2DCUA

Crystal structure of translation initiation factor aif2betagamma heterodimer with gdp
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
407
structure length
407
Chain Sequence
KTRQAEVNIGMVGHVDHGKTTLTKALTGVWTDTHSEELRRGITIKIGFADAEIRRCSNCGRYSTSPICPYCGHETEFIRRVSFIDSPGHEALMTTMLAGASLMDGAILVIAANEPCPRPQTREHLMALQIIGQKNIIIAQNKIELVDKEKALENYRQIKEFIKGTVAENAPIIPISALHGANIDVLVKAIEEFIPTPKRDSNKPPKMLVLRSFDVNKPGTPPEKLVGGVLDGSIVQGKLKVGDEIEIRPGVPYEEHGRIKYEPITTEIVSLQAGGQFVEEAYPGGLVGIGTKLDPYLTKGDLMAGNVVGKPGKLPPVWTDLRLEVHLLERVVGTEQELNVEPIKRKEVLLLNVGTARTMGLVTALGKDEIELKLQIPVCAEPGERVAISRQIGSRWRLIGYGIIKEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Translation initiation factor 2 gamma subunit
publication title Structure of archaeal translational initiation factor 2 betagamma-GDP reveals significant conformational change of the beta-subunit and switch 1 region.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Translation
total genus 87
structure length 407
sequence length 407
ec nomenclature
pdb deposition date 2006-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
A PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 2dcuA02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 2dcuA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2dcuA01
3TKLA 2OG2A 3TW8B 5GJBA 1KJZA 3P4YA 3OIWA 1KRHA 4F93B 4YAUA 2ZRIA 1E0KA 2DFNA 2G1KA 3PUVA 4BLTA 3ES9A 4HAUA 1RZ3A 1KOFA 3B5JA 4ZIRB 4OQNA 1Z07A 1VYTA 2C99A 1MABB 2JDID 1R2QA 3VHLB 2CCKA 4OK6A 1E99A 3KL4A 3BORA 4W5HA 2OEPA 1E1QA 4V0LA 4GP6A 5FBQB 1OHHD 2GZDA 2V6IA 4Q00A 5FTLA 2GHIA 3C16C 4EFLA 2H8KA 3T35A 3THWA 2AK2A 1CU1A 1FMJA 1JA0A 2QP4A 2QT0A 4TLAA 4D4LA 5JCPA 1E9SA 1DPFA 3SYLA 4IFEA 4QOSA 3U3JA 3GCGA 3IQWA 4FMBB 5HE9A 2F6RA 2O52A 2HXSA 3KXKA 4J0QA 1NVVQ 2CL0X 3QBTA 1XEWX 1VKJA 3K0EA 5D3MB 5KU1A 3WNDA 4YONB 3RABA 2WTUA 2XSZA 1P7CA 2D2EA 2ZAOA 4GT1A 1ZCAA 2FSHA 1BOFA 3EARA 4IOJA 3DHWC 4LHZA 1LY1A 4GL2A 2IYLD 1CF4A 3ZZTA 2Q0HA 5DYGA 4KXFB 4DEXA 1GSIA 1DDIA 4C0KA 2ZANA 5J4LA 1XEFA 1KK2A 1E2IA 1OFUX 3U61B 3ADKA 3DM5A 2VYFA 3NH6A 1FNMA 3LH5A 3PENA 4D26A 2GZAA 1P75A 4I1UA 4B3DA 3J81k 1W0KD 2PL3A 2QM7A 2ZAMA 3PV0A 5B2ZA 4PQYA 4P33A 1AKEA 3H84A 3T1VA 3K9NA 4G1BA 3RWOA 1ZCBA 1G5PA 5EE3A 1W47A 4CDGA 4HUQA 3GJ4A 1KO4A 2X2FA 2ZI3A 1NKTA 1MRSA 4QGFA 2CVHA 2ODWA 4EPYA 4DWJA 1KK0A 2BGJA 1GP2A 1VYUA 4ASUA 3KTAB 1GWNA 4B35A 4URUR 1IXZA 1E2PA 3THYA 3P26A 4Q01A 5E3HA 1D8TA 1L8QA 3OZUA 1FNCA 2PZFA 4ZGNB 3ETLA 4PX9A 1KK1A 5C2JB 4RKFA 1NSTA 4MYCA 3B1VA 1UM8A 2NO6A 2BVNA 4NBSA 2NG1A 3L0PA 1E64A 2YKGA 1Z0IA 1WBBA 1KD1D 3DZDA 4ZDWA 1QVGB 3CCMB 3NC0C 5J47A 2D06A 4M4SA 1ZBDA 3AVPA 1Q22A 1PJRA 1WXQA 1DTSA 2BEJA 4U5XA 4XD7A 4C7OB 3VU9B 2DCUA 2WAXA 1ZIOA 1X1SA 1P72A 1U0LA 3MGCA 2VQSA 1TEXA 2C95A 5GJCA 1IJEA 1N2CE 2QRNA 1E1RD 1YZUA 1YZTA 2ZU6A 3B9QA 1JA1A 1SXJB 2F55A 2AN9A 3QKSB 2F43B 2A5JA 2CMKA 2RGXA 2B7CA 5AR1A 2HMAA 2I4IA 3CCVB 3A37A 2ZRHA 3RRYA 2J0SA 1SVSA 4EIWA 1KZ7B 2ZPTX 3KKOA 4MITA 5EXTA 1G3RA 3MAAC 4S2EA 3CC4B 2FH5B 3EIQA 3LWNA 3HR7A 1EFHA 4HAWA 3I8XA 4JT4A 3EPHA 3DDCA 2QI9C 1ZM7A 2A5YB 1IM2A 2P65A 2FPKA 3N2IA 3Q5EA 4PSKA 5FBLB 2O8DA 4JLAA 1RRFA 5G40A 3TLXA 5IHPA 1IN5A 1GNPA 3FPAA 5B58C 4Q03A 3EA5A 2BMFA 3O47A 1W4RA 1KDPA 3SS8A 1DVRA 1G5RA 1LS6A 1W2HA 4OI2A 1Q82D 2GAAA 4IOLA 1P2VA 4LBYA 2DFLA 2ZRBA 4QL3A 3QE2A 1FW6A 5EXSA 4KU4A 2CE7A 2WOOA 3AP2A 1ZUHA 3ZZ0A 2ZJ5A 1ZM3A 2W00A 4R9UC 1SKYB 5FI1B 1IAQA 5FOTA 1GZSA 3WHKA 3WMGA 3LXXA 2JJ8A 3MWLA 4B74A 1KC8D 1MO4A 5DISB 4V0NA 4I1OA 5IT5A 2BM1A 4G3XA 4Y9RA 4DEYA 1Z0DA 1UKZA 3LBNA 3BB1A 4NYIR 5JWRA 2CXXA 2ZI4A 4O2RA 2BHRA 1IOZA 1TMKA 2JJ1A 4L15A 1G7CA 1S8FA 2W2VA 1UKYA 3LQQA 1DBSA 3EPKA 3OW2B 3K9HA 5DHFA 3H4MA 4Q66C 3TSZA 3ZVLA 3O8BA 4Q4JA 2JLSA 2ZRPA 1CNFA 5H8WA 4V0OA 4BLRA 1TQDA 1E0AA 3Q72A 3CNOA 4PGOA 1KDTA 2A5FA 1OIVA 1XCMA 1JXOA 3FHCB 2B6HA 1DO0A 4B48A 5CLLA 1VQKB 3TGPA 4AKGA 1Z06A 1YR8A 2JJ2D 3BB3A 2XTNA 5K8IA 4DJTA 4JLJA 4B2LA 3H86A 3A4LA 4HATA 1OH7A 4ESVA 1XX6A 2N1BA 1QG4A 4A0RA 1II0A 1PVOA 2RC5A 4C0AC 4Q47A 4Y0AA 3ZVRA 6Q21A 1I4DD 1FOEB 4FW9A 4TWZA 1S96A 2GZHA 4NPHA 1XJCA 3SBEA 2MMCA 3O8DA 4BZPA 1NVXQ 3VKGA 3F3YA 1XEXB 2EQBA 4DVGA 1KHTA 2WKQA 2IYQA 2G88A 1CIPA 4QHTA 4FMDB 3CCLB 2H57A 2QEQA 3UMRA 1KGDA 2Q3FA 3BJIC 1YVDA 1OT3A 1W46A 3LNCA 1XNJA 5AK0A 1W35A 3W2FA 3K70D 3L2OB 1M1YE 3T5DA 3CRMA 1E1QD 1XTRA 1YHNA 3KXIA 3C5CA 2JLRA 1W2BB 1A7JA 4YDSA 3TJZA 1P2UA 3X1WA 4A1FA 3WXMA 1CULC 4U00A 4TLBA 3W5JA 3U44B 2QN6A 3IKJA 1HA3A 3FJOA 4FCVA 3MHPA 2IUTA 3RYTC 1KDRA 3K0CC 2WMNB 3R9XA 1CJTC 2ZYTX 4QJ3A 4OHYA 4D0NA 3OZXA 4KFUA 1UDXA 1BX1A 5CK5A 2ODEA 5H59A 4KBGA 3ZYCA 3GLFA 4N3GA 1G3IA 4BRUA 2QZ4A 4JS0A 1XF9A 3L0OA 2ZRLA 4DCVA 2HLDA 1JR3E 1JQLB 3PUYA 2ZE8A 5HCIA 3LVBA 1W36D 3NDBB 4NZYA 1FNNA 4Q02A 4R71A 3WP0A 4Y9UA 1N0VC 3AVXA 4NCKA 4UKDA 4UQOA 5K8UA 2XZOA 1W5SA 4DB2A 1XB2A 3MSXA 2RKOA 1S3SA 4Z54A 1XTQA 4DLXA 2GEUA 1XU4A 1D2MA 4DDVA 1CLUA 5TDHA 1OH6A 1VQNB 1NMYA 3U3KA 5BW8A 1U8AA 5JMTA 3KKNA 3TSWA 1QFJA 1G4UR 1XMSA 2ZVPX 4BFWA 3MUFA 1RIFA 1AN0A 3ZVNA 3CBQA 3EASA 3K0FA 4YQFA 4YMVA 3LRPA 4L8GA 1QG2A 3GFOA 2WM9B 3AF3A 1G20E 1MV5A 2C78A 4OHZA 4TQAA 2ZSEA 1I4LD 1NBMA 3GJ3A 3TMKA 1QDEA 2ZJ8A 2PBRA 1CQXA 4EFNA 2OBLA 2VF8A 4JSYA 1HE1C 3CR7A 1NF3A 4YHBA 4RFSB 1CS4C 4LBZA 1C4OA 3K0SA 4W5JA 4F4CA 2C8VA 3OZVA 2DEUA 1YQTA 2BBSA 1MH1A 3RS7A 1MR3F 2J0QA 4TMKA 2NO1A 4JYCA 2V6JA 1NG1A 4RZXA 5UKDA 4NCHA 4M53A 4OJKA 4MRVA 4PQFA 2VSXA 4O2LA 1E79A 2AHOA 5DI3A 5FUVA 2FX3A 2VYQA 2CCJA 2J3EA 3JZMA 5CYOA 3SZRA 3GLGE 4EAQA 3BH0A 4PR0A 3CCJB 3FWYA 1KO7A 2QORA 1LFDB 3SN6A 3GEIA 1F2UA 1PLLA 1OXVA 5JJIA 1FQJA 2FFBA 2YOFA 2V4ZA 5BN5A 3I61A 1HEIA 3ZVMA 4IXMA 4ON9A 4RVCA 1A1VA 121PA 2C03A 2QU8A 4B3GA 3RRMA 1LB1B 3RRZA 2FMXA 3D3QA 5C46F 2QE7D 5AJZA 5L8VA 2RGEA 3W2HA 4GNKA 4LDJA 2AXPA 5CK4A 1AIPA 4PPQA 3WP1B 4MKIA 3R20A 1OJLA 3U4QA 3NIBA 2QG6A 4Q9JA 2OAP1 3IPXA 4LJ7A 3CH4B 1CRPA 1D9ZA 4TN1A 4PO9A 1OF1A 4EUNA 4HAXA 3TUJC 2QEXB 3Q9LA 4LV6A 4JVMA 2Q21A 2J46A 3K0AA 3SEAA 4ABYA 4BLQA 1Z0JA 4GDFA 3A1SA 1U81A 4TYPA 4N0DA 2WV9A 2XNCA 5C4GB 3B8HA 1Z6TA 4XJXA 3U2QA 1YJ9B 2VH5R 5F98A 2FZLA 2DWPA 1AQUA 1IONA 1MO3A 5GJWC 3RS3A 1YHQB 1NN5A 1FQKA 1ZJ6A 5KTYA 1GRQA 3GLIE 1T9HA 4LPSA 1HT1E 3Q85A 2HJGA 3AF0A 3GEEA 4PPNA 3CR8A 1NLZA 1GAWA 2A5GA 2QUZA 4D0LB 3SDZA 1G19A 4M21A 2XTZA 3TH5A 3QVVA 4RZ2A 2FSIA 1IY1A 1ZNYA 2ASEA 2CCGA 2WJYA 2WSSA 3U3RA 2V3CC 2IK8A 5KNDA 2VL7A 2AK3A 3GQBA 1Q1BA 4V03A 3HDTA 4IDNA 5F2EA 4JBWA 3ICQB 2O8EB 1FP6A 1J7KA 1SULA 4QG7A 3BE4A 5EP4A 3QKRA 1RVDA 1VQLB 2W6JA 1SVKA 2R9VA 3FPKA 4YALA 4K8OA 1P2TA 1CP2A 3CRZA 1BYUA 2ZQ5A 4HZUB 1N3BA 4KFTA 1SGWA 1H42A 4TYWA 4CYMA 1GFIA 1IBRA 3HP1A 1E4YA 2IF2A 1CXZA 5FL7A 4A0FA 2XOKA 5L3SA 2QA5A 3SOPA 3LV8A 3FHTA 1YR7A 1CR2A 1HUQA 2G6BA 2CL7X 2QAGC 4YAOA 3TR5A 2MMGA 1UBCA 2OV2A 5EE5B 3TAUA 4MGIR 1W0JD 2ZR7A 2VA8A 3KJIA 3WYAA 4FD2A 3KX2A 4EKDA 2FOLA 3UWOA 4EH1A 2OE2A 2HJVA 2JDIA 3CX7A 4I1SA 2J45A 3W5IA 3E1YE 3A36A 4DLVA 4URYR 2R6HA 1H8EA 3ECCA 1XXHE 3WYGA 1AM4D 1F2TA 2C04A 4HYYA 3WMFA 4TQ9A 5FH9A 3T1OA 4DSTA 2ORWA 3IO5A 3GLHB 2ZI9A 2O0HA 1JNYA 1WQ1R 4TMXA 1X6VA 2AKYA 4DDWA 2J41A 4A0GA 1YU9A 3G5UA 3REFA 4DCSA 3U7GA 3VR4A 2BN4A 1E9BA 3LBIA 2OK8A 1VG1A 2JATA 3KKQA 3CH5A 1VQ4B 1W5TA 2NPIA 2IS1A 1PLKA 4YXWA 2BBTA 2AL7A 3NEJA 3WNCA 5JFGA 1ZU4A 1HQCA 4RCYA 3RAPR 1NVWQ 1N25A 1F48A 2D7DA 5L3VA 2PEYA 1X1RA 1Q12A 1XFAA 3FGNA 3NKVA 3PQCA 3DZ8A 4JLNA 4QJ4A 3VX3A 3B1ZA 1F60A 3LD9A 3ZQ6A 1E2MA 1KSHA 1LNZA 1JI0A 1NN3A 3A1TA 4OJQA 1BH2A 1FRQA 3W5UA 1E0SA 1Y3AA 1ZNZA 4CT4B 2Q3MA 3CRW1 2AWOA 1EG7A 4C30A 721PA 4F7DA 2HLDD 2GAOA 1US8B 4N0EA 4FK8A 5H5JA 1ZRHA 3NC1C 2IUSA 4XWAA 1W0KA 1JEDA 4M1TA 4Q1CA 1EP3B 2EW1A 3LVQE 1P62B 4UNPA 5FOWA 5AUOB 2VPPA 2QA4B 4LHWA 2CHGA 4OQMA 1Z6AA 5DN6A 2YC4C 2GK7A 4MGYR 2GTPA 1QGYA 3BC1A 1Q3TA 2ORVA 4LBWA 1OW3B 3BXZA 4MRRA 3PIRA 2PMDA 3B1WA 2FV8A 1G3QA 2QTZA 2HYDA 2ZJZA 2Y8EA 1E63A 3HJNA 3IIKA 1KMHA 3EIEA 1E6CA 4P0TA 4QJ5A 4RY2A 4AK9A 4D81A 4LRWA 2BJVA 2QSZA 5CLQA 4NE2A 4M1SA 4B71A 2OTLB 1OH8A 1G7SA 2XEXA 2RMKA 1KI6B 1NBMD 3K1JA 4M9XA 1Q1EA 2IYWA 4N1AA 4NKRA 3SC3A 3WRYC 4BLPA 2IS6A 2OSBA 1N0UA 4M1MA 5JRJA 3CWQA 3W8NA 1VMAA 4JLVA 2GCPA 5FFMA 4DCTA 4DRZA 1VCOA 2BF4A 1Z2CA 5KSWB 2HXYA 2WJHA 4OHVA 5H1YA 4RZ3A 1YZLA 1G4AE 3E5HA 1OXTA 3O8CA 1E62A 1EWRA 3FDIA 3QIAA 1KY3A 2JLXA 5AJXA 3CC7B 2GJAA 4R2IA 2IWHA 3SQWA 1RFLA 3BRWD 2XJ4A 4ESHA 1UMKA 2JAQA 1XD9A 3EAQA 3K09C 4CEJB 1E1RA 1LS1A 2HF9A 4IEIA 2ZRAA 1SVIA 4P3YA 4HDCA 3UK6A 2REXB 4E22A 5E7IA 4Z8YA 3AVOA 2CK3A 3IEUA 3GJ5A 1NN0A 1JR3D 3AM1A 1TPZA 4FCTA 4TMZA 3JVUA 1RJ9B 3UKDA 3MWYW 4RZUA 3T12A 1DO2A 4AF7A 5TR9A 3CIOA 4MA4A 3ICEA 1VQPB 2IX3A 2NO7A 3MJRA 5J4VA 3U6BA 5KNCA 1G3MA 4QC2A 4YAWA 4PANA 2EFHB 2WOJA 2CLDX 3SU8A 3VR1A 3AUYA 2ZJOA 1OYYA 3PCRB 4A0HA 2O8FA 1MRNA 1SXJC 4FWIB 4Z1MA 1S72B 5HE8A 3SJCA 3R8CA 3HYRA 3X1DA 4XVUA 4HAZA 2R6GA 4DIEA 2GQFA 5LBIA 3K70B 3UATA 3I3SR 1OXUA 4UAJA 3G71B 5KYKA 2FN4A 4G01B 3TRFA 2O8CA 2OTJB 3BFVA 3X1YA 2IEZA 2I1VB 3THWB 3TNFA 3SNHA 4A4DA 2IYRA 3AVVA 1NL3A 4GOJA 5FOXA 5C18A 4R7ZA 2ZTSA 2IF0A 2IC5A 2PT5A 4K46A 4URWR 4P4SA 3EXAA 3B7GA 4ITRC 1Z5ZA 3PEUA 1CR0A 1W1WA 2QTLA 3FB4A 4HLCA 4MH0R 1G8GA 4LBVA 3IUYA 1S9HA 1LV7A 2YVUA 1JAHA 1N6PA 3PG5A 3SBDA 4GI7A 5EMNA 2WSSD 4L5BA 2Q9CA 1QUFA 4ZV4A 1FMLA 2F1RA 2ZYWX 1N8RD 2WMOB 3A4MA 2IHBA 2PZEA 2NPFA 4AG6A 4C0LA 1ANKA 2W6JD 1RRPA 2HCBA 3TVTA 2B7BA 4WZBE 2QGZA 4FIDA 4KSBA 1B23P 1ZM9A 4C43A 4ERNA 1GKIA 1VG9B 1QBKC 2A9KA 4PO8A 4M9ZA 1HT2E 4B32A 3TIFA 3LO8A 3PUWA 1KK3A 1GL6A 1NLFA 2GJ8A 3KJEA 3CMAB 2EFDB 3QEJA 3QKUA 5FL7D 1ETUA 2XOKD 3WNBA 1RW4A 3ASZA 1YZGA 3OJWA 1GAQA 1GL7A 1QHIA 1II9A 2GPJA 4NCIA 1W4AA 2ZRFA 3CRQA 1C1YA 1OGIA 2WHXA 2YWFA 2XX3A 3OE7A 3BH7A 3CXCB 4LWZA 2OFWA 1OGJA 3THYB 3GFTA 1K8AD 4F38A 4LCBA 3W6PA 2DERA 4CEHA 1H8ED 1R0WA 3BH6A 4WBSA 5EP2A 2ZS9A 2J1LA 1J90A 4FXPA 4NTZA 2DB3A 4IXNA 3OEHA 4HB2A 2VRWA 3REGA 3T34A 1J70A 1KYIA 4US2R 2JLWA 4F4IA 3H2YA 3PUZA 4KVGA 2QGNA 3AV0B 4V0ME 1ZINA 2YV5A 2W2TA 3GMTA 4M9QA 3CCUB 2ZETA 4GFDA 1Z83A 1JEEA 2GXSA 1BS1A 3VX4A 1YZNA 4JLKA 4YXWD 1OKKA 2GNOA 1OFTA 5A4JA 2EYUA 1P3JA 3PXGA 1K9MD 4BLSA 4Q18A 1T3HA 4HE5A 3QBVA 1FNBA 2IWRA 3JQQA 3IIJA 2B92A 2BWJA 3T1QA 1OLOA 2C9CA 1OIWA 3TE6A 3TQFA 1T8TA 2ZRCA 1VG0B 2YWEA 1GVNB 4KAXA 2XNJA 2VP5A 4B2IA 4AYXA 4YMUA 2BV3A 4LOAA 2YNMA 2IA5A 2QPOA 2ZUDA 1MOZA 4AKIA 3OIVA 3TQCA 5EE1A 4EJSB 3CMEB 3S1AB 1EXMA 5AN9A 2O8DB 4DZZA 4HUTA 1P9WA 1SVOA 4B43A 3U7EB 2XB2A 5G3ZA 1KI8A 1QZXA 5DN6D 4MRPA 2CLSA 3B82A 2QAGA 4OKSA 2QY9A 4NONA 4HLDA 1C9KA 2BCGY 2ZJAA 4POAA 4GSYA 2QT1A 5AUNB 4H1UA 1BYIA 4LHVA 3THOA 5HXBA 1QGZA 2GA8A 5CJPA 2ZJ2A 2ZJBA 4TL8A 2QSYA 5J4HA 1RPZA 2W6IA 5FUYA 3NVAA 3GJ0A 1SQ5A 4JLBA 2Z4SA 1TL7C 2R62A 5AWFC 1ZU5A 4EQ6A 2V1UA 1Q57A 4ZPXA 4ZIRA 1G6HA 2CJWA 2GXQA 2ZUBA 3QXSA 4G5RA 1I4TD 3LX5A 4RD6A 4GOKA 1VYVA 5HTKA 1ZP6A 4G1UC 3FTQA 1Q1QA 4WVFA 4Q4JB 1XE1A 2RGNC 4KODA 2ZREA 4L16A 1ZD8A 2BKUA 3QPUA 3RSLA 4IDHA 1CTQA 2QE7A 1TX4B 3WBJA 3NBXX 1N6KA 4LX0A 4MGKR 3CM0A 1F6BA 1M6NA 2CK3D 2BMWA 2OK7A 2A3RA 3SJBA 4NDZA 1DAMA 4RD1A 2AFHE 1VCIA 1H8HA 4X8OA 2KSQA 3Q3JB 3VR5A 1KSFX 3P20A 421PA 1XP8A 2CL6X 2IL1A 3L8YA 4PC1A 1W34A 1IHUA 3LA6A 2F9MA 2P2LA 2PX3A 1N6IA 1OFHA 1JQJC 2VP9A 3IBGA 5M04A 1VQ7B 4TTQA 1YRBA 4UNSA 5FTKA 4A8JA 2RC6A 4Q7MB 3MRSA 3CLVA 1R5OA 4Q1AA 3KKMA 3C5HA 2FGKA 3P32A 4Z1MD 4TMTA 5DH9A 1SXJE 5EJEA 4QKQA 2A7QA 3PEVA 4QM7A 2FG5A 4EDHA 2D62A 3CD6B 1WB9A 4ZCIA 3TBKA 2OBMA 4QBHA 4BE7B 4QGAA 1HH4A 2WIBA 3E20A 3QVUA 1BIFA 2XGJA 5TMPA 4CEIA 1NIJA 1VHTA 3TW4A 1B0UA 1IXRC 1W48A 4G5SA 4YC7A 5FTJA 4JBXA 2W0SA 1YJNB 2X1VA 5SZIA 4WZ6A 1UPTA 2O5VA 1E9CA 4BASA 3QXXA 1KQSB 4C3ZA 3GLFB 1QGAA 2AFIE 2G3YA 4Q4HA 2FPMA 2VLIA 1R0ZA 1W4BA 3LW8A 2FE4A 3IBYA 2D7CA 4BFTA 4B76A 3KUCA 4WXRA 3WYFA 4B2PA 2A78A 1DAEA 1A2BA 4H1VA 1T0HB 1VPLA 1GKYA 1UKEA 2AXNA 1K6MA 1MO5A 4UXIA 2H92A 4KFSA 1SKYE 1Q7YD 1NVVR 4EPXA 5HZKA 3CCSB 4MYTA 4OYHA 2WWHA 4PHTA 3R8FA 3U3MA 3CZQA 1W0JA 1NJGA 2QQEA 3OAAA 1D5CA 1DARA 1OIXA 3A1VA 3DKVA 4MKGA 5B64A 2J0VA 3PITA 1AMOA 4Y0VA 1XCPA 2QP9X 3F8TA 1KSGA 1EFTA 4C0JA 1U0HC 2NO0A 1G3UA 2F9LA 3BFXA 4P31A 1KIMA 3EX7C 3PJRA 4D82A 3CNNA 4BUJA 1COWD 4HZIA 1UAAA 1HYQA 1NIPA 2GCNA 3DO6A 3PR1A 4M1WA 4W5WA 5J4YA 3OE7D 2JLZA 2YJTD 1TTTA 4G5GA 1N6RA 2ZJYA 5E95A 4JMPA 3TUIC 2NTYC 5CJ2A 3RS4A 3L43A 4XTRA 1Q0UA 4ARZB 2KBFA 2OCPA 2QPTA 2YOGA 3OEHD 4MDEA 3OESA 3TVDA 4WOPA 4IOKA 1QHHA 3T1TA 2J0UA 4BLOA 2VNIA 2ZU0C 1T3SA 1R6BX 5FOVA 1KI1A 1NMXA 1G6OA 2KE5A 4B3FX 4OHXA 1OV4A 5JSZA 4JSTA 2A30A 1GJRA 2O0JA 4PHGA 2X3UA 4PSAA 5EZ5A 3KQUA 5LPNA 4IDQA 1F2UB 3U5ZB 3BWDD 4DT1A 3P4XA 3D6TB 3X1XA 1OKKD 4DHEA 2CLCX 2J7PD 4Q9KA 4ZDKA 2IT1A 1GRRA 4X8HA 4Q4AA 1XMVA 1W4CA 1Z6GA 2IXGA 3BAFA 4IDOA 2IYVA 1E94E 1YKSA 3Q5DA 3QQ5A 2IXEA 2YOHA 2HT6A 4QRHA 1NNEA 4IEEA 1WMSA 4NCJA 1DAKA 2CRVA 3AUXA 2HUPA 3AVWA 4TMWA 3U4QB 2D74A 2WKRA 4XSGA 1J2JA 2F1IA 2WWXA 2IYUA 4NYJQ 3W3ZB 2C5LA 4PC6A 5BXQC 2FFQA 2CVFA 3DM9B 2GJSA 3RC3A 1YITB 4QNRA 4LYJA 3I8SA 2JLYA 3AB3A 3I1FA 4BWYA 4QXAA 2WVJA 1CKEA 3KFXA 1KZGB 1J99A 5LB4A 4ZI3A 1BMFD 5G53C 3ZS8A 5FI0B 3V4FA 2G83A 2FDCA 2OCYC 2R6DA 1WDTA 2VHJA 2QBYA 4A92A 1XD8A 5BN4A 1NKSA 5FR1A 3B85A 3WHLA 4TL6A 4PC7A 1W44A 4JLMA 4QGGA 3UG7A 4DLTA 1E2DA 4JJZA 1ONBA 4DB4A 3K8YA 4IKEA 1R5NA 1I7PA 5JS8A 2G1JA 4PO1A 1HV8A 1FUKA 1K5DA 3NWJA 1XTIA 2BBWA 1PZNA 2VHTA 2W6ID 3C15C 2R8RA 2ZUCA 4A82A 3HR8A 1RRCA 5FBRB 1E2LA 3LFUA 1ZNXA 3AF1A 4A2QA 5THXA 2X77A 1IN4A 2DETA 3B1YA 3CRVA 2EYQA 4RKEA 2PT7A 5FPTA 3CCQB 3FMOB 1NVUQ 4I81A 1JR3A 5GVRA 4D4JA 4X8LA 3CC2B 2IHYA 3SYNA 2AKAB 4A6PA 1SKQA 1LW7A 4L9SA 3I92A 1GRNA 2RCNA 3QXJA 3V76A 5D3QA 2J7KA 3CO5A 4LJ9A 4DLSA 5L3SB 3EC1A 1RKBA 1KY2A 2QTHA 1GVHA 2F1JA 3B78A 5BYKA 5HKKA 3AGPA 1A8PA 4DKXA 4MYHA 2V7QA 4F7WA 1IN6A 1DADA 1H8HD 1XJ0A 3A1WA 1SVLA 3T15A 3UIEA 1S1CA 2Z43A 2YZ2A 1ZM4A 3PFIA 1F2TB 2HCJB 2GF9A 1A2KC 5DHAA 4AC9A 5FUWA 2JIZA 4DDUA 2WZQA 3NG1A 5CB8A 4LJ5A 1DAHA 2IYSA 2DPXA 4HEJA 1TU4A 1GO2A 1TQ2A 3JZAA 3BBPA 5KDLA 1OE0A 4BFZA 1ZD1A 5E4FA 1T8UA 4LJAA 3H1TA 2LCFA 2VHQA 2ODBA 3C14C 4CGZA 5HPYB 2FEOA 5DYIA 4PPFA 3M6AA 1RE0A 2DBYA 3ADBA 1HQYE 2FSGA 4HAVA 3QF4A 2WPDA 1A82A 1QVAA 3EPLA 2ZITA 4E5UA 4BZQA 1GUAA 4DLZA 3EZ9A 4RJLA 3RSOA 3GLGA 1AGRA 1D2NA 1ZC4A 4GMXA 4JKIA 4LJYA 5TVKA 2YWGA 2C77A 2YINC 1G8PA 4O25A 4G1VA 1SVMA 4YAFA 4TSFA 2V8OA 4F4JA 2WWYA 3EA0A 1Z22A 3FHOA 3JVVA 4Y7CA 4GZMA 1P60A 1QUEA 3DKPA 2OT3B 5EXXA 1NDHA 3RNLA 5GV8A 2RGNA 3SQXA 3TR0A 2PIAA 4KSCA 4NYMR 3ZZUA 3V00A 3FYHA 2ZRMA 3VR6A 1ZC3A 4ZCMA 3VAAA 4XSHA 3GP8A 3B2EA 3EWAA 4HLUC 5FUXA 2AD5A 4DBLC 1NLYA 4LJ6A 2ZSFA 3CCRB 4Q7KA 2BMDA 2GVZC 2ZVQX 3CKLA 2NZ8A 2V9PA 3GD7A 1KSJA 3OAAD 1OPXA 1EESA 1AS0A 1II8A 4P4UA 5AUPB 5L3QA 3SR0A 4H9GA 1KMHB 3TAHA 4UNRA 3NTUA 3BFKA 4ZO4A 3UXMA 3C8UA 4AYTA 1E2EA 2KI5A 1E0JA 3EG5A 4B3XA 2P0EA 4WW0A 2UKDA 2ZXUA 1DOAA 3VNUA 1TU3A 4II7A 4PQRA 5FTMA 1GG2A 3UPUA 3THXA 2WSMA 1XWIA 5FPHA 3UWKA 2VNHA 5BWMA 4MGZR 3BIFA 3ZS9A 5KSYA 5G3YA 3GLIA 1U99A 2EVWX 1L7VC 2QMUA 1XD2A 3FFAA 3QG5A 3RS0A 4TLCA 2OBNA 2O8BA 3HWSA 3HU3A 3L0IB 2BGIA 4E09A 1H85A 1XDBA 1WA5A 2H5EA 1GDDA 1NY5A 1J8YF 3W2IA 3OF5A 3TUZC 3B9PA 1RYHA 2B5OA 1N5LA 4BFSA 3GLHE 1AS3A 3WRXC 2OESA 4B4DA 3D8BA 2XXAA 1M7BA 1KI2A 3BGWA 1ODFA 3E70C 1U8ZA 3U6KA 3U7HB 1JB1A 2XJ9A 1BKDR 5AJWA 2VF7A 2JLQA 1ZYUA 3MWJA 2GEDA 2K5UA 1P6XA 2B8TA 4LHYA 2KJQA 4JBYA 1KNXA 4LZZA 2FSFA 1E9RA 1KJWA 2ZRDA 4LJ8A 4AIIA 3FFBA 5CDFE 5GADl 3ZLJA 1MKYA 2O8FB 1CJKC 1E98A 1T0JB 3HPRA 4HB0A 4EPWA 1FRNA 2GBLC 3F5FA 4QNMA 2GWHA 1FFHA 2E9SA 1U9IC 1QVFB 1M8PA 4BZXA 1XXHA 1M1KD 3QPVA 3ZJYA 1FTSA 3FVQA 4XH9B 2OFOA 2O8CB 4C9BA 4TL9A 1UFQA 2I3BA 3QI2A 4UNQA 1U94A 1KTVA 1EFUA 3KKPA 4EJSC 1ESMA 1XTJA 4ZDJA 4C2TA 3NXSA 4P4SB 2ANCA 4UJ3A 1CRQA 2X8AA 3CPEA 1SHKA 4LV8B 3LQRA 1P5ZB 3L0SA 1KKMA 3EW9A 3CF0A 3RLFA 3N70A 3DMDA 3KFVA 2ZR9A 1AKYA 1ZUIA 4XTCS 1Z0FA 2IYTA 1KAGA 2ONKA 4LPKA 4JVNA 3VFDA 4OI4A 4M1KA 3QENA 4E03A 4KITB 4C4PA 1EX7A 3ZIAA 2G0NA 3K0CA 2FF7A 4WQMA 4HB3A 3EC2A 4C0QC 2ZRGA 1QG0A 4ZI2A 1Q3HA 3EIHA 4IRUB 2WWWA 3AKDA 1E2FA 2P5SA 4A2PA 1TUEA 1NG9A 3ZC3A 1GIAA 2JLUA 4M8NE 3I56B 2GCOA 3AKCA 4L9WA 1NJID 3TK1A 2QMEA 3VKHA 3LXRA 3SHFA 2HEIA 1UADA 4ZKDA 4G0NA 1T3LA 3DOEA 4WIAA 1QVRA 1KI4A 4RD2A 5JBQA 2H18A 5HKKD 2IW3A 4M0LA 2V7QD 4QBIA 3QF7A 3MD0A 1E69A 5FL3A 1YZQA 1MT0A 3CONA 1J9ZA 2ZROA 4CEHB 4DSNA 5HCNA 3V9PA 4HB4A 4G5QA 1R8QA 3ASYA 1M7GA 5JEEA 3KB2A 1QHXA 4BRWA 2RB4A 5J4KA 3ZD7A 2XZLA 2JIZD 4IVQA 4TT3D 1YI2B 4W7SA 3C4JA 2BM0A 3EZ2A 2NIPA 2RGBA 4AY2A 3IQXA 3AF4A 1WCV1 1O87A 2C2HA 3VR3A 2WKPA 2GESA 2BMJA 3TSOA 1LF0A 2BBOA 2OXCA 1E9DA 1M74A 2VNKA 2VP0A 4O0MA 1KI7A 1VDZA 2WPDD 1W36B 1GAJA 4PZZA 2W58A 5EE0A 1O3YA 3VNVA 5EP3A 1ZVQA 1QFZA 2XNDA 5JZVA 1EP1B 2IYYA 4B75A 1G5TA 1E2HA 2BSAA 2EU8A 2DWQA 1XMJA 4LC1A 4TSFD 2QROA 1HE8B 2VIIA 1ELOA 1G7TA 1KNQA 2CHQA 3IIMA 4HAYA 4WXPA 4A15A 2GF0A 3BB4A 1TNDA 1N6LA 2YC2C 1JJ2B 4ZGQB 4A2WA 2J5XA 2QM8A 1HY3A 3ND8A 3MJHA 3KQKA 1NRJB 2JA1A 5FBWB 1JBKA 1GILA 2PZGA 3LBHA 3SJAA 3DOFA 1E2QA 1TLLA 4RCZA 1D9XA 3M1IA 1S4QA 2W83A 4M9SA 4RFVA 4DUGA 5BN3A 3MG9A 1ZUNB 2VP6A 4HUQB 4D2IA 2ONJA 2QAGB 3E2IA 4D0GA 4CF7A 1QHGA 5EXPA 1COWA 1TVCA 3UMFA 1IN8A 4JIMA 4L4UA 1P61B 5DNYB 3QG1A 2C96A 5DIFA 5JHHB 1RJ9A 1JALA 1ESNA 4IVPA 5E7MA 4MRSA 4ACBA 1S2MA 3E1SA 4TL7A 5G41A 1WBDA 2ZS7A 3T61A 1JB9A 4EPTA 1IJFA 4N3NA 1CJUC 2FWRA 3SFVA 2REOA 3CB4A 4GRAA 1G291 3QFSA 1PUIA 4F92B 2OCAA 2FFAA 3QPWA 4FCWA 1IQPA 4NP6A 3G0HA 1KI9A 1UEJA 4EQ6B 5TY0A 1CR4A 1P9RA 2UZIR 4C2UA 1XZQA 2CJWB 4DXAA 4C0BA 3GPLA 4B47A 3HU2A 2J7PA 2BJWA 3QEOA 2EWVA 3MMPA 3SFZA 2LKDA 4NYIQ 1KKLA 2F7SA 5KDOA 4LK2A 4KFRA 2IYXA 5EUQB 1XZPA 4URXR 2P67A 1A4RA 2FU5C 2RH5A 4AI6A 3WBKA 2I1QA 1EK0A 5IF9A 3R7WA 3FKQA 4Q1FA 2VHUA 4B73A 1FTNA 4GP7A 1G17A 5KHOC 4MYUA 3BERA 4JLPA 4B3BA 2UZ3A 3R9WA 3SJZA 2P6UA 4D80A 1E2JA 4W9MC 3G4SB 2V54A 2KBEA 1U90A 4FINA 5GVSA 2G0TA 1G7RA 2X19A 3QNUA 2P6NA 4PC3A 1X3SA 3CF6R 3RC8A 4OK3A 5JI2E 4P6VF 4YDHB 2RHDA 2AR7A 1FX0A 3EZ6A 4PTLA 1FUUA 2FZ4A 2G9NA 4HLUA 3LAWA 4D6PA 4A8JB 1KO8A 2GEVA 2RGGA 4DQLA 2Q9AA 2C98A 2WBLC 2VP2A 5AUQA 3AP3A 1BMFA 2QL6A 4BFYA 3RS2A 4AF6A 1Z2AA 4FN5A 1EFRA 1KAOA 2GXAA 1CNEA 4A6XA 1AZSC 5DO9A 3DPUA 5K8TA 4BECA 1TF7A 4UJ5A 1ZW6A 4CEIB 3X2SA 3DMNA 2CBZA 3A1UA 2AX4A 4DDTA 5IRCD 2HV8A 5E7JA 5H68A 2FGJA 1H65A 2WJJA 4V0MA 4PC2A 2UVQA 4U9UA 1DEKA 1TF5A 1AGPA 2QENA 5C4MA 4TZ0A 3WY9A 3BOSA 3LX8A 3RANA 3T5GA 2JCSA 1UBGA 4Q4HB 3I55B 2PLRA 1VQ6B 2J87A 4D4KA 2EFEB 1MABA 4Z8XA 2OILA 4NCNA 3AP1A 1D6JA 3I73A 5LB2A 1N5KA 3VHXA 1VIAA 2OO7A 2F1HA 4Q5IA 5AJVB 3ZIAD 2OHFA 1EGAA 3MFYA 3AF2A 5JEDA 5LD2B 1IY2A 1W7AA 2X2EA 4KJZA 3VO2A 5CITA 3A6PC 3OEEA 4LYHA 2HF8A 2NZJA 1ZIPA 1GITA 5TV2A 4R2HA 4DCNA 3JQPA 1K73D 5D3MA 2ZRNA 2C9OA 2NO9A 4EFMA 2CNWA 2XB4A 4KLZA 4HDOB 2YWHA 1XRJA 2H1LA 5IK2A 1QHYA 2BKEA 3SHWA 1GM5A 3QUSA 5FPKA 4DLWA 2CEAA 4MUBA 3UMSA 4B33A 3CNLA 1G16A 2GBLA 2N42A 821PA 3MLEA 1R8SA 1U9IA 4Q9HA 4AD8A 3H0KA 3IDQA 1IB0A 1U0JA 2CHVA 5FR2A 1TADA 2GK6A 4Q4LA 4C0HA 3QFTA 1DAGA 3QXCA 4QM6A 5JECA 1JJ7A 4XIGS 4BFVA 3B13B 4BFXA 1QHHB 3OHMA 2J0UB 4AURA 4EJSA 3W34A 3S1AA 1Z3IX 3IILA 1VCMA 4B6FA 4O3MA 2QTFA 3LLMA 2ZI7A 5B57C 5JSZB 1L4YA 4PAQA 2QDXA 3X1ZA 4IFBA 4FMCB 3KQLA 2QPAA 2BIFA 4DT1B 5JLJA 3NEYA 1BO6A 3LDAA 3KTAA 3QXHA 3CX8A 2Q3HA 1OFIA 3HYTA 4D4MA 4Q4AB 3N5CA 4B3CA 5JRZA 2N46A 2HYIC 4US1R 2AD1A 5KNBA 1ZM2A 5AJYA 3UG6A 4NHOA 1TAGA 4TYNA 2C9YA 2PMKA 4BPRA 3K09A 2ERYA 4JLOA 4MQBA 2XNSA 2XNDD 2ANBA 4DLUA 3IGFA 3ADCA 4FWTA 5CIWA 2VEDA 4CRWB 1Z6XA 3OJXA 1TQ6A 4KO8A 5KUTA 1SVWA 1F5NA 2R6AA 3LLUA 2EIXA 3ZGXA 2RGAA 1NY6A 2VBCA 1WRBA 3LVRE 3AVYA 4K1XA 1Z08A 2H17A 3QFCA 3MWKA 5KDDA 3DVLA 3ZD6A 3B1XA 3K0FB 3GLFE 3T06B 4C7OA 3VU9A 4DUGD 4M2LA 3FKSA 2ZE7A 2FA9A 4UXHA 1EFCA 2JEOA 2QTVB 2G77B 3I5XA 1PV4A 2DFKB 1F20A 4DLYA 2WJIA 1SXJA 2QMOA 4IVRA 4LV5B 5DSZA 5B30A 3QKSA 1YR6A 2F43A 5CYPA 4LY6A 4CT5A 2QBYB 3VKWA 3W90A 3IHWA 4UNNA 2P6RA 2OLKA 5ANRB 4AG5A 1Q1ZA 1FDRA 1JECA 5C1BA 1VQ5B 2QRZA 2R65A 4IJMA 2OCBA 3ZH9B 3W2GA 4OL0A 2R44A 2ERXA 4R98A 5GJVC 1TQ4A 1KO5A 3Q7PA 4IW3B 2VP4A 3K9GA 3ONWA 5DI3B 1E3MA 4PPGA 2ZRKA 2ODNA 2D2FA 1QHNA 1I2DA 1X8LA 2OXRA 3NDPA 1VHLA 1WE2A 1KDOA 1NBME 2W2XA 4KVAA 3KJGA 1T6NA 4NL4H 3RS5A 4JLDA 3BS4A 1UF9A 4DC9A 2RHMA 1A5TA 4CZ2A 4JKYA 5BYJA 1EP2B 2L0XA 5F3WB 3EPJA 2LKCA 1OB5A 1FP7A 1VECA 1YJWB 2E87A 4FI3C 2ORIA 3A58B 5ELXA 3N2EA 3ZBTA 2HT1A 4D25A 3U3OA 3F0TA 1VIYA 3PVSA 4NYMQ 1Q21A 2DHRA 4YLGA 4AWXA 4OQXA 5F9HA 2JGNA 4B6EA 5JJLA 1B2RA 5FOSA 3QJYA 3CPWB 4XWKA 1N5IA 2A2ZA 2WJGA 2IEYA 4LGMA 2Q6TA 1NMZA 1J8MF 1WP9A 4Q21A 1V5WA 3AGQA 4KYIB 3K0AB 3C41J 1ZNWA 2XSZD 3L8ZA 2OFXA 5K8LA 3AVQA 1W2GA 1X86B 1BX0A 1N6HA 1NP6A 3KJHA 1VQMB 1MO6A 2ZI5A 3CWZA 4LYFA 4PZYA 3W8RA 1RC8A 2J9RA 3RVBA 1CEEA 3LO5A 2EWWA 3P27A 4QGHA 4TLDA 2ATXA 2TMKA 4M1YA 3FMFA 1RYFA 2GXUA 4KLNA 1AQYA 1EFRD 1M34E 4AKEA 2F3RA 4NMMA 5KSPA 2QMHA 2RGDA 1U2RA 4CVNA 2GJ9A 2OAQ1 2D3WA 2YYZA 4M22A 2ZSBA 5IDVA 1FL9A 1Z0KA 3QF4B 5J40A 2ZE6A 5KSOA 1IY0A 1JJVA 1QF9A 4QBGB 1VCNA 2REBA 2KB0A 3M0EA 3GLGB 3CPHA 4NU0A 3CW2A 2GVDC 3OIUA 2DWOA 4GOXA 4OI1A 4MKHA 1XEXA 2WWGA 2OLJA 5A0FA 2NGRA 3RHFA 3WMEA 1SHZA 2PJRA 1GOTA 1AZTA 4ASUD 3QKRB 2XAUA 4DQKA 4A36A 3KB1A 5JWOA 2OUKA 3NBZC 1ZAKA 4PSVA 1KI3A 2F3TA 4Q7JB 2OM2A 1R5BA 3C7KA 1XPRA 2NMVA 3W9YA 1E2KA 4DCUA 1KMQA 3NHBA 4ARZA 1JXMA 1NI3A 2Z6VA 3A4NA 1YZKA 2VO1A 4KYUA 3U44A 4TYYA 1T5IA 5JJKA 3BK7A 1R10A 3G6EB 5GV7A 3GEHA 3IO3A 2ZS8A 2GDJA 2ZR0A 1U8YA 5SZHB 4OBEA 1Z0AA 1Z29A 1ZMXA 1GNRA 2D4HA 3IHLA 3OEED 1II8B 2WICA 4I1VA 3NBFA 4DLRA 4V0KA 5L3QB 1S9DA 5FTNA 4XD7D 3V4RA 2DYKA 4X8MA 3ADDA 2SHKA 5H70A 4KHZA 8OHMA 1OSNA 4XWOA 3I62A 2CNWD 4LHXA 5IK2D 5SZKB 4DIDA 1XCGB 3IEVA 3OFNA 1JPJA 4TT3A 3THXB 1KO1A 1UBEA 1F3OA 2XITA 4V02A 1M90D 1G18A 2QQ0A 3CF2A 1PUJA 4PFSA 3GLIB 3KZ1E 4F91B 3AVTA 1P9NA 1QX4A 4GZLA 1XD2B 2CE2X 3O8RA 5HR5A 2H7VA 2ZYVX 2O8BB 2ZIAA 2VNJA 4TQUS 4WAUA 2MSCB 2DY1A 2WJVA 2V1XA 1UBFA 3K70C 5KO2A 4AYWA 2ZE5A 2OZEA 3I4LA 1UJ2A 1SM4A 5FPSA 3RWMB 3W2EA 1DELA 5P21A 5DGXA 2VZLA 3B6EA 1CJMA 5F9FA 4ZDIA 4US0R 1XPOA 2ZSDA 3EWSA 5TB5A 5SZJA 3DL0A 3NBYC 1W49A 3OIYA 2ZM5A 2XXAB 1QH0A 1Z28A 1OYWA 4RFSA 4XVRA 1S0UA 1KJYA 2PJZA 4QHSA 4FMCF 4PHHA 4RD4A 3Q8XB 2IS2A 2CDNA 3LY5A 3W5VA 1LVGA 2JLVA 4Z51A 4TYQA 1Y63A 1GTVA 2MSEB 4TZ6A 1W36C 4OI0A 1R0YA 1E32A 1EX6A 2CNDA 3UANA 5JI3E 4KI0A 1XPUA 4ZKEA 1ZD9A 2FPLA 4MUAA 5TXGA 5KPDA 1N5JA 3NH9A 4Q1BA 3QFRA 5FA6A 2XZPA 4LSGA 2O0KA 4E07A 1JR6A 2JJ1D 2ZSAA 1XXHB 1YRAA 3FMPB 1AJEA 3D7MA 1JAIA 1QRAA 4M1OA 2Z5FA 3EZ7A 3SYKA 3MCAA 2DR3A 3W3AA 3FKSD 4Q48A 3KXLA 4HDQB 2R2AA 4LYAA 5KPJA 5FBVB 1SXJD 1LF5A 4TMVA 1VQ8B 1S1MA 4NYJR 4JVLA 4RSGA 1TF2A 1M2OB 2GKSA 2FJUA 1E4VA 3AVUA 4TTRA 1OH5A 1XJQA 4JL6A 2B8WA 3KQHA 1E9EA 5DE3A 4MDFA 1G64A 4XOIA 2NQ2C 3HPQA 4GPTA 4MKFA 4Q1EA 4C0SA 3FOZA 2BOVA 3M4YA 1FZQA 1LTQA 2EFGA 1OHHA 4B34A 3BD9A 1R0XA 2QP3A 1VQOB 4CIDA 1S3GA 4EPRA 3I32A 3IPYA 2AWNA 2WAYA 1K5GA 3K9LA 2QAJA 1QFYA 4A9AA 3CPJB 4ACAA 1P4SA 1OXSC 2IYZA 1T91A 3W6OA 4OQLA 221PA 4FMDF 1W87A 4Q19A 5FOUA 1AK2A 3VMFA 1E9AA 3P1JA 3OZWA 1X8JA 3LW7A 3GFPA 3QY0A 1DG1G 2P3SA 2GCOB 2E1RA 3G82C 3KQNA 2A5DA 2ATVA 2RAPA 3K53A 2RGCA 3GJ7A 2PH1A 1T5LA 521PA 4BQSA 2ZI6A 4RD3A 2WIAA 4MRNA 5JS7A 2BC9A 1CJVC 1YJ5A 1OXXK 4TLEA 1P2SA 2VSOA 4P32A 3VQTA 1GNQA 2O8EA 1EWYA 1V43A 1E9FA 1QHSA 5JWHA 1PLJA 1EWQA 2PCLA 5LDDC 1E2NA 1YIJB 4KCGA 2H16A 1AA9A 1Q81D 5EQTA 4BPBA 4HZUA 1Z6YA 5CB6A 4JVSB 3I72A 2V55B 1U98A 2GJKA 2FEMA 2FFHA 4TTPA 2GETA 1R7RA 3ND9A 5L3RA 2B21A 3CZPA 5BQ5A 3W6NA 4A8JC 4CW7A 4YMTA 4ZCLA 1I2MA 2VTKA 4YMWA 2IS4A 4BFUA 4GBMA 5TARA 1VG8A 3VTKA 4BGDA 3AQ4A 1G8HA 3DEFA 1DS6A 3SI7A 2IXFA 3ZBUA 1N0WA 2XTMA 1DE0A 2BCJQ 1E2GA 3W5HA 3SE0A 4GMDA 1Q44A 3Q7QA 2BEKA 3B60A 3AEZA 1Q20A 1T4GA 5FPYA 4Q9IA 3GLHA 3CUEF 2PX0A 4KV9A 2QNRA 2YHSA 4Q7LA 4QHYA 3L82B 4LI0A 4HSEA 2Z4RA 3I5YA 1VQ9B 4JJKA 2BPOA 2GRJA 3QSYA 1D2EA 2PLFA 3FMIA 4Q1DA 2Z83A 3CCEB 1G1MA 5KSZA 5DI9A 5EZ6B 5CDFA 1TEVA 1E79D 1Z47A 2ZEJA 2KWIA 2WWIA 3AKEA 3GJXC 1XTSA 4DSOA 1GL9B 3QE0A 4B44A 2W0MA 3CX6A 4HI0E 4UXJA 4HLQB 3QOFA 1L4UA 2BDTA 1IN7A 5LD2C 2HDNB 2VHCA 2VSFA 2BMEA 1NJFA 3EZFA 4JYBA 4YMSA 4K81B 4U7DA 1G8YA 3FE2A 5EUMA 1N6OA 1N6NA 1DG3A 5CIQA 1US8A 1G8FA 3AH8A 5HZHA 4OK5A 1M7HA 4AKHA 4QFMA 3OFND 5CM8B 4EPVA 5KOYA 3PEWA 1Z8FA 1X8KA 2MSDB 5CM9C 3A8TA 1NSFA 5DLQC 4JZKA 2PCJA 1NN1A 1CBUA 2ZRJA 1Q86D 1P73A 4P4TA 4PAMA 5A5GA 2IUUA 5JCZA 4LC0A 4QBFA 621PA 2NOAA 1GKUB 1DAIA 1D1NA 4KBFA 1OB2A 4WA7A 2PEZA 2IBMA 4NH0A 3ZQJA 2ZYUX 1TUIA 4PXAA 2P5TB 3RDPA 2EFCB 1YR9A 1DAFA 3KDSE 3HU1A 4URZR 3RRNA 2LWIA 1E96A 1JPNA 2R6FA 4LJ4A 5EP1A 5J5CA 3R7WB 1XEWY 1KI6A 1UEIA 4IOMA 4IDPA 3R9IA 5JHGB 1XTKA 4RD0A 2ECKA 3D31A 1GR1A 2GILA 3GJ8A 4URVR 1IXSB 1K8RA 4BEJA 1G9XA 1FPMA 1G41A 1FNDA 4OHWA 3PEYA 1L2TA 1BQEA 1SZPA 1FX0B 4JL8A 3CRRA 1Z63A 1VTKA 4OQFA 1HURA 1CR1A 1XBTA 2FNAA 3QKTA 4XVQA 4PHFA 1AS2A 4BEBA 3U7FB 4PZLA 4G5OA 2Q9BA 1HTWA 1BJKA 1RRGA 1XMIA 4CEJA 4WZAE 4DSUA 4U02A 1R4AA 3JQRA 1G21E 1UDWA 2J59A 2JJ2A 3AKYA 3GJ6A 3NHAA 4ILEA 4LUCA 2DFTA 1DDGA 4JL5A 4S35A 3U60B 3VR2A 3ZDQA 4IHQA 4I99A 4PAOA 2JASA 3KUDA 4I4LA 4JT2A 2WWFA 4HE6A 1WF3A 1UKVY 1YE8A 2Z0MA 3PUXA 5EE9A 4Q9LA 2R6CA 3VO1A
chains in the Genus database with same CATH superfamily
3BCUA 3QVOA 3GC6A 4U2GA 3MT0A 2HPAA 5GJBA 2EKPA 1MX5A 4IZ6A 3IPLA 3P4YA 1DEHA 5B7NA 1Y6GA 1KRHA 4EGCB 3PUMA 4I7EA 2VUHB 1VGQA 3OFJA 5EJ4A 1JKFA 1HLPA 1LLDA 2QJRA 3TG2A 1YMVA 2FK7A 2G9UA 1RMQA 1KOFA 4HAUA 1EXWA 2FSVA 1ESZA 3Q6MA 3AL3A 3FNGA 4OM8A 1TM5E 1VKRA 2IVZA 3D3WA 2QX6A 2X9GA 2BP7A 2F4NA 3DWFA 3IBCA 3IVXA 3TL6A 3ZLUA 4C7VA 4F21A 1FS5A 3BCFA 2QRLA 2JLVA 1P4JA 1T2UA 3G59A 2OEPA 3HCPA 3PF9A 4V0LA 3P0JA 1QHFA 4W5HA 1OHHD 5FHRA 2GZDA 5J2TF 2IEBA 1J9EA 4K9RA 4EFLA 1BS9A 2O7SA 2GN0A 2Z6UA 2X85A 3T35A 3THWA 3FSEA 4DXDA 4X3PA 1JDUA 4RTNA 1FYVA 3C3PA 2QP4A 4MV8A 1E9SA 2XZDA 3SYLA 1RIIA 3A6FA 4UM7A 2JGEA 3NHWA 3U3JA 1L4FA 1GZ4A 3HKBA 1D04A 3HJRA 4KQ1A 2F6RA 5DYYA 1C1DA 1HQDA 3A11A 4HKTA 2HXSA 2YZ7A 1FPQA 2I4LA 1NVVQ 2WF7A 3KD3A 3U16A 1AG9A 3O4FA 4P3PA 3GLGA 3EG9B 3DBIA 4NF2A 4PX5A 3RABA 1XQXA 3GRVA 1Q6YA 3AEUA 2FSHA 2ZIFA 3DHWC 4GL2A 1OA0A 4HV4A 2HK6A 1CF4A 5DYGA 4B6SA 4C0KA 2AMYA 2GKOA 1KGSA 3AY0A 3L7NA 5AW6A 5J4LA 2BR3A 5DN9A 3ADKA 1L7QA 3NBKA 2FI1A 3V7WA 1JEOA 2X4LA 3NH6A 4WPGA 1FNMA 4D79A 1CRZA 4IF4A 3EHDA 2BZGA 4I1UA 1S8OA 5F2NA 1E66A 3G6WA 1BQ3A 3SX2A 3KHUA 4PAAA 4P33A 1FYDA 4PQYA 4IIEA 3ZWYA 2PU5A 4G1BA 5GZ3A 4IIGA 2VKTA 3FROA 2CVPA 1U1CA 4IWYA 5HOQA 1WPQA 3DR5A 1J25A 1GGHA 3GJ4A 3A7EA 1KO4A 2X2FA 3F6YA 2WU3A 3QMVA 1MRSA 4UU8A 5DXAA 4EPYA 2VH2A 5T57A 2DECA 4QYWA 1VYUA 1Y8CA 4CF3A 3A1NA 1AD2A 3KTAB 4FOPA 2O7QA 1PGOA 1E2PA 1GG8A 3P26A 4PRLA 1MHTA 1X14A 4G5FA 3WNVA 3IJRA 4BVGA 4MDYA 4BX0A 5CVCA 5AVUA 5CEJA 1D8TA 1L8QA 3CUWA 4ZGNB 4ZFNA 1KFKB 4NS4A 1OCEA 3IV9A 5IMBA 5C2JB 1XZCA 2J30A 2A84A 4Y30A 1FDVA 3RTEA 2NO6A 4GH5A 1LDMA 1E64A 5JPDA 1Z0IA 2YKGA 2L17A 4HFNA 4Z4VA 2AJTA 1QVGB 4ZDWA 1WVMA 4RDJA 5AW4A 5J47A 2A4KA 3GLSA 3U4HA 5BV7A 4KR2A 3QLTA 4MKRA 1AKTA 1PJRA 2OV3A 3Q9NA 1QRRA 1WXQA 4K9LA 2BEJA 2X4IA 5IYWA 3LA8A 4J2HA 4PICA 3SJUA 4PRKA 3VU9B 2WAXA 2XQJA 3E5NA 3NAQA 1ZIOA 4Q4DA 3TO5A 1G6Q1 3T5PA 1K6EA 3KWLA 4Z86A 4QG3A 1N1GA 1P1HA 1IJEA 1DRJA 1ZWLA 4KXLA 1O94A 3STYA 1VL8A 2V6GA 2VN8A 1SQSA 2AQ8A 3B9QA 1KEEA 1Z39A 1M2VB 4D8VA 2RGXA 4KPYA 2I4IA 2VRBA 3VR5H 4WKPA 2XMPA 1FFDA 1XAJA 3K1ZA 1SVSA 4EIWA 1KZ7B 1SC3A 4NAHA 3RVPA 4EKYA 1G3RA 2Z98A 4S2EA 3NUQA 1ZOOA 6GPBA 2AG6A 3ITNA 4L0DA 1X1TA 3EIQA 3UF0A 4AWBA 3W5BA 1VF7A 4PGFA 1C8VB 3A9VA 2EATA 3NS7A 4BMYA 3EPHA 2A5YB 3HBNA 1IM2A 3Q5EA 4O08A 3AUJB 5FBLB 4Y2UA 5LIRA 4NNPA 1GPMA 3A9UA 2WIGA 4JLAA 2NTNA 5M3BA 5IHPA 1OWMA 1GNPA 3FPAA 4MVJA 4P5DA 5ALKA 5B58C 4EYOA 3O21A 2CXQA 3D1VA 3K92A 1W4RA 1U2PA 2P9TA 3C6KA 5ALGA 4WE3A 1DVRA 4CUKA 4ZDKA 1BCRB 1W2HA 1CY2A 2YHUA 1DBRA 3NWPA 3UJ6A 1N5MA 1Q82D 1PX2A 3BMQB 4IOLA 1P2VA 3RY8A 1RWQA 4QL3A 2Y93A 2NYRA 2PZ8A 2XYHA 3JCZA 1FW6A 5EXSA 5FV4A 1LGYA 2G1UA 3AP2A 3FDFA 3QYAA 1UJNA 1TD1A 4QBTA 4IUYA 2PQ2A 1PJLA 3DAGA 4ZT6A 1F6DA 1FU4A 4R9UC 3WGTA 1GYQA 2JFBA 5JPIA 5T3UA 3WHKA 3LXXA 3LE8A 4MWCA 4UAVA 4ES6A 4B74A 1QJ4A 3TFOA 2IYNA 4JWKA 5JNUA 1KVSA 2WNHA 5HG0A 2PGLA 1VPVA 4PYRA 1HT0A 3LBNA 2HCTA 2QLBA 5ECDA 2CXXA 1RKXA 2BHRA 1WUIS 4L72A 2P30A 4L15A 4MQ4A 3MQ2A 5PGMA 3TXXA 1F2VA 2ZYDA 2VTDA 1J0CA 1LX7A 1J5XA 3LHIA 2W71A 2WHRA 3BL8A 4LHSA 3G17A 4Y7DA 1GTSA 4I8IA 4DDKA 2PX2A 2ZRPA 1CNFA 1MUUA 1SA0B 1JF8A 2B94A 3Q72A 3M7IA 3SKBA 1SPXA 1U3DA 3KOMA 3F49S 4G4SP 4YA6A 1XCBA 4B80A 3DL2A 4UAUA 4V2IA 1E3TA 3R2JA 1JDVA 3D3NA 4OP7A 3DAYA 1IUNA 2E85A 3MEQA 3BB3A 2B34A 2OBRA 5U4XA 2A86A 3BFJA 2J3HA 4Y6RA 4DJTA 5K8IA 2GM9A 4FE4A 4HATA 1FLDA 4RWEA 1SU4A 3KZCA 2H2DA 1QG4A 3KOOA 1II0A 5LNK1 4C0AC 3ZVRA 2FEXA 2PUCA 3OJOA 1FOEB 5IXJA 4XUDA 4F5EA 4Z9YA 5AKYA 3PC8A 2GSWA 1XU9A 4F3CA 3E3AA 4DBVO 1F3LA 3F9CA 4G07A 3VKGA 3E15A 3UQYS 2EQBA 1MEJA 1KHTA 1P4HA 4YMGA 3CW8X 2G88A 2QQ5A 4DC0A 3BGOS 3K1TA 3VI3B 1TCCA 1L4HA 1W4LA 1N7JA 1YVDA 3OTIA 1ZR2A 1B14A 1K3TA 1MG0A 3GFBA 3LNCA 4F46A 2ILTA 3G2HA 4IDEA 2ZBQA 3NNSA 3K70D 2B1GA 4GHWA 2P4SA 3CRMA 1KQOA 1KARA 3OZSA 3TM4A 1OFUA 3C5CA 5AHKA 2D9RA 1I8TA 4YDSA 3QPCA 3TJZA 3W04A 3VBCA 3X1WA 1YKFA 2BISA 1DEOA 3IKJA 1XLTC 1HA3A 1YDEA 3NC4A 3MHPA 4MS1A 1LPMA 1OBHA 5E6UA 2IUTA 3OE4A 1KDRA 3K0CC 3O4VA 3R9XA 1CJTC 3OZXA 3BCHA 4KFUA 4KWTA 4BNLA 1BX1A 2H2WA 4Z4WA 1KJ8A 2XUIA 3CVJA 5CK5A 4KBGA 3SQDA 3S81A 3GLFA 2AB0A 3DBRB 4MW7A 3TD9A 2VWPA 4DCVA 1JR3E 4AJIA 1E5XA 1B1AA 1ZMOA 5HCIA 3NDBB 1OXKB 5HQTA 1FNNA 4Q02A 4R71A 1XHLA 5BVGA 1N0VC 5IYQA 3KDAA 4IZHA 4DB2A 3NBMA 1C4KA 3QVWA 1J5EB 1S7CA 1KPGA 2FAXA 3ET4A 2J3JA 2C9ZA 2GEUA 2V5VA 4P08A 5T41A 5AM1A 4J3NA 5I4KA 3WO1A 2XMGA 3WWEA 3KKNA 4BTLA 1XFDA 1ZUWA 2Y2VA 4GLJA 2ZGVA 4JI6B 3MUFA 1RIFA 4OJMX 3OPYA 3H11B 3GR6A 4YQFA 5TPWB 2WD7A 1ARZA 1ISSA 3LDUA 3LRPA 5EIEA 3AG6A 3EGDB 4TKZA 1Y8RA 4O6VA 2Z04A 1I9CA 2O1XA 5M5BA 4OMUA 1I4OA 2WM9B 2BE9A 3AF3A 1G20E 1MV5A 2C78A 1U5BB 2NYUA 3HZOA 4QOHA 3KBBA 4TS4A 5D7NA 1I4LD 3CTPA 3GJ3A 2ZJ8A 2QLFA 3ZH2A 2G67A 2VF8A 4RIFA 3T9EA 3CEAA 4HEA1 2BGGA 2RHLA 1Q74A 4RFSB 2UXCB 1SEPA 4X0EA 5LIPA 4LBZA 3K0SA 3RIGA 4MLDA 4W5JA 4J0IA 1I8DA 2DEUA 2FPXA 1U02A 2BBSA 1NW9B 3QXGA 4LWPA 1X7WA 4R40A 4PFKA 5ALJA 3TD6A 4JYCA 5MN4A 2MYPA 3WISA 3ZXXA 5DM1A 2LV8A 1UKAA 3HUDA 3QVJA 4RZXA 4NCHA 3ROQA 5F3DA 3NVKI 4F04A 5HQ3A 4MUNA 1PR1A 1ZXLA 4YDRA 1E79A 5A9RA 5DI3A 5FUVA 3C87A 3GLGE 1JH9A 3ESXA 3DCNA 3MMZA 1GGEA 3UNXA 2EIHA 2ZT5A 3CZAA 3H97A 1A97A 2VWQA 4AICA 4J0GA 5EY5B 5C9ZA 1VJ0A 1Z34A 2IX9A 4TWBA 3TQSA 5LFAA 3AR3A 2QD5A 1JR4A 2PVPA 1M6WA 2V4ZA 4X8IA 3WGNA 2MR5A 2R6ZA 4Q05A 3C7TA 3DMHA 4ON9A 3JR3A 4RVCA 3ZVMA 1NBAA 121PA 2GD1O 4ZEMA 1A1VA 4RPIA 3OFVA 2GS9A 1RLMA 2W2KA 4QTYA 1EXNA 3Q0EA 1SKMA 1T3GA 3VYUB 3M3HA 2JFXA 3R5FA 4I1PA 5C46F 1M1XB 4TVSA 4ANFA 2PRKA 4LJLA 2ID9A 1OAAA 3CZ9A 4MKIA 2J3LA 1L5SA 3I6ZA 3II6X 3P9CA 1E6WA 3HCNA 3IERA 2PLNA 1L5MA 3NIBA 1WTCA 4Q9JA 5DYNA 2OAP1 3IPXA 3ULKA 3AMVA 3H2IA 3IA2A 1Y89A 3MPOA 1P81A 3PVCA 1IG3A 2V0NA 3BHNA 3LCCA 1D9ZA 3ONFA 1NXXA 4P7KA 5BOSB 2ZZNA 1OF1A 2IUEA 1K0UA 2I2CA 4HAXA 3Q9LA 3ST7A 3E9YA 3V2GA 4B8WA 3ZDRA 5CVVA 2WTXA 1Z0JA 2ADMA 4D42A 2H2IA 2HLHA 4GMKA 4LWQA 4R6WA 3VJMA 1U81A 3JTMA 2X8JA 2OBYA 4MVJD 2OYSA 3WGQA 2PUVA 1BG6A 3B8HA 3FBGA 1Z6TA 3CNBA 5F98A 1XRNA 1YUMA 2DWPA 1NF8A 2F48A 3T8YA 3N86A 1YHQB 3C39A 4NFHA 5F33A 4E3WA 1KKUA 3CIFA 1ORVA 1KE1A 1GRQA 1HRDA 3NJ8A 2ZK7A 2JC3A 1L1EA 1LDBA 2AZ4A 2HJGA 3ZV5A 3FWHA 1KQGA 3CR8A 1GAWA 2PGJA 2QUZA 2VZEA 3KYBA 4M21A 1QIIA 3FFXA 2X5OA 1C2TA 1SBZA 1WPXA 3AJ9A 2DHQA 1HL3A 1QRUA 3R24A 5A0TA 2ASEA 2A7XA 1AXRA 2J33A 2VTBB 3PE6A 1MJFA 2OHOA 2V3CC 2IK8A 7YASA 1JEAA 3EBPA 5DB4A 4R0MA 3ZWDA 5JC1A 4V03A 3PRKE 3C3WA 2O8EB 3GW8A 4QG7A 3R75A 3QKRA 1QH1B 2W11A 4L3WA 2DQYA 3A3KA 3MD9A 4RVDA 1NDQA 2CXUA 3T94A 5K3EA 5KC8A 3FPKA 4YALA 4AVZA 3DWGA 1TFRA 4EKEA 1JG7A 3VR6H 2D00A 4UC0A 1SELA 5EQJB 2PMWB 5D85A 1PNQA 4KQFA 3UENA 1LA2A 2ZQ5A 4HZUB 4F5WA 3EF0A 1SC1A 1ZH8A 3ISJA 5D3ZA 3MZ0A 4C29A 3SWWA 1BMDA 1R8JA 3MMXA 3QSGA 3UHFA 4NFYA 1S8AA 2JNWA 1I1QB 4XGNA 1L5GB 5I9IA 3OLQA 1YI1A 4MJ7A 3UB2A 4MA0A 1FW8A 2XOKA 4LMRA 5L3SA 4JXZA 1CR2A 1Z0ZA 2IPAB 3AV3A 3CLSD 4RLQA 5B4TA 4M0MA 1UL1X 3TAUA 3TR5A 3SVTA 3A8JA 1C7EA 1LK5A 2EARA 1W0JD 2FUG6 2ZR7A 4MGIR 1ONSA 3EYAA 3KJIA 6ADHA 5E1BA 3LUGA 3UWOA 4EH1A 2HJVA 1NTOA 1M10A 3A36A 2JGKA 2AXEA 1QCZA 4H6WA 4LZAA 5EIBC 1XXHE 5EMJA 3WYGA 1DX4A 1SIOA 4EVRA 4DSTA 1XA3A 3HNPA 3RV3A 1C0KA 2ORWA 1ZI9A 3IO5A 3VR4H 1YA6A 3E2PA 4LG1A 2FHPA 2O0HA 1JNYA 3M6WA 1CUHA 2HW8A 2AKYA 1MN6A 1U0RA 3UHPA 1PRYA 4DDWA 2O20A 2G17A 3G5UA 5J63A 4DCSA 4E7PA 3MTIA 5ALQA 4RH1A 5FA5A 3ZWKA 2B2XA 3OTHA 2BJHA 4F5ZA 3KKQA 4K0RA 2RJNA 1W5TA 3OFKA 3ZE7A 4ID3A 3RV4A 1LZLA 2AL7A 3L6UA 4O63O 4DQDA 3WNCA 4BKOA 1ZU4A 2WFZA 4JI5B 3B2QA 2CFRA 5BMVA 4JC4A 1YFJA 4IWXA 5L3VA 3HHPA 4YCAA 3OCCA 4HTFA 3HDJA 5F35A 5IVDA 1IQRA 1FJGB 4WA8A 4W9RA 3A1TA 3SIWA 3U13A 1BH2A 4LF5B 2CDAA 5HUQA 1FRQA 3X2FA 4U4AA 4CT4B 3KFLA 1DJLA 1D7OA 2PWBA 4JVOA 1EG7A 4C30A 4YNBA 3ILHA 1JWBB 3CZCA 3O2JA 4HUJA 3B3JA 3KUUA 4IMPA 1ZRHA 3PI6A 5EJ8A 1GV0A 3AR7A 3D4BA 3MXTA 2D0IA 1EGMB 2YR0A 1JEDA 3OEYA 4XWAA 1I2AA 4KRFA 4A6EA 5L6LB 5L7TA 2A58A 1LKZA 1WZCA 2QA4B 3T7EA 4LHWA 3Q6IA 1ECGA 3AFNA 2GTPA 1QGYA 1ADGA 3BC1A 4IHKA 3AF6A 1BEEA 1Q3TA 1Z4MA 1VHEA 4MRRA 5KTOA 4AECA 3FLMA 5A3QA 1GN8A 3KLNA 2CLFB 2J31A 3EGWA 2OR3A 1DC5A 2H1IA 3PD0A 1UBHS 2Y8EA 2YHIA 5EMMA 4FGUA 1U0TA 4G5YA 2XBLA 4AK9A 5IHXA 2HL6A 4QJ5A 3LQ6A 1M67A 4D81A 3KWJA 2VFAA 2HPHA 4HN9A 4W99A 3IDOA 2BJVA 1ORTA 4QU9A 2QSZA 3F4BA 4NE2A 2FX2A 4UTRA 1NRXA 3EHEA 4MPDA 4YP0A 2OTLB 3UGQA 1DCKA 3BGVA 3O93A 4MVCA 2ZPAA 2IYWA 2IS6A 3KO8A 1RLOA 1QE0A 2WUFA 3NFRA 2KHZA 4FOOA 1VMAA 4I4CA 5G4KB 1X7YA 1R0RE 4WCFA 5KSWB 1WHTA 2ORYA 1CP3A 3DPSA 4HC4A 5D6OA 3MQ4A 3L7KA 4K03A 1JJFA 3M4ZA 3OJFA 1G4AE 1OXTA 2VDQB 5JR3A 5CAEA 2DHEA 1RWWA 2IFTA 4V24A 5AJXA 3JD2A 1EVZA 3PFFA 3ZX4A 5F21A 2VT6A 2GTHA 3FLAA 4JP3A 4Z3KA 5IBPA 1Z16A 3UJAA 5BT8A 3K09C 4KKSA 1VJCA 5KHLB 4YRLA 3FOEC 3KZOA 2FWIA 3K5IA 4EI2A 4P3YA 4XLCA 1I24A 3WIUA 4R8KA 1NBOA 4E22A 2B82A 3LFHA 3N2KB 1EM6A 1PZMA 4WVLA 3GJ5A 3UICA 4QRIA 1DIGA 1ZK2A 3QUBA 4TMZA 4FCTA 4JX8A 1BS2A 2UYHA 3JVUA 4D92A 2O2YA 2PKQP 2R8EA 1HWYA 2HHJA 1TTPB 4RZUA 3VC3A 3PHLA 5CG1A 3EBOA 4Y2RA 1ZDMA 2NO7A 4HWOA 3U6BA 1D2AA 1GZ5A 4G9GA 4JFAA 1YFZA 4ADSG 3ZWOA 1Q91A 3OCJA 2DVMA 4H60A 3H9NA 2WOJA 5AYVA 5I3CA 2VYVA 3SU8A 4QREA 3J80A 3H9UA 3RVNA 3VR1A 1DBIA 1T5HX 2PN1A 3G85A 1D1PA 1X87A 2PRSA 3PCRB 3UGKA 4OBBA 4A0HA 2X40A 1SXJC 4FWIB 2OBBA 4M88A 3WLHA 2YCBA 5A62A 1C0EA 1BWPA 1QE3A 3HYRA 3FYUB 4HAZA 2R6GA 5LBIA 1RI3A 4ZQFA 3ZHOA 1JIKA 1JWAB 1TCBA 1UBKS 1KU0A 1RXSA 3G71B 1XVLA 1TT7A 3I3SR 3LY7A 4LKOA 4FD3A 3UHAA 5IAJA 1UD8A 5FWYB 2EF1A 3GO4A 1ABEA 4LOIA 2WU0A 2C0CA 2OTJB 1VYHA 1NFRA 4B6JA 4DNQA 1ZPDA 2IEZA 1FXUA 3SNHA 4A4DA 4IX9A 2IYRA 1NL3A 5C18A 1HNZB 5FOXA 4AMBA 4EENA 1QLJA 2ZCUA 3CVVA 2ZTSA 2IF0A 3DD1A 4WLNA 5AM5A 1HLFA 2DR0A 1LI5A 3T9DA 1PQYA 2C4TA 3B3FA 3VH2A 5KTTA 3DUWA 1Y4UA 2NUAA 1Z5ZA 3TOCA 1RR6A 1WZEA 3FB4A 4ZODA 1E1CB 4HLCA 2GZ3A 2WDZA 3C3YA 1UXHA 2B5VA 4JA2A 1G8GA 1LK7A 1J39A 2YVUA 1JAHA 4WFKA 3PG5A 3LUDA 3ONDA 4Y2YA 3F2VA 1K0FA 1Z26A 2ORED 2AVNA 3ZDAA 1PDVA 5BMVF 3U37A 2Q6IA 5FO1A 4YUVA 1E18A 2I2XB 3VSEA 1FMLA 2ZYWX 1DBQA 1RZRA 3DZHA 3GBPA 3GFRA 2B1RA 3P2OA 5DRYA 3T7DA 1PE0A 3GLRA 4C0LA 1ANKA 2B7BA 4WZBE 4FYMA 2Q0SA 1JG3A 2R68A 5KYXA 2Q5HA 4C43A 4HNAB 4B32A 2YFYA 5JV5A 2EJCA 4O59O 4XQ0A 5HMLA 1GL6A 1GSAA 3V2UA 1NLFA 3K15A 4U0KA 1LLFA 5C52B 1CQIA 1R18A 1UAYA 5FYDA 3ASZA 1WLSA 2XOKD 3BK1A 2A9JA 1MHPA 5FRDA 4BJ1A 1RPTA 4IL5A 2R25B 4RWZA 1Z13A 3ET5A 5L46A 2XX3A 5LZ2A 3BH7A 1OAOC 5I9TA 3D54D 3O9MA 1T0UA 4LWZA 1I2ZA 4PYQA 4EWLA 2H63A 2VLBA 2GZSA 4NJEB 1YCGA 5BP7A 3ZWMA 1KZLA 3W6PA 4BMPB 4EELA 3L1UA 1K7XB 5HBGA 3RFXA 4CEHA 5FAKA 3BH6A 2A33A 3L5KA 3M3PA 4QOEA 5EP2A 1USKA 4PYJA 4TT8A 3NHPA 5LDGA 2WAAA 4C7XA 4NTZA 3V32A 4HB2A 2VRWA 1J70A 1KYIA 3UFBA 5BV1A 4QZVA 1UP7A 3VA7A 4JI7B 3IMCA 2BSXA 4OKNA 4MQFB 2JIPA 4AN0A 1FJXA 4QYIB 3S2IA 2R7LA 3KJXA 4ZI7F 2HWKA 4JV5B 1AHIA 5F4JA 4PZ0A 2DP4E 2R8YA 4RPHA 4N6NA 2YV5A 1VI6A 2O6LA 2W2TA 4HQLA 4OP2A 3CCUB 2ZETA 3WJ1A 4LF4B 2GXSA 1K92A 4MO2A 4X90A 4CMEA 4RY0A 3TTSA 4YUYA 1OKKA 4YAKA 1MTZA 2GNOA 4NS1A 3OSZA 4QTUB 5A4JA 5EERA 2NV4A 1SUCA 1VLMA 1WTAA 3PXBA 4EA6A 2FCRA 3N2ZB 1QNLA 2EGHA 4OOFA 4MP3A 4Z9FA 4YCCA 3T3OA 2VUIB 2ZIGA 4JOQA 3QBVA 5EZYA 1FNBA 1NYLA 2XUAA 3JQQA 3CQ9A 3IIJA 5GAJA 2B92A 3JWJA 1H2RS 1RJGA 2AW5A 4LYYA 3FWKA 3TQFA 4BQIA 3V33A 5KMGA 3IUQA 2NTEA 4NOMA 1YRQA 1XZJA 4AX8A 4ZVNA 3UJBA 4HWKA 1GVNB 1SH7A 1UJMA 2XNJA 4AYXA 3RIHA 5K0EA 1BU8A 4B46A 4LOAA 4MJXA 1EXDA 1L5WA 1ULSA 4AKIA 1FNSA 1KZ4A 1BKYA 3ZGLA 3NX4A 1Y7LA 5F78A 1ZJJA 5EE1A 3TQCA 1EXMA 3DZCA 3L7MA 2O8DB 1SVOA 3U7EB 4B43A 3T4EA 5G3ZA 1KI8A 5JYEA 3NOQA 4KZPA 4NRDA 3B82A 4E2WA 5DNWA 4ZJYA 1IQ0A 2PWAA 4EGSA 5I7UA 3TW6A 1JUDA 3IS3A 4OU5A 5CT6A 1ADFA 4IQGA 2UUBB 3IBSA 4NHEA 5DULA 5FNVA 1X7DA 1V2HE 2ZSUA 3LF2A 3HB9A 2YJ3A 1J0DA 1A5SB 2ZUTA 5JAUA 2D1RA 2HJSA 2X3FA 3THOA 1T13A 1X2BA 2V7XA 3L8GA 1DTWA 3T7RA 2BGMA 3LHSA 5AHWA 4IH9A 2JF0A 5FPPA 1GN9A 4EF6A 5J4HA 5LJLA 1HE2A 2ODPA 1WMBA 1U6KA 2OA0A 5KWIA 1RPZA 3TW8A 1GQYA 1Z0UA 4OGKA 1RADA 3ANTA 4FGJA 5G0TA 4JLBA 5B1HA 2Z4SA 1TL7C 1JHVA 4FOLA 4MWTA 5DGTA 3ZHQA 3W1WA 1P0FA 3TE7A 4RENA 1QCDA 3QXSA 4BOYA 4G2TA 4RD6A 5A89A 1R0KA 1VYVA 1ZN9A 1ZP6A 3PNSA 1G8SA 1Q1QA 4WVFA 1GQFA 3DFZA 5HZMA 1TO1E 2HXGA 1PYOA 1Q0PA 2BKUA 1RWNA 3A2LA 3OG9A 3VYWA 4DYVA 4IDHA 1NU6A 4J0EA 1CTQA 2YZKA 2QE7A 3G2NA 3K7EA 3QVLA 4IJ6A 5AKXA 3TLYA 5IJ9A 1TX4B 3WBJA 5JAOA 2VATA 1N6KA 3Q2OA 3BGIA 4LX0A 3TGLA 3HJHA 2OK7A 3IP1A 4C88A 1P5RA 2Y1KA 4S04A 1FSGA 4NDZA 2PU7A 4DV3B 3E9DA 4CM1A 2HA0A 3Q3JB 2W6ZA 4L8VA 4KXYA 3RSFA 421PA 1XP8A 2CL6X 3L8YA 3DB1A 3KBOA 3PGA1 4RHEA 3EVGA 5ESRA 4OPVA 5BV8A 3U9LA 4C1BA 1IHUA 2JFYA 2F9MA 1V2GA 2P2LA 2HLPA 1N6IA 1RWVA 1RMTA 2PX3A 2VP9A 4ISCA 5M04A 3OCWA 4B7ZA 2IXBA 4LOHA 4G0OA 4Q12A 2RC6A 1GQQA 3KAKA 3IXQA 1D4AA 3OZBA 1XVTA 4G97A 2GX6A 2JG3A 1T9ZA 2GR9A 4PQEA 2P1RA 3ROFA 4QM7A 3PEVA 3PL5A 4UMEA 2WYRA 2BFFA 2GN1A 4C20A 4EDHA 5EEHA 1NM5C 2DZDA 3FPHA 3DQPA 3IVRA 3AOGA 4BE7B 1YL7A 2W7TA 3EUWA 4DNFA 3SEQA 1D6MA 4Q6WA 1U4NA 1LPNA 1VA5A 3U1VA 3FI9A 3V48A 5K6AC 4CKCA 4GL4A 2QTBA 4DNRB 3TW4A 4TV9B 3HO1A 1Y7TA 1IXRC 4JENA 1UBLS 3KCNA 5FA8A 3OQIA 2HBZA 2I2AA 1MAHA 4QPDA 4B6PA 1UPTA 2HWYA 2O5VA 4NH4A 5JTTA 4EHJA 1E9CA 1AHNA 2V7VA 2P4HX 3D8TA 3QXXA 2WZPP 2PFGA 3ONNA 4RPJA 3KSRA 3C85A 5HUHA 2H5JA 5KQPA 1CSEE 4FT2A 2G7MC 4IIFA 4BFTA 4XN0A 3GUHA 3RSHA 4WXRA 4S24A 3EXEB 4KQHA 4ENSA 1K1EA 3UXHA 2FVGA 2XQKA 2WIDA 3D81A 5ER6A 1VPLA 1UKEA 5EZYF 1K6MA 1RZRD 4M1EA 3GJQA 2VHWA 1Q7YD 2P2ZA 5B3JA 3ZVKA 1K4YA 5F7ZA 3ZCRA 2WWHA 3U3MA 4TRRA 1J8VA 2QQEA 4J1TA 3REOA 3TB4A 1OIXA 1DARA 3A1VA 3MUOA 5KJ6A 2CNNA 1HNWB 1PZGA 3H5WA 1NW8A 2J3MA 3VZSA 3IE1A 1MZPA 4J49A 1KSGA 1VIMA 4F3NA 2GPNA 2NO0A 2JBHA 3BFXA 1CPYA 1D4ZA 1KIMA 4P31A 4S1NA 1L4NA 1PG5A 1AXGA 3UJCA 3CNNA 4CMBA 1H4SA 4HZIA 5FCDA 1HYQA 2GCNA 4W5WA 3COJA 5FQNA 3PQ5A 3FDJA 4F6RB 4ZV7A 1MQSA 3V1TC 5J4YA 2SCUA 3DDZX 4E12A 4D02A 1XMQB 1AV7A 3DOJA 4G5GA 1GZDA 1N6RA 4WESA 1V0EA 4WSOA 5JAZA 2FN9A 3LRTA 4P36A 1Y1LA 3LF1A 1PGNA 1UJ6A 1RHUA 1XRRA 2ZG6A 3P8ZA 2AR0A 2RK3A 4KPGA 4U6SA 4XTRA 5FNVF 3MF4A 3RS4A 1A9XA 4V1CA 3ML1A 2YOGA 2QPTA 3OESA 2F3SA 1KY4A 1QHHA 3HR4A 3HA5A 3NHJA 4FSHA 2DPGA 2X9VA 3R8XA 4BLOA 1R6BX 5KC9A 4PRZA 1G6OA 2VBUA 2I33A 3S70A 3PYMA 1OV4A 2O3TA 3VPDA 3R3VA 2BZ1A 2A30A 4JSTA 4L76A 1E92A 2JI9A 3A6HA 5JAIA 2BH2A 5LPNA 4IDQA 3IAXA 1EU1A 3M9WA 4GG1A 5IDXA 4AZSA 3A8IA 3D6TB 3DE2X 1OKKD 2IP4A 2CLCX 3OPNA 4Q9KA 1OTXA 2W9XA 2D3TA 5I8ZA 5SYAA 4DAOA 1NQAO 1FVOA 1UMBA 3ORHA 4QQFA 4DR1B 3KT6A 2IXGA 2LPMA 3JQAB 4IDOA 4Y2QA 2IYVA 1NJ2A 2CT8A 4P9SA 3Q5DA 2Q3LA 2Q6LA 1R12A 2IXEA 3RVQA 3RUAA 2V4DA 3ODGA 5AFSA 1NNEA 4ARIA 3D64A 3ZPNA 1IY8A 1WQ3A 4PTZA 3KOXA 4IIJA 4NCJA 4DSAA 3ZCSA 2CRVA 1GZ7A 3F3MA 2HMTA 4WZTA 3OX3A 3PHGA 4RM3A 4ZVTA 4MVYA 4Q24A 5DXFA 5CHYA 3H2GA 3U4QB 3UAWA 4XSGA 1J2JA 2F1IA 3VOBA 3RJ5A 3FLBA 1EK1A 2PJDA 3K5PA 5AW2A 2BFCA 2PH3A 3BWBA 3KOYA 3WIVA 4PGAA 4DA7A 1TJYA 3DFUA 3LGSA 13PKA 1MF7A 3O1HB 1DKMA 2RHGB 3TKAA 2Y1GA 1JFFA 2QN8A 4LYJA 5EN4A 1WVGA 2G4LA 3I8SA 4P5EA 4O4HA 3I1FA 2WEKA 2IPLA 4QXAA 1L4KA 1IIRA 2WVJA 4R2WA 3WGGA 4BNNA 2QN3A 1E60A 1FTGA 4MV9A 4AS2A 1KZGB 1J99A 3K3PA 3SLRA 5FLKA 4E51A 1NW4A 3C24A 3FOCA 1Y34E 3WYEA 4BO2A 1WORA 3V4FA 3O38A 3AHIA 5AVOA 3A4YA 3ZY5A 4DUPA 2R6DA 1WMFA 2KS6A 1NJ6A 4XCQA 1XD8A 4O29A 2IW1A 5BN4A 1JG1A 1N07A 4UDNA 1MOQA 1H2HA 3I1IA 3HY4A 3Q2IA 3WHLA 5CB4B 4UUQA 2G80A 3UT5B 1BE6A 4OA5A 1IMJA 1E2DA 3AEQA 1G9TA 2L42A 4MTLA 4R54A 1R16A 5IDYA 5JS8A 4BVLA 1FUKA 2O7NA 2IHTA 2BBWA 3BDAA 3IV7A 3LY8A 4A82A 1V95A 3HR8A 1RRCA 1M83A 1XALA 1ZNXA 3MGGA 2OQVA 2PX6A 4FDTA 3TSAA 2FDXA 5FPTA 4KDFA 5HIKA 1NUSA 2YV1A 3SXJA 3TN7A 3CCQB 1Y1QA 4I81A 5GVRA 3EC7A 4X8LA 1ONPA 3JW8A 4N4AA 4H7KA 3AOEA 3ENQA 5FUBA 5LP6F 3NKLA 1YX2A 1JMKC 2ZBDA 1LW7A 1U3TA 1P7WA 1N57A 3GWGA 4M36A 5C37A 4KLRA 3WMWA 4PLZA 4CF6A 5D3QA 2F59A 4HPWA 3VYTB 2PE5A 2F17A 1RKBA 1J0EA 1QYDA 1TOAA 2MCFA 5A5DA 5IFKA 5JFOA 1C41A 3ZOZA 2IRWA 4RCVA 1DINA 2XGSA 1QC5A 4DPMA 2FW0A 2C84A 3ASTA 2WNSA 1YQUA 3JYNA 1Q7EA 2CB0A 3O75A 4QUDA 3JZIA 3A10A 5LYJB 2FSSA 4K6HA 4YPOA 3T15A 1KC1A 3KSDO 2C5GA 3PGJA 4MX8A 4B8ZA 5EIFA 2LZJA 4FX5A 2PH7A 2JLCA 2HCJB 2GF9A 1A2KC 1NI4B 1UBMS 2VSQA 3AHFA 3JATA