3E20A

Crystal structure of s.pombe erf1/erf3 complex
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
196
structure length
196
Chain Sequence
APFIMPIASKYKDLGTILEGKIEAGSIKKNSNVLVMPINQTLEVTAIYDEADEEISSSICGDQVRLRVRGDDSDVQTGYVLTSTKNPVHATTRFIAQIAILELPSILTTGYSCVMHIHTAVEEVSFAKLLHKLDKTNRKSKKPPMFATKGMKIIAELETQTPVCMERFEDYQYMGRFTLRDQGTTVAVGKVVKILD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural insights into eRF3 and stop codon recognition by eRF1
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Translation
molecule keywords Eukaryotic peptide chain release factor GTP-binding subunit
total genus 32
structure length 196
sequence length 196
chains with identical sequence D, E, J
ec nomenclature
pdb deposition date 2008-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03143 GTP_EFTU_D3 Elongation factor Tu C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 3e20A02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 3e20A01
4G5GA 3MHPA 3G6EB 3FJOA 1VQ5B 3W2IA 1J9ZA 1B23P 4DQLA 1VQKB 1YJNB 1GJRA 2E1RA 3ZZ0A 1TTTA 1F60A 4PGOA 3U6KA 1VQ6B 1VQMB 1KC8D 3AGQA 5GV8A 1N8RD 4BPRA 1NJID 3VO1A 3CD6B 2PIAA 3I56B 1QFYA 4EH1A 3B8HA 4M0LA 1Q81D 3CPWB 3B78A 3ZZUA 1BX1A 1YITB 1G7CA 3AVWA 1XB2A 2YWEA 1F20A 3I55B 4MYUA 2PMDA 4DQKA 3W5UA 1KJZA 3CCJB 4RD4A 2VNIA 4HE5A 4C43A 3OZVA 3CCUB 4NCNA 4HE6A 3W2HA 3CCLB 1AIPA 1FNCA 3WNCA 3W2FA 3U2QA 1W2BB 4UAJA 1D1NA 1QH0A 4H9GA 2OK7A 4TMXA 1K9MD 1QVFB 3AGPA 1QGAA 1KTVA 1ZUNB 2VYQA 1N0VC 1W34A 3ES9A 4Y9RA 2C78A 3P27A 5GV7A 1GAQA 3CMEB 4ZCMA 2DERA 3AVYA 3CXCB 2YWGA 1KK2A 1JJ2B 2BVNA 2AHOA 5FA6A 4LBWA 2BSAA 3W5HA 4N3NA 4ZCLA 2PLFA 2BGJA 2ZITA 1JA1A 4MYTA 4B48A 4AF7A 4ZV4A 2VZLA 2VNJA 3VMFA 3W5VA 4Y7CA 1YIJB 1VQPB 4RD2A 1QG0A 4J0QA 4C0SA 2R6HA 1OGIA 1R5BA 1N0UA 1W35A 4M2LA 1OB2A 1EFCA 1QGZA 2FX3A 2B7CA 1DG1G 3WXMA 3W2EA 4Q7JB 1GR1A 2GQFA 4TMWA 2RC6A 1VQ4B 4LC0A 2GPJA 2QA4B 3CMAB 5KSWB 2YWHA 3ZC3A 1I7PA 4IW3B 1WDTA 3ZZTA 4RJLA 1Q7YD 3WBJA 4RCZA 1JNYA 1QFJA 3VNVA 2X3UA 3E1YE 1QUFA 2BF4A 4ACAA 1ZM9A 1DARA 2XNCA 3MMPA 1S72B 4M1KA 1K73D 1YJWB 5TR9A 1ZM4A 2QDXA 1KRHA 4RD3A 1Q86D 4PC2A 4ZCIA 2BM1A 5TY0A 4FN5A 1KK1A 2YWFA 3OJWA 1VQ9B 4NBSA 2BV3A 4R71A 1D8TA 3I1FA 1OB5A 1SM4A 4LBVA 2C77A 1NDHA 4B47A 2HDNB 1KK3A 4M53A 3U6BA 4RD6A 4P6VF 4Y9UA 4B3XA 1D2EA 1K8AD 3VNUA 1TVCA 4B43A 3E20A 3P26A 4AC9A 3MCAA 1H85A 3CB4A 1A8PA 5H5JA 3JQPA 3VO2A 2OTJB 4PC1A 3PENA 4ACBA 3ZBTA 1HA3A 1TLLA 3V76A 1G7TA 1KK0A 3B82A 3LO8A 5TV2A 1FNBA 1EP3B 3CC4B 1CNEA 3QFCA 1GAWA 1M1KD 1EWYA 4G1VA 3QSYA 1R5OA 1S0UA 4AF6A 4RCYA 3CW2A 4YAFA 1ELOA 3WBKA 4YHBA 3CC2B 1E64A 1BX0A 5JBQA 5DSZA 4QHYA 2HCJB 4TN1A 3ZBUA 3WNBA 3AVTA 5AN9A 3G71B 2CRVA 1FNMA 2DEUA 2BPOA 3WYAA 3CCVB 3CCEB 4TMZA 3W2GA 3AVUA 1YJ9B 1E63A 1G7RA 4LBYA 2D74A 1KQSB 3G4SB 2BMWA 1SKQA 5EMNA 3QE2A 1VQNB 2OK8A 4B4DA 2QTLA 4ZGNB 1VQ7B 3OW2B 1VQOB 2BN4A 1Q82D 3FPKA 1ZM3A 1EFTA 1FRNA 3JQRA 1W87A 2DETA 1M90D 1OGJA 2DCUA 2B7BA 1VQ8B 1U2RA 2QMUA 1EFUA 4ZGQB 1YI2B 1ZM2A 4TMTA 3OZWA 1JA0A 1YHQB 2HMAA 3CRZA 2OTLB 1EXMA 1QFZA 2BGIA 3OZUA 1BQEA 1XE1A 4N3GA 1FDRA 1UMKA 1IJFA 2EIXA 3AVXA 1GVHA 1CQXA 2CNDA 4TMVA 1KD1D 4P3YA 1IB0A 3SJZA 2EFGA 4K1XA 2QN6A 2XEXA 4PC3A 3CCRB 1CNFA 1QUEA 1EP2B 4F7DA 4G1BA 1TUIA 1E62A 4YAOA 1QVGB 1JB9A 4YAUA 4LBZA 4PC7A 2BM0A 3QFTA 4RD0A 3CCSB 1B2RA 3LVBA 4WQMA 1AMOA 4RD1A 1IJEA 4B44A 3AVVA 4YALA 1DDGA 1QGYA 2QEXB 4U9UA 1FNDA 4FK8A 2VNKA 1EP1B 1G7SA 2DY1A 5H59A 3CCQB 1R5NA 2QTZA 1DDIA 1QX4A 2XNJA 4QFMA 2B5OA 3J81k 2J7KA 1H42A 4FWTA 2VNHA 3OJXA 2RC5A 3QFSA 3CCMB 5HXBA 3CC7B 2NPFA 1FRQA 1GO2A 4PC6A 3WY9A 4YAWA 3JQQA 1BJKA 4M4SA 3WNDA 1VQLB 3QFRA 5THXA
chains in the Genus database with same CATH superfamily
2V31A 4G5GA 3MHPA 3G6EB 5LMZA 3FJOA 1VQ5B 2X6XA 1BMFA 1UD6A 3W2IA 1J9ZA 1B23P 4DQLA 4XLEA 1VQKB 1YJNB 1GJRA 2ZXIA 2E1RA 4QVAA 3ZZ0A 1TTTA 1F60A 4PGOA 3U6KA 1VQ6B 5BSXA 1VQMB 1Y0RA 1KC8D 2X6YA 3CPXA 3AGQA 3FKSA 5GV8A 4P12A 1N8RD 3KEWA 3GVJA 4BPRA 3BQJA 1NJID 2C5HA 3VO1A 3CD6B 2PIAA 4YXWA 3I56B 1QFYA 4NNJA 4EH1A 3B8HA 4M0LA 2JN9A 4OPOA 1Q81D 3CPWB 3B78A 3ZZUA 2XZPA 1COWA 4XLFA 1BX1A 1YITB 3WQZA 1G7CA 1T6YA 2JIZA 2F43A 2VJJA 3AVWA 1XB2A 2HLDA 2YWEA 3G05A 1F20A 3I55B 4MYUA 2PMDA 4DQKA 3W5UA 1KJZA 3CCJB 4RD4A 2VNIA 3ASSA 4HE5A 4C43A 4RDKA 5IYRA 3OZVA 3ASTA 4NCNA 4HE6A 3CCUB 3OFNA 1H8HA 3W2HA 3PUMA 1UD5A 3CCLB 2D9RA 1AIPA 4X7EA 3SEJA 1FNCA 3WNCA 4XLCA 4X7FA 3W2FA 1P4MA 3U2QA 3BNWA 1PJ6A 2WZPP 4B3FX 4OP7A 3GVKA 1W2BB 4UAJA 2R9VA 1D1NA 1QH0A 4H9GA 2OK7A 2CC2A 2F4NA 3ASQA 4TMXA 4UZEA 1K9MD 3A1PA 1QVFB 3AGPA 4DK0A 1N08A 1QGAA 1KTVA 1WOSA 5TRDA 1ZUNB 2ZBVA 2D3LA 2VYQA 1N0VC 1W34A 3ES9A 4Y9RA 5FO1A 2C78A 4PABA 1Y0YA 3P27A 4OPSA 3PA1A 5GV7A 1GAQA 2JJ2A 3CMEB 2V4DA 4ZCMA 2DERA 3A8JA 4XORA 4RM0A 4Z4ZA 3AVYA 3R6JA 3CXCB 2YWGA 1KK2A 4X0CA 2BVNA 1JJ2B 2AHOA 5FA6A 4LBWA 3BY1A 1WOOA 2BSAA 3W5HA 4N3NA 4ZCLA 2PLFA 4QVJA 4TSFA 5F4MA 2BGJA 4DNTB 2WJVA 2ZITA 2X53S 2JDIA 1JA1A 4MYTA 4B48A 4AF7A 4ZV4A 2VZLA 2VNJA 3VMFA 3W5VA 4Y7CA 1YIJB 1VQPB 4RD2A 1QG0A 4J0QA 4C0SA 5FL7A 3CMMA 2Z6BD 3LQEA 2R6HA 1OGIA 2ZZGA 1R5BA 1N0UA 1W35A 4M2LA 4II3A 2NV4A 3OEHA 1OB2A 2JJ1A 3SLNA 1EFCA 1QGZA 2FX3A 4XMYA 2B7CA 5IK2A 4Z4WA 2V7VA 1DG1G 3LQ6A 5BSYA 4P9SA 4XL9A 2C2WA 3WXMA 4XD7A 3W2EA 1PJ5A 4Q7JB 1GR1A 4Z4UA 1S4MA 2V7UA 2GQFA 1HVXA 4TMWA 4UZUA 2RC6A 1VQ4B 4LC0A 1WSVA 2GPJA 4XNFA 2QA4B 3CMAB 5KSWB 2YWHA 4IW3B 1I7PA 3ZC3A 1WDTA 3CTAA 4RJLA 3ZZTA 2XNDA 1Q7YD 2ZZEA 3WBJA 2E1BA 3FPPA 4RCZA 3H9NA 5DN6A 1JNYA 3ISXA 3OE7A 4HIZA 1YX2A 2QE7A 1QFJA 3VNVA 2X3UA 4QV2A 3E1YE 1QUFA 3A8KA 2OBTA 4G6IA 2D3NA 2BF4A 4ACAA 1RQRA 1ZM9A 1DARA 2XNCA 3MMPA 1T6ZA 1S72B 4M1KA 1K73D 3A8IA 3Q6QA 1YJWB 2FVGA 5TR9A 4OOVA 1W9XA 5F4OA 1UD8A 1ZM4A 2QDXA 1KRHA 3GIRA 4WZKA 4RD3A 4RDJA 5HKKA 1Q86D 5CDFA 4X05A 4RDLA 2VBSA 4PC2A 4ZCIA 4XN3A 2BM1A 4XLAA 5TY0A 5A8AA 4FN5A 1KK1A 1V5VA 2YWFA 3HAGA 4XLHA 1WORA 3OJWA 4X7CA 1VQ9B 4NBSA 1K28D 2V7TA 1NB0A 2BV3A 2GJPA 5FO0A 4X7DA 4R71A 1D8TA 3T56B 3I1FA 1N05A 3A3BA 1OB5A 1SM4A 1RQPA 4LBVA 4P1VA 1WTHD 2C77A 1NDHA 4B47A 1FX0A 4FXUA 5F4JA 3BCDA 2HDNB 1MRZA 3Q6RA 3BC9A 1KK3A 2ZL5A 4M53A 2WZNA 3Q3AA 1V0EA 4E0FA 1KMHA 1OB0A 5B6IA 2GREA 4G7XA 3U6BA 4RD6A 4XKVA 4P6VF 4Y9UA 4B3XA 1D2EA 4CQJA 1K8AD 4WZLA 3VNUA 2GJRA 5IYWA 1VHEA 1TVCA 4B43A 3E20A 3P26A 4AC9A 3MCAA 1H85A 3CB4A 1A8PA 4DNRB 2DYIA 5H5JA 3JQPA 3VO2A 2OTJB 3A35A 3SLDA 4PC1A 3PENA 2DOGA 4XR6A 4ACBA 3ZBTA 2X6WA 1XQBA 3ZPNA 3T53B 2ZXHA 1HA3A 1MABA 1TLLA 3V76A 1G7TA 2X85A 2WYRA 1KK0A 3B82A 2V7WA 4Z4VA 3LO8A 4GQNA 5TV2A 5IYPA 1FNBA 1EP3B 2XOKA 2XZLA 3ZUGA 3CC4B 1CNEA 3QFCA 3ASRA 4ROXA 2W6JA 2GJKA 4QUZA 1GAWA 1M1KD 1EWYA 1UD4A 3ONUA 4G1VA 1R5OA 3QSYA 1YLOA 1E1RA 2C4TA 2XZOA 3CESA 1S0UA 3BCFA 4AF6A 4RCYA 3CW2A 2GK7A 5FNZA 2VBTA 4RLZA 3PVDA 4YAFA 1WOPA 1E79A 1PKVA 5IYQA 1ELOA 3WBKA 3GQBA 3Q38A 1W0KA 1PJ7A 4YHBA 4G7WA 4TT3A 3CC2B 4XONA 1E64A 5L46A 1BX0A 2Q6KA 4X8IA 4XOTA 5KNLA 4Z4RA 1E3XA 4XKWA 5JBQA 5DSZA 4QHYA 2HCJB 4TN1A 3ZBUA 3WNBA 1Q9SA 2C5BA 1VLYA 1I8DA 3V7AA 3G71B 5AN9A 2CK3A 3CP8A 3R6KA 4P2NA 1HZEA 3OOCA 2ZL7A 4Z4YA 2CRVA 1V0FA 2ZZFA 3RY8A 1FNMA 3PUNA 2ZBUA 2CBXA 1N06A 3OPOA 2F1LA 2DEUA 2BPOA 1W0JA 3WYAA 3CCVB 2VJIA 2WJYA 1VHOA 1XFOA 3CCEB 1WP6A 4TMZA 5J3OA 3W2GA 1NB9A 3AVUA 1YJ9B 3OW7A 4P6YA 1E63A 4JMQA 1G7RA 4LBYA 4XN0A 1E43A 1N07A 2D74A 1KQSB 3G4SB 1VF7A 3ASPA 1I18A 3CP2A 3SKBA 2ZTNA 1EFRA 2BMWA 4II2A 1SKQA 5EMNA 4Z4TA 3QE2A 1VQNB 1WU8A 2KVOA 2OK8A 4B4DA 2PE3A 2QTLA 2WR8A 3ZIAA 4YELA 1T6XA 2M5SA 4ZGNB 1VQ7B 3OW2B 1WSRA 2BN4A 2OBRA 1VQOB 1Q82D 3FPKA 5A88A 1ZM3A 1EFTA 4AVZA 3Q39A 1FRNA 3JQRA 2ZL6A 5HZAA 1W87A 5J35A 5KW9A 2DETA 1M90D 1OGJA 5DS0A 2DCUA 2B7BA 1VQ8B 2WPDA 1U2RA 2QMUA 4WWVA 1EFUA 2OYNA 2V7XA 3NE5B 3T51B 2WSSA 4ZGQB 4Z1MA 1YI2B 3JU4A 5FIUA 3AVTA 1WPCA 4PAAA 1ZM2A 4L8JA 1T5EA 4TMTA 3OZWA 4DK1A 1JA0A 2ZTGA 1YHQB 2HMAA 3LNNA 5HZBA 3D26A 3CRZA 2OTLB 1EXMA 1E1QA 1NRKA 1QFZA 2BGIA 2VBVA 3GVLA 1BQEA 1BPLA 1XE1A 3OZUA 4N3GA 1FDRA 1UMKA 1IJFA 2EIXA 2X0KA 4X06A 3AVXA 1GVHA 1CQXA 2CNDA 4TMVA 1KD1D 4P3YA 1IB0A 1KZLA 5E6TA 1IHMA 3OP1A 3SJZA 3KL9A 2EFGA 2OBSA 4K1XA 4X07A 2LZJA 2QN6A 2XEXA 3A3GA 4OOXA 4PC3A 3CCRB 1CNFA 2XGJA 1QUEA 1EP2B 2V7QA 3OKXA 4F7DA 3VR6A 5A89A 4ASUA 4G1BA 1TUIA 1E62A 1H8EA 4XOPA 3DDYA 4YAOA 5IYNA 1QVGB 1JB9A 4YAUA 4LBZA 4PC7A 2W6IA 2BM0A 3GSIA 4TKOB 4XM3A 3QFTA 2CW5A 3OAAA 2Q6IA 4RD0A 3CCSB 4OOSA 1B2RA 1VJSA 3LVBA 4WQMA 1UD2A 1AMOA 4RD1A 1IJEA 4B44A 3AVVA 4YALA 1DDGA 1QGYA 2QEXB 4U9UA 2GK6A 1FNDA 2F1MA 4FK8A 2VNKA 1EP1B 1UD3A 1G7SA 4P26A 4WZTA 1NBMA 2DY1A 5H59A 3CCQB 4P22A 1R5NA 4B3GA 2QGGA 4XQFA 2QTZA 2Q6LA 3PA2A 1DDIA 1QX4A 2DIEA 4KKUA 2XNJA 3BH4A 3ONYA 2Q6OA 2C4UA 4QFMA 4WZEA 1VLOA 2B5OA 3J81k 1OHHA 2P3MA 2J7KA 1H42A 1BLIA 4FWTA 2VNHA 4P25A 2VBUA 2RC5A 3OJXA 3QFSA 4UZFA 5HXBA 3SJPA 3CCMB 4OPVA 3CC7B 2NPFA 2I1LA 3OEEA 2ZZQA 4RPDA 1FRQA 4YEJA 1GO2A 4KKSA 4PC6A 3H94A 4RPBA 3WY9A 2CF4A 2X8KA 4KKTA 4YAWA 4P3IA 1SKYB 3JQQA 1BJKA 4M4SA 3BY2A 3WNDA 1VQLB 4Z4SA 3QFRA 1E3ZA 5THXA
chains in the Genus database with same CATH topology
4G5GA 3MHPA 3G6EB 3FJOA 1VQ5B 3W2IA 1J9ZA 1B23P 4DQLA 1VQKB 1YJNB 1GJRA 2E1RA 3ZZ0A 1TTTA 1F60A 4PGOA 3U6KA 1VQ6B 1VQMB 1KC8D 3AGQA 5GV8A 1N8RD 4BPRA 1NJID 3VO1A 3CD6B 2PIAA 3I56B 1QFYA 4EH1A 3B8HA 4M0LA 1Q81D 3CPWB 3B78A 3ZZUA 1BX1A 1YITB 1G7CA 3AVWA 1XB2A 2YWEA 1F20A 3I55B 4MYUA 2PMDA 4DQKA 3W5UA 1KJZA 3CCJB 4RD4A 2VNIA 4HE5A 4C43A 3OZVA 3CCUB 4NCNA 4HE6A 3W2HA 3CCLB 1AIPA 1FNCA 3WNCA 3W2FA 3U2QA 1W2BB 4UAJA 1D1NA 1QH0A 4H9GA 2OK7A 4TMXA 1K9MD 1QVFB 3AGPA 1QGAA 1KTVA 1ZUNB 2VYQA 1N0VC 1W34A 3ES9A 4Y9RA 2C78A 3P27A 5GV7A 1GAQA 3CMEB 4ZCMA 2DERA 3AVYA 3CXCB 2YWGA 1KK2A 1JJ2B 2BVNA 2AHOA 5FA6A 4LBWA 2BSAA 3W5HA 4N3NA 4ZCLA 2PLFA 2BGJA 2ZITA 1JA1A 4MYTA 4B48A 4AF7A 4ZV4A 2VZLA 2VNJA 3VMFA 3W5VA 4Y7CA 1YIJB 1VQPB 4RD2A 1QG0A 4J0QA 4C0SA 2R6HA 1OGIA 1R5BA 1N0UA 1W35A 4M2LA 1OB2A 1EFCA 1QGZA 2FX3A 2B7CA 1DG1G 3WXMA 3W2EA 4Q7JB 1GR1A 2GQFA 4TMWA 2RC6A 1VQ4B 4LC0A 2GPJA 2QA4B 3CMAB 5KSWB 2YWHA 3ZC3A 1I7PA 4IW3B 1WDTA 3ZZTA 4RJLA 1Q7YD 3WBJA 4RCZA 1JNYA 1QFJA 3VNVA 2X3UA 3E1YE 1QUFA 2BF4A 4ACAA 1ZM9A 1DARA 2XNCA 3MMPA 1S72B 4M1KA 1K73D 1YJWB 5TR9A 1ZM4A 2QDXA 1KRHA 4RD3A 1Q86D 4PC2A 4ZCIA 2BM1A 5TY0A 4FN5A 1KK1A 2YWFA 3OJWA 1VQ9B 4NBSA 2BV3A 4R71A 1D8TA 3I1FA 1OB5A 1SM4A 4LBVA 2C77A 1NDHA 4B47A 2HDNB 1KK3A 4M53A 3U6BA 4RD6A 4P6VF 4Y9UA 4B3XA 1D2EA 1K8AD 3VNUA 1TVCA 4B43A 3E20A 3P26A 4AC9A 3MCAA 1H85A 3CB4A 1A8PA 5H5JA 3JQPA 3VO2A 2OTJB 4PC1A 3PENA 4ACBA 3ZBTA 1HA3A 1TLLA 3V76A 1G7TA 1KK0A 3B82A 3LO8A 5TV2A 1FNBA 1EP3B 3CC4B 1CNEA 3QFCA 1GAWA 1M1KD 1EWYA 4G1VA 3QSYA 1R5OA 1S0UA 4AF6A 4RCYA 3CW2A 4YAFA 1ELOA 3WBKA 4YHBA 3CC2B 1E64A 1BX0A 5JBQA 5DSZA 4QHYA 2HCJB 4TN1A 3ZBUA 3WNBA 3AVTA 5AN9A 3G71B 2CRVA 1FNMA 2DEUA 2BPOA 3WYAA 3CCVB 3CCEB 4TMZA 3W2GA 3AVUA 1YJ9B 1E63A 1G7RA 4LBYA 2D74A 1KQSB 3G4SB 2BMWA 1SKQA 5EMNA 3QE2A 1VQNB 2OK8A 4B4DA 2QTLA 4ZGNB 1VQ7B 3OW2B 1VQOB 2BN4A 1Q82D 3FPKA 1ZM3A 1EFTA 1FRNA 3JQRA 1W87A 2DETA 1M90D 1OGJA 2DCUA 2B7BA 1VQ8B 1U2RA 2QMUA 1EFUA 4ZGQB 1YI2B 1ZM2A 4TMTA 3OZWA 1JA0A 1YHQB 2HMAA 3CRZA 2OTLB 1EXMA 1QFZA 2BGIA 3OZUA 1BQEA 1XE1A 4N3GA 1FDRA 1UMKA 1IJFA 2EIXA 3AVXA 1GVHA 1CQXA 2CNDA 4TMVA 1KD1D 4P3YA 1IB0A 3SJZA 2EFGA 4K1XA 2QN6A 2XEXA 4PC3A 3CCRB 1CNFA 1QUEA 1EP2B 4F7DA 4G1BA 1TUIA 1E62A 4YAOA 1QVGB 1JB9A 4YAUA 4LBZA 4PC7A 2BM0A 3QFTA 4RD0A 3CCSB 1B2RA 3LVBA 4WQMA 1AMOA 4RD1A 1IJEA 4B44A 3AVVA 4YALA 1DDGA 1QGYA 2QEXB 4U9UA 1FNDA 4FK8A 2VNKA 1EP1B 1G7SA 2DY1A 5H59A 3CCQB 1R5NA 2QTZA 1DDIA 1QX4A 2XNJA 4QFMA 2B5OA 3J81k 2J7KA 1H42A 4FWTA 2VNHA 3OJXA 2RC5A 3QFSA 3CCMB 5HXBA 3CC7B 2NPFA 1FRQA 1GO2A 4PC6A 3WY9A 4YAWA 3JQQA 1BJKA 4M4SA 3WNDA 1VQLB 3QFRA 5THXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G5G A;  3MHP A;  3G6E B;  3FJO A;  1VQ5 B;  3W2I A;  1J9Z A;  1B23 P;  4DQL A;  1VQK B;  1YJN B;  1GJR A;  2E1R A;  3ZZ0 A;  1TTT A;  1F60 A;  4PGO A;  3U6K A;  1VQ6 B;  1VQM B;  1KC8 D;  3AGQ A;  5GV8 A;  1N8R D;  4BPR A;  1NJI D;  3VO1 A;  3CD6 B;  2PIA A;  3I56 B;  1QFY A;  4EH1 A;  3B8H A;  4M0L A;  1Q81 D;  3CPW B;  3B78 A;  3ZZU A;  1BX1 A;  1YIT B;  1G7C A;  3AVW A;  1XB2 A;  2YWE A;  1F20 A;  3I55 B;  4MYU A;  2PMD A;  4DQK A;  3W5U A;  1KJZ A;  3CCJ B;  4RD4 A;  2VNI A;  4HE5 A;  4C43 A;  3OZV A;  3CCU B;  4NCN A;  4HE6 A;  3W2H A;  3CCL B;  1AIP A;  1FNC A;  3WNC A;  3W2F A;  3U2Q A;  1W2B B;  4UAJ A;  1D1N A;  1QH0 A;  4H9G A;  2OK7 A;  4TMX A;  1K9M D;  1QVF B;  3AGP A;  1QGA A;  1KTV A;  1ZUN B;  2VYQ A;  1N0V C;  1W34 A;  3ES9 A;  4Y9R A;  2C78 A;  3P27 A;  5GV7 A;  1GAQ A;  3CME B;  4ZCM A;  2DER A;  3AVY A;  3CXC B;  2YWG A;  1KK2 A;  1JJ2 B;  2BVN A;  2AHO A;  5FA6 A;  4LBW A;  2BSA A;  3W5H A;  4N3N A;  4ZCL A;  2PLF A;  2BGJ A;  2ZIT A;  1JA1 A;  4MYT A;  4B48 A;  4AF7 A;  4ZV4 A;  2VZL A;  2VNJ A;  3VMF A;  3W5V A;  4Y7C A;  1YIJ B;  1VQP B;  4RD2 A;  1QG0 A;  4J0Q A;  4C0S A;  2R6H A;  1OGI A;  1R5B A;  1N0U A;  1W35 A;  4M2L A;  1OB2 A;  1EFC A;  1QGZ A;  2FX3 A;  2B7C A;  1DG1 G;  3WXM A;  3W2E A;  4Q7J B;  1GR1 A;  2GQF A;  4TMW A;  2RC6 A;  1VQ4 B;  4LC0 A;  2GPJ A;  2QA4 B;  3CMA B;  5KSW B;  2YWH A;  3ZC3 A;  1I7P A;  4IW3 B;  1WDT A;  3ZZT A;  4RJL A;  1Q7Y D;  3WBJ A;  4RCZ A;  1JNY A;  1QFJ A;  3VNV A;  2X3U A;  3E1Y E;  1QUF A;  2BF4 A;  4ACA A;  1ZM9 A;  1DAR A;  2XNC A;  3MMP A;  1S72 B;  4M1K A;  1K73 D;  1YJW B;  5TR9 A;  1ZM4 A;  2QDX A;  1KRH A;  4RD3 A;  1Q86 D;  4PC2 A;  4ZCI A;  2BM1 A;  5TY0 A;  4FN5 A;  1KK1 A;  2YWF A;  3OJW A;  1VQ9 B;  4NBS A;  2BV3 A;  4R71 A;  1D8T A;  3I1F A;  1OB5 A;  1SM4 A;  4LBV A;  2C77 A;  1NDH A;  4B47 A;  2HDN B;  1KK3 A;  4M53 A;  3U6B A;  4RD6 A;  4P6V F;  4Y9U A;  4B3X A;  1D2E A;  1K8A D;  3VNU A;  1TVC A;  4B43 A;  3E20 A;  3P26 A;  4AC9 A;  3MCA A;  1H85 A;  3CB4 A;  1A8P A;  5H5J A;  3JQP A;  3VO2 A;  2OTJ B;  4PC1 A;  3PEN A;  4ACB A;  3ZBT A;  1HA3 A;  1TLL A;  3V76 A;  1G7T A;  1KK0 A;  3B82 A;  3LO8 A;  5TV2 A;  1FNB A;  1EP3 B;  3CC4 B;  1CNE A;  3QFC A;  1GAW A;  1M1K D;  1EWY A;  4G1V A;  3QSY A;  1R5O A;  1S0U A;  4AF6 A;  4RCY A;  3CW2 A;  4YAF A;  1ELO A;  3WBK A;  4YHB A;  3CC2 B;  1E64 A;  1BX0 A;  5JBQ A;  5DSZ A;  4QHY A;  2HCJ B;  4TN1 A;  3ZBU A;  3WNB A;  3AVT A;  5AN9 A;  3G71 B;  2CRV A;  1FNM A;  2DEU A;  2BPO A;  3WYA A;  3CCV B;  3CCE B;  4TMZ A;  3W2G A;  3AVU A;  1YJ9 B;  1E63 A;  1G7R A;  4LBY A;  2D74 A;  1KQS B;  3G4S B;  2BMW A;  1SKQ A;  5EMN A;  3QE2 A;  1VQN B;  2OK8 A;  4B4D A;  2QTL A;  4ZGN B;  1VQ7 B;  3OW2 B;  1VQO B;  2BN4 A;  1Q82 D;  3FPK A;  1ZM3 A;  1EFT A;  1FRN A;  3JQR A;  1W87 A;  2DET A;  1M90 D;  1OGJ A;  2DCU A;  2B7B A;  1VQ8 B;  1U2R A;  2QMU A;  1EFU A;  4ZGQ B;  1YI2 B;  1ZM2 A;  4TMT A;  3OZW A;  1JA0 A;  1YHQ B;  2HMA A;  3CRZ A;  2OTL B;  1EXM A;  1QFZ A;  2BGI A;  3OZU A;  1BQE A;  1XE1 A;  4N3G A;  1FDR A;  1UMK A;  1IJF A;  2EIX A;  3AVX A;  1GVH A;  1CQX A;  2CND A;  4TMV A;  1KD1 D;  4P3Y A;  1IB0 A;  3SJZ A;  2EFG A;  4K1X A;  2QN6 A;  2XEX A;  4PC3 A;  3CCR B;  1CNF A;  1QUE A;  1EP2 B;  4F7D A;  4G1B A;  1TUI A;  1E62 A;  4YAO A;  1QVG B;  1JB9 A;  4YAU A;  4LBZ A;  4PC7 A;  2BM0 A;  3QFT A;  4RD0 A;  3CCS B;  1B2R A;  3LVB A;  4WQM A;  1AMO A;  4RD1 A;  1IJE A;  4B44 A;  3AVV A;  4YAL A;  1DDG A;  1QGY A;  2QEX B;  4U9U A;  1FND A;  4FK8 A;  2VNK A;  1EP1 B;  1G7S A;  2DY1 A;  5H59 A;  3CCQ B;  1R5N A;  2QTZ A;  1DDI A;  1QX4 A;  2XNJ A;  4QFM A;  2B5O A;  3J81 k;  2J7K A;  1H42 A;  4FWT A;  2VNH A;  3OJX A;  2RC5 A;  3QFS A;  3CCM B;  5HXB A;  3CC7 B;  2NPF A;  1FRQ A;  1GO2 A;  4PC6 A;  3WY9 A;  4YAW A;  3JQQ A;  1BJK A;  4M4S A;  3WND A;  1VQL B;  3QFR A;  5THX A; 
#chains in the Genus database with same CATH topology
 2V31 A;  4G5G A;  3MHP A;  3G6E B;  5LMZ A;  3FJO A;  1VQ5 B;  2X6X A;  1BMF A;  1UD6 A;  3W2I A;  1J9Z A;  1B23 P;  4DQL A;  4XLE A;  1VQK B;  1YJN B;  1GJR A;  2ZXI A;  2E1R A;  4QVA A;  3ZZ0 A;  1TTT A;  1F60 A;  4PGO A;  3U6K A;  1VQ6 B;  5BSX A;  1VQM B;  1Y0R A;  1KC8 D;  2X6Y A;  3CPX A;  3AGQ A;  3FKS A;  5GV8 A;  4P12 A;  1N8R D;  3KEW A;  3GVJ A;  4BPR A;  3BQJ A;  1NJI D;  2C5H A;  3VO1 A;  3CD6 B;  2PIA A;  4YXW A;  3I56 B;  1QFY A;  4NNJ A;  4EH1 A;  3B8H A;  4M0L A;  2JN9 A;  4OPO A;  1Q81 D;  3CPW B;  3B78 A;  3ZZU A;  2XZP A;  1COW A;  4XLF A;  1BX1 A;  1YIT B;  3WQZ A;  1G7C A;  1T6Y A;  2JIZ A;  2F43 A;  2VJJ A;  3AVW A;  1XB2 A;  2HLD A;  2YWE A;  3G05 A;  1F20 A;  3I55 B;  4MYU A;  2PMD A;  4DQK A;  3W5U A;  1KJZ A;  3CCJ B;  4RD4 A;  2VNI A;  3ASS A;  4HE5 A;  4C43 A;  4RDK A;  5IYR A;  3OZV A;  3AST A;  4NCN A;  4HE6 A;  3CCU B;  3OFN A;  1H8H A;  3W2H A;  3PUM A;  1UD5 A;  3CCL B;  2D9R A;  1AIP A;  4X7E A;  3SEJ A;  1FNC A;  3WNC A;  4XLC A;  4X7F A;  3W2F A;  1P4M A;  3U2Q A;  3BNW A;  1PJ6 A;  2WZP P;  4B3F X;  4OP7 A;  3GVK A;  1W2B B;  4UAJ A;  2R9V A;  1D1N A;  1QH0 A;  4H9G A;  2OK7 A;  2CC2 A;  2F4N A;  3ASQ A;  4TMX A;  4UZE A;  1K9M D;  3A1P A;  1QVF B;  3AGP A;  4DK0 A;  1N08 A;  1QGA A;  1KTV A;  1WOS A;  5TRD A;  1ZUN B;  2ZBV A;  2D3L A;  2VYQ A;  1N0V C;  1W34 A;  3ES9 A;  4Y9R A;  5FO1 A;  2C78 A;  4PAB A;  1Y0Y A;  3P27 A;  4OPS A;  3PA1 A;  5GV7 A;  1GAQ A;  2JJ2 A;  3CME B;  2V4D A;  4ZCM A;  2DER A;  3A8J A;  4XOR A;  4RM0 A;  4Z4Z A;  3AVY A;  3R6J A;  3CXC B;  2YWG A;  1KK2 A;  4X0C A;  2BVN A;  1JJ2 B;  2AHO A;  5FA6 A;  4LBW A;  3BY1 A;  1WOO A;  2BSA A;  3W5H A;  4N3N A;  4ZCL A;  2PLF A;  4QVJ A;  4TSF A;  5F4M A;  2BGJ A;  4DNT B;  2WJV A;  2ZIT A;  2X53 S;  2JDI A;  1JA1 A;  4MYT A;  4B48 A;  4AF7 A;  4ZV4 A;  2VZL A;  2VNJ A;  3VMF A;  3W5V A;  4Y7C A;  1YIJ B;  1VQP B;  4RD2 A;  1QG0 A;  4J0Q A;  4C0S A;  5FL7 A;  3CMM A;  2Z6B D;  3LQE A;  2R6H A;  1OGI A;  2ZZG A;  1R5B A;  1N0U A;  1W35 A;  4M2L A;  4II3 A;  2NV4 A;  3OEH A;  1OB2 A;  2JJ1 A;  3SLN A;  1EFC A;  1QGZ A;  2FX3 A;  4XMY A;  2B7C A;  5IK2 A;  4Z4W A;  2V7V A;  1DG1 G;  3LQ6 A;  5BSY A;  4P9S A;  4XL9 A;  2C2W A;  3WXM A;  4XD7 A;  3W2E A;  1PJ5 A;  4Q7J B;  1GR1 A;  4Z4U A;  1S4M A;  2V7U A;  2GQF A;  1HVX A;  4TMW A;  4UZU A;  2RC6 A;  1VQ4 B;  4LC0 A;  1WSV A;  2GPJ A;  4XNF A;  2QA4 B;  3CMA B;  5KSW B;  2YWH A;  4IW3 B;  1I7P A;  3ZC3 A;  1WDT A;  3CTA A;  4RJL A;  3ZZT A;  2XND A;  1Q7Y D;  2ZZE A;  3WBJ A;  2E1B A;  3FPP A;  4RCZ A;  3H9N A;  5DN6 A;  1JNY A;  3ISX A;  3OE7 A;  4HIZ A;  1YX2 A;  2QE7 A;  1QFJ A;  3VNV A;  2X3U A;  4QV2 A;  3E1Y E;  1QUF A;  3A8K A;  2OBT A;  4G6I A;  2D3N A;  2BF4 A;  4ACA A;  1RQR A;  1ZM9 A;  1DAR A;  2XNC A;  3MMP A;  1T6Z A;  1S72 B;  4M1K A;  1K73 D;  3A8I A;  3Q6Q A;  1YJW B;  2FVG A;  5TR9 A;  4OOV A;  1W9X A;  5F4O A;  1UD8 A;  1ZM4 A;  2QDX A;  1KRH A;  3GIR A;  4WZK A;  4RD3 A;  4RDJ A;  5HKK A;  1Q86 D;  5CDF A;  4X05 A;  4RDL A;  2VBS A;  4PC2 A;  4ZCI A;  4XN3 A;  2BM1 A;  4XLA A;  5TY0 A;  5A8A A;  4FN5 A;  1KK1 A;  1V5V A;  2YWF A;  3HAG A;  4XLH A;  1WOR A;  3OJW A;  4X7C A;  1VQ9 B;  4NBS A;  1K28 D;  2V7T A;  1NB0 A;  2BV3 A;  2GJP A;  5FO0 A;  4X7D A;  4R71 A;  1D8T A;  3T56 B;  3I1F A;  1N05 A;  3A3B A;  1OB5 A;  1SM4 A;  1RQP A;  4LBV A;  4P1V A;  1WTH D;  2C77 A;  1NDH A;  4B47 A;  1FX0 A;  4FXU A;  5F4J A;  3BCD A;  2HDN B;  1MRZ A;  3Q6R A;  3BC9 A;  1KK3 A;  2ZL5 A;  4M53 A;  2WZN A;  3Q3A A;  1V0E A;  4E0F A;  1KMH A;  1OB0 A;  5B6I A;  2GRE A;  4G7X A;  3U6B A;  4RD6 A;  4XKV A;  4P6V F;  4Y9U A;  4B3X A;  1D2E A;  4CQJ A;  1K8A D;  4WZL A;  3VNU A;  2GJR A;  5IYW A;  1VHE A;  1TVC A;  4B43 A;  3E20 A;  3P26 A;  4AC9 A;  3MCA A;  1H85 A;  3CB4 A;  1A8P A;  4DNR B;  2DYI A;  5H5J A;  3JQP A;  3VO2 A;  2OTJ B;  3A35 A;  3SLD A;  4PC1 A;  3PEN A;  2DOG A;  4XR6 A;  4ACB A;  3ZBT A;  2X6W A;  1XQB A;  3ZPN A;  3T53 B;  2ZXH A;  1HA3 A;  1MAB A;  1TLL A;  3V76 A;  1G7T A;  2X85 A;  2WYR A;  1KK0 A;  3B82 A;  2V7W A;  4Z4V A;  3LO8 A;  4GQN A;  5TV2 A;  5IYP A;  1FNB A;  1EP3 B;  2XOK A;  2XZL A;  3ZUG A;  3CC4 B;  1CNE A;  3QFC A;  3ASR A;  4ROX A;  2W6J A;  2GJK A;  4QUZ A;  1GAW A;  1M1K D;  1EWY A;  1UD4 A;  3ONU A;  4G1V A;  1R5O A;  3QSY A;  1YLO A;  1E1R A;  2C4T A;  2XZO A;  3CES A;  1S0U A;  3BCF A;  4AF6 A;  4RCY A;  3CW2 A;  2GK7 A;  5FNZ A;  2VBT A;  4RLZ A;  3PVD A;  4YAF A;  1WOP A;  1E79 A;  1PKV A;  5IYQ A;  1ELO A;  3WBK A;  3GQB A;  3Q38 A;  1W0K A;  1PJ7 A;  4YHB A;  4G7W A;  4TT3 A;  3CC2 B;  4XON A;  1E64 A;  5L46 A;  1BX0 A;  2Q6K A;  4X8I A;  4XOT A;  5KNL A;  4Z4R A;  1E3X A;  4XKW A;  5JBQ A;  5DSZ A;  4QHY A;  2HCJ B;  4TN1 A;  3ZBU A;  3WNB A;  1Q9S A;  2C5B A;  1VLY A;  1I8D A;  3V7A A;  3G71 B;  5AN9 A;  2CK3 A;  3CP8 A;  3R6K A;  4P2N A;  1HZE A;  3OOC A;  2ZL7 A;  4Z4Y A;  2CRV A;  1V0F A;  2ZZF A;  3RY8 A;  1FNM A;  3PUN A;  2ZBU A;  2CBX A;  1N06 A;  3OPO A;  2F1L A;  2DEU A;  2BPO A;  1W0J A;  3WYA A;  3CCV B;  2VJI A;  2WJY A;  1VHO A;  1XFO A;  3CCE B;  1WP6 A;  4TMZ A;  5J3O A;  3W2G A;  1NB9 A;  3AVU A;  1YJ9 B;  3OW7 A;  4P6Y A;  1E63 A;  4JMQ A;  1G7R A;  4LBY A;  4XN0 A;  1E43 A;  1N07 A;  2D74 A;  1KQS B;  3G4S B;  1VF7 A;  3ASP A;  1I18 A;  3CP2 A;  3SKB A;  2ZTN A;  1EFR A;  2BMW A;  4II2 A;  1SKQ A;  5EMN A;  4Z4T A;  3QE2 A;  1VQN B;  1WU8 A;  2KVO A;  2OK8 A;  4B4D A;  2PE3 A;  2QTL A;  2WR8 A;  3ZIA A;  4YEL A;  1T6X A;  2M5S A;  4ZGN B;  1VQ7 B;  3OW2 B;  1WSR A;  2BN4 A;  2OBR A;  1VQO B;  1Q82 D;  3FPK A;  5A88 A;  1ZM3 A;  1EFT A;  4AVZ A;  3Q39 A;  1FRN A;  3JQR A;  2ZL6 A;  5HZA A;  1W87 A;  5J35 A;  5KW9 A;  2DET A;  1M90 D;  1OGJ A;  5DS0 A;  2DCU A;  2B7B A;  1VQ8 B;  2WPD A;  1U2R A;  2QMU A;  4WWV A;  1EFU A;  2OYN A;  2V7X A;  3NE5 B;  3T51 B;  2WSS A;  4ZGQ B;  4Z1M A;  1YI2 B;  3JU4 A;  5FIU A;  3AVT A;  1WPC A;  4PAA A;  1ZM2 A;  4L8J A;  1T5E A;  4TMT A;  3OZW A;  4DK1 A;  1JA0 A;  2ZTG A;  1YHQ B;  2HMA A;  3LNN A;  5HZB A;  3D26 A;  3CRZ A;  2OTL B;  1EXM A;  1E1Q A;  1NRK A;  1QFZ A;  2BGI A;  2VBV A;  3GVL A;  1BQE A;  1BPL A;  1XE1 A;  3OZU A;  4N3G A;  1FDR A;  1UMK A;  1IJF A;  2EIX A;  2X0K A;  4X06 A;  3AVX A;  1GVH A;  1CQX A;  2CND A;  4TMV A;  1KD1 D;  4P3Y A;  1IB0 A;  1KZL A;  5E6T A;  1IHM A;  3OP1 A;  3SJZ A;  3KL9 A;  2EFG A;  2OBS A;  4K1X A;  4X07 A;  2LZJ A;  2QN6 A;  2XEX A;  3A3G A;  4OOX A;  4PC3 A;  3CCR B;  1CNF A;  2XGJ A;  1QUE A;  1EP2 B;  2V7Q A;  3OKX A;  4F7D A;  3VR6 A;  5A89 A;  4ASU A;  4G1B A;  1TUI A;  1E62 A;  1H8E A;  4XOP A;  3DDY A;  4YAO A;  5IYN A;  1QVG B;  1JB9 A;  4YAU A;  4LBZ A;  4PC7 A;  2W6I A;  2BM0 A;  3GSI A;  4TKO B;  4XM3 A;  3QFT A;  2CW5 A;  3OAA A;  2Q6I A;  4RD0 A;  3CCS B;  4OOS A;  1B2R A;  1VJS A;  3LVB A;  4WQM A;  1UD2 A;  1AMO A;  4RD1 A;  1IJE A;  4B44 A;  3AVV A;  4YAL A;  1DDG A;  1QGY A;  2QEX B;  4U9U A;  2GK6 A;  1FND A;  2F1M A;  4FK8 A;  2VNK A;  1EP1 B;  1UD3 A;  1G7S A;  4P26 A;  4WZT A;  1NBM A;  2DY1 A;  5H59 A;  3CCQ B;  4P22 A;  1R5N A;  4B3G A;  2QGG A;  4XQF A;  2QTZ A;  2Q6L A;  3PA2 A;  1DDI A;  1QX4 A;  2DIE A;  4KKU A;  2XNJ A;  3BH4 A;  3ONY A;  2Q6O A;  2C4U A;  4QFM A;  4WZE A;  1VLO A;  2B5O A;  3J81 k;  1OHH A;  2P3M A;  2J7K A;  1H42 A;  1BLI A;  4FWT A;  2VNH A;  4P25 A;  2VBU A;  2RC5 A;  3OJX A;  3QFS A;  4UZF A;  5HXB A;  3SJP A;  3CCM B;  4OPV A;  3CC7 B;  2NPF A;  2I1L A;  3OEE A;  2ZZQ A;  4RPD A;  1FRQ A;  4YEJ A;  1GO2 A;  4KKS A;  4PC6 A;  3H94 A;  4RPB A;  3WY9 A;  2CF4 A;  2X8K A;  4KKT A;  4YAW A;  4P3I A;  1SKY B;  3JQQ A;  1BJK A;  4M4S A;  3BY2 A;  3WND A;  1VQL B;  4Z4S A;  3QFR A;  1E3Z A;  5THX A; 
#chains in the Genus database with same CATH homology
 4G5G A;  3MHP A;  3G6E B;  3FJO A;  1VQ5 B;  3W2I A;  1J9Z A;  1B23 P;  4DQL A;  1VQK B;  1YJN B;  1GJR A;  2E1R A;  3ZZ0 A;  1TTT A;  1F60 A;  4PGO A;  3U6K A;  1VQ6 B;  1VQM B;  1KC8 D;  3AGQ A;  5GV8 A;  1N8R D;  4BPR A;  1NJI D;  3VO1 A;  3CD6 B;  2PIA A;  3I56 B;  1QFY A;  4EH1 A;  3B8H A;  4M0L A;  1Q81 D;  3CPW B;  3B78 A;  3ZZU A;  1BX1 A;  1YIT B;  1G7C A;  3AVW A;  1XB2 A;  2YWE A;  1F20 A;  3I55 B;  4MYU A;  2PMD A;  4DQK A;  3W5U A;  1KJZ A;  3CCJ B;  4RD4 A;  2VNI A;  4HE5 A;  4C43 A;  3OZV A;  3CCU B;  4NCN A;  4HE6 A;  3W2H A;  3CCL B;  1AIP A;  1FNC A;  3WNC A;  3W2F A;  3U2Q A;  1W2B B;  4UAJ A;  1D1N A;  1QH0 A;  4H9G A;  2OK7 A;  4TMX A;  1K9M D;  1QVF B;  3AGP A;  1QGA A;  1KTV A;  1ZUN B;  2VYQ A;  1N0V C;  1W34 A;  3ES9 A;  4Y9R A;  2C78 A;  3P27 A;  5GV7 A;  1GAQ A;  3CME B;  4ZCM A;  2DER A;  3AVY A;  3CXC B;  2YWG A;  1KK2 A;  1JJ2 B;  2BVN A;  2AHO A;  5FA6 A;  4LBW A;  2BSA A;  3W5H A;  4N3N A;  4ZCL A;  2PLF A;  2BGJ A;  2ZIT A;  1JA1 A;  4MYT A;  4B48 A;  4AF7 A;  4ZV4 A;  2VZL A;  2VNJ A;  3VMF A;  3W5V A;  4Y7C A;  1YIJ B;  1VQP B;  4RD2 A;  1QG0 A;  4J0Q A;  4C0S A;  2R6H A;  1OGI A;  1R5B A;  1N0U A;  1W35 A;  4M2L A;  1OB2 A;  1EFC A;  1QGZ A;  2FX3 A;  2B7C A;  1DG1 G;  3WXM A;  3W2E A;  4Q7J B;  1GR1 A;  2GQF A;  4TMW A;  2RC6 A;  1VQ4 B;  4LC0 A;  2GPJ A;  2QA4 B;  3CMA B;  5KSW B;  2YWH A;  3ZC3 A;  1I7P A;  4IW3 B;  1WDT A;  3ZZT A;  4RJL A;  1Q7Y D;  3WBJ A;  4RCZ A;  1JNY A;  1QFJ A;  3VNV A;  2X3U A;  3E1Y E;  1QUF A;  2BF4 A;  4ACA A;  1ZM9 A;  1DAR A;  2XNC A;  3MMP A;  1S72 B;  4M1K A;  1K73 D;  1YJW B;  5TR9 A;  1ZM4 A;  2QDX A;  1KRH A;  4RD3 A;  1Q86 D;  4PC2 A;  4ZCI A;  2BM1 A;  5TY0 A;  4FN5 A;  1KK1 A;  2YWF A;  3OJW A;  1VQ9 B;  4NBS A;  2BV3 A;  4R71 A;  1D8T A;  3I1F A;  1OB5 A;  1SM4 A;  4LBV A;  2C77 A;  1NDH A;  4B47 A;  2HDN B;  1KK3 A;  4M53 A;  3U6B A;  4RD6 A;  4P6V F;  4Y9U A;  4B3X A;  1D2E A;  1K8A D;  3VNU A;  1TVC A;  4B43 A;  3E20 A;  3P26 A;  4AC9 A;  3MCA A;  1H85 A;  3CB4 A;  1A8P A;  5H5J A;  3JQP A;  3VO2 A;  2OTJ B;  4PC1 A;  3PEN A;  4ACB A;  3ZBT A;  1HA3 A;  1TLL A;  3V76 A;  1G7T A;  1KK0 A;  3B82 A;  3LO8 A;  5TV2 A;  1FNB A;  1EP3 B;  3CC4 B;  1CNE A;  3QFC A;  1GAW A;  1M1K D;  1EWY A;  4G1V A;  3QSY A;  1R5O A;  1S0U A;  4AF6 A;  4RCY A;  3CW2 A;  4YAF A;  1ELO A;  3WBK A;  4YHB A;  3CC2 B;  1E64 A;  1BX0 A;  5JBQ A;  5DSZ A;  4QHY A;  2HCJ B;  4TN1 A;  3ZBU A;  3WNB A;  3AVT A;  5AN9 A;  3G71 B;  2CRV A;  1FNM A;  2DEU A;  2BPO A;  3WYA A;  3CCV B;  3CCE B;  4TMZ A;  3W2G A;  3AVU A;  1YJ9 B;  1E63 A;  1G7R A;  4LBY A;  2D74 A;  1KQS B;  3G4S B;  2BMW A;  1SKQ A;  5EMN A;  3QE2 A;  1VQN B;  2OK8 A;  4B4D A;  2QTL A;  4ZGN B;  1VQ7 B;  3OW2 B;  1VQO B;  2BN4 A;  1Q82 D;  3FPK A;  1ZM3 A;  1EFT A;  1FRN A;  3JQR A;  1W87 A;  2DET A;  1M90 D;  1OGJ A;  2DCU A;  2B7B A;  1VQ8 B;  1U2R A;  2QMU A;  1EFU A;  4ZGQ B;  1YI2 B;  1ZM2 A;  4TMT A;  3OZW A;  1JA0 A;  1YHQ B;  2HMA A;  3CRZ A;  2OTL B;  1EXM A;  1QFZ A;  2BGI A;  3OZU A;  1BQE A;  1XE1 A;  4N3G A;  1FDR A;  1UMK A;  1IJF A;  2EIX A;  3AVX A;  1GVH A;  1CQX A;  2CND A;  4TMV A;  1KD1 D;  4P3Y A;  1IB0 A;  3SJZ A;  2EFG A;  4K1X A;  2QN6 A;  2XEX A;  4PC3 A;  3CCR B;  1CNF A;  1QUE A;  1EP2 B;  4F7D A;  4G1B A;  1TUI A;  1E62 A;  4YAO A;  1QVG B;  1JB9 A;  4YAU A;  4LBZ A;  4PC7 A;  2BM0 A;  3QFT A;  4RD0 A;  3CCS B;  1B2R A;  3LVB A;  4WQM A;  1AMO A;  4RD1 A;  1IJE A;  4B44 A;  3AVV A;  4YAL A;  1DDG A;  1QGY A;  2QEX B;  4U9U A;  1FND A;  4FK8 A;  2VNK A;  1EP1 B;  1G7S A;  2DY1 A;  5H59 A;  3CCQ B;  1R5N A;  2QTZ A;  1DDI A;  1QX4 A;  2XNJ A;  4QFM A;  2B5O A;  3J81 k;  2J7K A;  1H42 A;  4FWT A;  2VNH A;  3OJX A;  2RC5 A;  3QFS A;  3CCM B;  5HXB A;  3CC7 B;  2NPF A;  1FRQ A;  1GO2 A;  4PC6 A;  3WY9 A;  4YAW A;  3JQQ A;  1BJK A;  4M4S A;  3WND A;  1VQL B;  3QFR A;  5THX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...