2DCUA

Crystal structure of translation initiation factor aif2betagamma heterodimer with gdp
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
407
structure length
407
Chain Sequence
b'KTRQAEVNIGMVGHVDHGKTTLTKALTGVWTDTHSEELRRGITIKIGFADAEIRRCSNCGRYSTSPICPYCGHETEFIRRVSFIDSPGHEALMTTMLAGASLMDGAILVIAANEPCPRPQTREHLMALQIIGQKNIIIAQNKIELVDKEKALENYRQIKEFIKGTVAENAPIIPISALHGANIDVLVKAIEEFIPTPKRDSNKPPKMLVLRSFDVNKPGTPPEKLVGGVLDGSIVQGKLKVGDEIEIRPGVPYEEHGRIKYEPITTEIVSLQAGGQFVEEAYPGGLVGIGTKLDPYLTKGDLMAGNVVGKPGKLPPVWTDLRLEVHLLERVVGTEQELNVEPIKRKEVLLLNVGTARTMGLVTALGKDEIELKLQIPVCAEPGERVAISRQIGSRWRLIGYGIIKEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Translation initiation factor 2 gamma subunit
molecule tags Translation
source organism Pyrococcus furiosus
publication title Structure of archaeal translational initiation factor 2 betagamma-GDP reveals significant conformational change of the beta-subunit and switch 1 region.
pubmed doi rcsb
total genus 87
structure length 407
sequence length 407
ec nomenclature
pdb deposition date 2006-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
A PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 2dcuA02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 2dcuA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2dcuA01
2CCGA 4TYYA 4AI6A 3CC7B 1U99A 2VLIA 3QKRB 1JR6A 1TAGA 3CZPA 2J41A 1RJ9B 2OUKA 1EFRA 1SM4A 1S72B 2GZHA 2PZEA 4TLCA 5FPHA 4AKGA 4M1WA 1W87A 2WSSD 3IO5A 2CEAA 2FN4A 4AYTA 4F91B 4CGZA 4GI7A 3P27A 1VTKA 2WM9B 5HPYB 1JBKA 1HYQA 4URUR 1KDTA 3FE2A 4KLZA 1T0HB 3A4MA 4MKFA 5K8UA 1Q3TA 3K0FA 5AUOB 2FGKA 2KBEA 3IO3A 4JLBA 1R8QA 721PA 1KOFA 5KDLA 4W5WA 1NDHA 1TPZA 1WBBA 2FFHA 1W5SA 2Q3FA 4JVSB 5FTLA 4JL6A 3AVTA 1CBUA 3WNBA 2YOHA 2ZJOA 1RW4A 1ZNXA 1DO0A 3BGWA 3MAAC 4NCHA 3ZJYA 3ZVMA 1KO7A 3DZ8A 1NLYA 1YU9A 3Q7PA 2WSSA 1KY3A 2J0SA 4ACAA 3GEEA 2R65A 4Q4AB 1E98A 2NTYC 2FGJA 3PUWA 4RFSA 2BV3A 2A5JA 3A6PC 2OFOA 5JHGB 4PFSA 3TUZC 1FTSA 4QG7A 1KSJA 1NI3A 1OIVA 3WMFA 1CJUC 1MV5A 3PG5A 4P4UA 3HU1A 2V6IA 4XTRA 3AVOA 1E1RD 3B13B 4G5SA 4D25A 1A2BA 2ZPTX 3VU9B 3IBYA 3RS0A 2ODWA 4BGDA 4Y0VA 1OFTA 1TTTA 2Q6TA 4AWXA 2ZI4A 3KQLA 3PUZA 2XZPA 5EXTA 1IB0A 1P60A 5SZIA 1M7GA 2W83A 4C0AC 2AR7A 1OHHA 4LJ9A 3RVBA 2BDTA 4C3ZA 1MOZA 2HT1A 1GNPA 5B2ZA 2CCKA 1RYFA 5EUMA 4B43A 1ZM7A 1RRCA 5KSZA 3ASZA 4TTRA 3KQNA 3KUCA 3B8HA 4BFYA 5FA6A 3RRYA 2GXSA 4Q02A 2BGIA 3RHFA 1VYUA 4AY2A 4RD6A 1YJ5A 3LLUA 3QENA 1NMYA 4NKRA 2OAQ1 1ZBDA 1GDDA 1DAMA 3MFYA 3OIYA 1RJ9A 4KFTA 4ZDJA 3KKPA 4GP6A 1ZINA 4PHFA 3VTKA 4Z8YA 3ZIAA 4BRWA 1SULA 3AM1A 4TMKA 521PA 4LBYA 3NH6A 3FFAA 1FW6A 5ANRB 3NG1A 1Q44A 2C8VA 4BFUA 4QBGB 5EXSA 1G20E 2C78A 1P2TA 3TUJC 3FGNA 2OV2A 2J9RA 2ZSAA 3KJEA 4ZI2A 2QDXA 3LX8A 1OT3A 5TMPA 1VG1A 4HATA 5J40A 2IYQA 1NVVQ 1B23P 1R0ZA 2ATXA 3TQFA 3GFOA 3N2IA 3P26A 1J70A 4FCTA 5LB4A 5IK2D 4BLQA 1AS3A 2WWFA 1JXOA 2XX3A 3C16C 1J2JA 4CRWB 3GFPA 2XNDA 2WKQA 2P67A 4EPTA 1OYWA 2N46A 2ZR0A 1F2TB 3DEFA 2YC2C 3Q8XB 3TUIC 3U4QA 1OXXK 2H1LA 1FQJA 1DAIA 1LF5A 1RPZA 1EFHA 4NPHA 1VQ4B 3C5HA 4BFXA 1R5BA 1COWA 1OHHD 4F4IA 3B2EA 1OXSC 1Z2AA 3U5ZB 1IXSB 2VO1A 1G8GA 1M6NA 4HB3A 3UMRA 2HYIC 1FRQA 3EPKA 2Q9BA 1UKEA 1YZNA 4BFZA 1D9ZA 4OHYA 5K8IA 3OHMA 1E79D 1NKTA 1K5GA 4MGKR 2XNDD 5C4GB 1SVLA 4B2IA 1UBCA 1HY3A 1H42A 1VQ9B 3RANA 2ZYUX 2BBOA 4ZV4A 4CT4B 4GPTA 2HXYA 3R8FA 2R6HA 3W2GA 2ZRKA 1H8HD 1TVCA 2PX3A 4ASUD 5DO9A 4OHXA 2JLRA 1Q82D 2OCBA 1U8YA 5KSWB 2BBWA 2D4HA 3BRWD 3L0SA 3MWJA 1BS1A 1E2JA 2C2HA 4XD7D 5DI9A 1AGRA 4DCSA 3R9XA 1KAOA 3W3ZB 4PXAA 5DYIA 2BM1A 1FNDA 1VCNA 1OSNA 1GZSA 2IF2A 3K0AB 4IVQA 2BMJA 2NO6A 4DIEA 2QE7A 3K8YA 1DVRA 3CRMA 1ETUA 3G6EB 2VQSA 2QEQA 1FP7A 1PLKA 4M8NE 1XCPA 1EX6A 1XZQA 2A5DA 1BX1A 2EVWX 4Q4JA 3VFDA 5F9FA 3HYRA 2GDJA 5JRJA 1IJEA 1ZM9A 1MO5A 4XSGA 1AIPA 3S1AA 3A1UA 2GCOB 4A82A 1NVWQ 1CR1A 3GQBA 4DEYA 4YXWA 3CR8A 1XEWY 1NIPA 4MGIR 2FFBA 3UPUA 1ZM3A 3IILA 5A5GA 4DHEA 1KDRA 2ZI5A 1W4CA 1OKKD 1Z2CA 3G5UA 4P32A 1UM8A 3WYAA 3OJWA 3W5IA 1G291 1AJEA 2XXAB 3CPEA 1AS0A 3AKDA 3UG7A 4LBWA 1KMHA 1G7CA 3G4SB 2O52A 2Z6VA 2RH5A 5UKDA 3WNCA 3A4LA 1VQMB 4NYJR 4YALA 4GL2A 1NMXA 2AD5A 2R6FA 3PR1A 4B3DA 5JSZB 1E2PA 3LDAA 2JLWA 2ZAOA 3SYKA 5KDOA 4A8JA 2ODNA 2WJHA 3OFND 3CCLB 3GJ7A 3VKWA 1FNNA 1NN0A 3B1WA 5CJ2A 3U7GA 1E0KA 1M7HA 3TAHA 3WMGA 1KI4A 2AFIE 1E1QA 4FMBB 4LHYA 1ZD8A 1KK0A 4HAXA 3T34A 4HB0A 3U7HB 3AKCA 3THXB 3DDCA 1I7PA 2NO9A 1EK0A 5JJKA 1SVOA 1YJNB 3AVUA 3CIOA 1XTKA 1CJKC 2XOKA 3JZMA 3QJYA 3F5FA 4G01B 2PJRA 2IEYA 1TQ4A 1GWNA 3I8SA 4BWYA 1ZUHA 4ARZB 1P62B 4HAYA 5DHFA 1T3HA 2RMKA 4YAFA 1LV7A 1ZP6A 3EZ9A 4PAQA 4MYTA 5KNDA 1E4YA 3NEYA 2WJYA 3KXLA 2XGJA 2QM8A 4MYHA 4Q9HA 2D62A 1ZNWA 3Q85A 4JKIA 4YDHB 3FFBA 2H5EA 3T5GA 1GJRA 4UKDA 3TH5A 3A1VA 5FI0B 1KO4A 4TLEA 1N25A 1WMSA 1N6OA 4GNKA 3WHKA 1S2MA 4I99A 4K8OA 3U3JA 1JNYA 1N6RA 4V0ME 3RSOA 1VQ5B 4NDZA 2ZS7A 4DLTA 3BFVA 2VF7A 4B76A 3PEYA 1N6PA 1NN1A 2DR3A 3EG5A 3WYGA 3CF0A 1JR3A 4K46A 3ECCA 5SZKB 4QL3A 1A2KC 1KAGA 2FMXA 2RGBA 1G4AE 3Q72A 3TK1A 1OH6A 2RGXA 3KTAB 3CRZA 1N6KA 2FU5C 2JCSA 5CYOA 2BKEA 2QGNA 4Q4AA 4XVUA 5EP2A 3CCMB 5A0FA 2O8BA 4RD3A 2OBLA 2QEXB 3PQCA 1HE1C 3B1XA 1Z08A 3L0IB 3GLFA 1W0KA 2OBNA 3ZBUA 3LBIA 421PA 4P6VF 2PZGA 4I81A 3F8TA 1RRFA 3ZYCA 4R98A 3TRFA 5HCIA 2VP0A 1YRBA 4H1VA 4TSFD 221PA 3CF2A 1VCMA 1T9HA 5AR1A 3GLIA 2GCPA 6Q21A 5J4LA 3CBQA 1J90A 3JVUA 2QM7A 1ZVQA 1E9EA 5JBQA 3K0CC 2EQBA 3SYNA 4PPQA 4CEIA 1G18A 4OK6A 5TY0A 1Q81D 1OLOA 3AV0B 1U0HC 1W44A 4DCUA 5HKKA 2CK3A 4RZ2A 2F9MA 2C9CA 4NYJQ 4B74A 4Q1AA 1CTQA 2ZJBA 4HAWA 2R2AA 3UMFA 1D1NA 2FZLA 2ZANA 1VPLA 1P72A 1CNEA 2EIXA 4G5QA 1VYTA 1ESNA 4W7SA 1FNCA 3AB3A 1E1QD 2OESA 5EE1A 1QX4A 3T1QA 4JJZA 1SKQA 3V76A 1YIJB 4MDFA 4MRRA 1GRRA 1LS1A 2ZEJA 4PGOA 1Z6YA 4R71A 4LOAA 4AF6A 1D8TA 1VQ7B 3TSZA 2B7BA 3VR4A 4WOPA 4QM7A 5CB6A 1JR3E 1KMQA 5BN5A 1NVUQ 2HXSA 3MMPA 1PLLA 2V7QD 2ZRPA 2R6GA 3EASA 3BBPA 2IBMA 3JZAA 4TL8A 3U3MA 4B2PA 4CEHB 2QY9A 2X77A 1KSGA 3SEAA 3VMFA 2CE2X 2DFTA 3PCRB 1RE0A 4D4MA 2GVDC 4HUTA 1ZIPA 2YWHA 1CR0A 1BQEA 1GVHA 5J47A 4D80A 5DH9A 1Z0JA 4B44A 1ZRHA 1W0KD 1GITA 2AL7A 3KDSE 4WW0A 3U3OA 4I4LA 3TMKA 5BW8A 2FPKA 4HAZA 1G64A 2NGRA 3EPLA 2WJJA 4ZI3A 3BERA 1NY6A 1R7RA 1P9RA 2W6JD 4Q1FA 4M1OA 2IUSA 1GAJA 3RS3A 5CLQA 3JQPA 3HWSA 4HUQB 4CZ2A 3G82C 3W5HA 4PC6A 1EWRA 1US8B 3FKSA 4TQUS 1GVNB 2ZQ5A 1S3SA 3IGFA 1ZW6A 3CNLA 4WZ6A 4TZ6A 5DYGA 1UEIA 3OEHA 4JSYA 5E3HA 2D7CA 2MMCA 1LW7A 2G88A 2IHBA 2FEMA 1VYVA 1E69A 3AEZA 4ZGQB 2JJ2A 3QXJA 3SHFA 4GBMA 4Z51A 1SQ5A 4AG6A 5JCPA 4PTLA 1NSTA 2IS6A 2B92A 1OH8A 4JVNA 2ZR7A 5DGXA 1P9WA 5DI3A 2H16A 3U6BA 1DTSA 3FMFA 1XB2A 1UKZA 5LB2A 2IS2A 2AX4A 2ZSBA 3NHBA 3QBVA 2PH1A 5DNYB 1GKUB 1VKJA 1FQKA 1XEFA 1U8AA 4V03A 3W6NA 3JVVA 4LPSA 3TIFA 1NVXQ 2O8DB 5DN6A 3RRNA 3PVSA 2J45A 1W36D 4GMDA 1N5KA 1YJ9B 3QXXA 4AIIA 3EWAA 4X8MA 4AD8A 2O0HA 1FL9A 1R5OA 2V54A 3I73A 5L3SA 5KPDA 2GXUA 2GJ9A 1Q7YD 3FDIA 1NSFA 4DLZA 2WWIA 3TLXA 1N0WA 2I1VB 1Z6GA 4FN5A 2VTKA 4WA7A 4XJXA 2FOLA 1R8SA 1TQ2A 3PUYA 5FBQB 4RZXA 2G9NA 1E2LA 3CPHA 3AP2A 1KQSB 5C4MA 1KD1D 4I1UA 2ASEA 2JDIA 2X19A 2GXAA 4B35A 2AD1A 1B2RA 2WWXA 5J5CA 4BECA 2J7KA 2WICA 5E4FA 5P21A 4Z1MA 2WAXA 2X2FA 4URXR 3UIEA 1VHTA 3ONWA 4LV5B 2P2LA 4LYAA 3THYA 3PJRA 1CJTC 4IOLA 1QBKC 1D9XA 2C5LA 2BEKA 2CLDX 5SZHB 1E9BA 1EX7A 3HP1A 3M1IA 1DDIA 2L0XA 2QPOA 4TT3A 2QTZA 4PHGA 5FBWB 3OZXA 2CCJA 1E63A 4OQLA 3EX7C 2CVHA 4RSGA 3SHWA 1MRSA 1R0XA 4FK8A 1MR3F 2BIFA 5C46F 1QHGA 1SHZA 2FPMA 1ZNYA 2RGNC 5FL7A 1QVRA 3NHAA 2OLKA 3TAUA 3IPXA 1FNMA 1DADA 3SYLA 2XAUA 3IHWA 1KK2A 1NLFA 4QGFA 3FJOA 3W3AA 1F5NA 3C5CA 3QI2A 2JATA 4W5HA 1H65A 5GV8A 3QFSA 1AMOA 1Q20A 2AWOA 3QF7A 2B8TA 4P0TA 2HYDA 3VHXA 5AUPB 4MRSA 4ZPXA 1D5CA 4KODA 3QSYA 1ODFA 3TW8B 2QE7D 2WIBA 2YJTD 4M21A 4Q9LA 4US2R 2P3SA 4PO8A 4PC2A 2Q9CA 2IUUA 5JJIA 2QG6A 5IT5A 2IWHA 4HZIA 2PBRA 3VU9A 3QE2A 1F20A 3EW9A 4HDQB 2WWYA 3K1JA 5BQ5A 2D7DA 2G0NA 3QFRA 1T5IA 1W0JA 3AVVA 1A1VA 4IKEA 2QN6A 2IS4A 1PLJA 2O8DA 1BX0A 2DWQA 1ZC3A 4V0KA 4DUGD 2WSMA 2RC6A 4QNMA 3ADBA 3P4XA 4HDOB 1SVKA 4QHSA 4CEHA 3HYTA 4OQMA 1RYHA 2Q9AA 3EZ6A 4D6PA 5CK4A 4QHYA 3C15C 3A1WA 3UWOA 2QP9X 1VCIA 4GDFA 2GETA 1W2GA 4L4UA 2GJAA 3LA6A 1AN0A 1KKMA 1VG0B 3EZ7A 1VQOB 1Q22A 3V00A 4B3BA 1NG9A 1W36C 1ZU5A 1OGIA 3VR5A 2ZI7A 1A82A 1NF3A 1O3YA 5DLQC 4FINA 5BYJA 3J81k 1XZPA 5EE3A 1V5WA 3W6OA 4EFMA 1W0JD 4I1VA 1WBDA 2GXQA 2B21A 3L8YA 1W48A 4KFSA 4M1MA 4AURA 5BXQC 3L82B 4F38A 4P33A 4Q7MB 2B7CA 1G8FA 3QKTA 4EJSB 2ORWA 1X8JA 3GJ6A 1EP1B 4OHWA 4LV8B 3SJCA 3X1ZA 3SFVA 1XMVA 5EMNA 1IHUA 3D7MA 4ESHA 4LJYA 4ASUA 3GLIB 1IBRA 4DLXA 1AZSC 5GVSA 1UAAA 3DHWC 4YLGA 4B71A 5DSZA 2QAGC 4MUAA 1GUAA 2WJIA 4C0SA 2EU8A 2ZYWX 3PUXA 1WA5A 3SN6A 3CD6B 3AUYA 3M6AA 5GADl 1E79A 1K5DA 3GJXC 3VKHA 1ZD9A 4P4TA 1W1WA 4EQ6A 3MJHA 3CC4B 1BOFA 2VBCA 4EJSA 2XNCA 3OESA 1CJMA 2IEZA 3E1SA 4MITA 1D2EA 5D3QA 2PX0A 2GQFA 4HLUA 2DB3A 2OCPA 4TMTA 3MHPA 2RAPA 1CLUA 1EWQA 4BRUA 3GLFE 2GNOA 4BE7B 1ZCAA 1GNRA 1ZYUA 4B3FX 3I4LA 3CH4B 2QUZA 2ECKA 5E95A 1FPMA 1ZU4A 3I61A 2DWOA 3LO8A 4ITRC 4DDVA 3FTQA 1XNJA 5M04A 3T15A 2R62A 4ZO4A 1UJ2A 5B30A 1HTWA 5AUQA 1JA0A 1HA3A 3SOPA 2MMGA 1GAWA 1G1MA 1G5TA 3U2QA 3DVLA 4RY2A 3B60A 1QGAA 4TYQA 4AF7A 1X8KA 4BASA 4LCBA 4PZYA 4OK5A 2VH5R 3QVVA 3HU3A 3PUVA 4PC3A 1E2NA 2YZ2A 3EA5A 1E64A 3ZZTA 2EFDB 1VIAA 1XD9A 2O8CB 4LBZA 1XXHB 2XSZD 2ZRNA 3NKVA 3TNFA 3K70C 3LQRA 2W00A 3BOSA 1W2HA 3MWLA 4YONB 2E1RA 3FMOB 4WIAA 3U4QB 1CEEA 4A2WA 1XX6A 2ZREA 3NBZC 4W9MC 3ZZUA 1FMJA 2I4IA 4QC2A 4DB2A 2DWPA 1U0JA 2KE5A 2CHVA 1KZGB 3H1TA 4KV9A 1XD2A 2J0UA 2GZDA 3P32A 4X8HA 5HE8A 5H70A 3UKDA 5J4HA 2QP3A 1NIJA 1QFYA 5JMTA 4XTCS 4B33A 5FBRB 1W4BA 2J0QA 2XNSA 3REFA 1G16A 3EC1A 1JJ2B 5HKKD 3EZ2A 4ACBA 1GKIA 1NN5A 4G1UC 1N8RD 5L3QA 1WE2A 1C4OA 4EFNA 1V43A 5KSPA 2A7QA 2C99A 5LDDC 4L8GA 2XSZA 3UG6A 4XVRA 1BJKA 2BGJA 1DG3A 2OK7A 5FR2A 2IF0A 2QBYB 4S2EA 4TQAA 3CCVB 3K0CA 4O25A 1IAQA 4UNSA 1PUJA 1W34A 2ZRAA 2ZIAA 3REGA 1YE8A 1YZTA 2GAOA 4QJ5A 2VEDA 1ZM4A 2QSYA 4D0LB 2REBA 1NBMD 2PEYA 4C2UA 1ESMA 1VECA 1GSIA 2ZAMA 3PEWA 1HURA 2FH5B 2ZM5A 4O2RA 3QKSB 2IXGA 5CDFE 3VR1A 1M74A 4XH9B 4ZKEA 1XFAA 3OAAD 2DPXA 1T8UA 3MGCA 5FH9A 3SNHA 3SZRA 1T3SA 2OCAA 2ZRBA 2YVUA 2VP9A 1U8ZA 4A8JC 3OE7D 4JJKA 4LZZA 1QDEA 5CITA 5E7JA 3BIFA 1TUEA 4I1SA 1OB2A 3B78A 4LYFA 4IDQA 3TR0A 5BN4A 4B3XA 1DO2A 4OJKA 3GLHE 4WXRA 3I55B 4DDTA 2J7PA 2PCJA 4FWTA 1OB5A 1JR3D 5G3YA 1TUIA 3ND8A 3QOFA 1L7VC 2IX3A 1G3QA 1FFHA 5EZ5A 2OEPA 3R7WA 3NXSA 3LW8A 3QY0A 5E7MA 2J87A 5GJBA 2W2XA 4TZ0A 4GP7A 4MA4A 4TLBA 4TQ9A 1AM4D 2NO7A 5GJVC 1GNQA 2JLSA 4CYMA 5CLLA 3OF5A 2EWVA 4NU0A 1CU1A 5F3WB 4HI0E 4IDPA 1OFHA 1DARA 4DB4A 4A2QA 4CW7A 1DAKA 2R9VA 2QTFA 4ON9A 2FF7A 2AK2A 1QG0A 3ZVLA 2IYSA 4FMCB 4EAQA 4TTQA 1U0LA 1DS6A 3GLIE 2QBYA 3ZS8A 3Q5EA 1H8ED 1S1CA 1BH2A 1T8TA 1KIMA 4B6FA 4RD2A 4Y9UA 4C0HA 3GLGA 3D3QA 4A0HA 4ZDIA 2OBMA 3ZLJA 2WPDD 5CM9C 3OJXA 1H85A 4IFBA 1E0AA 3ZS9A 2ONKA 2YWEA 2GKSA 1G7RA 1F2TA 3C4JA 5FUYA 3W9YA 4QNRA 4EPWA 1OH5A 1XMSA 4DLVA 2C98A 1EFRD 3KQUA 2ZRMA 4KVGA 4PSVA 1VQPB 2FSGA 5H5JA 5EE0A 2OM2A 4ZKDA 2ODEA 4DCNA 4EFLA 4CEJB 3U44A 2WJVA 1KKLA 2ATVA 3LV8A 2V9PA 2KJQA 3ZH9B 4KO8A 3GLHA 821PA 4JT4A 3KB2A 4N3GA 2NG1A 3RAPR 3U7FB 4OBEA 1IJFA 2GHIA 4KXFB 4L16A 2NQ2C 2IYVA 2VHCA 3GEHA 3K70B 4PC1A 1A7JA 3KL4A 1Z29A 2D74A 3AH8A 3H2YA 4CT5A 1IM2A 3HPRA 3W2HA 2QSZA 2FV8A 5GJWC 3ASYA 4BFSA 1HH4A 5JECA 1M34E 3X1YA 4NP6A 2DERA 3HJNA 3K09A 3CX6A 1UBGA 1O87A 2LKCA 4A6PA 4BZXA 1R0WA 4A8JB 1K8AD 3BH6A 3AF2A 3T1TA 2V1UA 3LH5A 2O8FA 1D2NA 4PO9A 4Q18A 5F9HA 2CNDA 4LPKA 4YAOA 5KSOA 1R4AA 4DC9A 1IN5A 3RABA 1JECA 2FSFA 4MKIA 5H8WA 1ELOA 1DPFA 3GD7A 4KBGA 5TVKA 3DO6A 4A2PA 1H8HA 3VNVA 2RGCA 3V4FA 2GBLA 2VNKA 2IYTA 4D4LA 1XD2B 1VIYA 4Q9KA 5CIQA 2CLCX 3GP8A 1XTJA 3ZGXA 3B1ZA 3DZDA 3AVYA 4Q9IA 1KJYA 4EPRA 3KXIA 4FWIB 5AJWA 3V9PA 2GCOA 1QG2A 2HLDD 3CKLA 4XD7A 2RC5A 1P5ZB 2ZUBA 3AP3A 4Q4JB 1EFUA 4LHZA 4TLAA 4URYR 3HU2A 2BBSA 3EIQA 2YWGA 2R8RA 1UPTA 2VSXA 2QENA 5KUTA 3RNLA 2XJ9A 1EFTA 4EJSC 2WZQA 3QKUA 1OYYA 1IOZA 5G41A 3VX4A 4A4DA 4A36A 4MDEA 1NJGA 2REOA 1RZ3A 3H0KA 2W6ID 4RJLA 3LO5A 4IW3B 1KZ7B 1XTQA 2PCLA 2VPPA 3DM5A 4RKFA 3W6PA 5L3QB 3N5CA 4PO1A 3SFZA 2VNIA 2EW1A 1KDOA 3QG5A 4N3NA 1EFCA 1E9AA 4E03A 2D3WA 4B32A 4GRAA 3P1JA 5HR5A 4RFSB 3KJHA 3N70A 1COWD 3KTAA 4HAUA 4MYUA 3AGQA 2XB4A 4DT1A 3O47A 2Z43A 4OYHA 4M4SA 4MRPA 1CQXA 1SXJA 1E9FA 3I92A 3K9HA 1QHIA 3CLVA 4QGHA 2IYZA 3BB1A 2FNAA 2FA9A 1YHQB 2A30A 2QMOA 1R6BX 1Z47A 4V0MA 3OZUA 2D2EA 1IY2A 1A8PA 4IFEA 2V55B 2IYXA 1Z0KA 1HQYE 3LX5A 1W46A 4TMXA 4LGMA 3IEVA 4OKSA 1E2IA 1Z0DA 3CCJB 2PT7A 2BMFA 2BVNA 1S3GA 2ZYVX 4DEXA 4G1VA 3LQQA 4LV6A 1EP3B 1ZNZA 1GM5A 3NBYC 3GPLA 2PIAA 4ZCLA 3W5VA 1P7CA 2WMOB 3FOZA 5DISB 3B1VA 2PLRA 2BWJA 3K9GA 4CF7A 2ZSDA 3AVXA 5EP1A 1M90D 4Z1MD 2QTLA 4RD1A 4ZCMA 1G4UR 2RB4A 4KSBA 4BUJA 2ZITA 1VHLA 4UJ5A 4B3GA 3WMEA 4DQLA 1U98A 3B85A 4LHWA 1HV8A 3IQWA 1I4DD 1JB1A 5CYPA 1UKYA 1NJID 1WDTA 2ZRJA 5BYKA 1Z6AA 4CVNA 1W2BB 4NZYA 1NNEA 5JI3E 2ZSFA 4BLRA 1IN4A 4TMZA 1K8RA 2JLQA 1JA1A 3T06B 4IRUB 4GZLA 2GF9A 4B75A 3GJ0A 4OI4A 1ONBA 2BJVA 3TBKA 2HF8A 3WYFA 4BQSA 2C96A 2OZEA 4LY6A 1LB1B 1MRNA 2WKPA 3TVDA 5SZJA 2OFXA 4A15A 4S35A 1SVSA 4IXNA 2WOOA 5C18A 2G83A 1YITB 4D4JA 4Q66C 1N0VC 1FUUA 5BWMA 4JIMA 2YV5A 2BSAA 3GMTA 1Z83A 4TLDA 1YR6A 2R44A 1L8QA 3IIMA 3A1TA 1J8MF 2Z4SA 4HLUC 1J9ZA 4EPXA 3CM0A 2QTVB 1I4TD 4DSTA 1DDGA 4FIDA 1VDZA 2BC9A 3CRW1 3EIEA 2ZUCA 5IK2A 2A9KA 5EZ6B 2HMAA 4URZR 3ZIAD 4FMCF 5D3MA 1NL3A 4BLOA 3ADKA 3SDZA 5CJPA 2CHQA 1Z63A 1GRQA 4YHBA 1FZQA 1KI3A 4XWOA 4XWKA 4C0JA 2GEDA 3IQXA 3WRXC 3U60B 4BFTA 4P4SA 2QI9C 4Z54A 2QQ0A 3B9QA 2MSCB 5TR9A 2CE7A 2JJ8A 4LUCA 1JQLB 2GK7A 2X3UA 2OE2A 2A5YB 1OXTA 3AKEA 4OJQA 1VCOA 2HCJB 5AJZA 3VNUA 4NCNA 2X8AA 3I1FA 1Q3HA 4IDNA 3CX8A 2AKAB 2AWNA 2R6DA 1N6IA 4TWZA 4KLNA 2NOAA 3SS8A 2BN4A 2F1RA 2HJVA 2GCNA 2LKDA 5KDDA 5B57C 1EESA 4ZDWA 3W2FA 4FD2A 2BMDA 1Q1BA 1BYIA 4C0BA 1FNBA 4PAMA 4GOJA 3PENA 4TTPA 2OT3B 4YMSA 1NVVR 4LC1A 4IVPA 1IXRC 2CHGA 3X1XA 1YR9A 1YVDA 4JLKA 2GPJA 1AA9A 3CB4A 1F3OA 1YKSA 4JLDA 8OHMA 2CL7X 5KYKA 3QQ5A 5LPNA 2RGEA 3KXKA 1S8FA 4KVAA 4UQOA 2ZRCA 5EP4A 4UXIA 3X1DA 4B47A 5FPKA 1KNXA 2DFNA 1E0JA 4KI0A 3KKMA 4HYYA 2TMKA 1I2MA 3W2EA 4KFRA 1A4RA 3TVTA 1QFZA 4FCWA 3C7KA 2ONJA 1S1MA 4PHTA 4QKQA 2ZRHA 2PMDA 5JS7A 2H57A 5KTYA 1GL7A 2V7QA 4X8OA 4Z8XA 5C2JB 1LF0A 3U61B 2ZRFA 2CDNA 1Y3AA 2GRJA 1Q57A 3RC8A 1R0YA 3CMAB 3QPWA 4UNQA 4LHVA 1KK3A 2GAAA 3R9IA 2GF0A 2IYYA 4L9WA 4PSKA 2A78A 3QVUA 4CIDA 1XU4A 4D82A 2CNWD 2ANCA 1VQ6B 1GL6A 2QGZA 4MKGA 3RLFA 1FRNA 5B64A 1EP2B 1BMFD 2ZRLA 3C14C 4M22A 2W58A 3I8XA 4Q1EA 2O8EA 1WCV1 3E5HA 4J0QA 1G3MA 1L4YA 5JCZA 3KQHA 3KQKA 2XTZA 3Q9LA 2ODBA 3T12A 3QUSA 3BC1A 3O8DA 1LTQA 3I62A 4PZZA 2Q3HA 2XZOA 4HLQB 2ZRGA 4Q7LA 2VHJA 4ZDKA 1G3UA 1N3BA 1PZNA 2J0VA 2WOJA 1G9XA 1TL7C 1Z0IA 3MLEA 4EKDA 4U5XA 1Z0AA 3LLMA 5AJVB 1G7TA 1XPOA 1NBMA 1VMAA 3OFNA 4EH1A 1K73D 4BLTA 1JAIA 4EIWA 4AKHA 4ZGNB 1GO2A 1E3MA 2ERYA 2UVQA 2AHOA 2JLUA 4NHOA 1G5PA 3BB4A 4C30A 1GG2A 4OHVA 3TQCA 4D0GA 3LW7A 3W8NA 1N2CE 1QRAA 1DAFA 1P3JA 5FR1A 5FBLB 2QL6A 2E9SA 3LAWA 1MABA 1OXUA 2C95A 2HJGA 3KKOA 2XTMA 5CK5A 5KNBA 1T5LA 4Q1BA 3CR7A 2W0MA 1WF3A 2QZ4A 2UKDA 1I2DA 5EP3A 5J4KA 5K8TA 2BEJA 3GJ8A 1TX4B 1T0JB 5H68A 4XIGS 3RSLA 1E4VA 3MG9A 3OEEA 4IOKA 3HR8A 4IEEA 4FCVA 5JI2E 1UBEA 2QORA 5DN6D 2ZU6A 4D0NA 5JLJA 1UF9A 1G5RA 3PV0A 3K09C 3I32A 3RS4A 3EZFA 2OAP1 4KJZA 4QM6A 4I1OA 3WP1B 3QEJA 2WBLC 3QBTA 1X1SA 3WY9A 1YJWB 1P73A 3QEOA 3C8UA 5G40A 2ZI6A 1NJFA 3ADDA 2D06A 5JWRA 1E99A 2O8FB 4M9XA 2ZVQX 4UXJA 2LCFA 2C77A 2GVZC 3AF1A 3TSWA 4FW9A 3EPHA 2W2VA 2GESA 3K53A 1JALA 2ZJAA 4Q7KA 1MABB 3BK7A 1XBTA 1MO3A 1R2QA 5A4JA 4TSFA 2VHQA 3UWKA 2O8CA 4Q5IA 2G6BA 1XWIA 4IDHA 4BZPA 2G1JA 4II7A 1Q0UA 2CK3D 4PZLA 3SBEA 3CRQA 4KU4A 3NVAA 2ZRIA 2HT6A 3OEHD 3QKRA 5J4VA 4JVMA 5H1YA 1PVOA 5L3VA 1YZQA 3GLHB 4Q19A 1T6NA 3M4YA 1K6MA 4Q4HB 1BYUA 1IY0A 2MSDB 3U44B 3FHCB 2ZUDA 1GFIA 2O0KA 3GEIA 1AQYA 1QVAA 4AYWA 2XB2A 2WWGA 4E07A 2WVJA 5LD2C 2G3YA 4WVFA 3SC3A 2GK6A 2GBLC 5FTJA 3OAAA 1XDBA 3ICQB 2ZVPX 1W4RA 4RFVA 3THYB 4JBYA 2WJGA 4Q03A 3DKVA 3JQQA 3UMSA 1Q86D 1X8LA 4V02A 2C9YA 3AVQA 4M1TA 1XTRA 1DAGA 2JDID 2VSFA 2JIZA 4FMDB 4WBSA 3VR3A 2ERXA 5JZVA 4RD0A 1YR8A 2QAJA 1VG9B 4LJAA 2WKRA 1OW3B 4PX9A 1GAQA 2CNWA 1J7KA 4HLDA 4OK3A 1L4UA 4PR0A 2HF9A 3E20A 4HE6A 1KO1A 2VP2A 3TGPA 4K1XA 4BEJA 1XJCA 3QKSA 3RWOA 2GJSA 4XOIA 4AKIA 1Q21A 5KNCA 5HCNA 2F1HA 1MO6A 4OHZA 4HZUA 4YMVA 1ZMXA 1U2RA 3ICEA 3IIKA 3WHLA 2P6NA 4MH0R 2QT1A 4F92B 3JQRA 1Z5ZA 3CONA 5FOWA 3S1AB 3CPJB 1N6NA 1RKBA 4IVRA 5JSZA 4EPVA 4TN1A 3VAAA 2NMVA 2J46A 3TJZA 5FUXA 2IK8A 2XTNA 4JVLA 1TEXA 3W34A 1W4AA 3PIRA 4AC9A 3A58B 3DMNA 3SBDA 1VG8A 2JLYA 3UXMA 1X3SA 2YOFA 3ND9A 3B9PA 4IHQA 1KJZA 1DELA 2ZI3A 5HZKA 5JEDA 3NTUA 2WMNB 5EJEA 3ZD6A 4UAJA 1SXJD 4V0NA 4DSNA 3K70D 2VP6A 2Z4RA 1I4LD 1S0UA 2BMWA 4YAWA 3FMPB 3LRPA 4IOMA 4JLNA 4U00A 3B82A 3KJGA 3CW2A 1XEWX 2K5UA 1VQLB 2HUPA 3NWJA 2IC5A 1E2QA 1KI9A 2JLZA 2W6JA 1YQTA 1FDRA 3FKQA 1SZPA 2BPOA 3CWQA 1ZUNB 4G5GA 4URWR 1YRAA 1RFLA 3BXZA 1EWYA 3LVQE 3L43A 3IIJA 2FZ4A 2H7VA 1QHHB 4NYMR 5CIWA 2QU8A 4LSGA 1JXMA 5EXPA 2HLDA 1SHKA 1YZKA 3MJRA 4YQFA 3NDBB 4Q01A 1SKYE 1KI8A 1CNFA 4YAUA 3H84A 4Q21A 2F1IA 4LI0A 4DSUA 1ZC4A 3QPVA 1E9CA 1E2DA 1X6VA 2PL3A 4NYIR 3LD9A 4KITB 4C7OA 3BAFA 1E2KA 3CO5A 2NPIA 2Q21A 3AKYA 1N5LA 4HEJA 5BN3A 2GWHA 2VP4A 4BLPA 3IBGA 3B5JA 3OW2B 4OL0A 2W6IA 3LNCA 4ERNA 3H86A 1KI6A 4PPGA 3EPJA 1Q12A 1NMZA 3KFXA 3UATA 3X1WA 1IN6A 1G8PA 1UEJA 2A5GA 3R20A 4BFVA 1ANKA 1II8A 2BM0A 2NO1A 1QFJA 4Q1CA 4DLWA 2QRNA 4KYUA 3BJIC 4HSEA 2AXPA 2PLFA 3W5JA 2BOVA 5DIFA 3AGPA 4TYWA 4D2IA 2VYFA 2F43B 2C03A 1GOTA 3EAQA 1KNQA 3AF3A 4LDJA 2HEIA 1ZIOA 1FMLA 4BLSA 4EDHA 2CMKA 2FPLA 4P3YA 2JJ1D 4HZUB 2JASA 4DQKA 2F1JA 5FL7D 2QQEA 4WAUA 2BCJQ 1XMJA 1SXJE 1M2OB 1DOAA 4YDSA 1AKEA 5KPJA 5AN9A 4QGAA 4ABYA 1Z8FA 2IYLD 4QBFA 3W8RA 1N6HA 2R6CA 4MRNA 2RGNA 1QHNA 1DAEA 2D2FA 2VIIA 4AYXA 4CDGA 2J1LA 5KO2A 5DE3A 4A6XA 1TADA 4FI3C 1DEKA 2H18A 4QGGA 4TYPA 5FUVA 1HT1E 1E96A 4RCZA 5C1BA 2DBYA 1II9A 1KSFX 4DLUA 1LS6A 2OO7A 2CLSA 2REXB 1N5IA 1XEXB 2DHRA 2UZIR 4DT1B 4GOKA 4RKEA 2QAGA 3MWKA 1W47A 2BBTA 3KUDA 3QE0A 1E2MA 3B6EA 1MO4A 2WAYA 3ZQJA 2CXXA 2WWHA 4LJ7A 4YC7A 3TR5A 2Z0MA 3MD0A 3PEVA 4JL8A 3GLFB 2DY1A 1L2TA 4DLRA 2FE4A 3I72A 3BH0A 3DMDA 3NH9A 1NBME 3C41J 3N2EA 4P4SB 2JAQA 3RS5A 1GKYA 2HDNB 1QF9A 4NBSA 4OQFA 1QUEA 3QXCA 2OSBA 1HUQA 2BCGY 4NCKA 5DHAA 4YMWA 3D6TB 4NCIA 4LRWA 3OIVA 5GJCA 4F4JA 3KFVA 2WWWA 2ORIA 4O0MA 1U94A 3BS4A 2VYQA 1XXHA 2DFLA 2ZE6A 3FVQA 4C4PA 3R9WA 4N0EA 4IDOA 4QBIA 3U6KA 4WXPA 2EFCB 3FYHA 1WP9A 1OF1A 4DBLC 1FTNA 4QRHA 4Y0AA 1T3LA 1OFIA 2HV8A 2WTUA 2O8EB 3SE0A 3I5XA 4BPRA 2JGNA 1U9IA 3E2IA 1SXJB 1NLZA 4OQNA 1JQJC 3GJ5A 2BHRA 2QROA 1IY1A 1VQNB 3FB4A 4JBWA 1PV4A 1QG4A 4KCGA 1CJVC 3ES9A 1JJVA 5FOXA 2ZJ2A 1T4GA 3Q3JB 3IUYA 3W5UA 4JYCA 3OIWA 4B73A 4A9AA 1M7BA 1XMIA 3LVRE 1KI1A 4R9UC 1OIXA 4R2IA 2JIZD 3DPUA 5JWHA 3RS7A 1OPXA 4WQMA 2VL7A 1E62A 4ARZA 1NKSA 5FBVB 4IOJA 2VA8A 5GV7A 4TMWA 3QF4A 4DJTA 1YR7A 1Z06A 2ZXUA 4O2LA 3THXA 2G0TA 4GT1A 1X1RA 3IKJA 1KYIA 1M8PA 1SKYB 1NG1A 2QT0A 3FHOA 2IS1A 1QHSA 1II0A 4C0LA 2FEOA 1IXZA 1E2HA 3IPYA 2PMKA 3ETLA 4OI2A 4KBFA 2CVFA 1FOEB 3SR0A 2QA4B 2ZI9A 3OE7A 4PHHA 3T1VA 1QGYA 3ZBTA 2O0JA 4IEIA 3SI7A 5IF9A 2QMUA 3QIAA 1CKEA 2YOGA 1E9RA 1JJ7A 1M1YE 2QP4A 2ZS9A 3UK6A 4LHXA 4KFUA 4H9GA 2CL6X 2F3TA 3VKGA 2WV9A 3LFUA 5TDHA 3FPKA 1CRQA 1S96A 3LY5A 2ZE7A 4LYJA 3AF0A 2GJKA 1EXMA 2JJ1A 4DIDA 3QNUA 4HAVA 5EUQB 4A92A 1G6OA 3WRYC 2P5SA 3CNNA 2VZLA 2ZRDA 1S9DA 4LBVA 3A36A 2F9LA 2VNHA 2J3EA 3L2OB 4RVCA 4M1YA 1Q1ZA 1AZTA 1KGDA 2ZTSA 3O8BA 1MKYA 4QJ3A 4K81B 4BPBA 2JJ2D 1UMKA 4MGYR 4RZ3A 3NC1C 2OXRA 4QHTA 5FL3A 3W90A 3X2SA 4WZBE 2KI5A 2YWFA 1QHXA 4NE2A 4QXAA 4OI1A 4BEBA 4DXAA 5J4YA 4V0LA 2AN9A 1XJ0A 2OLJA 3K0AA 2OCYC 5EE9A 1AS2A 2I1QA 4PQYA 3A1SA 5IDVA 2QMEA 5TB5A 4PANA 3OZVA 2ANBA 3K9NA 4G5OA 5EE5B 3H4MA 4IXMA 4JLPA 4QOSA 3ZDQA 3U3RA 4B3CA 5D3MB 3HR7A 2A3RA 5JRZA 4Y7CA 3I3SR 4E22A 1ZUIA 4U02A 1W5TA 4AKEA 1B0UA 3K0FB 1QUFA 4MKHA 2VRWA 4L9SA 4GFDA 2PZFA 2DFKB 2H92A 2N1BA 4UNNA 3L0PA 4NONA 1TF7A 3RC3A 3AUXA 3TE6A 3EXAA 3KKQA 4YXWD 1R5NA 1F2UB 2Z83A 1US8A 4JSTA 1XE1A 2SHKA 1Z28A 2RGAA 5F2EA 3K0SA 2FDCA 4US0R 1RVDA 4JT2A 4QBHA 2VSOA 3R8CA 1CR2A 3E70C 4R7ZA 3GFTA 4DLYA 1DAHA 3O8CA 1A5TA 1Z0FA 4DVGA 3BE4A 1UDXA 2MSEB 3F0TA 3LBNA 1ZCBA 3QG1A 2NPFA 1GIAA 2GEVA 2Q3MA 2G1KA 5L3SB 3CCSB 1G8HA 1OE0A 1KSHA 3GJ3A 4JZKA 2H8KA 1TQDA 4PPNA 3BWDD 5FTKA 2I3BA 2RGDA 3L8ZA 1DG1G 1D6JA 1E0SA 2C9OA 2BKUA 5GVRA 4BFWA 5THXA 4H1UA 4HLCA 2OILA 1RRGA 1P4SA 1YZGA 4DWJA 1TU4A 2J7PD 2FX3A 1GTVA 1JPNA 1KI6B 3IHLA 2NO0A 1XEXA 1KRHA 3DOFA 1W36B 3T35A 3SQWA 4QJ4A 3KKNA 4MRVA 3LBHA 2ZSEA 2VP5A 4M1KA 2IYUA 4HUQA 1SVMA 3RDPA 3PXGA 4Q9JA 5K8LA 1CRPA 2FFAA 5FOUA 4C0QC 1XP8A 1HT2E 1AQUA 1XRJA 3RS2A 2P0EA 1PJRA 3CPWB 1N5JA 1EGAA 4MGZR 3E1YE 1CS4C 4U7DA 3RWMB 4PQFA 2NZ8A 1YI2B 4HB4A 4QFMA 4LJ5A 4OI0A 4LJ6A 5ELXA 4DKXA 1TF2A 5JFGA 1J8YF 1QHHA 2OFWA 4N0DA 5L3RA 3WBJA 3PFIA 1WQ1R 2AFHE 2N42A 3OZWA 1BO6A 1D2MA 1CULC 3FPAA 3CF6R 1G7SA 2WPDA 4G3XA 3WP0A 3G0HA 4M53A 3WBKA 1JEDA 1GL9B 1QHYA 1XD8A 3QXHA 5TARA 1H8EA 3K0EA 1QH0A 1OV4A 4UXHA 2GILA 4TL7A 2OK8A 3RRZA 4DSOA 1GRNA 5TV2A 4NYMQ 4D4KA 3B1YA 5JJLA 3CC2B 3M0EA 5FPYA 4JL5A 4LX0A 5HTKA 5HZHA 3NEJA 4ESVA 4M0LA 3MUFA 3KJIA 4E09A 3TKLA 2FWRA 1KO8A 4JMPA 1NN3A 5HXBA 1HE8B 5FOVA 3VHLB 2PT5A 3AVPA 4Q4LA 2AK3A 3R7WB 1G8YA 1S4QA 2J59A 2ZS8A 2ZJ8A 2XITA 1C1YA 3LXRA 3LWNA 2P6UA 2V1XA 1E94E 3P20A 3VQTA 3SU8A 4C0KA 1P75A 3Q5DA 4B2LA 5IHPA 1KO5A 3CRVA 4EPYA 4MYCA 2KSQA 1CP2A 4Q00A 4JBXA 4US1R 2EFGA 3VO1A 1KY2A 3FKSD 2IHYA 1P9NA 1UFQA 1VQ8B 1EG7A 4A0FA 5JS8A 4RCYA 4G0NA 1U81A 3ZC3A 3THWB 1GP2A 2AXNA 2X2EA 3NBFA 2OHFA 3U3KA 1TMKA 5FUWA 4G1BA 5KOYA 4O3MA 1N6LA 4ILEA 3T61A 4YMUA 4X8LA 5CB8A 2KBFA 2IXFA 1FX0B 2OG2A 3VR2A 2BJWA 3EC2A 4L15A 2ZJ5A 1SVIA 5FI1B 1VQKB 2ZJZA 2OTJB 1S9HA 5G53C 2QNRA 3KB1A 2XNJA 5TXGA 4LK2A 5JEEA 3KX2A 3SJZA 1XCMA 3UANA 2X1VA 2QAGB 2YNMA 1OIWA 2DCUA 2C04A 3QXSA 1OKKA 5EXXA 5AJXA 2EYUA 1KDPA 1Q1EA 3DKPA 3MWYW 2P6RA 2J5XA 4EQ6B 3QFTA 2W0SA 1QVFB 4JLVA 4F7DA 1SXJC 1YZUA 3PITA 2IA5A 1F48A 4JLAA 1G3IA 2JA1A 4A1FA 3THWA 4TYNA 1G21E 2FJUA 3T1OA 4GSYA 4UJ3A 4G5RA 2IUTA 1GR1A 1N0UA 3CXCB 2RGGA 2V4ZA 2PEZA 1FUKA 4FMDF 3DL0A 1G17A 4F7WA 3D31A 3CCEB 3T5DA 3Q7QA 1BKDR 1DBSA 1U90A 3EARA 4NH0A 2V6JA 4CEJA 1E9DA 1BIFA 3QFCA 1HQCA 4TMVA 2GZAA 2XOKD 1LNZA 2F43A 3QPUA 2WHXA 4XSHA 4IJMA 2CRVA 2GTPA 1LFDB 1DE0A 2VNJA 1TNDA 4D81A 4OQXA 1TQ6A 2B6HA 3EIHA 2O5VA 1P2SA 2LWIA 4F4CA 4TL9A 5H59A 1P2VA 4D26A 4C9BA 2GJ8A 3HDTA 4Q48A 1W35A 1KI7A 2IYRA 4Q1DA 1CF4A 4DCTA 4M1SA 4UNRA 1Z6TA 3ZZ0A 1J99A 2QPAA 1KHTA 1ZM2A 3LVBA 1RRPA 2F7SA 3BFXA 3SJBA 2EWWA 3CMEB 2QTHA 3GCGA 4B48A 1E1RA 4JLJA 1KMHB 4V0OA 2WIAA 3ZVNA 3AP1A 2IXEA 5AJYA 4BZQA 1II8B 4JKYA 2KB0A 3CCUB 2RKOA 3A37A 1MH1A 121PA 1HEIA 3I56B 2B8WA 3F3YA 3BD9A 3NIBA 5B58C 2QPTA 4C2TA 2HCBA 3THOA 3ZVRA 2A5FA 3SJAA 4DLSA 2GA8A 4M2LA 3CCQB 3FMIA 1CIPA 2ZE8A 4M9ZA 2NIPA 4KAXA 4URVR 5AK0A 1JB9A 5JHHB 1Q1QA 3L0OA 1PUIA 4A0GA 4DDUA 2UZ3A 3GLGB 2V3CC 2W2TA 2XJ4A 2ZR9A 3FHTA 1XCGB 3VO2A 4PPFA 1BMFA 4DDWA 2FSHA 1KK1A 1YHNA 2PJZA 5HE9A 1NRJB 2DEUA 1T91A 3NC0C 5KHOC 4EUNA 2E87A 4LWZA 1OH7A 2JEOA 5FOTA 4JS0A 2ZYTX 1G6HA 4PC7A 1OGJA 1LVGA 4NYIQ 1Z3IX 4RD4A 2DETA 1UBFA 3IDQA 1NY5A 3K9LA 4FXPA 2YKGA 1XPUA 2FSIA 4DRZA 2H17A 4NCJA 3RRMA 2Z5FA 4LJ8A 1UKVY 1G3RA 1R10A 5LBIA 1OXVA 4C7OB 1XTSA 2FG5A 4RZUA 2IWRA 3PEUA 1Z07A 2RHDA 1WRBA 4JLMA 1W7AA 2CJWA 2GEUA 3FWYA 1G19A 1G41A 4Q7JB 3RYTC 5EQTA 4P31A 2XZLA 4DZZA 1ZD1A 1QVGB 1U9IC 1IN8A 1LY1A 3BORA 3KZ1E 4JYBA 1NP6A 3VR6A 5KU1A 1TU3A 4GZMA 4LYHA 4MUBA 3CRRA 2CJWB 1TLLA 4B6EA 3O8RA 1TEVA 1AKYA 2JLXA 5FTNA 1RC8A 3MRSA 2BF4A 1F6BA 2ZROA 1ZJ6A 2XXAA 2KWIA 4HE5A 1P2UA 1XTIA 4N1AA 1E6CA 3CUEF 4DUGA 5FFMA 2OXCA 1WXQA 1P6XA 3U7EB 5G3ZA 4UNPA 5IRCD 4A0RA 1JAHA 2CBZA 3V4RA 2F3RA 3WNDA 3EA0A 3CH5A 1Y63A 1ZAKA 2Q0HA 3G71B 1XXHE 2RCNA 3A8TA 1F60A 2Y8EA 1GILA 4LC0A 1OFUX 3GJ4A 3EWSA 2IL1A 4F93B 4AG5A 5AWFC 1IN7A 5FTMA 4ZCIA 1KC8D 4NTZA 4U9UA 2YHSA 1XPRA 4ZIRB 1JEEA 5CDFA 2QRZA 3MSXA 4JLOA 3BH7A 5CM8B 4W5JA 2A2ZA 1P61B 2QMHA 1TF5A 4Q47A 5DI3B 1E32A 3NDPA 2EFEB 1XF9A 1M1KD 3AQ4A 4TL6A 4YMTA 2ZE5A 4XWAA 4XVQA 5JWOA 1UDWA 3AVWA 4KHZA 4DCVA 1UADA 5FPTA 1KJWA 5FPSA 5FOSA 2FFQA 1E2FA 3DOEA 3CWZA 4R2HA 4HB2A 1FX0A 2XEXA 1QGZA 1MT0A 1Z22A 2VHUA 4TT3D 4LJ4A 4PQRA 2DYKA 3ZQ6A 1E2GA 2EFHB 4Q4HA 4B34A 4GMXA 3CNOA 2VF8A 1IONA 4WZAE 4L5BA 2ZETA 1AGPA 1F2UA 4B4DA 1QZXA 2BMEA 5L8VA 2JLVA 2IW3A 3NBXX 5KSYA 3VX3A 1JPJA 2YINC 1K9MD 4ZIRA 5F98A 4AK9A 621PA 2CL0X 1Z6XA 1WB9A 3CCRB 1SVWA 4KSCA 3TW4A 3D8BA 2AKYA 1KTVA 1YZLA 1FP6A 2F6RA 3AF4A 3BB3A 3CZQA 3IEUA 1JI0A 4NMMA 2F55A 2P5TB 3LXXA 5AUNB 4GOXA 4C43A 1CXZA 3W2IA 2QA5A 5LD2B 2P65A 3OEED 1CR4A 1OJLA 2IT1A 2J0UB 3A4NA 3OIUA 5E7IA 1SGWA 1IQPA 3MCAA 4PSAA 3GLGE 3B7GA 4CEIB 3DM9B 4E5UA 4M9QA 4Y9RA 2EYQA 3SQXA 4MQBA 3WXMA 1C9KA 2OTLB 1RIFA 2RHMA 3CX7A 3HPQA 3QF4B 3ZD7A 2ORVA 2VHTA 2G77B 3TSOA 2ZJYA 1XJQA 1E9SA 4POAA 1W49A 2V8OA 3P4YA 2ZU0C 4KYIB 3ADCA 2YYZA 2YC4C 2R6AA 1AK2A 3I5YA 4HDCA 2O8BB 1X86B 1E2EA 2IYWA 2NZJA 4M9SA 4PAOA 3BFKA 2B5OA 1KI2A 4NL4H
chains in the Genus database with same CATH superfamily
3D0QA 3MTIA 1B42A 1JR6A 1TAGA 4MQEA 3CPXA 3L92A 3VSCA 2WUGA 2J41A 3CZPA 3G5LA 5AOCA 3NIFB 2WIFA 4PCVA 1E6WA 4HWPA 2WJWA 4PYLA 1NYRA 5FPHA 4DV1B 4G2NA 4GYWA 5BSXA 2R751 2WIKA 5EMMA 4AYTA 4YT8A 2QE6A 3UWPA 3O5AA 5I5EA 3P2IA 4EMSA 1YDMA 4GLBA 2BM9A 1VTKA 2NADA 4M3NA 1RWQA 1ZIYA 2OZKA 5KC8A 2FEXA 1EHYA 4Y6RA 4B3RB 1VA4A 5COAA 4R54A 3F6CA 4E0FA 1WCIA 4FT4A 4L4ZA 1FPQA 5IKOA 4UD2A 1UINA 1MGOA 2KBEA 3DKRA 1TM7E 3KXDA 1KOFA 2C9ZA 4W5WA 2NYUA 1WBBA 1U5CA 1UZLA 1FFDA 2NNLD 4K6OA 1X1TA 1SC6A 2AN3A 1ZNXA 3NFRA 3KWMA 1GTG1 1P5HA 2LP4Y 2ZLBA 3IP6A 5JAHA 2XOXA 1YU9A 1AQJA 1SK8A 1YZ3A 2VFAA 3CE9A 4IQ8A 5J23A 2R65A 1YXMA 1S6YA 2FGJA 3ZIUA 4C5BA 2BFEB 1RJEA 1SUAA 1EDEA 2OFOA 3O1IC 1FTSA 1X1QA 4XQCA 1H2HA 1W76A 1CJUC 5H02A 2VDUE 3HXLA 2V6IA 3VZPA 4Z49A 3B13B 3T54A 4HSGA 3VU9B 1A5BB 3IBYA 3NIGB 4WE3A 2E4XA 2XA9A 3K2IA 1PZEA 3BHJA 4WN9B 3PLNA 3F7NA 1EP9A 4Y0VA 1G2IA 1VPWA 3H8VA 5KDDA 2OY0A 3KOWA 2ZI4A 2ZRQA 3GEDA 3RM3A 2LRHA 2NWQA 1OROA 1YKFA 4BO9A 5I4CA 5T4BA 4XFKA 3PE4A 2W83A 3LY9A 4LJ9A 3CTMA 2HEGA 5EUCA 1GNPA 1P0QA 2EP5A 3PFKA 1SXPA 3HY6A 3GPIA 4TRNA 5EUMA 2H1IA 1V5VA 4B43A 2BI7A 2DF8A 3Q6IA 4R83A 5KSZA 3AL0C 4TTRA 2DT8A 2CHEA 5TRTA 4KV7A 4J6EA 3RRYA 5HZAA 4EJFA 4G0XA 1XIVA 3GJZA 5DT2A 2GFIA 2QZJA 4RD6A 1YJ5A 1Z4JA 2HQOA 2PZBA 3LLUA 1GU7A 3NV9A 3QENA 2D54A 4I5DA 1ZBDA 3OO1A 3V1TC 1Q6ZA 3WS7A 4ZDJA 3UOWA 2WUDA 1VMIA 4DYDA 4RULA 2R87A 4C4XA 4BY9E 3QMVA 1N07A 3KKPA 1C30B 4HMPA 2A9QA 4HWKA 3QI7A 4PHFA 3AM1A 2G40A 3MA0A 3ROEA 4TMKA 3B36A 3OKPA 2FMHA 1Z0ZA 3U4DA 4LBYA 3RGWS 3Q87B 1TKAA 1O94A 3CS3A 3R77A 5JADA 5ANRB 3W04A 4AW9A 4K6FA 2ACEA 4RMNA 2VK1A 3C48A 3JARA 1V5GA 3ZGNA 5EXSA 5JANA 2Q28A 1CUZA 1N9GB 1Y98A 2BFNA 3SC4A 5JH7B 3TUJC 5EIEA 1IHXA 1N7IA 4EGQA 5TMPA 3A9WA 2YJ3A 4Q3NA 1VG1A 2PXHA 1F7VA 1V3UA 5DTRA 1Z7EA 3GFOA 3LUKA 4FCTA 5LB4A 4C4ZA 1AS3A 2TMYA 2UUAB 4FONA 2YMPA 1JXOA 3C16C 4QASA 1N7JA 3HV0A 2I4RA 4FGUA 1U7TA 4MO2A 3I1IA 4GGPA 1P81A 3MS7A 1U2ZA 2C5BA 1RR6A 1SZCA 3UJDA 3TUIC 1HC7A 1UIRA 2ODAA 1OXXK 1YBVA 1HEUA 4FYIA 4Y9SA 1DAIA 1N2EA 3A27A 4N9QA 3WLSA 3DZJA 1EFHA 3IKTA 4E7OA 1RPZA 2HR1A 1VQ4B 1COWA 1R5BA 2HFKA 4D9NA 4EB0A 1Y33E 3B2EA 1WB6A 3LX6A 3ESAA 4HRXA 4X71A 3WDLA 1L7AA 2O3QA 4MVJP 1Z2AA 5BT8A 2OBXA 3VPGA 3ZU6A 3ZLTA 3QE3A 5HYVA 5A1JA 2HYIC 1AF7A 3UMRA 2P9GA 4BGIA 3EPKA 2Q9BA 1UKEA 1LNSA 1YZNA 1GFWA 4MWBA 3ZHCA 4BFZA 2PZKA 4OHYA 4YHHB 2ZL6A 3K96A 2UUOA 4UHCA 1E79D 1S3IA 4J90A 4UZSA 2RJOA 1NKTA 1K5GA 2OCLA 2P5YA 3GAMA 4MGKR 4UPEA 3SCZA 1R1DA 1PR4A 2O2ZA 3I42A 3JR7A 4M7OA 4XIFA 1HY3A 4B2IA 3BSYA 4KQEA 1JHDA 8LDHA 2ZYUX 4HDNB 4HNAA 5ARCA 3H9NA 2PPVA 4CT4B 4GPTA 4DM4A 3WGNA 1FYVA 4AMZA 3W2GA 2ZRKA 3D7RA 3BWYA 4DTCA 2JLRA 1Q82D 2KLHA 3UC9A 4KV9A 4BB9A 4DN6A 1K3TA 3MWJA 3R9XA 3PSHA 2C2HA 2C7VA 1QYDA 3SQLA 1XA4A 2PLNA 4PXAA 1V1MA 3CVWA 5DYIA 4PYRA 2BM1A 1FNDA 1EK2A 1VCNA 3SF0A 2FQQA 4H59A 1PL6A 2O7SA 3UY4A 3DAPA 3GGGA 2OXTA 5K99A 5E6UA 5LU8A 1M54A 3K8YA 1DVRA 3ZUGA 4IDBA 2XYVA 2VQSA 1EX9A 4LYEA 1FP7A 4I6GA 4X94A 4HJRA 5AIBA 4OCZA 5D5PA 2OBRA 4CDNA 1PJ5A 1XZQA 3NAMA 2DSNA 3U4MA 1JKIA 3JQAA 4O4HA 2AMVA 3HYRA 2GDJA 3PFFA 4XD2A 1VM6A 3ACCA 3KHSA 4YO7A 5K3BA 1MO5A 1O9GA 5JRJA 4JI7B 5LQRA 1E5LA 3ETNA 4LKRA 1CR1A 1HDXA 2G9UA 1CUUA 4XARA 1O6CA 1D4FA 2JCVA 4QU5A 4IM7A 3V8BA 3ETDA 5A5GA 2YWDA 4DHEA 4G0OA 4GXQA 2VTDA 2IGTA 3G5UA 1TCCA 1XQ9A 2YJNA 2R4QA 2MU1A 1G291 3LWZA 3ZCSA 2AKEA 2XXAB 1PIWA 4DKJA 1ZOLA 5TJ9A 2HRQA 1GARA 1WLSA 3LQYA 4QFCA 1Z0SA 1NVTA 4YCCA 1GPUA 3Q6RA 1VQMB 3A4LA 4MOWA 3KAPA 4BKOA 4GL2A 1TA4A 1BD3A 2NZUG 2R6FA 3PR1A 4LDQA 4R2XA 4RGQA 5JSZB 3KR0A 2NZWA 3CH6A 2ZAOA 1N0IA 2QRHA 3FPSA 3KEFA 3Q1LA 3FNEA 2C1EA 4PLTA 2ODNA 2WJHA 3EJ6A 4RY8A 5AJHA 4A8JA 5JSQA 1ICEA 4KREA 3GJ7A 3VKWA 1FNNA 1IYZA 2Y6VA 4GUDA 5CJ2A 1INLA 5LBTA 3U7GA 1M7HA 2G1AA 4WOJA 4C4TA 4CKXA 1F38A 4OGFA 1KFKB 4MS1A 1DU4A 4LHYA 3WK7A 2WYIA 2PMCA 1ZD8A 4H31A 4NBLA 4RQUA 2DP4E 2W2MA 5FXMA 5A03A 1YL5A 3GIWA 2GH1A 3C43A 1YJNB 2BELA 4AJIA 4ER6A 3CIOA 3TJRA 1IM8A 1Z36A 3KT3A 2W6PA 3IELA 4JR1A 3F5FA 2HRBA 4MV8A 3NHUA 3LE8A 4D6XA 3I8SA 4BWYA 1ZUHA 5FO0A 4V38A 4ARZB 4M98A 4QG3A 4IIBA 4HAYA 3K35A 1H2WA 1NE2A 5DHFA 1T3HA 2YXLA 2WT9A 3L04A 3OCJA 4YAFA 5KI6A 4CJXA 7GPBA 3JTMA 2WIDA 3G17A 3DBLB 5KNDA 2PGOA 5IFLA 5BSMA 2WJYA 3GFFA 3GIRA 1IEXA 4ALKA 4KXWA 1WEKA 4NAVA 4N3AA 4Q9HA 4V2IA 2D62A 2R68A 3L46A 1SIUA 4JKIA 2BDUA 3OVMA 4YDHB 3TOVA 5JXHA 4FFSA 3NBAA 3TH5A 2KX7A 2G63A 4C4YA 1KO4A 5F35A 1N25A 1WMSA 3GUVA 1TMYA 3P2OA 3STUA 4BNXA 4I99A 4DC0A 1SHJA 2PBFA 1K75A 4P58A 1N6RA 5CFLA 1DAPA 4QU0A 3LPAA 4NDZA 2OC4A 3WNVA 1SUFA 3NDIA 3TIVA 3AU8A 4GRDA 2VF7A 2FAXA 5DGIA 1TYEB 4B4OA 4TWAA 1NVAA 3DQPA 5G4LA 4MVJF 1S2NA 1MFZA 3K4HA 1N6PA 2P2DA 3WLPA 3ZWVA 4BO7A 3PTAA 1IDOA 1QH1B 5DF1A 5E2IA 5FWYB 4BTVA 3ECCA 1GGHA 2H4JA 1OMOA 3KTAB 2JCSA 5LA6A 1DIOB 1GADO 1TT5A 3ILHA 4EWLA 1IOVA 1ZAYA 4Q4AA 3GNLA 5F52A 4LOKA 4N47A 4OPSA 1BTOA 2NU9A 3HA2A 5EQDA 1CZRA 1VYHA 3CE6A 3DS8A 1D1PA 3L0IB 3GLFA 2PK3A 4PZ9A 4P6VF 4ZRNA 2QMZA 4LYDA 4I81A 4COOA 4ZDWA 1WJGA 4KQ1A 1MD9A 1WSRA 3LY7A 4ZQIA 4YCSA 1XFDA 5KTSA 3SDSA 1OI3A 3UJ9A 1UOPA 1NFFA 4HDKB 1UMBB 2VP0A 1USKA 4MZDA 1KVRA 3RUHA 1NASA 3ZXSA 4BVHA 2IKSA 3CF2A 3M5WA 4TS3A 2NUAB 4A0QA 2GCPA 2JI7A 2D8MA 3CBQA 4IIJA 3FTFA 5LP1A 5JBQA 1G8SA 3JQBC 2EQBA 2QN3A 3CUSA 4I19A 2JHGA 1FVHA 1DXYA 2W6NA 4LRSB 3C3JA 3NZEA 2CLOB 4R3UC 4DPLA 2F9MA 2C9CA 1DQZA 2VUUA 3BYZA 4X61A 2IDJA 2Q3LA 3HS3A 2R2AA 3UMFA 2UXDB 3OCUA 3JQ8B 2FZKA 2ZANA 1VPLA 1P72A 2EIXA 1KFJB 1MAWA 3NVDA 4QSHA 2ZUTA 4LQ4A 1ESNA 4W7SA 3NX4A 4BFCA 1E1QD 2FMTA 2V03A 4MDFA 4JJZA 4H7FA 5JALA 1XYYA 2FEKA 2XDQB 1GRRA 1LS1A 2FW0A 1HRDA 2ZEJA 4H7DA 1UJNA 4R71A 3HWRA 4AF6A 4IFIA 3SSMA 1A1VA 2B7BA 3VR4A 3DGEC 1YOVA 1JDTA 2YJZA 1NQXA 4IHKA 4RTPA 3QHAA 1PLLA 3EASA 4UHDA 2R6GA 2IBMA 3U3MA 1WZIA 2L42A 3TRKA 1KSGA 3IBCA 3D6AA 3UH1A 3ZV7A 4UTPA 4CIBA 1RXSA 1L0BA 2CE2X 3GVXA 2NQ8A 4OLJA 2NUTA 1JFRA 4EHBA 4HUTA 4OPOA 1MEJA 4HYEA 2X9QA 4X65B 1GVHA 1GCOA 3ZHSA 1Z0JA 1FSZA 3D8NA 3S28A 2XUFA 3HJGA 3SF8B 3UB4A 2AL7A 1LBIA 4V0SA 4D8XA 5F4BA 3KDSE 3MFQA 1ZH4A 4I4LA 3TG2A 4TV9F 1UBTS 1RI2A 1EK5A 3NIWA 5H82A 5JATA 2AC7A 1ZITA 2AEMA 1GZUA 1MH9A 3UMCA 1GT6A 3EPLA 4B81A 4R8KA 4ZI3A 1SB9A 1NY6A 3ZBPA 1XL1A 3U9LA 1WULS 1P9RA 2HK9A 4M1OA 2WU4A 5CLQA 3JQPA 2RBKA 3OOJA 4G9EA 1E6EA 2GLTA 2A6PA 2VDLB 1WMDA 3T7DA 4DV4B 4PC6A 1EB8A 3RTDA 2J48A 2FG7C 3VR4H 2ZQ5A 3U4GA 3BD8A 1AUXA 3HDHA 4HVAA 3Q8MA 3IGFA 3ENVA 1AZWA 3CNLA 2C5EA 1FDVA 3OG9A 4TZ6A 1UEIA 3OEHA 1DCMA 5C80A 1XQBA 4FSHA 1GPLA 1Z2NX 2D7CA 2MMCA 1LW7A 2PZ8A 2IHBA 3OOEA 4MIYA 3W4KA 3CX3A 3I39X 1OXMA 1R15A 4KR3A 3VU0A 4MVXA 2NNWB 2DFPA 3QXJA 3IYLW 4BNNA 2CZQA 2SKCA 4RXTA 4GBMA 5CVVA 1SQ5A 3CB2A 1LLUA 1MG5A 2J6BA 2FOXA 4MI1A 4MUXA 3ZEIA 4AG6A 3QE9Y 4RK5A 1BZYA 3ST7A 4DBZA 5KYVA 1UKZA 3EEQA 3ELWA 2ZWOA 3PNPA 2AX4A 3M33A 3UB2A 4RVHA 3EXIA 1CEYA 3I9OA 2PH1A 4EG5A 2CJYA 4M37A 5DNYB 1RWPA 4IS3A 4PLWA 4XPZA 1L7DA 1R0RE 5FADA 3CKKA 3LKDA 2M1ZA 5B37A 4MX8A 5C34B 3R9XB 3QBDA 1GM5A 4V03A 3UTDA 1IBLB 3L7NA 5KC9A 5T6BA 1F1JA 4LWPA 4MV3A 1VHQA 5CTAA 5JXWA 5DN6A 3RRNA 4S0ZA 2J45A 5ILGA 4MEAA 3HADA 2YV3A 3QA9A 1NU8A 4AIIA 2GJ4A 1L5KA 4X8MA 2X8KA 1GPKA 1PGPA 2HWXA 3NHKA 2QD1A 2M6LA 5C7IO 3I73A 5G1OA 5KPDA 2PUDA 2GJ9A 1Q7YD 2AOTA 3FUCA 3OT1B 4YJ3B 4K40A 1CJCA 1YS1X 4K9KA 4KXLA 5H3HA 3TLXA 2LW7A 3IQZA 3WGQA 2PSJA 2R1UA 3KJFA 4DA0A 1WSDA 2FOLA 3UMMA 2CLLB 4LSMA 2OD7A 4RZXA 1MVNA 4N7RA 3VJKA 1Q77A 3VSDA 1ULSA 2BRUA 2JJQA 1Z5OA 4MB2A 1OYOA 3M8KA 5C4MA 1Y8ZA 1KD1D 1CUBA 4I1UA 3KZOA 2CXSA 4UZEA 3ISXA 2AD1A 2GYVA 4IXDA 5J5CA 1RFGE 2D0DA 4XM0A 4BECA 3U19A 2J7KA 2BUAA 5DULA 4RHTA 2WAXA 2X2FA 4E70A 2RGYA 1VHTA 3ONWA 1PDOA 4WLOA 3T8YA 4A0SA 3OF2A 3LBFA 4IOLA 4MUFA 5JEDA 4DM7A 3HP1A 3DAGA 1XWWA 3F6EX 2L0XA 5FBWB 2I6SA 3K0HA 3TOSA 3V42A 1RWNA 3OZXA 4BV3A 3QX3A 5IMSA 1E63A 4OQLA 2UV8A 2CVHA 3NONA 3OPYI 2VJYA 1DKNA 4JYMA 1J39A 5HMLA 3BWVA 1BE8A 1T4MA 1MR3F 5C46F 3NFYA 2F3SA 2RGNC 5TPWB 2AZ4A 1F0NA 3JQ6A 2OLKA 1WDLA 1W73A 2IPAB 2X9VA 1BCSA 5HP4A 1M8JA 3IHWA 4FSDA 3NBUA 3W5DA 1IBMB 1XAGA 5JFOA 2NM0A 3HP4A 2VDJA 5GV8A 1YR1A 1DQSA 2AWOA 1A9ZA 2ETVA 5K3AA 1PTKA 4A1OA 3VHXA 4Y2VA 5AUPB 5JVDA 4ETWA 1Y6RA 4X1YA 3AHEA 2PGLA 3ENWA 5HIKA 1T2FA 4D9BA 2QE7D 1YJQA 1EBUA 2Q9CA 2IUUA 1UZNA 3N87A 3ZHBA 5JJIA 3U0VA 2IWHA 4YUYA 3O82A 1Y6FA 2Q2NA 5BWCA 1W581 4RESA 4YK7A 1F20A 4AXXA 2AI1A 4MWCA 4JEMA 4M83A 4J4TA 5JIBA 3QFRA 1T5IA 1W0JA 1T9CA 4EAAA 5T3UA 2X7XA 1VE9A 4P83A 4HNRA 1ECGA 1ZC3A 3W5AA 4OREX 2XXBA 4GM4A 1JF8A 5EEHA 2C4TA 3P4XA 3K5IA 2YRXA 4YRRA 4B7UA 5IVDA 5KVQA 4MICA 4XLZA 2W6MA 1C4XA 2E4WA 5F4ZA 4QHYA 5KYWA 3UWOA 1VCIA 1W2GA 4L4UA 2J3KA 4XKJA 2GJAA 1A50B 3LA6A 3DE3X 2R00C 3EZ7A 1U0GA 3GDOA 3IQGX 3R3SA 4MJLA 3V00A 3AILA 1ZU5A 1T9ZA 4DLLA 1OGIA 2XODA 1XOIA 3PICA 3W7AA 2DQSA 4JWKA 4EYSA 5IYZF 1NF3A 1O3YA 3U7IA 3IR5A 2I2XB 4H6VA 5HWSA 1JDUA 3SEZA 3CCFA 3EOAI 3KUXA 4P53A 4I1VA 2XDWA 1JJBA 3M1LA 4HV4A 5B1HA 1ZWKA 2O1EA 3F9RA 3STWA 3LDGA 1BJRE 3MGKA 1TVMA 2G76A 4KFSA 4LKOA 3VR4D 4BMYA 2YN2A 5E8RA 1H5NA 1ZEMA 3L82B 3R0XA 4F38A 2PUFA 1MVLA 3GNQA 3N05A 1TZCA 3AFGA 5IXJA 4I8IA 3GC6A 1V26A 1EP1B 2Z9CA 4OHWA 1NBAA 2FSPA 4ESHA 4YBRA 1IBRA 4LZWA 4BP8A 1RAAA 3C8DA 3H2BA 4PBTA 5C4IA 3DHWC 3I4CA 4B71A 5DSZA 1O6FA 3SPXA 4IKPA 4JB8A 3AERB 2I3ZA 2QR3A 5KJCA 5DGDA 2JIDA 4XYMA 3SN6A 4O8ZA 5K2MA 4D5GA 1J5PA 5GADl 1K5DA 5K3CA 3R1IA 1ZD9A 3BMCA 4P4TA 3PGLA 3MJHA 1NVEA 1A9OA 1BOFA 2HPVA 1CJMA 1IM5A 2WQZA 1OQAA 4M89A 2PVCA 2GQFA 4HLUA 2A1IA 2OCPA 3AOGA 1E59A 4O02B 3GK3A 4TMTA 2RAPA 2Q50A 2CF5A 4BRUA 2GNOA 3ITKA 1CFZA 4LWQA 2QYOA 2OAEA 4MPTA 4NPAA 1N2SA 5E95A 4V3CA 4REQA 3I61A 4D57A 3EXFA 4NZ9A 3FTQA 5M04A 3OLQA 5LYYA 1U8FO 5EZQA 3LUDA 2QD3A 5B30A 5CDYA 3EYAA 1JA0A 3FWZA 2X22A 3SDBA 3SOPA 1GAWA 1D2CA 1OBFO 3U2QA 1CETA 3DVLA 3GARA 4ENPA 5U4QA 4OQZA 1WR8A 1F8GA 2QRQA 3N07A 4PCLA 4XA8A 3LT1A 3DO8A 3LI2A 4PZYA 4OK5A 1POWA 5D5HA 4A6EA 5EVCA 2CF6A 3PUVA 4BFLA 4D96A 5AVRA 4KN6A 1PQ4A 5DWDA 5BOVA 4JQSA 2ISQA 4Z4UA 1WCIB 3ZZTA 2FMKA 3KTFA 1TVKA 5ECWA 5T57A 2XSZD 1XXHB 3R5JA 3V80A 3K70C 1E3IA 1MC1A 1W5AA 3HUEA 4G09A 1G5FA 2PZLA 4KRGA 3FMOB 4WIAA 1GL3A 3C97A 1XX6A 1Z4QA 1DIRA 2DULA 2Q5EA 1GPJA 1FMJA 2I4IA 3NBZC 3WGKA 3OQOA 4G5HA 4D4HA 4ROXA 4P86A 2DE0X 3DDOA 1VPTA 3P32A 3PYMA 4RYDA 2BHNA 2VOEA 1B7GO 2IIPA 2W8BA 3WQHA 2YVKA 2X14A 4PYKA 1MEOA 5IZCA 1U6JA 3REFA 2NU7A 1L1FA 3EC1A 1UQRA 1JJ2B 3PNSA 2YIDA 3RUDA 4BOYA 1VPVA 1A04A 5E2BA 3BKWA 1GKIA 2LPMA 5JSYA 1W5BA 2NX2A 5IAGA 1FQWA 5L3QA 1Z56C 3RU7A 2P69A 4REOA 1C4OA 4V39A 4MYRA 4L8VA 3CVJA 5AHWA 1SEVA 5AIAA 3D2LA 4RPKA 10MHA 3VPAA 3AYZB 3LMKA 5ALFA 4O59O 5K0NA 1RMQA 3Q7IA 4A8TA 2QTWB 1BJKA 1Z8DA 3O9ZA 3O1LA 4MW7A 2WYVA 5HK9A 1FJXA 2FQYA 1ML3A 2QBYB 4S2EA 1JTFA 2GRUA 3NGMA 1PQUA 2Z3WA 1IAQA 3W3AH 1M5RA 2ZRAA 2R8PA 3HJRA 5BY2A 2HK7A 2DHQA 1ZM4A 1T5EA 2QSYA 2WG0A 3BHIA 1H9AA 7YASA 1CQWA 4O1IA 1NBMD 2WTBA 2J8ZA 2EDAA 4GAEA 1VECA 1GSIA 4YJ3F 2ZM5A 3OWXA 3GCXA 4ZARA 5EESA 3FCOA 1KS2A 3JXEA 1VJ5A 4G2TA 1T0BA 5CDFE 1VE5A 2NZVG 2BJHA 4TV8B 3UUGA 2BHTA 2D3TA 4WJKB 1XFAA 2QX8A 3OAAD 4ZKEA 3TEFA 2DPXA 1C3EA 4ZVRA 3LL7A 3PI7A 2MCFA 2ZRBA 2EF1A 4A8JC 3PJEA 3Q0TA 2QRUA 4LZZA 5CITA 2UUPA 4PICA 2WTNA 3BQMB 3N8HA 4OUDA 4I1SA 1OB2A 4AF8A 2SCUA 4XR4A 2VYVD 3B78A 4JEUA 3TLJA 4IDQA 3TR0A 2XQVA 3ZWXA 1Y89A 3LUPA 1R8XA 3GLHE 1KMIY 1YRHA 4OJKA 3NHJA 4E12A 5MDHA 2RG1A 4FWTA 3AW8A 3IBSA 1L3BA 5H9WA 1P91A 1PFUA 3ND8A 4LCJA 1L7VC 2YW9A 4G89A 4WEQA 1G3QA 1FFHA 5EZ5A 4TS9A 3NEPX 1UANA 3HKDB 3NXSA 4WCVA 3INNA 2HGZA 2J87A 5E7MA 5H3LA 4ER3A 4MA4A 1MEEA 2ZZFA 5LR6A 1AM4D 4INAA 2JLSA 1BG6A 4XFJA 3JVIA 2OQVA 5F3WB 3N9IA 4IDPA 4MARA 2VJQA 3K7EA 1AKNA 3F6SA 4PZ0A 1DAKA 3BTUA 3WSTA 4CW7A 4ZK6A 4DB4A 2QTFA 3KD3A 2AK2A 2AYZA 2XVZA 1Z38A 3HDVA 1DJMA 3IODA 3SVLA 3ONVA 1DS6A 3GLIE 4R3NA 3OKFA 3WG9A 3WJ7A 2OBBA 4L28A 5FUBA 2H29A 2HX1A 5T6MA 1H8ED 3UPDA 1BH2A 3ZHTA 1PJ2A 4MUNA 4B6FA 3I6YA 1ZL2A 3CR3C 4FFVA 4C0HA 1YS7A 3ZLJA 3T0IA 3FHLA 1OLUB 1OY1A 2WPDD 2VAXA 4IFBA 3KT0A 3PVDA 2DQYA 3D3NA 2X0EA 1YD7A 3LRTA 1EQAA 1J06A 4UD6A 4Q6BA 4UM5A 3FDZB 5BSUA 1DHRA 4C6TA 4BU0A 2C98A 5CT9A 2Q6OA 4YQZA 5JOQA 3KQUA 3KLPX 4W6ZA 5F1KA 2AFHA 1GZVA 1RXEA 3O9VA 1M8KA 3DBLA 4GKJB 4YRAA 4O4IF 1SU6A 2ODEA 2WYRA 1V11B 3GRYA 3NIDB 2PUHA 1FS5A 3CY6A 1NNSA 4F5DA 5EG5A 3ZH9B 4Y7DA 3GLHA 1Y9EA 3X3HA 4X20A 821PA 5F12A 1NQWA 2GN9A 3TLAA 3R6LA 3RAPR 2J07A 3U7FB 2GHIA 1YSCA 3SIRA 1P3Y1 2FW7A 2NQ2C 2I2DA 2IYVA 2XYQA 3C70A 3GEHA 5JNTA 5B2EA 2O06A 3A1PA 5B58T 2OGSA 4L1KA 3AH8A 1D4ZA 2ZWMA 2F67A 1IM2A 3W2HA 2QSZA 4MRMA 3Q40A 2HRDA 4BFSA 3QPCA 3PX2A 4OQDA 3EY9A 4AMGA 5JECA 3X1YA 1SA0B 2HPHA 3FZYA 2Z8XA 3PHHA 4TM8A 4JBLA 2DERA 4F2DA 3KQSA 2G8LA 3HCEA 2FQWA 1GZHB 3PLRA 3UYKA 2EKZA 3IT0A 5D8DA 1K8AD 2C94A 2PTHA 3BH6A 4X20B 2O6HA 4A8JB 3T1TA 3SWWA 2V1UA 1YASA 5F9HA 1FU7A 1X7WA 4Q3EA 1J5XA 1QVVA 3OMXA 3G2HA 3ZDXB 4YAOA 3KPWA 3OKCA 2PX5A 1ZH2A 2WSLA 1VL8A 2YDXA 4IG9A 1EE1A 1JECA 3TMAA 2FSFA 4MKIA 1TPYA 1ELOA 4BLUA 4ARBA 5I3ZA 3N0VA 2LNDA 3VO9A 3NLLA 1HYBA 2FP4A 2RGCA 5AI9A 3LYHA 3M6WA 3SLGA 2VNKA 2Q5LA 2PMWB 4G0QA 1YQXA 1XR3A 3GZNB 3F7OA 2CLCX 1JWLA 1XTJA 3ED1A 1GQOA 3B1ZA 4MP8A 2DX7A 3OY7A 1JIVA 4Q6WA 2ZJ3A 3MD9A 1EZ1A 2R1TA 3WKBA 3U5TA 3KXIA 5K3EA 2AMLA 1YT5A 5BQFA 5A4KA 3I1YA 1Y4AE 2IU6A 4CETA 3CKLA 4G6IA 1QVZA 4AM8A 1Z2PX 4M1QA 4XD7A 3L5OA 5KWVA 3AP3A 4URYR 2X6WA 1EFUA 4ZO6A 4PLCA 5KWSA 1L4HA 3H65A 1P39A 5DOVA 1UPTA 2UYYA 2VSXA 1FYEA 1NF9A 3CPSA 4WZBA 5JY1A 5KUTA 2XJ9A 3DDUA 4EJSC 4NOLA 1P1JA 4LTNA 3QKUA 1WB4A 5KX5A 2QN9A 4A4DA 2PMBA 1MAVA 2REOA 2DKNA 4K9DA 1OLSA 4HNTA 1XAIA 1ZJYA 2GPBA 5H81A 5IYRA 4RJLA 3LO5A 4NATA 2VPPA 3D54D 3DM5A 1O0BA 3N5CA 1Y4SA 3V4ZA 1MX9A 1BEUB 2QXTA 3G9QA 4N3NA 4M6WA 5KNBD 1EFCA 1E9AA 2YFQA 4B32A 3M6UA 4O2BB 1KEEB 2QTAA 1BVUA 4YFVA 5EKXA 1YVPA 1IZ7A 1PFYA 1Q5PA 4RFSB 3KHKA 1RLMA 3LQ4A 4B4WA 5HR5A 5KOJA 4OV6B 3DDHA 3KTAA 5LA6B 5DK6A 5CB4B 1RBMA 4MYUA 1XVLA 5A5DA 4DT1A 3O47A 1B3RA 2Z43A 5F9MA 4M4SA 2C2YA 4F85A 3VZBA 3A8KA 4W9NC 1CQXA 1DC4A 1NW8A 3H0EA 1RLUA 3K9HA 4EMBA 2ESRA 1LBQA 1QHIA 1SEPA 2QVCA 1W88B 2WW8A 3DPSA 3COVA 4QGHA 3BB1A 3ESRA 2FNAA 5SYAA 1DT5A 1R6BX 3E9RA 4E08A 3TDNA 2ONYA 4MQ5A 1UBHS 4LRUA 2LR0A 4HUJA 1DCKA 4LOHA 4RF5A 1NVBA 1PJCA 1CCWA 1W46A 3ESZA 4LGMA 3WLEA 1WXEA 2N75A 4X1IA 4OKSA 2IYAA 1YUMA 3FYCA 3ROMA 3RVMA 4ARUA 5U9CA 2XGMA 1AHNA 2ZUWA 4YASA 4B3GA 3MRXA 1P7YA 4G1VA 3LQQA 3QWIA 1HDIA 3G23A 3DMTC 4E30A 4RJTA 5HGXA 5IZCC 2WMOB 3GPLA 1GTSA 4IEFB 5DISB 3PZRA 2PLRA 5I9IA 4UTNA 4R7TA 2ZSDA 4JELA 3IS3A 3TTVA 5EP1A 2HA2A 3WK4A 4Z1MD 2QTLA 3DL2A 1VFPA 2NYAA 4LXXA 3D3WB 4OG2A 2ZITA 5LZ2A 3PDCA 4UJ5A 2R8BA 2I6UA 2H85A 3DHYA 4IMPA 4YMGA 4LHWA 3IQWA 1NPDA 3IMCA 5CYPA 4WZTA 2CW5A 2ZRJA 4CVNA 2YWJA 4NZYA 4AT1A 3GZ4A 1TE2A 1UBNA 2F2TA 3OZCA 4PABA 5B1YA 2O19A 1EEXB 4IJWA 4MWOA 2V9ZA 5K3DA 2JLQA 1G6KA 2VN8A 4LGVA 1Z26A 1I1NA 4HN2A 1SCDA 1G21A 1JI3A 2GF9A 2IV2X 4MS1B 3GJ0A 5A5FA 4QDOA 4IUCS 1NZDA 1ZS9A 4ZVKA 2W90A 3TBKA 1WU8A 3ZY4A 1QB7A 3WYFA 2NT4A 3N59A 4BL5A 3LT0A 5GMOA 2C96A 3EK2A 4JXJA 1JQKA 1LB1B 4K03A 2NU6B 4ZODA 1HZJA 2WF6A 3ULKA 4FZVA 5SZJA 3AR5A 5BV7A 2V7GA 1XROA 2RHWA 5B1DA 2X58A 1EFPA 3BZUA 1FJHA 4KIFA 3KOXA 2G83A 1GD1O 3HCCA 4Q66C 3WWOA 1P2FA 1FUUA 3BEDA 5BWMA 1W59A 2I2FA 4K86A 1JHPA 3U80A 4KO2S 3NVMB 4TLDA 3FH0A 1D04A 1D1TA 2W93A 1YR6A 2J32A 1XVTA 2Z2JA 3C24A 3LSYA 3QE4A 4OTZA 1J8MF 3RASA 3SEFA 4HLUC 1FC0A 3ZV3A 4EPXA 5K3FB 1WXDA 3OUTA 3GFQA 4IILA 4TWRA 1U2EA 4DSTA 3GV0A 4FIDA 4LOIA 1VDZA 3F73A 5LP6A 3SVZA 2ZAIA 3NJRA 1XRSB 2ZUCA 5IK2A 3C5VA 1QYVA 3PNVA 4URZR 5GZ3A 3ZIAD 2QRPA 4FMCF 4OJYA 3PHLA 3TLGB 2WVHA 4BLOA 5I7UA 2BLNA 2X0NA 5CJPA 3HCNA 4XWKA 1FZQA 2VPZA 4FHEA 1I14A 3W78A 4C0JA 1O8CA 2PVSA 3AW9A 1VJRA 1I1OA 3CNBA 3ILSA 4Z54A 4EHDA 4B80A 2CFIA 3ESYA 2IPOA 4EG7A 1IWPB 2GK7A 4O63O 5D7BA 1ZN9A 2ICAA 3P0JA 3H1GA 4WK6A 3V7WA 2IW1A 2BFEA 1I0LA 2Y92A 1A4IA 3KB8A 1AO0A 3TTXA 2I87A 3NO4A 1UPBA 3D8TA 4EL5A 4MS4A 3QVSA 2A0FA 2PBZA 2CFCA 4ZO9A 4CXMA 2AWNA 3C8HA 1JDBB 3SS8A 1FY2A 1PZXA 1CQJA 3T7JA 1N3IA 4DMKA 1WKBA 2OV3A 3H5LA 4H60A 5J1TB 2FXVA 1XA0A 2LKDA 2R5WA 1J1ZA 5CEJA 3OLZA 3W2FA 3VKFA 3N2GA 2VHYA 4CPDA 5E1BA 1X14A 2BMDA 4MV6A 5DYNA 3UQYS 2RGWA 3FX2A 3ZDEA 1O7JA 2VSQA 2J31A 4H15A 3CXUA