A;  5IK2 A;  1GVH A;  5A8A A;  4M0L A;  4LBW A;  2BSA A;  4X8I A;  2BGJ A;  1FRN A;  1N0V C;  2ZTG A;  1KD1 D;  1FNB A;  1AIP A;  1VQL B;  2WZP P;  1Q7Y D;  3WNB A;  4AC9 A;  1FRQ A;  4Y9U A;  5H59 A;  4J0Q A;  3FJO A;  4OPS A;  1S72 B;  1EFT A;  2PLF A;  4Z4R A;  3A8I A;  3U2Q A;  2VNH A;  1JA1 A;  4P1V A;  2QTZ A;  3D26 A;  3AST A;  1YLO A;  3CD6 B;  2C5B A;  4B48 A;  5J3O A;  1W2B B;  1I7P A;  3WND A;  1TUI A;  4TMZ A;  3OEE A;  2VBV A;  1UD4 A;  1KK0 A;  4G1B A;  3CRZ A;  1TTT A;  1E1R A;  4B4D A;  2CC2 A;  1R5O A;  2CW5 A;  3GSI A;  3LNN A;  3PA2 A;  4PAA A;  4RPB A;  3AVU A;  2ZZG A;  4TSF A;  3W2E A;  3U6B A;  5J35 A;  1KRH A;  5L46 A;  1FNC A;  3QE2 A;  3JQQ A;  1T6Z A;  4M1K A;  5AN9 A;  2WPD A;  1QFJ A;  2Q6K A;  3CB4 A;  2X0K A;  4CQJ A;  1IJE A;  5F4J A;  2QMU A;  2CRV A;  2E1R A;  4JMQ A;  1K9M D;  1QFY A;  1T6X A;  4NNJ A;  4DK0 A;  2V7V A;  4RD4 A;  3CCU B;  3WBJ A;  4X07 A;  4YXW A;  5IYQ A;  3AGQ A;  2ZXI A;  3CCJ B;  2ZBV A;  1XE1 A;  1DDI A;  2XND A;  3A3G A;  3JQP A;  5FIU A;  1R5N A;  2GK7 A;  2BGI A;  1JJ2 B;  4P25 A;  2WR8 A;  4M4S A;  4ACA A;  4II2 A;  2VBU A;  1KK2 A;  1PKV A;  3Q6R A;  3CCE B;  4ZV4 A;  1N8R D;  4WWV A;  4TT3 A;  3PA1 A;  4TMT A;  2PIA A;  3SLD A;  1K73 D;  4UAJ A;  1T5E A;  1GJR A;  3CMM A;  3OPO A;  2JN9 A;  1NBM A;  2WJV A;  4N3G A;  4XLE A;  1COW A;  3OP1 A;  4ZGQ B;  3CCR B;  3AVT A;  3ZZT A;  4G7X A;  5E6T A;  1WP6 A;  2DYI A;  3A1P A;  1UD3 A;  5IYW A;  2BPO A;  2X6Y A;  1TVC A;  3WYA A;  3CXC B;  1SKY B;  3QFT A;  2QDX A;  5FA6 A;  4LBV A;  2VJI A;  4P3Y A;  3OKX A;  2VBS A;  1RQR A;  1J9Z A;  4LBZ A;  1BX0 A;  2Q6I A;  3H9N A;  4OP7 A;  4Z4Z A;  5FO0 A;  2YWG A;  2EIX A;  2ZZE A;  1B23 P;  1UD5 A;  4X7F A;  4WZK A;  4YAU A;  1GR1 A;  3RY8 A;  4X0C A;  1ELO A;  2VYQ A;  3OEH A;  3CES A;  4LC0 A;  1VQ4 B;  1AMO A;  1A8P A;  3CMA B;  4YEJ A;  3AVW A;  1PJ7 A;  3FPP A;  4TKO B;  3OW2 B;  4K1X A;  3W2F A;  1QVF B;  4XL9 A;  4DQK A;  1HVX A;  1ZUN B;  3I1F A;  2JJ2 A;  4PC7 A;  3W2I A;  3VR6 A;  2V7W A;  2X85 A;  4DK1 A;  1WSV A;  4XLA A;  3CCM B;  1OHH A;  1QVG B;  3E20 A;  3Q3A A;  1VJS A;  3CC2 B;  1BPL A;  4X7D A;  1N0U A;  4NCN A;  2C4U A;  2VNK A;  2OK8 A;  1GAQ A;  2V7T A;  2QN6 A;  3CCQ B;  1H42 A;  3LVB A;  1SM4 A;  2GJP A;  1HZE A;  2OTL B;  4P3I A;  4TMV A;  4PC3 A;  3LQ6 A;  2C78 A;  2OYN A;  3R6J A;  1KQS B;  1KJZ A;  1K8A D;  2XOK A;  4XM3 A;  5DS0 A;  1Q81 D;  2RC5 A;  2BVN A;  4G1V A;  1E62 A;  1VQO B;  3GVJ A;  3P27 A;  1VLO A;  3CME B;  1Y0R A;  1NJI D;  3A3B A;  3OE7 A;  4M2L A;  1H8E A;  2E1B A;  2V31 A;  4Q7J B;  1F20 A;  4ZGN B;  4ACB A;  3ZBT A;  1EP3 B;  5KNL A;  4YAF A;  5HXB A;  3QFS A;  1QUE A;  2R9V A;  2DY1 A;  4HE6 A;  5KW9 A;  1R5B A;  3ZC3 A;  4ZCM A;  3CCV B;  3PEN A;  4B47 A;  4RD0 A;  4Z4U A;  2B5O A;  3G4S B;  3WY9 A;  1NB9 A;  4PGO A;  3OFN A;  2QEX B;  2JJ1 A;  1YJW B;  4XR6 A;  4X06 A;  3WNC A;  5HZA A;  1E63 A;  4RPD A;  2BF4 A;  3CPX A;  2V7U A;  1W0K A;  2QE7 A;  3LQE A;  2V7Q A;  4QHY A;  2OTJ B;  4PAB A;  1D2E A;  4P9S A;  3CCS B;  1FDR A;  1EFR A;  3P26 A;  5F4M A;  4XD7 A;  3Q38 A;  3VO2 A;  2DOG A;  1E3X A;  3W2H A;  4Z4S A;  3VNV A;  3G6E B;  5BSX A;  3JQR A;  2D9R A;  4QVJ A;  4C0S A;  2GJK A;  3G71 B;  4FWT A;  2C4T A;  4YHB A;  4TMW A;  4YAW A;  3SJP A;  4RD1 A;  4B3X A;  4Z4T A;  3OJX A;  3QFR A;  2C77 A;  2ZL7 A;  1KTV A;  4Z1M A;  2OBT A;  1CNE A;  3SJZ A;  3NE5 B;  4MYT A;  3CC4 B;  3AGP A;  2X8K A;  3Q6Q A;  1F60 A;  4XKW A;  3AVX A;  3VMF A;  1S0U A;  4ZCI A;  2ZTN A;  1YI2 B;  2GQF A;  3QSY A;  2DIE A;  1WOP A;  1NDH A;  4DNR B;  4X7E A;  5FL7 A;  1KMH A;  2X53 S;  4N3N A;  5H5J A;  2ZL6 A;  1UD6 A;  1HA3 A;  4TN1 A;  1WTH D;  1YX2 A;  4RD6 A;  3I56 B;  1Q86 D;  1D1N A;  1V0E A;  3CP8 A;  2FX3 A;  3ISX A;  4RJL A;  1VHE A;  1W0J A;  4IW3 B;  3KL9 A;  4U9U A;  1EFC A;  1QGZ A;  4RCZ A;  3B82 A;  3PUN A;  2R6H A;  4OOS A;  4UZE A;  1UMK A;  5IYP A;  1B2R A;  3T56 B;  1VQK B;  4DNT B;  2F4N A;  2XZO A;  1EP2 B;  3PVD A;  5TY0 A;  1Q82 D;  3WQZ A;  4MYU A;  2CBX A;  5F4O A;  4F7D A;  4BPR A;  1OB5 A;  4RM0 A;  4XNF A;  4XN3 A;  5GV8 A;  1FND A;  1PJ5 A;  5DSZ A;  4FK8 A;  5B6I A;  1W9X A;  2VNI A;  4B43 A;  2PE3 A;  2QGG A;  2XNC A;  3PUM A;  3ASP A;  4R71 A;  3ZIA A;  1VQ5 B;  1QG0 A;  1VQP B;  1H85 A;  1EFU A;  3GVK A;  2PMD A;  1I18 A;  1W34 A;  3OAA A;  5THX A;  1UD8 A;  4L8J A;  3BC9 A;  5EMN A;  2VJJ A;  5FNZ A;  5TRD A;  5KSW B;  3ZZU A;  3SKB A;  2VNJ A;  4OOX A;  2F1M A;  2Q6L A;  4XLC A;  3QFC A;  4AVZ A;  2XZP A;  2I1L A;  3E1Y E;  2WSS A;  4G6I A;  4WQM A;  2YWH A;  2ZIT A;  5BSY A;  1ZM4 A;  4UZF A;  4WZE A;  2ZZQ A;  3KEW A;  2HCJ B;  4RD2 A;  4XOP A;  1KK3 A;  3OZU A;  3ZUG A;  1GAW A;  1G7C A;  1W87 A;  3B78 A;  2RC6 A;  1CNF A;  3OZW A;  4QUZ A;  4Y9R A;  2QTL A;  2C5H A;  4P2N A;  3ASS A;  1N07 A;  1DG1 G;  1N08 A;  3OZV A;  1K28 D;  3OOC A;  4ASU A;  3ONY A;  3T51 B;  1GO2 A;  4UZU A;  3ZZ0 A;  4PC6 A;  3VNU A;  1ZM3 A;  2X6X A;  2HLD A;  4C43 A;  1H8H A;  2BN4 A;  1XFO A;  3T53 B;  2BM1 A;  3JU4 A;  2X6W A;  4QV2 A;  4Z4V A;  5IYN A;  1E3Z A;  1JA0 A;  2VZL A;  3J81 k;  3ZBU A;  3GVL A;  2CND A;  4YAO A;  1VQ7 B;  2GK6 A;  1YHQ B;  4OPO A;  5GV7 A;  4H9G A;  1BMF A;  1NRK A;  2ZZF A;  2BV3 A;  4WZL A;  1RQP A;  2NV4 A;  3WXM A;  1WOR A;  2V4D A;  2XGJ A;  1N05 A;  2FVG A;  2DEU A;  1FX0 A;  1WSR A;  4XOR A;  1FNM A;  2HMA A;  2P3M A;  1PJ6 A;  4QVA A;  3B8H A;  1JB9 A;  3HAG A;  3MMP A;  4B3F X;  3BCD A;  5HKK A;  1OB2 A;  1Q9S A;  4P6Y A;  5A88 A;  3U6K A;  4OOV A;  1WPC A;  4RD3 A;  2HDN B;  1CQX A;  3VO1 A;  1BLI A;  1BX1 A;  1IB0 A;  1Y0Y A;  1XB2 A;  3CPW B;  4RCY A;  1IJF A;  3A8J A;  2ZL5 A;  4XLF A;  5JBQ A;  3MCA A;  1VQ6 B;  4G7W A;  4P22 A;  4WZT A;  4B44 A;  2KVO A;  3GQB A;  2YWE A;  1IHM A;  1E79 A;  3OJW A;  3H94 A;  1ZM2 A;  3A35 A;  2GPJ A;  2BM0 A;  3I55 B;  3V7A A;  4AF6 A;  1WU8 A;  4RDL A;  1QH0 A;  4Y7C A;  2YWF A;  1WOO A;  1EXM A;  4KKT A;  5FO1 A;  4P12 A;  1V0F A;  4YEL A;  1OGJ A;  1G7S A;  3ZPN A;  1VQN B;  2F43 A;  2W6I A;  1YIT B;  1TLL A;  3W5V A;  2DER A;  1DAR A;  4FXU A;  3CC7 B;  2OK7 A;  1YIJ B;  1G7R A;  2X3U A;  4AF7 A;  3BNW A;  3FPK A;  3BY1 A;  4XQF A;  2M5S A;  1M90 D;  3A8K A;  1BQE A;  4EH1 A;  3ES9 A;  4X05 A;  2GJR A;  3ASR A;  2DCU A;  2B7C A;  2LZJ A;  4XMY A;  2ZBU A;  1MRZ A;  1SKQ A;  4QFM A;  1OB0 A;  1E1Q A;  4RLZ A;  4RDK A;  2CF4 A;  1G7T A;  3DDY A;  3G05 A;  5TV2 A;  1QX4 A;  2EFG A;  4HE5 A;  2JIZ A;  4XON A;  2B7B A;  1YJ9 B;  4GQN A;  4XKV A;  2CK3 A;  2Z6B D;  4KKS A;  1KC8 D;  1XQB A;  3GIR A;  1T6Y A;  4ROX A;  4E0F A;  2C2W A;  1QGY A;  4RDJ A;  4B3G A;  4TMX A;  3BCF A;  4OPV A;  3BY2 A;  3SEJ A;  1MAB A;  2WZN A;  3R6K A;  2XNJ A;  2XEX A;  2AHO A;  2W6J A;  4NBS A;  1KZL A;  1VHO A;  4DQL A;  1YJN B;  4P6V F;  2J7K A;  3BQJ A;  4PC1 A;  4Z4Y A;  4ZCL A;  4II3 A;  1JNY A;  1M1K D;  1WDT A;  4YAL A;  3W5H A;  1WOS A;  5IYR A;  1V5V A;  2F1L A;  1NB0 A;  2V7X A;  1VQ8 B;  2NPF A;  1EP1 B;  2WYR A;  4P26 A;  1E43 A;  1QGA A;  3ONU A;  4XLH A;  1U2R A;  5HZB A;  3W5U A;  3Q39 A;  1VLY A;  5DN6 A;  1KK1 A;  4HIZ A;  4XOT A;  1QFZ A;  2VBT A;  5A89 A;  4XN0 A;  1EWY A;  5CDF A;  4G5G A;  5TR9 A;  3CW2 A;  2XZL A;  4PC2 A;  1VQ9 B;  4Z4W A;  3W2G A;  2WJY A;  1N06 A;  1OGI A;  2ZXH A;  2GRE A;  3CCL B;  3BH4 A;  5LMZ A;  4LBY A;  2DET A;  1BJK A;  1S4M A;  1ZM9 A;  3OW7 A;  4KKU A;  1DDG A;  1VF7 A;  2D3L A;  3AVV A;  1I8D A;  2OBS A;  2D74 A;  1D8T A;  1QUF A;  3FKS A;  2OBR A;  3LO8 A;  3CTA A;  3SLN A;  1UD2 A;  2Q6O A;  1VQM B;  4FN5 A;  3CP2 A;  3MHP A;  4M53 A;  2JDI A;  2D3N A;  2QA4 B; 
#chains in the Genus database with same CATH homology
 1W35 A;  3AVY A;  2BMW A;  3WBK A;  1E64 A;  3V76 A;  1GVH A;  4M0L A;  4LBW A;  2BSA A;  2BGJ A;  1FRN A;  1N0V C;  1KD1 D;  1FNB A;  1AIP A;  1VQL B;  1Q7Y D;  3WNB A;  4AC9 A;  1FRQ A;  4Y9U A;  5H59 A;  4J0Q A;  3FJO A;  1S72 B;  1EFT A;  2PLF A;  3U2Q A;  2VNH A;  1JA1 A;  2QTZ A;  3CD6 B;  4B48 A;  1W2B B;  1I7P A;  3WND A;  1TUI A;  4TMZ A;  1KK0 A;  4G1B A;  3CRZ A;  1TTT A;  4B4D A;  1R5O A;  3AVU A;  3W2E A;  3U6B A;  1KRH A;  1FNC A;  3QE2 A;  3JQQ A;  4M1K A;  5AN9 A;  1QFJ A;  3CB4 A;  1IJE A;  2QMU A;  2CRV A;  2E1R A;  1K9M D;  1QFY A;  4RD4 A;  3CCU B;  3WBJ A;  3AGQ A;  3CCJ B;  1XE1 A;  1DDI A;  3JQP A;  1R5N A;  1JJ2 B;  2BGI A;  4M4S A;  4ACA A;  1KK2 A;  3CCE B;  4ZV4 A;  1N8R D;  4TMT A;  2PIA A;  1K73 D;  4UAJ A;  1GJR A;  4N3G A;  3AVT A;  4ZGQ B;  3CCR B;  3ZZT A;  2BPO A;  1TVC A;  3WYA A;  3CXC B;  3QFT A;  2QDX A;  5FA6 A;  4LBV A;  4P3Y A;  1J9Z A;  4LBZ A;  1BX0 A;  2YWG A;  2EIX A;  1B23 P;  4YAU A;  1GR1 A;  1ELO A;  2VYQ A;  4LC0 A;  1VQ4 B;  1AMO A;  1A8P A;  3CMA B;  3AVW A;  3OW2 B;  4K1X A;  3W2F A;  1QVF B;  4DQK A;  1ZUN B;  3I1F A;  4PC7 A;  3W2I A;  3CCM B;  1QVG B;  3E20 A;  3CC2 B;  1N0U A;  4NCN A;  2VNK A;  2OK8 A;  1GAQ A;  2QN6 A;  3CCQ B;  1H42 A;  3LVB A;  1SM4 A;  2OTL B;  4TMV A;  4PC3 A;  2C78 A;  1KQS B;  1KJZ A;  1K8A D;  1Q81 D;  2RC5 A;  2BVN A;  4G1V A;  1E62 A;  1VQO B;  3P27 A;  3CME B;  1NJI D;  4M2L A;  4Q7J B;  4ZGN B;  1F20 A;  4ACB A;  3ZBT A;  1EP3 B;  4YAF A;  5HXB A;  3QFS A;  1QUE A;  2DY1 A;  4HE6 A;  1R5B A;  3ZC3 A;  4ZCM A;  3CCV B;  3PEN A;  4B47 A;  4RD0 A;  2B5O A;  3G4S B;  3WY9 A;  4PGO A;  2QEX B;  1YJW B;  3WNC A;  1E63 A;  2BF4 A;  4QHY A;  2OTJ B;  1D2E A;  3CCS B;  1FDR A;  3P26 A;  3VO2 A;  3W2H A;  3VNV A;  3G6E B;  3JQR A;  4FWT A;  4C0S A;  3G71 B;  4YHB A;  4TMW A;  4YAW A;  4RD1 A;  4B3X A;  3OJX A;  3QFR A;  2C77 A;  1KTV A;  1CNE A;  3SJZ A;  4MYT A;  3CC4 B;  3AGP A;  1F60 A;  3AVX A;  3VMF A;  1S0U A;  4ZCI A;  1YI2 B;  2GQF A;  3QSY A;  1NDH A;  4N3N A;  5H5J A;  1HA3 A;  4TN1 A;  3I56 B;  1Q86 D;  4RD6 A;  1D1N A;  2FX3 A;  4RJL A;  4IW3 B;  4U9U A;  1EFC A;  1QGZ A;  4RCZ A;  3B82 A;  2R6H A;  1UMK A;  1B2R A;  1VQK B;  1EP2 B;  5TY0 A;  1Q82 D;  4MYU A;  4F7D A;  4BPR A;  1OB5 A;  5GV8 A;  1FND A;  5DSZ A;  4FK8 A;  2VNI A;  4B43 A;  2XNC A;  4R71 A;  1VQ5 B;  1QG0 A;  1VQP B;  1H85 A;  1EFU A;  2PMD A;  1W34 A;  5THX A;  5EMN A;  5KSW B;  3ZZU A;  2VNJ A;  3QFC A;  3E1Y E;  4WQM A;  2YWH A;  2ZIT A;  1ZM4 A;  4RD2 A;  2HCJ B;  1KK3 A;  3OZU A;  1GAW A;  1G7C A;  1W87 A;  3B78 A;  2RC6 A;  1CNF A;  3OZW A;  4Y9R A;  2QTL A;  1DG1 G;  3OZV A;  1GO2 A;  3ZZ0 A;  4PC6 A;  3VNU A;  1ZM3 A;  4C43 A;  2BN4 A;  2BM1 A;  1JA0 A;  2VZL A;  3J81 k;  3ZBU A;  2CND A;  4YAO A;  1VQ7 B;  1YHQ B;  5GV7 A;  4H9G A;  2BV3 A;  3WXM A;  2DEU A;  1FNM A;  2HMA A;  3B8H A;  1JB9 A;  3MMP A;  1OB2 A;  3U6K A;  4RD3 A;  2HDN B;  1CQX A;  3VO1 A;  1BX1 A;  1IB0 A;  1XB2 A;  4RCY A;  1IJF A;  5JBQ A;  3MCA A;  1VQ6 B;  4B44 A;  2YWE A;  3OJW A;  1ZM2 A;  2GPJ A;  2BM0 A;  3I55 B;  4AF6 A;  1QH0 A;  4Y7C A;  2YWF A;  1EXM A;  1OGJ A;  1G7S A;  1VQN B;  1YIT B;  1TLL A;  3W5V A;  2DER A;  1DAR A;  3CC7 B;  2OK7 A;  1YIJ B;  1G7R A;  2X3U A;  4AF7 A;  3FPK A;  1M90 D;  1BQE A;  4EH1 A;  3ES9 A;  2DCU A;  2B7C A;  1SKQ A;  4QFM A;  5TV2 A;  1G7T A;  1QX4 A;  2EFG A;  4HE5 A;  2B7B A;  1YJ9 B;  1KC8 D;  1QGY A;  4TMX A;  2XNJ A;  2XEX A;  2AHO A;  4NBS A;  4DQL A;  1YJN B;  4P6V F;  2J7K A;  4PC1 A;  4ZCL A;  1JNY A;  1M1K D;  1WDT A;  4YAL A;  3W5H A;  1VQ8 B;  2NPF A;  1EP1 B;  1QGA A;  1U2R A;  3W5U A;  1KK1 A;  1QFZ A;  1EWY A;  4G5G A;  5TR9 A;  3CW2 A;  4PC2 A;  1VQ9 B;  3W2G A;  1OGI A;  3CCL B;  4LBY A;  2DET A;  1BJK A;  1ZM9 A;  1DDG A;  3AVV A;  2D74 A;  1D8T A;  1QUF A;  3LO8 A;  1VQM B;  4FN5 A;  3MHP A;  4M53 A;  3CPW B;  2QA4 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...