2DCUA

Crystal structure of translation initiation factor aif2betagamma heterodimer with gdp
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
407
structure length
407
Chain Sequence
KTRQAEVNIGMVGHVDHGKTTLTKALTGVWTDTHSEELRRGITIKIGFADAEIRRCSNCGRYSTSPICPYCGHETEFIRRVSFIDSPGHEALMTTMLAGASLMDGAILVIAANEPCPRPQTREHLMALQIIGQKNIIIAQNKIELVDKEKALENYRQIKEFIKGTVAENAPIIPISALHGANIDVLVKAIEEFIPTPKRDSNKPPKMLVLRSFDVNKPGTPPEKLVGGVLDGSIVQGKLKVGDEIEIRPGVPYEEHGRIKYEPITTEIVSLQAGGQFVEEAYPGGLVGIGTKLDPYLTKGDLMAGNVVGKPGKLPPVWTDLRLEVHLLERVVGTEQELNVEPIKRKEVLLLNVGTARTMGLVTALGKDEIELKLQIPVCAEPGERVAISRQIGSRWRLIGYGIIKEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Translation initiation factor 2 gamma subunit
publication title Structure of archaeal translational initiation factor 2 betagamma-GDP reveals significant conformational change of the beta-subunit and switch 1 region.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Translation
total genus 87
structure length 407
sequence length 407
ec nomenclature
pdb deposition date 2006-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
A PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 2dcuA02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 2dcuA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2dcuA01
4BLPA 3MWLA 2F7SA 3CCRB 1QHSA 1GO2A 2WICA 3U3OA 3TGPA 2ZUBA 3B9PA 4GMXA 1GTVA 4C0SA 3EWSA 3HPQA 2W6JA 3IUYA 1II8B 1P5ZB 1W5SA 2AK2A 2RAPA 1ZM2A 4LX0A 2RB4A 5EP2A 3WMFA 2YNMA 1KI2A 2OG2A 3L0IB 4RY2A 1G4UR 1I4LD 1U99A 4BEBA 1TL7C 2G0TA 1XEFA 3P20A 2FPMA 1KI8A 2IL1A 2C78A 3QKRB 1P62B 4B3FX 3CRQA 1RRFA 3QXHA 2DERA 2IA5A 1X1RA 2OHFA 5DI9A 3UG7A 2GJ8A 3EA5A 3Q9LA 1N6IA 4LZZA 1IOZA 2GBLA 3JZAA 5DYGA 2VHUA 4GNKA 3EIQA 3S1AA 4YLGA 4D25A 1JI0A 1NMXA 3UMSA 1K8RA 4W5HA 1MR3F 2C77A 1Z6TA 1DO2A 3LLMA 3ICQB 3IBYA 5J4HA 2DB3A 1P60A 2G88A 3VR5A 3LQRA 1SVWA 2DWQA 2ZSDA 3FPAA 3PJRA 1QX4A 4LJYA 1KZGB 1LY1A 3WMEA 4R7ZA 3ASZA 1BIFA 1N2CE 1R8QA 1XBTA 5LD2B 1JALA 3OAAA 1DAMA 4RFVA 3A1VA 3ASYA 4NYJQ 4GBMA 4TQ9A 1G4AE 4M1WA 1YZTA 2JDID 3VX3A 1KJWA 2OFXA 3AB3A 1KQSB 2QRZA 4IHQA 4U9UA 3NBFA 5JFGA 1GR1A 2ZYTX 821PA 4RD4A 3BFVA 2PJZA 4BGDA 1XCGB 3MWKA 4TMXA 2BF4A 1JR3A 1FTSA 1V43A 1BYIA 3MWYW 2J3EA 1UKYA 1AQUA 5F2EA 4Q48A 4D81A 3W8NA 3WMGA 3CR8A 4KSCA 1KI3A 1MO6A 2ZTSA 1KSJA 2XZPA 4AKIA 1G8YA 4UNQA 1G18A 4I1OA 2ZU6A 3B1YA 1Q3HA 1P9RA 2EIXA 1OXSC 2BN4A 4JLKA 3HR8A 4HLUA 2QAGB 2IF2A 1X86B 3UANA 3B1WA 4Z1MA 4BFVA 1DE0A 4DLTA 3E70C 4G5QA 4KFSA 5EP4A 4YAFA 2BMEA 3O8CA 4MDEA 4NTZA 2ZIAA 3CRVA 4H1UA 4CYMA 3BE4A 1VQMB 1ZUIA 1DARA 1G3QA 3CXCB 3E5HA 3JQPA 1EFRA 3LWNA 2Z43A 4UJ5A 3UKDA 4YMUA 5UKDA 1IY1A 1EGAA 1SM4A 3GJ8A 1XCMA 4HAZA 2YKGA 3EAQA 1U2RA 2HEIA 2ZE5A 4Y0AA 3MUFA 4HZUA 3DM5A 5FR1A 5AK0A 1L4YA 3KJEA 1E2PA 4R2IA 4RFSA 4DSOA 3K0FB 1ZD8A 2D06A 1CBUA 3NBXX 3KL4A 2PEZA 5C18A 2CK3A 4A15A 4RVCA 3CC4B 4JZKA 2QTFA 4A0GA 4ZIRA 5EXXA 4B33A 2O8FA 4GL2A 4OHXA 1ZINA 2AWNA 2FSHA 4MGIR 2EFEB 1LTQA 2BMFA 3NIBA 1BQEA 3CB4A 1FDRA 3NHAA 4HAWA 4C3ZA 3GLIA 4QG7A 3SE0A 4DT1B 1E9BA 3CPWB 1ZVQA 2DY1A 5L3SA 621PA 3FPKA 4HLQB 4MYTA 2X2FA 4RD6A 2X1VA 4DSNA 1N5IA 4LV8B 5DO9A 1YQTA 3Q8XB 2J46A 1KI6B 5HZHA 3MWJA 2B5OA 2EYUA 4WXPA 1E0AA 3KB1A 3CRMA 3E1SA 1KI4A 3IILA 1E2QA 2KSQA 4NCHA 1BJKA 3RAPR 2A5DA 1E2IA 2DWPA 3H4MA 2EFCB 5FBRB 5JEDA 2IXGA 1NLYA 1Q21A 3PFIA 2FEOA 3W3AA 3K0EA 5HE8A 2J7PD 5FI1B 2FX3A 1VCNA 3M1IA 4FMDB 4DLYA 4DB2A 2CLSA 4AI6A 4ZDIA 4M0LA 2F1JA 1W2HA 4Q02A 3WHKA 4JYBA 2QMEA 3ZYCA 2RH5A 1XE1A 2BGJA 3CCEB 4E07A 3D6TB 5EUQB 2OILA 4M9XA 4P0TA 3VTKA 1PLKA 3U3RA 4GZLA 3FMIA 1QVFB 3RWMB 4KHZA 5BYJA 2V3CC 1COWD 3IHWA 1CJUC 3ZH9B 2WWYA 3WP1B 1E32A 4RKFA 1XXHA 3MJHA 1XEXA 3IPXA 4G5RA 2WJJA 1M1YE 2BHRA 2IYSA 2CHGA 2B92A 4L8GA 4EPTA 4ZDKA 2ZRDA 2GXAA 1R4AA 4NL4H 4C43A 1S1CA 2RGCA 4LHYA 2JASA 3OEEA 4Q1AA 1LF0A 3BBPA 2WZQA 2XAUA 2F55A 3B2EA 3WHLA 1IHUA 3DVLA 3EWAA 5AJZA 4V0ME 4XTRA 3CKLA 3T12A 4ON9A 3OJWA 1YJNB 3QFSA 2IHBA 3AV0B 1NN3A 2A9KA 1F6BA 1NP6A 1Y63A 1EXMA 2D7CA 2HV8A 4EPRA 1XX6A 3BIFA 1DAFA 4DRZA 4KVAA 2B8WA 1KD1D 2NMVA 1U8AA 1VQKB 2WWWA 4KVGA 4FCTA 1YZGA 4ASUD 2ZSFA 3K1JA 1VQPB 1Z07A 2JGNA 1YITB 1A5TA 1E0SA 3AF0A 1Q0UA 1Q3TA 4OQLA 2QA5A 5G53C 3VMFA 5J4LA 1UBFA 4ESVA 1GNRA 1XMVA 1CJVC 2ODWA 4RZUA 4AD8A 2ZR9A 2QMHA 2W0SA 3HYRA 2AD1A 4HLDA 5KSPA 1W4AA 1XD2A 2JIZA 2JLYA 3EXAA 4XJXA 4TYWA 4DLVA 1RPZA 1DDIA 3RHFA 3CMEB 4NONA 3AF4A 4B35A 2XSZD 4TT3A 4YXWA 4U00A 1CR0A 5GJVC 4NYIQ 4BLSA 1K5GA 4MRPA 3QPWA 3ZIAA 1SVLA 2OBNA 4QRHA 1NBMD 1XP8A 1WDTA 4BFSA 4M2LA 5IDVA 2YVUA 3QF7A 2ZQ5A 2O0JA 4LSGA 2QQEA 4Q4HB 3UIEA 4RD3A 4BQSA 5B30A 1V5WA 1Q22A 2OT3B 2WMNB 3CF6R 3U7EB 3IQWA 4A0FA 2Q21A 3QFCA 1BMFD 1F2UA 4B3BA 3HU2A 1HQYE 3PUVA 1OXTA 1KGDA 2WJHA 1GRNA 5LD2C 1WXQA 1R0YA 4QM6A 1QRAA 2FFHA 4DDWA 1T3LA 1XNJA 1E2GA 2QBYA 1EESA 2NOAA 5FL7D 4DB4A 4B44A 3B9QA 1WBDA 1ESMA 2CRVA 4QL3A 3U3MA 1D6JA 5AWFC 1E62A 4IDOA 4BZPA 2D74A 3K9HA 1CTQA 3EC2A 4DLZA 3ZZUA 3LFUA 1N6OA 1YHQB 2E87A 1MT0A 1Z28A 1XCPA 3MG9A 3N70A 4CEIB 2RGNC 1E2DA 2VBCA 3OZVA 2NO7A 2P67A 1RRCA 3UK6A 2O8BB 3IBGA 1XU4A 5JS8A 1W44A 2QTLA 2DFTA 2C95A 1A82A 3LD9A 1EFHA 1G3MA 3T35A 1WA5A 3U60B 4C0KA 4LHVA 1OH7A 2OCPA 3N5CA 1SVIA 1Z6XA 4NYJR 4KYUA 8OHMA 2OESA 1IJFA 2PZFA 2O8DB 3I8XA 3A58B 1T4GA 3ZQJA 3R9WA 2JJ2D 1E9CA 3TVDA 3A1TA 3OIWA 2GESA 4OQMA 3RWOA 2FU5C 5CYOA 2IYRA 4YAWA 1GZSA 1PJRA 5FPTA 5KNCA 4JL8A 1M8PA 1ZUNB 1GVNB 2CBZA 1E3MA 3M0EA 2NO9A 1EWYA 3MD0A 4LPKA 1JJVA 3W5VA 3B82A 2A5YB 2YC2C 2IHYA 1XTSA 4B48A 3GJ0A 4I4LA 2GTPA 2GXQA 4B43A 1VG0B 1XTJA 5JZVA 2P6UA 1EWRA 4B3XA 1F3OA 1M6NA 2VEDA 2CL7X 1GRRA 1GAWA 4DBLC 3Q72A 3U7FB 4CGZA 3GFOA 4PPQA 2QAJA 4H1VA 4R71A 2JLZA 3MCAA 4AYTA 5FUYA 3AKEA 4TYQA 2NZJA 5HZKA 2A3RA 3Q7PA 2D2FA 3AVPA 3KKOA 4RZ2A 2R6DA 4EAQA 2CHVA 1TQ6A 2JLSA 3BS4A 1ODFA 1GILA 2G83A 4MGZR 3UG6A 4U02A 1JXMA 1QVRA 1G6HA 3T15A 3R9IA 3NXSA 3A4LA 4IOLA 5KSWB 5B58C 3THXA 4FK8A 3G82C 2YJTD 5D3QA 3EX7C 1HE8B 2QGNA 1S0UA 2ZROA 2IUUA 4Y9UA 4JS0A 1Z2AA 3C4JA 4OHZA 5E95A 3FGNA 3ICEA 1SXJD 5E7MA 5KHOC 1FNBA 4Q4AA 4XVRA 2YC4C 5AJWA 2IYQA 1P4SA 1TF7A 1MOZA 2XNSA 3KXKA 2QT1A 2XJ4A 1IN4A 1FNCA 1GP2A 5J5CA 3BC1A 4AF6A 1CULC 2F3RA 3EC1A 4P4TA 4QHTA 4B3GA 2PZGA 2VP9A 3GLIE 4ILEA 4JBXA 3KKQA 1AKYA 5EMNA 4RCZA 4EH1A 3ZVRA 4GP6A 4EPVA 3CNLA 3U44B 1A4RA 1SVSA 3IDQA 1VIAA 3WRYC 3SZRA 2AN9A 3AH8A 4TMZA 3TSZA 3BB3A 1NN5A 3L0SA 4NE2A 1ONBA 4DUGA 4P3YA 1KK1A 5FUXA 4RZ3A 4B34A 5KNBA 1UF9A 3FDIA 2IYWA 4JKYA 2IF0A 3VR2A 3ES9A 1XTRA 5D3MA 1G9XA 4Z8XA 2CE7A 3LW8A 1JJ7A 4B75A 4I99A 2J0UA 3ZD7A 3PEUA 1N8RD 1KK0A 4HZIA 3LVBA 2WTUA 3IGFA 2IX3A 5TR9A 1H8HA 4Q7JB 2BMJA 3GLHE 1P2VA 3REGA 1D2NA 4Q00A 2BM0A 1EFUA 4W5WA 1B0UA 4G1BA 5AJYA 1K9MD 1E79A 3PG5A 3K09A 4EJSA 2OCYC 2YZ2A 2Z4SA 5JWRA 2BJWA 3IQXA 3AVYA 4E09A 3AF3A 2WKPA 3NEYA 3NEJA 4DC9A 4KBFA 3LV8A 2H18A 3W2GA 1Y3AA 3K70C 4M9SA 2C9YA 5AUOB 3KQUA 2HXSA 3QKUA 2UVQA 4UNRA 3W9YA 5EUMA 1CXZA 1XXHE 4LC1A 5P21A 4QHSA 4OHWA 2XJ9A 4K81B 3FKSD 2R62A 1E9RA 4N0EA 3BWDD 1W46A 3DKVA 2ZR7A 2C5LA 4C0QC 5BQ5A 4MRRA 1D1NA 1NLZA 1OKKD 1FP7A 4Q01A 1XPUA 1WMSA 2PLRA 3TLXA 1QZXA 3QE0A 3LRPA 1F48A 4Q9IA 4XWKA 4M21A 5KUTA 1XJCA 3PIRA 4HB4A 4U7DA 4W9MC 4US0R 3I61A 3CCJB 5TY0A 1DEKA 2ZSEA 3THYA 4GOXA 1KDPA 3T61A 1XPOA 1OFIA 1KRHA 2EFGA 1G8HA 1N6LA 4QJ3A 1VQ8B 1JEDA 4A36A 2Q9AA 1HTWA 2D7DA 5HE9A 4US2R 3SFZA 1JNYA 1KK2A 5JJKA 4HDOB 2OK8A 3PEWA 3SJAA 1XD9A 1NY5A 4KSBA 2PL3A 1ZNYA 3H0KA 5KOYA 1KO5A 2ZRHA 3QNUA 4YMTA 1VKJA 4PZLA 3I32A 1UDWA 1D9ZA 2JJ8A 1R7RA 3VKGA 2BDTA 1QFZA 4TL9A 4PAOA 5IK2D 1NVXQ 2GETA 3SS8A 1HT2E 1RJ9A 4RD0A 4PGOA 1Z47A 1VYTA 3DZDA 4CW7A 2GCNA 1E63A 4X8OA 5EE3A 4TMTA 5H68A 1W4BA 2GZDA 3UWOA 3HJNA 2DYKA 3K8YA 1SXJE 1NDHA 1VYVA 3GJ5A 3W2FA 2WPDD 4XVQA 1FRQA 1R8SA 1XMIA 3CW2A 2KE5A 2VSXA 3QF4A 4TLEA 2P0EA 1QG2A 4MGKR 3F0TA 4G1UC 4JT2A 2QU8A 5K8UA 2SHKA 2BPOA 1L4UA 4IEEA 4LWZA 4AY2A 2CVFA 1KY3A 1HQCA 1TQ2A 3N2IA 4BRWA 2HT6A 2ZRFA 1GG2A 4KYIB 4BRUA 2ERYA 4LUCA 3W5HA 2R44A 3FVQA 3GEIA 2NO6A 4MRSA 1J7KA 5E4FA 2QPTA 4O3MA 3THWB 2OFWA 1QHIA 1ZM3A 2JA1A 1CJKC 3CPJB 1JAIA 4TWZA 1KNQA 1ZJ6A 3T1OA 3BAFA 2JDIA 4DLUA 1GFIA 3RVBA 4V03A 3DM9B 1GNPA 2ZVQX 2CL0X 4HUQA 1D2MA 3A6PC 4LK2A 3DDCA 3HPRA 3ZGXA 5F3WB 3AP1A 4PPGA 2WSSD 5J47A 4LHWA 2ORWA 1UADA 3QKRA 3NTUA 3H84A 3LW7A 2ZI4A 4B32A 3NBYC 1WP9A 2GILA 3BH0A 3CIOA 3EZ2A 3FFBA 1M2OB 2BBOA 4LJ6A 1XMJA 4B4DA 3GMTA 2ZEJA 2GZAA 2RGBA 4CEJA 3IIMA 5CK5A 2PCJA 4G0NA 4Q03A 4YONB 2JLQA 2RGAA 4Q5IA 2OCAA 1YZNA 3FMOB 3SFVA 4O2LA 1NVVQ 1NRJB 1ZCAA 1NIJA 4A8JB 1QHHA 4LJ4A 1W0KD 4B73A 4CVNA 3U4QA 4HAUA 2CNDA 1G17A 3QXCA 5DHFA 3AGPA 3DOFA 1E2MA 1P72A 2VF7A 3NH9A 2V54A 3HP1A 3M6AA 1XDBA 2WWGA 4GOJA 2CXXA 2F6RA 1IBRA 3KJHA 3B60A 2QDXA 4Q1BA 2ZI6A 3A8TA 1AMOA 2R6HA 2ZJOA 4Q7MB 5FBQB 4Q47A 5DSZA 4D2IA 3FB4A 3HU3A 2CLDX 2O8CB 3KQKA 1N0VC 1W87A 4M4SA 1TQDA 4X8HA 1YJWB 3DZ8A 1M7GA 2WIAA 4WAUA 2QTZA 4PQRA 1KSHA 2KWIA 3I4LA 3TW4A 4AYWA 1AZTA 2BSAA 4AYXA 2V1XA 2ZS9A 2ZANA 3PUZA 1B2RA 4G5OA 3IIJA 4DLRA 5JJLA 1CJTC 3W3ZB 2FGKA 1K73D 4PSVA 1NMYA 2I3BA 1FNNA 4XVUA 4M8NE 5KTYA 2HCBA 2Z0MA 2ZRGA 1UPTA 1JEEA 2GDJA 4D4KA 1NSFA 2EW1A 3OESA 4KLNA 4QJ5A 1TU3A 5GJWC 4F91B 4D26A 1N25A 4JT4A 1U9IA 1T5LA 1EFTA 4EPWA 1GNQA 3QIAA 1W48A 3A1SA 4I1VA 4NHOA 5DN6A 4ZI2A 1UKZA 5C4MA 1TPZA 4IDHA 4FMCF 2CE2X 2WJYA 4KAXA 2AD5A 1EX7A 2IYLD 1W0JD 4WIAA 2IW3A 1WBBA 3UWKA 1O3YA 4C0JA 4LRWA 1TF2A 1NSTA 2AX4A 2V7QD 3SJBA 3OEHD 1QHNA 2OSBA 1VECA 4A2WA 2W58A 4C30A 2YWEA 1Q81D 1F2TA 4TLDA 2H57A 1C4OA 4PANA 4O25A 3ZVLA 1ZW6A 2XXAA 1T0HB 3VNUA 2AR7A 3QI2A 4JSTA 4MUAA 2OXRA 3C14C 1Q20A 3NVAA 4A2QA 2ZRNA 1FNMA 3LVRE 2D62A 5BXQC 4UXIA 2DWOA 2XX3A 2IUTA 4A0RA 3ADBA 1X3SA 1MO4A 3P26A 4N0DA 1P6XA 2X8AA 3CC7B 2ATVA 3RABA 4ZCIA 5EZ5A 3ZLJA 2J7PA 3BOSA 3ZDQA 1AM4D 2OAQ1 4A9AA 5FUWA 1P61B 1U90A 5FUVA 3WBKA 4OQFA 4LBZA 2O8EA 1AA9A 1VHLA 1QVAA 1G7RA 3TE6A 3SC3A 1JA0A 3X2SA 3C15C 4TSFD 2IWRA 5SZHB 4HB3A 4MYCA 1OXUA 2CVHA 1COWA 3IHLA 2QRNA 1E96A 2IYTA 3CX7A 4A4DA 4LJ5A 4XSGA 1CJMA 4BFUA 1ZNWA 1CLUA 4IVRA 2Z4RA 1SHKA 3QEOA 4IDQA 2QM8A 4V02A 4LYFA 4DLXA 5FTJA 1II9A 4CEJB 2XNJA 2R6CA 2G3YA 1FUUA 3Q85A 3QUSA 4IKEA 1IQPA 1YHNA 3AVQA 3HWSA 1CF4A 2BM1A 4R98A 1RRGA 1QFJA 3REFA 4D4MA 3GLGE 2MSDB 4WXRA 4HSEA 2A7QA 3ADKA 3MJRA 4US1R 1FOEB 4BFYA 2FOLA 5FOTA 2B7CA 2IC5A 3WNCA 4LHXA 1M7BA 3V4RA 4MYUA 1CKEA 1KIMA 1TAGA 2WIBA 4B3DA 2XZOA 3QVVA 1ZMXA 3S1AB 2F9LA 2CJWA 4ASUA 3TK1A 1U98A 5EE0A 1OF1A 4LBWA 1LS6A 2PT7A 4QBHA 1S96A 3AUXA 1KO8A 2QZ4A 2KBFA 1GOTA 221PA 4YMVA 2XITA 4OI2A 1WRBA 2GQFA 4D4JA 1Q1BA 3AVOA 1G7CA 2ZUDA 5ANRB 3B7GA 4B6FA 2ZRLA 3E1YE 4MITA 4JLVA 1QGZA 2VZLA 1G8PA 1Z3IX 3K0CC 3TQCA 4NU0A 4DSUA 2QMOA 1G64A 3ONWA 1MKYA 721PA 1R5NA 4CIDA 3I5XA 2XSZA 1OXVA 1NVUQ 3KQLA 1CQXA 2J59A 4MKFA 4MDFA 1XEWX 3B1ZA 1Z0FA 4M9ZA 1D5CA 4TL8A 2J5XA 1NBMA 3KTAA 3JVVA 3K09C 3X1ZA 2ZETA 2MMCA 3A1UA 3CF0A 4S2EA 2AWOA 3RSLA 3AVTA 1AS3A 3TKLA 1US8A 1ZP6A 3D7MA 3LBIA 5KSZA 5CJPA 5BN3A 1PLJA 1BMFA 5DGXA 3BH7A 1FNDA 1VCMA 5L3QA 2GXSA 2A2ZA 2FFAA 2OE2A 2VLIA 3BH6A 5AN9A 1VIYA 3R20A 3LNCA 1NNEA 1VQ9B 2C98A 3KXLA 1TUIA 1OH5A 2HDNB 1Q44A 3GLHA 3G71B 4NYMR 4Q18A 5THXA 4FD2A 4YDHB 2GRJA 2RKOA 2J9RA 2OCBA 2QSYA 1KK3A 2OZEA 3L82B 4ZGQB 3CCLB 1ZC4A 2QSZA 4MYHA 1TF5A 4Q21A 5CK4A 5FL7A 3RNLA 6Q21A 5CJ2A 1RC8A 4P4UA 1WF3A 1R0XA 4JSYA 1SHZA 5DH9A 2YWHA 1Q82D 3X1YA 1QVGB 3LX8A 1S1MA 2VHJA 2OTLB 5HCIA 4F4JA 1MH1A 4WQMA 1FL9A 4QOSA 2X2EA 5HCNA 4D0NA 5JCZA 4DLSA 1EWQA 1MO5A 1H8ED 4XSHA 2GEDA 3CPHA 5JHGB 3CH5A 3AGQA 5AJXA 2OXCA 4PXAA 3EIHA 3VU9A 2ZYWX 3QKSA 2VA8A 3SOPA 2ZREA 2KJQA 3PUYA 2QE7D 4A8JC 1CEEA 2GVDC 3AVXA 5G40A 4DHEA 4C0AC 1C9KA 2JJ2A 2ZM5A 1FUKA 4HZUB 1OIVA 3GJ4A 4XIGS 3K70B 3OZUA 4DVGA 4C7OA 2D3WA 4JLAA 4RFSB 1ZBDA 1DPFA 1ZIPA 2X77A 5JI3E 4UXJA 1ZM4A 4EKDA 3CNNA 4ZKDA 2Z5FA 5IHPA 1QG4A 3QJYA 2F43A 3CLVA 4ZIRB 2HLDD 2O8FB 3B78A 3W5UA 3B8HA 1Q7YD 4PX9A 5LDDC 1PLLA 2IEYA 3GLIB 4W7SA 5KDDA 3Q7QA 4CF7A 4DCTA 4X8LA 3OZWA 2JJ1D 2WOOA 1KKLA 2QNRA 4CEIA 4Z51A 4IFBA 2QEXB 4JLOA 1KI1A 1I7PA 4EFMA 2XB2A 5L3SB 4A82A 2W0MA 5CB8A 1SVOA 5IF9A 1RFLA 2O8BA 1DAEA 1RIFA 2CNWD 2G77B 2GAAA 4KI0A 5EXPA 4RJLA 2ZI3A 3VX4A 3W6PA 2IS1A 5H59A 2K5UA 3FHOA 4TLAA 3U6BA 2PX0A 3FJOA 1E9AA 1JECA 2VP2A 3IIKA 4LC0A 4PHHA 5FFMA 3SBEA 3U7GA 4GDFA 5L3RA 3SJZA 1R5BA 4AF7A 4KV9A 4GFDA 5F9HA 4PHGA 5JS7A 2ZJBA 1G3UA 2MSCB 2V6JA 3TMKA 2C99A 2DHRA 3GLFB 3K70D 2HF9A 3L8YA 1NIPA 4M53A 2PEYA 2RHDA 1A2BA 2JCSA 1SXJA 4B76A 1W36C 3KKPA 1BYUA 4ZGNB 2OTJB 1MABA 2WV9A 5DYIA 3KQHA 1QGYA 3EPHA 3W5JA 2ZI9A 2W2TA 3AEZA 1UKVY 1F60A 4UJ3A 2BMDA 4Q9KA 4G5GA 3JVUA 4JKIA 4B71A 1GKYA 1HE1C 3I8SA 4DCSA 1OJLA 4LYHA 5EP1A 1OB5A 3TJZA 4BLQA 1KAOA 4FXPA 1S9HA 3G5UA 2FN4A 2P3SA 3CR7A 2Y8EA 2ODNA 3K9NA 4IOJA 2L0XA 5CLLA 1A7JA 1AZSC 1QG0A 1XXHB 4LYAA 1M90D 1XEXB 4MGYR 3VKHA 3GEEA 1E2NA 4Q4JA 1E94E 3AKDA 3AVUA 3R7WA 2PX3A 2QM7A 2J0VA 2Q9BA 5KU1A 1G7SA 1Q1ZA 3P32A 4CEHA 4OJQA 5DE3A 2GF9A 2OEPA 3GCGA 1IJEA 1NF3A 2YHSA 2FGJA 2OO7A 1N0UA 2ZUCA 4OI1A 5JMTA 3LBNA 4HE6A 1S9DA 1AIPA 2B8TA 5FBLB 4TYNA 3KX2A 4QFMA 5TMPA 2ZXUA 1QUEA 3P4XA 5B2ZA 3U2QA 3V4FA 4PQYA 1YU9A 3VFDA 1CIPA 4WW0A 4I81A 2W2VA 1UM8A 2KB0A 1YE8A 1P2SA 3SEAA 4PZZA 1ZIOA 1OFHA 4AG6A 5FI0B 1IN8A 1OHHD 3PEYA 4GPTA 1Z0AA 2MSEB 1LW7A 2G9NA 2FE4A 3BXZA 2OAP1 4UKDA 3K53A 4C0HA 5GVSA 2ZRKA 2J0SA 1SULA 2WKQA 1GWNA 2H7VA 2XNDD 4D80A 4ACAA 1N6PA 2BGIA 2VSFA 4M1SA 3E2IA 4QBGB 5DLQC 3DPUA 4XH9B 1DS6A 1XD2B 3CZPA 3ZVNA 4PC2A 2G6BA 3RSOA 3WNBA 3HDTA 4UNNA 3AUYA 1OGJA 3RS4A 1Q86D 3FKSA 1Z29A 1U9IC 3MSXA 5FPKA 1RRPA 3AQ4A 3LBHA 3C41J 4ZCLA 4OK3A 5FOXA 4F93B 1OKKA 3T1QA 2GBLC 2ZE8A 4TQAA 3MMPA 4HUTA 3A36A 2ZRBA 1E2EA 1YZUA 5L3VA 3OE7D 4BLTA 2ZRMA 1U94A 3SQWA 4KU4A 3L0PA 2LKDA 4C9BA 1XZQA 2W00A 2RHMA 2C9CA 1AN0A 1F2UB 2GNOA 1QHXA 3RRNA 2J41A 4DLWA 1UMKA 2XB4A 3G0HA 2I1VB 2BWJA 2O0KA 3TH5A 4W5JA 3TR5A 1FX0A 2EYQA 1KMHA 1ZD1A 4URWR 4L15A 3QOFA 1BO6A 4EFLA 5JECA 3I56B 3NC0C 4HDQB 3JZMA 2GA8A 4ARZA 2NG1A 4LDJA 2EVWX 1XRJA 3UMRA 4OQXA 2NZ8A 4C2TA 3W90A 2J0QA 2FDCA 1YR7A 4KFTA 2P6NA 2GJSA 5SZJA 3C5HA 4PC6A 1E98A 2FF7A 5DHAA 2QORA 1IN6A 4HI0E 5A4JA 1Z0IA 2JAQA 4IW3B 1HY3A 5IK2A 5DI3B 3O47A 2YOFA 4WOPA 2ZRIA 1Q57A 5E7IA 1Q1EA 4F4CA 4Q1DA 2ZRCA 3H2YA 4PAQA 2WKRA 1Q1QA 1NBME 2HXYA 4PTLA 1I4TD 2ZE7A 1G7TA 2N42A 3G6EB 4NP6A 3ND8A 4NCJA 1W35A 3NDBB 4JJKA 2WPDA 3I62A 2VIIA 4KFRA 2XGJA 1CRPA 5JBQA 1YKSA 2ANCA 3W6NA 4F92B 1OLOA 2OLKA 3EASA 5CYPA 3RS7A 3FKQA 4PZYA 3VKWA 4HLUC 2VNHA 4K1XA 1NMZA 1I4DD 3FMPB 3GJ3A 4MUBA 3EW9A 3RDPA 4LY6A 3CCUB 5FTLA 4DWJA 3BK7A 1KYIA 4JVNA 2W6ID 4NDZA 4PR0A 4A6XA 1AK2A 2RGGA 3CWQA 3B85A 3OFND 4C0LA 3NG1A 3SYKA 1WE2A 3CBQA 2OBLA 1JB1A 3CMAB 4ERNA 2ERXA 4ZDWA 2FZLA 4ZI3A 4YC7A 4DIDA 4PAMA 4LJAA 5DNYB 1R2QA 2EU8A 2NGRA 3WY9A 1XZPA 2QG6A 1VPLA 2EWWA 3HU1A 4Y9RA 2VNIA 1BH2A 1OYWA 2GCPA 2RMKA 3VO2A 2VH5R 5DISB 2AKAB 2VYFA 2YINC 3GJ7A 1Z8FA 2WM9B 3GQBA 1JA1A 1PZNA 4OBEA 2PCLA 5EQTA 4BFWA 2WSSA 2ZJ8A 1ZM9A 3DOEA 1X1SA 3RANA 4Q1EA 3PUWA 4P6VF 5HR5A 4JLPA 4IXNA 4G01B 3VR3A 4D6PA 2EFHB 4R2HA 2BC9A 2HF8A 3TUIC 4KFUA 3GLGA 1G20E 5TVKA 4JIMA 3THXB 1N6NA 1N6RA 2FSFA 4N3GA 2RCNA 3DMNA 3QENA 5K8IA 1JB9A 1KDOA 3C16C 2QP4A 1RYFA 4J0QA 3J81k 1SZPA 1L7VC 3BFXA 1AQYA 2H5EA 3SYLA 1H65A 1W0KA 3K0AA 3ADCA 4TZ6A 1ZD9A 2IK8A 5FR2A 2DR3A 4URYR 1L8QA 2IWHA 2RGEA 1T5IA 1ZU5A 4XD7D 3GEHA 5FPYA 4TN1A 4MKHA 5CDFA 3PVSA 2PMDA 1VQ4B 2REOA 4JLNA 2F9MA 2H17A 4FMCB 2QI9C 1GKUB 5H1YA 3FHCB 1FRNA 4OK5A 1YIJB 3QG5A 4G3XA 2C8VA 1QH0A 4RKEA 1J8MF 5JSZB 5GJBA 4M9QA 3A1WA 2GJ9A 2REBA 3P1JA 1KDTA 1UBGA 2ASEA 4QHYA 5KPDA 4P4SA 2JLUA 2GEUA 2ZI5A 4BPBA 2JLXA 2AL7A 1RYHA 1TNDA 4S35A 3ZZ0A 4PHTA 5LB4A 3FTQA 2BBSA 5D3MB 4LBVA 1QDEA 2DBYA 1PV4A 2NTYC 1KJYA 5KDLA 2J0UB 3VR4A 3TBKA 1IXZA 1G5PA 1GAQA 4XWOA 4TYYA 2BIFA 4FW9A 2V8OA 3FMFA 1AGPA 4JMPA 3V00A 1Z6YA 2QUZA 2REXB 3B5JA 3CWZA 3F8TA 2HMAA 5HKKD 2R65A 4F38A 3I72A 4DCUA 5LBIA 4HAYA 4PSAA 3W34A 1L2TA 4MA4A 2PIAA 3E20A 4NYIR 4NCNA 2BCJQ 2ZJ2A 4TLCA 3B1XA 3HR7A 4EJSB 5KO2A 1NL3A 1Z0JA 3HYTA 4LGMA 1W0JA 3F3YA 3TAUA 4EQ6A 3KQNA 2NO0A 2ZU0C 3D31A 2ZYUX 2GCOA 4Q9LA 2V7QA 5FOVA 3OEHA 2IBMA 3U7HB 1VQ6B 3LAWA 3NKVA 4YMWA 5G3YA 5JRZA 1WQ1R 1HYQA 2XNCA 4GMDA 3EZ7A 1G5RA 421PA 5BW8A 3KJGA 4LBYA 1NKSA 4QNRA 2HCJB 1II8A 4LV5B 4Q7LA 5HTKA 3JQRA 2QP3A 3CCQB 4DDTA 1W2GA 4TTQA 3LVQE 4QGHA 2GK7A 1OXXK 5EE1A 1Z83A 3SJCA 2VHCA 1R0ZA 1HUQA 3TW8B 2AXNA 4TTRA 4EDHA 1J9ZA 1T3SA 1J99A 3T1VA 4OHYA 3THYB 1G19A 4HLCA 2GAOA 5F9FA 1EK0A 1TMKA 3A4MA 3L0OA 4UXHA 1N5KA 4WZ6A 4PHFA 4BE7B 2GXUA 3D3QA 4GT1A 4FWIB 4TSFA 5EXTA 2G1JA 4D0LB 3VNVA 2ZJZA 2AXPA 3GJXC 4TMVA 2ZS7A 3Q5EA 2YWGA 4BZQA 2PH1A 5GV7A 4EPXA 4PO9A 1KZ7B 4LPSA 5JEEA 3QFTA 2IYVA 3RRZA 1YR6A 1XD8A 4OK6A 1LS1A 4URUR 1KOFA 1M34E 3VR1A 1SXJC 2I4IA 1E1RD 4JLMA 2X3UA 3ECCA 2ONKA 3IKJA 1FTNA 1OE0A 3ZZTA 2VPPA 4LYJA 3LXXA 4GSYA 1RJ9B 4HAVA 4H9GA 1UDXA 1U0LA 4IJMA 3SHFA 1G6OA 3CCMB 4AURA 2OUKA 4CZ2A 2P5SA 4YALA 2WSMA 2DCUA 1YI2B 1K5DA 3R8FA 3FHTA 3MFYA 3KDSE 1VG9B 3KUDA 4NMMA 1J8YF 1XTKA 3KZ1E 4UQOA 4M1KA 3UATA 2RGNA 3DMDA 3PV0A 1KMQA 3QF4B 4B2PA 1QUFA 5FA6A 2NPIA 1G5TA 4B74A 2VP0A 1IN7A 3QE2A 1Z0KA 1FZQA 2A5JA 2FSIA 3BERA 4L9SA 1GIAA 1T3HA 4EIWA 3O8DA 4IEIA 2QMUA 4MRVA 3PXGA 1W4CA 1XTQA 3F5FA 4YMSA 3TIFA 4CT5A 1Q12A 2UZIR 4NCKA 4TLBA 2VYQA 3WBJA 3I3SR 2QAGA 4UAJA 4LI0A 1NI3A 1FMLA 1KI7A 1SVMA 4EFNA 4NZYA 4QJ4A 3FWYA 5IRCD 4ZCMA 2IYYA 4N1AA 1RKBA 1W36B 1NY6A 1RW4A 4RSGA 4HATA 3PITA 4KODA 4MQBA 5L8VA 1IXSB 4TTPA 4HUQB 1H85A 2R6GA 2ZS8A 2ZSAA 2BJVA 1N3BA 1XJ0A 2EWVA 4ABYA 5H8WA 2HJGA 4M1YA 4AG5A 1RE0A 2DFLA 3FYHA 2VF8A 3PQCA 1ANKA 3EA0A 1KKMA 3K9LA 1IM2A 1FPMA 1J90A 3VHXA 3KFVA 2JATA 2GEVA 2Q6TA 2FZ4A 2C9OA 1G8FA 4ZV4A 1KSFX 2BEJA 2WWHA 3QBVA 2F3TA 3K0FA 1BS1A 3O8RA 4PPNA 1IAQA 1EP2B 2ZE6A 1UAAA 2D2EA 4K46A 1OFUX 4F7DA 4HAXA 4HB0A 3FE2A 1EP3B 3KUCA 4JLDA 5DIFA 1M7HA 2R6AA 1QHHB 3U4QB 3CH4B 3Q5DA 2QTHA 4X8MA 3SU8A 3WP0A 2C2HA 1PUIA 5CITA 2HYIC 1CNFA 2IS6A 3RYTC 1OB2A 2FFQA 4GI7A 1FQKA 2VSOA 3DKPA 4HE5A 1NJID 1OT3A 2LCFA 3SHWA 4QGAA 1U0HC 3CO5A 4PC3A 3X1XA 2XOKD 1DADA 4DT1A 2CDNA 1KC8D 2ORIA 1A2KC 2CCGA 4QGGA 1W36D 1TEXA 4URVR 1E2KA 1OSNA 4L4UA 5KPJA 3DL0A 1E69A 1H8EA 2NO1A 4KO8A 4A92A 2R2AA 5FPHA 5B57C 3L43A 2DETA 1UBCA 1IXRC 1CS4C 1KI6A 2F1HA 1NJFA 2WAYA 1SKQA 2P6RA 5DN6D 2C04A 2FPKA 2QA4B 1DVRA 4B2IA 4IDPA 4FCVA 1ZAKA 2QE7A 3T06B 4OQNA 5FTMA 1KI9A 1LVGA 1ZNXA 2ZRAA 3VQTA 2QROA 2CHQA 1AS0A 4M1TA 2WMOB 1HA3A 3AVVA 5F98A 4P33A 1E1QD 2AHOA 1JQJC 3AKYA 3WYFA 2DPXA 2BMWA 5GADl 1LNZA 5A5GA 2HLDA 1EX6A 1G21E 1E2HA 2IYZA 1W4RA 2O5VA 3QPUA 1OW3B 2QGZA 4BFZA 1HV8A 1KO4A 1XTIA 4E22A 2Z83A 1DO0A 4Q1FA 3CRW1 3ZVMA 2JJ1A 1A8PA 3BJIC 4GRAA 2JLRA 3QXSA 5CDFE 3ZBUA 1MO3A 2ZJYA 4IVQA 4Q4LA 5FBVB 4WBSA 1KTVA 1P2TA 2CNWA 2WWFA 3H1TA 3NDPA 2XZLA 2CLCX 3R8CA 4V0LA 2LWIA 2YV5A 3EZ6A 4D4LA 5C2JB 2XTZA 1F2TB 2XXAB 4FIDA 4E03A 1E6CA 2WOJA 4BFXA 4AIIA 3IEVA 1XJQA 1KO1A 1KDRA 2GJKA 2W6JD 2YYZA 3QVUA 4OL0A 4BWYA 4Q66C 2GVZC 5GVRA 1LV7A 3U3KA 5JJIA 1BX0A 1QHYA 4YHBA 1P3JA 3CM0A 3FFAA 5EZ6B 3EPJA 4EJSC 3BORA 2VRWA 1UEJA 5KSOA 4NPHA 3TVTA 2OFOA 1CR4A 3AF1A 1OFTA 4QKQA 1ZRHA 3EPKA 1RVDA 2NQ2C 1VMAA 4C0BA 5TV2A 4YDSA 4WVFA 1D8TA 3GP8A 1E2JA 1VQOB 2GWHA 3NHBA 2QPAA 3TAHA 3SBDA 1X8JA 3KFXA 4Y7CA 3CF2A 4Q1CA 3I92A 1NN0A 1TU4A 3C5CA 2GJAA 3DHWC 2O8EB 1T8UA 1BX1A 2PMKA 1SKYE 4P31A 2QTVB 1HEIA 3C7KA 3CCVB 2A5FA 5G41A 2N46A 4JL5A 3QFRA 1E9FA 1P2UA 4V0KA 2FA9A 3ZS8A 1T6NA 1E9EA 2P65A 4G5SA 2QPOA 4LJ9A 3CRRA 3OAAD 4ITRC 3T5GA 3GFTA 1W7AA 1TADA 4PO1A 4ESHA 1KNXA 1Z22A 3ZC3A 1S3SA 3IO3A 5JCPA 3GLFA 2OV2A 3C8UA 5K8LA 5BWMA 2F1IA 2OM2A 1FMJA 2CEAA 2J87A 4O2RA 4Q4HA 4A0HA 4ZKEA 2VTKA 4YAOA 4QBIA 5EJEA 4D82A 5JRJA 4OI0A 5FOWA 2EQBA 1JR3D 4YAUA 2G1KA 1CNEA 2PT5A 3GFPA 5GJCA 1P73A 1Z2CA 2NPFA 1OHHA 2ZJ5A 1F20A 2CJWB 4IXMA 1KJZA 3H86A 1WB9A 2GZHA 2IT1A 3LO8A 3CCSB 2OBMA 2WWXA 2XNDA 1JJ2B 1GM5A 1Z5ZA 3TUZC 1YJ9B 2BBTA 3PUXA 2VNJA 1R0WA 3CX8A 4RZXA 2FSGA 4JL6A 3Q3JB 4I1UA 4P32A 4R9UC 4Q9HA 2QN6A 4Z1MD 3AP3A 5CLQA 4QGFA 2FNAA 3RC3A 3TNFA 1NLFA 1ZCBA 2BOVA 2HJVA 4DKXA 3LX5A 2ZPTX 3IO5A 1G3IA 1U8YA 4LJ7A 5JWHA 2P5TB 3CRZA 1YVDA 1NJGA 1NVVR 4AKGA 2AFIE 5EE5B 3OIUA 4XTCS 1TLLA 1QGAA 1CR1A 2H16A 3I55B 3KTAB 1GKIA 3NWJA 1ELOA 1I2DA 4JBYA 4LV6A 4URZR 4DIEA 1BKDR 3ADDA 3OE7A 4V0OA 1XB2A 1EFRD 1Z63A 3QSYA 1NG1A 1US8B 2V9PA 4RD2A 4B2LA 1VDZA 2QENA 3U61B 2O8DA 5L3QB 1VCIA 1RZ3A 3T1TA 1T8TA 4UNSA 5AUPB 3X1WA 1O87A 4KBGA 4RD1A 4IRUB 5HPYB 1DAGA 3OJXA 1DG3A 1DAHA 4D0GA 1E99A 5TB5A 5AJVB 1N0WA 3GLHB 4WZAE 2H1LA 4DDUA 3OIVA 4L9WA 2VL7A 2OLJA 2CK3D 4C2UA 5KSYA 1Z6AA 1R10A 4JJZA 1W47A 5FTNA 1YZLA 3MHPA 1HH4A 5BN5A 3N2EA 1DDGA 1OGIA 2VQSA 2W83A 2P2LA 4JLBA 2GF0A 3P4YA 2WBLC 1NVWQ 1E64A 2J7KA 1UBEA 2PZEA 3B1VA 4II7A 4MKIA 1VQ5B 2F1RA 3PR1A 3SN6A 1E2LA 2JEOA 1CP2A 3EZFA 1X6VA 1G41A 1MV5A 3OHMA 3ZD6A 2C03A 1G3RA 3ZQ6A 1VQNB 2E1RA 5TARA 1G1MA 1TUEA 3OIYA 5JHHB 4XOIA 1SQ5A 1TEVA 5EP3A 3VU9B 4F4IA 2CCKA 3QKSB 2DFNA 4QM7A 1GL9B 2ANBA 1D2EA 2V6IA 3I73A 1G8GA 2V1UA 1JAHA 2WWIA 2FJUA 1DAKA 4GOKA 1KO7A 2ZSBA 3MLEA 2BV3A 2FWRA 4C7OB 3UXMA 1MRNA 4HYYA 3I5YA 2W6IA 1DELA 2ZAMA 3WYAA 3TSOA 4BPRA 4BZXA 3OFNA 4DCVA 2F43B 2ZYVX 2DFKB 4NCIA 1OYYA 4WA7A 4LCBA 3QQ5A 3GJ6A 4JVMA 1FW6A 4PFSA 1GL7A 2ONJA 1AKEA 3T34A 5JWOA 2ZJAA 1VHTA 2IUSA 4TMWA 3DO6A 4LHZA 5DI3A 4PC1A 3X1DA 2FFBA 1FP6A 4KLZA 1AJEA 1HURA 2TMKA 4DDVA 3U44A 1D9XA 1VYUA 2IYXA 2Q3FA 2I1QA 3NBZC 1J70A 1G291 3LH5A 5C46F 1XEWY 2ODEA 4IFEA 4BASA 1N6KA 2AKYA 2QY9A 2J1LA 1QHGA 3CNOA 2IXFA 4Z54A 2ODBA 1JR3E 1FQJA 3SYNA 1IB0A 1W2BB 1KHTA 3OEED 2QAGC 1A1VA 5JLJA 1R5OA 1P7CA 3P27A 3A37A 1UFQA 4LJ8A 2VHQA 3WYGA 1DOAA 4CRWB 4DCNA 2QL6A 1JBKA 1JXOA 2ZI7A 1IY0A 4DEYA 4YQFA 1VTKA 3RS0A 5K8TA 5J4KA 1SXJB 1TQ4A 3MRSA 5FOSA 4FMDF 4BLRA 2IYUA 5FBWB 5IT5A 3BD9A 1PUJA 3L2OB 1MABB 1U81A 1YRAA 5BN4A 1C1YA 1PVOA 5C1BA 2BKEA 2B6HA 1I2MA 2H92A 1N5JA 3QY0A 3SNHA 3R9XA 2YOHA 4XD7A 3RRMA 3TQFA 3LLUA 5SZIA 1JQLB 1U8ZA 1OH6A 1G16A 2BCGY 1GSIA 1ZUHA 1QFYA 4MKGA 1XMSA 3VHLB 3G4SB 4F7WA 2Q0HA 2VO1A 5M04A 1EP1B 3KJIA 4XWAA 2QBYB 3CX6A 4OKSA 2JIZD 4K8OA 4Q4JB 4KJZA 3R7WB 2H8KA 4CEHB 1UEIA 2QQ0A 5J40A 3I1FA 4DQKA 1OIXA 1LFDB 4DSTA 1XF9A 3QXJA 1XFAA 4TT3D 4YXWD 1W49A 3ZJYA 3THOA 3ZIAD 3W2HA 2ZAOA 1NKTA 2O52A 5C4GB 4DJTA 5BYKA 5ELXA 3QKTA 4BLOA 1ZM7A 4A6PA 2VP5A 5H5JA 2D4HA 2GKSA 3KB2A 4BUJA 1K8AD 3CD6B 3EG5A 1K6MA 2HYDA 3LDAA 1OH8A 2VP4A 5H70A 4QC2A 2X19A 5HKKA 3VR6A 1Z08A 4ACBA 4Q19A 5J4VA 1M74A 5CIQA 1ESNA 3AVWA 2FEMA 5KDOA 3IPYA 2V55B 2PLFA 1LF5A 2QT0A 4POAA 4FINA 2FH5B 4GP7A 2B7BA 3KKNA 1H42A 1IY2A 3ETLA 3ND9A 3SDZA 4WZBE 1ZYUA 2WJIA 4C4PA 2FV8A 2ZVPX 3CZQA 2IS4A 5JSZA 1Z06A 1YR8A 3AF2A 1YZKA 1IN5A 4Y0VA 5G3ZA 1EFCA 3LXRA 4PO8A 4PPFA 2A30A 4PSKA 4A1FA 4DQLA 2AFHE 5AR1A 1MRSA 4A2PA 4QBFA 3PCRB 4IOMA 1N5LA 4AKEA 2Q3HA 3SQXA 1AGRA 4JVSB 4AC9A 1GITA 3GLFE 3SR0A 1YJ5A 2RGXA 5EXSA 3U6KA 2N1BA 4PQFA 3W2IA 2ZR0A 5FH9A 5E3HA 1GJRA 3K0CA 1E2FA 1GRQA 1R6BX 1Z6GA 2ZRPA 1VCOA 2R6FA 1ZU4A 3LA6A 3LO5A 1ETUA 3TUJC 2YWFA 3W6OA 4CT4B 4TZ0A 2B21A 4KITB 3T5DA 2ECKA 3RRYA 3RC8A 4G1VA 4KCGA 1T9HA 1FX0B 5CIWA 1KMHB 4AWXA 3WRXC 2GHIA 3B6EA 1S3GA 1ZNZA 4FN5A 4ARZB 2OK7A 1E9DA 1HT1E 4LOAA 4Q4AB 3BB1A 3EIEA 1U0JA 2RC6A 2ATXA 4B6EA 2DEUA 4MH0R 5LB2A 1S4QA 4HEJA 3CC2B 1E1RA 5TDHA 5AUNB 3THWA 1OV4A 3GPLA 1N6HA 2BBWA 2WHXA 2QEQA 5JI2E 5LPNA 3W8RA 2CMKA 1NG9A 3BGWA 2UKDA 1TX4B 1TTTA 3OZXA 1E0KA 2BVNA 5CB6A 3V76A 2V4ZA 2Q3MA 4N3NA 4NH0A 4IDNA 4O0MA 1JPNA 3QBTA 2IXEA 4U5XA 4ZO4A 3TR0A 2KI5A 4CDGA 2GK6A 4M22A 2ORVA 2VP6A 3A4NA 3CONA 1DG1G 2LKCA 4RCYA 4HDCA 2UZ3A 4TL7A 3GD7A 4NBSA 4DZZA 1VQLB 4TMKA 2G0NA 1B23P 2ZRJA 4PC7A 3IEUA 521PA 4B47A 4DEXA 4BECA 1BOFA 5B64A 3DEFA 4AK9A 3RS2A 3B13B 2XTNA 3ZS9A 3VAAA 4A8JA 5FTKA 4URXR 4FWTA 3BRWD 2W2XA 2VHTA 4AKHA 4M1MA 3U5ZB 2NIPA 1S72B 4IOKA 2WVJA 5CM9C 3LY5A 2RC5A 2Q9CA 3KXIA 1QF9A 2E9SA 2A5GA 3OF5A 1P75A 3RLFA 5TXGA 1J2JA 2PJRA 5FPSA 1OPXA 3TRFA 4UNPA 1NN1A 3EPLA 2O8CA 4OJKA 1JR6A 4JYCA 3M4YA 3SI7A 2CCJA 3BFKA 4NKRA 3OW2B 4JVLA 4NYMQ 1KY2A 1YR9A 3PENA 3VO1A 1VG8A 1W34A 2MMGA 4JBWA 4DUGD 1JPJA 2BEKA 1CRQA 5J4YA 1UKEA 3CPEA 3NC1C 4I1SA 2CL6X 2WJVA 3MGCA 1GUAA 3EARA 4BFTA 1DAIA 4E5UA 2A78A 1AS2A 3NH6A 3GLGB 4EPYA 2KBEA 1GVHA 1F5NA 3AKCA 3QEJA 4QXAA 1E4VA 1XWIA 2EFDB 4GZMA 5GV8A 4HB2A 2O0HA 4Z8YA 1H8HD 4FI3C 1P9NA 2IEZA 3K0AB 3RS3A 1W5TA 2JLVA 1SGWA 1YRBA 1OIWA 5HXBA 1VG1A 1QBKC 3MAAC 3WNDA 1Z0DA 4JLJA 1S8FA 1KAGA 3AP2A 4OI4A 4TYPA 4EUNA 2R9VA 1E79D 2R8RA 3O8BA 3QG1A 4ZDJA 121PA 2HT1A 2XOKA 1CU1A 2QP9X 4L16A 4V0NA 1X8LA 3QXXA 2IS2A 2VNKA 2FG5A 1EG7A 3FOZA 3CUEF 4L5BA 1LB1B 4OYHA 3K0SA 1E4YA 4FCWA 4QNMA 5A0FA 4IVPA 2RGDA 4ZPXA 2FPLA 4MRNA 3BB4A 3TSWA 1T0JB 1T91A 1W1WA 2Z6VA 4P4SB 3V9PA 5AUQA 3ZBTA 2WAXA 5E7JA 3KKMA 5KNDA 1VQ7B 2PBRA 1KSGA 2GPJA 4V0MA 5FL3A 1DBSA 1E1QA 1S2MA 5FOUA 5KYKA 4Q9JA 1FFHA 5CM8B 2FMXA 2XEXA 1TVCA 1IONA 2WJGA 1M1KD 1DTSA 4KXFB 3UMFA 4TQUS 4M1OA 1GL6A 2C96A 3LQQA 3UPUA 2HUPA 2AK3A 5SZKB 1UJ2A 1CR2A 4BEJA 1XPRA 1GAJA 3D8BA 1P9WA 1E0JA 1SKYB 3JQQA 1X8KA 4B3CA 3L8ZA 1WCV1 4DXAA 2YOGA 3AM1A 1GDDA 1YZQA 2ZITA 4FMBB 4TL6A 3QPVA 3RS5A 4EQ6B 1SVKA 4Q7KA 1II0A 2XTMA 2GCOB 1E9SA 2BKUA 4OHVA 3W5IA 3PEVA 3W2EA 3U3JA 2JLWA 3EZ9A 2J45A 3K9GA 1ZC3A 3WXMA 5EE9A
chains in the Genus database with same CATH superfamily
4BLPA 2YY6A 3PSAA 3KB6A 1LVHA 1TOAA 2F7SA 1GO2A 2WICA 3KHUA 4DLLA 3TGPA 4GMXA 4K0RA 2PSHA 4WECA 3T52A 3B5EA 1P5ZB 1RI1A 2AK2A 2XZDA 3L0DA 1EI9A 3NJ4A 4CQMD 2RAPA 1MVLA 4LX0A 4BFLA 1JHRA 5EP2A 3R3XA 3OQIA 4JDUA 4AKSA 4EW6A 1NZJA 1I4LD 4EHHA 1QV7A 2TECE 1TL7C 5C7LO 1XEFA 2EW8A 1RHRA 2VF2A 2I66A 5CLJA 1KI8A 3QKRB 1Q95A 3KPWA 4KL8S 4LTNA 5DI9A 5DLYA 2ZUTA 1O6GA 2FJ0A 2GPBA 3PHGA 3EA5A 1N6IA 1VE5A 3INGA 2E4WA 3S1AA 1EDZA 2C5HA 1H9BA 2A86A 2GBLA 3O1HB 1G2OA 5DYGA 4DIKA 2CNKA 3QVLA 3SP1A 4X5OA 1YJ8A 1ADCA 3MT7A 2DX7A 4DDKA 4O4HB 3PFNA 3OC0A 3OPOA 1DRKA 3EZGA 4H4DA 3LUKA 1FFAA 1YL6A 2H4XA 3E7XA 3H18A 1TGVA 4OB8A 3ICQB 3GVPA 2G88A 4QVJA 4QUEA 1SVWA 3VR5A 2OR3A 2JW5A 3PJRA 4LJYA 1KZGB 1LY1A 3WMEA 2HHLA 3ZHVA 1ADYA 5TT1A 4L78A 4YB8A 2JGFA 4PZUA 2FN8A 3FN4A 1XZDA 1WMBA 3KQMA 4G5XA 2PRSA 4GOMD 1BIFA 3CFYA 3NFRA 5LD2B 5HIKA 2OXTA 1MOQA 3NTXA 3WB2A 1DAMA 1AUPA 1NUAA 1V5GA 4KX5A 1XKLA 1P17A 4BKOA 4M1WA 4DA8A 4UM8B 2A4KA 3PE3A 3ZY6A 2JDID 3M34A 3OCVA 1KJWA 2OFXA 3ZZMA 5B12A 1OA1A 1AQ6A 1YZHA 4N4AA 2VRCD 3R3WA 2IOQA 2XUGA 4ZO8A 2I8CA 4Y2UA 5KYWA 4MRMA 1V3UA 3DAFA 5JFGA 5ETJA 1GR1A 821PA 3MUNA 4M49A 4ALKA 1GZHB 2QE6A 3EPPA 3M82A 3LGSA 2MU1A 1XCGB 3GUUA 3K4QA 4UDOA 2YZ7A 2BF4A 1EX9A 1V43A 1BYIA 1QX3A 2WKWA 1TI7A 3CLUC 3KPJA 4Q48A 2ZZMA 4ZMSA 3W8NA 5FT9A 2YZKA 5C0OE 1CERA 1QLJA 1RBQA 2IPMA 2V7TA 1KI3A 5ESDA 3RWBA 3HM2A 4WZAB 3CTMA 4Y2VA 5JXIA 4WH0A 5AKZA 4O08A 3TB6A 4BB0A 2ZU6A 4JROA 1C8VB 3HY3A 1RXVA 1Q3HA 3ER8A 4HXYA 1WV1A 2BL4A 2EIXA 2X7XA 3HP4A 1OXSC 5L51A 1NWHA 1ZSNA 4U4AA 1MEOA 3ZPNA 2A1IA 3HA2A 1BPLA 1CHDA 1GZ4A 3KEFA 5HILA 4DLTA 1VXOA 4G5QA 2PMWB 3HFSA 3HWX1 1ZD3A 3NUGA 4WKBA 3TFQA 2C7OA 1J23A 3O8CA 2UUCB 1O95A 4BNKA 5AVQA 1Q1AA 3IT3A 4POOA 4IQ4A 1VQMB 1UBHS 1ZUIA 5I9LA 1SUCA 5T6MA 1JFLA 4JEHA 5IKOA 1DARA 1G3QA 5LQUA 3V1UA 3CXCB 1WXHA 4LXTA 4MV1A 2B61A 3Q12A 3D3EA 4X54A 1EFRA 1ZPDA 4PTYA 5B7NA 1T26A 2Z43A 3EGIA 3UKDA 4YMUA 3LRXA 3T3OA 4UREA 2HJSA 3HHEA 2CNBA 4QXOA 2VT2A 5SY6A 4CFYA 3QWFA 2HEIA 1NRKA 2OGSA 1YB5A 4PCLA 3R7NA 4DWWA 3IV7A 2YVQA 3JATB 4HZUA 4UMFA 4WJZA 5FR1A 1E1CB 1L4YA 2HMTA 3LZCA 4CMIA 4NBTA 1E2PA 4R2IA 3R1IA 4IMPA 4D9BA 4DSOA 4G6IA 1SBNE 1XAJA 1ZD8A 4B1FA 3NBXX 1FDSA 3SYTA 5T4HA 3Q3EA 4RVHA 4P3OA 3BJMA 3D3KA 5C8YF 2CK3A 3GH3A 3CC4B 3VHQA 2MSKA 4C4TA 1DLJA 1MHTA 5EXXA 4N7MA 5JMPA 3M4XA 3ACDA 4YRSA 4U2EA 3TIGA 1ZINA 2PE5A 3VKHA 1LZKA 1LTQA 2BMFA 5JNVA 1FDRA 1XHLA 2A94A 3IPAA 5SICE 3RU3A 4YJ2A 1DXHA 5MDHA 1TC2A 1NPYA 3EISA 4MVJF 4NAUA 2GNAA 3CPWB 2IYPA 2ZB2A 3JASA 4QBKA 3TF5A 1UDCA 5LLSA 1SHJA 3ECSA 4HLQB 4MVJE 3VYRB 2OQRA 4RLZA 1EFPA 1TTQB 3P9SA 4R54A 4WK2B 1GA1A 1SQ6A 3C3JA 3LUFA 4XM2A 5IF3A 1RMYA 4HBGA 1YQTA 2V7WA 3OLVA 3P19A 3ZKWB 4ZD6A 3IEIA 3M6UA 3PI6A 2VDMB 4IS2A 5AVSA 1JEYB 2PS0A 2VPZA 4ZN6A 1VKRA 1DX6A 3FPLA 2X8JA 1I5RA 2PBZA 2AFHA 1P1BA 2EYUA 4BNMA 4C4XA 5HTOA 3KB1A 3E1SA 3IC5A 3C8HA 1JEOA 1UOOA 3U7QB 4PG5A 2HA6A 3EHEA 1J2UA 3KZVA 5KYGA 3G2PA 1C7QA 3AOGA 3TZ6A 1Z2DA 2C94A 3LUGA 4C04A 5FX2A 5ALEA 1IJKA 4R9SA 13PKA 1U8TA 1QIEA 3BMNB 2FEOA 3EXEA 3PFIA 4WXEA 3W3AA 4R8SA 3R7AA 4C7XA 5FI1B 2FDRA 3M1IA 1XDGA 2Q4OA 2CLSA 3PNPA 2FPSA 4IVNA 5LMNB 4M0LA 1W2HA 4QUZA 2RH5A 3MXOA 2BGJA 1CJSA 3ELUA 5AQEA 2GX6A 2JD1A 2QTAA 3D6TB 3L1IA 2UZ1B 3VVLA 4CKEB 4BX2A 1AQLA 4M9XA 3RTEA 3S68A 4OVKA 3FSEA 3CLTC 3G17A 3VTKA 5IFLA 5LM3A 5LIRA 4KHZA 3SKBA 1COWD 1HE2A 2INGX 3DAHA 3PXUA 2J5RA 3HBAA 3F8WA 3CKKA 4O1IA 4O4LF 4RKFA 3MJHA 1LDNA 1XEXA 3AERB 5IASA 2V4MA 3UJ9A 2IEBA 1M1YE 5U4XA 1V3VA 4RHEA 3WE7A 4ETMA 2GO1A 2FWPA 1SXQA 5BSUA 1Z26A 2B4RO 1WW2A 2IYOA 3D6AA 3KPVA 1GU7A 4HRXA 5TT0A 4C43A 5HOEA 2CMGA 4ZGWA 2IYNA 1N5MA 1LF0A 2X5XA 3LT5A 4K1LA 3EGOA 2WZQA 2RD2A 1I0IA 3SLDA 2DLDA 4ZU3A 5A89A 1J7JA 2B0JA 2JA2A 4YMIA 2PLWA 5ERYA 1H4VB 3JQ8B 3ULKA 2PYIA 2A57A 4J7CA 1IHUA 4H59A 3T5TA 4DV1B 3EWAA 4DR5B 3A10A 1XVTA 4M8SA 3L8EA 3BCHA 1RKVA 1XO1A 3QFSA 2Q07A 3HZHA 5IBQA 1NN3A 1R9GA 1HDRA 3MCUA 3M6LA 4PW0A 1Y63A 1EXMA 5BV7A 4EPRA 1XX6A 2HRRA 2JEYA 3SIRA 3BIFA 3W04A 4DRZA 2B8WA 5HJ5A 3N2GA 3ELDA 4YGYA 3BMOA 2L82A 4MQEB 1LX7A 4BX8A 4LJRA 3WL4A 3R3SA 1R27A 1QH1A 2P2SA 1FS6A 2P2ZA 1FW8A 1YMUA 3K1JA 4Z0HO 3UMCA 1YVRA 2NUTA 1Z38A 1JU4A 3OX2A 4GIBA 1Q0UA 1JHUA 1O8CA 2QA5A 1RPAA 3VMFA 3L7OA 4OQLA 1ICIA 1UBFA 5J4LA 4M1EA 4JOBA 4CMHA 3Q2OA 2YMLA 1HO3A 4N01A 4RZUA 4H0NA 4DHWA 3BC9A 4L4YA 4JOQA 4HLDA 2JLYA 2AD1A 2BCEA 1V9CA 2JIZA 1XD2A 2FWNA 3R0XA 3EXAA 2O1XA 4PICA 2FMIA 2GAFA 1YLOA 1JG7A 1Y1QA 3ODGA 3RAGA 1DSSG 1XELA 3I12A 3KU4A 3OLZA 4YT5A 1ZD4A 1QRRA 1P4JA 2WSBA 4DAEA 4U00A 4DYVA 1CR0A 1JZTA 1XU9A 1CZOA 1GUBA 1K5GA 2B99A 3D6MA 3FDZA 1SVLA 2OBNA 1X7ZB 2KVOA 4BFSA 1WPCA 1R0SA 1U7DA 3F9CA 3UKJA 3IE1A 1K5PA 2O0JA 3UIEA 3ZDCA 4CV0A 4GKKB 4AJ4A 3KALA 4UD2A 1U2TA 1V5WA 1Q22A 2FWMX 2OT3B 3GLTA 2I6UA 1RYMA 2Q21A 4UVDA 3QFCA 4XJSA 3GBSA 5HVNA 4NCXA 5LJIA 1RKUA 4Y6GB 2XQVA 5FWXA 4DMCA 1Z0SA 1UMDA 5HUQA 1IZ9A 2AVDA 3EEYA 2H6EA 2WM2A 3BXHA 1NSYA 1K8YB 1V5EA 1LPBB 3QIVA 4G0OA 1GU0A 4EAAA 5HYVA 1IOWA 5LD2C 4TV8B 3CUKA 5CLIA 1WXQA 4DNPA 1M0SA 1R0YA 1Y9JA 3BWMA 1QRAA 1UP4A 1WP4A 5AQ1A 4U7PB 4KXNA 5BT8A 3UAXA 5EHXA 1IPEA 3HB4X 3DAYA 1BXRA 2NOAA 3BCDA 4B44A 2ZULA 3IQFA 4GI3A 4IJUA 1ESMA 4QL3A 3RVJA 5BR7A 1T0UA 1Z8NA 2HQRA 3A4VA 4ESEA 3ZCXA 4IDOA 5ALRA 4BZPA 2D74A 1LVUA 3ZZUA 4F56A 1D07A 1SBHA 3LFUA 1YHQB 2E87A 1MT0A 1Z28A 3V4VB 3N70A 2H06A 2FOIA 1E2DA 1P9OA 2RGNC 5JY6A 2NO7A 2P67A 4LKRA 3NV9A 3Q41A 3VYUB 3NCHA 3WWOA 1PQUA 2ZWMA 3V7YA 3R4CA 2PMEA 2B78A 2QTLA 1G3MA 2FK7A 3DBOB 4LXYA 4UHHA 4RTPA 3N5CA 3WKDA 2WUVA 1SVIA 3ZK7A 3CSSA 4DNFA 1JQ3A 5HIJA 3SWWA 1JX6A 2BZ1A 5HA5A 2PZFA 2JL1A 1MFZA 4HV4A 1Z6ZA 3R9WA 4EY8A 2BFPA 2P77A 2XQKA 3A1TA 1WVGA 2GESA 2E5WA 3DTTA 3ENVA 3DBRA 3I2IA 4MV9A 1PJRA 1H0HA 3H6GA 3VNRA 4EA6A 1GVNB 3MIIA 3WI7A 4AJPA 1V37A 4LPKA 3IEKA 4K6FA 5ESRA 3ER9A 2ZT6A 3B82A 2REQB 3KDAA 3PC4A 1Z34A 4B48A 1MPTA 1MZVA 1W6UA 1SO8A 4EUEA 4B43A 1YDGA 2C9DA 3SC2A 1JAZA 2X5OA 1S4MA 2CL7X 2ZTVA 3PTZA 2B4QA 2E4ZA 5JALA 2E49A 4DBLC 4CGZA 3CIFA 4PPQA 5IAAA 2P6MA 3OCXA 1F8UA 5IH7A 3ITNA 3NM5A 5E6SA 3MCAA 2RCYA 3AKEA 3LVFO 4ENSA 4IUCS 1YB1A 4WA8A 2H51A 1UD4A 1KMIY 1V9SA 2C4WA 2J31A 2NZJA 3CT4A 4G5FA 5TMDA 3E9QA 3KKOA 1L6RA 2WJ6A 2GERA 2R6DA 3K1AA 3MT8A 1Z7EA 1KMNA 3BD6A 4ISCA 1L5SA 4GSLA 2O19A 3BS4A 4HQOA 1GILA 3UG6A 4MGZR 1U0NA 4RX1A 1JXMA 4Q3OA 3ZWNA 2FZCA 4XVHA 1IUOA 3S29A 1A9PA 3ROQA 3T15A 3R9IA 4X1YB 2IU4A 4JGIA 4G8BA 1UZNA 1GKLA 3HNOA 2A9JA 4LNUB 4RE6A 4Z3DA 3IRUA 1MV8A 3L06A 3Q11A 1V6CA 3P8ZA 4LWPA 4P84A 5B58C 1A04A 2YJTD 3HXKA 3WLKX 1HE8B 4XCQA 1OROA 1PTKA 2Q1WA 3A2NA 4WK4B 4HNQA 3NHLA 4JS0A 3S8EA 1A27A 5CT9A 4OHZA 4QPDA 1SXJD 1UODA 2YC4C 3T4XA 1MOZA 3V34A 1X2EA 4EB6B 1PJ5A 2XJ4A 2VQDA 4GR9A 4REMA 5FNZA 1CULC 4IIJB 1E18A 2HL6A 4JX9A 2AH5A 4KV7A 4S1NA 4YJ2F 2O1EA 2PZGA 4OXXA 5B1IA 4ILEA 2J3KA 5DHTA 1KXJA 1T6YA 1NRWA 4WDRA 1YGYA 3I9V1 2B1IA 3H2ZA 2ZCVA 2WAAA 3E81A 5FAXA 1M2WA 4KQGA 5I9SA 3VH3A 5IYRA 2QS9A 3CNLA 4J75A 3ZJ4A 4BTVA 1GY8A 2DUJA 1GPYA 4P81A 3RLIA 2JGLA 3SZRA 2AN9A 4DLAA 2AUTA 3AH8A 4TMZA 3TSZA 4EG5A 2Y2UA 3R5HA 1PYGA 3G85A 2B8JA 4E3WA 3E35A 1ONBA 1QHFA 1QVVA 2FK8A 1WO8A 3FDFA 1BWRA 5EMKA 5B4UA 4Q6WA 5JZ9A 4B34A 5K8VA 2IYWA 2H1RA 4JKYA 2B3DA 2HMVA 3G89A 2GD1O 3WLJA 1CUWA 3ZWQA 4YRAA 1UJ6A 2RHWA 1JJ7A 3LW8A 2W37A 4XUCA 2AE1A 1ACLA 5K99A 3LU1A 1N8RD 4HZIA 1T3ZA 2WTUA 4DSZA 3ZW9A 4KE8A 2BMJA 5J63A 2XPCA 1PO7A 2R5NA 2WUWE 4YPFA 4A2CA 7REQA 4ZVTA 2YBEA 3LHSA 2HA5A 3G8BA 1T3GA 3GGCA 3I3OA 1Z2EA 3DZIA 1W4LA 3DUFA 2FQ1A 3H83A 1U3GA 5DRYA 4RZHA 2I8AA 4HDRA 3PG5A 1E79A 2QRLA 4B7UA 1T8PA 4C1BA 1E7WA 3GVXA 1R0RE 1YS4A 1QMPA 1G8MA 1H1LA 1AKNA 1IPHA 4ZU6X 3KU1A 3IX7A 3EGWA 3PPIA 2AG1A 3NEJA 3NEYA 3O38A 1QE5A 1JDPA 1OBVA 4G97A 3PJFA 1L7AA 1TIBA 2H18A 2HLPA 2WINI 4HN9A 3D1VA 2HF2A 4IUYA 2QG9A 5EXDA 1QV6A 2UVQA 3DZHA 5EUMA 1E60A 2PVCA 1RXIA 5P21A 4DJEC 1KBZA 5CX1A 2XJ9A 4HNVA 1FDWA 4EF6A 4AULA 2QQGA 4HD8A 4G0XA 4N0EA 5FV7A 5H4HA 4B3RB 1W46A 1VMIA 3CUWA 5HDBB 2W70A 3RT7A 5DIZA 1OKKD 1X92A 2PX8A 1QVWA 1V3TA 4AZWA 1XPUA 3TLXA 2J6BA 5K3OA 4DE5A 3Q39A 2Z6QA 3T5CA 3BHJA 4N6OA 5REQB 3EDCA 1JHXA 1TUBB 1FJXA 5JE8A 1E3IA 2DTXA 4W9MC 2Q0SA 5IVHA 2YS6A 5TY0A 2QLNA 4MICA 1DEKA 4NJOA 1IZYA 4BKQA 3THYA 4Y1EA 4FEYA 1GUYA 1OFIA 1QK4A 2GN0A 3ASPA 2Y0BA 1G8HA 1N6LA 2XR1A 2IEIA 4P5DA 1X7DA 1U9YA 3OI7A 1LBSA 4BCDA 2ZSJA 4MWDA 3A9TA 1KXZA 4US2R 2HWUA 1KK2A 3BRCA 1NAHA 3JAKA 3CV3A 2XUOA 2JVIA 3SJAA 5CW1A 4KSBA 3FW1A 1NVTA 4KQHA 4Q7QA 3HHPA 4V1CA 2GLXA 2UUPA 2WU0A 1JKXA 1VJRA 3ZXUB 3UJ7A 5LNK6 4XLHA 3I32A 2XCSB 1D9ZA 1IVSA 3VKGA 3KSAC 1NV8A 4PAOA 4IHKA 2C7PA 2B9VA 5HF5A 1HT2E 4K9QA 2RHLA 5DP2A 4RD0A 3AIOA 3O95A 1Z47A 5KTPA 5IXSA 1Q0RA 2R66A 1E63A 3G7UA 4RTQA 2OA0A 1VSTA 5J9FA 3ZJUA 3OJ0A 3ZI4A 3LQ4A 1Z15A 3V4ZA 1T15A 3UWOA 4MKXA 2QRQA 3WIOA 3VOAA 3JAMA 1QK5A 1VYVA 3C6ZA 4W8OA 1LNSA 2WYVA 2A35A 1WPQA 2FHSA 2DR0A 4TLEA 1XYYA 3QVKA 5KNDH 2BEVB 1RYEA 2GK4A 2HPVA 2CUTA 1RP1A 2H1IA 3Q7IA 3ZU4A 3R5JA 2C00A 4JT2A 1PWXA 1GNVA 3MYRA 1JIUA 2SHKA 3DCNA 4E46A 2C7RA 3ZEAA 3HUUA 4OOSA 3WV4A 4A7PA 1Q14A 1ZUWA 5DWDA 3QMVA 2CVFA 2GN9A 7ABPA 4G0UA 4YJDA 1SHLA 1M0EA 1JLSA 2GHQA 1GG2A 1KS9A 2ZRFA 3IAUA 2P9QA 3JQ9C 4JAVC 5D84A 1Q0HA 4HDKA 2XA1A 2FPPA 3GD5A 4MRSA 2WG2A 5AKIA 3PTAA 4ND8A 4BAZA 4UCFA 1IC6A 1DDOA 4LDZA 4O3MA 5C8XA 3KR9A 3PD1A 3THWB 4D45A 1CDDA 4BXOB 1HDEA 4P9SA 4P22A 4IQ8A 1ZJ6A 2VXOA 2QN8A 4R5MA 4MIYA 1KEEA 3QH4A 1RKQA 4EP1A 1PVDA 3RBVA 9GPBA 2CL0X 3BH4A 1D2MA 4HUQA 4N3CA 4TTAA 5IAKA 2CNOA 4IEFB 1YDFA 1Z5GA 4HFJA 2JJYA 2BP7B 4ZK2A 5JS6A 2RG7A 5F3WB 1QIMA 4LHWA 2ORWA 3B7PA 4S1PA 5D7BA 3OBBA 3CEHA 4EMBA 2ZI4A 1ZY2A 3EPRA 3FETA 2XUDA 3NDJA 3BYZA 4PG4A 4PFQA 4TRNA 1CQPA 4UUQA 3O4FA 3ZX4A 4GYKA 1SC4A 1VJGA 4WHMA 4R8KA 3GMTA 2RGBA 2PCJA 3CYFA 4RJ2A 2PLAA 1N1DA 2D1TA 4IYRA 1SCNE 3OOEA 4R84A 5COAA 3KSDO 5EWLA 2Q5LA 4EB3A 2OO5A 4O2LA 1HT0A 1UFKA 1JLLB 1NRJB 2ATCA 3TEFA 4A8JB 3U4QA 4LJ4A 1W0KD 4CVNA 4ZZ3A 4WFQA 2J0EA 2XMCA 5LOVA 4H3KB 4HAUA 5H81A 3WLMA 2I4LA 3QXCA 1TM2A 2AOWA 3AGPA 1E2MA 1P72A 2PL5A 2VF7A 2OTCA 3HP1A 4Y9SA 4JU9A 4ETNA 2F8SA 2ONZA 1MJ5A 4OFXA 1QWOA 5JPDA 4S04A 1E6KA 3B60A 3OZSA 4V24A 2BH9A 2NADA 2ZI6A 4Q7MB 5FBQB 2JCXA 3A4TA 4Q47A 5IJWA 3AJRA 3FWZA 3I6ZA 4F3KA 2UXDB 2FEWB 1EVQA 1QDLB 4CF3A 1E92A 2ZDHA 4JJ7A 4M4SA 5JZMA 1KC3A 4HDMB 4EA8A 3ET5A 2XTJA 4G0QA 1LBEA 2PBFA 2XMBA 1KSHA 3I4LA 3CKYA 5IC5A 2BSAA 4R69A 3I45A 1L1FA 3DGEC 2ETVA 3PUZA 4RK4A 2E4XA 1B2RA 4DLRA 1JKJA 4ALLA 1LSSA 3AL3A 3W3ZB 2FGKA 2XWJI 3WLPA 4PSVA 2G5PA 3PQEA 1E5QA 1ZCJA 1T5TA 5E9WA 4WLUA 4P82A 1GPH1 2GYYA 2HCBA 2VAMA 4KI7A 2ZRGA 2FZ5A 1R5JA 1UPTA 1JEEA 1WS6A 3FBTA 4D4KA 4D9EA 3VC1A 4DMRA 1HFKA 1GGEA 3UGJA 3ZHUA 2Z8XA 3C2QA 2R1VB 3FWKA 3TL3A 3AR9A 1WJGA 3H04A 4G0PA 4ZAXA 1BMQA 1O0SA 4NZOA 4C4OA 4EPWA 3A1SA 4I9HA 5DN6A 3E48A 1N9ZA 4NHOA 4UAUA 1ZMOA 4ZI2A 4D02A 1WV0A 4GWKA 5AHXA 4MUIA 4EEXA 3WC4A 5DLPA 5L4NA 1DUIA 4HQNA 1R8YA 4I9GA 5CYFA 3KZOA 3LS2A 2YH2A 2XA9A 5FBZA 1I7DA 1EMDA 4IDHA 3WZLA 1MA0A 5TQ2A 2WJYA 2ZTGA 3P9YA 1IK6A 2OHVA 2HFJA 5GP1A 2IYLD 3ENQA 4GLOA 5B1SA 5WRFA 1W0JD 4WIAA 2IW3A 2ES4A 4IHAA 3UXHA 4ALNA 4ZANA 1G5QA 4D43A 2C4KA 1BEUB 4FX5A 1NSTA 4XQ0A 2JGDB 2V7QD 5JOQA 2OSBA 1YUBA 3BTVA 4LY9A 4A2WA 2IHNA 2GLUA 1XGKA 1YB2A 1F2TA 2ACKA 1TYBE 3M4JA 3PEEA 2CHUA 3KUXA 3KJZA 4PANA 1QYWA 3EE6A 1SC3A 1T0HB 4CFSA 2AR7A 3IAM6 3QI2A 3ILSA 4JSTA 2VDWA 2O2EA 2SECE 3NVAA 2Z6AA 1DC8A 1VA4A 3A1FA 5BXQC 1HC7A 5LU9A 2VJMB 1P91A 1I1QB 4XLLA 4A0RA 3ADBA 1X3SA 4N0DA 3DE7X 5ECWA 1WSWA 2AT1A 3SQDA 5FB3A 4DV7B 5HKLA 3ESXA 3CC7B 2HEGA 2XYGA 1FC0A 4ZCIA 3URMA 2J7PA 4F86A 2DFVA 2F3SA 3A11A 4P54A 3CX3A 1WHTB 4M9CA 3T3IA 5JCOC 4GGOA 5JAIA 1GZ5A 4X0CA 2VUHB 1PJ6A 1OZAA 4RIEA 3STUA 4GU5A 3PVZA 1GQSA 4FEAA 1PNVA 1QVAA 1VHWA 3QTBA 2ZBFA 2CBGA 1ID8A 4TSFD 4G41A 3WWCA 1SD5A 4HEQA 4HB3A 3R5FA 1EHIA 1Y1TA 3IQZA 4A4DA 3GNLA 2L69A 3RRJA 2BZSA 1RMQA 3WGTA 3BKWA 3P0EA 2AC2A 3VSEA 2JANA 2QW8A 1C4KA 4ZOLF 3AYXB 4V02A 5F4OA 1SHKA 3D8UA 1ITZA 4LYFA 2VH1A 1F7UA 3DCIA 4R0NA 1VLHA 3DJFA 4LJLA 5I7UA 3D3WB 1T9KA 2R6CA 4IJKA 3Q85A 4HEA1 4B4UA 3HWWA 2Q7XA 3PUHA 1G0OA 3AVQA 1CF4A 3CNQS 2C2BA 4GMFA 2Z6UA 1RRGA 1QFJA 4GYJA 3REFA 3TN7A 2PUAA 3QP9A 1LPNA 4TXLA 1AKTA 5I3CA 2Q4EA 3UJDA 2ZZNA 2B5VA 5D6OA 4B80A 1DT3A 1SY7A 3DBLB 4I55B 1BWPA 3AIMA 1N07A 3GFFA 4RK0A 4F97A 4X61A 3IP1A 2E4YA 2XDQB 4U8GA 1M7BA 1WMFA 1H2FA 2LTAA 2XZOA 1KIMA 2P9HA 2WIBA 4XQGA 5HGJA 3ABSB 3TLEA 3UA3A 4X97A 4B3DA 3J80A 1RZVA 4JJEA 4AAYA 3I34X 3MJFA 4K03A 2CJWA 4AICA 1TKCA 1D7AA 4RIGA 4QBHA 1Z5OA 4UTOA 1P4MA 3D4OA 5B5SA 4KE6A 1CV2A 4EGQA 1GOTA 5HOQA 2QZZA 1SQGA 1NMSA 3CEMA 2XITA 1WRBA 2GQFA 5EJ5A 3W05A 1O7JA 1ZXLA 1G7CA 3SNKA 1RWNA 4ATNA 3F6BX 3N7UA 2AC7A 3OZFA 3W6ZA 1QU2A 4MITA 2QZSA 1QGZA 4M3NA 2XBUA 1JYFA 4NU0A 1MKYA 3I5XA 3T6KA 2PT6A 4I9NA 1QKJA 5L7YA 1CQXA 2J59A 1TYAE 3H9QA 4LHSA 1XEWX 4Z4SA 3DHYA 1Z0FA 2GQ0A 4M9ZA 4PZEA 4OMFG 2DKNA 5DMXA 3WZMA 3QYAA 1X0VA 1U7WA 3K09C 3MINB 3Q8KA 4ZT6A 2ZETA 2PYZA 2AWOA 2F3UA 4X7RA 1UJBA 2WZBA 3PC7A 3GZNA 1A77A 1UXKA 5JDIC 1ZP6A 3PA2A 3LBIA 3MIZA 1Y6ZA 5CJPA 1PL8A 1PQ4A 3L8GA 1I7LA 1FNDA 3NC4A 2FFAA 1Z4LA 2OBFA 3HJRA 2BDEA 2X76A 2F4NA 5AN9A 2P4QA 2WM8A 4R16A 1Y8QA 2W8BB 3PLAE 1VL6A 4GWLA 4MW4A 1SBQA 2I7CA 3ILVA 1RBYA 3O1LA 4PYLA 4D3FA 4BKPA 1RQGA 1E43A 3C5WP 4JCOA 3THRA 3ILXA 1UAYA 4FD2A 3WL8A 3M5CA 1SRQA 3DVAB 3HMKA 5KTTA 4ZGQB 2QSZA 4Q21A 4MYHA 1Y8RA 5F1KA 2EV9A 4KQKA 5A8AA 2GVNA 1M73E 3NRBA 3PI7A 4KRFA 2IDZA 2C42A 5GY7A 1BKSB 4JSYA 1FDVA 2YWHA 1Q82D 3I1YA 2BI4A 2RHTA 4KKUA 4B5LA 5A03A 5IC6A 4F3NA 2O06A 2ZBGA 3B20A 2LRHA 3K1YA 5ALNA 2GEFA 3PD0A 4QOSA 5JCZA 3BA1A 4G1FA 4CG1A 3EVEA 2X86A 4MQ4A 4OHFA 4C6SA 1DAPA 3AM5A 4QYIB 4DIMA 2H5LA 1JIQA 3EGDA 2AV6A 1KS2A 1L7DA 1XTTA 1A0OA 2D00A 4PXAA 2UYCA 4KZKA 1KVSA 3I2HA 3PRKE 5B3JC 1RC0A 4A8JC 3UCFA 3AVXA 3O6VA 4D56A 4JV5B 3HKBB 4R1TA 1ZG3A 3PHIA 4EY6A 1EQAA 1NRIA 2DP4E 2HSWA 2JLCA 1QGUB 2VCEA 3KPUA 4H7EA 2D3WA 5DV9A 1ZBDA 4M88A 5KWJA 3IKLA 1DPFA 3NANA 3IE0A 2HQ1A 3OWOA 7MDHA 2HKIA 5JI3E 2YHAA 4ZKDA 3LSTA 5GM1A 2I67A 4AO7A 1QG4A 1RDFA 3QJYA 4L4SA 2F43A 3SHQA 3IERA 5LOVF 4GW3A 4RK7A 4ZQCB 1PEKE 2PYDA 3BF8A 4KBYA 5H16A 1PRYA 5GGXA 5HJ2A 1JT9A 1OWLA 1PLLA 4R3WA 4QX6A 5EJ9A 1JBQA 2HPZA 4LMRA 4X8LA 4AN1A 3OZWA 3PQ6A 1VJDA 1TFUA 1WZNA 2QNRA 4CEIA 2A9VA 1ESDA 5G1NA 3ZOKA 1GLNA 3ICOA 1KI1A 5F52A 4MOWA 1PJBA 1WNTA 3L41A 5C53B 3AINA 4NXNB 1RFLA 2ENUA 2GDZA 1XSEA 2GAAA 3KSZO 3BD8A 3E8MA 4RJLA 2ZI3A 2RK6A 1TC1A 3VI3B 3W6PA 3WGKA 3GFQA 2ZYIA 4GM1A 3FHOA 4RW0A 3TLGA 3SBEA 1F0NA 2EWMA 2QTNA 2VP2A 4X84A 3V6MA 5CDUA 4DNRB 5MN5A 2V98A 3VGJA 4Y2YA 1P6UA 3ASVA 4WLVA 3JR7A 5FCDA 3KVYA 4DY4A 5JS7A 1G3UA 1I10A 2CF4A 2B20A 2H4ZA 2OCIA 1ND5A 3TMKA 3USZA 5EAIA 4AQ7A 3DMFA 1NIPA 2X0RA 3A6GA 3UICA 1QCCA 1A50B 2ID4A 4OXKA 3RUPA 1M5UA 1U2SA 1MIHA 2XKJE 5IJXA 1SKMA 4BNDB 4B76A 3CHYA 1E4OA 3R3YA 2XWBF 3LKDA 3A6FA 2HJ9A 4YMLA 5DYIA 1YACA 4NSNA 2JNWA 2GA9A 4HWTA 3EPHA 4WEOA 1SXGA 4XIJA 2W2TA 5TRTA 1HTTA 3S3TA 1Z68A 4G5GA 3I0MA 3JVUA 3PVCA 4B71A 4EABA 1GKYA 2HHJA 1B93A 2QXTA 3I8SA 3LPMA 3N8GA 4MJXA 4B6GA 1YQGA 4KR7A 4G86A 1BCSA 4RA9A 4BNHA 4N8EA 4BLQA 1K1EA 4BMYA 4F04A 4Y6PA 4BX0A 3V2HA 1GQOA 4FXPA 5EWJA 2EGHA 5TS2A 5EIWA 1C7FA 2FN4A 3M2TA 2Y8EA 1YQXA 3JVIA 4OKNA 2L0XA 4P1ZA 1A7JA 4AMZA 5IMBA 1K2WA 1QG0A 3IXMA 1FE8A 1M90D 1GU1A 5CP8A 3TI7A 5FQNA 3FRHA 3GEEA 1FIUA 1DQZA 1E94E 3AVUA 3AKDA 3OPVA 4YACA 5TLSA 2I2WA 4FBLA 2Q9BA 1UFVA 3HUDA 5CURA 1HEYA 5DE3A 4URFA 3COPA 1NR5A 2M2IA 2BEUA 2R1ZA 3JQAB 2QL9A 2YXLA 4PYKA 1N0UA 1YBAA 2OZVA 1BWQA 5LYJA 3QBEA 3UK0A 4HE6A 2B8TA 3LLCA 5FBLB 3ZWXA 1FDOA 3IVCA 4QFMA 2FAXA 4MAMA 3SR4A 4BKUA 2JEZA 5ALKA 3EMBA 2WQ6A 3MTJA 3JYNA 2R47A 5K0TA 2H85A 4I5IA 5HK8A 2VBVA 3JR3A 1XHEA 4WKGA 3ZE7A 3GRKA 4E1BA 1JE0A 1P3DA 3VC2A 2W2VA 1JLKA 4JJ8A 4M55A 3VPAA 5C46F 1LA2A 5LC1A 3GCZA 4RM2A 1IN8A 5FI0B 5B36A 4ALJA 2ZIZA 5HUHA 2YL2A 2EC5A 3UB2A 4OAQA 1LQTA 5KJFA 3NYWA 3W9UA 2G9NA 1ZVJA 3L9WA 1SUEA 3I9MA 5AW8A 3IHTA 3I53A 4QEDA 4XGRA 3D5QA 1D4OA 1GWNA 2H7VA 2XNDD 2HQSA 4QAQA 5CX4A 3CZRA 4HDNA 2BGIA 1MF7A 4BX3A 1VI5A 4YH1A 5A5EA 4QBGB 2VJOA 1TJNA 1DS6A 5LQCA 2OHXA 3PQDA 4J0JA 1I33A 4CIXA 3AUYA 3U1BA 1OGJA 1LKZA 3RS4A 3FKSA 1FY2A 4DFDA 5E2IA 5G2OA 3MSXA 4BLVA 3E4CA 4EHLA