3E20A

Crystal structure of s.pombe erf1/erf3 complex
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
196
structure length
196
Chain Sequence
b'APFIMPIASKYKDLGTILEGKIEAGSIKKNSNVLVMPINQTLEVTAIYDEADEEISSSICGDQVRLRVRGDDSDVQTGYVLTSTKNPVHATTRFIAQIAILELPSILTTGYSCVMHIHTAVEEVSFAKLLHKLDKTNRKSKKPPMFATKGMKIIAELETQTPVCMERFEDYQYMGRFTLRDQGTTVAVGKVVKILD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Eukaryotic peptide chain release factor GTP-binding subunit
molecule tags Translation
source organism Schizosaccharomyces pombe
publication title Structural insights into eRF3 and stop codon recognition by eRF1
pubmed doi rcsb
total genus 32
structure length 196
sequence length 196
chains with identical sequence D, E, J
ec nomenclature
pdb deposition date 2008-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03143 GTP_EFTU_D3 Elongation factor Tu C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 3e20A02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 3e20A01
3CCMB 2PLFA 1E62A 4H9GA 3ZBUA 1EFUA 1FNCA 2DETA 2E1RA 3V76A 1IJEA 1BQEA 4G1VA 2J7KA 3G6EB 3AGQA 1QFZA 3CCJB 1VQ7B 1S72B 1D1NA 1EP3B 4YAOA 2QA4B 1KC8D 1GAWA 2QN6A 1IB0A 2GQFA 2DY1A 1QFJA 3W2EA 4B43A 1QGAA 3CCQB 3CCLB 3ZZTA 4DQKA 4UAJA 4FWTA 1TTTA 2OK7A 3AVTA 1OB2A 4IW3B 3OJXA 4PC6A 4RD2A 2BN4A 1QX4A 3WNBA 3MCAA 3U2QA 4RD6A 5EMNA 2B5OA 2BGJA 1K9MD 1KQSB 3AVUA 3G4SB 4RD0A 5GV8A 1W87A 1W35A 1SM4A 3W2HA 3WNCA 1M90D 1F60A 1JNYA 5HXBA 3MHPA 4M53A 3CD6B 4FK8A 4TMWA 2QEXB 4Y7CA 1B2RA 1VQPB 3CW2A 1F20A 3CCSB 1JB9A 4M4SA 3P26A 4F7DA 1VQNB 1XB2A 1W2BB 4B47A 3I55B 2BVNA 4YAWA 3CMEB 1GR1A 5DSZA 1KTVA 4M0LA 3I1FA 1YHQB 5H59A 1FNDA 1EP1B 1N0UA 2CRVA 4ZCLA 1QVFB 4TN1A 2EIXA 4WQMA 4J0QA 4N3NA 2B7BA 1H42A 3W2GA 3J81k 2VNIA 1K8AD 4ZCIA 1JA0A 2D74A 1EP2B 3W2FA 3CC2B 1IJFA 3OZUA 1VQ4B 1ZM2A 1Q82D 1FRQA 2QDXA 4B48A 2BM1A 4NCNA 2OTJB 4ACBA 1R5OA 1EFCA 1AIPA 3QFSA 1U2RA 3ES9A 1FNBA 1DDIA 1Q86D 1QGYA 2B7CA 1G7SA 1D8TA 2YWFA 1VQKB 1KJZA 1CQXA 3WBKA 3W5VA 3FPKA 4QFMA 1DG1G 1KK0A 1VQOB 4PC3A 4AC9A 4RD1A 1QVGB 1G7CA 4PGOA 1G7TA 5KSWB 1GO2A 1M1KD 4B3XA 1FNMA 1KK3A 2VNKA 3LO8A 3JQPA 1G7RA 3ZZ0A 5TV2A 2ZITA 4MYUA 2BPOA 4RCZA 4B4DA 3JQRA 3E20A 4LC0A 3W5HA 2NPFA 1ZM3A 3W2IA 2PMDA 4K1XA 3OZWA 1KD1D 4ZGQB 4YAFA 4Y9UA 1AMOA 3ZBTA 1VQLB 3QFCA 4ZCMA 1R5BA 3CRZA 1KRHA 4M1KA 2BMWA 1ZM9A 4AF7A 3I56B 2XNJA 4R71A 1HA3A 2C78A 2VNJA 2AHOA 5H5JA 4HE5A 1D2EA 3JQQA 4Y9RA 3B78A 2QTZA 3AVYA 1GAQA 3ZZUA 1NJID 4G1BA 3CCVB 1YJWB 1J9ZA 2BSAA 3QE2A 1CNFA 4M2LA 1I7PA 4EH1A 4LBYA 3W5UA 1Q7YD 3LVBA 3WBJA 3OW2B 2HCJB 1YITB 3B8HA 1YIJB 2C77A 3WYAA 1Q81D 3AVXA 1DARA 1KK2A 3OZVA 4PC2A 2EFGA 3QSYA 1WDTA 4U9UA 1EFTA 2DEUA 1JA1A 1BX1A 4TMXA 2YWEA 4C0SA 3CMAB 3VNUA 3VO1A 4P3YA 4ACAA 4TMVA 2GPJA 4DQLA 3QFRA 4RD3A 4LBWA 1BX0A 4PC7A 4BPRA 2YWHA 1DDGA 5TR9A 1N8RD 3U6BA 1UMKA 4ZV4A 3CC7B 4ZGNB 1OB5A 3WXMA 2FX3A 1E63A 1CNEA 3FJOA 2DCUA 2VYQA 4B44A 3WY9A 1XE1A 1ELOA 5FA6A 3CPWB 3CCRB 1OGJA 2BV3A 5THXA 1QG0A 5AN9A 1VQMB 3AVVA 3VMFA 2DERA 4YAUA 4FN5A 2VZLA 1OGIA 3B82A 3CCUB 3OJWA 1VQ9B 2VNHA 3CC4B 3G71B 2BM0A 1TVCA 2HMAA 1GVHA 3MMPA 4YALA 4LBZA 3E1YE 2BGIA 1GJRA 3U6KA 1KK1A 2XEXA 3SJZA 3CXCB 1FDRA 3AGPA 2CNDA 1VQ6B 1A8PA 3PENA 4RJLA 4RD4A 1QUEA 4N3GA 4TMTA 2OTLB 4C43A 3VNVA 3CB4A 1YI2B 4MYTA 1QFYA 5GV7A 4HE6A 4AF6A 2X3UA 4Q7JB 2XNCA 2OK8A 3QFTA 1E64A 2YWGA 1QH0A 1YJ9B 1S0UA 1QUFA 1R5NA 2R6HA 4PC1A 1H85A 3VO2A 4LBVA 1K73D 4YHBA 1JJ2B 5JBQA 1ZUNB 3P27A 4RCYA 1TLLA 3ZC3A 2HDNB 1N0VC 1VQ5B 2RC5A 1ZM4A 4QHYA 5TY0A 3CCEB 1NDHA 3WNDA 1YJNB 1EXMA 1TUIA 2PIAA 4G5GA 4P6VF 4NBSA 4TMZA 1QGZA 1B23P 1VQ8B 1EWYA 1FRNA 1W34A 1BJKA 1SKQA 2QTLA 3AVWA 2BF4A 2RC6A 2QMUA
chains in the Genus database with same CATH superfamily
3CCMB 4P3IA 2PLFA 4P1VA 1E62A 4H9GA 3ZBUA 1P4MA 3LQ6A 1EFUA 1FNCA 4Z1MA 2DETA 2E1RA 3V76A 1IJEA 2I1LA 4L8JA 1BQEA 1T6ZA 4G1VA 4UZFA 4XNFA 2J7KA 3Q6RA 2ZTGA 3ONUA 3G6EB 3AGQA 1QFZA 3A8IA 3CCJB 1WPCA 1VQ7B 2D9RA 1S72B 1WU8A 1D1NA 1EP3B 1OB0A 2X6XA 4XD7A 4YAOA 5F4MA 2QA4B 1KC8D 5BSXA 1GAWA 2QN6A 3H94A 1IB0A 2GQFA 2DY1A 1QFJA 3CESA 3W2EA 4B43A 4QUZA 2D3NA 3BCFA 4UZUA 1QGAA 1PJ6A 2C5HA 4G6IA 3CCQB 1T6YA 2FVGA 5BSYA 3CCLB 3ZZTA 1WORA 4DQKA 4UAJA 3D26A 4FWTA 1TTTA 2OK7A 3AVTA 2XGJA 2LZJA 1OB2A 2X8KA 2M5SA 4XLFA 3H9NA 4P12A 4X7EA 4IW3B 4QV2A 3ZPNA 4Z4WA 3OJXA 5IYPA 4PC6A 2WSSA 4RD2A 2BN4A 3OW7A 1QX4A 3WNBA 3MCAA 3U2QA 4Z4RA 4RD6A 5EMNA 5A88A 4X7CA 2B5OA 2BGJA 1K9MD 4YEJA 5FO1A 1KQSB 3AVUA 4JMQA 4II2A 3ISXA 2D3LA 1NBMA 2V7TA 3G4SB 1BLIA 4RD0A 5GV8A 1W87A 4E0FA 1W35A 1SM4A 3W2HA 3WNCA 4DNTB 4WWVA 1M90D 1F60A 1JNYA 1YLOA 2XZPA 3GVKA 3R6JA 4TSFA 5HXBA 3MHPA 4M53A 4YELA 3CD6B 4FK8A 4TMWA 2QEXB 3CP8A 5E6TA 1V0EA 4Y7CA 4FXUA 1B2RA 2NV4A 4OOVA 1VQPB 3CW2A 1E43A 1F20A 1I8DA 3CCSB 1NB9A 1JB9A 4M4SA 3P26A 3NE5B 4F7DA 1VQNB 4XONA 1XB2A 1W2BB 2ZXIA 4B47A 3I55B 2BVNA 5F4JA 4YAWA 3CMEB 4AVZA 4XN0A 1RQRA 1GR1A 5DSZA 5A89A 2VBTA 1KTVA 1Y0RA 3PA2A 4M0LA 3I1FA 4P2NA 2V7WA 1YHQB 2X6YA 1W0KA 5H59A 1FNDA 2GK6A 1EP1B 1N0UA 2CRVA 4ZCLA 3ASRA 3V7AA 1QVFB 4TN1A 2EIXA 4WQMA 4J0QA 4N3NA 4P25A 2B7BA 3Q3AA 1H42A 3W2GA 3J81k 2DOGA 2VNIA 2OYNA 4ZCIA 1K8AD 1JA0A 2D74A 1EP2B 1N05A 4XKWA 3W2FA 4G7XA 3CC2B 1UD8A 1IJFA 3OZUA 4QVJA 1BPLA 1BMFA 1ZM2A 1Q82D 1VQ4B 1FRQA 2QDXA 2GJPA 4B48A 4QVAA 2BM1A 4RM0A 4P9SA 4NCNA 3G05A 2OTJB 3PVDA 3R6KA 1OHHA 4ACBA 1R5OA 1EFCA 2X0KA 1AIPA 3T53B 3QFSA 1U2RA 3ES9A 1FNBA 1DDIA 2VBUA 1QGYA 4PAAA 3KL9A 1Q86D 2XZLA 2F1MA 2X53S 5KW9A 2B7CA 1G7SA 4G7WA 1D8TA 2YWFA 1VQKB 2Z6BD 4DK1A 1VJSA 2JIZA 2CF4A 1KJZA 1XFOA 1CQXA 4XKVA 5KNLA 2ZTNA 5IYWA 2OBSA 3WBKA 1XQBA 4RDKA 3W5VA 3FPKA 3FKSA 4QFMA 2V7VA 2ZL5A 3SKBA 2JDIA 4OOSA 1DG1G 1KK0A 1T5EA 1VQOB 3RY8A 1KMHA 2JJ1A 4OPOA 4PC3A 4AC9A 3FPPA 3GVJA 4P22A 1N06A 4RD1A 1QVGB 1G7CA 1IHMA 4PGOA 1G7TA 5KSWB 5DS0A 1GO2A 1M1KD 1FX0A 4B3XA 1FNMA 1KK3A 2JJ2A 2VNKA 4ASUA 3LO8A 1MRZA 3JQPA 1G7RA 3ZZ0A 5TV2A 2ZITA 4MYUA 2BPOA 1S4MA 1NRKA 3OFNA 4RCZA 4B4DA 3JQRA 1MABA 2WJVA 3ASQA 3E20A 4LC0A 3W5HA 3BQJA 2Q6IA 2NPFA 4WZKA 4CQJA 4RDLA 5J3OA 1ZM3A 2GJKA 2DIEA 3W2IA 2PMDA 1HVXA 4K1XA 1WSVA 1N08A 3OZWA 1KD1D 4XLEA 2F4NA 5LMZA 4ZGQB 1WOOA 4YAFA 4Y9UA 2HLDA 3A35A 3KEWA 1AMOA 3BY1A 3ZBTA 1VQLB 4UZEA 2P3MA 3QFCA 4ZCMA 1R5BA 3CRZA 1WOPA 2GREA 5TRDA 1KRHA 4M1KA 5FL7A 1RQPA 2GK7A 3GVLA 2BMWA 2OBTA 4WZLA 1H8EA 2C4UA 4X05A 4XLCA 1ZM9A 4AF7A 3I56B 2XNJA 5FIUA 3VR6A 4R71A 3SLNA 1HA3A 1PJ5A 2C78A 2ZL7A 4X07A 2VNJA 3BCDA 2AHOA 4OP7A 4KKTA 5IYRA 5H5JA 3PA1A 4HE5A 1D2EA 3A8JA 3JQQA 1E1RA 1UD4A 4Y9RA 2X85A 3B78A 2WPDA 4B3FX 1I18A 2QTZA 1UD6A 2WZPP 3AVYA 1GAQA 3ASPA 1NB0A 2W6IA 3ZZUA 1NJID 4G1BA 3CCVB 1YJWB 1YX2A 2W6JA 4XLAA 1H8HA 2Q6KA 1J9ZA 2BSAA 3QE2A 4PABA 5HZBA 4TT3A 3JU4A 2CBXA 3PUMA 1CNFA 4M2LA 1I7PA 4EH1A 4LBYA 4RPDA 4XR6A 3W5UA 1VLYA 4X7DA 3CTAA 2E1BA 3OP1A 1Q7YD 4Z4YA 5FO0A 3LVBA 3WBJA 1PKVA 4HIZA 2HCJB 1E79A 1COWA 4Z4VA 3BNWA 3OW2B 2CC2A 3B8HA 1YITB 4RLZA 1YIJB 3ZUGA 3OAAA 4Z4UA 2C77A 3A3GA 3WYAA 1Q81D 1VLOA 3AVXA 1DARA 1KK2A 3OZVA 4PC2A 2ZZEA 3GQBA 4XM3A 2EFGA 4XL9A 1WDTA 4U9UA 2PE3A 5J35A 3QSYA 1EFTA 2DEUA 3ZIAA 1JA1A 1BX1A 2V4DA 1WP6A 4TMXA 2YWEA 4C0SA 3CMAB 3VNUA 3VO1A 4P3YA 4ACAA 4RPBA 1WSRA 4TMVA 2GPJA 4DQLA 3QFRA 2C2WA 5A8AA 5IYQA 4RD3A 5IK2A 4LBWA 1BX0A 2JN9A 2KVOA 4PC7A 4BPRA 2YWHA 1DDGA 5TR9A 1VHEA 2ZL6A 1N8RD 3U6BA 1VF7A 2V7XA 1UMKA 4ZV4A 5B6IA 3CC7B 4ZGNB 1OB5A 3WXMA 2FX3A 3BC9A 1E63A 1Q9SA 1CNEA 3ASSA 2DCUA 3FJOA 4GQNA 2VYQA 4B44A 3WY9A 1XE1A 1ELOA 2F43A 2WYRA 5FA6A 2V31A 3HAGA 3CPWB 3DDYA 2R9VA 3CCRB 1WTHD 4XN3A 2CK3A 1OGJA 2BV3A 5FNZA 4XLHA 5THXA 1QG0A 3A8KA 3Q6QA 4ROXA 5AN9A 1V5VA 3ASTA 1VQMB 1E3XA 3SEJA 2F1LA 3AVVA 3CPXA 3VMFA 1V0FA 3A1PA 2DERA 3WQZA 2XOKA 2VBVA 4FN5A 4YAUA 2VZLA 1OGIA 3B82A 3CCUB 3OJWA 1VQ9B 3OOCA 2VNHA 3SJPA 4Z4TA 1VHOA 3CC4B 3CMMA 1SKYB 5IYNA 4XMYA 3G71B 1KZLA 2BM0A 1HZEA 1TVCA 2HMAA 1GVHA 3MMPA 4YALA 4LBZA 3E1YE 3OKXA 4OOXA 3OPOA 4X8IA 5HKKA 3BY2A 2BGIA 1GJRA 1PJ7A 3U6KA 1UD5A 4OPVA 4II3A 3LQEA 4KKUA 5HZAA 2WJYA 1KK1A 2XEXA 1T6XA 3SJZA 3CXCB 3OEHA 1FDRA 3AGPA 3ONYA 4X06A 2CW5A 2CNDA 2VJIA 3SLDA 1A8PA 1VQ6B 4YXWA 2Q6OA 2VJJA 3PENA 4Z4SA 4RJLA 2DYIA 4RD4A 2XZOA 1QUEA 4X7FA 4N3GA 4XQFA 4TMTA 2OTLB 4C43A 3VNVA 3OEEA 4XOPA 2V7QA 3CB4A 1YI2B 4MYTA 1QFYA 5GV7A 4HE6A 4AF6A 2X3UA 4Q7JB 1E1QA 2XNCA 3PUNA 3Q39A 4XORA 2OK8A 3QFTA 3A3BA 2QGGA 1E64A 2YWGA 4P6YA 1QH0A 2ZXHA 1YJ9B 1S0UA 1UD3A 4B3GA 3CP2A 1QUFA 4KKSA 2ZZGA 4WZEA 1R5NA 2V7UA 4RDJA 2R6HA 1N07A 4PC1A 1H85A 3VO2A 3GSIA 2ZBVA 4LBVA 2OBRA 1K73D 4YHBA 3LNNA 4Z4ZA 2VBSA 1JJ2B 5JBQA 2QE7A 1ZUNB 1K28D 3P27A 4RCYA 4DNRB 1TLLA 3ZC3A 2HDNB 1N0VC 1VQ5B 2RC5A 5CDFA 4XOTA 1ZM4A 4QHYA 2X6WA 5TY0A 1WOSA 2ZZFA 1Y0YA 1W0JA 1W9XA 2Q6LA 3Q38A 1E3ZA 3CCEB 2ZZQA 1NDHA 4P26A 4OPSA 3WNDA 1YJNB 5DN6A 4TKOB 1EXMA 2WR8A 2C5BA 3T56B 1TUIA 3GIRA 1UD2A 4DK0A 2PIAA 2C4TA 2GJRA 4G5GA 4P6VF 4NBSA 4TMZA 3OE7A 1QGZA 5L46A 1B23P 3BH4A 1VQ8B 1EWYA 4NNJA 2ZBUA 1FRNA 4WZTA 1W34A 2WZNA 1BJKA 2XNDA 1SKQA 2QTLA 3AVWA 4X0CA 3T51B 2BF4A 5F4OA 1EFRA 2RC6A 2QMUA
chains in the Genus database with same CATH topology
3CCMB 2PLFA 1E62A 4H9GA 3ZBUA 1EFUA 1FNCA 2DETA 2E1RA 3V76A 1IJEA 1BQEA 4G1VA 2J7KA 3G6EB 3AGQA 1QFZA 3CCJB 1VQ7B 1S72B 1D1NA 1EP3B 4YAOA 2QA4B 1KC8D 1GAWA 2QN6A 1IB0A 2GQFA 2DY1A 1QFJA 3W2EA 4B43A 1QGAA 3CCQB 3CCLB 3ZZTA 4DQKA 4UAJA 4FWTA 1TTTA 2OK7A 3AVTA 1OB2A 4IW3B 3OJXA 4PC6A 4RD2A 2BN4A 1QX4A 3WNBA 3MCAA 3U2QA 4RD6A 5EMNA 2B5OA 2BGJA 1K9MD 1KQSB 3AVUA 3G4SB 4RD0A 5GV8A 1W87A 1W35A 1SM4A 3W2HA 3WNCA 1M90D 1F60A 1JNYA 5HXBA 3MHPA 4M53A 3CD6B 4FK8A 4TMWA 2QEXB 4Y7CA 1B2RA 1VQPB 3CW2A 1F20A 3CCSB 1JB9A 4M4SA 3P26A 4F7DA 1VQNB 1XB2A 1W2BB 4B47A 3I55B 2BVNA 4YAWA 3CMEB 1GR1A 5DSZA 1KTVA 4M0LA 3I1FA 1YHQB 5H59A 1FNDA 1EP1B 1N0UA 2CRVA 4ZCLA 1QVFB 4TN1A 2EIXA 4WQMA 4J0QA 4N3NA 2B7BA 1H42A 3W2GA 3J81k 2VNIA 1K8AD 4ZCIA 1JA0A 2D74A 1EP2B 3W2FA 3CC2B 1IJFA 3OZUA 1VQ4B 1ZM2A 1Q82D 1FRQA 2QDXA 4B48A 2BM1A 4NCNA 2OTJB 4ACBA 1R5OA 1EFCA 1AIPA 3QFSA 1U2RA 3ES9A 1FNBA 1DDIA 1Q86D 1QGYA 2B7CA 1G7SA 1D8TA 2YWFA 1VQKB 1KJZA 1CQXA 3WBKA 3W5VA 3FPKA 4QFMA 1DG1G 1KK0A 1VQOB 4PC3A 4AC9A 4RD1A 1QVGB 1G7CA 4PGOA 1G7TA 5KSWB 1GO2A 1M1KD 4B3XA 1FNMA 1KK3A 2VNKA 3LO8A 3JQPA 1G7RA 3ZZ0A 5TV2A 2ZITA 4MYUA 2BPOA 4RCZA 4B4DA 3JQRA 3E20A 4LC0A 3W5HA 2NPFA 1ZM3A 3W2IA 2PMDA 4K1XA 3OZWA 1KD1D 4ZGQB 4YAFA 4Y9UA 1AMOA 3ZBTA 1VQLB 3QFCA 4ZCMA 1R5BA 3CRZA 1KRHA 4M1KA 2BMWA 1ZM9A 4AF7A 3I56B 2XNJA 4R71A 1HA3A 2C78A 2VNJA 2AHOA 5H5JA 4HE5A 1D2EA 3JQQA 4Y9RA 3B78A 2QTZA 3AVYA 1GAQA 3ZZUA 1NJID 4G1BA 3CCVB 1YJWB 1J9ZA 2BSAA 3QE2A 1CNFA 4M2LA 1I7PA 4EH1A 4LBYA 3W5UA 1Q7YD 3LVBA 3WBJA 3OW2B 2HCJB 1YITB 3B8HA 1YIJB 2C77A 3WYAA 1Q81D 3AVXA 1DARA 1KK2A 3OZVA 4PC2A 2EFGA 3QSYA 1WDTA 4U9UA 1EFTA 2DEUA 1JA1A 1BX1A 4TMXA 2YWEA 4C0SA 3CMAB 3VNUA 3VO1A 4P3YA 4ACAA 4TMVA 2GPJA 4DQLA 3QFRA 4RD3A 4LBWA 1BX0A 4PC7A 4BPRA 2YWHA 1DDGA 5TR9A 1N8RD 3U6BA 1UMKA 4ZV4A 3CC7B 4ZGNB 1OB5A 3WXMA 2FX3A 1E63A 1CNEA 3FJOA 2DCUA 2VYQA 4B44A 3WY9A 1XE1A 1ELOA 5FA6A 3CPWB 3CCRB 1OGJA 2BV3A 5THXA 1QG0A 5AN9A 1VQMB 3AVVA 3VMFA 2DERA 4YAUA 4FN5A 2VZLA 1OGIA 3B82A 3CCUB 3OJWA 1VQ9B 2VNHA 3CC4B 3G71B 2BM0A 1TVCA 2HMAA 1GVHA 3MMPA 4YALA 4LBZA 3E1YE 2BGIA 1GJRA 3U6KA 1KK1A 2XEXA 3SJZA 3CXCB 1FDRA 3AGPA 2CNDA 1VQ6B 1A8PA 3PENA 4RJLA 4RD4A 1QUEA 4N3GA 4TMTA 2OTLB 4C43A 3VNVA 3CB4A 1YI2B 4MYTA 1QFYA 5GV7A 4HE6A 4AF6A 2X3UA 4Q7JB 2XNCA 2OK8A 3QFTA 1E64A 2YWGA 1QH0A 1YJ9B 1S0UA 1QUFA 1R5NA 2R6HA 4PC1A 1H85A 3VO2A 4LBVA 1K73D 4YHBA 1JJ2B 5JBQA 1ZUNB 3P27A 4RCYA 1TLLA 3ZC3A 2HDNB 1N0VC 1VQ5B 2RC5A 1ZM4A 4QHYA 5TY0A 3CCEB 1NDHA 3WNDA 1YJNB 1EXMA 1TUIA 2PIAA 4G5GA 4P6VF 4NBSA 4TMZA 1QGZA 1B23P 1VQ8B 1EWYA 1FRNA 1W34A 1BJKA 1SKQA 2QTLA 3AVWA 2BF4A 2RC6A 2QMUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCM B;  2PLF A;  1E62 A;  4H9G A;  3ZBU A;  1EFU A;  1FNC A;  2DET A;  2E1R A;  3V76 A;  1IJE A;  1BQE A;  4G1V A;  2J7K A;  3G6E B;  3AGQ A;  1QFZ A;  3CCJ B;  1VQ7 B;  1S72 B;  1D1N A;  1EP3 B;  4YAO A;  2QA4 B;  1KC8 D;  1GAW A;  2QN6 A;  1IB0 A;  2GQF A;  2DY1 A;  1QFJ A;  3W2E A;  4B43 A;  1QGA A;  3CCQ B;  3CCL B;  3ZZT A;  4DQK A;  4UAJ A;  4FWT A;  1TTT A;  2OK7 A;  3AVT A;  1OB2 A;  4IW3 B;  3OJX A;  4PC6 A;  4RD2 A;  2BN4 A;  1QX4 A;  3WNB A;  3MCA A;  3U2Q A;  4RD6 A;  5EMN A;  2B5O A;  2BGJ A;  1K9M D;  1KQS B;  3AVU A;  3G4S B;  4RD0 A;  5GV8 A;  1W87 A;  1W35 A;  1SM4 A;  3W2H A;  3WNC A;  1M90 D;  1F60 A;  1JNY A;  5HXB A;  3MHP A;  4M53 A;  3CD6 B;  4FK8 A;  4TMW A;  2QEX B;  4Y7C A;  1B2R A;  1VQP B;  3CW2 A;  1F20 A;  3CCS B;  1JB9 A;  4M4S A;  3P26 A;  4F7D A;  1VQN B;  1XB2 A;  1W2B B;  4B47 A;  3I55 B;  2BVN A;  4YAW A;  3CME B;  1GR1 A;  5DSZ A;  1KTV A;  4M0L A;  3I1F A;  1YHQ B;  5H59 A;  1FND A;  1EP1 B;  1N0U A;  2CRV A;  4ZCL A;  1QVF B;  4TN1 A;  2EIX A;  4WQM A;  4J0Q A;  4N3N A;  2B7B A;  1H42 A;  3W2G A;  3J81 k;  2VNI A;  1K8A D;  4ZCI A;  1JA0 A;  2D74 A;  1EP2 B;  3W2F A;  3CC2 B;  1IJF A;  3OZU A;  1VQ4 B;  1ZM2 A;  1Q82 D;  1FRQ A;  2QDX A;  4B48 A;  2BM1 A;  4NCN A;  2OTJ B;  4ACB A;  1R5O A;  1EFC A;  1AIP A;  3QFS A;  1U2R A;  3ES9 A;  1FNB A;  1DDI A;  1Q86 D;  1QGY A;  2B7C A;  1G7S A;  1D8T A;  2YWF A;  1VQK B;  1KJZ A;  1CQX A;  3WBK A;  3W5V A;  3FPK A;  4QFM A;  1DG1 G;  1KK0 A;  1VQO B;  4PC3 A;  4AC9 A;  4RD1 A;  1QVG B;  1G7C A;  4PGO A;  1G7T A;  5KSW B;  1GO2 A;  1M1K D;  4B3X A;  1FNM A;  1KK3 A;  2VNK A;  3LO8 A;  3JQP A;  1G7R A;  3ZZ0 A;  5TV2 A;  2ZIT A;  4MYU A;  2BPO A;  4RCZ A;  4B4D A;  3JQR A;  3E20 A;  4LC0 A;  3W5H A;  2NPF A;  1ZM3 A;  3W2I A;  2PMD A;  4K1X A;  3OZW A;  1KD1 D;  4ZGQ B;  4YAF A;  4Y9U A;  1AMO A;  3ZBT A;  1VQL B;  3QFC A;  4ZCM A;  1R5B A;  3CRZ A;  1KRH A;  4M1K A;  2BMW A;  1ZM9 A;  4AF7 A;  3I56 B;  2XNJ A;  4R71 A;  1HA3 A;  2C78 A;  2VNJ A;  2AHO A;  5H5J A;  4HE5 A;  1D2E A;  3JQQ A;  4Y9R A;  3B78 A;  2QTZ A;  3AVY A;  1GAQ A;  3ZZU A;  1NJI D;  4G1B A;  3CCV B;  1YJW B;  1J9Z A;  2BSA A;  3QE2 A;  1CNF A;  4M2L A;  1I7P A;  4EH1 A;  4LBY A;  3W5U A;  1Q7Y D;  3LVB A;  3WBJ A;  3OW2 B;  2HCJ B;  1YIT B;  3B8H A;  1YIJ B;  2C77 A;  3WYA A;  1Q81 D;  3AVX A;  1DAR A;  1KK2 A;  3OZV A;  4PC2 A;  2EFG A;  3QSY A;  1WDT A;  4U9U A;  1EFT A;  2DEU A;  1JA1 A;  1BX1 A;  4TMX A;  2YWE A;  4C0S A;  3CMA B;  3VNU A;  3VO1 A;  4P3Y A;  4ACA A;  4TMV A;  2GPJ A;  4DQL A;  3QFR A;  4RD3 A;  4LBW A;  1BX0 A;  4PC7 A;  4BPR A;  2YWH A;  1DDG A;  5TR9 A;  1N8R D;  3U6B A;  1UMK A;  4ZV4 A;  3CC7 B;  4ZGN B;  1OB5 A;  3WXM A;  2FX3 A;  1E63 A;  1CNE A;  3FJO A;  2DCU A;  2VYQ A;  4B44 A;  3WY9 A;  1XE1 A;  1ELO A;  5FA6 A;  3CPW B;  3CCR B;  1OGJ A;  2BV3 A;  5THX A;  1QG0 A;  5AN9 A;  1VQM B;  3AVV A;  3VMF A;  2DER A;  4YAU A;  4FN5 A;  2VZL A;  1OGI A;  3B82 A;  3CCU B;  3OJW A;  1VQ9 B;  2VNH A;  3CC4 B;  3G71 B;  2BM0 A;  1TVC A;  2HMA A;  1GVH A;  3MMP A;  4YAL A;  4LBZ A;  3E1Y E;  2BGI A;  1GJR A;  3U6K A;  1KK1 A;  2XEX A;  3SJZ A;  3CXC B;  1FDR A;  3AGP A;  2CND A;  1VQ6 B;  1A8P A;  3PEN A;  4RJL A;  4RD4 A;  1QUE A;  4N3G A;  4TMT A;  2OTL B;  4C43 A;  3VNV A;  3CB4 A;  1YI2 B;  4MYT A;  1QFY A;  5GV7 A;  4HE6 A;  4AF6 A;  2X3U A;  4Q7J B;  2XNC A;  2OK8 A;  3QFT A;  1E64 A;  2YWG A;  1QH0 A;  1YJ9 B;  1S0U A;  1QUF A;  1R5N A;  2R6H A;  4PC1 A;  1H85 A;  3VO2 A;  4LBV A;  1K73 D;  4YHB A;  1JJ2 B;  5JBQ A;  1ZUN B;  3P27 A;  4RCY A;  1TLL A;  3ZC3 A;  2HDN B;  1N0V C;  1VQ5 B;  2RC5 A;  1ZM4 A;  4QHY A;  5TY0 A;  3CCE B;  1NDH A;  3WND A;  1YJN B;  1EXM A;  1TUI A;  2PIA A;  4G5G A;  4P6V F;  4NBS A;  4TMZ A;  1QGZ A;  1B23 P;  1VQ8 B;  1EWY A;  1FRN A;  1W34 A;  1BJK A;  1SKQ A;  2QTL A;  3AVW A;  2BF4 A;  2RC6 A;  2QMU A; 
#chains in the Genus database with same CATH topology
 3CCM B;  4P3I A;  2PLF A;  4P1V A;  1E62 A;  4H9G A;  3ZBU A;  1P4M A;  3LQ6 A;  1EFU A;  1FNC A;  4Z1M A;  2DET A;  2E1R A;  3V76 A;  1IJE A;  2I1L A;  4L8J A;  1BQE A;  1T6Z A;  4G1V A;  4UZF A;  4XNF A;  2J7K A;  3Q6R A;  2ZTG A;  3ONU A;  3G6E B;  3AGQ A;  1QFZ A;  3A8I A;  3CCJ B;  1WPC A;  1VQ7 B;  2D9R A;  1S72 B;  1WU8 A;  1D1N A;  1EP3 B;  1OB0 A;  2X6X A;  4XD7 A;  4YAO A;  5F4M A;  2QA4 B;  1KC8 D;  5BSX A;  1GAW A;  2QN6 A;  3H94 A;  1IB0 A;  2GQF A;  2DY1 A;  1QFJ A;  3CES A;  3W2E A;  4B43 A;  4QUZ A;  2D3N A;  3BCF A;  4UZU A;  1QGA A;  1PJ6 A;  2C5H A;  4G6I A;  3CCQ B;  1T6Y A;  2FVG A;  5BSY A;  3CCL B;  3ZZT A;  1WOR A;  4DQK A;  4UAJ A;  3D26 A;  4FWT A;  1TTT A;  2OK7 A;  3AVT A;  2XGJ A;  2LZJ A;  1OB2 A;  2X8K A;  2M5S A;  4XLF A;  3H9N A;  4P12 A;  4X7E A;  4IW3 B;  4QV2 A;  3ZPN A;  4Z4W A;  3OJX A;  5IYP A;  4PC6 A;  2WSS A;  4RD2 A;  2BN4 A;  3OW7 A;  1QX4 A;  3WNB A;  3MCA A;  3U2Q A;  4Z4R A;  4RD6 A;  5EMN A;  5A88 A;  4X7C A;  2B5O A;  2BGJ A;  1K9M D;  4YEJ A;  5FO1 A;  1KQS B;  3AVU A;  4JMQ A;  4II2 A;  3ISX A;  2D3L A;  1NBM A;  2V7T A;  3G4S B;  1BLI A;  4RD0 A;  5GV8 A;  1W87 A;  4E0F A;  1W35 A;  1SM4 A;  3W2H A;  3WNC A;  4DNT B;  4WWV A;  1M90 D;  1F60 A;  1JNY A;  1YLO A;  2XZP A;  3GVK A;  3R6J A;  4TSF A;  5HXB A;  3MHP A;  4M53 A;  4YEL A;  3CD6 B;  4FK8 A;  4TMW A;  2QEX B;  3CP8 A;  5E6T A;  1V0E A;  4Y7C A;  4FXU A;  1B2R A;  2NV4 A;  4OOV A;  1VQP B;  3CW2 A;  1E43 A;  1F20 A;  1I8D A;  3CCS B;  1NB9 A;  1JB9 A;  4M4S A;  3P26 A;  3NE5 B;  4F7D A;  1VQN B;  4XON A;  1XB2 A;  1W2B B;  2ZXI A;  4B47 A;  3I55 B;  2BVN A;  5F4J A;  4YAW A;  3CME B;  4AVZ A;  4XN0 A;  1RQR A;  1GR1 A;  5DSZ A;  5A89 A;  2VBT A;  1KTV A;  1Y0R A;  3PA2 A;  4M0L A;  3I1F A;  4P2N A;  2V7W A;  1YHQ B;  2X6Y A;  1W0K A;  5H59 A;  1FND A;  2GK6 A;  1EP1 B;  1N0U A;  2CRV A;  4ZCL A;  3ASR A;  3V7A A;  1QVF B;  4TN1 A;  2EIX A;  4WQM A;  4J0Q A;  4N3N A;  4P25 A;  2B7B A;  3Q3A A;  1H42 A;  3W2G A;  3J81 k;  2DOG A;  2VNI A;  2OYN A;  4ZCI A;  1K8A D;  1JA0 A;  2D74 A;  1EP2 B;  1N05 A;  4XKW A;  3W2F A;  4G7X A;  3CC2 B;  1UD8 A;  1IJF A;  3OZU A;  4QVJ A;  1BPL A;  1BMF A;  1ZM2 A;  1Q82 D;  1VQ4 B;  1FRQ A;  2QDX A;  2GJP A;  4B48 A;  4QVA A;  2BM1 A;  4RM0 A;  4P9S A;  4NCN A;  3G05 A;  2OTJ B;  3PVD A;  3R6K A;  1OHH A;  4ACB A;  1R5O A;  1EFC A;  2X0K A;  1AIP A;  3T53 B;  3QFS A;  1U2R A;  3ES9 A;  1FNB A;  1DDI A;  2VBU A;  1QGY A;  4PAA A;  3KL9 A;  1Q86 D;  2XZL A;  2F1M A;  2X53 S;  5KW9 A;  2B7C A;  1G7S A;  4G7W A;  1D8T A;  2YWF A;  1VQK B;  2Z6B D;  4DK1 A;  1VJS A;  2JIZ A;  2CF4 A;  1KJZ A;  1XFO A;  1CQX A;  4XKV A;  5KNL A;  2ZTN A;  5IYW A;  2OBS A;  3WBK A;  1XQB A;  4RDK A;  3W5V A;  3FPK A;  3FKS A;  4QFM A;  2V7V A;  2ZL5 A;  3SKB A;  2JDI A;  4OOS A;  1DG1 G;  1KK0 A;  1T5E A;  1VQO B;  3RY8 A;  1KMH A;  2JJ1 A;  4OPO A;  4PC3 A;  4AC9 A;  3FPP A;  3GVJ A;  4P22 A;  1N06 A;  4RD1 A;  1QVG B;  1G7C A;  1IHM A;  4PGO A;  1G7T A;  5KSW B;  5DS0 A;  1GO2 A;  1M1K D;  1FX0 A;  4B3X A;  1FNM A;  1KK3 A;  2JJ2 A;  2VNK A;  4ASU A;  3LO8 A;  1MRZ A;  3JQP A;  1G7R A;  3ZZ0 A;  5TV2 A;  2ZIT A;  4MYU A;  2BPO A;  1S4M A;  1NRK A;  3OFN A;  4RCZ A;  4B4D A;  3JQR A;  1MAB A;  2WJV A;  3ASQ A;  3E20 A;  4LC0 A;  3W5H A;  3BQJ A;  2Q6I A;  2NPF A;  4WZK A;  4CQJ A;  4RDL A;  5J3O A;  1ZM3 A;  2GJK A;  2DIE A;  3W2I A;  2PMD A;  1HVX A;  4K1X A;  1WSV A;  1N08 A;  3OZW A;  1KD1 D;  4XLE A;  2F4N A;  5LMZ A;  4ZGQ B;  1WOO A;  4YAF A;  4Y9U A;  2HLD A;  3A35 A;  3KEW A;  1AMO A;  3BY1 A;  3ZBT A;  1VQL B;  4UZE A;  2P3M A;  3QFC A;  4ZCM A;  1R5B A;  3CRZ A;  1WOP A;  2GRE A;  5TRD A;  1KRH A;  4M1K A;  5FL7 A;  1RQP A;  2GK7 A;  3GVL A;  2BMW A;  2OBT A;  4WZL A;  1H8E A;  2C4U A;  4X05 A;  4XLC A;  1ZM9 A;  4AF7 A;  3I56 B;  2XNJ A;  5FIU A;  3VR6 A;  4R71 A;  3SLN A;  1HA3 A;  1PJ5 A;  2C78 A;  2ZL7 A;  4X07 A;  2VNJ A;  3BCD A;  2AHO A;  4OP7 A;  4KKT A;  5IYR A;  5H5J A;  3PA1 A;  4HE5 A;  1D2E A;  3A8J A;  3JQQ A;  1E1R A;  1UD4 A;  4Y9R A;  2X85 A;  3B78 A;  2WPD A;  4B3F X;  1I18 A;  2QTZ A;  1UD6 A;  2WZP P;  3AVY A;  1GAQ A;  3ASP A;  1NB0 A;  2W6I A;  3ZZU A;  1NJI D;  4G1B A;  3CCV B;  1YJW B;  1YX2 A;  2W6J A;  4XLA A;  1H8H A;  2Q6K A;  1J9Z A;  2BSA A;  3QE2 A;  4PAB A;  5HZB A;  4TT3 A;  3JU4 A;  2CBX A;  3PUM A;  1CNF A;  4M2L A;  1I7P A;  4EH1 A;  4LBY A;  4RPD A;  4XR6 A;  3W5U A;  1VLY A;  4X7D A;  3CTA A;  2E1B A;  3OP1 A;  1Q7Y D;  4Z4Y A;  5FO0 A;  3LVB A;  3WBJ A;  1PKV A;  4HIZ A;  2HCJ B;  1E79 A;  1COW A;  4Z4V A;  3BNW A;  3OW2 B;  2CC2 A;  3B8H A;  1YIT B;  4RLZ A;  1YIJ B;  3ZUG A;  3OAA A;  4Z4U A;  2C77 A;  3A3G A;  3WYA A;  1Q81 D;  1VLO A;  3AVX A;  1DAR A;  1KK2 A;  3OZV A;  4PC2 A;  2ZZE A;  3GQB A;  4XM3 A;  2EFG A;  4XL9 A;  1WDT A;  4U9U A;  2PE3 A;  5J35 A;  3QSY A;  1EFT A;  2DEU A;  3ZIA A;  1JA1 A;  1BX1 A;  2V4D A;  1WP6 A;  4TMX A;  2YWE A;  4C0S A;  3CMA B;  3VNU A;  3VO1 A;  4P3Y A;  4ACA A;  4RPB A;  1WSR A;  4TMV A;  2GPJ A;  4DQL A;  3QFR A;  2C2W A;  5A8A A;  5IYQ A;  4RD3 A;  5IK2 A;  4LBW A;  1BX0 A;  2JN9 A;  2KVO A;  4PC7 A;  4BPR A;  2YWH A;  1DDG A;  5TR9 A;  1VHE A;  2ZL6 A;  1N8R D;  3U6B A;  1VF7 A;  2V7X A;  1UMK A;  4ZV4 A;  5B6I A;  3CC7 B;  4ZGN B;  1OB5 A;  3WXM A;  2FX3 A;  3BC9 A;  1E63 A;  1Q9S A;  1CNE A;  3ASS A;  2DCU A;  3FJO A;  4GQN A;  2VYQ A;  4B44 A;  3WY9 A;  1XE1 A;  1ELO A;  2F43 A;  2WYR A;  5FA6 A;  2V31 A;  3HAG A;  3CPW B;  3DDY A;  2R9V A;  3CCR B;  1WTH D;  4XN3 A;  2CK3 A;  1OGJ A;  2BV3 A;  5FNZ A;  4XLH A;  5THX A;  1QG0 A;  3A8K A;  3Q6Q A;  4ROX A;  5AN9 A;  1V5V A;  3AST A;  1VQM B;  1E3X A;  3SEJ A;  2F1L A;  3AVV A;  3CPX A;  3VMF A;  1V0F A;  3A1P A;  2DER A;  3WQZ A;  2XOK A;  2VBV A;  4FN5 A;  4YAU A;  2VZL A;  1OGI A;  3B82 A;  3CCU B;  3OJW A;  1VQ9 B;  3OOC A;  2VNH A;  3SJP A;  4Z4T A;  1VHO A;  3CC4 B;  3CMM A;  1SKY B;  5IYN A;  4XMY A;  3G71 B;  1KZL A;  2BM0 A;  1HZE A;  1TVC A;  2HMA A;  1GVH A;  3MMP A;  4YAL A;  4LBZ A;  3E1Y E;  3OKX A;  4OOX A;  3OPO A;  4X8I A;  5HKK A;  3BY2 A;  2BGI A;  1GJR A;  1PJ7 A;  3U6K A;  1UD5 A;  4OPV A;  4II3 A;  3LQE A;  4KKU A;  5HZA A;  2WJY A;  1KK1 A;  2XEX A;  1T6X A;  3SJZ A;  3CXC B;  3OEH A;  1FDR A;  3AGP A;  3ONY A;  4X06 A;  2CW5 A;  2CND A;  2VJI A;  3SLD A;  1A8P A;  1VQ6 B;  4YXW A;  2Q6O A;  2VJJ A;  3PEN A;  4Z4S A;  4RJL A;  2DYI A;  4RD4 A;  2XZO A;  1QUE A;  4X7F A;  4N3G A;  4XQF A;  4TMT A;  2OTL B;  4C43 A;  3VNV A;  3OEE A;  4XOP A;  2V7Q A;  3CB4 A;  1YI2 B;  4MYT A;  1QFY A;  5GV7 A;  4HE6 A;  4AF6 A;  2X3U A;  4Q7J B;  1E1Q A;  2XNC A;  3PUN A;  3Q39 A;  4XOR A;  2OK8 A;  3QFT A;  3A3B A;  2QGG A;  1E64 A;  2YWG A;  4P6Y A;  1QH0 A;  2ZXH A;  1YJ9 B;  1S0U A;  1UD3 A;  4B3G A;  3CP2 A;  1QUF A;  4KKS A;  2ZZG A;  4WZE A;  1R5N A;  2V7U A;  4RDJ A;  2R6H A;  1N07 A;  4PC1 A;  1H85 A;  3VO2 A;  3GSI A;  2ZBV A;  4LBV A;  2OBR A;  1K73 D;  4YHB A;  3LNN A;  4Z4Z A;  2VBS A;  1JJ2 B;  5JBQ A;  2QE7 A;  1ZUN B;  1K28 D;  3P27 A;  4RCY A;  4DNR B;  1TLL A;  3ZC3 A;  2HDN B;  1N0V C;  1VQ5 B;  2RC5 A;  5CDF A;  4XOT A;  1ZM4 A;  4QHY A;  2X6W A;  5TY0 A;  1WOS A;  2ZZF A;  1Y0Y A;  1W0J A;  1W9X A;  2Q6L A;  3Q38 A;  1E3Z A;  3CCE B;  2ZZQ A;  1NDH A;  4P26 A;  4OPS A;  3WND A;  1YJN B;  5DN6 A;  4TKO B;  1EXM A;  2WR8 A;  2C5B A;  3T56 B;  1TUI A;  3GIR A;  1UD2 A;  4DK0 A;  2PIA A;  2C4T A;  2GJR A;  4G5G A;  4P6V F;  4NBS A;  4TMZ A;  3OE7 A;  1QGZ A;  5L46 A;  1B23 P;  3BH4 A;  1VQ8 B;  1EWY A;  4NNJ A;  2ZBU A;  1FRN A;  4WZT A;  1W34 A;  2WZN A;  1BJK A;  2XND A;  1SKQ A;  2QTL A;  3AVW A;  4X0C A;  3T51 B;  2BF4 A;  5F4O A;  1EFR A;  2RC6 A;  2QMU A; 
#chains in the Genus database with same CATH homology
 3CCM B;  2PLF A;  1E62 A;  4H9G A;  3ZBU A;  1EFU A;  1FNC A;  2DET A;  2E1R A;  3V76 A;  1IJE A;  1BQE A;  4G1V A;  2J7K A;  3G6E B;  3AGQ A;  1QFZ A;  3CCJ B;  1VQ7 B;  1S72 B;  1D1N A;  1EP3 B;  4YAO A;  2QA4 B;  1KC8 D;  1GAW A;  2QN6 A;  1IB0 A;  2GQF A;  2DY1 A;  1QFJ A;  3W2E A;  4B43 A;  1QGA A;  3CCQ B;  3CCL B;  3ZZT A;  4DQK A;  4UAJ A;  4FWT A;  1TTT A;  2OK7 A;  3AVT A;  1OB2 A;  4IW3 B;  3OJX A;  4PC6 A;  4RD2 A;  2BN4 A;  1QX4 A;  3WNB A;  3MCA A;  3U2Q A;  4RD6 A;  5EMN A;  2B5O A;  2BGJ A;  1K9M D;  1KQS B;  3AVU A;  3G4S B;  4RD0 A;  5GV8 A;  1W87 A;  1W35 A;  1SM4 A;  3W2H A;  3WNC A;  1M90 D;  1F60 A;  1JNY A;  5HXB A;  3MHP A;  4M53 A;  3CD6 B;  4FK8 A;  4TMW A;  2QEX B;  4Y7C A;  1B2R A;  1VQP B;  3CW2 A;  1F20 A;  3CCS B;  1JB9 A;  4M4S A;  3P26 A;  4F7D A;  1VQN B;  1XB2 A;  1W2B B;  4B47 A;  3I55 B;  2BVN A;  4YAW A;  3CME B;  1GR1 A;  5DSZ A;  1KTV A;  4M0L A;  3I1F A;  1YHQ B;  5H59 A;  1FND A;  1EP1 B;  1N0U A;  2CRV A;  4ZCL A;  1QVF B;  4TN1 A;  2EIX A;  4WQM A;  4J0Q A;  4N3N A;  2B7B A;  1H42 A;  3W2G A;  3J81 k;  2VNI A;  1K8A D;  4ZCI A;  1JA0 A;  2D74 A;  1EP2 B;  3W2F A;  3CC2 B;  1IJF A;  3OZU A;  1VQ4 B;  1ZM2 A;  1Q82 D;  1FRQ A;  2QDX A;  4B48 A;  2BM1 A;  4NCN A;  2OTJ B;  4ACB A;  1R5O A;  1EFC A;  1AIP A;  3QFS A;  1U2R A;  3ES9 A;  1FNB A;  1DDI A;  1Q86 D;  1QGY A;  2B7C A;  1G7S A;  1D8T A;  2YWF A;  1VQK B;  1KJZ A;  1CQX A;  3WBK A;  3W5V A;  3FPK A;  4QFM A;  1DG1 G;  1KK0 A;  1VQO B;  4PC3 A;  4AC9 A;  4RD1 A;  1QVG B;  1G7C A;  4PGO A;  1G7T A;  5KSW B;  1GO2 A;  1M1K D;  4B3X A;  1FNM A;  1KK3 A;  2VNK A;  3LO8 A;  3JQP A;  1G7R A;  3ZZ0 A;  5TV2 A;  2ZIT A;  4MYU A;  2BPO A;  4RCZ A;  4B4D A;  3JQR A;  3E20 A;  4LC0 A;  3W5H A;  2NPF A;  1ZM3 A;  3W2I A;  2PMD A;  4K1X A;  3OZW A;  1KD1 D;  4ZGQ B;  4YAF A;  4Y9U A;  1AMO A;  3ZBT A;  1VQL B;  3QFC A;  4ZCM A;  1R5B A;  3CRZ A;  1KRH A;  4M1K A;  2BMW A;  1ZM9 A;  4AF7 A;  3I56 B;  2XNJ A;  4R71 A;  1HA3 A;  2C78 A;  2VNJ A;  2AHO A;  5H5J A;  4HE5 A;  1D2E A;  3JQQ A;  4Y9R A;  3B78 A;  2QTZ A;  3AVY A;  1GAQ A;  3ZZU A;  1NJI D;  4G1B A;  3CCV B;  1YJW B;  1J9Z A;  2BSA A;  3QE2 A;  1CNF A;  4M2L A;  1I7P A;  4EH1 A;  4LBY A;  3W5U A;  1Q7Y D;  3LVB A;  3WBJ A;  3OW2 B;  2HCJ B;  1YIT B;  3B8H A;  1YIJ B;  2C77 A;  3WYA A;  1Q81 D;  3AVX A;  1DAR A;  1KK2 A;  3OZV A;  4PC2 A;  2EFG A;  3QSY A;  1WDT A;  4U9U A;  1EFT A;  2DEU A;  1JA1 A;  1BX1 A;  4TMX A;  2YWE A;  4C0S A;  3CMA B;  3VNU A;  3VO1 A;  4P3Y A;  4ACA A;  4TMV A;  2GPJ A;  4DQL A;  3QFR A;  4RD3 A;  4LBW A;  1BX0 A;  4PC7 A;  4BPR A;  2YWH A;  1DDG A;  5TR9 A;  1N8R D;  3U6B A;  1UMK A;  4ZV4 A;  3CC7 B;  4ZGN B;  1OB5 A;  3WXM A;  2FX3 A;  1E63 A;  1CNE A;  3FJO A;  2DCU A;  2VYQ A;  4B44 A;  3WY9 A;  1XE1 A;  1ELO A;  5FA6 A;  3CPW B;  3CCR B;  1OGJ A;  2BV3 A;  5THX A;  1QG0 A;  5AN9 A;  1VQM B;  3AVV A;  3VMF A;  2DER A;  4YAU A;  4FN5 A;  2VZL A;  1OGI A;  3B82 A;  3CCU B;  3OJW A;  1VQ9 B;  2VNH A;  3CC4 B;  3G71 B;  2BM0 A;  1TVC A;  2HMA A;  1GVH A;  3MMP A;  4YAL A;  4LBZ A;  3E1Y E;  2BGI A;  1GJR A;  3U6K A;  1KK1 A;  2XEX A;  3SJZ A;  3CXC B;  1FDR A;  3AGP A;  2CND A;  1VQ6 B;  1A8P A;  3PEN A;  4RJL A;  4RD4 A;  1QUE A;  4N3G A;  4TMT A;  2OTL B;  4C43 A;  3VNV A;  3CB4 A;  1YI2 B;  4MYT A;  1QFY A;  5GV7 A;  4HE6 A;  4AF6 A;  2X3U A;  4Q7J B;  2XNC A;  2OK8 A;  3QFT A;  1E64 A;  2YWG A;  1QH0 A;  1YJ9 B;  1S0U A;  1QUF A;  1R5N A;  2R6H A;  4PC1 A;  1H85 A;  3VO2 A;  4LBV A;  1K73 D;  4YHB A;  1JJ2 B;  5JBQ A;  1ZUN B;  3P27 A;  4RCY A;  1TLL A;  3ZC3 A;  2HDN B;  1N0V C;  1VQ5 B;  2RC5 A;  1ZM4 A;  4QHY A;  5TY0 A;  3CCE B;  1NDH A;  3WND A;  1YJN B;  1EXM A;  1TUI A;  2PIA A;  4G5G A;  4P6V F;  4NBS A;  4TMZ A;  1QGZ A;  1B23 P;  1VQ8 B;  1EWY A;  1FRN A;  1W34 A;  1BJK A;  1SKQ A;  2QTL A;  3AVW A;  2BF4 A;  2RC6 A;  2QMU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...