2DCUA

Crystal structure of translation initiation factor aif2betagamma heterodimer with gdp
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
407
structure length
407
Chain Sequence
KTRQAEVNIGMVGHVDHGKTTLTKALTGVWTDTHSEELRRGITIKIGFADAEIRRCSNCGRYSTSPICPYCGHETEFIRRVSFIDSPGHEALMTTMLAGASLMDGAILVIAANEPCPRPQTREHLMALQIIGQKNIIIAQNKIELVDKEKALENYRQIKEFIKGTVAENAPIIPISALHGANIDVLVKAIEEFIPTPKRDSNKPPKMLVLRSFDVNKPGTPPEKLVGGVLDGSIVQGKLKVGDEIEIRPGVPYEEHGRIKYEPITTEIVSLQAGGQFVEEAYPGGLVGIGTKLDPYLTKGDLMAGNVVGKPGKLPPVWTDLRLEVHLLERVVGTEQELNVEPIKRKEVLLLNVGTARTMGLVTALGKDEIELKLQIPVCAEPGERVAISRQIGSRWRLIGYGIIKEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Translation
molecule keywords Translation initiation factor 2 gamma subunit
publication title Structure of archaeal translational initiation factor 2 betagamma-GDP reveals significant conformational change of the beta-subunit and switch 1 region.
pubmed doi rcsb
source organism Pyrococcus furiosus
total genus 87
structure length 407
sequence length 407
ec nomenclature
pdb deposition date 2006-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
A PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 2dcuA02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 2dcuA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2dcuA01
3U61B 1NRJB 3B78A 5DGXA 1XCGB 4N0DA 4Q1DA 1JECA 1F48A 4N3NA 1VG1A 4L9SA 2BMFA 2H1LA 2J9RA 1M8PA 1W1WA 2OLJA 3L0OA 3WNBA 3T5GA 3HP1A 3TUJC 2ZJ5A 2VP2A 1OFHA 3L0IB 4IEEA 3QSYA 4WZ6A 4EJSB 5FOSA 2QEXB 3K9NA 2BHRA 4QGGA 1EFRA 4D4LA 1FNMA 2P6NA 5IT5A 2AKYA 2FFBA 3RC3A 1U8AA 2GETA 3V4RA 2ZITA 3N70A 1CR1A 1DAFA 2HXYA 3MMPA 4EIWA 4EPTA 2I1QA 1OH5A 4DUGA 2WMNB 3CNNA 1YHQB 1JNYA 2BVNA 3LO8A 1UKEA 4QL3A 4Z54A 2V54A 2PMKA 1CXZA 1E4YA 3HU1A 4IXNA 1E94E 3Q85A 2G88A 4Q1CA 4II7A 5K8IA 4DDWA 4MYHA 1GDDA 2HF8A 2EW1A 1G20E 1GRNA 2O8FA 1BJKA 3AVQA 1EX7A 3ZJYA 1ZC4A 5FA6A 2QL6A 4U02A 4LHZA 1KNXA 4UNNA 3TQCA 2IYSA 5TDHA 3B7GA 2PLFA 2QPTA 5JECA 3W2FA 1RFLA 1NNEA 5JBQA 1NMZA 1E2NA 3U60B 2QE7D 5DO9A 1GL6A 3KJEA 3E1SA 4M1YA 2FOLA 4CIDA 1FUUA 2QAGA 1KO1A 2EU8A 5KSPA 2QPAA 3CC2B 3K09A 2CL0X 2ZE7A 3QF7A 3KKPA 3QENA 1T3HA 5F2EA 2MSCB 5F98A 1KGDA 2CHVA 4YAFA 1XD2B 3PXGA 1OYWA 1Z28A 2GVDC 5JFGA 3K70C 2F1RA 2GEVA 3GD7A 4DJTA 5GADl 1WQ1R 5UKDA 3WMFA 3OESA 1GTVA 4UNQA 3GJ7A 4LHVA 5TXGA 4IOMA 1E9BA 4M9SA 1ZINA 4W5JA 2Q9CA 3L2OB 1KO5A 2IK8A 3MWKA 1WRBA 4C7OB 1OH7A 2CCJA 3V4FA 3EZ9A 1VYUA 4V0KA 3ICEA 4M1TA 3QKUA 1VHLA 1O3YA 4BFUA 2HT1A 4TMXA 1SGWA 1IN7A 4LZZA 2WWHA 5JEEA 4IXMA 4R71A 3T61A 4TZ6A 3RS5A 1R8SA 2W2VA 4KFUA 1EP2B 4OK5A 1QFYA 1FNDA 1DARA 4YONB 3QQ5A 2IXGA 5FR1A 4GFDA 4E5UA 4TQAA 5FTMA 4KU4A 2HF9A 3IILA 3W2HA 4FMDB 4PSAA 2VP0A 1GIAA 4RFVA 1X8KA 3VHLB 1D2EA 2J0QA 1XPOA 3L82B 2GK7A 2WAXA 1NVXQ 5B30A 2ANCA 4JLJA 1EXMA 2QZ4A 2WSSD 1KMQA 4BPRA 1CTQA 1NJGA 5GJCA 1CRQA 1DDIA 3CF6R 3NEJA 1FZQA 3QF4B 4C0JA 3IBGA 4UXHA 2QBYB 4KSCA 1QVRA 3MJHA 3LVBA 5AUNB 3TK1A 5IK2D 4DLVA 3WXMA 1J70A 1FNBA 1J8YF 1NDHA 1A5TA 1QUFA 2A5GA 1X86B 2XNSA 3LNCA 1E1QA 1FTSA 2UKDA 3GJXC 1JB9A 1MO4A 5CLLA 2D7CA 2FSGA 2JJ1A 5EXSA 1YQTA 2RH5A 4YAOA 1E4VA 621PA 2D2FA 1EX6A 1RE0A 2HXSA 2J0VA 2XJ9A 3NDPA 1TF2A 1UDWA 1Z08A 1A8PA 2O0HA 4DT1B 1A82A 1XMJA 3BK7A 3CCSB 1M34E 1T5IA 5KHOC 2NO0A 1E2QA 3KL4A 3O8RA 2FSHA 3QFTA 3HR7A 5JEDA 1CLUA 4M0LA 2O8BB 3B8HA 2HYDA 2GILA 2WWFA 1AZTA 1VCMA 2X2EA 4EPXA 3NDBB 4X8MA 1FP6A 2XNDD 3MJRA 4JBXA 1KSJA 1JB1A 2GCNA 2PCLA 4ZV4A 2QP4A 1NSFA 3GLIB 2IUUA 1OE0A 2CBZA 4D4MA 1T8UA 2OZEA 2QBYA 5EE3A 3KQUA 3T1TA 3ICQB 1Z06A 3AQ4A 1VQNB 1Q12A 2YZ2A 4HE6A 2HLDD 3CR7A 3LBNA 1WXQA 3THWB 1KAGA 5AUPB 1YIJB 1KK1A 1P6XA 2J0SA 4GDFA 1XMSA 1KD1D 4HUTA 4LJ7A 4TLBA 5LD2B 1UM8A 2C95A 1XNJA 3H4MA 5FI1B 1NIPA 1ZJ6A 3OEHD 3PUVA 1KI6A 1V43A 4AK9A 2BF4A 3AGQA 1G291 2V6IA 5DHFA 5EP4A 2ZYWX 4EFNA 5JHGB 1FNNA 2ZVQX 2LKDA 4V0ME 1G7RA 1W0JD 2JAQA 3CWQA 1RC8A 4PQYA 4IJMA 4XWAA 4IDQA 4DT1A 3P27A 1XXHB 2J0UA 4FMDF 1TF5A 2QGZA 1E9SA 4B3FX 1GVNB 1P2SA 2FMXA 4TL7A 1R5NA 1DAKA 1EGAA 3SOPA 3DPUA 5J47A 2NPIA 1TAGA 1BQEA 3SYNA 4DXAA 2P5SA 3OE7D 2ZRGA 3ASYA 2RKOA 4EFLA 3SYLA 4NCJA 1JALA 3OJWA 2BKEA 4P4UA 1A2BA 3SDZA 2BDTA 2PZFA 3CRRA 3V00A 3TBKA 4A1FA 3GLIA 3C41J 1TLLA 1G17A 1XTRA 1SKYE 5JLJA 1VIYA 1QVGB 2XITA 3NKVA 4R9UC 1UMKA 121PA 4QJ5A 4P0TA 1OV4A 2QP9X 3THWA 1DAHA 4A15A 4O3MA 3A1VA 2ZJOA 1YITB 1GAWA 2ZPTX 1DPFA 821PA 3LO5A 4HB0A 1IN8A 2DETA 1L8QA 5DYIA 2ZS9A 1E9AA 3UXMA 1T0JB 4QC2A 5CB8A 3D8BA 2IT1A 3W2IA 4G3XA 3DM9B 3B60A 4M21A 3BORA 4Q7KA 3QE2A 3PFIA 1XDBA 2ZAMA 4GOJA 4GP7A 1U9IA 4FI3C 4OHZA 1RRCA 2ZUBA 4W7SA 4JLBA 3W2GA 1CJMA 3SJZA 1V5WA 2JLYA 1L4YA 2PLRA 2H8KA 4JVLA 4TYQA 4A82A 3GLIE 2CCKA 1TEVA 3TIFA 4D25A 1CR0A 3KKMA 1SVLA 4PC2A 3BB1A 3CLVA 2F43B 1X1SA 3QEOA 1M1KD 4LJ8A 4G5GA 1NN0A 4NBSA 2ZXUA 2QTLA 1E79D 4P32A 3VNUA 2BN4A 1FDRA 4LBWA 1OIVA 2BEKA 4OHXA 1PUIA 4Q5IA 5BYJA 4QJ3A 1QFJA 1I4TD 2QQ0A 2ZE8A 4S35A 3AKYA 5FUWA 1J8MF 1I2MA 4MGIR 4P31A 1G18A 1Q1BA 3CF2A 2QT1A 2GXQA 1F2TA 2BMDA 3GJ4A 5H59A 3F0TA 3EIHA 1PZNA 3K0CA 1VCOA 3P4YA 5AUQA 1OF1A 3K1JA 4A4DA 1EP3B 2W6JD 4ZKEA 3ND8A 4MKHA 1XF9A 1AS3A 2TMKA 2G0TA 5F3WB 5FTLA 2WTUA 3QG1A 1I2DA 5FFMA 2FG5A 2CVFA 3LLUA 2A5FA 1VQKB 3CCMB 2ZSEA 4QNRA 4AKEA 1QDEA 5CM9C 1M74A 4GPTA 5G41A 4KLZA 4DBLC 1KDRA 4F4CA 4DVGA 4N3GA 1IOZA 3ZVRA 2VIIA 3W3AA 2OBMA 2A2ZA 4KYIB 5KDLA 3A1UA 2HJGA 4QBIA 1DE0A 2ZQ5A 2IYQA 2V7QD 4GI7A 4C0AC 3QKSA 1DAIA 2ZR0A 2WOJA 2B6HA 3ZZTA 2ZJ8A 4A2QA 3UKDA 5JZVA 4LV8B 2W2XA 5EE1A 4B3BA 5KO2A 3FHTA 2YKGA 4JKIA 4IFBA 4KXFB 3QBTA 1FX0B 3R20A 2QAGC 3TKLA 3BH0A 2FGJA 4DCNA 4LJ9A 2FN4A 3OE7A 2VHJA 5HCNA 1QHXA 3WHKA 2PX3A 3K09C 3FKSD 2IYUA 3CRQA 1NJID 2OE2A 3LXXA 4MRPA 2C99A 3A1SA 5AJZA 5FPHA 1XWIA 2Q3HA 2EFDB 3VR6A 3DOEA 1P61B 1Z0IA 4EDHA 5GVRA 5CK5A 3HWSA 2J59A 2NO7A 2Q6TA 3THOA 2VZLA 1TL7C 2RGGA 2FGKA 3AF3A 1XD8A 1U90A 3QKTA 4Q9LA 1PV4A 3X1ZA 3RSOA 1S9DA 4PPQA 1SVMA 2VSFA 3SFVA 4TSFA 1F3OA 4UNSA 1M2OB 4C0LA 4QJ4A 2OV2A 2WJHA 1MR3F 1T0HB 4BE7B 4PPGA 2H92A 5CYPA 1QG2A 1ZD8A 2F3TA 2CNWD 2KE5A 4MITA 4TMWA 2ECKA 3I5XA 3B6EA 4WA7A 4ZDKA 2OEPA 5TMPA 2IW3A 4A8JA 3C5CA 1E2HA 2IS6A 1OB2A 2V55B 2R44A 721PA 2JEOA 2CCGA 3H1TA 2QROA 2XZOA 3E20A 1ZM3A 1QFZA 1YZGA 4OJKA 2PIAA 1H8HD 1P4SA 1FX0A 1OXTA 4MRNA 221PA 1HTWA 2VBCA 5DIFA 5DNYB 2C98A 4DB4A 4DDUA 1CS4C 1GRQA 3HU3A 4HLQB 4Q03A 2NO6A 2ZSBA 3H0KA 2JLWA 2BBTA 2DEUA 3TRFA 3CCUB 1Q44A 4BFWA 4ZO4A 3VKHA 1QRAA 1ZNZA 2ZYVX 2OT3B 4EPWA 4BWYA 4QFMA 1R7RA 1JPNA 4AY2A 3FHOA 3DKVA 4TMKA 4WOPA 2I4IA 1U0JA 3R8FA 2BCGY 4PR0A 2RGBA 3PEVA 1FTNA 5SZHB 1E32A 4E03A 2V1XA 5EZ6B 2EFGA 4C43A 4KFSA 4Q4AB 4U5XA 3TUZC 4M1MA 1CKEA 4QM7A 1Z8FA 2QMEA 3U7HB 4JS0A 3PR1A 1QHIA 4Q1AA 2YC2C 1YJ5A 1T3SA 2BCJQ 5EZ5A 3RS4A 1Q20A 1K5DA 3I8XA 2GKSA 3KJHA 3AF4A 2ZRMA 2DCUA 3UMFA 4WQMA 3K9LA 2FPMA 1QX4A 3LDAA 4A92A 5GJBA 1N6RA 4HAVA 1X8LA 3KXLA 3GFOA 2RGCA 1RRGA 2JDIA 4FMCB 1Z07A 4PSVA 1W4AA 2A9KA 1JJ2B 4L9WA 1VTKA 1K9MD 3BFXA 3RRYA 3ZDQA 5BN5A 1A7JA 3CD6B 2LKCA 5J4HA 2JLUA 4QNMA 1FFHA 4TZ0A 4PZLA 2HYIC 2W83A 2ZU0C 4TQUS 4BFYA 3I62A 3D31A 3TLXA 4IEIA 3CIOA 1UBGA 4HB4A 4LPKA 3W6OA 4LPSA 1GP2A 3A1TA 4GBMA 3K0FB 4ZCIA 1EG7A 3DHWC 1OHHA 2ZJAA 3KUCA 1YKSA 2BV3A 1G5RA 1R0ZA 1G1MA 3CCQB 1VYTA 1SHKA 3SEAA 3EIQA 1BMFD 1J99A 4PTLA 3SE0A 1IXRC 5CJPA 1I7PA 1G4UR 1JPJA 1YJ9B 4Q4AA 3X2SA 4K1XA 3CZQA 1YJNB 1RPZA 2CXXA 3VMFA 2J41A 4NMMA 1JQLB 1GZSA 4TN1A 1W36D 2R65A 2FFQA 4QXAA 4A0GA 4QGFA 4DLYA 1TEXA 3B85A 3KFXA 4NONA 5FR2A 4Z51A 2IC5A 1KI9A 4ON9A 1QG4A 3PV0A 2EFCB 1AM4D 3K0AB 4LYAA 4LSGA 3I55B 1CJKC 3KQKA 1Z6TA 1ZMXA 3BC1A 4BPBA 4OL0A 2V9PA 1AKEA 1J2JA 3LBHA 4A9AA 3JZMA 2YWFA 4PZZA 3THXB 4KODA 1R6BX 3DMNA 3SJAA 1EFUA 1QF9A 2ANBA 2C5LA 2QUZA 4NPHA 5LB4A 4C0KA 1YI2B 3WNCA 5J4VA 5JS7A 5JCPA 4TMVA 1N25A 1NMXA 3K0FA 3SHWA 2C96A 1L4UA 3FB4A 2F1IA 4OI1A 1QUEA 1SXJB 2IBMA 2KBEA 5FBRB 3AVTA 3BJIC 3RHFA 4MDFA 4AI6A 1GNQA 4RZ3A 5LD2C 3GJ8A 3JZAA 4HAXA 3T1OA 2QRZA 2ZIAA 3FYHA 2XTZA 3VKWA 1UBCA 2D74A 2REOA 2BPOA 5KSOA 2O8CA 4PHFA 4DIEA 2ZU6A 4YDSA 4XD7D 1YR8A 4L5BA 2GA8A 3FFBA 2ZI4A 2GPJA 521PA 3CZPA 2BJWA 1P7CA 5EXPA 4FMCF 2XSZA 2HMAA 5EQTA 4QBFA 4IVPA 4LV6A 1U9IC 4LHYA 4LBYA 3AP1A 4NCIA 3K0AA 3JVVA 3OFND 2GXAA 2UVQA 2ODNA 2J1LA 5FBQB 4ABYA 1JR3A 3H2YA 4XWKA 4FCWA 4M1OA 3CRMA 5M04A 4Q21A 5B64A 4IDPA 4CEIB 1VPLA 4DSTA 1W36B 4O2LA 3QFSA 1RIFA 3THXA 2EWVA 1TADA 2ONKA 2GCOA 3AF0A 4B4DA 2N1BA 2QU8A 2Z0MA 2WPDD 4HAYA 5H70A 2RCNA 3QXXA 3E5HA 3GEIA 4US0R 4URVR 1ZCAA 4IDHA 4ESVA 3C15C 1OGJA 4AYTA 1SXJA 5AJXA 3QFRA 3QNUA 1VG9B 2R6CA 1XX6A 4C0QC 4F38A 4BZXA 1EP1B 5J4YA 4KVGA 2PEZA 3DDCA 3TQFA 3RABA 5KOYA 3ZIAA 3NBFA 4MUBA 2AXNA 1XTKA 4CF7A 3K0CC 2DHRA 5GJVC 5HTKA 2PJZA 1KKMA 3W5JA 3W6PA 1Z83A 1IBRA 2DWOA 1ZUNB 4WW0A 2DYKA 3GJ0A 5E7IA 3F5FA 4Q4HB 2IEYA 3VNVA 4G5SA 1L7VC 1YZUA 3FPAA 5JRJA 1NG1A 1CRPA 3ZS9A 4C2TA 1DAMA 2WOOA 1DELA 4YMSA 1JR3E 1OFIA 1CBUA 3IGFA 4A36A 1YR9A 2VHCA 1GVHA 2AL7A 1WP9A 1KJZA 2EWWA 4FIDA 1UBFA 2R8RA 5FTNA 3QXJA 3BFKA 3R9IA 4ILEA 1S3GA 2WJGA 4O25A 1ZM2A 3CCEB 1NKTA 2GHIA 2QTHA 3RNLA 3B82A 3G4SB 4Q1EA 1MABA 4FCTA 4WIAA 3EA5A 1SULA 2W00A 4LRWA 1KY2A 1UKYA 4PC7A 4Q1FA 2PX0A 3X1XA 4D82A 1DAEA 5IF9A 5LDDC 5H8WA 1W46A 2KB0A 4ZKDA 4RKFA 1TQ4A 2ODWA 1LY1A 2QPOA 1SXJE 4OJQA 4D6PA 1FMJA 2B8TA 1JBKA 1E9RA 5F9HA 2CHQA 4B48A 3EARA 4BFTA 2X3UA 5L3QB 5BXQC 3GP8A 3OZUA 2GWHA 3ZZUA 4UQOA 2OILA 1TTTA 4TL9A 1GJRA 3WRYC 1D2MA 2A5YB 4BLRA 1GAQA 2FZLA 2AD1A 4V03A 2IWRA 2BBSA 4XWOA 1Z22A 1XZPA 5FOTA 1B23P 1D5CA 2QI9C 2KWIA 3WNDA 3CX6A 3RC8A 4DQKA 2Z4SA 3VAAA 2ATXA 4LHXA 4FN5A 3PEUA 4Q4HA 4Y9RA 3VQTA 1MO3A 5KU1A 3CUEF 2RGNA 1IJEA 4RD3A 4KVAA 3AEZA 5FPYA 1BO6A 4AF7A 4G1UC 1W0KA 3PUZA 3PUWA 4F91B 3VR4A 4EQ6B 1US8B 3I1FA 4P3YA 2JLQA 1C1YA 2VHQA 4I81A 4QG7A 1E9DA 2BKUA 2GZAA 5JWOA 3KTAB 2ORIA 4MH0R 1E2LA 1W34A 2BM0A 2QY9A 2OAQ1 4UAJA 3LBIA 4G0NA 3VR3A 4EJSA 3C7KA 4A8JC 1SZPA 3RS0A 2VHTA 2EFEB 1XPRA 2QT0A 3Q5DA 3UPUA 2LCFA 2X77A 4XVQA 2DY1A 1UKVY 1GSIA 2IYLD 4CRWB 5F9FA 1FPMA 3UWOA 2QENA 1GL9B 2ORVA 5L3QA 3I4LA 2RC6A 2ZETA 3CR8A 2WMOB 4A2WA 5C4MA 4BLTA 1GL7A 1VQLB 1KI8A 5JHHB 3IEVA 3EZ7A 3NBXX 5EE0A 1YZLA 5AWFC 3SI7A 1P75A 4BFZA 3LAWA 2J5XA 4AG6A 3OW2B 2V4ZA 1IONA 1HQCA 1Q3HA 2WWGA 1OH8A 4NHOA 2CRVA 1G3QA 4ASUA 1Z63A 2WPDA 3DZ8A 2PMDA 3IQWA 4LJ4A 4DEYA 2XNCA 2IYTA 3P4XA 1XPUA 1PJRA 2QN6A 1QH0A 2REXB 1NBMD 3R9XA 3CCJB 4TLAA 1KKLA 1W35A 1TPZA 4KYUA 1QVAA 4K46A 1NKSA 4AWXA 3QFCA 2P2LA 3RYTC 3K9HA 1ZUHA 3KQLA 4EQ6A 4MKIA 2DFNA 1KAOA 1X3SA 2CK3D 3RS7A 3ADKA 2WSMA 3OIUA 5JJLA 4O2RA 4PC3A 2D2EA 3KTAA 2ZRNA 4YLGA 4CEJB 4OK3A 1G8FA 4H1VA 1IB0A 5L3RA 2OFWA 2K5UA 2BGJA 3E2IA 2QM7A 5KSYA 1XD2A 1E3MA 4TTRA 1KSHA 3JQPA 1SVWA 1LNZA 1AA9A 2NIPA 2WWWA 2ZANA 3CRVA 4TYNA 3B2EA 4Q19A 2WAYA 4U9UA 1E2MA 2ZRFA 1GAJA 3TNFA 2JLZA 4UNRA 3TAUA 1E6CA 3P32A 2ATVA 4Q02A 4HDQB 3UWKA 4C7OA 1G41A 3ZD7A 1VQ8B 4NCKA 4G5OA 2A5JA 1KIMA 3REGA 3DEFA 1J90A 1YRBA 3GFTA 3VR5A 2GRJA 3QBVA 2ODEA 2D3WA 4URYR 4L4UA 3LVQE 4B2LA 1Q0UA 1TF7A 4I1VA 1JI0A 4QKQA 1DG1G 4BFSA 2YOFA 4IHQA 2AD5A 2GAAA 2DFTA 2OG2A 3PIRA 1Q57A 3T34A 4C4PA 2Q9AA 2QQEA 4A6PA 1KI3A 1XD9A 1LW7A 3BOSA 3K9GA 3VX3A 4DCUA 4GZLA 4J0QA 1NN3A 3FPKA 4HAZA 1R4AA 3W2EA 3WYFA 4LBVA 3EA0A 5JCZA 1TUEA 2MSEB 3LH5A 3SBDA 3TE6A 1ZCBA 2O8DB 4DLWA 4D26A 4UXIA 5DI9A 2WJVA 2QMUA 2P67A 3U3RA 4TTQA 1M7BA 3H86A 4M53A 3QF4A 3B5JA 1N0UA 2QSZA 4DSNA 2A78A 1CNFA 2CLDX 4PHTA 5JI2E 4JLNA 5DI3B 4H9GA 2HCBA 2WKQA 3LD9A 3ZGXA 2QE7A 1IN4A 1NJFA 4EUNA 2ZRAA 2OXRA 2RC5A 1BKDR 2J45A 3P20A 4M9XA 4YALA 3L0PA 3DO6A 4AF6A 1Z29A 5KDDA 1GKYA 1XMVA 3M0EA 5JWHA 3T35A 2VF7A 2IYWA 2WJYA 1GITA 3NBYC 2ZRLA 1KO8A 5C46F 4FW9A 1Z6AA 3WMGA 3LY5A 1GWNA 4ZCLA 1HE8B 5FI0B 2VYQA 3UG6A 1X6VA 1D9XA 4MKFA 4DHEA 1TQDA 2KI5A 2OSBA 1NY5A 2VP4A 2PT5A 2CLCX 2DFKB 1E1RD 1XTJA 2O8BA 1HE1C 3OZXA 3GPLA 3TW4A 1M7HA 5E7MA 1XE1A 2QP3A 3C4JA 2GJKA 2JLRA 3N2EA 2W6ID 5FPSA 1FP7A 2O8DA 4NH0A 1P2UA 2XNJA 2MMGA 4MYCA 1S1CA 3BB3A 4NYMQ 5SZJA 3LFUA 1NLFA 2OBNA 3I3SR 2OFOA 4IRUB 3VR1A 2R9VA 5DI3A 3VU9B 2UZ3A 3PVSA 1N5IA 4US2R 1IM2A 1N6PA 3AKCA 3GFPA 4ZI3A 1QGYA 1FQJA 5DSZA 5KTYA 3B9QA 3JQQA 1I4DD 2G6BA 2XX3A 2A5DA 2WSSA 3F8TA 2Z83A 3QPUA 1SVSA 1R5OA 4DCSA 4Y0AA 3SR0A 2IXEA 1W87A 1ZU5A 1ZD9A 2P65A 4NYMR 3ADCA 5IK2A 3MSXA 3EPKA 1Q1QA 4V0NA 4CGZA 4QHTA 3KQNA 1E64A 4LC0A 1ZYUA 1XXHA 1MO6A 2V8OA 1E2FA 1P3JA 1S3SA 1SXJC 4MGKR 1JEEA 1N5KA 1GKUB 2QM8A 5HE9A 4F4JA 2J7PD 1IY2A 1OIXA 2GF9A 5FOXA 4B71A 3NTUA 1ETUA 3AVOA 3N2IA 2ZRBA 3W8NA 5JI3E 4LOAA 3DM5A 5KNDA 4YMTA 1SM4A 2OLKA 3EWAA 3SFZA 2ORWA 3CC7B 1AS0A 1IN6A 1HURA 4LCBA 3MRSA 1KK0A 4HAWA 1U81A 3QG5A 4OYHA 3CPHA 1HY3A 2ZR7A 1P2TA 1NSTA 2VL7A 3K70D 4Q7MB 1PLLA 1Q3TA 3EPJA 1RJ9B 3IDQA 1VKJA 3PITA 1G4AE 4B43A 3I72A 3VU9A 4CT4B 5C2JB 4HB3A 5JSZB 1E2JA 1E2KA 3SYKA 1QGZA 2E1RA 1FUKA 3OZVA 3CRZA 1N3BA 1SHZA 2XNDA 4FWIB 4RD1A 2YINC 2OK7A 2REBA 4HAUA 3DKPA 3G82C 2WWIA 3IHLA 4PC6A 5K8UA 4XOIA 1XXHE 2CLSA 1W48A 2PL3A 2V6JA 3A8TA 3CM0A 5E3HA 5CB6A 3AVVA 2VLIA 4CDGA 1PUJA 3FOZA 2FJUA 2YYZA 5IHPA 1F20A 2HLDA 1P62B 1QZXA 3OEED 1BYIA 1LS1A 5EXTA 1FRQA 4B6EA 3HPQA 4LHWA 1OB5A 1G7CA 1W5SA 3I8SA 4DLUA 5DN6D 3KUDA 3AKDA 4DZZA 2GBLA 3ZQ6A 2MSDB 3OEHA 3GJ6A 1XCMA 5CIWA 2AK2A 2DBYA 1J7KA 1YZKA 2NTYC 1E63A 1QHHB 2QMHA 4OHVA 1MH1A 1DADA 3ZZ0A 2ASEA 2C04A 2YJTD 2W2TA 2WKPA 4X8HA 4DB2A 3K0EA 2QORA 2FPLA 1W0JA 1COWD 2AX4A 2F43A 4US1R 1BOFA 3NVAA 3FJOA 2QEQA 4IKEA 2RGNC 4H1UA 2ZRDA 1II8B 3LX8A 1RJ9A 3EWSA 4LV5B 5G3YA 1KMHB 4PANA 4M9ZA 4RY2A 5TARA 1E2GA 5JSZA 4JLMA 3Q9LA 4XVRA 5CLQA 4Q01A 4B33A 4Z1MD 1M90D 4W5WA 4CYMA 2GJ9A 2W6IA 3GMTA 4YC7A 2RHDA 2I3BA 4NKRA 3D7MA 2VQSA 4IDOA 2V3CC 2EVWX 3NBZC 4RD6A 1ZBDA 4EJSC 4RD2A 4R2IA 1KY3A 1GG2A 3T1QA 5ELXA 4F93B 3ZLJA 4JL5A 2QG6A 2B7BA 1NP6A 1QBKC 1GUAA 3CNOA 2NMVA 1N8RD 4Q9KA 3OAAD 2CL7X 1EFHA 1QHSA 3FMPB 3O8DA 5C4GB 3VHXA 4U7DA 1WMSA 4JLVA 4NP6A 2PJRA 4BFVA 2ZVPX 4R7ZA 2ZI7A 4JJKA 1KI7A 1KNQA 1KHTA 1H8ED 1QHHA 5FBWB 4ZDWA 1U8YA 4AURA 3OZWA 2BJVA 1G16A 2Q3FA 4JT4A 2ZR9A 3W5HA 2ZS8A 1XEWY 1PVOA 3TMKA 3OF5A 2O52A 1CJVC 5DYGA 5HR5A 2ZI6A 4QRHA 5FTKA 1II8A 5DHAA 3V9PA 4YXWD 1VCIA 3HYTA 2GJSA 2X19A 3ADBA 1KMHA 1RYFA 4L8GA 4DC9A 1KC8D 4M22A 1HV8A 4WZBE 1MT0A 3WBJA 3EAQA 1IN5A 5KNCA 1GOTA 1LV7A 1OIWA 3CPWB 5FOVA 3F3YA 1K6MA 1P9RA 1KI2A 1CP2A 1OJLA 3S1AB 2A3RA 2AR7A 2B92A 1KK2A 1P73A 1WBDA 3FMIA 3AVUA 1TUIA 5HKKD 4DLSA 1E9FA 1E79A 3E70C 1Q22A 1I4LD 2HJVA 2IF2A 4M9QA 3VX4A 4JJZA 1BX0A 3PUYA 2CE7A 1GFIA 1FRNA 1ZM4A 4X8OA 2ZI9A 3AV0B 4OHWA 1K5GA 2YNMA 2V1UA 3EZ6A 1W2BB 4Q66C 3SQWA 1R5BA 3RLFA 2E9SA 4FMBB 4QHSA 1H65A 3BRWD 4Q4JB 2QSYA 1KDPA 2BSAA 3NHAA 4A0RA 1S9HA 2WWXA 1II0A 2GF0A 1EFCA 2J87A 4KBGA 5P21A 4YMUA 2W6JA 1AKYA 2ZREA 3U7GA 4TT3D 4URZR 2IEZA 3GLHB 2IS1A 4PO8A 4GMXA 1E69A 1G3UA 3EW9A 1S72B 3DMDA 4EPRA 2FEMA 3N5CA 5BW8A 2GESA 4NL4H 4C9BA 1YR6A 3EC1A 3LW8A 4KLNA 1ZW6A 4QBHA 4Q9IA 3ZH9B 1SVIA 3LV8A 3D6TB 3ZBUA 1CR4A 2R62A 1G6HA 3UIEA 4CZ2A 3BH7A 2Z6VA 2OTJB 3NIBA 2C03A 5IRCD 4N1AA 5DLQC 4NE2A 2OCBA 4Q48A 4UJ3A 3RWMB 3DOFA 3L0SA 4PO9A 5IDVA 4ARZB 4MGZR 2V7QA 1SKQA 3G6EB 3T5DA 2AHOA 1Z2CA 3S1AA 1DTSA 4OBEA 1YRAA 1VDZA 2H5EA 3CPJB 5BWMA 1K8AD 1NG9A 3CXCB 4D4JA 2O5VA 1CQXA 3MLEA 4JLDA 5HCIA 1U99A 3BERA 3X1YA 1YZNA 4BLSA 3GLFB 3W6NA 3AGPA 1XP8A 2JJ2D 4HI0E 4PQRA 2L0XA 2N46A 1ZP6A 3FKSA 1IXSB 3EXAA 2B7CA 1KOFA 3SNHA 4Q4JA 3VO1A 5FPTA 2C77A 2JGNA 4E22A 2XAUA 3WP0A 1VQ6B 4F4IA 5KYKA 1Q82D 3B9PA 3KXKA 4X8LA 1Y63A 3UMSA 1ANKA 3I56B 1UFQA 3GLHA 1HEIA 1LTQA 3U3KA 5JS8A 1WA5A 2PZEA 3IUYA 3K8YA 1H85A 4M8NE 5EP3A 2ZROA 2JLXA 4HATA 2VNKA 1DOAA 1DG3A 2ZS7A 4OQXA 2O8EB 2Q9BA 2AWOA 4UXJA 2CNWA 2D62A 4OKSA 3HR8A 1AN0A 5FL7D 4V0LA 3RRNA 1VQ4B 4YAUA 4ARZA 4QM6A 1JXMA 3A4MA 5FL3A 2FX3A 3UANA 1EFRD 1S1MA 4HDCA 1NN1A 4HUQB 2VSXA 2BWJA 3VO2A 3ADDA 2Q21A 1WDTA 2QA4B 3H84A 4DUGD 3GLFA 1H8HA 3U3MA 1E96A 1F2UB 1FMLA 2FU5C 4OHYA 4JL6A 2C9OA 1ZNXA 3M1IA 4PC1A 3AVWA 4B3DA 2OCYC 4KJZA 5HPYB 2DFLA 4XSGA 3QE0A 4Z8XA 2IS2A 3NEYA 8OHMA 1LVGA 2F6RA 1N6IA 3IIJA 4OI0A 4FCVA 2OAP1 2ZRPA 4B74A 1G19A 3AKEA 3R7WB 1HUQA 2KBFA 2VH5R 3CRW1 4NCNA 4MA4A 1SVKA 1KJWA 2YHSA 1QG0A 1F5NA 1X1RA 2Z5FA 2ZUCA 2PCJA 1M1YE 2WHXA 4JSTA 4OI2A 5EP2A 4BLQA 2OHFA 4JIMA 2QRNA 4TYYA 5KPJA 1H42A 4B35A 3GLGB 4GOKA 4JVMA 2HCJB 3B1XA 4Q7JB 2CL6X 2VO1A 4ZIRB 3C8UA 3OIVA 3CW2A 3GLFE 2PBRA 2G83A 4GSYA 5EE9A 2FSFA 3A4LA 4HUQA 3SU8A 3VR2A 1NVVQ 3Q3JB 1Z0KA 4TLEA 3IBYA 1CIPA 3TW8B 4PAMA 1MO5A 3U2QA 2ZI3A 3FWYA 4M4SA 3P26A 3HU2A 1F2UA 4XVUA 3AVXA 1ZM9A 1QHYA 4BGDA 2OUKA 1OYYA 3HYRA 2ZRCA 3U44B 1W44A 3RRMA 4JKYA 1GILA 4Q9JA 4DCTA 2WICA 4HLUA 2B5OA 1Z6YA 3GEEA 2Z4RA 1TVCA 1Z6XA 2F9MA 3NXSA 1CF4A 1GR1A 5CDFA 2PH1A 1KDTA 4C2UA 2YWEA 1TMKA 3R7WA 3NH9A 1NVVR 4RVCA 1IQPA 1G8PA 3U6KA 2R6HA 1P72A 4PXAA 1VG8A 2CE2X 1BMFA 3BXZA 1UADA 2GBLC 3TVDA 1YJWB 1N0WA 4LI0A 1Q86D 4M1SA 4ZGNB 4D0GA 1YZQA 1R10A 5HZHA 2VNJA 4B34A 4CEIA 3MAAC 2O8FB 2BGIA 3PEYA 3AUYA 1HT2E 3GLGA 4RCZA 4JBYA 4YMWA 4KSBA 3QPVA 4GRAA 2WWYA 3THYB 4DDVA 4ZIRA 3QY0A 2XTMA 2ERXA 1LF5A 4RCYA 4LYHA 3QIAA 3L8YA 2QGNA 4UJ5A 1OGIA 1N6HA 2QAGB 4EKDA 2GZDA 5K8TA 5LPNA 1E1QD 5EP1A 3B1VA 1HQYE 2ZJBA 1S2MA 2JJ1D 4NZYA 2XTNA 4U00A 3WMEA 4E09A 1KI4A 4RSGA 4YAWA 4I1OA 4QGAA 3UMRA 1U94A 5FL7A 3U44A 2WVJA 4Y9UA 1KZGB 3IHWA 2XZPA 4OI4A 5EMNA 5CDFE 2IL1A 5L3SB 1JR6A 4RD4A 1CULC 3FHCB 4Q18A 3AH8A 3RWOA 4MYTA 2X1VA 1Z6GA 4YQFA 3TSZA 3IIMA 4XIGS 3HJNA 3T15A 3NHBA 1XTSA 4AIIA 5SZKB 3AP2A 4LX0A 1OXXK 2OXCA 4G5QA 4Q4LA 4I4LA 4RZXA 3ZD6A 1W4RA 3QUSA 1Z0AA 3RSLA 3GQBA 1WE2A 4F7WA 4EH1A 3CCLB 5C1BA 1W2GA 4G1BA 3GLGE 5E95A 2JLSA 2HV8A 4MRVA 3NWJA 1GNPA 4XD7A 3MWLA 4C0HA 3KQHA 4M1WA 2ZI5A 3PENA 1EWYA 1S96A 2VF8A 3TSWA 1T5LA 3SHFA 3UK6A 2Y8EA 1TNDA 3W34A 4E07A 3THYA 4BUJA 3OHMA 2ZE5A 3Q7QA 1PLJA 3E1YE 2XOKD 5TVKA 3U7EB 3LVRE 2ZM5A 1Q1ZA 2XEXA 1MRNA 4LJAA 4BEJA 3OFNA 4TMZA 4TLCA 5JJKA 2NO1A 2OM2A 2G1KA 5AN9A 4LYJA 3TH5A 1WF3A 4PZYA 4QBGB 1AJEA 1T91A 3EC2A 3ES9A 4S2EA 4DIDA 1UF9A 2JASA 1T8TA 1AGPA 5AJWA 4AYWA 5ANRB 4CT5A 4WXRA 2DB3A 1JA0A 1N6KA 4DQLA 2KSQA 4D0NA 4NTZA 1Q1EA 2H18A 3FFAA 1KJYA 1VHTA 2GNOA 1CNEA 1G3MA 5TV2A 2IUSA 2QNRA 5L3SA 2IYZA 3SZRA 1MKYA 1Z0DA 3ZYCA 1U2RA 4B6FA 1HYQA 1S0UA 2YOGA 5E4FA 2JLVA 2YVUA 4JMPA 1B0UA 5HXBA 1IY1A 1VG0B 3BE4A 3KFVA 1PLKA 3W90A 4BECA 1UBEA 1N6NA 1R0WA 3WHLA 1T6NA 3GCGA 1F6BA 3BS4A 1YE8A 1US8A 1FL9A 3O47A 4KFTA 2DWPA 5FTJA 1G9XA 3RS2A 5BN4A 4CVNA 3FE2A 2IWHA 3LW7A 4AKHA 2WV9A 1JJ7A 1KTVA 1U98A 4M1KA 3DVLA 3PQCA 4WXPA 2FSIA 1GRRA 2SHKA 3C14C 2P6UA 5KUTA 4LYFA 3ZS8A 4B32A 1BIFA 4JLPA 4UKDA 4URXR 3LXRA 5FOWA 5JWRA 2ZSDA 4RZ2A 4GMDA 4RD0A 5KNBA 4LBZA 4D81A 1ZD1A 2GJAA 2ODBA 2X8AA 1JAHA 3ETLA 4P4TA 3TGPA 5JJIA 4DLRA 2BBWA 4AYXA 2ZYUX 3I73A 4G1VA 2GTPA 3DL0A 3U3OA 2GEUA 3A37A 1G21E 3ZBTA 4PHHA 1D2NA 1W49A 4FXPA 3WYGA 5CJ2A 3P1JA 1N5JA 4JLKA 1XB2A 3A4NA 1NL3A 1XFAA 3KDSE 3J81k 1SKYB 1DBSA 2VTKA 1XEFA 3ND9A 4B75A 3U7FB 3CONA 1E2IA 2R6FA 5J4KA 1AQUA 2A30A 2WKRA 4JYCA 5GV8A 4CEHB 2JCSA 4K8OA 4MYUA 1KI6B 1UEJA 2IYRA 1P2VA 3BBPA 2Z43A 2G77B 3G0HA 1ESNA 1KSFX 3X1DA 4CEJA 1ZNYA 2D4HA 4F92B 1ESMA 3C16C 1EK0A 3Q5EA 2J0UB 1OSNA 2AN9A 4NCHA 3RRZA 3CX7A 5A0FA 1JAIA 3A58B 1GO2A 4V0MA 2ZE6A 3IO3A 1D1NA 4PAOA 1WBBA 1YHNA 5AJYA 4DCVA 4LJ5A 3PUXA 2RGAA 4EFMA 5FBLB 3VTKA 2KJQA 2VPPA 4DSUA 3RVBA 1DS6A 2OO7A 5TR9A 1AMOA 2OESA 4G01B 5FBVB 2NG1A 5CYOA 2WJIA 4Q47A 2R6GA 1B2RA 2NQ2C 5BQ5A 4CW7A 1XJCA 2NOAA 4JVSB 3B1WA 4F7DA 3W9YA 3LQQA 4DDTA 1NMYA 3FMFA 5KPDA 1QHGA 2RMKA 3QI2A 1LF0A 2BMWA 1Z47A 2YWHA 4MGYR 2FPKA 4JSYA 4R98A 3EZ2A 4KI0A 3UATA 3EIEA 2RHMA 4BASA 4JVNA 2IHBA 1LFDB 1UJ2A 2VP9A 4FK8A 5J4LA 3GJ5A 3QPWA 2FDCA 2ZJ2A 1XJQA 4A2PA 4B44A 2H7VA 3Q8XB 2XOKA 3QVVA 3W3ZB 1EFTA 2F55A 1E62A 2RB4A 2ZJZA 1NI3A 1E0SA 1VYVA 5AUOB 5AJVB 4FINA 1VQ7B 1TU3A 4DLXA 4D0LB 1DAGA 3K0SA 1P5ZB 4PGOA 5CITA 4CEHA 4QHYA 4YHBA 2DERA 3SS8A 4Y0VA 1XZQA 4W5HA 1OKKD 2HEIA 3G5UA 2OBLA 4LJYA 4NDZA 1A2KC 2NZ8A 3LQRA 4BLPA 5HE8A 1T4GA 3EZFA 3W5UA 5KSWB 4AG5A 2N42A 2PEYA 2GCPA 2GXUA 2OCAA 3QJYA 4PPFA 1GKIA 4DWJA 3AUXA 4IOKA 1G8GA 4PAQA 5AK0A 3T12A 1NBMA 4MRSA 4GZMA 3EX7C 2CHGA 1JEDA 4M2LA 2VEDA 5H68A 1HA3A 2I1VB 4B3CA 4TYPA 3TSOA 3QKRB 2FE4A 2CK3A 1XBTA 3KJIA 2BMEA 1UPTA 2QAJA 2H17A 3ASZA 3ECCA 3MGCA 1KYIA 4OQLA 3CWZA 1R0XA 2R6AA 3SC3A 4RJLA 2B21A 3B1YA 1E2PA 1TQ6A 2EIXA 2QMOA 5EE5B 3T06B 3KKOA 3A1WA 3SJBA 1RRPA 1ZIPA 2H57A 4AD8A 1IHUA 2O0JA 4WZAE 2VP6A 1NLZA 4GP6A 1R2QA 4WAUA 1Z3IX 4ZPXA 4JBWA 2F3RA 1DVRA 3ZC3A 2JJ8A 4BFXA 1UKZA 1Z5ZA 3K53A 2IHYA 2XZLA 3BH6A 4C0SA 1NVUQ 3I61A 4TSFD 3AB3A 3X1WA 1F2TB 3EPHA 2FA9A 2C78A 2BIFA 1R8QA 2E87A 3OIYA 4A0FA 1VMAA 5KSZA 1E2EA 2W0SA 4KO8A 3G71B 2ZAOA 3BB4A 3LX5A 4HLUC 1NBME 3L8ZA 4OQMA 5FUYA 1ZC3A 4UNPA 1Z0JA 1G3IA 5CIQA 4D80A 1VQ5B 2BC9A 2AFHE 1KQSB 1P60A 4ZDIA 3D3QA 1FOEB 4JZKA 5EJEA 3IKJA 3MUFA 4RKEA 4HDOB 4C30A 4HLCA 2NGRA 3CX8A 3AP3A 1DEKA 2ZSFA 4KHZA 3QVUA 2GXSA 4ZDJA 4HZUB 4P33A 3RS3A 4AC9A 1JXOA 4MQBA 3QKRA 3TUIC 4L15A 1OH6A 1JJVA 1CJUC 2F7SA 2QDXA 3ONWA 2NPFA 5GV7A 3WBKA 1U0LA 4LC1A 5K8LA 4GT1A 2ZSAA 3KXIA 3QKSB 3GJ3A 1A1VA 4HEJA 1W36C 3PEWA 1CU1A 2R6DA 2VA8A 4AKGA 1KO4A 1LS6A 4NU0A 1KSGA 1ZVQA 3OJXA 4B2PA 1P9WA 4Q1BA 2RGDA 3IPXA 2GAOA 1DO0A 3T1VA 4ZI2A 1AQYA 2P0EA 3AF2A 1NVWQ 4P6VF 2CJWB 2LWIA 1XMIA 2FZ4A 3KB2A 2EYQA 5DH9A 2JATA 1F60A 4IDNA 2OTLB 1AIPA 2GZHA 3U6BA 1G7TA 3QXCA 3JVUA 2CMKA 5KDOA 2BM1A 2ZEJA 4IOJA 4V0OA 4DEXA 2G3YA 4EPYA 3B13B 3DZDA 3NC1C 5TY0A 5D3MB 3I92A 2YV5A 4I99A 3ZVNA 4DLTA 2ERYA 2ZRJA 1RRFA 1G7SA 3LA6A 1WB9A 3WY9A 3CPEA 3EASA 4HB2A 1VQOB 2JDID 1E1RA 1N6OA 2DWQA 3FDIA 2FFAA 1NF3A 3QXSA 3TR5A 4BRUA 4HZUA 1E9CA 1YVDA 1OKKA 4LDJA 2Q3MA 2IS4A 4Z8YA 3IEUA 1YZTA 4TMTA 4GOXA 2RGXA 2XXAB 2J7KA 3LRPA 4PX9A 5H5JA 4A8JB 2QA5A 3K70B 1ODFA 2JIZD 2QTZA 3MWYW 4PPNA 2HDNB 1IJFA 4TTPA 4BZQA 1NIJA 1OXSC 3BAFA 3HDTA 1OHHD 4XTRA 3PJRA 4G5RA 1MV5A 3CF0A 4HZIA 4JT2A 5FPKA 1HH4A 3NC0C 5CK4A 3FKQA 1KO7A 5FOUA 1QHNA 1XEWX 1JQJC 2CJWA 1RYHA 4JLAA 4O0MA 1N0VC 2BMJA 1G8YA 3M4YA 2IF0A 3U5ZB 2CDNA 3C5HA 2D7DA 2J3EA 1WCV1 2IA5A 2A7QA 1OT3A 5FUVA 4DLZA 4URWR 1HT1E 2IYYA 3V76A 2GEDA 2ZJYA 1GNRA 3GEHA 3SN6A 1XU4A 4JL8A 5D3MA 2GJ8A 2P5TB 2W58A 3BIFA 4MKGA 2J7PA 3IQXA 3TR0A 1BH2A 2ZYTX 1XRJA 2YOHA 2EFHB 3MWJA 4MDEA 1W7AA 4A6XA 1N5LA 2WIBA 4ACBA 3RAPR 3SBEA 4PHGA 4FWTA 1N6LA 4RFSB 4WVFA 4JLOA 4P4SB 2DPXA 3BWDD 4B47A 1E98A 4HYYA 4GNKA 3IIKA 4LK2A 4NYIQ 3VFDA 4B3GA 3MCAA 2F1JA 2XXAA 1BS1A 4DKXA 1G3RA 4BRWA 2GDJA 5H1YA 5C18A 4KBFA 3AF1A 2OK8A 2NZJA 1ZM7A 1D9ZA 4YDHB 3TVTA 4D4KA 4I1SA 2CNDA 1O87A 3ZVMA 4C3ZA 1OLOA 2XGJA 1SQ5A 5B58C 4TYWA 2RAPA 1DO2A 1AGRA 5FH9A 3KX2A 5LB2A 1FNCA 1K8RA 2WM9B 4ERNA 1OPXA 5GVSA 4IVRA 1KZ7B 2BOVA 2H16A 2ZRKA 1OXVA 4NYIR 3KZ1E 2IX3A 2P3SA 5BYKA 3CC4B 1DDGA 3QOFA 4RZUA 1CR2A 5A5GA 4MRRA 2CVHA 3NG1A 1AZSC 2XSZD 1EWRA 1ZRHA 3OEEA 2F1HA 3TJZA 1XJ0A 1VQ9B 2FEOA 2FH5B 1XTQA 4Q00A 421PA 1W47A 5G3ZA 3MG9A 4ESHA 3U4QB 1BX1A 5DN6A 1S4QA 2DR3A 2WJJA 1ZU4A 4B76A 1JR3D 5G40A 3IO5A 5CM8B 4OQNA 2EYUA 2PT7A 5D3QA 1XEXB 1LB1B 4PFSA 2G9NA 2FWRA 4RFSA 3CCVB 2XJ4A 4P4SA 4YMVA 1EESA 3LWNA 1ZNWA 1AK2A 3MFYA 3I5YA 3EG5A 1COWA 2OCPA 2OFXA 3PCRB 5HZKA 3JQRA 2XB4A 1W5TA 4XH9B 2R2AA 3I32A 1OFTA 4DSOA 1KRHA 1TX4B 2B8WA 1YU9A 5JMTA 2YWGA 2BEJA 4WBSA 5AR1A 3MHPA 1Z0FA 1SXJD 4B73A 2AFIE 3CKLA 4EPVA 1QGAA 1W2HA 1K73D 3BD9A 3BGWA 4LY6A 3RDPA 2IYVA 4Z1MA 3LLMA 2EQBA 1NN5A 2FFHA 2GQFA 2G1JA 3CMEB 2D06A 2AXPA 4FD2A 4LUCA 4NYJQ 3ZIAD 4KITB 4KV9A 2G0NA 1ELOA 2X2FA 3O8BA 3R8CA 1E0KA 3REFA 2JIZA 2HT6A 4KAXA 2QTFA 3W5IA 1G8HA 3CNLA 4Q9HA 1MOZA 4ZCMA 3O8CA 2Q0HA 1ZUIA 3OAAA 4I1UA 3A6PC 2RGEA 2J46A 1A4RA 3AVPA 1P9NA 4BQSA 3U4QA 2HUPA 3KB1A 4DRZA 1X8JA 2ONJA 6Q21A 2VNHA 1UAAA 4C0BA 1RVDA 3KKNA 2WZQA 4QGHA 2O8CB 5JRZA 4NYJR 2YC4C 4ITRC 2VNIA 1XEXA 2F9LA 3NH6A 1H8EA 1BYUA 1C4OA 3L43A 1G64A 1RW4A 4EAQA 1VIAA 3M6AA 3PG5A 4KFRA 3ZQJA 1W4BA 4ACAA 5EUQB 4KCGA 4XSHA 5EXXA 2BBOA 4BLOA 3U3JA 1M6NA 4LGMA 1J9ZA 4XJXA 4OK6A 2NO9A 2AKAB 3QXHA 4YXWA 1Z2AA 3W8RA 1AS2A 1ZIOA 1T3LA 1ZAKA 1IXZA 2W0MA 3ZVLA 2C9YA 3VKGA 2MMCA 4TL6A 4JYBA 2PZGA 1EWQA 2VRWA 3KKQA 3WRXC 4PO1A 5L8VA 1IAQA 4PSKA 3GLHE 1L2TA 1GM5A 4Y7CA 2GCOB 3WP1B 1XTIA 1W4CA 2AWNA 1M7GA 1FW6A 2WIAA 3CB4A 2FF7A 5SZIA 1TU4A 2ZRHA 5HKKA 4V02A 1D8TA 1UEIA 4MUAA 2ZTSA 2GK6A 3CBQA 4HE5A 2O0KA 2AK3A 1S8FA 4TL8A 4URUR 5LBIA 2QTVB 3W5VA 1W0KD 1C9KA 3A36A 2P6RA 1FQKA 1YR7A 2C2HA 4D2IA 1IY0A 4HSEA 1MRSA 1JA1A 2O8EA 2GVZC 3CH4B 2UZIR 1E99A 4TT3A 4B2IA 5E7JA 3WYAA 5EUMA 1OXUA 4L16A 4TQ9A 2ZUDA 3QEJA 1G5TA 1NY6A 1E0AA 4IVQA 5J40A 1ONBA 2VYFA 3SQXA 1U0HC 1Q7YD 1VQMB 3CH5A 3B1ZA 1KK3A 4Q7LA 1Y3AA 4PQFA 3KJGA 2C8VA 4TWZA 5B2ZA 4BEBA 1T9HA 5FUXA 4HLDA 1R0YA 5GJWC 3IPYA 3FTQA 4OQFA 1MABB 2FV8A 1N2CE 2C9CA 3OIWA 3Q7PA 3UG7A 1RZ3A 1KI1A 3AVYA 3FMOB 1Q81D 4POAA 5A4JA 4GL2A 4QOSA 4LWZA 4B3XA 5THXA 3CMAB 3CO5A 2JA1A 3RANA 3TAHA 4ASUD 1VQPB 3R9WA 1D6JA 5B57C 5G53C 5DE3A 1G5PA 4XTCS 2WBLC 2IUTA 1CJTC 4BZPA 3MD0A 5DISB 1CEEA 4AKIA 2JJ2A 1QVFB 3FVQA 2IYXA 3SJCA 1NLYA 4N0EA 5L3VA 2IXFA 1UDXA 3BFVA 5J5CA 1TQ2A 4A0HA 1G6OA 3CCRB 1VECA 4ZGQB 4IFEA 1E9EA 1OFUX 2XB2A 4R2HA 4TLDA 3EPLA 3AM1A 1Q21A 4LJ6A 5BN3A 2ZRIA 1E0JA 2VHUA 3Q72A 4K81B 5TB5A 1KDOA 4W9MC 1II9A 2VP5A 1VCNA 3FGNA 1U8ZA 1OW3B 1RKBA 3HPRA 2FNAA 1E2DA 4IOLA 1SVOA 4IW3B 1XCPA 2VSOA 2CEAA
chains in the Genus database with same CATH superfamily
4ARCA 1NRJB 4PNEA 3C8MA 2J85A 4N0DA 1TZMA 2G9UA 4J7CA 2JVIA 4Z4UA 2NTJA 1BXRB 1T6BY 4CQMD 1VBMA 3K9WA 4KGVA 4N3NA 1PFKA 4OPOA 2BDUA 1LH0A 5LQJA 2H1LA 1Z56C 2J9RA 2OLJA 1Q15A 3WNBA 1NJ5A 3H5AA 3HP1A 4R16A 2HSGA 4WLNA 3GBVA 3N2GA 4W4TA 4WKNA 4D02A 5LUBA 4WZ6A 4EJSB 1Z7GA 3N5KA 2HCRA 3QY9A 4KQ9A 4QFBA 2LRHA 5FOSA 2QEXB 4D4LA 2P6NA 2EJWA 1CUIA 2FFBA 4KDCA 3RC3A 1U8AA 5I7FA 2FXVA 3HL4A 3PE6A 4P3NA 1DAFA 4BE9A 4ZCPA 4DMCA 3MMPA 3RK1A 4EIWA 2P2CA 1IBMB 3H7AA 5CB4F 3AB7A 2NU6A 5K3BA 2WMNB 3H1AA 4D43A 1U3UA 1JE0A 1KPHA 2LE0A 3LO8A 4WHMA 2ODTX 1GL3A 3NONA 2BKLA 4WXMA 4HXFB 1CXZA 1E4YA 3SLDA 3QTBA 4IXNA 2P1DA 1J0AA 1UPAA 5AI8A 3Q9NA 4AZSA 1PP4A 3QEMA 1PGQA 2G88A 2CC2A 2GOYA 4B3SB 1T8WA 3DHEA 5K8IA 5MHTA 2SBTA 1ZN2A 2C1EA 1ISSA 4EMTA 4OSEA 1F8GA 3AVQA 3ZJYA 5DJ5A 1ZC4A 5ECWA 4UNIA 3IAS6 4U02A 4QVIA 4QG3A 1JWAB 1VBNA 4MCAA 4LE2A 4IQ8A 1NNEA 1Z5PA 3W2FA 4LQ4A 4WCFB 5JECA 3LKBA 1E2NA 4I50F 2QE7D 3MZ0A 1GL6A 4D3DA 3P7MA 4F2PA 4M1YA 2FOLA 5DM70 3DUWA 2ZBFA 1ZXXA 1KP3A 3K09A 4X06A 4MS3B 4NQRA 2H9IA 1EXWA 3BMQA 3KKPA 4NDNE 3UT0A 1KARA 1M72A 1I6KA 4BEVA 1LPAB 3EGDA 1BXKA 1NB9A 1WV1A 1ZRMA 2AXEA 3Q8KA 2CHVA 4YAFA 1GCIA 1QKJA 1OYWA 1YJCA 1Z28A 3HGQA 4JJIA 4KQ2A 3PXGA 3R7SA 2V0GA 4FD3A 2C2YA 2F1RA 3GD7A 1PKEA 4I5GA 1WQ1R 4RORA 3KVRA 5DHQA 3DLIA 3WMFA 3OESA 1CJBA 1O6CA 4LKRA 1Z4PX 5BNZA 5TXGA 5JYBA 2ZIUB 4W5JA 2QRHA 3SIXA 2UXCB 2Q9CA 3N0WA 4U3JA 2V7WA 1PVDA 2IV7A 1WRBA 4ZQBA 4ZJYA 4UTZA 5GWXA 2AF3C 3TDNA 1WW3A 2HQSA 2XCIA 5BO5A 3SGLA 1TRKA 3N58A 3R7NA 3JQ7B 3EZ9A 3V4FA 4C5AA 4EKIA 4I55F 3QKUA 4R05A 3RF6A 5INTA 4G8BA 2HA0A 2FPGB 1MOQA 3BGVA 3O31A 4ENUA 1KS2A 3D9QX 3R5FA 4TMXA 4PFQA 1SGWA 1IN7A 3ZLTA 4AJPA 8MHTA 3WLNA 2WWHA 2FVXA 1K92A 4R71A 3A6ZA 4IFIA 3RS5A 2W2VA 4N6NA 1FNDA 1NYQA 1UFOA 1EFDN 3L7JA 1TAQA 1QS0B 4AY4A 3DBRB 4HPXB 3RYHB 4EKYA 3OO0A 2J0EA 1GIAA 1X8KA 3VHLB 4ZA2A 1QZ3A 2BFMA 5HFAA 3L82B 1NLUA 4B4KA 5LU9A 2WAXA 1XPOA 4YT2A 5B30A 4JLJA 2E6UX 3SR3A 4BPRA 1NJGA 3GCXA 3ZYZA 1BHO1 1WBJB 2CLLB 2OG1A 3CF6R 3R9KA 4C0JA 4TRMA 4UXHA 1MFZA 1RZUA 2BKVA 3GJQA 1A5AB 1BKSB 5JDIC 1ZNQO 2AG1A 3WXMA 1J70A 1XVIA 1Z0ZA 2L17A 1EE1A 1U7WA 4G0PA 5A5DA 1NDHA 2P30A 4OY3A 2P35A 4JELA 4MAAA 1RM3A 3ZU2A 1X86B 3ANNA 4WJLA 3JZIA 2OMKA 1OT5A 1E1QA 1FTSA 2HO4A 1MO4A 2A59A 2JJ1A 2L82A 5E9AA 2FCAA 4YT4A 2RH5A 1DV2A 4YAOA 1K63A 3GW8A 2D2FA 4U2BA 4NE9A 4Y6PA 4ZVLA 1AHPA 3IP1A 4JJ7A 3NUZA 4BB9A 5AVXA 1DRJA 1M1UA 1TF2A 2VDWA 4MPPA 4WXHA 1ZXBA 2GHQA 3U0VA 1A8PA 4KVFA 3HKBA 3EGVA 5LN1A 4ONEA 1A82A 3GNSA 3WLKX 4ZGWA 1XMJA 3FSJX 5IWAB 3CCSB 1GG5A 2PSFA 4KNYA 1T5IA 1VKNA 1FFYA 3QVTA 3LT4A 1FFWA 1WOYA 1QV6A 3H17A 3B8HA 4EGQA 2O8BB 2GILA 3AI1A 4ZARA 4DRXA 5I51A 1ODSA 1U6KA 3EHDA 2CLKB 3OLCX 3ZWNA 3JALB 4TV8A 4X8MA 4FYJA 1T3GA 3FIUA 1I30A 2IEIA 3WLAA 4JK3A 3ELYA 4ZV4A 2V7UA 1NSFA 2QP4A 3F67A 5LZ2A 3IUQA 1RKQA 1OE0A 3E18A 5K1ZA 3GJYA 3KZXA 5IKMA 2FHSA 1ZVKA 4G1FA 4OAOA 2W6QA 1A76A 3EXG1 3TXAA 4AZTA 1E6EA 2YZ2A 4JIGA 5ED4A 3BMCA 1X94A 1L0BA 3TZEA 1KAGA 1GLVA 2X1LA 4Y0NA 2PBLA 5EPOA 4WKBA 3IAM1 4RSRA 2IHJA 5IXSA 4XLLA 3D8UA 3TIVA 3KZMA 3OE1A 1MB2A 3DONA 4XJVA 2D9RA 1I1NA 3G5LA 3GY0A 3H4MA 5FI1B 3HXOA 1XOIA 3EVDA 3OBIA 4G26A 4DIBA 3PUVA 4DREA 4DA6A 5A3QA 3L1HA 1SQSA 5CAEB 3NTRA 3N3BC 4OQQA 4PR3A 3BD8A 5EFOA 3WLRA 2BF4A 4K9LA 2WHEA 1RACA 5LXTA 1LLCA 2ZYWX 5ESRA 5CB0A 4GBJA 3M9LA 1RC8A 3KHKA 3CVWA 4PQYA 4XWAA 4QBKA 3FR8A 4BZWA 2EP7A 2J0UA 5BW5A 3KQSA 5ALEA 1DJOA 3QX8A 4OB8A 1XCOA 4AB1A 3QE9Y 1GVNB 4ITVA 1P2SA 1DFGA 2QG4A 4TL7A 1R5NA 3RREA 4EMSA 2YW2A 3WLHA 5L53A 4U6NA 3SSNA 4AICA 2QLNA 3OTGA 1JI3A 3O21A 3SYNA 2DE0X 1FSPA 1PL8A 3HEMA 3W5BA 1H3FA 4PLGA 2P0AA 1DQZA 1SBTA 1L7MA 3BJZA 3F9CA 3QVWA 4URHA 4EFLA 5KTOA 1FPQA 2X1HA 4QPJC 3OURA 3K6SA 4H3VA 3SDZA 4MS4A 2UYGA 4TZTA 3L8CA 5IZ4A 1HDOA 4MINA 5KX5B 2BZSA 1TLLA 3ENNA 4FZ5A 5FPQA 1GZHB 4FFBA 2I7VA 1P91A 1XTRA 1SKYE 2ISQA 2RB5A 1C30A 2V4DA 1DJPA 4OQEA 5L9AA 3NKVA 1UMKA 4DSZA 3KZNA 4P0TA 1OI2A 2QP9X 1SNYA 1GXSA 2I55A 4CUJA 4FYXA 4H7HA 3GRVA 2YQ5A 2ZYAA 3VZBA 2O9JA 4R31A 1Y1LA 2XBMA 3VR4H 1GAWA 2UYCA 1YQUA 2PRYA 1JXQA 4UATA 1R9GA 3KUUA 1L8QA 3O4RA 4JJ6A 5DYIA 3VC7A 3FCUB 1E1KA 1T0JB 5IUJC 3I8OA 5HYVA 4EENA 1T2CA 3F6EX 2ZB7A 1RTKA 5U4QA 4FNMA 4M21A 2X15A 1FLDA 1I7LA 3BORA 3KWJA 5JXGA 1KH1A 4FNOA 4JX8A 3PFIA 5FDFA 1VKZA 4HQFA 2GWRA 1L1RA 4DWOA 5JD4A 2ZJ3A 3TTXA 5A4MS 2G17A 5TNXA 4RLFA 4YRIA 2ZUBA 4JLBA 1CJMA 3OE4A 3P52A 2W8BA 1BTOA 4UZSA 1L4YA 1RCUA 3GLIE 3RVRA 1RLUA 1WP6A 4OO3A 1CR0A 3FDZA 4HHEA 4K3UA 5LQCA 4PC2A 4JEMA 2BSQA 1C29B 1E7WA 3QEOA 3ZKWB 1G5QA 2P11A 4G5GA 3ICVA 2OGTA 2IV2X 5AKEA 3JQBA 2QTLA 3C3JA 3T9CA 3QX3A 1I1OA 1CYEA 2PKWA 4OHXA 2OXEA 4O4HB 4Q5IA 5D85A 1W85B 4OJNA 4U2GA 4J03A 2FPXA 3VSBA 3HDVA 4DM4A 4PLPA 1XUOA 3RSSA 1YL6A 1OX4B 4KQMA 4MGIR 3BD7A 5LA6A 1G18A 1Q1BA 4RM0A 1IPHA 3BXHA 4P83A 2DHQA 3UOGA 3MTAA 2PWZA 3EIHA 3I39X 1N2GA 5AUQA 2A57A 5I9TA 3BJEA 3JQAB 2PBFA 1NAIA 2C2OA 3R7FA 3OLYA 3ND8A 3DT6A 1RI4A 1M5UA 1OREA 1XF9A 2H5JA 4XFJA 4BVKA 3HH8A 2XW6A 1GYPA 3R41A 4IIGA 2KLHA 4TYMA 4BXOB 2WIFA 3RK4A 4Q9DA 1I2DA 1RHQA 3G2KA 3K94A 3KTFA 2Q4RA 2AN5A 1XE3A 2Y05A 2FRDC 1HQKA 3CCMB 1X77A 3SC6A 4PONA 2XRMA 1P4GA 2ATIA 1VM6A 5CM9C 3G2OA 4KLZA 4QARA 2R86A 4DBLC 2G36A 4NZMA 1Y6GA 3ROZA 3KYDA 3ELBA 4F4CA 1RBZA 3DLPX 4CMBA 5DGCA 5LLSA 3R0IA 4CCYB 1YR2A 2VIIA 3DXXA 1G6KA 4ENSA 1R18A 4KYIB 1SUIA 1JDNA 3A1UA 1KXJA 2QX6A 2HJGA 3GZNB 1DE0A 5EYPB 2AV6A 1E20A 5GQSA 5BSWA 3M1AA 1DAIA 5TJHA 1R6UA 1IWOA 1W52X 3KJQA 4A2QA 3IUBA 2FR1A 4CQJA 4LV8B 1XWFA 4DXHA 4X7RA 2W2XA 5EJMA 1W6RA 4B3BA 4WFQA 4NS1A 4N6OA 3EOBI 4UE6A 3L84A 3A1CA 3NYRA 1ORWA 4PO3X 4ZEMA 2FGJA 4DCNA 1EIWA 1C9NA 3OE7A 3WRYA 1QHXA 4YACA 2FN9A 3KYBA 3GGDA 4RPDA 3FKSD 3HNOA 3IEPA 3WSTA 2H1IA 4A5OA 4KREA 3ED5A 2W6MA 3MWDA 5ICMA 1RWNA 1Z16A 2OE2A 1L4HA 4KWTA 4MRPA 4OTZA 4ZOEA 2C99A 3ER9A 5FPHA 4HQRA 2VDVE 1TFRA 2Q3HA 4BYMA 2EFDB 4XQFA 4EUHA 3DOEA 3BF7A 3F2IA 3BD6A 3O8QA 3H2GA 4GZ3A 4WASA 4CDRA 1X70A 1AXRA 2RGGA 2H2DA 2FGKA 1XD8A 4Q9LA 1UJ6A 1NU6A 2O3JA 3QW4B 4CG3A 5ALNA 1KZHA 5D86A 3TOCA 1S9DA 4O59O 1JEAA 3WBFA 1SVMA 4REQB 5THKA 2H85A 1NJ8A 4E2XA 4CMHA 1M2OB 2C8JA 3DVQX 3LUDA 3Q5GA 3ZV6A 1V4VA 3RAJA 2I34A 3G0OA 3W77A 2XYGA 4X61A 5TF4A 1SQFA 2HSEA 3V4ZA 1GCGA 3JQCA 3IALA 3B6EA 4ZDKA 4PNHA 3AIOA 3WO1A 5TMPA 3GJRA 1K7YA 3AJAA 2HKIA 3CO0S 2NWQA 2I9KA 1OB2A 3JU4A 4BDTA 2IS6A 4B5LA 1PJTA 3ONDA 1CS0A 2J3MA 2Z6BD 1QCYA 1ONPA 3Q6IA 4X60A 2II6A 1D0VA 1I2BA 2Q62A 5ENZA 4N5LA 4AY6A 3DW3X 1YZGA 3BAZA 3ZHUA 1KZ9A 3ORHA 1H22A 4D41A 4YAEA 3F71A 4M7PA 3JPWA 6LDHA 1SIWA 4CI9A 1GD1O 1CS4C 3HU3A 3OCCA 3FRJA 3WHIA 2IH4A 1SC4A 1RJFA 2ZSBA 1UR5A 1GADO 1RBQA 3FCCA 3LBFA 4BUZA 4MLDA 3TRFA 2QVCA 3P9NA 4NE7A 4GU5A 2ES4A 2JGDA 2W4MA 5EWLA 4AZVA 4H7EA 2R25B 4ZK2A 2W22A 2AG5A 2WYVA 4N3AA 3V8PA 3FN4A 1HGXA 4QT0A 5JCJD 3KYIB 3I6BA 3AEUB 4CQLB 4XDYA 4AY2A 2P3MA 3FHOA 2YBDA 3ICCA 1VLLA 2JBAA 4PR0A 3PEVA 5SZHB 4CMEC 4BVLA 1E3ZA 2QXUA 3BDIA 3DGEC 2I9PA 2V1XA 3CG0A 1YCHA 4C43A 2BY4A 5H3HA 5BSEA 1CKEA 2BFOA 3QWBA 1GGEA 1Z8FA 4WFIA 3GR6A 2Z8YM 3AUJB 4FFRA 2AMLA 1NZJA 1N5RA 1QHIA 3PR1A 3KQMA 5I7AA 4CKBB 1QAQA 1JDUA 4HN9A 5EZ5A 1P1HA 3PHJA 3NYQA 1EP9A 2WWTA 1JILA 1QIIA 2FPMA 2W6NA 2GZRA 1AUVA 3A8KA 3HB5X 3GV0A 4IG9A 3WDMA 4YI5A 3P2YA 1ZEJA 4HAVA 2P2SA 1EDEA 1YOVB 4OH1A 1RRGA 1CUVA 1ZITA 3H6KA 3CA8A 4INZA 3C1AA 4L9WA 4KR0A 3BFXA 4XQGA 2IP2A 2PMEA 3ZV4A 5BN5A 3CD6B 4D56A 3FI9A 2JLUA 1NOJA 5T8KA 3TNJA 4AJLA 2HYIC 2W83A 2D3NA 1YFZA 2QD1A 4LOKA 3JWJA 3EY9A 3CIOA 4LSWA 1UBGA 1J56A 1E8NA 1T2DA 1X1DA 3QHQA 1A9XA 1YFLA 4N76A 4QU5A 2JNWA 3K0FB 3DD5A 4ZCIA 1XZMA 2JIQA 1KEKA 4O5AA 3EZYA 2PWPA 3MCUA 2ZJAA 3WGQA 2WDZA 2V59A 2H2FA 3U17A 4OGGA 4EF5A 4B4WA 4OF4A 3CCQB 3FFTA 2Q2OA 3LL7A 2X0IA 3D81A 3EIQA 1E3XA 2NV0A 3A6KA 1WXWA 4OUDA 5EIAA 2D5BA 3ESBA 4CF6A 2B8NA 1SCKA 4IHKA 1RD4A 1R9MA 1E58A 2QVXX 3IPAA 5CLHA 1PJ3A 4DR4B 2CXXA 4YVFA 4YELA 3RI3A 4NMMA 1O8CA 3HS3A 3MJSA 5JFOA 1XT6A 2FFQA 3CZ4A 4F6LA 5F77A 1TEXA 4TKMA 1FZTA 3KLMX 2E85A 1A8HA 2EEZA 1KI9A 2IC5A 3E9YA 3HCFA 4BATA 1AM4D 3FHLA 4KXUA 4N7MA 4LYAA 4CU2A 2FQYA 3H3JA 3GDWA 1VL0A 4XN3A 1ZMXA 4MDHA 4QSHA 5CLFA 2YV3A 1S2OA 1J2JA 4ZV7A 2NTEA 3ZDZB 4N5HX 1FFXA 2YWFA 2OD2A 2OCIA 4E4YA 1EFVB 5F4ZA 4GR5A 4D4IA 1HDRA 5HNKA 4J0KA 1U8TA 2B8JA 1FJ2A 4PZZA 3IPRA 4KODA 3DMNA 1T2FA 5I8PA 3ASUA 2C5LA 4NPHA 1I32A 3NDRA 2FUEA 1YI2B 4H6XA 1P8JA 2GQ0A 1N25A 2AZDA 1NJ2A 3SHWA 4PRLA 4RTJA 5MGBA 2HBZA 4MP8A 4UDYX 4OI1A 3FGPA 4EW6A 2FY8A 2KBEA 1BWSA 5E1OA 5FBRB 4PCUA 4C4RA 3AVTA 5A3RA 3RHFA 4J9UE 3DBOB 4MI3A 3NB0A 1GNQA 2NSJA 3JZAA 3VTAA 4GWKA 4TQGA 1N9GA 2QV7A 3D64A 2YZKA 1XZAA 4TUYF 1NRKA 1B2LA 4UM9B 3MWEA 1UBCA 2D74A 1RS0A 1X7GA 3A9CA 5EWMA 1TTPB 3FSRA 4YQYA 4D8TA 3IEKA 4L5BA 1L5HA 4E21A 3FFBA 4BV2A 2F90A 3MQ4A 1V95A 2OQVA 3LOPA 5JSKA 4D0RA 4ND8A 1G8MA 5EQTA 1Z33A 1OILA 5GOTA 5ICFA 1ESZA 4LV6A 4LOHA 3AW9A 2V0CA 2ID4A 2Q0SA 4KH1A 1CYDA 5EHNA 2HIMA 4X6YA 2GXAA 1ZS9A 4HNGA 5BP7A 2J1LA 4R68A 1FNSA 4E5DA 3JWGA 1K7CA 2PO7A 4XWKA 4F1WA 4BKUA 1YUMA 4J94A 3CRMA 3UAVA 5B64A 2JS7A 5BSRA 3DE5X 2PUWA 2XMPA 1VPLA 4QDOA 3IQHX 4FPXA 2EZ8A 5AJUA 4BMSA 3QFSA 3THXA 3DKRA 1TADA 3O1HB 3V8RA 2Z1DA 1L7QA 3EEFA 1UQRA 3HCWA 3FDXA 3SIPA 3UHFA 3CP2A 4HAYA 3TJMA 1UBUS 3GEIA 3P0IA 2F3SA 3VDMA 3UAZA 3EJ6A 3AUTA 1POWA 2QN7A 2P8JA 3QFRA 1P4JA 3MWGA 3O26A 3JYHA 1HLPA 3N53A 1UBOS 1NF8A 4D9GA 4MUHA 3JY6A 1GPWB 4OJTA 1POXA 3RABA 4KR3A 4JI7B 2X6RA 3Q11A 4IJVA 3WFIA 4CCAA 1X2EA 2G07A 1NVMB 1E8DA 2GEKA 4CF7A 4JCOA 5HTKA 3HB4X 1LDNA 2QYOA 4J75A 5B1SA 4AS2A 2WWRA 2PJZA 2FMUA 3IJRA 1ZL0A 3KB8A 3W5JA 3WGKA 8LDHA 3W6PA 2BE7A 4WW0A 2DWOA 2DYKA 4P9SA 1KVSA 3F7TA 4I4NA 3WLIA 3VNVA 4G5SA 7ADHA 1L7VC 1JSRA 4HRXA 1CRPA 3UMMA 3EOAI 3L06A 2VJMA 4AN0A 1ZKMA 3D3KA 4MW5A 2BZ1A 1JR3E 1OFIA 2Z9CA 4UVGA 5D5PA 5HF8A 5JMPA 3IGFA 3KE9A 1YR9A 2VHCA 4Q16A 5IKOA 4BAZA 5JAHA 2G5GX 2OQRA 5A2GA 5KNBD 4O2BA 1YQDA 1BXZA 2R8RA 1P3Y1 2WT8A 2XNHA 4RA6A 1ZA2A 5FTNA 3R9IA 5CT8A 1CP3A 1S3GA 3RR2A 3OD5A 1F0YA 4L6AA 1YS7A 2XA9A 3OPMA 2WUDA 4O25A 3RNLA 3WNZA 3PFGA 5IC5A 3EA5A 1SULA 1ZHOA 3A4YA 5H7XA 5A3SA 4Q1FA 1ICEA 2FOIA 1DBQA 2Y27A 3SYRA 4HVCA 3BCUA 3VR5D 1P29A 3NJ4A 4PIMA 1ZJJA 4ML3A 1E5XA 1N3YA 2JD0A 1T8RA 3LZ6A 1EXDA 1C5KA 2EX1A 4B6SA 2UUPA 3BIXA 1ES9A 4XVHA 1DXQA 3VU8A 3DT8A 4S1WA 1E9RA 2XYHA 3EEYA 5ITZA 4F84A 3ZZNA 3EARA 3GDHA 5F9HA 5L3QB 2DT5A 1I9CA 2HLPA 3HY4A 3ML1A 1YTUA 3Q41A 4Y2QA 1PG2A 1GJRA 1KMCA 1QIGA 2A5YB 2QUJA 2R4UA 5L6MB 5ETJA 2P2DA 3OLQA 3U3DA 4RIGA 2BBSA 1GA1A 2XCTB 3C3EA 5IZCA 4G85A 1NX6A 3GCWA 3WNDA 3O75A 4ZAXA 1C3OA 3IXQA 2Z4SA 4TWJA 5HDQA 1ZUNA 4LHXA 3PFBA 1G8SA 1JEYB 4Y9RA 3IP7A 1DMRA 1WX1A 3JQDA 5ENDA 3REQA 4X7PA 4EECA 3R9XB 4KVAA 3A3OA 3VPDA 4OA8A 2NVUB 3EQ2A 5D51S 2HU2A 2A92A 5AVQA 3L7AA 3IV6A 3N74A 1WTCA 3PUWA 1M66A 2CT8A 3EVGA 1US8B 2SECE 4P3YA 3D5EA 3E9CA 1V1MB 3GDOA 4YN3A 4Z4CA 2VHQA 1G66A 2JFFA 1TE2A 1TYEB 5JWOA 1WEHA 2E21A 2XT0A 3KTAB 3V34A 3AY7A 4MH0R 5BUZA 5I7RA 5JANA 2ZUFA 4YRQA 1EVKA 1K3FA 5LQKA 4ZVOA 1MPXA 4UAJA 4G0NA 3KKLA 1FB5A 1ZMTA 5DHTA 4YV2A 4EJSA 2IOQA 3C7KA 2YZMA 4JEHA 1SZPA 2PGDA 2RHLA 2EFEB 2NV2B 3DL2A 3OP1A 1Y37A 3FVRA 2GYYA 3KK0A 4KNVA 4YAIA 3OU6A 4LN1A 1UKVY 1I1QB 1RADA 5AFSA 4DPMA 3SZ3A 3KLBA 1I3LA 4XLHA 5E6RB 3UJNA 5AICA 2NNWB 3HBNA 4OHFA 3DZHA 3I4LA 4L73A 4UASA 2ZETA 5FUBA 4EA8A 4KQ1A 3ZV7A 1MC4A 2XQIA 3KDPA 4A2WA 5C4MA 1XRNA 5AW8A 3PLNA 1VQLB 1SOWA 3TTYA 1XZGA 1T3ZA 2P77A 3H1EA 3EZ7A 5C8DA 2ONYA 3IEVA 1P75A 1VHJA 3LAWA 4E70A 3LPCA 1OH8A 1Q3HA 3R5HA 4P4LA 4RPIA 3T5TA 2WPDA 2HF2A 3DWIA 3DZ8A 3T51B 2QU7A 2IYTA 3DZBA 3MGKA 1R6TA 3P4XA 3FPPA 1LX6A 3EWIA 4PYQA 4XMYA 4D5EA 3V33A 4IYJA 3EIUA 2X0DA 4BZZA 2XVAA 4K6OA 1W35A 4C7VA 1TFUA 1W73A 4RGYA 4WCFA 4PGFA 5BW6B 1KWGA 4CMAA 1C1XB 4F72A 1O94A 3ENVA 4MKIA 1HFKA 3I01M 1HE5A 1HYGA 2WSMA 1YX2A 1WUIS 2PKQO 1GV1A 4K6KA 2D2EA 5K0NA 2GD1O 4A73A 1AG9A 1G8FA 2XQFA 4H4EA 4OK3A 3I3OA 3HHEA 5ABPA 5L3RA 1JDJA 1NR7A 1GGHA 2Y4NA 2KMLA 3FOWA 3TZKA 1VSVA 2QM7A 2CXHA 2IIPA 3T38A 1LPSA 1E3MA 5A4FS 3HCNA 3LQEA 1KSHA 4LY3A 1RPTA 4NECA 4NV3A 3FKJA 4PINA 4QTTB 3A4IA 4I4TB 3DE3X 1NXOA 5K3CA 4K9OA 2DBVO 4Q19A 1O1YA 1W94A 2WAYA 4N12A 4UEWA 5A04A 3IKMB 2ZRFA 1QPBA 1GAJA 4UHCA 1G8AA 1V3VA 3FYSA 2W4QA 3OKAA 2I2XB 4UNRA 5LOVB 1E6CA 1NYRA 2ATVA 3G9ZA 3MJTA 3P32A 4HDQB 4Q4CA 1MC8A 3OM1A 3AL2A 4NCKA 5EL0A 1XVLA 1OYOA 3DKIA 3PU6A 2HWKA 2WU4A 3FD8A 4RUKA 4BMPB 4H18A 4BU1A 3O38A 3TTSA 2AG8A 4URYR 1TYDE 2IPAB 2ODEA 2PGXA 4R8LA 3LVQE 4B2LA 1Q0UA 3L7BA 2VHVA 2YOFA 2AD5A 2JAPA 1P1BA 3D8HA 2CW5A 3AJEA 1EGVB 1Q57A 3T34A 1CK4A 3DB1A 1WG8A 3DTVB 2D0PB 2C1ZA 4E1BA 5IBQA 4V3CA 2BEVB 2OPBA 2ZIVB 3J7TA 4Y1RB 3N75A 2OHGA 4UVEA 4ZT3A 1YI0A 4BBZA 4FDTA 2D4AA 4GX1A 5E3IA 3GBSA 5CD1A 1TUEA 3DBRA 1O95D 3G9TA 3LH5A 1CQIA 2FP4B 3RYHA 3SBDA 3V8VA 2OWEA 3NRJA 3ON5A 2WA1A 3QSGA 5DI9A 4AJEA 4BP1A 2H06A 3E9QA 1BHSA 4JY7A 4TTQA 2Q45A 5DT9A 1GAEO 3H86A 5AM0A 4IMIB 4JZYA 4I7EA 4BFCA 3CESA 1N0UA 3TTUA 4PHTA 4DSNA 3BHMA 4AULA 3K1ZA 4FFLA 3P0HA 2QYHA 4H9GA 3IAS1 1L3IA 1JDPA 2VYVD 1RRKA 2VI5A 3IOMA 3DW1X 4OQDA 4XDHA 3ZGXA 2OBSA 1LSJA 3K31A 3L9WA 1IN4A 1PWHA 3P9KA 2OXRA 2RC5A 3CTAA 1ZH2A 2J45A 3TQHA 3E9NA 3P20A 1LJUA 3GRCA 4GQBA 4M9XA 1PR1A 2VRCA 4XYGA 1YJAA 3VO8A 3AUUA 3NBMA 1PJ8A 1Z29A 3DLBA 3JARB 1GKYA 4HWTA 4EB0A 1FMFA 1NUPA 2IYWA 3NBYC 1EJ2A 1SC3A 3RJMA 1KO8A 1OV6A 4KXMA 3JSXA 1Z6AA 3WGJA 3LY5A 3WMGA 4ZCLA 4XUCA 4YMIA 4QVGA 4K2AA 1MXHA 4B6OA 2C1XA 5EWJB 2KI5A 1KDZA 4DHEA 3BHJA 3UA3A 4ZOQI 2VBSA 2R4TA 3MXOA 1QIKA 4OKIA 1SXHA 5A6SB 2FR0A 1QYCA 2ZXFA 3S2YA 1WOPA 1EK5A 3DV0B 3VC1A 3MT0A 2V4MA 1XTJA 2O8BA 4IZIA 1EA5A 1HE1C 3OZXA 1V5IA 5H16A 2NU8A 3GPLA 3ENKA 4ZHQB 1GFSA 4FYKA 4GGOA 5IAJA 5TF0A 3PS9A 2CFRA 4BQPA 5BQ3A 2NSYA 3BE8A 3BULA 4I1YA 5HFNA 3BMNA 4JI6B 1MW8X 4QLOA 2UYQA 1A3CA 2MMGA 3SZMA 1NXWA 1S1CA 1UBNA 4D3ZA 1YFKA 2WIDA 4FX2A 4NYMQ 3L02A 3LFUA 5EIFA 5SZJA 1NLFA 1HXHA 3HR4A 3I3SR 3UK0A 2FZEA 4OHBA 3WLEA 3MCTA 1SC9A 5T4BA 4BY9E 2R9VA 3CUWA 3VU9B 1DKNA 4G25A 4MV0A 4QU0A 5ALJA 1N5IA 1KEEB 4US2R 4RV9A 1N6PA 2ILVA 1IH8A 4M38A 3AKCA 3MT8A 1FQJA 5DSZA 1I3OA 3HZOA 4EO7A 3I0ZA 2WSSA 2NAPA 2IP4A 2XCUA 1F4PA 4GECA 4MYSA 5TLSA 2ZWIA 3H16A 4JFRA 1FS6A 1W87A 2I6XA 3A9TA 3ZGVA 1I6MA 2C5HA 2DZDA 5CAEA 5CFPA 4UTNA 2P65A 5CXSA 1I8DA 3DF7A 4D8WA 5I6DA 1X38A 3RSZA 3TSCA 4V0NA 1Q91A 4OU5A 2QJRA 3HYNA 1E64A 4LC0A 1AV7A 4KE9A 3UF0A 4KYTA 3HJFA 1RYYA 1E2FA 1S3SA 4LZLA 1SXJC 5F4MA 4ZYVA 1NASA 3F7MA 4M76B 4XDGA 3HUDA 4G5XA 4BTLA 1NQAO 3FFWA 3CNHA 1V35A 3C3WA 4LRUA 1LNQA 2ZRBA 3OZRA 4LOAA 3DM5A 3CF4A 4R84A 1B43A 4P2GA 3HKEB 1CVRA 3TRIA 4EW3A 1K4KA 1QRRA 1WW2A 1C3EA 1Y33E 3E3OA 1ZY2A 3QVJA 5ALIA 1HURA 3U13A 2VDOB 4LCBA 1BROA 1H5UA 5C80A 1Z2PX 1PQPA 3EYAA 3GFSA 1U81A 1XKTA 3QG5A 3IKLA 5T5QA 1NSTA 1L8LA 1WS6A 2VL7A 3LUJA 4ENVA 5JYDA 4IV8A 3BUSA 1YOBA 3DL4A 4QUIA 2DTXA 1ORVA 5KS2A 3IXMA 3DYVA 4ZI7B 4B43A 5HRAA 1P4MA 5C2JB 4ESEA 5AVKA 2GPAA 3M5DA 3P45A 1QVVA 2AE1A 3OC0A 5K99A 3OMXA 3DBLB 1IUNA 2PKRA 3CVUA 1ZJYA 3ORYA 4A91A 1L5QA 1N3BA 2X9LA 4K6CA 1N92A 1R8JA 1G8JA 4IO0A 4AO7A 4JJAA 1Y4SA 4MI9A 2JKYA 4UE2A 5CNMA 1JEOA 2VG8A 3DKPA 3G82C 2G9ZA 1L4MA 1RMTA 3FUXA 4IGFA 2OD7A 1XXHE 4OHRA 1CY1A 4XOIA 3WGTA 1D2GA 3A8TA 4CLEA 5CB6A 1KTIA 2VLIA 4WA8A 3WHPA 4Z7JA 2FJUA 1QTRA 2QY6A 1TCCA 2WUVA 3FRHA 1QZXA 1F2VA 2GPYA 1B14A 4MVJD 4I5IA 4LHWA 4LMBA 3I8SA 1KFBB 4DLUA 5KNBH 4YCLA 2C5GA 2WF6A 2R8ZA 3BFJA 4WOKA 1DIRA 1C50A 1PT5A 4TMFA 3WGZA 1X3LA 4IIEA 2HGSA 1J7KA 1Y6ZA 2C4WA 4RM3A 2NTYC 3OM8A 2Q5IA 3WADA 4OHVA 1DADA 4ZAWA 4X8HA 3OCWA 1AXGA 4LXTA 3V3KA 1N05A 3IVMA 4HBZA 1COWD 4IR7A 4JDUA 3VR5H 5LP6A 1BOFA 2QEQA 4MUNA 1PGOA 2YWCA 5JAPA 4GKBA 1B1AA 4FS3A 5MFPA 3GN1A 5JUWA 2RGNC 4RK4A 1NUUA 3N0XA 1NF2A 3AIKA 3NU1A 1I7QB 3UWPA 2QK4A 4LZOA 4TTVA 3WGHA 1PR3A 4O4HA 4EGJA 1UWLA 4YASA 5TARA 1RR6A 3U4GA 1KL7A 3D59A 2QN8A 1NURA 4UVIA 3FUCA 4KMSA 1OX4A 1MQ9A 1NP3A 3KV1A 3ND5A 3K0SA 2HLHA 4NKRA 5J63A 3CW8X 4XRGA 4U2KA 4NFLA 2VCYA 4WZBA 4D3XA 1LLFA 2XVZA 1ZONA 3AYXB 3HHPA 1GG2A 3CJRA 4XCVA 3T1QA 3ZLJA 3PRJA 3BREA 4JL5A 5J3JA 4HNAA 3T7KA 5EZSA 3ZWMA 3AKZA 1C8BA 3HRHA 1YUNA 4LHEA 4B0PA 2Q29A 3ZV3A 4H7IA 4MNTA 5C4GB 1SKUA 2AYZA 3BVPA 3KUXA 1AE1A 2OO5C 2PFKA 2Y1WA 3LLCA 1EXVA 1WMSA 1V4BA 1EBFA 1ST2A 3OT4A 4A23A 3A6DA 5EEGA